2P5ED

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
194
Chain Sequence
b'MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLITPWQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
total genus 40
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD02
2BNRB 3NGBB 4PRHE 2W0FA 4XNXL 4FA8A 5IB4B 5KS9F 2DOCA 1IGJA 2IAMB 3CVIL 2BHZA 5J1AB 3QHTC 3RWGA 5I15L 5TE7H 1LK2B 5D93B 3AAZA 5DRXB 4YHPA 3EHBC 3KXFE 5TDOB 1ACYL 2VE6A 4G8EA 4HK0B 4ODHL 4YQXL 5IFJB 2QR0B 1N8ZA 4TUKH 1MEXH 4D8PB 1IQWH 4W4OC 4H25A 4XBGB 3OZ9H 2HKHH 4FOMA 3QR2A 2NYYC 5C6TH 4KRLB 1BBDH 4HK3N 1SYSB 3HZMA 2VC2H 3QEHB 1D6VH 2ZUSA 4NDMB 1XGPA 4LHQB 5C0CE 3HE6A 4UAOB 1NCBL 2BVQB 5SWZA 1EEYA 5DJAB 1MUJA 4M6ML 2R0WL 1KIRA 3OAUL 2YD4A 4OZIE 2D2OA 4P5KB 4HKBA 1OP5H 4WEMB 2O5YL 3G5ZA 4YAQB 3V5HA 1FNFA 2X4TA 3HMXA 3VI3E 1IRAY 1MH5A 1AD0A 4EI5D 2Q7YB 1BZQK 4IBLT 2YS4A 3UTTA 3GM8A 3W0WB 5FYLL 3HNTL 4I2XA 3MTRA 1MQKL 4HCRH 4XC3H 3T09A 1DQQB 3ESVF 2BOBA 3P3YA 3UMTA 1PZ5B 4Z7VF 3GBNL 3K3QA 1X4XA 4LRIC 4ODXA 1AHWC 2R0LL 4Z7UE 1A4KB 5LGJB 3VD5A 5E4IA 3CUPB 5FA3A 4S2SB 1ORSA 5CZXC 4M6NH 1U58A 1LEIB 4YHML 1X7QB 4WW1A 1YMHB 3EFFB 4OCXH 1ZVSA 2EH7H 1JE6A 3K8MA 3B3IB 3DARA 5EA0L 1BQHG 4HT1H 1VESA 1T2XA 2CLRA 1WIOA 2WBJA 3VFSA 2JB6B 3STLA 3S37L 3PGCB 3LDBC 3WNLA 4RSVA 5CIPB 1WBXB 1BJMA 5HDQH 2GSGB 3PWPD 2DYPD 1ZLSL 5HYJD 5IG7A 5TE4L 1NSNH 4BH8B 3VCLB 3UJIL 2CPCA 3O3UN 4JDZA 5I15H 2AV7A 3QJHB 1JF6A 1L4IA 4PLKD 2AV1A 5KSVA 3C60D 2WP3T 4KKAD 3PWUA 4NO5A 3MLSL 1MFEL 3AS1A 5JOPE 1RJYA 1S9XB 4XPGH 1F6LL 4YHMH 3F7YB 5DRZA 1KTLB 5GISL 1VEMA 3GSOB 4HWBL 1JYXA 5L2JA 2X4NA 4LPTA 4X4XA 3UTSA 2GUOB 1II4E 4DFIA 5D8JH 2C5DC 5F7EL 1U3HB 1BQHA 3DRQA 4OLVH 1G7LB 1WK0A 3C9NB 5LBSH 3S8WA 4OIBA 3UBXA 2J6EH 2JELH 2FJHB 3KYMA 5DI8B 5DUML 3JXAA 4RMSA 5F89A 4QWWC 4JPKL 3I6LD 1XCQA 3C6LB 3CFEB 3N50A 4HKZA 3MROA 5MEQA 3FQXA 5ID1B 4IRZH 2APXA 5HYEA 4JDZB 2HMID 1AGEB 3L5IA 4OCSL 2Z91B 3L7FA 3OB8A 5BVJB 4JM2F 1Z9LA 1BD2D 4PBVC 2YWYA 4Y4KB 3TA3D 1TPXC 4OCMC 3HHRB 3QDJA 3MUGB 3MRLA 1YN7B 1QUNA 2CUMA 4FRWA 4QRRA 3QDJE 2NY1D 4X7CC 2W65A 3MV8A 1BZ9A 2DIBA 4L3AA 3UC0H 4X9HA 4HUVB 3DURA 2FO1A 3T77A 5DFWH 4MA8L 4BZ1H 4M02A 4QXUH 4XB8A 4GS7C 3T8XA 3TNNB 3BE1H 5HHNB 1ORSB 2A77L 1IGYA 2IPUK 2DIAA 3MYZA 2H32B 4QT5B 2BOBB 1QLRA 3DI3B 2DLGA 1Y6KR 3FZUD 1GYAA 4JFFE 1KENH 2EYSA 4CW1B 5DJYB 4QRTA 3U9PH 4R4FH 1BIHA 4G8GE 1KIRB 5EC1A 1JYNA 1S7UA 1QSEB 4L3EE 3MJ9A 4M7KH 4MCZB 4OI9A 4HUUB 1G7HB 4M6OH 3JVGA 1JV5A 4GAYA 3QWRA 1T0MB 3PHQB 2GJZA 1FGNL 1H8OA 1OPGH 5KSAD 4L5FL 5IESH 1MFCL 3QEQB 4RAUB 1IMHC 3KYNB 5CCKH 1I1AA 1T6WA 2YC1B 2HWZL 4N8VA 5F9AC 2DQCH 3SY0B 1TLKA 4I0PC 3WO4B 4RMQA 3TBWB 4MWFA 3MRFA 2V7HA 1U8LA 3P9WB 3QG7L 1W72H 2VDPH 3T0DA 2PCPB 2HRPH 4N8PA 1CE1H 3ARWA 4Y5VC 1Q38A 1KULA 2DBJA 1NCTA 2GJ6D 43C9A 1A7OL 5GS1A 3TH3T 1FYTD 3HAEB 1EGJH 3NTCH 4AQOA 2GY7B 2ITDB 1P7QD 5L7XH 1VEPA 2PTTA 3RIAF 5CJBA 4Y4KD 5F9OL 1MCIA 3ARRA 5D7JD 4WV1C 3UJJL 1QRNE 5HDOA 2F74A 3EYQD 4PJEF 2V7NA 4LLQB 3K8KA 1BP3B 1QTYT 2HJFA 4A6YL 1VGEH 3S35L 4HX1A 5HGAA 3V0VB 4WI3A 4NFCA 4JFZH 3MJGX 2DI9A 2F5BH 3NIDF 4IRSC 1HHJB 1RZFH 5IVXB 2X4SA 4PFEA 3U46B 1HINL 1YQVL 5F72S 1A1NB 1U8OB 2AK1L 3OGCB 5HHMD 5DZOA 4D0CB 3EDEA 4OTXL 4BZ2L 4ZYKB 3JV6A 1CZ8L 4Y1AA 4XGZA 5IM7A 4IDJH 1M71A 2IANB 4MNQE 2ATPA 4WY7H 3L1OH 3UAJC 3BMVA 2H3NA 1UCTA 3U2SA 1YNTB 3IDJA 5FB8B 3BP7B 2BXYA 1CTNA 3FO0H 4GT7A 2Z31C 1CS6A 3MO1A 3X14A 2VH5H 1AI1L 1CK0L 4U1JA 2G5BB 3RVVC 4YPJA 3U46A 3LN5A 2D0FA 3PQYE 1IM9D 4L4TE 3TVMB 2MQCA 2X40A 3UPAA 4OCWL 4ZNEA 3QIBB 2H2PC 2X09A 4FZ8H 2YEZA 3VFPA 1OAYL 4ZS7L 8FABB 4QRPE 1KJVA 5IMLB 4JO1L 1INDL 3VWKC 3Q48A 4XPBH 5HHVH 3ZHLA 4GG6B 4XZUB 4YUEH 1D6EB 3PHSA 2ID5A 4GKZB 5KW9L 2B0SL 5I1IH 4DZ8A 1QA9B 4MXVF 3T0AA 1MWAH 4HUKB 2EDLA 1MLBB 1FFQA 4NRZA 3HAEA 2VTFA 4MD5A 4TRPL 3AM8A 4YX2H 2VZOA 1FH5L 2WWMC 1RHHB 2HFTA 5E9DB 3RZCB 1CICB 2L7UA 3GJEB 1IKFL 5DK0B 1LVEA 5T33H 3CX5K 3OJVC 1YJDL 4JQIL 3RY5A 1E4KC 4LCUB 1OP3K 5JW3H 3L9RA 5FFLA 2DLIA 4XHJC 3IU4H 4N90E 3MRDB 4WHTA 3MJ9L 5CEYB 1BPVA 1I3GL 4KJPC 4N0RA 5BQ7A 3OF6A 2BVUA 2XZQL 1I3UA 5F6IB 4CVZA 4QRUA 1AKJD 5D7IB 2Y36L 4X6FA 1XEDA 1FV1B 1G7MA 4G6MH 4KZDL 2VXTL 4XCNB 2EICA 3H42L 3OKDA 1I8LA 1IAOB 4JZOB 2E6PA 4DW2L 2YUZA 2FZ3A 3L5XH 5E6YA 1S7UB 5JDSA 2HKFL 5F7FA 2X41A 2OZ4A 3VG0L 5CJ5A 1KLGB 2X4PA 4X80H 3IXTB 1A1OB 3V0WL 1WZLA 2C7UA 4HGWA 4K8RC 2A38A 1CVSC 3N06B 3W9EB 4X8XA 4U1LB 1C8PA 2R1XB 2F8VA 4JFDA 5KZCD 1P7KA 3HE6D 5C0CD 1IAOA 2BJMH 3G6JF 1U95A 3QWRD 4AMKH 4FQJH 5CJOL 2EIEA 1X6LA 2DBLH 4NQTA 3NOIA 2X05A 1NAML 5BZWB 3TIEB 4JHWL 3C5JA 3C2AL 5C0ND 4DGIL 1I8KA 3MMEA 2B39A 3BFOA 5F9OH 4APQD 3SBWA 3L1OL 3T2NH 4IDJL 5GJTH 5I1GH 3U36A 2C4XA 1CGXA 3RWDA 4PB0H 2ZCLH 5EU6B 5BRZB 1HDMB 1VGKA 1DEDA 1F90L 5C0IB 2XN9D 1NC4B 5EU6E 3SDDC 3SE8L 2OL3B 5E8PB 4CADB 3FQNA 5IQ7L 4WFEE 2VDPL 1MREL 5I76B 1RHHA 4DEPC 5FO7B 4BYHA 3I6GA 1D5BB 1RIUL 5CEZH 1Q0YH 2EXWD 1GZPA 2P5WA 1NGWB 1A5FL 2IH1A 1AQKH 3P0YH 2X9YA 4P2RD 4XX1E 2EIBA 4DZ8B 4HPYH 4KFZC 3HMWL 5B38A 1BBJA 4R2GC 1U8NB 2EC8A 1U9KA 3C9NA 5EOQL 3DX9A 2YOCA 3P4MA 3NAAL 3U30B 1HILB 5FAAA 1JHKL 1KJVB 5FHBL 5IMLA 4XP4L 5FO8B 3VXUA 3AY4A 1HQ4B 1PGRB 2C26A 1RY7B 2J8UE 3IS0X 4LMQE 3C5ZB 1A6ZA 3MLTA 4P2YA 1LDPL 4GW1B 1B0RB 4Y5YA 5C09D 5IEKA 1CFTB 3HZKB 1MAMH 5E99L 3M8OL 1F4AA 1N5AA 3TVMA 3BIBX 3RZCC 3O8XC 2FECI 1HNFA 3REVB 2EYRA 2D7PA 3G6JB 4EDXA 1AGBB 3SDDA 1T5XA 4QYOB 3D0LA 4TSAL 2VL5A 3I02A 3Q6FB 5I1CH 4YHZL 3HE7D 2GAZB 5DVOA 1UACH 3QJHA 5TDPA 5EWIL 4MXWL 1UZ6E 3B43A 1EMTL 12E8H 2ZUQC 3T2OA 3VCLA 1MCPL 5T1KD 5INDA 4BZYA 3FO2B 4ZYKA 2GSGA 3TN0C 3D1MC 3HC3L 1A21A 2JB6A 4G9FB 3DXAE 4UINL 5GS0D 1U8OA 4UT9H 5C0AE 2X6MA 3S4SG 1CG9A 2QJDA 1UXSA 4WI5A 2D7QA 4NCC2 1BIIB 3NIFE 1VKXB 3FRUA 2ZUXA 4RFEB 1I1RA 3QISA 1QBLH 1JNNL 4HX1B 2GY5A 4NQSA 1Z0NA 1G7PB 4RWYH 1LEIA 4CDHA 1BD2E 5ITBL 4JFEB 3CUPA 2NY5L 4WUKH 5CD3B 2YN5A 4U1IB 4U6YB 2HVKB 4KWUA 3RVWC 4OZGA 2MOVA 1BOYA 1UKSA 2PETA 4P4KB 4RA3A 5CUSH 2MPAH 3RNKA 2YPVL 5ANMA 4D9LH 4H8WH 3W0WA 3FO1B 2Q7YA 3K74B 3C8HA 3CLFH 2P47B 3RGHA 4NWTL 3IKCA 4MA3B 5HHOD 2AABH 1R3LA 1I7ZB 2KBGA 43C9B 2FHBA 2E7CA 1NLBL 4P23C 12E8L 1OSPH 3BPNC 4HCRL 4LKXB 1G9NH 1GH7A 1K6QH 4P57B 3L3KB 2C1PA 4NZRL 5DMYA 1CDJA 3RIFF 4CJ1A 5I1LB 1ZOXA 4TUOB 4K3EL 5D4QA 2XWJA 4PTUB 5ADPL 4HUWB 2N7BA 4PV8A 4LP5A 2GI7A 3KYNA 2G9HB 4Z7WB 3RWFB 3QEQA 3O2DH 2NX5E 2QQQA 4LSDA 4ZUTA 4EDWH 1DDHB 1E27A 5FYJE 5IFJA 3QULB 3ZKXC 4U1GC 1FN4A 5I1KL 3VD7A 1A6AB 4KGJA 1DUYB 1H3WM 1JV5B 3BPCA 4MNGB 3MYJA 1SVCP 1IQWL 4GRMA 1IKNC 3QQNA 1FNHA 3L3KA 2F19H 4RBPK 5FYKL 1QSEA 4H1LH 5INCA 4C57C 1JF1A 1BF8A 2EYTA 4NNPH 1E4WH 4YWGL 1R3LB 4TNWF 3D9AH 5JLZB 2QQKL 3IDXH 3NZ8A 2P5ED 5JO5A 4AMKL 1ZTXH 1IQDB 4KC3B 4KJYB 4NHCH 2DI8A 4HIEB 1NC2B 1RZIB 2VDOH 4CDGC 1KGCD 3MLUL 3GMOA 4R90L 5E94A 1RUKH 3NCYP 4QTIL 3PV7A 4U6YA 4X7SH 4QY8B 1A3QA 2EDWA 3HFML 1I8MB 2FHCA 1R3IH 1I7RA 2C4FT 3T8XB 1P84J 3HR5B 4PB0L 4PGEA 3O6KH 3JTSA 1PSKL 2N1KA 4UIKH 1GGCH 3DURB 5FKPB 1F8TL 3ILPA 5BS0E 1UXSB 3KWWA 5HVWA 1NCDH 4NSKA 5GRXG 4DVRL 1L6ZA 5T3XH 5CJ8A 4NM4H 1J0KA 5J6HA 1JWMA 1JMZA 5E24E 1MCRA 2P42B 2E6QA 3O9WD 2A6KB 1ZLUK 3WJLC 1C7TA 3FO2A 1P7HL 5INDB 4W4OA 2P48B 4Y4HB 1TNMA 5HI3C 1AGEA 4DKEL 2I5YL 4IRSA 3WYRA 1JHTB 2NW2B 4LIQE 4I18C 5MEQB 2CUHA 2J8HA 5EN2A 3R06A 3SO5A 5BW7A 2FJHA 1QSFE 4XXDA 3GKZA 4OFIA 2BNUB 3B5GA 3IDNA 4PJEA 3HC4L 1WGOA 3P0VL 4YPGA 1OL0A 4ZTPH 1W72B 1OP3H 4LSSL 2NXZC 4KAQL 3NBNA 2CKBA 5D1ZB 5HVFB 5B39A 1S7XA 2Z31A 5L2JB 4R7NA 3FT4A 3OJMB 4PJ7F 2YD8A 4M7ZB 4WEUD 3P4MB 4DCQB 1CDHA 3M17B 2C3VA 3OXRA 4NO3B 1DQDL 4JO2L 5B38B 4RGMC 3FQUA 4UQ2A 2LFGA 4OT1L 2VKXA 2WSKA 2A83A 5JIHA 2D7TL 4PJ8A 4PTTB 3QXAA 2AV7B 1KB5L 2I24N 1EIBA 3WFEH 4Z7WE 5HYJB 2DQIL 3S98A 4KVNH 4F57H 4D9QE 3EO1B 2Z9TA 2YD1A 1XR8A 3KS0J 4NWUL 3ILQC 2D7MA 3U0WH 2X1PA 1JPGA 4AYFA 3WFEL 1Z0MA 5ETUB 1E6JH 4PJAE 1N0XH 5DEFA 3W11C 1MVFA 2NMSA 2VQTA 3D85D 1TZIA 3S5LA 1NGQH 5LGKA 3O45A 1I4FB 3T3ME 5J4MA 4X6EA 4K7FA 4WW1B 1ORQB 1N4XH 3K46A 4IM8A 4B7LA 4RMRA 4EQ3A 3N1FC 3FB5B 4N1CA 1S7SA 3KXFB 2Z8RA 2CKBL 5T5NF 4KJWC 1MRDH 1P7KB 1FAKT 1CR9H 2D7NA 5JXAL 4JFDB 2OJEA 3I50L 2IJ0C 4KKCD 4F7TA 1AQKL 2AXFB 1W72L 4AG4H 4RAVA 5L2KD 1KLGA 2X4PB 2NW3B 5EUOE 2JJWA 4ACPA 1L7TH 4IIQB 1LDSA 2BRRL 5C2BH 4LCCA 1UG9A 5EZJB 3IFOA 4JZOA 3MYJB 3DROA 3SE8H 3MLZH 1DUYA 2XRAL 5HYFA 3GMNA 3EYFB 3BYYA 4X6FB 1NFDA 3T1WA 1RZFL 3QQ9D 2F5BL 5D6CA 1LO0H 4JHAL 3ROLA 3MFGB 3OKKB 4JY6A 5D5MF 5SWSA 1CDGA 1K4DB 4R0LB 4PV8B 2HT4C 4WHTB 3BHBA 4G8EB 2BX5A 4M7LL 3MLYH 4P3DB 4OV5A 5E7BA 1TCMA 4H8WC 3ARFC 4MJ6B 1MY7A 4DKAA 2APBA 4HIJB 1QFOA 4M3JA 5HJ3B 4KRNA 1KCVL 4N8CL 1T22A 2BNRD 4O2CB 5IBTL 5ALBL 1CFNB 3AROA 1MLBA 2B1AH 1MELA 4X6DF 3IKCB 5EZIH 2VWEE 5KJRL 2PN5A 3HE7A 4M1DL 3FONA 3ME0A 4IJ3C 3WL9A 3DSNA 3H9HA 2BVYA 5KZCB 3GUTA 1D5XB 2E9BA 4NKIL 1HKLH 4ZFOB 4R97B 1D6EA 4FFZH 3QXDB 2H6PB 2VLRD 5DQJB 3KNBB 4MAYC 4J3XA 3TBTB 2V5SA 3CLEH 1ZWIA 4EJ1C 4OZFH 3ARYA 3RWCB 3O3BB 3INUL 1M7DA 3QFDB 2DYPA 5DJDB 3MGOB 3LN5B 4X0KB 3VXNB 3HE6C 4U1JB 4G8FA 5KVDL 1F2QA 5M95B 1TZGL 1ZAGA 2NZ9D 5E5UB 3ROOB 3VGEA 1OGAB 1PFCA 3PF2A 2BMKA 3BQUA 1VPOH 4KVCL 3QI9A 3VXTA 3U2SB 4LLDB 4HZAA 1KFAH 2N4IA 2H3NB 5D7LB 3WUWA 4KU1A 2ESVA 3O3DA 2VXVL 4ORGA 4G6AD 5ILTH 3IU3A 4EVNA 4PS4H 3Q6FA 1EH9A 4JPWH 4YIQB 1HH6A 1TJIH 3Q1SH 4XMKH 5EU4A 4CAGA 3GEWB 1F3JA 2EZ0C 4PGBB 2EO1A 3CZFB 4Y4FC 5KVGL 2D7OA 4DUXA 5KVEH 3TM6A 2YPKB 2R29L 1MFEH 1EAJA 4OBSA 4Y5YB 5F8QC 1CGSL 3OGOE 4G9DA 3C5ZA 4KKLD 1ZWIB 2W60A 4YFDB 5C3TA 1ZSDB 3IKKA 4B41A 4TTDD 4JQVC 4FABL 1N64H 1DN0B 4K3JL 3REWB 1E4XI 4D9QD 1G6RB 5D2LF 1RIHH 2W59A 3D25A 3DO7A 3E1F1 1OT1A 1HHIB 3DI2B 3UJIH 3KDMA 3QO0B 2PTTB 4PJHF 3BESR 2R56H 3GBMH 2J8OA 1S5IH 1VEOA 3H7LA 4Z78B 3V79C 4HS8H 3AGVA 4ODSL 4NC0B 2X4UA 1XMWA 3MRCB 3CFKB 5ID0B 1EFQA 2F5AL 3HNVL 3QDME 5I76A 3KPOA 1B4JH 1YEIH 4E41B 1HXMB 1S7TB 2ZJSL 4AIXA 1X5YA 3TBVB 4GAJL 1KJ2H 4G9FE 4LIQH 4YBLB 4POZC 5H94B 5EU6A 5AZEL 5IVOA 1S9KC 3QPXL 3L3OB 3EJZD 3G6DL 3GSVB 1MIEL 3BPOB 1KEGL 3HI5L 3MNZB 4K8RH 4NM4L 3LMJH 3MMEB 1I8KB 3DNKA 2VN7A 3UTPE 1P2CA 5TFSL 4C83A 1JFQH 3ULVF 5TGBB 2ZUTA 1RJZB 3IF1A 5DJ8A 1U8HB 3MGAA 3F7VA 4M5YL 3SKNA 1NUNB 3HMXH 1ZLWK 1YPZF 1X5IA 3DROB 3MV7A 4XTRD 2OTWA 2NYYD 3HFMH 4K7PL 4Y16D 3W9EA 5I1DA 4D3CL 4NO2B 1AQDA 2YK1L 4J3WA 2BHUA 4U2YA 4TVPD 4D0BB 3P0YL 5C0AB 4PJXB 4OM1H 5I74C 1ZLVH 2ADGA 3WXWL 2B20A 4HC1L 5T1LB 2NXYC 2X10A 3ALPA 4TOYH 4EI5C 5EIIB 1HIML 1SEQH 2HT2D 2BOCB 3N9GL 5F7KC 3KXFA 1QVOB 2Z92B 3VRJA 1FV1A 4XH2A 1UQSA 5T3ZD 4L29B 4P5TC 3LKQA 3UTSD 4D3CH 3Q3GB 4GRLA 5DLML 3TP4A 3VGAC 5BQ7B 4TQEL 5ALCH 5F96L 4X6EB 3QUZB 5EO9B 4OD2A 4JFFA 5C07D 2VB5A 2BSED 1IM3A 4R8WH 2WWKT 4YHZH 4L9DA 3SO3B 3T3PF 3MRLB 4HS8L 1JPGB 2YXMA 3LOWA 1QSZA 4NKDA 4NPYA 4LNVA 3RVVD 4MZ3A 4V2CB 1BZ7B 3P73B 2VDRL 5I9QB 1G6VK 2WBKA 1F00I 4MD0B 3OMZA 5KTEL 1A9EA 3OXSA 4YHKH 3I2CL 4HUXA 3W2DL 1G84A 3MV11 4HKZB 1RZGA 1WZ1L 1KTDA 4FABH 3MFFB 4YHLL 3ARDA 2HTLD 4HHAA 2UZXB 4FXGB 1CLYH 5D1XA 3CVIH 1DVFB 4XZUA 5C0JB 5EUOB 1QBAA 1TDQA 1PG7H 4Z76B 1IC5L 4MS8C 8FABA 4KJPD 4R7NB 3D9AL 1VACA 4UQ3A 3QIBA 4U0QB 2FH6A 2Q86B 1MHEB 1MCHA 1MCFA 4LLYB 1FG9C 1NAMA 2ESVE 1KNOB 3MACH 4XCEA 2G5BA 1RURL 4HPYL 3C2SA 3LVEA 4Y19D 3OAYH 4C54A 3IU4L 1XF4B 1NUGA 4TVSa 2IMMA 5EN2B 1YNTA 3U4EB 4AY0A 3RX8A 2AK4D 5ACZB 2NW2A 4TYUA 4EUPA 4F7PB 3IRZA 3BDXA 3BH8A 3UTZB 5JMOC 4LGRB 4IRZL 5IHUL 3BMWA 2ZG1A 2OR9L 2XPGB 4E42B 1Q9OA 3SOBL 1FORH 1IGML 4JO3L 3ILPB 3HRZA 2X4SB 2N56A 4L4TB 4MAYD 3T2NL 3H3PL 4GKSA 4FTVB 2ZOKA 3UYPA 6FABH 2NY1C 4DZBA 3HR5A 4YFLF 4UTAL 4HWEL 3V4PH 2HN7B 3ZKSD 2F74B 5BZDA 2VSDA 4S1DC 1S9YB 3WIIL 4OD3H 3A67H 5HPOA 5E8DL 4I2XB 2Z35A 4WNQA 4KTDL 4HIEA 4ZMAT 4KROD 4KUCD 1XH3A 4GJTB 5I19L 5CUSL 1J0JA 3PABA 3SDDD 4QHNB 4YHYB 4Z7OF 4O00A 5F7UA 2XQBH 2VXQL 5CBEA 4DKFL 1CIUA 3L95B 4TULL 1FO0H 2PYFA 2EYTB 5I73B 4HW6A 1YA5A 4RZCB 3MLYL 3L5XL 1QKZL 3VI4F 3HI6L 1J7VR 2K1MA 1J5OL 3TO4D 3JWDC 3HZMB 3QEHA 4NQEE 5I8EA 4CMHC 4PJFB 4MWFB 1MJ8L 3C60B 3JUYA 1FL3A 5T1MA 1YEHL 1I1FB 2BVPB 1BVZA 4R2GD 4Q0XL 3VXQA 4LAQL 3WFHB 1MCOL 4QXGH 3MV7E 4MYWB 4QHLB 3PWVB 4I18A 2XY2A 1T4KA 2FGWL 4UV4H 3CZJA 5EWIH 5HI5D 1H8SA 1KJ2B 3ARGD 4U1NB 5DEGB 2FYYA 5C0BD 1RV6X 1HQRA 4J1UA 1HHGA 2RHEA 4XPFH 4R4NC 5JDJA 1FL3B 1LK2A 1G9MC 5I8EB 2VITA 1XGUB 5ILTL 4X83A 4KK8C 1OAKH 3ZT7A 1HSBB 5D7KD 1IGJB 4PRHB 2EKSA 1OF2A 4G42B 5HHXL 5ISZA 2ADJB 3HPJB 1KJMB 1IAIM 2EECA 1FFPA 2V2XB 3Q5TA 3STZB 3ALWA 5FUOL 5HI4C 1OY3B 3TN0D 3CVHB 1Y0LB 4WNQB 5JPMB 1TZHB 3WO3B 3FAWA 2DQUH 2RR3A 3UROR 1H3PL 2PXYA 2VC2L 1NCNA 3ARSA 3K4DA 4P4KA 2BNRE 4JO1H 3AVEA 4O2FB 4P3CL 4KHXH 1NGPL 2Y7QA 1NCCH 4A2LA 3QDGB 1KIQA 3PGFL 2HN7A 1K8DA 3NACH 2UWEB 1S8DA 2NLJA 4E0RA 1UWGH 5MENA 2BNQE 2HAZA 4RGNB 4RFEA 4HIHB 3U7WH 3WV0A 4LHUB 5MHSE 1D5MB 4JGJA 3U30C 1DJSA 5DURB 3UPCA 5F70A 4PJBE 4MD4A 4LPYA 4NYLB 2GITA 5DA0B 5H37H 3X12B 5AAMA 3QQ9C 5JUEL 3DMMA 4KRPD 2V2TA 4CMMB 4EBQL 3X13A 4IRJA 4FQQB 3S96B 3KJ6L 1NDGB 3B83A 4HKJB 4C56B 1YN6B 4GFTB 4Z7UA 3U9PL 4NQDB 1FNAA 1MOEA 3U0WL 4P46A 4PP2B 5IHLB 3DV4A 3OKEB 4GMTL 3QUZD 2AK4B 3G9AB 5GJSL 1UWXH 5ICXB 4JFZL 5EOCH 5KN5B 4K2UL 3LD8B 3P0VH 1ZS8A 4PGZA 1I9IL 3UTSB 2UVEA 4OM0L 1MNUL 3NTCL 5DMKA 1HQ4A 3PDGA 4Y19A 4E5XA 1EVTC 1BM3H 5JHDE 1AFVH 5TJWK 2CMRH 3WJJC 4YK4C 4LSTL 3UCRA 4JFXA 1HCVA 1J1OH 3VWJA 1YYML 3MOBH 1QSFA 4WWKC 1U93B 4NO0D 5C0AD 2MWCA 5HDBF 5HY9A 4ZD3L 1J1PH 1JGEB 1OW0A 3MV8E 3OXSB 2VDKL 1RFDL 4BUHA 4D0DA 2XZAL 2P1YA 4O58L 1H8NA 5CIPA 1KB5H 1KACB 1YEEH 1QYGH 3KJ6H 5JW5B 5C0IA 1B2WH 2WBJB 4U1MB 4U7MA 3QDJD 5I75B 1HDMA 1NBZB 2Q76A 4BSVA 1IM3B 1JIBA 1GGBL 3EYOA 3KPNB 5CEXB 2FO4A 4KMQA 2EE6A 2X1WL 5DFTA 1CZ8H 4K55A 4PY7B 4EIGB 4ZPVA 2J3SA 5E2UL 4F7MB 4PREB 4DTGL 5JXEC 3QJFA 3MUJA 3GM0A 1U8KB 4OLVL 3NPSB 3X11B 4X7TB 4FFWC 5LGJA 1NFIA 3VRJB 1I85C 5C07B 5AYQA 5TDNB 2WM0A 5IB2A 3MV01 1PZ5A 3LRGA 1BOGA 1BREA 3ALXA 5F71A 1N6QH 3U48A 4UV4L 4HJGB 1Z9SA 4LVOC 2NX5B 3BW9A 4Y0GA 3UTTB 4TUJA 2A9MH 3QNYA 1WISA 3TVMC 1NGPH 1KIPA 4OLWH 3KR3H 1RUML 4H88L 4XAKE 3HS0A 3BE1L 3QH3A 1UT9A 4L4VB 4PRAB 2E8YA 1UWXK 4ZUVA 5E2WH 3CSPA 4CGTA 2R0KH 3IDIA 1JI1A 5ICYA 1JZ5A 2VZTA 1DANT 2YRLA 2R2EB 5D2LB 4PJ9B 2F15A 4Z0BH 1MI5D 2O5XL 1QG3A 1WWWX 4P4RB 2R9HC 5IJVB 5D7IA 4ONGL 1U36A 4D8PA 4HIXH 5ICYB 3HUJF 1XGRB 4OQTL 4HWUA 2IALB 5DK3A 4V2BA 4HZLA 1XGYL 2G2RB 3G04A 3QH3B 1CBVL 3VMNA 1AY1L 1P9MC 1T83A 1YYMH 2IPUG 3HS0B 3IJSA 5TDOA 2XNAB 3JZ7A 3BP4B 3VRIB 3O6FA 1MCQA 3TBVA 1J0HA 5IB3B 4OF8A 5F7DB 1J1XL 4OBRA 1IZJA 1OTSD 4JG1H 1NBYA 3BW9B 1KCLA 3CSYA 3BPOC 3UZQA 1T83C 3O6ML 4QRSA 4APQA 4BQBA 5E00B 1OPGL 4KI5E 5CFHA 3LB6C 4PUBL 4PJFF 4UIMB 1YNKL 3GSRA 4YDKL 2BNRA 3D18B 4WHCA 4OKVA 4UDTA 4UV7H 4H1LG 4P5MA 1P1ZB 2AP2A 4I2XE 5DT1H 4M6AA 3TO4C 4ONHB 1T2QL 1K8IA 4S1SH 1ND0A 1IC5H 1HHIA 3Q2CA 5EG6C 3VJ6B 3VFVB 1OB1A 3EDKA 2JK5B 1I1YB 4M4PA 5H37G 1YYLL 5H35B 2Q76B 4BSVB 1ES0B 4P9ML 3GSUB 5JOEA 1RUKL 2X4QB 5I71C 3WIHA 4J12A 1XF1A 1V7MH 1PD6A 4MMXC 3P77A 4PLOB 5BS0B 1C16B 3LMJL 5E8NA 2LQRA 3DIFB 4OI8A 2PKDA 2WLZA 3V6BR 4OQTA 4KZEH 1SJEA 5GRYA 1ZHLB 4LARH 2JIXB 3HN3A 2BP3A 2PTUA 2C4FU 3IJYB 2ZUYA 1HI6A 1JNNH 4NZRH 1TJHH 1X5XA 2QV2A 4ZS6C 3IFPB 5CEZE 5T5NG 1P53A 4Q2ZA 5IB5A 3VXPA 3DSFL 4XGZB 2ESVD 3L3IA 5FYKE 1L6XA 2PW2B 1A7NH 5F7NC 1F3DH 1U8JB 1ZS8B 5J9PA 4JM4H 4HH9B 2VR9A 3WKML 5IW1B 2UV3A 1RQ5A 3C8DA 3AS3A 1UJ3B 1Q0XH 2X70B 3ARQA 4OCXL 4WI7A 3L6FB 5EO1A 2PNDA 3A6OA 5I1AA 3WE6A 2F58H 1RD6A 4P9HL 2HJFB 3TA3A 5DJXA 4XCFH 1Q72L 3GMPA 5D6DA 1NDGA 2XZCL 3ZDXE 4LGPB 3HUJE 3EJYD 3MCKA 3QCVH 4N5ED 2H45A 3U83A 3W39B 3U1SH 2ICEA 1O5DT 4N9OB 1MQKH 2M26A 4U1SB 1W2KT 4XC3L 1DBMH 5JOPD 1MCLA 2LU4A 2XY1A 4NZJA 3ARVA 1MAML 3OKMA 5DQDH 4MDJB 4NYLA 5F1IA 2XWTB 2APTA 1F90H 4H8WL 3QDGD 4MLSA 3F7PC 1UVQB 4G8GA 5DQDL 3DRTA 2OSLB 3MBEC 4HS3A 4ETQA 2CRZA 2EC9T 3ULVC 5DZLA 3VI3F 5K9JL 3VH8B 1A14H 1BBDL 1U8LB 5DHYA 3U1SL 1WBZB 3SE4C 2VR4A 2Y7QB 2I9LB 1A5FH 1U8MA 3ZE2F 1DBAH 1NKRA 2H1PH 3SDAA 1JPTL 2ZZUT 3FFDA 2Q8AH 4KK6C 2IBBA 4C55A 2DMBA 2VABA 4CL7A 4PYHA 4C56D 1KJMA 3CXHJ 3RKDC 5I2IA 1T0MA 1JRHH 2JTDA 4OCRH 2X9XA 5A16B 3S9DB 1FFOB 1F3DJ 3MV7D 3AREB 1ZE3C 1X5ZA 3TF7C 4J4PC 3BX7C 4NC1E 1DBAL 3HLAB 4G80A 1KB9K 4XPHL 5C7XL 4BFIB 3PIQB 3LZFL 43CAB 2ED9A 1RHFA 2VLJD 4D9RD 4LLWB 1T2JA 1XIWC 3TLRA 4XP4H 5D1QC 1G9MH 3C6LC 1F4WH 1FYTA 3VD4A 3N0PB 2DKUA 1A8JH 3PWPE 5ECJE 1S5IL 5MEPB 1F11A 1CD0A 3T0EE 2VXVH 1JTPA 4RZCA 1NPUA 2OM5A 1O7SA 3MACL 2BC4A 1YNKH 1HIMH 1SEQL 4U3CA 3LCYA 1GIGL 2Z35B 3VFOB 1GC1L 3QQ3A 3JWDH 5AZEH 3SJVA 2YSSB 4NP4H 1NJ9B 1NMAL 4L8DA 2ENYA 3O9WB 5BZDB 4DK3A 3RWEB 1N5YH 1IC4H 3SE9L 4AJ0A 5AYUL 1GHFL 1CLOH 3GSXA 5C0BB 1KN2H 1YMME 2CK0H 4DZBB 3HUJB 3WEXA 3GHEL 2W38A 2ZKHL 1U8PB 3BXNA 4L4TA 4NO3A 4YHLH 3CGTA 4PRPA 1UB6B 3GIZH 5IQ9A 3QWQB 1YNLH 2CDGA 2Y06H 1JUFA 4P59L 4HBQA 2HFEA 5DDHA 2EE2A 3MNWA 1FYTE 1OVZA 4NRYB 4U3HA 1CGWA 2BDNL 4PRID 1INEH 2EO9A 3QIWA 4A6YA 3KPSE 5JW4N 1NMCB 3BD3A 3V6ZB 3B6SA 2ADFL 1JNLH 5EBWB 4NJ9H 2BNUA 4K3DH 2FEEI 2YA1A 4WI8A 4PR5B 3MJ8A 3PL6B 4KJQD 1J8HB 4XVUD 3B9AA 2IWGA 3MX0A 3OPZH 2E9JA 2VDQH 4Q9QL 3UZVB 5ANME 4QEGA 5EORL 1DVFD 3QG6B 5B22A 4YHOL 1ONQB 4L4VE 2HFGL 4GAFB 2A6DA 4UQ3B 1FSKB 3PGCA 3SDCD 3QIUB 1ZA6A 1ACYH 1I9JH 3B8SA 5D72L 5GZNC 2AJVH 1VERA 3B9KA 4R4ND 1E28B 3VW3L 3BN9D 2B1AL 1UB6A 1DVFA 1H15A 3X3FL 4M1GL 4FXGA 4B50A 3BYTA 4N1EA 2LAGB 1H3TA 1KPUA 4FQCH 5FYKU 3S3JA 1U58B 2MCPH 4L9LC 1I7RB 2CD0A 1G7IA 5FA3B 3E6FA 2F8XC 2YD9A 4HLJA 1QQDA 4AEHL 1A9EB 1U3ZA 1LE9A 4RMUA 1F58H 2YD2A 2VDKH 5CP3A 3VXSB 4JDVA 5C0DA 5F6IC 4KJYA 2VMFA 1IQDA 5GRVK 1MH5B 1GGIL 1KJ3L 4KJWD 5LXGH 3BSZH 2NY3B 4OSUH 3UEZA 4LBEB 2ZCHL 4ZDHB 4F33B 5E7FA 3QUYB 2P4AB 4JFFB 3WIFA 2VXSL 5CIPH 4GRLD 1EEYB 3QXTA 5DJAA 1O0VA 4X6DB 5DRWB 1XF2A 3KLHD 3PE9A 3WS6C 3ULUD 1AO7A 4JN1H 4UT6L 4RIRA 3MZTA 2FBJL 4XBGA 3MRJA 3H2WA 4JAMB 2JCCB 1A7OH 1P6FA 1E27B 2FX8L 3X3GH 4ZUTB 4LLWA 4KVNL 4F57L 4Z7WA 1SMAA 2VRAA 4FQXC 1DP0A 4L3EB 5HGGS 3SDYL 2GTZB 3CFBB 2CQVA 5DRXA 3ZZ1A 1BWWA 5I1DB 4OZ4B 1N6UA 2W9DL 3HC0B 2OMNA 2DTML 4LEOA 4FQLH 2VUYA 2MMXA 4JO2H 1DQDH 3QUZC 3B9KC 4EBQH 1MWAA 4PGJA 2WINA 4Z0XA 1LHZA 5IB4A 2LTQB 4M1DH 3B9EA 2YN3A 3LQAC 2ZSVA 3V8OA 3R8QA 3WKNA 5KVEL 1JPFB 1IEHA 5IBTH 4PRBA 3FB8B 2APWA 1N6QL 4M3KB 3JWDL 3EAKA 1KV3A 2XZAH 4U1HB 4WJ5B 1SY6L 2VXUH 5K9OB 2FLBT 2FX7H 4F9PA 2IQAA 5C6WH 4I1NB 4OFKA 4U1IA 2OR8A 5MP6H 2EE9A 3OPZL 4QWWD 3VXMD 1H3PH 5DHVB 5L9DH 3NA9L 4I3GA 4YDJA 1CICC 3MUZ1 5I6XB 5K9QG 4KTEL 3EOAB 1R24B 3QWOA 2DQEH 5DUPH 3KPOB 1FQ9C 4HEPG 2WWKO 3MRCA 4KQ3L 5CJQL 1WV7T 2XICA 3OKLA 1A0QH 4MJ4A 5BJTA 1X5GA 4PJHA 5DTFA 4QNPF 3TJHC 4XVSH 5J12B 1NCDL 2LABA 1NFDE 3D2UD 3GRWH 2ICEB 5J56B 4U2ZA 2JJVA 3BVNA 5F1NA 1RULL 1GZQB 1JCKA 5C92A 3PDOB 3O4LE 3EGSA 5E6IC 1QLEH 4ELMF 2CGRH 2VL5B 3I02B 4Y7MA 2GT9B 4QRQA 5T1KB 4LRIA 1G0DA 3T0EC 4O4YH 2G60H 2X70A 1G6RH 3LB6D 1YECL 4LAQH 5C0EB 1CFTA 1CCZA 4FMFA 2EDDA 3WLBB 2X1XR 4JPKH 1ZHNB 5DJCB 4EVNB 1MCDA 1OGAD 3JV4B 4DVBB 3TV3L 5LKNA 4DUWA 4YWGH 3TYGL 4HIIA 4JM2D 4I48A 4BM7A 3MRQA 1Q1JL 2AGJL 2KL6A 1OTTD 4UT7H 1TVHB 4RGNE 4R97C 4PJHB 1U2HA 3WD5L 5F3BB 1T20B 4LP4A 1DCLA 4NM8H 4WFFE 5ITFA 1NGWA 2Z4QB 4G8FB 1D5BA 1DQMH 3WFDH 4L1DA 3C87A 4F8TA 1JNJA 5E4EC 4YDJB 2A77H 5ELIA 1P4IL 4HXAH 4QRPA 1OCWL 3RL2A 3BRFA 1A4JA 2RQ8A 3KHOA 4YXLL 3HI1B 4OGXL 2HT2C 1I1YA 5I9QC 3C5SB 1RZ8A 3GBNH 5K9OA 1ED3A 5HGHB 1BFSA 3B5TA 3FZUC 4P5TD 3H3PH 3PGFH 1XF5B 4K7PY 4BFBD 7FABL 3A6BL 1BJ1J 1KN4H 4JFEE 1CFNA 2XACC 4YHNB 1MWAB 1TQCB 4OLXL 4APQB 1FCCA 3HKFA 3J7HA 5F21B 2RAMA 1B0GA 3DVFA 4OB5L 4OZ4A 4U1GB 3RI5K 4DAGH 1XR9A 3FFCD 3LEVL 3CFBA 5K9KB 2MHAB 3LH2L 1CD1A 4Y16C 2E8ZA 2P49B 3FTGA 5GRUL 4OLEA 3LQAH 2FHFA 1OW0C 5D6CB 4OZHB 3C08H 3MODL 3CC5B 4Z18A 1RURH 3DJ9A 1FFNB 1KXTB 4IS6A 1UGNA 3KPRB 3NIFF 4P4RA 4P48A 3IFNH 3LS4H 4UB0L 1AGDB 3E6HA 2OR9H 2VLKE 2Z0BA 5B8CC 4Z7VA 3MBED 1VFUA 4X6DA 5EUKA 3KPSB 5LAXB 4HF5H 2J7LA 1ZLUH 4ZNEE 1M05B 1UZ8A 3MRBA 2FD6L 4F33A 2O93L 3OZ9L 3RJDA 1X6NA 5AG9A 3ISWA 1FZOB 3I2CH 1YEKL 1G7JA 3VXSA 4AK1A 4Z9KB 1D9KA 3CDGA 1CLCA 5FECB 3T4YA 2E7LC 1DSFH 2GJ6A 4Y2OA 4MD5B 3VI4E 1CL7I 5F88A 4NRZB 4QKXB 3FB5A 2H8PB 2B5IC 5ESVA 3WKMH 2YD7A 5A3ID 3IETA 4JKPL 4K7FB 3RVXD 5E2TH 4PJ7B 2H26B 2QEJA 1LNUA 4GQ9H 2I60H 1GJIA 3D2UB 3AREC 1KT2A 2FDBP 1UM4L 2GYSA 3QCUH 4MXWH 3TZVC 4Q9RL 1SMOA 4CN4A 5IW6B 3L7EA 2I5YH 5MEND 3D69A 5C8JB 3O2DA 4Q7DA 1Q0YL 1ZANH 3IGAA 1INQA 4MB4A 4M03A 2V6HA 2NXZB 2BY3A 3S34H 1J8HA 3M8OH 2ED8A 1T7XA 2PTVA 2NXYB 4JFHD 4WW2B 3VXMB 3CH1B 4HWNA 3ARBB 1A0QL 1KEML 3V95A 2R69L 3TVMD 5EBWA 1ADQH 5LGHH 5ALCL 2C3VB 3OXRB 4GRWF 2WUBH 4K7PH 2ADIB 4H26A 1IC7L 1OD7A 2RFXB 4QTIH 4N0UE 5JOFA 5GGSY 1S7XB 1UWEH 3LIZH 1YEJH 3MNWB 1QFPA 1S5HB 1TJGL 3B8YA 5FK9A 1MIEH 4YDLB 1MCWM 2CDFA 1NGXA 3G6DH 4CVXB 5IQ9B 1J05B 3DV4B 3OKEA 1U8PA 5D93C 3MRHA 1XF3B 4Z7UB 2P5WD 4CUCA 2NY2D 1YMMA 3RA7L 2AJSH 3TZVA 2R1WB 3RWEA 3EGSB 5HI5C 1BHGA 2EH8L 1NH6A 1NBQA 5EFIA 4LFHD 2J5LC 4PLJC 5JZ7C 1BVKB 1ZT1B 3OR7A 3HZYA 3O2VH 1A6TB 3JV5A 3VD9A 1JWMB 1OTSC 4YE4L 1MPAL 3DXAA 3AXLB 4N0CD 1FRGL 2WZPD 1WFTA 1JK8A 3O0RH 3MRRB 1D5MA 5GS1B 1Z6JT 4EI6B 3SGJA 1KEGH 1DQJA 4HGMA 4K3EH 5D2NA 1KCUL 3CXDH 3MLVH 3K0WA 4EXKA 3MRFB 1KIQB 3QDGA 1FYTB 3PL6C 4PJXE 3W82A 4QOKE 3RUGE 1FNSL 4RDQF 1HH9A 3UO1L 3QAZC 2GTWA 2QADB 1IKFH 2YBRA 2IPTH 1I85A 3FB8A 1J87A 1C5DB 2M1KA 3V5DB 4LCWD 3NH7L 3VXUE 4GXUN 1V3KA 2FL5B 3WJLA 5J0BA 2BVOA 5M94B 3T3MF 1DEEA 2B8OT 1RAMA 1UCBH 1BD2B 1HSBA 4HC1A 1NGYA 3NZHL 4XPTH 4OFPA 1F02I 4GRMB 1KCRL 4JRWA 4P2OB 2A1WH 4MNGA 1JZ6A 2OS7A 4Y16A 2P8LB 4ZS6D 4QRTB 3LDBB 3RNQA 3MA9H 1CGSH 2F54B 1OAYH 3QNZA 3EW3B 3HG1E 4HBCH 4HAFA 32C2A 4X6DE 3NFSL 3PWVA 2QADD 1FYHB 2Z93B 5J11B 4QHLA 3B2VH 4U7SA 4WWKA 3IXAB 2H32A 3IVKB 1W0VA 2X5PA 1I9JL 3S7GA 3T65A 1I1FA 4Z0BL 4ZXBD 4KJQC 1T66C 1A6UL 4IJ3B 5DHYB 1OTUD 4YHYC 1HHHA 4QHKI 2HG5A 4FG6C 1HKLL 3UYRL 1PBYA 3T77B 1X5AA 5DRWA 3MOBL 3TCLB 3EYSL 4HS3B 5DS8B 1UH4A 1ERNA 1IARB 5KOVC 3AFLA 1I7UA 1LE5B 4IDLA 1E6OL 5DJ6B 2OXGA 2VJXA 4QRRB 4ZSOB 4PJCE 4QHNA 3DTXA 3KR3L 2OQJA 2V2WB 4EI5A 4HPOH 2DN7A 2X89D 5IROA 3FO1A 4YBHA 1V7ML 2AEQH 1T1XB 5KBNC 3MCLL 1I9IH 4W6WB 4TN9A 4UU9B 3L7FB 4KTYA 5BVJA 4ZOCA 3ESUF 3I3EA 5E2WL 4M6OL 5D1XD 5FM8A 1OLLA 3NPSC 3NABH 1JHKH 2ERJB 3HG1B 1T0NA 5FHBH 2ZG2A 1KLFA 1DQLL 5ENWA 2F53B 4OF5A 4XMPH 3TA3B 3DGCR 3RBGA 1PY4A 1EO8H 1UB5A 4JFQA 3T08A 2DQDL 3ZE1F 2I27N 3WNOA 1JGVL 5K93A 5C6PB 1DBBH 3LKNA 1S5HA 3DETD 4AH2A 4XCCH 3WUWG 5TF0A 3O6FD 2YPLE 4KK6D 5I1IL 1B90A 4IIQC 5F93C 4M43L 3FN3A 3QQ4A 3QB7C 4QXTA 5EZLA 1EFXB 4NRXB 1BLNB 1S9XA 3QG6A 4H26B 4MHHG 3BISA 1TIUA 1C5BL 5SX4I 2HRPL 3TO2A 2Y25A 1A2YB 4BSWA 1RK1B 3MSPA 4DN3H 3PL6A 4NUGH 3L3HB 1XF4A 3GO1L 2VIRB 1VA9A 5JORA 1QLEL 1ZHLA 3W81A 2VIRA 4I3SH 3GRWA 3LKSB 2ZNXA 4J4PD 3WBDA 1DBBL 3ZYJA 5D7IE 3NACL 4GSDL 1PDKA 4NZDA 5E8NB 4JPVL 2OI9C 5KG9A 1LO0L 1NAMB 4N5UA 4PJAF 2HRLA 4WTZA 1YC7A 1AE6L 5IG7B 1INQB 2Q86A 4ZD3H 3MLTB 2BERA 5C8JA 3LRSA 3O0RL 4PJCA 2XWBB 2R4RL 2FSEB 4WFFD 4YHIB 1UA6L 3INUH 4HAGA 4N8CH 5HDLA 1U8NA 2NY0D 5C2BL 4JFQB 2W9LA 3QO1B 2VLRA 4HHAB 1L7TL 5E1HB 5CP7B 2JB5H 3KPMB 1F6AA 3FJTA 4JFYB 3BIAX 2BVEA 4NJAL 1T0NB 1IC1A 1NJ9A 3O41B 3D5OF 4WDIA 2PUQT 3LKPA 3MUHL 5KAQF 5E00A 4UU9A 2QQLH 4NPYB 1G0XA 2OL3A 4WFHE 1NC4A 3DVNB 2ZWLT 4FHBD 2PYED 5J3HC 3RQ3A 3VRIA 4GBXA 4N0UA 2VZSA 5IGXL 1UM6H 2MCPL 5AD0A 4B7IA 1Y6MR 1WWAX 3SGJC 4HZLB 3HE6B 1PW3A 2R39A 1ZVHA 1MFDH 1NGQL 1SYSA 3KPPA 1UQSB 5E2JA 3U82B 3EYVB 2X7LA 4JRXD 1HNGA 3SE3A 2AQ2A 1GGIH 4KV5F 1A7BA 4HMEA 1U8IB 3KPRD 1FFNA 3L3DA 1FDLL 3ARTA 3FHAA 3WNKA 2DQIH 2IANE 4MNQB 3FMGL 5CJXC 1TENA 4AEIL 1LEKA 1N2RA 3NCBB 3OR6B 2LU3A 5C0AA 4XNYH 1A3RL 5A2LH 1U41A 1FJ1B 1U0QA 1G9EA 4DGVL 2P8LA 1XR9B 2WUCL 1N4XL 1K3IA 4NT6B 1B0GB 4X99B 1AKJB 5DYOA 3SEPA 2DQUL 3HZVB 2B4CL 5K59F 4KDTC 3G6AB 4FZ8L 1ZLVK 3P9MA 4ZXBA 2VDLH 4IOFC 1V3JA 4LLUA 2YBRB 4JRYD 2GTWB 5HGHA 1ZA3A 2ZUWA 3FFDB 1IZKA 1PVHA 3TPUA 5CEYA 1QR1A 4OZIA 5DD1L 1HH9B 1HZHH 4X8JB 2A74A 2J4WL 1YZZA 4Y4KC 1AD9B 1Y6NR 1ZANL 1FO0B 3RL2B 1KC5L 4M5ZH 1GOHA 2Y9RT 4EEEA 2NTFB 1UM4H 4DKEH 5BS0D 3GJEA 3DRTB 5TE6H 3V6FA 4G8GB 4EI6A 4UOW1 5E6ZA 2FX9H 3PGDB 1CF8L 4Z78A 5L88H 1L7IH 1EEZB 4JN2A 5FV2A 3THMH 4YEEA 1D5IH 3AXLA 3IFNL 3LS4L 1OSZA 4ZFOL 5F3BA 4OLZL 1MJ8H 3NCYS 3GSWB 3ARDD 1F4YH 5IIEA 1BVKA 1KB9J 1ZT1A 2NY0B 1K9TA 3S3SA 4ELME 3UPRA 1KYOJ 5IR1B 4Y5XB 4XPGL 4HIIB 1RUPH 3SN6N 2P8PB 1YEJL 4JM2B 3ABZA 2DKSA 5JHLH 5B4MD 2YUWA 4PJ5D 4X4ZA 3UTOA 5DJXB 1RJLB 2W60B 2D4FA 2J1KA 4IMKC 2CXKA 4HMCA 3CU1A 4XRCA 2HH0L 2CDFB 1CXKA 1UM5H 3JUZA 4PP2A 3GK8H 4ZO7A 3RHWF 4FG6D 4DGYL 4GG8B 5FO9B 1WC7A 4FQXA 4BFEA 3CCHA 1A02N 5B3NA 5DWUL 3T0WA 4MSWA 4NNPL 5DEZA 5B3JE 4RQQB 4MJID 3K2UH 4P2QB 1JVKA 1NCWH 2V5MA 2ATPB 5I16B 5AWNH 5E9DD 3ET9F 3CPLB 3CFCH 3CX2A 1HI6B 5A2JH 3ILQD 2FIKB 3QP3A 4JO3H 5D1QB 1EGJA 4YXLH 5D1ZC 1GAFH 2DQFB 3I6LE 3RL1B 3TZVD 1LK3L 2PO6D 1F4WL 3VXMA 3VGDA 1EEZA 2FR4A 4I0PB 4QHKJ 1L0QA 4D9LL 3DIFA 3ULUF 1H9VA 2BY0A 5BS0A 4WO4C 3MGOA 3CLFL 3V6FB 2W9EH 4HIHA 3FMGH 2OL3L 2VAAA 3VU2A 1BX2A 3GMQA 5FKAA 2FGZA 4NQDE 1WAAF 4UTBL 5HGAB 2QQKH 4ODHH 1YJDC 4YQXH 4X6CA 5EU7E 1OAQL 1S8DB 2NLJB 2V7NB 1V3MA 3MRIB 1AD9A 4O2FA 3PP3K 3E2HC 4NN7C 5I73C 4DWHA 4OZIB 4QLRA 1ETZA 2YK1H 2IQAB 4OV6F 3UTTD 4JRYA 2UWEE 4HS6B 3EO0B 3OX8A 2XQBL 2VISB 3BUYA 3BD4A 3H9HB 4OUUA 4X98A 4ONHA 4XNXH 1X5FA 5IT2H 1HEZB 4ENEC 1YPZE 3EKCA 4P5MB 2ZSVB 3E3QE 2XTJB 3S88H 1FBIL 3D18A 4G42A 4O2CA 2P5EA 4KHTH 5DVKA 1YPZB 2G75B 1G7JB 3RVXC 2XG4A 3E0GA 5DD1H 2PCPA 3S88L 5HPMB 3HC0A 3GSNA 1FE8L 4J3VA 3FQRA 5I8OH 1DQML 5BW7C 3ZSSA 4PP1C 2CGRL 4EZMA 4L3EA 1A1MA 1M05A 1FLRH 2FYYB 4L3ED 4R0LA 3WFCH 4U6XB 2B4CH 2PF6A 3GGWB 4KY1H 1BJ8A 2E7MA 1NGZB 1MCWW 2O5YH 5C0BE 4JB9H 1AXIB 4HJ0D 3KYOA 1SQ2N 1DUZA 3WFHA 4W4NA 3HNSH 1D3CA 2R2EA 5D2LA 2E27L 4I9WE 4OB5H 3VRLE 4OZIF 5D7JB 1IAKA 3TYFA 3V52L 4IMKA 1XFPA 3L95A 1IBGL 3H9SA 1PZUB 3FO9B 4JM2C 4ZDHA 4CBPA 1M7XA 4CW1A 5FXCH 1MEXL 2H9GA 4ODBD 3PJSB 3RY6A 1REIA 3QAZB 1AXSB 5EPMA 1T7ZA 4F15B 1ZHBA 4MQSB 1S9YA 4JFOB 1UZ6F 1TTGA 3ZDZE 1QQDB 3TGXA 4TTDC 5HHNA 1YEDA 3KPMA 1I9RH 2LV4A 1XF5A 1G7QB 3ELAT 5J12C 4F7MA 1MCPH 4OFYA 4P2QE 1KYOK 1EMTH 3SDXE 4G6FD 1KCVH 4HUVA 4KRPB 3C2AH 4I77L 3S36L 3C5SA 3PP4L 4LCYB 3BN9C 4YHIA 1HSAA 3F5WB 1A4JB 5BOPA 5IMMB 4I0PD 4U1MA 2R0ZL 2BY2A 3QUYC 3MLRH 1NEUA 2BJML 4HGKC 1MY5A 5CEZL 2QHRH 4Q9CA 3I84A 1T3FB 4HV8B 1A7PL 1AP2B 3H9YA 1MVUB 2C1OB 3QXAB 3MROB 4ZOBA 3SDXF 5SX5K 1EHXA 1J8HD 3PL6D 1QD0A 4ODTL 4OIAA 5JORB 5EBLA 5ESAA 5AAWA 2ZCLL 3EUUA 4RISH 3EJZC 1B6DA 1A2YA 5DLMH 4BSWB 1YEIL 3MXWL 2LE9A 3HE7C 3M17A 4JG0H 1MJUL 1FVEB 3I3DA 3BZ4B 3QA3B 4FQLL 3RY4A 4MA1C 2GUOA 3EYQC 2OK0H 1Z3GH 5DMKB 5D9SA 4BH7A 2G5RA 2WW8A 3QFJA 3RTQD 1M1SA 4PG9B 5EOTB 5CJOH 4GXVL 5KN5A 1S9VA 5CGTA 5GGTA 2PW1A 1LDPH 2XOTA 2J8UB 4PJEB 5DK2B 1C5BH 4JG1L 3MRPB 1KTRL 3R0MA 3WEXB 2GT9A 4UOJA 3ARDB 1IAMA 3DUSA 3MFFA 4Z7WF 3BP6A 3HAEG 2JKXA 5C0GB 1PKQE 1BWMA 3VFNB 4FQCL 3GB7A 1UEMA 1EDQA 3MCG1 1FVCB 1ODAA 4M7LH 5AUMA 5KVGH 1VFBA 3SPVB 2WIIA 4NKDB 4OZHF 5J6HB 4XBEH 2OQJB 3DETC 3VFSB 2Y1VA 1D5ZA 1K5NB 4ZXBC 2R1YA 3VG9B 2NY4B 4KUZH 5IVZA 2AQ3A 3VFWB 3BSZL 3VFTB 4CJ0A 2XRAH 1VCAA 5F9WB 4LSPH 3QWOB 1MFAH 4MB5A 4N68A 3W0WD 3BKCL 3FQTB 3Q3GA 4WUUA 4E0RB 3LKQB 1T1WA 5L9DL 4KK5C 4HDIA 1K8DB 3GMRA 1TMCB 1A4KA 1SY6A 3IXAA 1GC1C 2YWZA 5T1LA 3WNMA 5JPMA 1T1ZA 5GHWL 5C71A 1NC2A 1R3JB 3QIWC 2B2XL 1BQSA 5D71H 3HR6A 2OI9B 4V1DE 3NZ8B 1ZGLM 3GHBL 4QGTA 2YR3A 1B6UA 4G7VH 3NIDE 1QO3A 1AHWB 4FQHB 4ZUWB 5D72H 2EKSB 3FQWA 4EN3C 5D5MA 1EJOH 2ARWA 4M61B 3MV9B 2IBZX 3T0EB 2UZYB 1Q9WB 4ZTPL 1I3GH 5DD5L 4NDMA 4Z8FH 3ARED 3MV7B 2DDQL 3BPCB 5CBAB 5DD3H 2HVJB 5I2IB 1QO3B 3SGEH 2VLKD 1FN4B 5JW4R 5DEGA 3PV6B 3QULA 2M8XA 5GSVA 1S7VA 2FEDC 2BCKA 1P2CB 4J3UA 3O3EB 2VABB 5DMJB 1C5DA 3SJVE 1T4KB 1PG7W 4FN0A 4LSPL 3V8CA 1MJ7H 2FX8H 3L3OA 3X3GL 4ONOA 2VDNL 5DMIH 4UILH 3FL7A 2I9LA 1R3HB 4RIRB 1I9RL 5L2KE 2ZCKL 4UBDC 2PYEB 4YXKL 3B2VL 2WLYA 4NGHL 5D96B 3NH7H 3RWGB 3P2TA 3M07A 4ZODA 1AGCB 3D39E 5J1AA 4LRNL 3QUYA 2VERN 4NUGL 1P4LB 2R1YB 2XWTA 1BQLH 1MNUH 3MNVA 5GGRB 5MI0B 2M2DA 4Z8FL 3ZYZA 1NMBL 4P5TB 5HGDB 1WLHA 1XH3B 4WFED 2CRIA 2EEBA 1HINH 3ZHDA 2NZ9C 3I75A 4I0KA 3DVGB 5IMOA 3DX7A 3RNKB 1G6RA 1LE9B 1ZTXL 3B4NA 1DN0A 4ZFZB 4GMSH 3DPBA 1FZMB 4FQ1H 1U6AH 1YMMD 2XYCA 1EK3A 3E6FB 4JFEA 3UJTL 4G9DB 5CSZA 4G6AC 1LO4H 2IADB 3A0OA 3MRPA 4APQC 3X3FH 4L5FH 5JXAH 1IC7H 4DEPB 2I07B 2IQ9L 1BFOA 1FL5B 4N0CC 4M1CD 3MGTA 1BEYL 4EOWL 3TWCH 5JOFB 2GQHA 2QQNL 4R96A 5DMGD 3ZDYE 5T3XE 4KKLC 1KLUA 2VR5A 5KS9B 2ESVB 1CE1L 4N8VG 5HBBA 4ZO9A 2VH5L 1OARH 4G43B 1X4YA 4X9FA 4YO0B 3U4EA 2FATH 2GAZA 5I1JL 3MJ8B 3IJYA 3LSOB 4F3FA 2ZSWA 3CH1A 3D0LB 4Y1AD 1OP9A 5B8CB 2FD6H 4YC2C 5C0RH 3MPCA 2C1OA 5HD8D 3VXNA 1T04B 1UXWA 4RISL 4XC1L 3EO9H 4ZAKD 5DJDA 1QSEE 3U6RB 2XA8L 4LLYA 3QFDA 5HXMA 4JLRB 3QIWB 3U4BH 4JDTL 3ARGA 3D69B 2YMXH 3B2UD 3UX9B 2VSCA 1I75A 3KNBA 5DDHB 3CSBA 1HSAB 2H6PA 5DQJA 1KT2B 4LCYA 3QEGH 4PRPB 1OAQH 1GOFA 4R6UA 5D1XB 5IVNA 3VFVA 3T3PE 5D7IF 3QEQE 4G5ZL 2VUOA 4POZD 3UTQB 3WIHH 4YEFA 5CD5D 4XVJL 3HUJA 4LKCB 3OJ2C 3PP4H 1UH2A 4XCFL 5L8LB 5FV1L 1B3JA 3GSRB 2DM2A 5KSBB 5LQBH 3SJVB 5TPWL 2WANA 1VHPA 5D7SH 2QADC 5TF1H 1KSRA 4CADA 5GS2H 4LQ1A 2NY6D 2KUTA 4I5BA 4I13B 4X6CF 2E7BA 1K4DA 3HCVA 3DMMC 3JWOL 4DJMA 1IL1B 5DRNB 5HVGB 1F11B 1XGRA 1U91A 2XA3A 3R0NA 3UC0L 4L8BB 4NNYA 1BAFH 5IJVA 5GRUH 2RB8A 1IE5A 2PO6C 5KVFH 1J10A 1KJ2L 3ORJA 4NWUH 4K7PX 3KPRA 2EDKA 3VE0B 1A7QH 1F45A 4PJDA 2NCMA 5GGUB 4A2MA 2QKIB 1FFRA 1JNHB 3BPNB 3PQYA 3U4AA 1F42A 1UM5L 2E27H 3EFDL 4IIQA 3FTGB 3EZ8A 5D70H 4N0YL 4HGWB 1A7QL 43CAA 4HFUL 4D0BA 1DBJH 2MHAA 4OLYL 1OGTB 4CNIA 1SJHA 2HT4D 4QXUL 5JHDA 3BKYH 4TUJB 3WNNA 1CF8H 4N0FA 2FZ3B 4K94H 4XVTH 4Z7UF 5GGUA 1Q1JH 2AGJH 3V7MA 5SX4H 5HVHC 4NFBA 1YPZA 1MRCL 5D8JL 4JZJB 3SKNB 1CQYA 4RGMB 4OLUL 5JQ6L 5C07A 1ZT7A 5TGBA 1S9WB 4U7KA 2AJUL 1N59A 2DQHL 5KSUB 1S3KH 3SGKA 1U91B 2V9TA 4OAWA 4GG6E 4Y2DC 5F1KC 3EO0A 4H0HB 2W9EL 3P4OA 1G6RL 1UKTA 3G5VA 3MRGA 4XI5C 3JV0A 3OAYK 1I4FA 4O5LH 3O45B 2YD5A 4C59B 1EAPB 1ZGLB 5GS2D 1J86A 5SWZE 3MRMB 1P9MA 4PRIB 3SDCA 5KVFL 5IF0A 1TETL 5C0RL 2BNQD 3BKMH 4JKWA 2V17L 1S7TA 1PY9A 2R8SH 5L6YH 4FFVC 1CIDA 1ADQA 3GMQB 5FKAB 5AWNL 1J88A 1H3GA 4G6JH 1FC1A 5E9DA 4Y88A 3IJHA 3RGVB 4W70A 4JREB 4H0GA 5FOJA 4Z7NF 2X4RA 4H0IA 4PJ8B 4PTTA 2EE3A 2UUDK 1OWRM 5I1EH 1Q72H 1W8NA 2O5XH 5DO2C 1T20A 2P7TA 2QQNH 4P2RA 1JN6B 4QF1A 2FIKA 5FA4A 5EIVA 3OSKA 3O6KL 4JFXB 1D6VL 2WIMA 4IOIA 4M6MH 3RUGF 5CWSA 3V4VL 4KMTH 1A3LL 4JE4B 1EZVX 2UY7A 1CLZH 1I9EA 2FWOB 3BGFC 5J89A 4LCWB 3WE6B 1RUPL 3STBA 1QBLL 4JLRA 4ERSL 3QUMH 1LP9E 5TE4H 5IW1A 3FT2A 5B8CA 1FSKC 3MO1B 5IQ7H 3VH8G 4HKJA 1TVDA 1UM6L 3IDJB 5FB8A 4ELMA 3PDOA 5EU3A 1GZQA 2BY1A 1YEGL 1A6PA 3O3DB 4CN1A 3Q5OA 5D7LA 2HP4A 2VLJB 4S1DD 3D87B 1TJHL 4R96B 5CS7A 1RPQA 5IIEB 4OI7A 1T5WA 4D0CA 1OSZB 1R6VA 3BO8A 4M5YH 3W2DH 2DD8H 1NEZG 35C8H 3PWPA 4NQEB 5TFSH 4X7FC 3D48R 1C16A 5GGRY 5DMIL 3LKRA 4TSBL 3DLQR 3JTSB 5CSZB 1J1PL 2W0LA 5DHVA 3H3BC 1I8MA 4KPHL 4PBXA 4O9HH 2NZIA 3CNKA 2XXMB 3S97C 3U0TB 1EEUA 1G9NL 1K6QL 4WW2C 3ARBC 1CDCA 2ZOLA 4PJ7E 4WFHD 3C8KB 1D5XA 3VRLF 4XPBL 4ZQKB 4TNVF 1NCUA 1R5WA 3OF6D 2KKQA 3HMXL 2ITDA 3BDYL 5HHOA 1FFPB 1JI2A 4OCLC 3ZYOA 4NQXB 5ISZB 3CFIC 3ARGC 1JF1B 1HYRC 4GMSL 3EOYG 4UILL 1CXHA 4PJXF 1AGCA 2GFBB 4I8DA 4MCYA 1JGLH 4X99A 5DYOB 5F97E 5FHAH 1JF5A 1N64L 4NT6A 3ARDC 4XTRC 3HTLX 4XWGH 3BP4A 2L7JA 3ZE1E 3ARPA 4N8VB 1CXIA 1HQRB 2AXJA 4G8IB 3RHWK 1PQZB 4F7CA 1SM3L 4TSCL 1EVUA 1LEKB 4HWZB 5ACLA 1HKFA 4ETYA 5C6TL 2XTJE 5DUBA 3JSSA 2CMRL 2BSTA 3TFKC 1WFUA 3DOSA 4M62L 4F37K 1VB9A 4MA7H 2ZP0T 1N0XL 3NN8A 15C8H 1MFNA 5T1MB 2OZ4H 1UADC 4R2GB 4XCYB 5C86A 3MOQA 5I1LA 4PJFA 3FFCB 3WNPA 3IFOB 4JY4A 2DQGL 2ZG3A 4K2UH 4MCZA 3WDIA 1NCAL 4O2EB 3MV9A 1G1YA 1RZ7H 5DD0L 3RWJB 1UWGL 5B4MC 5CBEB 1I7ZA 2CXGA 2AEQL 4PGDA 4L1HA 4GBXB 4N0UB 1QLFA 2VLMD 2JB5L 2KPNA 5EIQA 2DF3A 5C0DB 1XGTA 3EZJB 4KROB 1I7TA 1JRHI 2AXGB 5ISZD 1G9NC 5IBLD 2R2BB 1OAXH 2YKLL 4ISVB 4IRJC 1S7SB 4XP5H 1CT8B 2Y4SA 3VXME 1RZJL 2Y72A 4X7TA 1G7IB 4QCIA 3FQTA 2C3XA 4M9OA 4PJCF 3KYKL 2ZOKB 4GKSB 2DMKA 2VN4A 4MAUH 2HTLC 4YHOH 1ZXQA 3MV8B 1CG9B 4J6RL 4Y19E 3IS1X 4XNMB 1SHMA 2VKWA 1MCEA 5I17B 1MFDL 2W92A 4G9FA 2ATKA 1M6OB 4GKOA 2JE8A 1PEWA 4RGOH 4MXVE 2E9WA 5T33L 1JZ7A 2DLFL 4PY8J 1ONQA 5JIKA 5LWYL 3BKJL 5AUMB 1QNZH 2Z91A 3D39B 1H3XA 3ZKMC 1KGCE 1RUQL 3ULVD 5CZXD 1LO2H 4EUPB 3NFSH 4LLVA 1GIGH 2FJGA 2NY5C 5B39G 2OYPA 5HY9B 1P4BH 5IUSA 3QEUB 2A83B 1T89A 5I71B 4Q0XH 2HJLA 1SVZA 3DUUB 5IKCA 4F7EB 5EOCL 1FNGA 2H2SD 3REVA 3PDDA 2Y5TB 5C0CA 4CN6A 4BQ9A 2O61B 3FRPG 1EFXA 2A9NL 4NRXA 1U92B 5GGVL 1VACB 5D9SB 4BH7B 2IMNA 3VXUB 4X7SL 4AH2B 2MKWA 3NABL 1JUFB 1DFBH 4Z76A 4FNLL 1W72A 4NCC1 4CMHB 4P23B 3C60C 4GW4B 3AB0B 2P5WE 1Q9KA 5ESAB 2LVEA 3N1MC 5HHME 2F53A 4LCIL 4OIIH 1XZ0A 1I3RA 1CFVL 1KB5B 4HUXB 4AIOA 3X13B 4Y4FB 4IRSB 4MQXC 4YBQC 3SKOB 3EYSH 4MQTB 3IAPA 3VFOA 2VZVA 3X12A 2SEBB 1BZ7A 3FRPA 3BT2L 2VDQL 4Q9QH 4LF3A 3QDAA 3BIKB 2R4SL 3FB7A 1H3VA 4JY5H 1FO0L 4XP6L 3QDGE 1NCCL 2ILLA 4MNHA 4WHYG 3GBLA 4LHUA 1MPAH 4BQ6A 5DVNA 4HCRA 3I6KA 4KQ4H 1IEAB 3QUZA 5JPNA 2ADFH 3VXRE 5LCVH 1PX4A 4L8SB 4AM0B 1N6VA 1YMHA 1X7QA 5IFAL 4L29A 2UWEA 4J6RH 1IAIL 1LO3H 3MOAH 4K9EH 4CU6A 1F6FB 5DQ9B 1ZHBB 5FUZH 5E94B 1DQQA 3PNWA 2DLEA 1I7TB 3NZHH 4XPTL 2ZKHH 1Y0LA 3UTPD 4HK3J 1AXSA 4D2NA 4LCWE 3ULVL 1EO7A 1DLFH 2R9HD 4URTB 3RVTC 2V2XA 5GGTL 4EKXA 1QLFB 2F53E 4LNRA 3PIQA 4HKBB 4Y8DC 4BFIA 3HPLA 1AQDB 3H9SB 1CXFA 3EYUH 5JDSB 3WFZA 3HLAA 2ED7A 4P2OA 3IDMA 4HLZH 1XCTB 3TEUA 5HHVL 3MLSH 1IAKB 1RZKL 1BD2A 1SM3H 2JCCE 3FFCA 4XCYA 2V9RA 1KBGL 4NN5B 4XCNA 5GRWA 3H9SD 5C9JA 1U8HA 1MHHA 4NUJB 1W0WA 4PJFE 2VLJE 2AJ3B 4D9RE 3V5DA 1GCFA 3SHSA 2XQYK 3I85A 4XPHH 3VXRA 4I18B 4FZEH 1MHCA 2EC9U 4HUWA 5AZ2L 3L5HA 1A1MB 4JFFD 2XWJB 4PTUA 5J13B 4OD1L 3VFUA 1U8MB 4LK4A 2IPTL 4RX4A 3TJEH 4UMGA 1WBZA 4L9LA 1BGXL 5I74B 4WO4B 5GGVY 2X4OA 4P57A 2GIYA 2EIZA 2QSCH 4LKXA 1GAFL 4M00A 3VMOA 2OSLA 3SDXB 4ETQB 1CICA 5CLTA 1WZMA 1TQBB 2EXWC 3V0AC 1E6JL 1S7QA 5C09B 1CWVA 3SDCC 3QCVL 3V4PL 4R4BB 1LP9F 1QSFD 5F7EH 5HYSA 4PG2A 4YK4B 4TSBH 3F7RA 3QO0A 4PB9H 3P9LB 4FP8H 4HS6A 5ANMB 1AR2A 4YZFF 4B0MM 4X6BB 5A2KH 5F7HA 1FVDA 3RDTB 4RFNB 4Z5RB 3WHE0 4OT1H 1QEWB 2UYLB 2P24B 3IDYB 5ABDE 2XKNB 3GZKA 3UJJH 1YMMB 2UZIL 4UB0H 3QIUD 4PRNB 1K2DB 2DLHA 1CL7L 5I1AB 5IV2B 5K59E 4LVNB 1MCBA 3NFNB 2FJFB 3MRHB 4XPAL 5EO1B 3G5YB 4ZPTB 3U0PA 5L7XL 1KN2L 1AC0A 1WICA 2WBJC 2DI7A 2R69H 1E4XL 3OAZH 5FDYA 2DJSA 4BSJA 1PX3A 1TPXB 1IBGH 2NY6C 2A6JA 2D03H 3QIWD 5FGRA 4PJAA 1JZ4A 1R5IA 1JGLL 4WFGE 5EU6D 3UTZA 1J18A 1AR1D 3JWNC 3L3IB 3WDHA 4DGYH 5JW4M 4GRLC 5DHXB 3S37X 1NDMB 1DVFC 5TDPB 4Y1AB 4EN3D 3VWKD 4ONFH 2J8UF 4KK5D 3K81A 5LQBL 2D4DA 1WC7B 4FQXB 3W11D 2AXHA 3V52H 1RJCA 5GS0C 2H41A 5CINH 1M7IB 3DBXB 5B38G 2NR6D 1TTUA 2EYRB 5IESL 2J88H 3RWHB 4ZPTA 3U0PB 2J5LB 3TT3H 3O3BA 1J12A 3FOMB 4PD4J 4U4BA 1RJLA 3CD4A 3S6CA 3BWUC 4LLQA 4HWBH 1N7MH 3EDJA 4QHUA 3GSUA 1CGVA 1QEWA 2EDRA 4JQXA 4LSQH 4OGZA 5EUOA 2AVGA 4MJ5A 2JK5A 4GLRH 1YEKH 5IR1A 4PJ7A 5DFVD 4ZOAA 3NFPA 3GSWA 1K8IB 1FIGH 4WI9A 1A3LH 3RZWA 2O5ZL 3C5ZC 4OLYH 1E0OB 1GZPB 3C6SB 5E0QA 5JXED 3I6GB 1CFQB 3OTTA 4HXAL 1P4IH 3PHOB 1FZJB 4P23D 3QBTB 1D9KB 3CDGB 1A22B 4HMDA 3KPTA 3MBEA 3KLSA 3KLHC 4PRDA 5FGSA 2AEPH 2X44D 4HIJA 4BFGA 1RUAH 3TBWA 3OKOB 4OLUH 5JQ6H 1WBYA 5AEAA 2IPKA 3THML 4PS4L 2XNAA 2A74B 4JGUA 3IJSB 1OM3L 2UUDH 5BOZG 1ZGLA 3S4SA 4R3SB 4TOYL 3RWDB 1PEZA 3GBML 2G2RA 3G04B 3OKKA 4JY6B 5SWSB 7CGTA 1ZA3B 4JVPA 3BUTA 4PUBH 3QI9C 1C5CL 4L4JA 5KSUA 4DN4H 2AJ3A 4K3JH 5BZWA 1EHLH 2GJZB 1KC5H 4M5ZL 1JYWA 2WUCH 3O3AA 4O5LL 1HYSD 4EDWL 1QSVA 2GK0B 4MJIA 2AEWA 1YEEL 3BAEL 4IS6B 1QFWH 4W6XB 1CFSA 4NC2B 5EZJA 2AJXL 4N0FB 2VAJA 4Q6IB 1FLTX 4MAYB 3O6LH 3TNMB 4L4VA 1IGTA 4PJXA 3IYLW 5I1EL 2C3GA 5DJYA 5I1CL 2VDML 2JELL 1WJ3A 4OCYL 4NO2A 5ITBH 1TJIL 3B9DA 5L2KB 5I8KH 1S7WB 4X9IA 2EYSB 4QOKD 3OAUH 3TNMA 4F7TB 3CDFA 1NCWL 4GXUM 1CQKA 1V5JA 4LVNC 3MV9D 1OAZH 4LSTH 1LP9A 3KYAA 4XXCC 2CR3A 1JBJA 3BKML 3OKDB 5KSBE 2IC2A 1Z5LB 5JHLL 5EO0B 5E56A 1G7MB 4U31A 3KXFD 1FZKB 4Y89A 3EOTL 5A2IH 3DX6A 2OTUB 1B2WL 1ORQA 5MEOA 1J11A 1X4ZA 5CSGA 3ULUL 3I6KB 5JPNB 2KZ1B 3KLDA 4O51B 2AERT 1IGCL 2EEDA 3KPNA 4EN3A 3HI1A 4PJGE 1A7NL 5CEXA 1WCQA 4NNXA 2IPKB 1MRCH 2JF1A 3BIKA 3FB7B 3BT2H 4P49A 5F9WC 1S7RA 1IGFL 1D9KD 3EO1A 4JEGB 1OQXA 2P43B 3ZDXF 5HYJA 1J1OL 4D0DB 3SKOA 3CFKA 4POYA 5B3JF 5ID0A 2HJKB 5CZVL 2L0DA 5ESQB 3TFKD 3C6LA 4JFYA 3AMKA 3KLAB 3QNXA 3KYMB 1H0DA 4WTXA 2NTSP 4EUPH 1BECA 2MSPA 5D7SL 3FQUB 3GJFH 4Q6YA 3RP1A 3UBXB 1KF9B 2G60L 4P23A 3REWA 1BQHB 2BRRH 4XVUC 2D0GA 4LVOB 2B1HH 3RY6C 3IFLH 4QHUB 2XWBA 1U3YA 4CVWA 4X4XB 5DJCA 3SQOL 1QFWI 3TT1L 3BZFB 4FQ1L 5B39B 2XN9E 3MJ7A 5ICXA 2O61A 1KCKA 1RJYB 2UY6A 4R26H 4LASH 5IFHL 5F6HI 1IT9L 1QFUL 1HXYA 5C08D 3V9FA 5DA4A 4O02H 1JTOA 1PKQA 1XAUA 5CMAA 4X80L 4XNZB 3QEUA 4IRJB 5IHZA 5C1MB 2DAVA 5DSCA 4F37F 3OB0H 3H0TA 2FJGB 3ZSTA 3TO2B 1SYVB 3CX5J 4DKDC 2IG2L 2IANA 1K3ZA 1NLDL 2EDHA 4H1LB 5C3LD 4NGHH 4OKDA 2DB8A 1KFAL 2GEEA 3QI9B 3GNML 3VXTB 5FGCB 5ADOL 1AY1H 2BMKB 5MERB 1PYWB 4PLKC 3OGCA 1FL5A 2DQJH 2YPLD 4GH7B 1VADA 5ADOH 4PJ8D 2B1HL 5LXGL 4LLMA 5SX5H 1UYWH 3RPKA 1J0IA 3BKJH 5IV2A 2FEDD 3D6GA 3LEYH 5E1AB 3K1KC 3FN0H 5AG8A 1QBBA 2IQ9H 5DJZB 1RZJH 4XCCL 1X3DA 3BZDA 5HYSG 1T1YB 4XP1L 4XP9H 5EBMA 3AS0A 4L8CA 4WCYH 4O02L 4XBPA 4QOKA 1NL0L 4ZFZA 3RUGA 2PXYB 1IJ9A 4FQ2H 2Z8VC 3DVGA 3EJJX 4WJ5A 4DQOH 2YHGA 4KKCC 3ZTNH 1MJUH 3CVHA 2D31B 4ZTOH 1AD0B 5JO5B 4R4FL 4AEEA 2DBLL 1RMFL 5HHQA 2KDGA 1V7NH 1UCBL 1EA9C 1S7QB 5C09A 4PGDB 4HD9A 1TCRB 5I0DA 3BZEA 1LE5A 1NLDH 1NEZB 5I0ZA 4IHOB 2L4OA 2X4OB 3WIIH 2V7HB 2OZ4L 2WNGA 4MXQC 4J23A 4RRPG 3V4UH 3H9ZA 2CIIB 2JIXD 3NN8B 1WIPA 1CE6A 1HHGB 4K3HA 4MMZC 4PV9A 3B9KD 5BV7B 2YC1A 1INEL 3K7UA 2HLFD 2Z93A 1DDHA 5E6ID 4OZHE 4YBQD 3KPQB 3P4NA 32C2B 3VXRB 4I77H 2BCKB 1NFDB 1KCSL 2Q6WB 4NUJA 3QZWG 3PHQA 4G8IA 5C9JB 3WXVL 2Y36H 3VXQB 4AG4L 4XBEL 4Y16B 5EULV 1NAKL 1QNZL 1QACA 5D1QD 2C1PB 4M1CC 1VFAB 3ULUH 2Q3AA 1YNLL 3M45A 3IDMB 4MNGE 4PPTA 1MLCA 4LSRL 1U3HD 4P46C 1NMBH 5FUOH 4AIZB 2DJUA 4L8SC 4GKNB 3RVUD 3G08A 5DUMH 4RAVB 4LSUL 4NQVB 1JGVH 5HHOB 2E7HA 2OJEB 5GSRA 4TRPH 1CR9L 6FABL 3TJHD 4QT5A 1SJVA 4OCNC 3RAJH 2NY2C 2HVKA 3DVIA 1JGDA 1TJGH 5GJSH 5E1AA 3LIZL 1G7PA 3P40A 4MQXD 1IEAA 2DLTA 4KTDH 3N1GC 4XMPL 3H6JA 4FTVE 5GGQL 5JR1H 3I9GH 3PWPB 4NQEA 4BZ2H 5CLWA 1E28A 3MRRA 1ACZA 2AI0L 4R7DA 4U6HA 3MUGA 4E42A 1ZA6B 4JJ5B 3ARUA 2AK4E 4Y4KA 1YQVH 1PAMA 3OR7B 3QUXC 2VXSH 4P2RE 4KV5E 2D9CA 3SDAC 3ZMRA 4L4VD 1Y18A 4NQUA 3VA6A 2QHRL 5HDQL 5DSCB 4JQXC 1Z3GL 2PO6B 3TZVB 3DXAD 1FRGH 4UQ2B 5EORH 5EA0H 4P59H 1F58L 4P2CG 2X42A 1I8IB 2ARJA 1L0XA 1HXYB 2HFFA 2PW1B 4OF3A 4HXBL 1QFHA 1B4RA 1GL4B 3F62A 5HD8C 3QPQD 1XT5A 4LCWA 3BZFA 1ZT4A 3Q6GL 5D1ZA 4BKLA 2RFXA 1NMAH 4J4PA 4U6VL 4KAQH 2CDGB 5CWSB 1WQVT 3MQIA 4TPRH 3WFBL 2ORBH 3WJJA 5BVPL 1U2CA 4UTBH 4HUNB 5FIEA 4F7EA 4XXDB 4P2RB 4RFNC 2DQCL 3SE3C 4WW2A 5CD5C 3GIZL 5L8JB 2Q3ZA 2EDNA 1F4XL 2YD6A 3BD5A 4L8DB 3WHE1 1WF5A 5DURD 3TPKA 2ZPKL 5FYLD 1AP2A 4MNQD 1N26A 3FQNB 4WI4A 5HYQA 1EGJL 1NC4D 2CLRB 3RWIA 1VGKB 5IW6A 4R7DB 5IMMA 4NNXB 4G8GD 3B3IA 4X9BA 3UTTE 4F80A 5FKPA 5HSFA 4JFDD 3PWJA 3IETB 1CGTA 1Q94B 1YEHH 4PG2C 4G7YH 1ZT7B 3D0VA 5EO0A 4ZFGL 5F88B 3BEWA 5CCKL 1Z9MA 3OWEA 5HHOE 2BOCA 3ULUC 4RCAA 2AXGA 4GQ9L 5GSRB 3WLWD 2CRYA 2J88L 4WWID 4S11A 5FCUL 4XPAH 1XGTB 2GW5A 1T0PB 1OD9A 3VWKA 4Y5YC 2R1XA 5AYUH 5E99H 2YRPA 4NQDD 3HNSL 4FFVD 1YEFL 3AY4C 3V5HB 5L2KA 2I25N 4QRRE 5EC2A 1OLZA 3FO9A 4LL9A 3MRBB 4KY1L 3RWJA 1N0LA 3UDWC 3NA4A 5C70A 2WAHA 2DL2A 1P69B 4Q6IA 3BWAA 1JPTH 2QKIA 3PQYB 4PJDB 2CH8A 5D7JA 3ARFD 3HI5H 3GMLB 1AIFA 4X5WA 3F7VB 2DMCA 4J3SA 3BGMB 1PG7X 1RJZA 3IF1B 5DJ8B 3LH2H 4LHUD 1HK6A 4HF5L 1RIUH 4CVUA 2X1QA 1WAAA 1YY8A 2RCSH 3P4NB 4N1HB 5FM5M 4CU8A 2OLDA 3SDAB 4P2OC 1B4JL 3ARXA 3WS3B 1PQZA 4AL8H 1CD1B 4F7CB 2KQMA 4NBYB 4XI5D 3L9RB 3UTSE 1A47A 4YDVA 1DN2A 3GSNB 2NR6C 2J6EL 1V05A 1AJ7H 5J7CC 1YYLH 5DK0A 2JJUA 2IAMA 4KRPC 3DHJA 1CFQA 1CICD 2AEIT 5BO1H 3KAAA 3LY6A 4MA3A 3S37H 1MF2H 2OXHA 3ETBF 4X98B 4NZUH 4XMLL 4NCDA 1WTGT 3O2WH 4FTVD 4GKZA 5TF1L 2ITCA 1LWRA 3W39A 4AEIH 25C8H 4QOKB 3RUGB 2YA2A 4NZUL 4OZGB 5GXBB 3P11L 5IROC 5CD3A 9CGTA 1T7WA 3ARGB 4NQSB 5GGTH 1JJUA 4HKXA 5BO1L 3ZHKA 4HLZG 3ZTJG 2AS5M 4LLMB 2VLLA 2XFXB 4FQIH 5CSBA 3GI9L 2R8SL 1F4YL 4WUUE 5IK3B 2W07A 3PP3H 4QTHA 4RRPA 4YHKL 4QRPD 1MCNA 2VXTH 3AS2A 3BO8B 3T4AB 3LS5L 4LDEB 3RTQB 1KXQE 4P46D 2EDFA 1YY9C 3CH8A 3FAXA 4ORGB 3UXFA 3DHMA 2HMIC 4H1LA 1NDMA 4I48B 3AB0C