2P5ED

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
194
Chain Sequence
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLITPWQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 40
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD02
4GAGH 4OCRH 5KS9E 2HH0H 3V6FA 3W5MA 1RZFH 4EJ1C 1P7KA 2X1XR 4K3EL 2YZ8A 4ZFOA 3CMGA 1QVOB 1UM4L 5D2LA 3WMSA 4Z7WF 2G75A 4P23C 5HHOB 1E4KC 3QJHA 4JVWA 2A9ML 1KJ2B 4U0RB 1ITCA 3GUTB 1IGJB 3D2UA 3GMQA 2XNAB 5SWSA 2NY4B 5FOBB 2AJUL 4IDJH 1I7TA 1QVOA 4NNPL 3F12B 1N5AB 5DJAA 1MCIA 5DTFA 5I74C 1FVEB 2X44D 1HHIB 2A2QT 2B39A 2VAAA 3BPOC 1KTRL 3H9HB 2FYYB 5FM5O 4NZUH 1D9KA 3KYMA 3BEVB 4JDZA 2AVGA 3W9EA 2XXMB 4XGZA 4R4FL 3PWJA 5EO9B 3TZVD 2EDHA 2C1OB 3DIFA 3NACH 3P0VH 3QXDB 1FDLH 4UDUB 1KJVB 4KGLA 5FUZL 5C8JB 4F7EA 2VLKD 3PQYB 3KGRA 3O4LA 5DC4B 3NFPA 3OJDA 4DGYH 4HWBL 1X7QA 2VE6A 2N1KA 4JO2L 1TJGH 1CXEA 5FA3A 2P5WA 3VFVA 4JREC 1HHIA 4NFDA 1IGYB 3EOTH 1JHKH 5J12B 1CICD 1GGBH 4F7PB 4S1QL 2GSGB 2ZUSA 3PP3K 4X7SH 4M6NL 5EB9A 4YDKH 3B8SA 4WU5A 2KZWA 3C08L 4X6DE 3N1FC 2LE9A 4H88L 4M7KH 3RFZC 3G5YB 5KVDL 3OKDB 3ESVF 3L95A 3D18B 1NKOA 2NY3D 3MRPB 4GS7C 4R4NC 5DUBB 3QIUD 4FZEH 5D2LB 2Q7NA 3WBDA 2P24B 1OLLA 1ZA6A 4URTB 2A74A 3WO4B 4NKDA 4PPTA 4YHLL 5CBEB 4XBEL 5TQ2H 4TVSa 2IPKB 3RP1A 3LSOB 2I5YH 3JV4A 3DRTA 2WBJB 2CRMA 4D9QE 5FCUH 1YEFH 4JY6A 1MFAH 4GW1B 4ZTOH 3R0NA 1DL7H 4UIMA 1ZGLP 5I8OL 4WW2A 5B3JE 1K4DA 2R8SH 1OLZA 2FRGP 4X80L 1U8KA 5M7QA 3THMH 4M48L 4NDMA 2A9MH 4XC1L 1SYVB 5F3HA 4HK0B 5SV4A 5EOTB 5CJXC 5LGKA 4PRPD 3D39E 5F88B 1WWCA 4D9LL 2HG5B 1B3JA 3J8F7 3GO1L 1CVRA 3BN3B 2DQTL 4LBEA 3NAAL 1NBZA 4FQJH 1QNZL 1WSST 3LAFA 5BVJA 3RZCA 3WFBH 1RU9L 4YHNB 3BP7A 3V8CA 2ERJB 2DQIL 1FNLA 5E8EB 3HKFA 3BPNB 3IFNL 5DQ9A 3K1DA 3MRIA 4JO3H 1E4WH 1V8HA 3HUJF 3LD8C 2I9LA 3HNSH 1UGNA 4KVCH 4DEPB 1DQJA 2D31B 2W07A 3WL9A 5T3XE 4G7YH 4JKPL 3WFHA 5HHXL 4HDIA 5CIPB 2DL9A 1TVDA 1ZXQA 4QXUH 3CZFA 1Z6JT 3TO2B 1R24A 3HRZA 1KEGL 2WIIB 4JM2D 3GNMH 5F71A 3RIFK 1DVFA 3V6FB 2MKWA 2JK5A 4PY8I 4Z7OF 2ZZUT 4UTBH 1Q0XH 4JFOA 4QRTB 1XF2B 1Z5LA 5BRZB 3DRQB 4P9HC 4MAUL 1UM5H 3EYFA 1I9JL 4TVPL 5E8PA 1LDPH 2XTJC 1TZGH 3E6HA 4YO0A 4RGNB 2AJXL 1OB1B 1J8HE 4YHKL 3RWDB 4NM4H 4ZAKA 3RUGF 4F7TA 4S1RL 5IFAH 1F3RB 1FPTH 4U1HA 5J6GA 5GHWH 3P2TA 4U1NA 2E6JA 3RPKA 4IRSD 4PTTA 4K9EL 3CZJA 1IKNC 2IQ9H 1FG9C 2BZDA 3C5ZD 3QUZA 4OCSL 1ZOXA 1MPAH 1G7MB 1J11A 3PJSA 4RA0C 1A3RH 4M00A 3C8HA 4ISVB 3ARGB 2IEPA 2OQJA 3BYTA 2QV2A 4M48H 3GI9L 1WF5A 3TM6A 2KDGA 3S5LA 1MSPA 1AGFA 2R23B 4RMQA 4XNYH 3KPSD 1F4AA 2J1KA 2WANA 4L4VB 1EFXB 4ZUTB 3QZWB 5D6DA 1SYSB 4PJFE 4GW5B 4RWHA 3S37H 4NKOB 2MCPL 2HRLA 2ADGB 3LKNA 2NY5L 1E4XH 4OGYH 2NY3B 3KJ4B 1TTGA 3MX0A 1EXUB 4PBWD 3QZWA 4G80A 4J6RL 3ALWA 2EO1A 5D70H 5GGQL 5DJ8B 2NW2B 4YK4C 5C0NC 3PWNA 4PB9H 3VXMB 4EI6A 3QWOB 5DDHB 2CLZA 3QEUB 3M45A 1I9RH 4AEHH 4LCWA 3O9WD 3SPVB 3SDDA 1Y6MR 4F8TA 5T1KA 1U91A 1S7QA 2X4PB 5DK2B 1YMHA 1JHLL 4L29B 2O5ZL 3FQNB 1NCWL 5A16A 1T3FB 4LRIA 1KCSH 3E3QC 1EHXA 3OG4B 4LLWA 2EIZB 2MQ3A 1KIQA 4LNVA 1P7QA 3DVIA 4ELMF 2YKLH 1BVKA 2FO1A 2X70A 2DLFH 3VXMA 4UNVA 2DJSA 2IMNA 2XKNB 4ONGH 4P9ML 3UYPA 4MCYB 1D5IL 1T66D 3UBXB 3NBNA 4OB5H 3I9GH 3LOWA 2DLGA 4YIQB 2PF6A 3KJ6H 3QQ3B 4NO3B 2H3NA 4JJ5A 4WHYG 3PGFH 2BVQB 3A6OA 2BXYA 1RPQA 4GJTB 4OZFG 4OTXL 3ZDXE 2XRAL 2D7OA 1J7VR 1HQRA 5C0CA 5EORH 2VZTA 3MBED 4Y4HD 4NO0B 3VFUB 3RTQD 4DK3A 5HI3C 3RL2A 4G43A 3PHQB 1M7IB 3PG2A 3ZLQC 2DQJL 5F1OB 4OSUL 1LK2A 4TVPD 3P73B 5TDOB 3MODH 2Q86B 4P5MB 4P46B 1MJJA 5JPNB 2BNQB 3ZE2E 4PTTB 2VLJD 4GLRI 2X1OA 3U0TB 5DT1L 1DBJL 1E28A 3ARDA 4NT6B 4R8WH 3HA0A 3MLSH 5BW7A 3ULVL 1FZMB 4UUJB 5MP6H 3RHWK 4JRXE 3CSYA 4M93C 4OD3H 4ORGA 3SHSA 3BWUC 5GSVA 5AG9A 3PL6B 5L6YH 1B2WH 2XZAH 3M8OH 4EI5C 1T1ZA 3HC4L 2W9LA 1HH6B 4PRNA 3VU2A 1S5HB 4QRSA 1A9BB 1S5IH 2KUTA 5GSRB 4C56A 2LQRA 4NC1C 5BS0A 5EO9A 2X05A 4OAWB 2J8UA 1OGAA 1T20B 1WT5C 2Z0BA 4PP1C 5GZOC 3QHFH 4N8VG 1I1RA 2Z31C 2VAAB 1WZKA 5DUPL 2WBJA 2KPNA 4RAUB 3MLZH 2FX9L 4JFQA 5IB3A 3X13A 4MD5A 3ARGD 4G8IA 1ZMYA 3DSFL 5F1NB 4P5KA 3TIDA 1AGFB 1H0DB 5TQ0H 3MUGB 3L3KB 1I9IL 1JL8A 1AGCA 1SBSL 4XPAL 4XHJD 4ONGL 4DAGL 4H1LG 4V2BA 3FONA 2P5EB 1I1CA 3QEQE 3MLYL 1A7OH 3O3EA 4I3RH 4TN9A 5IW6B 5TFSL 1NBZB 4DVRL 5CSZA 1RIUH 1MCRA 4N90D 2JJUA 3ZDXF 3MRHB 3GMNA 4TSAH 5C9JA 4ELKA 2J6EA 4AEIH 3TBSA 4HIHA 3BZEA 2Z8SA 2FECL 3F6LA 2UZIL 5J9PB 5ITFB 4G3YH 3CFCH 3K8LA 4YNYA 2ICWB 5J0BA 2XWTB 4Q58C 5FOJA 4N0UB 1DBKH 2P47B 5F7FA 4GG8A 3OHXB 2N7BA 4FTVA 1DVFD 3ARFC 1I1FB 1VADA 5DMKA 1C5DA 3PP4H 3V5HA 3ULVE 3LQZB 3PWJB 2VISA 3QUMA 2VXUH 4DN4L 2F19L 1LE9A 2BX5A 1YEGL 4LGPB 1MY5A 1CFQB 2E7BA 3DX6A 4OD3L 3RPIB 3T65A 2CH8A 4XNUH 1QTYT 1QEWA 1VFMA 2H2PC 4XP9H 4OLZL 1ES0A 2MHAA 3MYZA 4NQSA 4MNQB 3VWJB 4I18A 3M8OL 3PWVA 1XIWD 3GIZH 3NZHL 5LBSL 1CI5A 5AUMA 5GRXG 2QSTA 1E6OH 1H3XA 3TJEL 4F33A 2E7LC 1PG7H 4YDVA 3CMOL 2YC1A 3P9LA 2HLAB 2CDEB 4BUHA 3B83A 2NYYC 2X4PA 4GAFB 3MLUL 3PE9A 5I75B 4B7LA 2MTPA 3MBEB 4GRLA 3TV3H 4Y4HB 4X9HA 3QDHA 3BD5A 1NGYB 4I4WB 3ARYA 4HG4J 2N7AA 1F11B 3W39B 3WXWH 1WZMA 3NA4A 3ZDZF 2XWBB 2GYSA 3KPMB 2E9BA 3P40A 3GK8L 2R29H 1VPOH 3WE6B 2LAGB 2VQ1B 3TN0A 5JLZA 1I9IH 5H2BB 2BNQD 4PJ7A 1BD2E 4JHZA 1NMCC 2EEAA 4PJBE 5EOCJ 3AB0B 4PRHB 2YA0A 3B9KD 5A2LH 5C0JA 5GS2D 1HEZB 3CFDB 4NNPH 1H3GA 1JRHI 3FB5A 1G6RL 3CVHB 4G6KL 3DTXB 2F8OA 3DWTA 4L1HA 1INEH 4YDJA 5DMJB 1NC4A 1JF6A 3GKWL 3MACL 3ARPA 3QUXC 2J5LC 3H2WA 4OZIA 1CXIA 2CRIA 3C60B 1MCEA 3MOAL 3MRFA 1FN4A 4EI5A 4PRAB 4U1JA 1KN2H 5EO0A 3RGVD 1T83A 2HP4A 4HMEA 1I3VA 4YDJB 2IG2L 3FMGH 3ARVA 3F7YA 2X9YA 3RQ3A 5DHVB 1IM3A 4GMTH 4Z7NE 2H6PA 2F54A 1HHJA 2A77L 1B88A 4U1NB 4UV7L 5D2NC 5IHUL 5JXEA 4HUXB 5KZCD 1NUDA 1EHAA 2WBWB 1TJGL 2V7HA 3ILQD 4K7FB 4MXWH 5DRZA 4XC1H 5CZKA 1J0KA 4GRWH 3SGDH 1A1MA 5ID0A 1T04B 4KDTC 3V0AC 2XWTA 4JG0L 1EJ6A 2WINB 4Y19D 2IADA 3TH3T 4IOSD 2FDBP 4X6DA 5I6XC 12E8H 4RGMC 3SDCD 5L7XL 5KW9H 5C0CB 1NCCL 1Z9LA 2P5EE 5DRNA 3QCVL 4X8XA 2P4AB 1RJLA 4K3HA 5B4MC 2YMXH 3IFNH 4XWGH 4UOW1 5CJQH 3ZHLA 3GSWB 3HMXA 5HDQL 4D0DA 3FRUA 4MNHB 4H1LB 4NNXB 5HVGB 1OM3H 1HWHB 3SDAB 1L4IA 1IBGL 3VXNA 1RK1A 4MXVF 4N1EA 1KEGH 1LVEA 4JQXA 4O51A 3Q3GB 4O9HH 4OFDA 1OOAA 1IAIL 5K9OA 5SWQB 3O3DB 5DURD 4FHBD 2RJMA 3TT3H 3L3IB 4XCCH 4EDXA 4L8SB 4BK4A 4MJ5A 1MI5B 4FFZH 1DN0B 1PY9A 4WNQA 1P7KB 3QUKA 5MENE 3S34L 3QQ4B 4Q9BA 2AJXH 2CMRH 3FO2A 1AR1D 3U9UB 3IGAB 3GSWA 3QDJE 3AUVA 1ZLWH 3WJJA 3WO4C 2SEBB 1RY7B 3S36H 4MNQD 1PYWA 2CDGA 4XCFH 3VWJD 3KLAB 2PO6D 3BWAA 1R5VA 4DQOL 5C6TL 3B8YA 1ZT7B 3CFKA 3KXFE 5ERWB 3RIAF 3DX8B 3GI9H 5E0QA 4FQ2L 4I0KA 1P1ZB 1CICA 5HPOA 3BKMH 3WKNA 1WFUA 5IBUG 2V9QA 2WINA 2APVA 3EO1B 1HQ4B 2EDEA 3GSUA 2BMKA 3UTTA 2CLRB 4QOKD 4ODTL 2VXVL 4LAJH 2CKNA 2ARJB 5FKAA 3GHBH 1T2JA 1QPPA 4Y5XA 1GVIA 3B5HA 2G60H 3MRMB 4WENB 3RL1A 4P5MA 3JWDH 1I3RA 4N5ED 2VL5A 2AXFB 3NH7H 3HE6D 1ZLUK 3OV6A 1DR9A 3MRFB 3BJLA 4KRPD 1U3YA 4KI5C 5HYJA 5KSUA 3RVXD 1MCCA 1Q9LB 4O00A 3WYRA 4ZUSA 4PRHD 3S97C 4OGYL 4M4PA 4RFOH 5FV1L 5TE6H 3PF2A 4MJIB 5IEKB 2HLFC 2O5XL 4LSUH 4P2RD 4GRMB 1NQBA 4EVNB 4TRPL 4HWEH 3OXRA 4UDTA 5GHWL 4RMWA 1KSRA 5IQ7H 1BFTA 1ZHNA 2B2XL 5BOZG 4LCCC 2YKLL 1MIEL 4UINH 3C60D 5JHDB 1HDMB 1K6QH 1ZLSL 5JLZB 1N6QL 4JZJA 3BP5B 4L1DA 3IKKA 2VLKE 3DLQR 5TDNB 3GIVA 1UXWA 3ETBF 1KLGB 2VDNH 4M6AA 1L6ZA 5JPMA 3KJ6L 4PTUB 1S78C 3TNNB 3FB6B 3T2QA 1EFQA 4JDZB 4CJ1A 1I4FA 1J8HD 2J2ZA 3K4DA 3ULUF 2WK2A 4JFFD 5FO8A 3U0WL 1ZEAL 3UTPD 2EDFA 3CH8A 2AJSH 2CMRL 3D3VA 2A73B 1YJDH 4BM7A 1ZT1A 5DJAB 2OM5A 3TT1H 3AM8C 3A67H 4R26H 1KTLA 2ZUQB 2Q86A 4XCNA 1IGTB 3ARDC 4Z78B 5ID1B 1JN6A 2W38A 5EUOA 3GMMB 1NDGB 3WS6A 4U1MA 4X5XB 3L6FA 1D6VH 4TOYL 1BQHA 4LCUA 3MLSL 3VRLF 4H1LA 1KPVA 3L3HA 5TF0A 5GISL 5EZIL 4KUZL 4NKOA 3QO1A 3SQOL 5MERB 5D9SA 4Z7QE 1SJEA 4XNMB 4OSUH 5B21A 4HD9A 4HH8A 4QRPB 1T03H 1V7MH 4FTVB 4UTAL 1ZGLM 2J88H 5DJYA 4KAQL 4GRWB 2JJVA 4HWBA 2O5ZH 2X5PA 1EAPA 4IJ3B 2D4FA 4IRSA 3R4DA 1R6VA 2NY2B 2OJZH 3LN5A 4DGIL 2QTEA 4PGBA 2VJXA 3SGEI 1IC1A 2YWZA 4UV4L 5ECJE 2OTPA 1FC2D 2OP4H 3KPRE 3CC5A 3EJYD 3LIZH 3NCEB 4XH2B 4LDLB 3P30L 2JCCB 2NXZD 2PO6B 1JZ6A 1Q0YH 5BJTB 1DDHA 4LNRA 1CIUA 4OGZA 4P4KD 5I2IB 2OSLB 5GRYA 4HGKC 4NRXB 2VR5A 3QEHB 2P24A 2UY6A 3ROLB 5B39A 4KTDH 2MCG1 3F7VB 1N6QH 3SKUD 1FO0H 3HC0A 2Z91B 1UKSA 1L0XA 3LKSA 4WWKA 3RGVA 3Q5YA 3FT3B 4QOKB 1S7WB 4XPTL 4GAYA 5FGBC 3P0YH 5FKPA 5E8PB 3JV6A 2XZQL 1UVQB 1FZOB 4O5LH 5EBLB 3FT4B 1EERB 1INQB 2RFXA 5MI0C 3P4NA 4E41A 3ARBA 4OGXH 3QZWG 4M3JA 3DI3B 1YJDL 2AJZB 1GCFA 4UQ3B 4PJDE 4POZD 4KRPB 3ZTNH 5EBWB 1TPXB 3S5LG 3LN9A 1PKQE 2P1YA 1M4KA 3MO1A 4G8FB 5F1SA 1A7OL 4G6JH 4KI1A 5IT2L 3SE4C 1N7ML 4TSBH 4HH9B 3TO4C 3BP6A 2XZAL 1U41A 1G0XA 1BF2A 4MJID 3R0MA 4HWBH 5EO1A 4OLXL 2C3VA 4DJMA 1S7VA 4P2RB 1T89A 4ZTPH 4GSDH 1WISA 1HOCB 2DKMA 1EO8H 1K8IB 1AE6L 3NA9L 1U8NB 1MI5A 1U8LA 4MLIA 1CLZL 2HT4C 3RVTC 1DBKL 3BGMB 4QYOB 1T03L 2ED8A 1I8IA 1XF3B 3P77A 4M03A 1SMOA 3NCBB 3OKNB 2L4OA 2P46B 4AENB 5IB4B 1M7IA 3WIHH 3VW3L 1CXKA 4QHNB 4J23A 4YHML 3ZHKA 4S10A 3UTSD 2P8MA 5BXFB 4UT6H 4JGUA 1JWMB 1WJ3A 1K8DA 4MD4B 1KTDA 1YPZE 3LSOA 3SGJA 1NFIA 5JW4Q 1BHGA 3MV9B 4ZUUB 4GKNB 1EAJA 4IOIA 4NQCD 2VDPL 4P3WA 1RZKH 5I15H 2OTWA 4HT1H 4WDIB 5L88H 4U6HA 3T0EE 5FA4A 1VPOL 1EEUA 2QL1A 3V5KA 1FL5B 4KTDL 3ZYIA 1L6XA 1W72L 4JKLA 4X7CC 4Z7VB 3CCHA 1ULVA 3SKMA 1FP5A 3OKNA 4Y89A 4PV8B 3IXTB 1DQJB 5T5FL 2B1AH 5CEXA 1XF4B 4HUXA 1R0AH 2IQAA 3ARFB 2P44B 2VB5A 2OBGA 3BAEL 3BKJL 1FSKB 3BGFC 5SWZB 5T1LB 3FQRA 3RIFF 1TTUA 2FO4A 5A2JH 5DD6B 3FFCE 3FO9B 1QA9B 1DEEA 1HCVA 2XI9A 1XR8A 1KJMA 4XNZC 4Y8AA 3VI3F 5I30H 1UCBH 2B0SH 2ITCB 1CFBA 3WFCL 4I2XE 4PJHA 2X4OB 4HS8L 2HKHL 4ZS6D 1FNEB 2FD6H 4OF7A 4FRWA 2QADB 1AH1A 1B0GA 4MD5B 5FYKL 4K7PX 4OBSA 5H37G 2W9EH 1QBAA 3DGGB 4G7VL 3W0WE 5C0JB 4RQQB 4OT1H 2R0LH 4KHXH 1OARH 4JN2B 2DJUA 4Z7VE 1XZ0B 4WW2C 1VKXA 4FQIL 3SE3A 3V0VB 1KIPA 1MUJB 1S7XA 3MV8A 1HCFX 3MLVH 1X6LA 5HY9A 3LEXA 3VG9C 4JFEB 1P7QD 2NY6D 2VQ1A 1AO7D 3TN0B 2OR8A 4WWKB 3IXAB 3GRWL 4DUVA 4R0LA 2DQGH 1QFWL 3DVGA 3U82B 5CD5C 1RULH 4U1LA 1EK3A 1OCWH 3U6RB 1N64L 5HGDA 5AYQA 1QBMH 1BQLH 2VL5B 5CJQL 5FHBH 1GJIA 4X5WA 1WIUA 4LF3B 5ESQA 5LCVL 1MCWW 3N9GL 1OM3L 4NN5B 43C9A 4MA3B 2H2SC 5I1KL 5F93C 4R6UA 1EO5A 3Q5TA 5CILH 4LLYB 3MPCA 2GUOB 4F2MB 4GG6A 2CO7B 4OD1H 2ZUXA 4TYUA 3QDJB 1MRFH 5ACZA 1I1AA 2NNAB 1N6VA 2IFFL 5CEZE 2B1AL 1HILB 3MV9A 4U1GC 2VABB 4YR6B 5DLMH 3QUMB 1LE9B 3H9SA 4HIIA 3G6DL 5CGTA 3WDHA 4PJIE 5C09D 4FP8H 2Y4SA 4V2CB 5JIHA 2VDLH 5KVMC 1JPTL 4JM2C 5LAXB 1D9KC 1OF2A 4GRLC 1CGVA 3B4NA 2RQ8A 3EYUL 3WD5L 3P0VL 5E6ID 4TUKL 1RSFA 3D39D 3G6AB 1BFOB 3IDMA 1QSEB 4G6AD 4Z78A 4Y0GA 2BHUA 4YLQT 2ZG3A 5JUEL 5JR1H 5T1DL 4PJ9A 4DUWA 3S7GA 3TBYA 4OCXH 5L7XH 2EDWA 4NQCB 3LKPA 5T1KB 3VGAC 2BSTA 3RJQB 5DMIL 1KACB 2C1PA 4M7ZB 4JHAL 1GGBL 4PJCF 3E6FB 3U1SH 3FZUC 4Z95L 4K7PH 1AGDA 3S36X 2GIYA 1X5AA 4NRYB 4IRSC 5A43C 2DQGL 4YC2C 3G6JA 5GJSL 1AQDB 5IMMB 2EC9T 1BEYH 3WHXB 4K3GA 4X7EC 2YWYA 2LVCA 5T1LD 1F13A 5GRZA 1KPRA 1OGAE 4OLYH 1NAMB 3RVUD 4TRPH 1F6AB 3N50A 4YZFE 4RFEA 3N06B 1WEJH 2H6PB 3IYLW 4EDWH 4P59H 1UACH 2GT9B 4EQ3A 2KQMA 4QCIA 5TH2B 1N59A 2JJTA 4CW1B 1KJ2L 5D1ZC 1YEFL 1DZBA 2YR3A 3I75A 5EUKB 5F7EH 2JJSA 4JPWL 4MD0B 5EA0L 5L9DH 3ARZA 5C07A 3FO0L 4ZUVA 2IAMA 25C8H 2QSQA 1WIOA 3DXAD 2OSLA 2YS4A 1HWGB 3PXJA 2AXFA 5DMGD 2QQQA 5AAWA 2PW1B 4D0CA 3MRMA 1Q38A 2X4QB 1NUNB 4YHYB 3GO1H 1VGEL 2NY0D 4QEGA 1HEZA 4JFED 1B4RA 2Y6SD 5DK0B 4JPVH 5BW7C 1KV3A 5IMLA 3TN0D 4U1HB 3ZSSA 5J6GB 3EFFB 4EN3B 5EPMA 1DUYB 3S88L 3WFBL 4IMKC 1BZ7A 1T0MB 2MNUA 2FLRT 5L6YL 1KC5L 1UJ3B 1LEGA 4F37F 4HF5H 4ESKA 2WZPD 2V7NA 4JRYA 5C70A 5IR1A 5H35B 3ZL4H 4H8WL 5GGRY 2C1OA 4YBLB 3OTTA 5FDWA 1QRNB 2QHLA 1R5WA 3V5DA 1OAYH 4PB0L 1JZ4A 4I4WA 1K8DB 3ZTJH 4FA8A 3RNQA 3NFNB 1U58A 2KBGA 4XNXL 1ERNA 1ACYH 5AYUH 5HYIA 4NQCA 5IIEA 4BKLB 4Y5VC 4JFZL 4KAQH 1GZPA 2X4TB 3O6FD 4MCYA 2CDEA 1FIGL 5C08B 2VXSL 4MNQE 4WNQB 5B3JF 1VGKB 4JHAH 1I9JH 3VXSE 2V2TA 3QDJD 2FJHB 1NAKH 3PWPB 3VFSA 1P2CA 3R8QA 1BFSA 1I8IB 1FORH 3IB4A 4ZQKA 5DR5L 1VEPA 3CPLB 4KUZH 5MEND 2ATKA 2NR6C 1P5UA 1DBML 4I3SL 4MNQA 4EBQL 3W0WB 3RZCC 4JM4H 3HCVA 4HMCA 5D7IF 1FBIL 2VDNL 1JWUB 1PSKH 2IH1B 4AMKH 2GFBB 5L0QB 4AQ1B 4KWUA 3BESR 4DVRH 5HHNB 2AEWA 2DMKA 1G6RA 4AT6B 4M7JL 1AQKH 1WQVT 2VERN 5JZ7D 5K9QI 3EYQD 4TSAL 5DRNB 3D39B 1VENA 2ZUQC 3QIBD 2NLJB 2DIBA 1QSED 2Q3ZA 1VEOA 4NIKB 4KDTA 5ACZB 1OAUL 2NNAA 1IILE 4DZBA 2GJ6D 3OSKA 4MJIE 5F9OL 2IAND 2DKSA 2K3TA 5EIQA 1DFBL 2C3XA 4UIMB 3MJ8A 2NQCA 2GUOA 5D72L 5ANME 4GG6B 4X9BA 1T5WA 2X1PA 3FT2B 5T5NG 4NKQB 1SY6L 3RNKA 3TYFA 3QI9A 3FRPA 1DSFH 1I7RB 3IT8D 2GY5A 3KR3L 5CMAA 1HXMA 3AFLA 3DVNB 1HI6A 3EO9L 4OGAD 1NLBL 1ZA6B 3NABL 5E70A 3MTRA 3E1F1 4JRXD 5FYKD 5CZXD 4U1JB 2CLVA 3NFSL 1RUKH 2FATH 3WIHA 5IFJB 2X42A 4LAQH 4FXKB 4PB9L 5F9AC 2VUYA 4AG4L 4UT9L 4LSTH 4NZRL 3ARWA 4IHOA 4ZTPL 4F3FB 1BM3L 2WIMA 4LVHB 2VOTA 5I76A 2V6HA 1AHWB 4N0YH 1CYGA 3VA6A 4FFVD 4OFPA 5ADPH 3AM8A 2ZJSH 4RZCA 4ZNCD 4YFLF 2KQNA 1VFBA 2AJYL 4JN2A 4XNXH 1YEHL 4XHJC 4Y5VA 2R4RH 4UU9A 5I6XB 3HMXH 4BFIA 4PG9B 4NBZB 2CK0H 5TE7L 3OAYK 2ZOKA 1Y0LB 1G7JA 1FNEA 3MJGX 5MEOA 3CFBB 1U42A 3K2UH 4FABL 1EO8L 1F11A 3UDWA 5A2KH 3MFGB 3E6FA 4EBQH 2YRZA 2GHWB 1SVCP 1BZQK 4NN7C 1D5MB 1WCQA 1WAAF 1S9XB 4WFGE 3MNWB 2RR3A 3P0YL 1NAMH 4ETYA 5FYLH 5E99H 1DN0A 2OLDA 4IM8A 4WW1A 2VYRE 4ZFFA 1FFNA 4NQEA 2CJUH 4L4TB 1H15B 2IF7A 5CEXB 1NGZA 1URLA 4U31A 3S3SA 4JAMA 2R69L 4HFUH 4P3CH 1TJIH 1RK1B 1PY4A 3HLAA 2I9TB 4JM2F 2FIKB 1AFVH 4Z7WE 4ZYKB 4D0DB 3LS4H 4GKNA 4JQVA 4IOIB 3WHE1 1JI2A 3O6FB 1XIWC 2H8PA 3WJLC 3WS3A 5C0RH 2FR4B 1H3PL 3KLSA 2W0LA 4OQTL 5FK9A 1DSFL 5CGYC 5DD1L 4J4PA 3GMOB 4HS8H 2JCCE 4XX1G 4XBPB 4QHNA 1I8MB 3QT2A 1QLEH 4KY1L 1MAMH 5KVEL 2Z8WC 3PGDA 3TVMC 1FE8H 4Y5YA 5F8QC 5FUCC 4XMPL 4P4KA 4UT9H 2AXGA 1BBJA 2VDQH 3MYJA 3JWNC 2F9BT 4ELMB 4KJWD 1GZQA 3GMNB 5HGAB 3VGDA 2Q8AL 5HYQB 1B6UA 4LLUA 2XT1B 4JQIH 1OAQH 1CDGA 1K8IA 1RZ7H 4XC3L 3QPQD 3CVIH 2FL5B 1JPFA 4LRIC 2BSRB 4KI5E 3QDGD 3NGBB 5D7IB 3AS2A 3D1MC 3O45A 4D8PA 5K9JL 3SJVB 4OZHA 5K9KA 4HAFA 3C2SA 4LSVL 4PJCE 4CNIB 2WM0A 3CFIC 1CL7I 5I15L 6FABH 3DETC 4WWID 4HZAA 1XGRA 4U1KA 5IMOB 3CVHA 3FL7A 2NPLX 1CE1L 2PYFA 1EV2E 3S4SG 1EBPA 3SCMC 3LMJH 4X7SL 2JIXA 4JQXC 4CVWA 1MUJA 1NFDF 5HYSB 3KPLA 4HFWB 1MFCH 3GRWH 5F7MC 3V4UL 5LKNA 4R3SA 1PX3A 3GSOA 3QRGH 3S36L 2J8UB 2EZ0D 2NY5C 1RIHL 3WEXB 4XBGA 2OJEB 2ZOLB 4LSRL 1T7ZA 2XN9A 1MQKH 2IBGA 4AEIL 2IFFH 3O2VH 3VWKA 1GC1L 4KKAC 5DYOA 3X3FH 3Q6GH 3ZT7A 2EDXA 4PRDA 4E5XA 1NBYA 4G3YL 5I1KH 3ECBA 5J56B 2YBRA 3WN5B 1WBZA 3IU3B 4ODHH 3VGEA 4E0RA 3PQYD 4ORGB 3VXRA 1JF1A 4LIQE 1HXMB 4BA8A 4OM1H 2HLAA 1OAXL 4M43H 4PJFA 5D71H 1PW3A 2EIBA 3RKPA 4Y16C 1CG9B 4HWZB 4JO1L 3C5ZB 1IC7L 4L8DB 2XV6B 4G7YL 4JKPH 3KYOA 5DLML 1FL5A 4L5FL 5DEGB 5DD5L 2DQTH 1CL7L 5HHVL 4ZO9A 1IEAA 1PG7W 3BDBA 5A2IH 4EZMA 4Y4FC 5CP3H 2NLJA 1B90A 1HQRB 2VLRE 1A3LL 1DN2A 4KQ4L 2QLVB 2HT3C 4RNRB 1XAUA 2Z31A 3CXDH 4Z7UA 4LHQB 1CGSL 2BHZA 2X2YA 3V6BR 3OB0H 4Y2DB 3V4VL 1GH7A 4BSVB 1NFKA 4KI5F 1MY7A 4JO4L 4P2OB 2EYSA 4OJFL 1YYML 5J57B 1AR1C 1UZ6E 3MRBB 5TDPB 5IB4A 4X5XA 1NMBL 5BOPA 5I1IH 3GSQA 1FCGA 2WWMC 3AS1A 2DD8H 3AAZB 4KK8D 4RAVA 3EUUA 5F21B 3CDGB 1F4WH 4R7DB 2Z92A 5DF0A 5E7BA 4NRZB 5I0ZA 1M7XA 1ZS8B 5ESQB 5HGHA 4UT7H 2ADJB 1T2XA 4P23A 5I1EL 3OKOB 4JPKH 2ZPKH 4S1SL 5IBTL 1RZGA 3QRGL 4R26L 2C26A 2BOCB 2VDML 4JHWH 5EU6A 4GH7B 25C8L 3IXAA 4PJGE 5TDNA 4PJ5A 3H9YA 5IFHL 1KLGA 3CFEB 2NW2A 1OTTC 2P5WE 3T0BA 3T08A 1FGVH 4DGVL 4PG9A 1MFDH 4BQCA 4F80A 3QO0A 3WUWB 3F7PC 3CSBA 5SWSD 3KPPB 2XXCB 4V1DE 5ICYB 4HK3J 3VGFA 3IJHB 3T3ME 5B3NA 3QDGB 4X99B 1FYTD 3ULUL 3T2OA 5I18H 4GMTL 5DD3L 1FZOA 1T0NB 1OAXH 4M43L 1TETL 1ZVSB 2X89A 3BEWB 3HMWL 4M8QA 4OLUH 4WEBH 1XGRB 3HB3D 5EZJB 4HJ0D 4DWHA 2H32H 3V52H 2P48B 4NO0D 4MQXD 3RTQB 1AKJA 5DUBA 1ND0B 3TPUA 3FQWB 4Z95H 1XEDA 1P7HL 1FYTE 1I3UA 3PJSB 3I50H 5HI4D 4EIZC 12E8L 5F6HJ 4X8JA 5IGXH 1Z9SA 3X14B 5EZJA 3DXAE 3K0WA 4NBXB 4FFYH 1FSKC 5TH2A 1A6UL 1KC5H 4NWTH 3CLFL 4LKCA 4OFVA 2FJGA 5J11C 3GDBA 1NL0L 1CDUA 1RZJC 4OM0H 1EEZB 1HH9A 1VERA 2DM7A 1NGPL 4X6BA 3G5ZB 3WXVL 5KSBF 1A9EA 3ZYOA 3TP4A 1NGWB 5DWUH 3GGWB 3IRZA 4IRSB 1U6AH 1IKFL 3STZA 1UQSB 1KJ2H 2R56H 4PFEA 5AWNH 3KPRB 2OTWB 4PJHF 1M05B 1SM3H 1OGAD 2IPUK 3BX7C 4RBPK 4PJ7F 1PSKL 1KJ3H 2AJVL 3E6HB 1R5IA 3H8NA 1AO7A 4O58L 4WUUA 3SKOB 1PKOA 2IANA 4PS4L 1UKQA 1NFDA 5C0IB 2A1WL 5D6CA 1CGXA 4XVUD 1NAKL 3D69A 3A6CH 3EYSH 4J4PD 4P23B 3GKZA 1QKZH 4LCUB 4NQVB 4PP2B 3H7BA 4YPJA 3UC0L 1PZUB 1JGEA 4PJBF 5D1ZA 3MCKA 3V2AR 3TBSB 4N1CA 4J3VA 1JGLH 4LVNB 3BSZH 1Z3GL 2UYLA 4KRLB 4O51B 2F5BH 4NQEB 4R4BB 1CDHA 2PYEA 1OSPL 3TBVB 2BY3A 1RK0A 3K8MA 4BKLA 1HHKA 4PLJC 1HYSD 1CIDA 3VRIA 5CP7A 1JTTA 3EDJA 2P45B 3M07A 4LBEB 1GPOH 4Z7OE 1I4FB 5CD3A 4QXGL 1V5JA 3O9WB 5HPMB 4PGEA 3IF1B 3T0XA 3CFBA 4HW6A 4P2YA 5FF6A 3VI3E 1FIGH 1QLRA 4JRYB 3WUZA 3U4BH 4NN7B 4RWYH 5JHDA 5I1CL 1A2YB 1H8OA 4LLDA 5D2LE 1YEIL 2CDFB 3ARUA 1OGTB 3L3JB 5J12C 1UENA 5EZLB 2E6QA 3BGFB 5KJRL 1JHTA 3H42L 1T5XA 3PWLA 1WFTA 5EBMB 2IAMD 4YHPA 4X98B 5IEKA 5F9DC 2WSKA 4XNZB 1FNHA 5FHAH 4J8RA 3STLA 3UCRA 2OCFD 1TFHA 1XIWA 3DSFH 4PJXE 4TUOA 3WJLA 5EO0B 2ED9A 4FXKA 4XXDB 4L3EA 4AH2A 5JHLL 3C9NB 3IETA 3UJIH 4XI5C 5DMYA 2AV7A 5T1MB 5HYSG 1J9CT 5AWNL 4POZC 4QHUA 1XIWB 2GCYA 4NQXB 3MC0A 3H9SD 2B4CH 1RAMA 3DTXA 4OZIF 2GT9A 3HMXL 3I6KB 4WTZA 3AREA 3P9WB 3BEWA 4UB0H 3JTTA 5MEPA 4PRPA 4M3KB 1PKQA 3SKNA 1D5ZB 3TA3C 2HTKD 3BP4B 1LO0H 4R96A 4P46D 5D93B 1LP9F 4YEEA 4LDEB 3WFDH 1N3NA 1XMWA 2ARWA 2Z4QA 2MPAH 4KMTH 4DFHA 2EXYD 4K3DL 5DGRA 4KMQA 2HN7A 4X4YA 4TNWK 2M26A 1IC4H 4JHBA 2IJ0C 1NAML 2W91A 3FOMA 3JV5A 5FO7B 4MAYA 5D7JA 5DVOA 5FB8B 3KLAA 4I0CC 15C8L 4YBQD 3L7EB 5DFTA 1YQ2A 2R1XA 1Z5LB 5DHVH 5BRZA 2GJ6E 1W0YT 5D7IA 1D9KB 2GFBA 1MREL 1I7ZB 3TBYB 4WI7A 3L5XH 3CFCL 1AXSA 1P9MA 1RUAL 4MJ5B 1MFBH 4Y4KA 1XF4A 4M9OA 4U0QB 1D5XA 1UXSB 1GZQB 4PJ8B 3GIZL 1YUHB 2IGFL 3NZHH 1P2CB 5AUMB 4K2UH 1F3DJ 3QJHB 1WWWX 1UM6L 2CR3A 3DV4B 2X9WA 4XPBL 1IGFL 3U4BL 2WUBL 3DO7A 3VH8A 3SDAA 5IIEB 5CCKL 1GZPB 2X4TA 1KNOB 1IC5L 3SE8L 3BVNA 4GO6B 1IM9B 4P23D 3DYPA 5TQ2L 2YD4A 4HS6B 2NTFA 3MLTA 4Y19A 1YEDB 5IMKA 2HG5A 1FVDB 1I1FA 1VADB 2A6JB 5C0FA 1AGBB 4LSVH 4L4JA 3VA2C 2R1YA 3P11L 1PG7L 4GKSA 3BXNA 4N90E 4PJAB 1CTNA 4PR5A 4HKXB 4L9LC 3ZKXC 3MNVB 1J0JA 3INUL 1ZHNB 4XC3H 4MYWB 5D1QA 3LZFL 3ABZA 2XN9D 1CFNA 1F3JA 4HJGB 2VQUA 1UYWL 3EFFA 4MX7B 1JYWA 4OI9A 4JZOA 1YEJL 2OMNA 2A6DA 3D0VA 4O2CA 4PJHE 3PIQB 4G6KH 3RA7H 2GK2A 1CT8B 1RUQH 3ALXA 2HMID 4QF1A 3IFPA 4L9DA 4M1GL 1U8HA 2MQ0A 1U3JA 4JRYD 4QHKJ 4ZFZB 1JPGA 2JELH 3RKDD 3D18A 1MQ8A 5IVXE 2W9DH 3IDNA 3O3BB 1MFCL 4YHYC 2DBLH 2VZVA 4M1CD 5EUKA 3BQUC 1EA9C 4P99A 1U8IA 3VFTB 2VNCA 4NN6B 2D0FA 5DURB 4RGOL 2FBOJ 1Y18A 1G6RH 5E8NB 2LV4A 4OCXL 5CWSB 2NZ9C 1UM4H 4GQ9L 4RFEB 1FNSL 2BP3A 4HIEB 4J3OC 1P4IH 1MQKL 4N0CC 2OK0H 3PHOB 3K81A 1C08B 1XCQB 2DYPB 2PCPB 2FX8H 1DP0A 1PFCA 3OJDB 2K7QA 1Y18B 3KPOA 1G7IB 4P57B 1SQ2N 4F7MB 3B2UD 1KCLA 5ERWA 3UTZA 3LHPL 1ZLVK 4OV6F 2VXTL 5KW9L 1DBBH 1FRGL 2G5RA 4ONFL 1HH6A 4PRNB 2C7UB 3C09B 1IGFH 5KG9A 5C7XH 3MR9A 1WBYA 4MS8D 3ROLA 4Z9KB 2JK5B 4OIBA 4DCQB 1DDHB 2VKWA 4LNRB 3NCYP 5F89B 3F5WB 2F8VA 4K23L 2VN4A 3HC3L 2JF1A 1YMMB 5I19L 4RAVB 1IGJA 3OF6D 4BZ2H 3B9KB 4JPWH 3SKJL 4JO2H 2Z93A 3IDMB 1A3RL 1EHNA 5D1ZB 2Y07H 1IGCL 4MB4A 5ACLA 3BP7B 1ZLVH 3LZFH 1D9KD 5T5FH 1JGUL 1GOGA 3B9EA 2UVFA 1FZKB 1OHQA 1CS6A 5J3HC 2YD5A 1XGTA 1S7RB 5EG6C 1CFTA 3O4OB 3GJFA 2WMPA 4YIQA 5CJ8A 1T7WA 4X4XA 3TT3L 5D5ME 3MA9H 4FFZL 2NY1B 2B0SL 1JNHB 2IBZY 5E7FA 1KF9B 2UWEA 1ZLWK 4AEEA 5JHDD 4U49A 3SDXF 1BFVL 4KROD 1IC7H 1UWGH 4YHOH 4MWFA 2ZCLL 3PV6A 5EU5B 5FM5M 3ZO0A 4RA3A 3EHBC 1CL7H 4FMFA 2VITB 1A22B 2VDOH 3O0RL 1U8NA 4C59B 5EFIA 3SDCB 4GQ9H 1S7QB 1YYLH 1J8HB 4V1DA 4IOFC 3D3VB 5DVLA 4L3CA 4JANB 4YWGH 3DMMC 1RUML 3EOTL 2B1HH 4P2OC 4M02A 3BGAA 3LS5L 4X6DF 3HR5B 3HI5H 4WI3A 2CLZB 4C83B 2XN9B 5GPRA 4OKVB 4HS3B 3BP5A 3ISWA 1W72A 1O5DT 3HMWH 4ONOA 4PJ9D 2ZKHL 3ARED 3ESUF 3VFVB 4CVXB 2HJLB 2CPCA 1EH9A 3H0TA 1F4WL 5C3LD 3C5SA 4M7JH 5HHXH 4NP4L 3B6SB 1W72B 1S7WA 5DXWA 2I26N 3REVA 1HZHH 1TJHL 5FKPB 1P6AB 5FUCE 4ORZC 4HJJL 1WK0A 1NJ9B 1YA5A 1AXIB 4PRIA 3RX8A 4DOHB 2VSCA 4WU7A 4NZTH 4NWTL 5E2TH 3MRJB 3QAZB 2OL3H 4ODVH 2ZWLT 3IKCB 3ARRA 5SX4H 5E4IA 1Z2KA 3VFPB 5GS0D 4JY5L 3U0WH 3BUYB 4L8BB 4EQ2A 1BIIB 4K94C 1TVHB 4Q2ZB 1S7SA 3GJEB 3FO1A 2ICES 1FZMA 4XH2A 2VITA 2V2WA 1A0QL 5IF0B 2BJML 1FC1A 3MJ9H 3CD4A 4HJGA 3NABH 4YGAB 4P48A 1EMTH 4P4KB 1T2QH 4X6FA 1Z3GH 3HZKA 1Z9OA 32C2A 1IQDA 3GSXB 1YC8A 4O2FA 3ULVD 3SOBL 1N0LA 4LU5H 1FCCA 5GGVH 5ICXA 3S4SA 1YECH 3RVVD 1BVLA 4JCMA 4HWNA 2Y7QB 2WBKA 3U9PH 1YY8A 3UBXI 1MJ7L 3CSPA 1G6RB 3RBGA 2BVQA 2NR6D 4PJDB 4XAKE 1T6WA 2B7DT 2J88L 3PNWA 2PXYD 2AK4B 3GHEH 4H25A 4OKDA 4GAJH 1IAMA 4NPYB 3BO8A 1CFVL 5L2JA 3VXRD 2AS5M 5IBUB 3PDDA 3VFWB 3R1GL 4N1HB 5GISH 1Q9WA 4Y1AD 1B4JH 3K2MC 3NN8A 4DN3H 1DANU 1XGUB 1FH5H 1E4XL 3FQNA 1F2XK 2NY7L 1T1WA 4OZ4A 4QXGH 5E8DL 4ODUA 5D70L 5ALBH 3AVEA 1KG0A 1IAIM 4MCZB 3K80A 1JGVH 1P84K 3WLBA 4BYHA 4WHDA 4AIZA 2XG4A 2NY1D 3MRNA 4S2SB 3FB6A 5D7LB 1JWSB 3P3YA 4XMLL 4R90L 3UJIL 3KVQA 4OV5A 4KROB 4PLNC 1A6TB 3U4EB 1CICC 2BRRL 5JORA 3KYAA 5L2JB 4X7TB 3MO1B 3I6GB 3O11A 1EXUA 4K55A 3WIIH 2ZCHL 4OGAC 2K1MA 2OL3L 4UU9B 3WNOA 2YUVA 5EOQH 3C8DA 2OTUA 4R4ND 4JN1H 4EI5D 1DQLH 3UPRA 3UROR 5I1JL 3IFLL 4QRPE 1ETZB 1EFXA 1BJ1H 5E6YA 1A7NH 4NHCH 4TTDD 5C08E 4MB5A 2A74B 3MRCA 3LQAH 4NKDB 5CP3A 4C58B 3S88H 5JW4M 3B3IB 1XF5B 3TH4T 2APBA 2V2XA 3CXHK 2XA8L 4FQCL 5E5MB 5KS9B 3KPQB 4FFVC 3MXWH 4R97B 4NQDD 4QRPD 5I1DA 4Q97A 3IFPB 2OZ4L 2P7TB 5HGGS 4NNYA 5F1IA 5IESL 4X4ME 4KPHH 2LTQC 1E6JH 1VACA 5EU6D 1QZ1A 3HPLA 1OAQL 1M6OB 4EN3C 3TVMA 5IB5A 3U0PB 3BJ91 4TSBL 3VFOB 1TVBB 2FGWL 3O3AB 4K2UL 4EOWH 3WUWA 5IKCA 3KHQA 3MREB 3TGXA 1K5NA 4RMVA 4JRYE 1A7PL 1DBJH 3VXQA 4IIQC 2R29L 4H8WC 1BWWA 1A14H 3SE4A 4PGDA 1MLCB 1MVFA 2QADD 3BMWA 2ZNXA 4XCYA 1LO4L 3CXHJ 2V5YA 5CZVL 2B4CL 5ANMB 4Y4HA 1BIHA 2IGFH 4PJGF 5IBLC 4YXKH 4HAGA 3FQRB 1HHHA 5DJZB 3V79C 2HT2D 3TBVA 2VDRL 3M17B 2WIIA 2YRPA 4KQ3H 1AQKL 4KKLC 4FMKA 1U95B 4YQXH 1P7QB 1CK0L 3FTGB 3I2CL 3LN4B 1JN6B 5EUOB 1D5BB 3WFDL 5T3XL 2VLLB 3QUXA 2ZSWB 1M71A 2V2TB 4ETQB 1L0QA 2BNRA 1QRKA 4RMRA 5DJ2A 3Q1SL 1I7ZA 4EXPX 4Y4KC 4PUBL 5D8JL 4K9EC 5EC1B 2X7LA 3I3EA 3P11H 4W4NA 3VWKC 1EBAA 3P4MA 2QQLH 3TIEA 5HSFA 3OPZH 1HHGB 4O2EA 4KJWC 1N6UA 3ULVH 1OP5K 4DAGH 3NMEA 1R5IB 3QFDB 3T0AA 1DLHB 3MSPA 5INDB 3LQAL 3TA3B 4I77H 1X9QA 4PJXB 1GL4B 1RUPH 4LLQA 3JUYA 5FYKU 2Q7YB 2VTFA 1QR1A 4X9FA 4JR9L 3BYYA 4QRQB 4Z7WA 2XQBL 1QSVA 4X4XB 4QNPE 1EGJA 3VRJB 4RZCB 2R9HC 1WUNT 3DRTB 1UCBL 4QTIH 5BS0E 2C5DC 3QEGL 2BCKB 1RD6A 2YHGA 5D7LD 5I1HH 4LF3A 5EU3B 5C09B 3S5LB 1MVUA 1Y6NR 1F8TH 2A6IA 4RX4A 2E7LA 4HIJA 4P2RA 2APTA 2R4RL 1YYMH 1ZV5A 1QSFD 4GUPA 3PP4L 2CRZA 3W9DA 5EZOH 2P8PB 1ZLUH 2R0LL 1EZVX 2P49B 4Y8DC 2EZ0C 3QI9C 2H1PL 2A6IB 2F53A 4NYLB 1N59B 4CW1A 3WS6C 6CGTA 2D0HA 4NC1E 3C8KA 5C0BE 3U79A 1ODAA 2OJEA 1S7UB 3FB5B 3MLVL 3V8OA 4CADB 4TNVK 4K23H 1NCAH 1U8PA 3PWLB 4N68A 4GG6F 1GHFL 1NAMA 3QB7C 1GIGH 3HNVL 1FGNH 3ZKQD 1CXFA 3O9WC 3MJ8B 3AY4A 1RIUL 3GSNH 3G6JB 3MV7D 3V4PL 4OFKA 4GKSB 3O4LB 1J1XL 2F5AL 4WTZG 3QNZA 3L7FA 5C86A 3MLUH 1V3KA 1F02I 3RGHA 4NZDA 2I5YL 3TBWB 4LHUA 1CXHA 5B39G 3EFDL 1T89C 1C08A 3DNKA 1LEKB 3GJFH 5I2IA 1CGTA 5D96B 1T66C 5I18L 4U6YB 2DQIH 5I66A 4P0DA 4HMDA 1K85A 3P9LB 4Y4FD 4OLUL 1DTUA 1WFNA 2D7QA 4MWFB 2VO5A 4HSQA 3NH7L 3QIWB 1A7QL 5E2WH 1QYGH 4PJ8A 5I71C 2LU7A 1UB6B 3MBXH 2QJDA 4MXQC 4Z7VA 4DEPC 1A02N 2QQNL 3ZSTA 4NQSB 5C08A 3RTQC 1EAPB 4O4YL 2DM4A 5HI3D 2Y72A 2Y06L 4P2OA 3NIDF 5CAYB 1LEKA 5DRXA 2AK1H 1JZ5A 3VXSB 3BQUB 2G2RA 2J3SA 1XGPA 1X5LA 3UTQB 5ESVA 2AKRB 2QHRL 3ZKMC 2DMCA 5D93C 4NKMA 4L3ED 5ALCL 5FB8A 3ELAT 2Y7QA 4Z7UF 1J8KA 2VC2H 2E7CA 2H26A 5GZND 4JGMA 2J12B 4WY7H 3FMGL 3MV7E 2ICWA 5K93A 1K6QL 2CXKA 4U1IA 2R56L 3BXNB 1ZLSH 32C2B 2FX7L 3QXUA 2H32A 3EO0B 3C5ZA 1VHPA 3QUZD 5E9DB 6FABL 1KJ3L 2AJVH 3B9KA 3BRDA 2EKJA 4Y2OA 3BP4A 1H15A 1IGCH 2YD3A 2Q20A 3P4LA 4IRJB 4PJFF 4HS6A 1TZGL 2DQHH 1BAFH 3RWJB 3AS3A 5C0BD 1UACL 3NGBC 3BKCL 1N0XL 1OT1A 2WNGA 3NIDE 2BOBB 3VDBA 4HPYH 2D0GA 5T1MA 1I8LC 3A67L 4XXCA 2P8PA 3QCVH 4X7FC 3EOBB 3UC0H 4ZMAT 3L3OA 4QHMA 5GZOD 4NZTL 5E2TL 1MRCL 3QUXB 5KS9A 2DQUL 3WNNA 4MJ2A 4R0LB 5BVPL 4OLYL 4LSRH 4JEGB 2YD2A 3UTZB 2HTLC 3GKWH 5JXAH 3NOIA 1HIML 1JFQH 1G1YA 2FH6A 4LPYA 3MFFA 5MENB 4X0KB 4M8QB 4XVJH 1G7IA 2HFGH 4NP4H 2ZCKL 4K9EH 5E6IB 5LQBL 3C5SB 3MA7B 4I2XA 4JPVL 1A4JA 4FG6C 1N4XL 5EZLA 2OTUB 3O4OC 4POUB 1T20A 1YN6B 1RHFA 4I13B 5E03A 4HG4K 5HI4C 1AD0B 1WZLA 2VXQL 4ODVL 1B0RB 1YJDC 4F3FA 4CAGA 4LEXL 1I7UA 5T1KD 4XRCB 5KBNC 1KJVA 3FFCD 3V0WH 4DZ8B 1YECL 3ULSB 2XOTA 1HHGA 4EUPH 3HE7D 2VQTA 4OLEA 4BFBD 3BOVA 3MV01 3KYMB 3PWUB 3WLBB 4AIXA 5GSVB 3FO9A 3BH9A 1HXYB 4Y1AA 2XY1A 2GY7B 1HI6B 1BX2B 3T77A 1GGIH 3IDJA 3T0EA 4H26B 2YMXL 3LIZL 1P4BH 3B5TA 5CJXA 2DDQH 3V7AG 1QSFE 1CZ8H 1LDSA 1PDKA 3MV7B 5HDQH 1S78D 4JFPA 3O4LD 1D3CA 4PV8A 2OZ4A 2HFEB 2YD8A 4L9LA 2XYCA 1A6ZB 2A83B 1BLNA 3LN5B 3SQBA 1DQQA 1J0YA 3T0DA 2Y36L 4G43B 2ITDB 3DMMB 3QPXH 1FO0L 2H2PD 3I02A 4QGTA 3RPIA 3QHTC 3SBWC 2F8XC 3BKYH 5TGBB 4B41A 3DURB 1I3GH 1VFAA 4CVZA 1X6NA 5EN2A 4G9FA 2AKRA 4YPGB 5CJ5A 1JGVL 2CDGB 3QDMB 4U1SB 1B0WA 3DXAB 1X5HA 3QO1B 5KSAC 4PJIF 3RRQA 1MJUL 2P8MB 2NXYC 1M05A 4CN4A 1UC6A 5D2LF 2YSSB 1A21A 3OKEB 3L5HA 5IKCB 3HZYA 4KTEL 2W0FA 1L7IL 3CJJA 1A9EB 1KGCE 1PZ5B 2QEJA 3UTTD 1YUHA 1F6FB 4KV5E 3NTCH 4L3EE 3PGFL 1F6LL 1X5YA 3SN6N 4XP1L 5HPMA 4B0MM 2YUXA 4WUUD 4Z7NF 1KCKA 2ZCKH 4WW1B 1MCSA 5GGSY 4OCYL 4W81A 3R8BB 3OKKB 1DQDL 4FXGB 1C1EH 4X6CA 1QRND 4ZO6A 4WJ5A 5DD3H 1YNLH 1FNGB 4MQTB 5HHPB 2OI9C 5D72H 4L4TD 5C6WH 1H5BB 5TJWK 3LN4A 3SGKA 3SE3C 1GAFL 4EI6B 1ZHLB 3MV9E 3CU7A 5DS8B 3ZKSD 4JPIA 1G9EA 3KPOB 4P57A 5HI5D 1MCDA 4G80B 1QHPA 1LD9A 2X40A 1PX4A 2PYED 2VWEC 43CAA 3KR3H 1ETZA 4PRPE 1XCQA 5DFVD 4Z0BH 5EIVA 5FGSA 2J8UF 5JQHC 1T04A 1J05B 3C6SA 4BJLA 2IH3B 3OGCB 2RFXB 2ZP0T 1NKRA 3NFSH 1SYSA 2B4CC 3TC9A 3UAJD 2QQKH 1IGIL 3B9VA 3K74B 1FHGA 4GBXB 4XX1E 2Z91A 5HYFA 3I84A 4HWEL 4PJ5B 4ZSOB 1CLYH 5HVWA 3KPRA 4D9QD 1G0YR 1V05A 4HZLA 5LXGL 4ZUVB 4XMLH 4Q9RH 4XPAH 2W65A 2RB8A 3KNBB 1S8DA 3GMLB 2MOVA 1P5VA 4F9LA 3STLB 2E8YA 2YZ1A 2Z8RA 4NQDE 2YK1H 2GJ6B 1YQVL 3G08A 3QNXA 4RRPG 5EULV 5T1LA 3U7YL 1T1XA 4ODXB 3DX7A 5EU4B 4LIQH 3CDGA 3O6KL 1QACA 1ZEAH 5F7HA 3GJFK 5FA3B 1O0VA 4LLMB 5IP4A 4UV4H 5I1DB 3FN0H 4F7TB 3WHXA 3MCLL 4PR5B 2AABH 5GIRA 1P1ZA 2BSED 4CJ0A 4KZDL 3GSRA 2ZSVB 1VEMA 5FUZH 3QSKB 1KIRB 2FEDC 5FF6B 3EYVB 4M5ZL 5TFSH 3D39A 4RGOH 2GK0A 4O2EB 2GSIB 1PYWB 5KSVB 4TOYH 2FR4A 3HPJA 2QQLL 3D0LB 5IVOA 5DHYB 1CE6B 1VB9A 4WFFD 1KCVL 2V17H 3I2CH 1IQWL 1OSZB 5I16B 3QQ3A 4NO3A 3EZ8A 4UIKL 1JHKL 1OP5H 4XXCC 3EYOB 4OI8A 5C71A 1JNLL 5BQ7A 3IAPA 1NANH 2BVPB 4ZD3H 3C08H 3FKUS 1YPZB 1NDGA 5AD0A 4U1MB 3VG9B 4RMUA 4RX4D 5IUSA 4EOWL 4WGVB 2YN5A 1K2DB 4S2SA 5GGVY 2V2WB 3T09A 4LVEA 4U3CA 2QKIA 1OF2B 4QTIL 2I25N 5IJKC 4FS0A 1YMHB 4ERSL 4Z0BL 4I8DA 1F8TL 3J7HA 3UZQA 5D1XB 4ZOAA 3MRQB 2VABA 4R7DA 4BK5A 2UVEA 3UZVB 4ZTOL 4HIXL 4MSWB 1YPZA 2H1PH 1ED3A 3UDWC 2J4WH 5F7UA 3QDJA 1MCLA 4LRNL 5I1GL 2W60B 2HJFA 3FN9A 5T5NF 4G8EA 3K7UA 2DI8A 3ARBD 3PNWB 4H25B 3OXRB 1TPXC 5GRJH 2R0WL 3H3PL 3OX8A 1DUYA 1FNFA 1UA6H 4AQOA 3DXAA 3ZE0E 1CCZA 4P4RB 4MA3A 5MEPB 2GSIA 4O5LL 5C6PB 1JMZA 2FIRT 1KB9K 2X4QA 3O6KH 4IBLT 1IEBB 2L0DA 4Y2DD 1HKLL 4P2QE 4PLKD 1GC1H 4O02H 1WLHA 5JXED 3L3OB 3MCLH 4F58H 1OPGH 1Q8MA 2YPKB 1FAIL 4AL8L 5BZDA 4WHCA 4M7LH 3V6OC 4OCRL 3QR2A 1F42A 2GSGA 5L88L 5B38B 1Z0MA 4Q74A 2X4SA 1BZ9A 4H26A 4UV7H 5IHUH 2XPGB 4NBYB 1RMFL 3GSUB 3RY6A 4PJ5D 1KPRB 1C16A 4P9HL 5BZWB 1WGOA 5E2WL 3EO1A 5AZEL 2H32B 2W65B 1UM5L 3GBNL 3P4OB 4S11A 4WI2A 5AEAA 5H2BA 4JKWA 2OL3B 3BAEH 2XA3A 3VXUD 3U4AA 4GXVL 1N8ZB 1ZT7A 3CFKB 1S5HA 3G6JF 4M61B 2PTUA 1OTUD 3GMOA 3KYKL 4XPGH 5FGRA 5INCA 3O6ML 2PCPA 3UP1A 1REIA 3PL6A 4U6VL 3B9AA 1CFSA 2GTZB 3D3VE 4APQA 3B9DA 4NQDA 3G04B 1WEJL 3LDBB 1RJZB 3F12A 5DTFB 3ME0A 1AKJD 1SEBA 5DD5H 1UH2A 1A6VL 4R4BA 4DGYL 4ODSL 3VRLE 4HJJH 3O3DA 1FFPB 1NMBH 5I1LA 4XWOD 2ATPA 1X4ZA 3AAZA 2NX5D 3WLWD 5TDOA 1QFWI 2VZUA 4XCNB 3G6AA 3S35L 4CMMB 3MRDA 3RDTB 3VWJA 1SEBB 3QCUH 3O45B 5E00B 4KKBD 4PJBA 4JANA 5JDSA 5JIPA 3DROB 4NSKA 1QEWB 2FSEB 3V4VH 5E2VL 3BH9B 4H88H 5ANMA 3MQIA 4K8RL 3JWOH 1X4XA 2L7UA 4XVTL 3MV11 1QFWH 2YEZA 3S35X 2MCPH 1U92A 1MRCH 3A0OA 4HULB 3ULUE 2VDMH 3T2NL 3OR7A 1G7JB 2HN7B 4X4YB 1LO3L 4NC2B 5JXAL 5GGQH 3STZB 4IOFD 4LLQB 5TE4L 3MXVL 1JUFA 2DQHL 1OPGL 1ZE3C 3TZVB 4WEMB 3TJHD 8FABB 5CEZD 3FFCA 1J1PH 5CILL 3MBXL 1KB5L 1MFAL 3U0PA 2VLKB 3SO3C 2QQNH 2VL4A 1TNNA 5D1XA 4ENED 5DJDA 5F9JA 3T4YA 4KDWA 4XCFL 3MZTA 4YPGA 2JKXA 1AJ7L 4MXVE 1IM3B 4X6EA 3D2UD 2EDOA 2HJKB 4KK9D 1MF2H 3U30B 5IFHH 3JWDL 4FQ2H 2AK1L 4QHUB 2O26U 2OS7A 1NCWH 3SPVA 1KEMH 3U6RA 5EO1B 5ALCH 5J13B 3WV0A 3IDXL 5JW3L 1J0ZA 3L3DB 3R1GH 1G6VK 3AS0A 3N1MC 3QG6A 2X4NB 3IVKB 3KYKH 4XPGL 3REVB 1BD2D 3GMRA 3LKOA 2A6DB 1P4BL 2VLKA 1ZSDA 1LO5A 3HNSL 1XZ0A 3D87B 1EZVY 3N0PB 4V1DD 3C6SB 2XKUA 4G5ZL 2XN9E 1G9MC 2JTDA 1X7QB 2VE6B 5LCVH 2DQDL 4YHZH 4UINL 3NVQA 1A1OA 4ZO7A 2P5WD 1IAKB 4I5BA 4BH7B 4LKXA 1A6TA 3OJMB 1A6AA 4CU8A 2A6JA 3TN0C 1AD0A 5IW1A 4UAOC 1UG9A 1EX0A 4ZPTA 1ORSB 1W0VB 3MODL 4TVPH 2R1WA 3EDKA 2BDNL 3HNTL 5AG8A 2F53E 3WXVH 3L5WA 3H9HA 5IB5B 3QQ4A 2FO4B 1JGUH 4MNGB 3ULVC 4PRPB 3QUYC 2HVJA 3LDBC 5FFLA 3QRFM 5C9KA 3GMQB 1BEYL 1R3KA 1F5WA 3NN8B 4U2ZA 3K1KC 4WFED 5SWSB 2K9UA 4YXHL 3WSQL 1BBJB 3MYJB 4KRNA 1MHHA 4M1DH 5DEFB 5ESAA 1SEQH 3RWIB 4WTXA 3NPSB 1JNHA 4JG1H 2PXYC 3FB7A 4DTGH 1MJUH 4FQXA 3RZWA 4YHOL 4XP6H 5FYJE 1XR9A 4GBXC 4XNMA 3UJTH 1GPOL 3K46A 5DUML 1ADQH 4BQ9A 5C0EA 4HC1L 4XCYB 4HQQH 1XF2A 5L2KA 1INDH 4ALAH 3QHZH 1QSFA 3FO0H 3QWRD 3QHFL 5T3XD 5TGBA 1V7ML 3ZTJG 5EWIH 3SEPA 5ICXB 4X9GA 1QFHA 1PLGH 1LD9B 1EDQA 2Z4QB 2B1HL 5BV7H 2ENSA 4CU7A 4JY4B 3BI9X 1FV1B 5BRZD 3C87A 1I1AC 3O3AA 2FBJH 3MLWL 1DLHA 5INDA 3HI5L 2EKSB 2R2HB 2DTSA 5E56A 3SDXA 3WUWG 2NY1C 5IQ9B 3WKML 5C0FB 3WN5C 2OP4L 3W2DL 4L29A 3U36B 1LO2L 4CUCA 1FFOA 1FVCA 5KOVC 3T8XA 3EOAA 3FCTA 4JJHA 8CGTA 3REWB 3TWCH 3BMVA 2XTLA 4WV1C 1JP5A 1WBYB 4S0SD 1S8DB 1U93B 3GMLA 1F4YH 3VG0L 1LWRA 2E9WA 4CMHC 5F9WC 1A4KB 3IJSA 1TJHH 5SX4I 1XCTB 1DBAL 2A0LD 4MA7H 5F3HB 5TF1H 2XZCL 2ZOLA 1UKTA 1KLUB 5LWYL 1SMAA 3DHMA 4TTDC 3ZMRA 4NWUH 5J06A 4XPTH 4KTEH 4JFEA 1OP9A 4NQVA 3QUML 4YHPB 4U6YA 2VLMD 3LRHA 1WBXB 1KCSL 3CFDA 3IDIB 4RAUA 5CZXC 5IVZB 4F7CA 3NTCL 3IJHA 1MH5A 3ROOA 3HNTH 1CLYL 5L8JB 4G8GD 1A4JB 2R1WB 2ADGA 4X4MA 4XB8A 3VGHA 1TDQA 2K7PA 1QLFA 5I8CA 1ZGLB 4LHUB 1YEEL 1IM9D 43CAB 4L4VD 4F57H 4HKBB 5AAMA 1MIMH 2BC4B 3I6GA 3MLXH 1WITA 1KB5A 2A9NH 2G9HA 4QRUA 1A6AB 3IDUA 4LASL 1W2KT 4OB5L 4HGWA 4ZODA 3MRGA 5IB1B 1UQSA 3OR6B 4WEUD 4MLSA 1BD2B 5CD3B 3MGTB 5J1AA 4HF5L 3OKMB 2AV1B 1KJMB 3L1OH 3RHWF 4ZS7L 1MCHA 4V1DB 1TQBB 3CSYB 3EW3B 3U9PL 2DTMH 2PO6A 3RL1B 2AEQL 3ZTNL 1ADQA 2IANE 4ODUB 5B38A 4RMTA 5H8DA 5I71B 3RNKB 3TYFB 1BIIA 1C5CL 2WLYA 4NM8H 2P5WB 2DS4A 3KPSA 3NCCB 4G6JL 5IT2H 4JLRB 5D7SH 5LG1A 4NOBA 4ZXBC 3OAUH 2IAMB 3S98A 5EZOL 1SY6H 3ULSA 1UEYA 1JZ7A 4HIJB 3B3IA 4NO0A 3VFUA 5CCKH 4F7EB 1MREH 3ARXA 4LLVA 3GJFB 4FFWD 4OIIL 4PJ7E 4BH8B 5ICZA 5L2KB 1T0NA 3MJ6A 4UNUA 1EEQA 1R3JB 4G6AC 1U8JA 4J2XA 3QIBA 2IALA 1FGNL 3Q0HA 2IH1A 1NSNL 3U7YH 1RZFL 3VXRE 4N5UA 2ITDA 3DMMA 3ZT5A 4PJEE 4PJAF 5HYJE 2I60L 2BXZA 1CGWA 3SE9H 3L3IA 4QXTA 3T0ED 3KLHD 1RV6X 4HX1A 2AW2A 1TVBA 3TCLA 4NJAH 3GUTA 3SE8H 1IGTA 5ID1A 1T21B 2ZJSL 4K8RD 4W4OA 1JK8A 3FHQA 3X3FL 1FNGA 4CN6A 3ZKND 3MJ7B 3VXOB 1YEJH 3IFOA 3MMEA 1CD1A 1ZT4B 4GAGL 1RHHB 3REWA 1JF1B 1PG7X 1MFNA 4NNYB 5F1IB 4DCQA 2E3VA 4MNHA 1RUQL 2DI9A 4U7SA 4YH6A 1Q9OA 3IFLH 4LRNH 5I1GH 4H20H 1W72H 3CX5J 1IZKA 1M71B 4P2CG 5EBGA 3RVUC 3QCTH 4Q0XL 5ITBL 5L8LB 5CEZL 4ZAKC 3SDXB 2X4UB 1YMMD 5GRJL 1A7QH 2Y5TB 3KXFA 3VFWA 4QT5B 3QWOA 4JFFE 5DDHA 2WQ8A 1LE5A 3V6OA 2EYRA 2Z9TA 1B0RA 5D1ZD 5BQ7B 2EECA 1WWBX 4NCC2 2A38A 2W9EL 1EEYB 2GJZA 2HAZA 4LAQL 4U2YA 3KPSE 3VXUA 4AG4H 5IROA 4B5EA 3SDXE 4U6XB 1J05A 2V9RA 4FQPA 1ZSDB 1KN4L 1PEZA 4Z7UB 2QBWA 1E6JL 3HTLX 1KENH 5DMGC 1F4XL 1TJIL 2F54E 4EUPA 3KYNA 4BSJA 4KK6C 4ODBD 1SHMA 1ED3B 1ZHLA 3MLRL 4FQXB 1BP3B 3I02B 1IBGH 1T7XA 1TMCB 4C57C 1UJ3C 1G9MH 2EICA 1H3PH 3P9MB 4L9LB 1JPSH 1MHCA 4FXGA 1XR8B 2XTJE 1BVZA 4PIRF 1JPFB 1D7FA 1J8HA 4MA8L 5EU3A 4OLVL 3ORJA 4ZOEA 3K2UL 2JCCA 4WV1A 5HGHB 1YY9D 4LGRB 3MJ7A 3S34H 3VCLB 3H9SE 5FYJU 3LHPH 2X4RB 5KVDH 2BMKB 1JI1A 4LVHC 1EO7A 2VDQL 2E27L 3OZ9L 2C7UA 4HZLB 1QBML 1BQLL 5EIIA 4JQIL 1CN4A 3TA3A 1MWAL 4NJAL 1AGDB 1AGBA 3B5GA 3KAAA 4ZFGL 5JOEA 4NKMB 1MFDL 4OZGE 2EDRA 2ORBL 4HC1A 2HWZL 5KSVA 3BQUA 3TIEB 5D4QA 3VI4F 5I19H 2Z35B 1IEHA 3G6DH 1TQCB 4TSCH 5FCUL 3H0TB 4WHTA 1KPUA 4U1GB 1FIEA 3FO2B 3OMZA 4ODTH 1DVFB 1MCWM 1BQHB 3JVGC 1H3UA 5DS8A 3C8KB 4N9OB 4WEBL 1M7DB 3LMJL 2D31A 4P9HH 1F58L 2HT3D 2ZNWA 5E2VH 4QY8B 4UQ2A 3VFSB 2DYPD 3MRRB 5C0AB 2DQFB 3MRQA 1KB5H 2PR4H 4PP2A 4ZFZA 4JFYA 4M5YH 4BFEA 2PETA 4MAYD 5D7JD 1RU9H 2VDLL 5KVGL 1INEL 4YHNA 4TVPE 1A6UH 1MF2L 3X12B 4HV8A 1BD2A 1WC7B 3QEGH 2FGZA 4Y4FA 2EC8A 5F88A 2R0ZH 1MLCA 1RZ7L 1U3HD 4B50A 4XP4H 1OVZA 5AD0B 3RVWC 2ZOKB 4MDJA 4Q9QH 5DA0B 1U6AL 1HINH 3FJTA 3V5KB 2GAZA 1NCBL 1JYXA 5ISZB 4MXWL 2GEEA 3WDJA 2ESVB 1A7BA 4K7FA 1QHOA 1IAII 4JQVC 4BQBA 1MCOH 4OLWL 3QCUL 1KTDB 3BDYL 1IM9A 1IT9H 3F62A 2KZ1B 4OCNC 2R2CA 1ZVYA 3FN3A 4C4KT 2J8HA 4X5WB 2PTVA 4HUUA 1OAKH 3UJJH 5F96H 2PXYB 1OQOA 5CJBA 2EDBA 3BZFA 4WJ5B 3KDMB 1F45A 5HYJB 4XNQB 2GJJA 4DK6A 3QIWA 5GS0H 3QDGE 1MCJA 1CGSH 4JLRA 5F97E 3O4LE 3TZVC 2R2EB 3CX5K 4Y7MA 1OTSC 1HE7A 2VH5H 2HFFA 5KSBA 3NZ8A 4MB3A 2F58L 3BISA 4FQXD 5F7EL 4KU1A 4PJGB 1QFUL 2JCCF 5EU7E 3MRJA 2DJ4A 4CDGC 3LQMA 2DQCH 2APWA 5E4EB 5CEYB 1U8MA 3VFRB 2YPLE 3RWCA 4J3WA 4UBDC 4LU5L 5GGVL 1CLOL 3LH2H 4QTHA 5DZOA 1PEWA 2AI0H 1U8OB 2CSPA 4KUCF 1VGEH 2D7MA 1YEIH 4FQLL 3R06B 5DQJB 4Y19B 3DRQA 1LP9B 3VXSA 1U8QB 1C16B 4WI8A 4F7CB 4KH2A 2DLIA 5KJRH 1JWUA 1A3LH 4W6XB 1RZJH 5E00A 5DD0H 4GAJL 4IRZL 1E28B 3L5JA 4NT6A 3TYGL 1CWVA 4PJ9B 3AREB 3CZFB 2F15A 4P5TA 2QHRH 3G5XA 3RWIA 2CUMA 2BFVL 2CKBH 1GGYA 3FB8A 1YEKL 2AXHA 4Z6AT 4XP6L 5JHDE 3GM0A 3KPNA 4QRRD 1KFAL 4Q9RL 4KK5D 1AHWC 1AGEA 2HVJB 5IOPA 1JZ8A 4Z77A 2NY7H 1NUFA 4NRXA 4MNGA 4NQDB 4U6HB 4RFNC 1U0QA 5AYUL 1CFSB 2GTZA 1RHHA 4I1NB 5L8KB 2R4SH 3RY4A 1WWAX 4OLWH 5DZNA 5A3IC 3T4YB 4XP5H 4IMLA 3MUZ1 1MI5D 5E2UL 4MX7A 4HXAL 1EVUA 1P84J 3RI5K 1RJLB 4DVBB 5MEOB 1RVFH 1EGJH 2AGJL 3QNZB 3UYRH 4CU6A 1AXTL 1OAKL 3UJJL 4LFHD 1RURL 4JKMA 4PLJD 1HYSC 1MHEA 2VMFA 2DKUA 4MJ4A 1J1OL 4AENA 3GMPB 3WIIL 1FBIH 5DJ6B 4WI9A 2DQUH 2Q76A 1BZ7B 5BVPH 1BBDH 1JVKA 2KL6A 5SX5H 2FCBA 5I73B 2RAMA 4XVJL 1F4YL 2ADIA 3SKNB 2G2RB 3DOSA 4JDVA 1TQBC 1XT5A 2QSCL 4MA7L 3QG6B 4YE4H 3NCMA 4U3HA 5HI5C 2FNBA 5T3ZL 4HKJB 2NY4D 1QFUH 4XNQA 1KT2A 1JYVA 3QHZL 4Y19E 5DEFA 5ESAB 3WCYA 4ZO8A 4PRIB 4WO4A 4H0GA 2YOCA 2OZ4H 4XPBH 2ESVD 3O3UN 4P5KB 5CSGA 4X6EB 2AI0L 1AP2A 2JB6A 5DT1H 5L0QC 3WEXA 2FHCA 4QWWC 5DJDB 3V0VA 1T7YA 5J89A 5ETUA 4Y1AB 1I8LA 1OSZA 4Z8FL 1UJTA 4E41B 4FFYL 1MRDL 2BK8A 1GGIL 1JGLL 1EEYA 2H45A 3LQAC 3TYGH 5HTSA 1SY6A 1CZ8L 4PJ7B 2UUDH 4QTHB 3FT3A 4QOKA 2R1YB 4HT1L 1NGPH 3DX8A 1NCUA 3GSRB 4K3EH 3DV6A 3HZMA 5GGUB 3IF1A 2HRPH 3TA3D 3ILQC 1BM3H 1RJCA 1SBSH 4IMKA 3C5ZC 3G9AB 3SJVA 1CGYA 4TUJA 4POYA 1C5CH 1T0MA 1F90L 3BVNB 3EJZD 5EC2B 3KG5A 4I9WE 4LVOB 5FO9B 4YXKL 2YUWA 1Q72L 2FEDD 1MNUH 4OZGA 2VLRB 4A6YL 3U30C 1A7PH 1EVTC 1MCNA 1XGUA 2YPLA 3X17A 3OGOE 3PV7A 5ENWB 1T22A 1H3VA 1D5BA 4JFFB 3N1QC 1KCRL 3MV8E 2JJSC 3GSQB 4Y5YB 3TPUB 5J11B 5BRZE 3IS0X 2NCMA 4M9PA 2I07B 4LASH 5GRUH 1UWXH 4I3RL 2CUHA 2LFGA 5JNYB 3UPCA 5FYKH 2WWMD 4G7VH 3B6SA 4C54A 4P4RA 4DKFL 3UPAA 4R2GD 4X99A 4YQXL 2G5BB 1RMFH 1VFAB 4JJ5B 4LLVB 3EOYG 5HBBA 3D5OF 4PYGA 4E42A 2DTML 2AEQH 3GBNH 4LLDB 4CBPA 4QRRB 3PL6C 1YNKL 5CUSL 2BVYA 3BD3A 5C07E 4YDIL 5FYJH 5KOMC 1N3NB 4HGMA 4X6FB 3W11C 2EH8L 4PUBH 5D8JH 4OGXL 2WP3O 3HG1E 4JFPB 1E6OL 1JIBA 1RULL 1G7PA 5IMKB 1Q94B 3AB0C 3MRIB 2SEBA 2Q8AH 1YEGH 2JJWA 5F89A 2DBJA 3B2VL 5I8KL 2DI7A 1CD0A 2AEPL 3QWQB 4M6ML 2Y1VA 3IU4L 4JM2B 3RAJH 3O8XC 1UB6A 4EDXB 1FLTX 3ZDYE 3CNKA 4HGWB 2CKBB 3QIWD 1KN4H 4Q9CA 2BVPA 1KYOK 1N26A 4MA8H 2BVUA 2BC4A 4AK1A 3IJYB 3MBEC 3VFGH 5IM7A 3HB3C 7FABH 4X7DC 3LY6A 1GIGL 3HNVH 2BVTA 5D2NA 3QEQD 1IGMH 3P4NB 5JXEC 1AY1L 3D6GA 3RKDC 4WHYH 3RWEB 3SDYH 3HPJB 3JV4B 1UVQA 1NMCB 3CIQA 5IM7B 3BQUD 3F58L 5IVXA 2IFGA 4FP8L 4UILL 5MENA 4HEPG 5HXMA 3DURA 2YA1A 3DV6B 1JPSL 3HZMB 3T2NH 1QLRB 1UZ8B 1DUZA 4YX2H 3L7FB 4P49A 3EKCA 4LQ1A 1H5BA 4H20L 1MJ8L 1CLCA 2CIIB 3KLDA 4TPRL 4WUKL 1KCRH 1K5NB 4FNLH 4OD2B 1T1ZB 3MXVH 1E0OB 1J0IA 3C5JB 3KPTA 5BV7B 4LSSH 2KKQA 4KMTL 4X6CB 2HWZH 4QOKE 5F8RC 1PJ9A 3N1GC 3OXSA 5B38G 1CT8A 4XT1C 3RY5A 3QUZB 1QO3A 3C60C 2X41A 1LO5B 5DD6A 3JUZA 4LMQI 1YN7B 3VRIB 4X6CF 3V6ZA 1D5ZA 1V7NH 1HHJB 3GNML 3U7WL 4HEME 1HN1A 4K94L 5D71L 3VXTB 3F5WA 1E4KA 5KANG 1KCVH 1YDPA 2V17L 4HHAB 2VSDA 5DEZA 3JZ7A 5JA9A 1EFXD 5J8OA 5HGDB 4JO1H 4MS8C 5DJ0B 4XVUC 3BPCB 2Z31D 4CKVX 3E8UL 2CIIA 4K7PL 2EYTA 3FQUA 3BKJH 4M5YL 1P69B 1KIUA 4L4TE 3SCMA 3S37X 1QSFB 1CGUA 3CDCA 5FGBA 2Q6WB 4KQ4H 2EEDA 1S7XB 3VXMD 3N85H 3WLWC 2PN5A 4G8GE 1I85A 1CR9H 1A1NA 4HUMB 4GRWE 2Q76B 2VR9A 4Z7WB 2VC2L 1I1AB 3HCVB 1A2YA 2I07A 2EXWC 3MROA 3VDCA 4ZG1A 4OIAA 4JVPA 5KVGH 2AK4E 2BSSA 1NGZB 1O7VA 1FZJA 2UZXB 2Q87A 4XPFL 1KCUH 2EC9U 1AC6A 1M6OA 1NC2D 5A16B 5GQBA 3X12A 3HE7B 1PGRB 3RX5A 4X8JB 1XGQA 4OJFH 2ORBH 5KTEH 2P5EA 4RMSA 5CHNB 4ZPTB 1DBBL 5K9QG 3RU8L 3TJHC 2CD0A 1R5WB 2OX5A 3GSVA 5ADOL 3ARFD 5GGRA 2VLJA 4W6YB 4L8SC 2HVKA 1DE4B 4MZ2A 3Q48A 3JVGA 5C6TH 4LKXB 2COQA 4KKCD 1XGYL 4M1DL 5GS0L 1FG2B 4NC0B 1JMXA 4I18B 1HIMH 1HSAB 4KK9C 1MCPH 4NPYA 4UT7L 4W68A 2JELL 1BAFL 3G04A 1GYAA 4WW2B 1UWEH 5FA4B 5I8CB 3HC3H 4UQ3A 3AROA 1OP3H 4MNGE 5LQBH 4PG2A 3PHOA 3DMMD 5IJVB 2BY0A 2Z35A 2G5BA 3JSSA 2BNRD 4KJPC 2CQVA 5JO5A 5DUMH 1BECA 1U8PB 3OG6B 3BW9B 4PBXA 3O11B 3IDYB 2FZ3A 5FYJD 3V5HB 1R3LB 1T83C 2XG5A 1U2HA 3VXPA 5E08H 1ZVHA 3CGTA 7CGTA 3RBSA 1UWXK 3HC0B 2VN7A 1CLOH 3WO3B 3P4OA 3CLEH 3QXVA 3BE1L 1NGWA 5C07B 1BMGA 4L3EB 1AR2A 4LCIH 3I50L 5ENWA 3WFEH 1QNZH 1I1YB 4WFEE 4BSWB 5BJTA 5E8DH 1NH6A 3TO4B 3CAFA 1RZJL 3CLFH 5FKAB 3QXAA 4JO3L 1KXVC 4JZNB 4J3UA 3CX2A 4LPWA 4ZXBB 1NFDE 5E9DD 3ARQA 2AXJA 3O6LH 4E0RB 2MQCA 3ZHDA 3TZVA 5DGQA 4PY7B 2B2XH 2YBRB 3WN5A 4IRJD 2P42B 4D0BA 3BDYH 4ZAKB 5GS0C 3B9KC 1ZTXL 2CGRH 4OZHE 2ADFL 3MOBL 3QPXL 5JW4R 1SM3L 4BSVA 2C4FU 4YO0B 5HYEA 2HT4D 3KPMA 1ZVSA 4N0FB 3VFNA 5DSCB 4J1UA 3QUXD 1QBLH 2H8PB 3QDGA 3GSOB 5A40E 3PDOA 2BRQA 1MH5B 3MBEA 4GRLB 4H1LH 5IQ7L 5CP7B 3ILPA 4NUJB 3RGVC 3LD8B 1C5BL 5EBLA 2VH5L 4Z7QF 3BIAX 4F57L 3VH8B 3HRZB 1I75A 3TT1L 1A7NL 1HSBB 4L8SA 3QULB 3O2DA 4FQQB 3D25B 2ZKHH 3U4EA 1NLBH 4GBXD 1XCTA 4EIGB 1BFOA 3IDNB 3O3BA 4FZ8L 1KJ2A 4FTVE 1YPZF 3MV7A 2ZUTA 1WC7A 2LAAA 2VDKL 2DQCL 3OKLA 3VD3A 1TIUA 2NZIA 1ZA3A 4HXAH 2BERA 3L1OL 4K71C 1C12B 3Q6FA 3HAEA 4KJYB 4E41E 3GI8L 2HJKA 4OCYH 1WBZB 3IU3A 4OCSH 3HHRB 1RURH 1DQDH 4NZJA 3ARDB 4A6YA 1I1AD 5GS3A 4G42B 3R06A 3ET9F 2R15A 3TH2T 2RCSH 5IQ9A 4LHUG 3FOMB 1Q9WB 1CFNB 1F3JB 5B8CC 1H3WM 5GJTH 1D6EB 2RBLA 5DJ6A 1KBGL 1NBVH 4QHLB 4XP1H 4DW2L 5IHZB 4U1IB 1HNFA 1A7RH 1NC2B 2HMIC 3UX9B 3ZZ1A 3PHSA 4JFXA 1A14L 4UOW0 2JIXD 2V5RA 1LHZA 1OY3B 2R0KH 4XAWH 5E6IA 4ZS6C 4BUGA 3GMRB 3LKOB 1W0WA 2Y9RT 4IJ3C 1OWRM 1OAZL 2PW1A 1KNOA 2P8LB 3X14A 5F3BB 4MA1B 1NSNH 1Q9LA 5E99L 1EUTA 3T0WA 3ZL4L 4JFHD 1PAMA 4FQHA 4KQ3L 3QDMD 3HZVA 3WNPA 3T1FA 1ZTXH 1VFOA 2NX5E 3BN9C 5GXBB 2BSRA 1UXSA 1A47A 2DMBA 2W92A 2PO6C 4I3GA 3RWGA 5GS2H 3HFMH 5SWZE 5J6HA 1T1XB 4F7PA 5I66B 3MUHL 3Q1SH 4LSQL 3V6ZB 5K59E 2NW3B 4C4KO 3C6LD 1BBDL 3L9RA 3UTTB 1NDMA 1SJXA 4NJ9L 5CJOH 1JYNA 2YRLA 5AZ2H 3MNVA 2JLLA 3GB7B 5C0BA 4WUUB 2HA1A 5INCB 2QSCH 5DYOB 1KUMA 3FOLA 4XTRD 2DM3A 5EUOE 4MSWA 1UZ8A 3I9GL 2QR0B 5IR1B 2VRAA 4EN3D 4OLZH 4F7MA 2H2SD 4PJHB 3BIBX 4H0IA 1NCDH 4OFYD 4LIQL 4U3XA 4KRPC 1KULA 4YBLC 4ZXBD 1TZHB 5GS1B 5M94B 2D03L 3ARBB 3ES6B 2V5SA 2HFFB 5KSBB 4KHTL 2NW3A 2GJZB 2ZG1A 1BZ9B 2UV3A 4JFYB 4PG2C 2AABL 2PYEB 3QP3A 1I7TB 4HC1H 1MHPH 2AP2A 4L4VA 4OZ4B 3QQ9C 4W4OC 4UOJA 2X4NA 3FQXA 5C0AA 2R2EA 1QSEE 4D3CH 2N4IA 2QADC 3WFHB 4WFHE 2HLFD 4JFDE 4ZUWA 1KBGH 1NBVL 4DW2H 1PLGL 1DQLL 2VZSA 2WUBH 1WTGT 5IBLD 3RUGE 4NO2A 1RJZA 5FYLE 5C0DA 4MDIA 3UYOD 3ZT6A 1NLDL 1RFDL 2HT2C 4NO5A 4GRLD 4KTYA 1FVCB 1X5GA 5CMAB 5DC0A 3HE7A 2P43B 3WIFA 3KLHC 1KELH 2VZ1A 1YNKH 5CUSH 2ADIB 1NFIB 4ZD3L 3SKOA 1JHTB 4K8RC 5DO2C 3LQZA 1BGXH 1JK8B 5C0CD 5C1MB 3IDGB 3V4UH 5FO7A 4N8CH 3S96A 2HH0L 2D9QB 4O2F