2P5ED

Crystal structures of high affinity human t-cell receptors bound to pmhc reveal native diagonal binding geometry
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
194
structure length
194
Chain Sequence
MKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLITPWQREQTSGRLNASLDKSSGSSTLYIAASQPGDSATYLCAVRPLLDGTYIPTFGRGTSLIVHPYIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of high affinity human T-cell receptors bound to peptide major histocompatibility complex reveal native diagonal binding geometry
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
total genus 40
structure length 194
sequence length 194
ec nomenclature
pdb deposition date 2007-03-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2p5eD02
1J12A 4OB5L 2O5YL 2YEZA 3FKUS 4OZHE 3WXWL 2N1KA 4M03A 3WV0A 1J11A 5INDB 3MA7B 2W60B 4PRBA 3G6AB 5C0GA 4PP1D 3G5VA 5I15H 3WHXB 1LEGA 1VHPA 2P5WA 1UB6B 2J8HA 3V52L 1HN1A 2A6IA 3QIUC 4OQ1A 4GAGL 3WIHH 3UTTB 1A6WL 1T0NA 2NLJB 1UWEH 2AGJL 1N7MH 4U1IA 4PJ9D 1J0YA 2B1HL 5EUKB 5HGGS 1D9KD 4NPYA 3QCTH 4HIEA 5A40E 4LSSL 4NZDA 5GS3A 1QRNA 1WBYA 5I76B 4JPVH 3S37L 1S9WA 1HKLH 4OZHF 4R96A 2DM2A 3DI2B 5HYFA 1FL3B 3R06A 3MLSL 3UROR 4JM2C 1FL5A 5J56B 4KZDH 5EOQH 3L1OL 2F53A 3UO1L 1AQKH 3SDAB 1L7TH 1CICA 3MNWB 4HBCH 4Y5YA 4YHML 3BPOC 4XCNA 5I1GL 1NGWA 3VFPB 5H94B 5C7XL 4XXDA 5T1LD 4JEGB 4WIQA 1R6VA 2OL3H 4PGDA 5DUBA 5D6CA 5BS0A 1B4JH 4Q74A 1R3LA 3VXPA 4Z77B 4OLVL 3MLXL 2DLIA 1QSEB 1TLKA 4NNYA 2I25N 4LOUD 1L6ZA 3ZKXC 3VRIA 5GGTL 2W0LA 2XN9D 3JV4B 4GRMB 1UM5H 5C2BH 4P3CH 1M7IB 3Q2CA 4ZNEA 2X7LA 2QQLH 5HHMB 4BFBD 1HCVA 5GRXG 2OP4H 2HT3C 1DVFA 3BGFC 4MA8L 3VXMA 1JRHI 4LDLB 4AM0B 4M7KH 1YEGL 4PJHB 4WNQB 4NQEA 5ACMA 4E5XA 4WWID 4I0PC 5EBLB 1TQBB 5HVFB 1CG9A 3WS6A 5B3JF 1U36A 2VQTA 4ONFL 3RY6C 2X7LB 3I50L 1G6RB 1ZLSL 3QIWB 5CBEA 5L2KA 3WFCH 2NY6C 1MH5B 1IKNA 1SJEA 4QHLB 4XI5C 5T5FL 4JFXB 3GMPA 3S36H 1EMTL 2GJ6A 4OGXL 2NW3B 3GHBL 4G6FB 4JRWA 4L8DB 3A67L 2A77H 5DJ2A 1A1MA 4C56E 4ODWB 1YEDA 1YDPB 4TVPD 2AJZA 4ZTPH 1EEQA 1BFTA 5ESQA 5EU3A 1KT2B 5EU7C 2OI9C 1SY6A 1S9XA 4LEOA 3FHAA 3QG7H 2RFXA 4FQQA 3ECBB 1I1AD 3BKYL 4PGEB 1P7QB 4FS0A 2YHGA 3L5XL 4MSWB 2X44D 3GSRA 1SM3H 3QB7C 4PS4L 4KWUA 2OR8A 3TN0B 4YXKL 4RGND 2Z31C 3QPXL 4RFNC 1OP5K 1QVOB 1H5BA 1FFPB 4LVNC 3BFOA 1U58B 5DD1H 3TNMB 4NWUH 3BX7C 2Q3ZA 3TCLA 1PAMA 4JVWA 1FIGH 5F1NB 5FO7B 4U1HB 4OZFB 5T1LB 3TPKA 3MRIA 1FQ9C 3LN5A 1EUTA 5IB3A 5JHDD 1MEXH 4JRYB 5F71A 3LQMA 4LLYA 3E3QE 4HIEB 4R0LB 1U3ZA 4MJ2A 1W2KT 2EH8H 1U42A 2J8UE 3H0TB 1Q94B 1RJYA 4D9LH 3BEVA 5T1LA 1MHPL 5TE7L 1MFAH 1HYSD 4OD2A 5DGQA 1QG3A 4Z7UF 3F6IA 1IGCH 4U49A 4X6EB 3V4VL 4HX1B 3WHXA 1QSFA 3FMGL 1AD9A 1JV5A 1P9MA 2HLFC 2VIRB 3MOAL 3VFWA 2OZ4H 5IBUB 2FNBA 3ULVF 1AXIB 1ZEAL 4QHMB 2XN9A 3OF6A 4YNYA 4IS6B 5J11B 2ZPKL 4QRPB 4TQEH 1FFOA 4X83A 3QIWD 3CDYA 5FCUL 3K8KA 4NT6A 3CMOH 4OCYH 3B4NA 5DEGB 1RMFH 1F8TL 4HUWA 1FDLH 1LD9B 1X4ZA 4HIIA 2EYTB 1P1ZA 3FTGB 4LRNL 5KSAD 3DROA 2VLJE 3OHXB 1F90H 2XA8L 1K8IA 3BJLA 1UCBL 1WCBB 4L3ED 4YDVA 3BWUC 4GRWB 3O3UN 4F8QA 4LCYB 1DLHB 3JVGA 1AGBB 3DLQR 4NM4L 3T09A 5ITFB 3FQTA 1TTGA 2O5XH 4G6AD 2UWEA 2XACC 4EJ1C 3KLDA 3H2WA 4R4ND 4RGMB 3PGDA 3IU3B 3P0VL 5ABDE 1X5YA 3RNKA 1KB9J 3QXTA 4X6BA 2X2YA 4RAHA 4K3DL 1FBIH 1DQQB 2VAAA 4XCNB 4H0HB 5LQBL 2Q8AL 5D72H 2ICWJ 3G08A 2IH1B 4XH2A 5EZOH 2YZ1A 5I1AB 4GAJH 1P2CB 2I60L 1X5HA 5AG9A 1H3PL 3MACH 3MLPA 3OKYA 1T1ZA 3EO9H 1JNNL 5EBGA 4OJFH 1A5FH 4LLAA 4YE4H 2J4WL 4LLVB 4XAWL 1QKZH 4LAJH 3V4PL 2DQUH 1ZEAH 4L9LB 4EI6B 5BMFL 5IFHL 3CNKA 3WUWA 1GJIA 5GXBB 2R0KH 1NMBH 1XF3B 2G60L 2ZWLT 2WQ8A 4UMGA 4U1MA 1FL6B 1TVBB 4L4VD 3SDCD 5CGYD 4YXLH 4Z6AT 5TE7H 3MFFB 3VGAB 1Y18A 5EH1A 4U1NB 4XVUD 4G8EA 5JA8B 4NN5C 2EEAA 5IM7B 3E6FB 1WAAE 1YMME 1YC8A 1FORH 3D9AL 3OJMB 1H15A 4GG8A 2CRMA 5EU6D 3CX5K 3DX9B 1T03L 4MS8C 1I8LA 1NFDA 3ULUE 4PGBA 3LSOB 2VE6B 1NBVH 3INUH 3CX5J 3KJ4B 2ZCHL 5LWYH 3GB7B 1MWAL 3CH8A 2AV7A 4HMDA 3QH3B 3GIVB 3PHQB 4O9HH 4WUUB 3B3IB 5ICYB 5E5MA 2EYRA 1HHIB 1T3FB 3IVKB 3JUZA 2VDQL 5ALCH 2NW3A 1YMHA 3V6OE 2IADB 1JK8A 3PP3K 3E8UH 4IM8A 1YDPA 4HPYH 3KPRE 4ZYKB 1KIQA 3QXWA 4P59L 2R2EB 4QKXB 5LCVH 3FQRB 4KKBD 1TNNA 4R97B 3MV8A 3QA3B 5IJVB 2ARJB 2F8VA 3PG2A 4RNRA 4Q6IB 2IBGA 3U1SL 1D7FA 2CKBH 1S7SA 1RUPL 2IPTH 3KPSB 4XNUL 5I66A 4XP6L 2EO9A 4Z7VE 4UU9B 2A77L 3NCFB 3WDIA 1OCWH 3Q3GA 2QADC 3ZT6A 2ZUYA 2OXGA 3S5LB 3AVEA 4UV4L 1AGCA 1BREA 4GKZB 1YJDL 3C5JB 4BH7A 3HC3H 5DD5L 3QEQA 4NN6C 1QSFD 2ERJC 3LH2H 4KUCD 1FCGA 5BJTB 5I6XB 3VXOB 4FFZH 2Y07L 4ODHL 1EFQA 3ZMRA 2VLRB 3QUMA 5EBWB 4MD5B 2AQ3A 1HHHA 3X13B 4HIJA 5KS9B 4KTYA 2WANA 4Z7VB 3VFNB 3RUGA 1S7QA 2FECL 1NCDH 3U7AA 1F4XL 4Q9RH 4WTXA 1TNMA 4JO3L 3TIDB 3IDNA 5I1CH 3DIFA 1D6EB 4WY7L 3MJ9L 3MLSH 4LLWB 3BP7A 3OR6A 4Q2ZA 3RY5A 1A7NH 2B4CH 5IK3A 1IM9D 4OKVB 2AABL 4P2OB 1CLOH 1LVEA 4DN4L 4KROB 4XC3H 3HA0A 3GBML 4AT6A 4QGYA 5GS1C 3DX6A 1T83A 1XAUA 4DW2H 4QOKE 1DLFL 4J3TA 2ZUWA 3DX8B 4M9PA 2OJZL 2FDBP 3LEVL 1VKXA 1WFNA 1TZGH 3D48R 3LHPH 4OCXL 4ZSOA 4UOJA 4NQUA 2IGFL 4YFLI 5E00A 3IJHA 1MCHA 5IGXL 1RD6A 2D31B 2H8PB 5GHWL 3TVMA 1HILB 5JW4R 3QQ4A 2Z8WC 1WIPA 5CUSL 1VKXB 4M4PA 5T1KD 2YKLH 2FBOJ 1BZQK 1UFUA 5MENE 3VXUE 1HE7A 1YNKL 2C9AA 2XTJC 1AKJD 2LQRA 4YHZH 2W9DL 4HKBA 4NQXA 1WBXA 2DBLL 4TUKL 4UILH 1PEZA 2GK2A 3DETD 1KJMA 1CTOA 4RBPH 4XPBH 4EN3A 2QSTA 2H2PD 3B9KD 3DARA 1H3XA 1KLUB 2HVKB 5CD3A 4JAMA 4LPXA 3VGHA 2WM0A 5KG9A 1S78D 5HD8C 3EOAA 3U2SB 35C8H 3MOBL 4JDZB 5ALBL 1R3JB 3IAPA 1OL0A 4HWZB 3QEGL 4PTUB 1Y18B 5D2NA 2JLLA 7FABL 4HKZB 5GS0L 4X6DA 4NDMA 2ZSVA 4YZFE 4HH9A 1K4DA 1NGPL 1V7MH 3GSNH 1N64H 4I8DA 1OGAE 1X44A 5D6DC 5IB1B 2HT4D 4ZOBA 1S7VA 2CUMA 2VXSH 2VDMH 4Y4HB 1E4KA 3TZVA 3KPOB 5I2IB 1Q1JH 3P9LA 3FFDA 1ZA6B 1H5BB 2OMNA 3RIAK 4AEHH 3SBWA 4XNZC 1GVIA 3RPIB 3CSYA 1NGYB 8CGTA 5I19L 3HE7D 3RAJL 1ZGLA 2O26U 2ADJB 2VLKB 2HMID 5E99H 4NQVB 3W2DH 2C3VB 2Q6WB 1MY7A 4PUBL 5E8PB 5DR5H 4NO2B 1FSKC 4FZEL 3CFBB 3DMMD 1YEKH 4IBLT 1LEKA 1QRKA 4RQQB 1NCAL 5FXCH 1Q9OB 1CVRA 3C60D 2CLVA 2GJJA 3SCMB 3VD3A 5TDOB 1T7WA 1J1PL 4LSVH 4JZJA 5E08H 5CSBA 4R3SA 1PSKH 1CD1A 4WUUD 2CH8A 1NCWL 1G9MC 3AY4C 3QXDA 4X7SL 5FUOH 4J4PC 3VDAA 1T1YB 3HE6A 5FIEA 3SN6N 2H45A 4A6YA 4JFPB 4AIXA 4HWZA 2P5WD 3DUSB 3NABL 3BT2L 3TYFB 4EZMA 1A4KB 3HC0A 5SWZE 2X10A 3EYQC 2VR9A 4JRXB 4RFEA 5DHVH 3V5DA 3CAFA 3MRRA 3D25A 2DM3A 2X4SB 2L7JA 2MCG1 5EORH 4XHJD 1Y6NR 5JR1H 3PP4L 5IIEA 3ARGA 4P2RB 3UZQA 4F2MB 5HGDB 1QPPA 5AYUL 1B2WH 1KFAH 1NMCC 2YUWA 4ZFZA 4ZG1A 4NQDB 3OG6B 4NNXA 4N5UA 3P4NB 4MHHI 2MFNA 3VFOA 2OTWA 1F4XH 3MXVH 4Q9RL 1VPOH 5JLZA 5FCSH 2AK4A 4K3JH 3HPLB 4C83A 1NBYB 3CPLA 1HKFA 1I8KB 3KXFE 4KU1A 2CXGA 4B50A 4Y2DA 4FFYH 2Q7YB 4J3SA 4D0CA 4XMLH 2V7HB 4WTWA 4YPJA 5ICYA 1B6UA 2DAVA 3L3GA 4GS7C 2IG2H 5F7HA 3FO2B 2E6QA 1CFNB 4KJWC 3GRWL 3W0WB 4TUKH 4KJYB 1TJGH 1QFUL 1EGJA 3BSZL 3U0WH 4UQ3B 3C9NB 5HHMD 4ZXBC 3RL1B 2W9EH 5AD0B 4G9DB 1R3HB 2D7PA 4Y1AD 3CFCL 1RY7B 4JY5L 2AJ3B 4WWKD 3OZ9H 5F93C 2BRQA 5B22A 5B4MD 1KYOJ 3ME0A 4TSCH 3MRJB 3WE6B 2VXUH 4TSAL 1FYTD 5IB5B 1TZHA 1ZLVH 1OQXA 2VH5L 4JFZL 3QXAB 2UZXB 2NY4B 4NC0B 2NW2A 4P59H 3CFDA 4KVNL 5C0JA 2H26B 5CEXA 4QRTA 1MVUB 3L3OB 3RWIA 1J1OH 3G04A 3SGEH 2DLEA 5DRWA 3M17A 3MGOB 2XQYG 4L8BB 2NY0B 3LQAL 3GB7A 2YK1L 1CLOL 1CICD 4KTEH 6FABL 3VD4A 3U0TB 2VDKL 2XFXB 4ONOA 2B4CL 3UXFA 3VWKB 5EZJA 1RU9L 3TBTA 1KB5B 1UWXK 1JCKA 1IAMA 1XMWA 2C5DC 5DYOB 1OAYL 1FGNL 4WI8A 1QUNA 5I16B 1NC4D 1JZ7A 3NGBB 3F7VB 3MBXL 1MLBB 3OSKA 4GG6A 3W9DA 5CJQH 3FZUC 1T22A 1KJ2H 4M6NL 3GSQA 3L3IA 4WFHD 2ZUVA 5EU4A 1QLFB 3BEWB 4LGSB 1CFTB 4YHPA 3U4BL 4FQ2L 1PDKA 1CXHA 2EIDA 4FRWA 1DL7H 4MA3A 1WCBA 5D2NE 4PRPD 1DLHA 1ZHBB 1IGJB 4IRSD 4L3EE 2J2ZA 3C6LB 5CWSA 3TJHC 1N59A 3IFLL 4XRCA 5E70A 3SKUD 5EOTB 4IEFB 3Q6GH 1RSFA 1BBJA 4X99A 4JFZH 5CP3H 5D93C 3MRJA 1NQBA 1QKZL 3PWVB 4J3VA 2F54D 1A6ZA 1W0YT 4FNLL 1N8ZA 2DF3A 3DHJA 1XZ0B 2J3SA 1A14L 1IAOB 1PD6A 1GAFH 5BVPH 5ICXB 5EIIA 1JHKH 1VFUA 4QRRD 3UYOD 3SOBH 4KKBC 1OTTC 2NX5B 5ELIA 1ODAA 1KIQB 1X5LA 3UTZB 2IAMA 3T0EE 1KNOB 5F7KC 1HHKB 3W0WE 3QJFB 1DFBL 5B38A 2YXFA 4LSQH 1G7QB 3K1DA 4HQQH 3SGKA 4R4BA 1RPQA 2WP3O 4MJID 2WP3T 4F7EA 1IBGL 2D03H 3DSFL 3LPFA 4KV5E 3LKPA 2QADB 3ZT7A 3MV9A 5DJ8B 1AD0A 1IBGH 2D03L 1CE6A 3WIIH 4PRHA 4TOYL 4NHUB 5EU4B 4KROD 4PB0H 3TNMA 1G7MA 1K8DA 4L29A 4OD3L 2BK8A 4MNQA 4N0YL 4C4KO 5HBBA 2DQCH 4NKIL 5DQJB 1MFBL 5JZ7C 2CO6B 2XKNA 1D9KC 1GGCL 1KJVA 4ELME 3R06B 5J1AA 4NZRH 5C0ND 3RNQB 3P77B 1JZ6A 3MRHA 1REIA 4X7TB 2EDNA 1L0XA 5F7YC 5T3ZE 2BHZA 1A6AB 5B4MC 2C1OB 3S4SG 3G9AB 1RULH 1RIHL 2KKQA 4DFHA 1JP5A 4ODWA 3WFHA 4R0LC 3DO3A 1KPVA 3BOVA 1CR9L 3RNQA 3BYYA 2R39A 5I1JH 8FABB 5C0CD 3T65B 1A21A 1DANU 2DWEB 4TULH 3P0YH 1X5GA 3B9VA 4I5BA 3ULVC 4HD9A 5GRWA 3QUZC 2LE9A 1BQSA 3JTTA 3G6JA 5DJDB 3O0RH 1FFOB 4HUNB 1WZ1H 1X5KA 1S5HB 4YPGB 2VDOH 4TNWF 5KSAA 3O6ML 3EYSH 2FEDC 5I1KH 2CRZA 5IJKC 2FD6L 4I1NB 1G7PB 1BX2A 1J86A 5JDSA 2WBJD 1BZ7B 5CILL 3OB0K 1T20A 3HE6B 1T1YA 3ARRA 4C4KT 5KSBA 2XOTA 1ADQA 3HUJE 4NHCH 1PKQE 2VRAA 3L95B 1D6VH 1LE5A 3JXAA 5F44A 3KHOA 5EZLA 3TA3D 3C6LC 1NFDF 1JTTA 5DJ0B 3GNMH 4FQ1L 4JGMA 4CVUA 4QY8B 1ZT7B 5J8OA 4KQ4H 3NZ8A 4WW2A 2YK1H 4L3CB 1Z0NA 5BW7C 2VERN 2Y36H 1A7BA 3MUGA 3VFNA 4RMUA 3PQYB 3GJFK 2D9QB 2MCPL 4I0CC 4LF3B 4KJPD 4QOKA 1YYLL 2R0LL 1N0XH 2K9UA 2QKIB 5IFJA 1P4IH 1HOCA 2AJUH 4HJJH 4G43B 5J6HA 2P8LA 1MJ8L 3TA3B 4N0RA 4JDZA 1SJHA 4BZ2L 2PW1A 3ARFB 2EE9A 2IQAB 4YAQB 5E0QA 4NQSB 3LQZA 1A1NA 5JOEA 3CFCH 2D7NA 1V3KA 4FQIH 4N8PA 2H1PL 4U1GB 1JHLL 2H3NB 3P0GB 1T89A 3RY4A 3CDCA 2YPKA 4FXGA 4ALAH 3SQBA 3QIBD 1JFQL 4Y4HA 5I66B 4OFVA 1KCUH 2CRYA 3MRIB 4JY6A 1AY1H 3HCVB 4MVBD 4LCWD 2G5RA 3QFJE 1RJZB 1RK1B 1QR1B 5IQ9B 5LGHL 2OL3L 3L3DA 4XVTL 3EHBC 3HE7C 5DQJA 5F7LB 4WHCA 4MB4A 2CLRA 5DFVD 2R15A 4QRQA 3BYTA 4HBCL 4YHMH 5DC4B 3PV6B 4LCCB 2W92A 4MAYC 4CMMA 2DTMH 1G1YA 1XZ0A 3LKSB 3H9ZA 3WNLA 4NGHH 3MBXH 2WBJB 2HVKA 4PJDB 2KH2B 1JWMB 1NEZA 3LEVH 4LVEA 1FZJA 5DC9B 4Q58C 4J3OC 1RZKL 4O2EA 4O2CA 4ELKA 1CWVA 3WO4C 1SVCP 3ARZA 3TNNA 2VZUA 4OGXH 3G5ZA 4JPWH 2GTZB 4H5SA 1W0WA 1QHPA 3O8XB 5T33H 4U6YA 3CK0L 2BNQE 4OFKA 4M61A 3NCBB 5D1QB 5FGRA 3TZVB 4JFQB 5DHVB 4ZTOH 1KN4L 2F15A 4LHUA 3AM8A 4PLKC 5E1AA 4PY7B 1CF8L 3GSWB 1N8ZB 3JZ7A 2IANB 3I75A 2UZIH 4WUKL 1IILE 4PRIA 1CGTA 5BRZB 4L8CA 3R0MA 5C2BL 4OLWH 4HIHA 3HZKB 1KBGH 4GRLA 2FGWH 3FRUA 4YDIL 3QZWB 4DZBB 1M6OA 2W0PA 2BVQB 2XYCA 4JFHD 5A16B 5I1AA 5E94A 1KCUL 5M95B 4BJLA 3I3DA 4PBWD 4KDWA 5LAXB 2NY6D 2AKRA 5EFIB 2APBA 3OKMA 1R0AL 1U91A 3GBLA 2OK0H 5I30H 4LF3A 4DJMA 5LJYH 4JM2F 1RK0B 4XVSH 5GJSL 3QHZH 3QDJB 2VWEE 3VJ6B 1KG0A 3A6BH 3HTLX 1UH2A 1BM3H 3IFNH 5FUZL 1ZTXL 5F96L 2PO6B 2Q3AA 4NUGL 2LV4A 3CK0H 1LE5B 1E4WH 1NGPH 3ZE1F 1MAKA 3MLRH 5DEGA 3W82A 2WWMD 3DTXB 1ORSA 3N1FC 5K9KB 4NQCE 2BCKB 5I71C 4HCRA 4PJBB 5IEHA 3BMVA 2NQCA 1GIGL 1WLHA 3QIBB 3DJ9A 3INUL 1VGKB 2AGJH 2VZ3A 3ZL4L 1ADQH 2V5MA 1UWEL 1EJ6A 5D5MF 2BSRA 1HILA 1LNUA 1LO0L 1M7XA 2X4RA 4YR6B 3MRDA 4P46A 2VLLB 3LN4A 1JPGA 2P8PA 4HFWA 1URLA 4FQXC 3QCVH 2PN5A 3MV7E 3NVQA 4XBGB 2VC2H 5ADOH 3LKNA 5K59F 4YO0B 1J7VR 5SX5H 3MNZA 1MJJB 3QHFL 5HHOA 1HWHB 4H1LA 4ZOAA 5JA9A 5IWLC 4LPCA 3OG4B 5EUOE 3FO9A 5T1MA 2AKRB 1KJ2B 5EFIA 5HDBE 5KG9B 4IRJB 4QGTA 4YQXH 1GOGA 3LB6C 3ZE2E 2DJ4A 1FL3A 4F7MB 4D0BB 2F9BT 3BXNB 1QVOA 1HH6B 2DLFH 3HG1A 1A5FL 4HF5L 3VXQA 3MACL 1QTYT 1RUML 3O3AA 3VW3H 5KW9L 4X7CC 4Z0XB 4M5YH 3MJ7B 5CGMA 3SDDD 1IZJA 2X40A 3GSWA 2B4CC 4GXUN 5JHDE 4FTVD 4POUB 4P3DB 2NY1C 1FNGB 3WNKA 3GMLB 4X5WA 4X4ZA 3S35L 1WV7T 4UV7L 4FTVA 5GRUL 1BIIB 2MCPH 1JGDA 4JREC 4L8DA 3UPRA 1OF2A 3UZVB 1OTUD 1QFWL 5L6YL 3HUJB 4O02L 1K9TA 3FN3A 4NQSA 4EN3B 3QO1A 1KEML 1I7ZA 1NDMA 5CD3B 3GIVA 3PHQA 2BVPB 4M1DH 4LNRA 4WW1A 3FJTA 1QLEL 4YXHL 5CJOH 3FFCE 4AIZA 3IU4H 4HLJA 2HN7A 5TDPA 2ZCLL 4YHZL 5FYKL 5F9JA 5CLTA 3OL2A 3BQUB 4N90D 4G8IA 1BGXH 1FFNA 3RVXD 5T3ZD 3RWJA 1VGEH 2UZIL 2DQTH 4AL8L 2W60A 3MGTA 2HLAA 1NGXA 3AU1B 3WEXA 2CKBL 4BUHA 4BQ8A 4TRPL 5J1TC 4OLZH 1F6FB 2X9YA 4PFEA 5EWIH 2NY7L 3RL1A 3REVB 2DM7A 5KVFH 4P5TB 3T1FB 4PJBA 4FXGB 3BRDA 3KPMA 2WV3A 5HVHC 4X7EC 5H8DA 4MA7L 1RZGB 1MEXL 3MV9E 1XGQB 1HSAA 1U58A 4DGVL 2ITCB 4NZTL 2LVEA 1FVCB 1RZKH 4DKFH 4JFFD 1GGCH 4WU7A 1UZ6E 1N4XL 4MJIA 3QNYB 2A38A 3ULSA 4LLMA 1EERB 2VSDA 3W0WD 9CGTA 4G8GA 4BZ1H 4G6MH 3GUTA 1MCOL 2XZAL 3ZTNH 2HKFH 4OQTL 3NCYS 3TLRA 1M71A 1PZUB 5KS9E 3MGAA 1F3JA 3CC5B 4J4PD 4EUPA 4HZLB 1A7RH 4JY4B 3WD5H 3ARBC 5DRXA 2FBJH 5EO1B 1A1MB 3ARYA 3DVGA 3ZHDA 5HJ3B 3I2CH 1ZHNA 3O2DL 4O58L 3DSFH 4LLDB 4R26H 2GAZA 5HHQB 1KB5H 1YEHL 4LSQL 4I4WB 3QRFM 4ZUWB 2QQKH 4PREA 1YY9D 1QSVA 3EFDL 3A6CL 5IFHH 4DAGL 2DYPB 2HVJA 5IEKB 3DX9A 4OCRL 1BEYH 3C2AH 4X4YA 4NN6B 5C8JA 4UTBL 5TE6L 3T77A 3QI9A 1UEMA 3LKNB 4G80B 2P4AB 4LSRL 4ORZC 4F7PA 2OX5A 1DQDL 3BKMH 1A6UL 4BZ2H 2DD8H 4AG4H 3O6KH 4P23C 3WO3B 4DFIA 4J2XA 1FH5L 4WW2C 2EH7L 2VITA 3HAEB 1XT5A 3ROLA 1P5UA 4WHTB 4WEUD 5K59E 1NAMA 4LLQB 2G5BA 3THMH 1GC1H 2GSIB 1AI1L 3B5GA 3IDIA 3RTQA 1ZKAA 4F7TA 1MCNA 4G3YL 15C8H 4EI6A 5HHXL 3OKEA 2YD3A 3E8UL 1MSPA 1PLGL 4ZO6A 1UXWA 1ORSB 4PJDE 1BJ1J 1NUNB 4KRMB 4BKLB 2YD8A 4L9DA 5D1XC 5A2JH 1ZV5A 1AXSB 2IQAA 4YAQA 4OV5A 3VXTB 1CGYA 3Q5OA 3IXTA 1BP3B 3DV4A 1AD9B 1NANI 4QYOB 2P5ED 2NNAB 3DXAE 4J6RH 4MZ2A 4PJ9C 2CRIA 3U30C 4G6ML 2FD6H 1KXVC 1QQDB 4MCZB 1K5NB 4Y4FC 3DV6B 4PRHB 1NLDH 2C7UA 1BVLA 4XBEL 5HDQL 1MRFH 1MI5B 2FYYA 4G8FA 1LO3L 3OHXA 4MLIA 1R5VA 1LDPH 4A2MA 4P4KC 4F15C 1XR8B 4PJFF 5TH2B 1VFBA 2GTWB 5FYJH 5SWSA 4XHQA 4Y7MA 4I48A 5BMFH 3U46B 5FECA 3QDMA 2WWKT 3GKZA 3P30H 5D2LA 3TWCL 3ARGC 5IFJB 4ZFGL 4ISVA 4KMTH 5E8OB 2BSTB 2XG5A 5KVGH 4H26B 2W07A 3HNVL 1WT5C 3RVTC 2D7QA 5A2IH 2A83A 1AP2A 3IB4A 4XCYB 4WFEE 1G7LB 4YO0A 1GZPB 4AH2B 4AK1A 1XH3B 3ARSA 4MQ7B 4PTTB 3LEXB 3H6JA 4Y5XB 3MLUL 5I8EB 4KAQL 3FTGA 3PUCA 1RIUH 3MLVL 2GCYA 5FO9A 4IIQC 4IMLB 3VD7A 3IDGB 5EIVA 1C5DA 1IGJA 4PRPA 1MF2L 5D7IE 1GGBH 4GJTB 5D6CB 5BS0B 3N1QC 3IDYC 1G7PA 2WQRA 5K9KA 2XKUA 3BAEH 2PR4L 3ISWA 5IHBA 4K7PX 1TJIH 1FO0H 2XKNB 1DFBH 1OM3L 3C9NA 5FK9B 3SQOL 3EDDA 4HXBH 4HUUA 4RA3A 5LBSL 3TGXA 2HH0H 4LBEB 3VWJC 2IFFL 3WS3B 3GSNL 1NFIB 3TIEA 1A3LL 3IT8D 4ACPA 5EORL 1IGCL 2DMKA 7FABH 5I75C 3WKNA 3SGEI 3I6GB 1DBBH 1EHLH 1FYHB 3CC5A 4JFEE 4XZUA 4FG6C 1C1EH 4WGVB 3WNNA 4MJIE 5GGTH 2EH8L 3ZYZA 1XGPB 4QRPE 3LVEA 3DMMA 1Y0LB 3VG0L 5IHZA 1JPSH 2VL5B 3X3GL 3N9GH 4YFLF 2I5YL 2Y7QB 4WI2A 3FOLB 3SDYH 1FV1B 1IGYB 5E08L 3DBXB 5IW3A 4MB3A 3K0WA 3VH8B 5DYOA 5T3ZL 1J87A 3D0VA 1BMGA 2VXVL 3KPPA 1ZT4A 2BDNH 4EI5D 4NBXB 5HHNA 1RZIB 2IGFH 3LY6A 4IRZH 1IL1B 5FUCC 5ISZD 3MRLA 2VXTL 4ODSH 3UC0L 3OTTA 4CN1A 3ZZ1A 3KPRA 3FONB 1S7WB 3SKOA 5TH2A 4DUWA 4QF1B 2QSCH 1JK8B 2BMKA 3E6HB 2IAMB 4XPHL 1KLGB 4AJ0A 5IT2L 4JDTH 1I9RH 4Z7NF 1JF6A 3WFDL 3LRSA 4KRPD 4F58L 4PBXA 3HZYA 3MYZA 1I8MB 3WXVL 3X13A 1ZVHA 3HI5L 3PJSB 4Y5YB 4MJIB 3MBEA 5ENWB 5E8EB 3VXRE 5M94B 5C0RL 5SV4A 1A6WH 1NDGB 3TYGH 1FNFA 5HGAA 2UV3A 4JQVC 3GMMA 1Q9WA 5CP3A 3QIWC 5ANME 1E28B 3MUZ1 2BNQA 3NACL 1KIUA 2D9CA 2X1XR 4JJ5B 4GKZA 3D25B 3SDXA 2OP4L 6CGTA 3I6KB 1R5VB 1QR4A 1J8KA 4MJ6B 3RBGA 4BYHA 3HNTL 2XT1B 1AGFB 5E5RB 3L7EA 5SWSB 4Z7UE 3UJTL 5DJ6A 4DCQB 3PQYE 1BD2D 3L3JB 4M1CD 2YPVL 5KVDH 3BIBX 5HGHB 1U95B 2R1XB 4QTHB 4B0MM 5FM8A 4OF5A 2NY3B 2YR3A 4PJCA 4S2SB 4QOKD 4ZS7H 5AUMA 1KBGL 3MJGX 4POYA 5HI4C 3SEPA 2GSGB 2DRUA 4H1LG 4FFYL 2A9MH 1JUFB 3QFDB 2ADIA 3ARDC 3LMJL 5B38G 1FYTE 1RUKH 4E42B 2B39A 5JORB 4JB9H 3QFJA 2XRAL 1CF8H 4XNMA 5F6HI 3GI9L 4PJEB 3PL6C 5LXGL 3UAJD 2X4OA 1KC5L 3LHPL 4LEXL 2MPAL 1QNZH 1RQ5A 4DEPC 4P2RD 3G6DH 1OAQL 3TYFA 2CDEA 1ZANL 4IRZL 2ZJSH 2YA0A 4HIXH 4B41A 3WNPA 1CT8A 5HYEA 4O00A 5DVOA 3ULVD 3WO4B 1G7QA 5E24E 2NX5E 4K9EC 3D3VA 5FOBA 4XC3L 5EO1A 1S9YB 1OSPL 4PR5B 4APQB 3GIZH 1OAKH 1DE4A 3MGTB 1JGEA 3WE6A 1EO8L 2YS4A 3GMQB 3LV3A 3SE3C 4HUWB 1B88A 3O8XC 4Z7WA 5CCKL 5C0FB 3NIGE 1J18A 3VI4F 4LCIL 2PYEB 5A43C 2CLZB 4RMSA 1MCCA 4I2XE 3PWUA 4OF8A 2CD0A 1PSKL 3BIKB 4DGYH 3SKMB 5DJ6B 2CPCA 5GSRA 2FR4B 1HSAB 1WZKA 3V9FA 4EDXB 4KHTL 3I6LD 1MIEL 3ZYJA 5CZVH 3RY6A 2O5YH 4F33A 3HI1A 4OGYL 2ENYA 5GRVK 3F7PC 4KI5D 5GZND 4D94A 3QDGE 2EDWA 4G5ZL 3ABZA 1XR8A 5BV7B 2CIKA 4NQXB 1UJ3A 1A2YA 1U3HC 3DIFB 2IH1A 4RMVA 3H42H 5E6IB 3KVQA 2HTLD 1PX3A 4NJAL 2H32B 2MQ0A 4FQIL 4LSTL 2NY4D 1QLFA 1G6RL 2X1PA 3L5IA 3CUPA 1DSFH 2W65B 1D5ZB 5HYJB 1QOKA 2YWYA 3LDBC 1BD2B 5IMKB 4ZSOB 3Q1SL 5HPMA 5L0QB 1MJ8H 4YHOL 1YJDC 1WTGT 4U0QB 1F4YL 4XPAL 1UADC 5GIRB 1KV3A 2YD6A 1E27A 5I8KL 3T0XA 1P1ZB 3NCYP 1WAAA 1YMMA 4WFHE 2XV6B 1T20B 4WHYH 5C07E 3KLAB 4JO1L 5DRWB 2VDPH 5HHNB 1YQVL 2VKWA 3VI3F 3HZMB 2IPKA 3RIFK 5GGSB 1JWMA 1NEZB 3HR5A 1WISA 3RWDB 4NRZB 3PWUB 4KC3B 4YK4B 1YMMB 2JELH 2ZSWB 3HS0B 4HAGA 3U0PB 3OKOA 4LL9A 3VG9B 1BD2E 2QR0B 5HSFA 4GBXC 2EDHA 5E6YA 5FYJU 2WUCH 4YUEH 4P2YA 4HWBA 1FNEB 4PYGA 1I3UA 1P7KA 5DQDH 5DJZB 2X9WA 4WFGE 8FABA 3MLWH 3U4AA 3I9GL 1FVEA 1RHFA 1YNKH 3EO0B 4M7ZB 5I1HH 3S9DB 5KS9A 2YKLL 1V5JA 1MJUH 3K2MC 4NZUH 3TBYB 5HDQH 4XWOD 4TULL 3P4OA 3GSXA 4YFEA 4ZUWA 3BXNA 1QFWM 4NYLA 1U8OB 3AMLA 1IAIM 3DTXA 4P4KD 3VXRD 1WIOA 5MEPB 3V5DB 4DKEH 3SDXB 4JG0L 2QSQA 4QT5B 4UDTA 3RPIA 1I7RA 2FIKB 1MCEA 4J6RL 1OAXL 1OT2A 5E6ID 4YUEL 4LQ1A 5C09B 1U8IB 5BQ7A 2DWDB 3QFDA 4BFIA 1N5AB 2RIKA 2BSSA 3VXUD 4M7LL 5T5NF 3RWGA 2I07A 1IAIH 5E00B 1BJ1H 5IMLA 3B9KB 3UTTD 5I1CL 3ZSSA 1B9ZA 3B5TA 1N6VA 1XGQA 1HSBB 2EYRB 4G3YH 1OSZB 5L9DL 1SJEB 4QHLA 1WVZA 3Q5YA 2VNCA 2IADA 3KR3L 1S7WA 3THML 1KJ3L 4IRJA 5FOBB 1SJHB 3PWPB 4ZAKB 4LRNH 1PQZB 3BQUD 1H5BC 3BE1H 1A22B 1P84J 3H9HB 2FRGP 2QTEA 3ZYOA 4F9LC 5JIPA 2YD2A 5F1OB 2LAAA 4LU5L 1SJXA 4L4JA 5EU6A 3HG1D 4LCWB 2C3WA 4EN3D 2R4SL 4G9FB 1PY9A 4X6DF 2HMIC 3FN0L 3STBA 5EA0L 1TFHA 2KZWA 1CDHA 2NY2C 4DAGH 4OSUL 4Q0XL 4V1DB 4HCRL 1OP9A 3MX0A 1B0RA 2P5WE 1ORQB 3VI4E 1T21A 4JRXE 3JUYA 1FNGA 1GAFL 3TT3H 3TO4A 3K2UL 2DS4A 3GMNB 1E6JL 4WI5A 4YHNB 3HE7B 3TF7C 1A7QH 1GGIL 4G6AC 1T66D 5CZKA 1MIEH 3HI6H 2H6PA 2XIDA 3QNZA 4NKOB 3M8OL 2OTPA 4HLZH 1A7RL 1U8IA 1SEQL 2OMBA 1ZGLM 2ZKHL 4PY8I 3BPNC 5A3ID 5IG7B 4MMZC 4NN7C 3DX7A 3O2DA 3ZTNL 4UB0H 1YNTA 5GGVH 4IOFD 4MHHG 5DURB 4U2ZA 4L5FL 2CR6A 5A2KH 1AH1A 4FZ8H 4M7LH 3SJVD 4FZ8L 3UTSB 1ZE3C 5JPMA 3OAZK 2YSSA 3W39A 2R4RH 4XH2B 3IJSA 4OI9A 3MRPA 3MRKA 3O3BB 3D39E 2DQIH 5HHPB 3WDJA 4XWGL 4AMKL 1HXMB 1I8IA 4CVZA 3NPSC 5DURD 5ENWA 3PQYD 1TVHA 2GUOB 5DTFB 4PGCB 3D9AH 2HAZA 5FKAB 1DJSA 2AI0L 4PJIA 4M1GL 2OSLB 5T1DL 2YSSB 4LEXH 4L9LA 1I9JL 2B5IC 4XP5L 3GKWL 2IQ9L 1U93A 5F7DA 3KDMA 4E41E 3U6RB 4M5ZL 1CLYH 4BK4A 4DGIL 5J11C 5IP4A 3HI1B 5A2LH 2B7DT 4Y5YC 1A64A 3TT3L 3WYRA 2HWZH 5IEHB 2P48B 3FRUB 4ELMF 1UH3A 1CG9B 5KZCD 4DOHB 2SEBA 2X9XA 4WO4B 1TETH 2A0LD 2AJVL 4KK9D 3I50H 4OF3A 1LK3H 1IGIL 2ITDA 5F3HA 4GAGH 1MFEH 1WT5A 1MQ8A 1CFNA 4TSCL 4JN1L 1MHEB 4K55A 4QRRB 1NC2D 1Y6KR 5DMJB 3TC9A 4P3CL 4WW2B 1FZKB 1Q0YL 3ESVF 3G5ZB 3QIBC 1XGRA 1A3RL 2FH8A 4GG6E 1F6AA 3BSZH 4HMCA 5JQ6L 3LS4L 4GXVL 2AK4B 3QIUA 4IDJH 5EO0B 1T89C 1WTLA 1OTUC 5DJCA 3NFSL 5C9JB 1P84K 4NQTA 2R1YA 4LVOC 4N9GB 1F00I 3EOTL 2P7TB 1U3JA 4IRSB 2OR9L 3I3BA 1KENL 4X4XA 1WUNT 4HKJB 2X4PB 5HY9B 4H0IA 3KS0J 4NJ9H 3AUVA 1JGVL 3B9KA 3O4OB 2FJGA 5CBAA 4MQSB 3RX8A 3VWKC 3GMRB 1P4BL 1BQLH 3OX8B 4N9GA 2XFXA 2PYEA 3HMXA 5TE4L 3G6JE 4NKDB 4PJGE 4YDJB 3CFKB 1L4IA 4XI5D 4YC2C 4TUOA 1Q9KA 3CSGA 3MRGA 4GSDH 4P9HL 4XNXH 3UP1A 1ZT7A 4F8TA 1HINH 3QUYC 2EKSB 4BQ6A 5CBEB 1G9MH 5L2KB 5E8DL 3H7BA 3UDWC 3V0WH 3BT2H 4LP4A 3QCVL 1NDGA 3HNSH 3WIHL 2J88L 3VFRB 2J88H 2JJVA 3G6AA 4LCIH 3BPCA 4PTTA 4Y88A 4Q6YA 3HHRB 4KY1H 1I85C 2IANE 1NGZA 1RI8A 5DD3L 4UDUB 1TENA 4B7IA 3MUY1 4DVRH 4QXTA 3GEWB 1F4WL 4M43H 4KI5E 1P7QA 3KNBA 1AD0B 1OSPH 1X5AA 5DD1L 5J0BA 1S7TA 4MXWH 3CIQA 5EUKA 1WEJL 1F11A 4QCIB 2FWOB 3NPZB 4U6HA 3SE8H 1E4WL 5HGBB 2Q8BL 2R9HD 1SM3L 1DTUA 1BIIA 2GKIA 2MPAH 1HQ4A 4DKAA 2O61B 3EDJA 3KAAA 5BZWB 3BQUC 3UZEA 1RZFL 5DMIH 2NZ9C 3TCXA 2XPGB 1LEIA 4W6YB 3V6OC 1MHHA 4KRNA 4ZO8A 1WFUA 1MCFA 1G6RH 4OZGB 2NX5D 3FO1B 3UJIL 1PZ5B 2NY0D 2XICA 4WU7B 5KVEH 4DKDC 3TA3A 3VFVB 3ARBD 4Z76A 3I85A 2AXGA 4JCLA 4NWTH 3ULUD 2VTFA 1CGUA 3U6RA 1MCBA 5DS8B 2P5EB 3UJTH 4JANA 4Z7NE 4OLWL 4GT7A 3B9EA 4XMKH 4TSBL 1KPUA 1L9NA 1UM5L 1Q72H 4NC2B 3FFCD 3WEXB 3QJFA 4UZGA 3HNVH 4HKXB 3WIFB 4X0KA 4Y16A 1DQML 5IBTL 1BQHB 2B0SL 3G6JF 3D2UA 4YIQA 2QJDA 3LRHA 2G2RB 4E5XB 4AENB 3CXHJ 1YNLH 4LASH 2Y06L 2ZOLA 2WIMA 3IDXH 2Y5EA 4MQXC 4OI8A 3V7AG 1HINL 3RDTA 1KPRB 2OL3A 3OXRA 4WEMB 2UYLB 1F58H 3FFCB 1DBML 3G04B 4MNGA 4BK5A 3VXUB 3EOBA 5EO0A 2EE6A 3MJ8B 1J5OL 4D3CL 4MQTB 1HKLL 3JTSB 3L3GB 1XGRB 1OSZA 3JWOH 3SBWC 1R3LB 4G6KL 4Z8FL 4NN5B 5D8JH 4EBQH 5JW4M 1N6QL 3VMNA 5DRXB 1JPTL 5FAAA 4WV1C 2R4RL 3D69A 2P46B 3UTSE 1RZ7H 5LKNA 3FRPG 3BDYH 2Q87A 4JRYE 3EYUL 4PJHA 3QUXA 4EOWH 1FG2B 1MCIA 4DUVA 2R8SL 5KSBE 1FJ1B 3K80A 1BBDH 3FB7B 1N59B 4JJHA 4PGZA 4NHUA 1U3HD 4HKXA 3MV7D 3S5LG 3N1MC 4CGTA 3TFKD 5BRZA 1U8QA 2D7OA 5FA3A 4WV1A 5K9QI 1RZ8A 3PF2A 4JN1H 3WCYA 1A9BB 4RWYH 1T1WB 1RURL 1MWAA 3VFUA 1GPOH 2AJXH 5E95B 2NY5C 1IC7L 3AS0A 1J8HA 2B8OT 1VENA 3AGVA 3RWEA 1FRGL 4NNXB 4NQDA 1CQKA 3OJDA 4HXBL 3OPZH 3O9WC 4UT9H 4XCEB 3EFDH 4HFWB 5I16A 4RQQA 4OLUL 3RWJB 3SDAA 1ZHLA 2PF6A 4XP6H 3TN0A 3CXDH 5IV2B 5KN5A 1A4JB 5HGAB 4XCYA 4EEEA 3ZE1E 3QI9C 4QHKJ 3IXTB 5DUPL 4NN7B 3AREB 5GGQL 5F89A 2XWJA 1JPFB 2Q1EA 1OD7A 3T4AA 3HRZA 2FATH 1WFTA 4IJ3C 4NHCL 3CU1A 4JFYB 1FIEA 1ZMYA 3DECA 5GS1A 1RJLA 4HPYL 1B4RA 5GSVB 2GCYB 1QRND 1UXSB 4H8WL 4YDLC 3QCUL 4D2NA 5F7DB 1UEYA 2A6IB 3O6MH 1Z3GL 1JN6B 1NUDA 1PG7W 1WC7A 4XXCC 4KQ3L 4OCNC 4TNVF 3VH8G 3GO1H 2VLLA 3LN4B 3Q0HA 4OFDA 3ROLB 4OM1L 3TM6A 4DZ8B 4NFCA 1T4KA 4OF0A 5BZDA 2EDJA 4RDQG 3PWJA 3DGGB 2COQA 4MA7H 1RK0A 1IAOA 4C56D 5I1JL 1OAUH 4LAQL 3RDTB 3GMRA 4XWOC 4FQJH 3QR2A 4Y4KB 3BKCH 3HR5B 4N1HB 2ICES 1ONQB 4DKEL 2BSTA 2BFVH 2H9GA 2NY7H 3PNWB 1CDJA 2YA1A 1NL0L 1RULL 1WGOA 4FXKB 1T6VN 1LILA 4PIRF 1IEAB 4Y1AB 2K1MA 2VZVA 1MHCB 4ZD3L 5HHOD 3V0AC 3BP7B 3ULUH 1S7UB 1VA9A 4HGMA 4NCC1 5ETUB 5DTFA 5CFHA 1CBVL 1F42A 3BKCL 1BFVH 3SHSA 4EQ3A 4MB5A 4U1IB 1FO0L 4YGVB 1JWUB 1U2CA 3FQTB 1B6DA 5C0FA 1DDHB 5D7LB 3WIIL 1U9KA 3R0NA 3SPVB 1IMHC 3ROOA 1DQJB 3DRQA 3MRBB 5D72L 4OZGF 1Z3GH 2JJSC 2V7NA 1RIVL 1BAFH 5IIEB 4C58B 1HIMH 3CGTA 3X11A 4RGMC 2BSRB 3ORJA 1INDL 3U48A 2IPKB 1U8LA 4F33B 2XNAB 2HVJB 3C08H 1AO7D 3RI5K 3TBWA 1IAIL 5DA0B 1QLRB 3ZE2F 3ARDD 2A1WH 3CVIH 1XIWA 2MSPA 3MREA 1D6EA 2FEEI 3ZLQC 1TDQA 2X70B 4KKAC 4RNRB 4X6EA 3VA2C 4LFHD 1F8TH 3OR6B 4JFXA 4N9OB 5IROC 5L88L 3NOIA 2PW2B 4FXLA 5TE6H 1D5ZA 4PJAB 4NUJB 3QAZB 1XIWB 2D4FA 5HPOA 2BSED 4LVOB 2A9NH 5JTWA 3VDBA 3QEHA 4HZAA 2AXHA 2EDQA 2FX8H 3P4LA 1G7IA 3G9VA 4YEFA 2P24B 3IDJA 4NIKB 1WJ3A 5D96C 2OL3B 3OXRB 1MFAL 2BNRB 3LKRB 4M5ZH 1T04B 3WUWG 3GKWH 2BHYA 5C07A 5BXFB 4PJ7B 3EHBD 5C0IB 1OB1B 4PYHA 2NPLX 3T8XA 4O4YH 3NCCB 1WWBX 3FOMA 7CGTA 2X1OA 4MNQB 4MD0B 3D2UB 4YIQB 3UPRB 4HFUL 4NSKA 2C4FU 2VLJA 4LMQE 3BN9D 2AS5M 5BZDB 3I3EA 3QQNA 1YPZF 4K71C 3ALWA 1GIGH 3MV7A 2UWEB 4L5FH 3BHBA 2FB4H 4PJ5D 3WFBH 3OKMB 4ZUSB 1S7XA 3MROB 4M8VA 5JW5A 2DJUA 3O6LL 4PV9A 4ZUUA 5DLMH 3D85B 4GQPH 4EI5C 5L7XL 4WVRA 1CLZL 5IKCB 4UUJB 5IW6B 2HYMA 4GOSA 5C0BE 3BKYH 5JXEC 3FB7A 2CDEB 1C8PA 3H3KA 4G7YH 5CGTA 1SJVA 4G8GE 2AJSL 3FO9B 5T1MB 3AS3A 1FH5H 2Z91A 2XRAH 3ARDB 3O6KL 3CFJB 4XT1C 3QHZL 3K2UH 4YX2H 1HDMA 3IXAB 4HT1L 3MV9D 3LB6D 3EJJX 5T5FH 5KSAB 4KK8D 1O5DT 1TQBC 4NOBA 4OCRH 5FYKH 3UCRA 3CLEL 1BIHA 3T04D 3MODL 1BECA 3S37X 3OKOB 3RWGB 2IPUG 1KB5L 1YEHH 1X7QB 2AEQH 1CXIA 1QRNE 2DQHL 2FGWL 4NP4L 1EV2E 4M1DL 4ZS6C 5DJ0A 1VFOA 3EO1A 1NAKH 5TGBB 5DQ9A 4TNVK 1UQSB 2WINA 4DGYL 1S8DA 1S7UA 2YD9A 3GDBA 1H9VA 3M45A 4JFYA 3QXVA 4X6CA 2QHRL 1WQVT 3EYUH 1NAML 5C6PB 3MCLH 5DJAA 1B2WL 1KFAL 3O8XD 4ZQKA 2R56H 3HI5H 1EO8H 3G5XA 3NA9L 2P8LB 1A6VH 3GGWB 2W65A 3KYKH 5HYJA 4OV5B 4NQCB 2GQHA 3MFFA 5E1AB 3S3PA 4QTIH 1CIUA 4M8QB 2P47B 4XAKD 4PJ5B 4JQIL 4OT1L 4Z7WE 4HIXL 2RCSH 4JKLA 4LEOB 4N1EA 4DVBA 2UZYB 4KUZH 5DMKA 1HQ4B 5BOPA 3T0BA 4LLUB 3T08A 3X3FL 4OZ4A 4OUOA 2B5IB 32C2A 3UTPE 3L95A 4JPVL 3RRQA 2BDNL 2V17H 1G0YR 5INCB 1IEAA 1NC4A 1T2QL 5KAQG 2EIEA 1UVQA 3ZE0F 3DX7B 1FPTL 4ODXB 3CDGA 1CE1L 3U82B 4AEFA 3UJJH 4LSDA 3QSKB 1X5FA 2NXZB 3LD8B 2ZOKB 3OQ3B 5DJYA 4OGAC 1N7ML 4PJHE 4AEIH 1AP2B 4RRPG 3STLB 2JCCE 4NO3A 4AIOA 1DQMH 5FDYA 1T2XA 4HC1H 4FZEH 1IQDB 1EEYB 1P7KB 5E8OA 5DK2A 2R1WA 5I15L 1KG0B 2EDTA 3BMWA 4ORGA 1QSEE 1U8HB 1MELA 3B2VL 3DGCR 3UTTE 4L3AA 5DFTA 5I8CA 4AEHL 4LIQL 1QACA 4OIIH 1DCLA 2V2TB 3QUXD 4HJGB 1EXUA 4P4RA 3TYGL 2E6PA 2QQNL 3HRZB 5GRUH 5GS0C 3KNBB 3HUJF 1QZ1A 1BQLL 4O51A 5HHVH 2VE6A 1BFSA 5FGBC 4BA8A 2UUDK 3LS5H 3QNXB 3V2AR 4PD4K 1TJIL 4WJ5A 1ZOXA 4HUUB 5GS2D 1I3GH 3LIZH 4EDXA 3RI5F 3SDCA 2HJLA 1RUQL 5C6TH 5D2LB 2P49B 1QBLL 3ROOB 4WI9A 5F1KC 3ES6A 5ALBH 4HBQA 1MI5D 4D0DA 2JB6A 3U46A 1RZGA 4RMTA 4S1DC 5FK9A 3GSUB 5IVNA 5BV7H 3DGGA 2V2WB 2MKLC 1JF1A 1L6XA 4R4FL 1H3VA 1EDQA 5AWNH 3QNZB 3SDAC 1I8IB 4CVZB 4MYWB 4LCCC 4OGYH 2VLMD 4ZPVB 3U2SA 2W91A 3AREC 3UTZA 1WZ1L 5DEFB 3SCMD 1T0MB 4PG2C 5DD3H 1IAKA 1UJTA 5DEZA 5CIPB 3RUGF 4U4BA 1ZS8A 1BQUA 4KMTL 4D8PA 4YNYB 3QIUD 4X4XB 3BH9A 5JOFA 4P5KA 1ACZA 1OOAA 1AIFA 2BRRH 4LHUB 3V0WL 2RHEA 1LO5A 2ICWA 4KKNA 2AEWA 3J7HA 3VCLA 3EYOA 1HEZB 2AEPH 4R2GB 1DVFB 1JZ8A 1CZ8L 5C0AD 3BGFB 3AMKA 4YBHA 2XY2A 5CEZH 5DVKA 3FB8A 4HS3A 4OZ4B 3TH3T 5D71L 3RIAF 4LHUD 1FSKB 1A6TA 1ZA6A 3G6DL 3NPSB 2YN5A 3VFMA 4R0LA 3WKMH 1KOAA 1T2JA 1HI6A 1VSCA 2DQCL 3L3JA 3LZFH 4NKIH 4TUJB 5FYLE 5J06A 4X80H 1BM3L 3IFNL 3DO7B 4U31A 3U9UA 1MAML 3NMEA 2ID5A 1A6AA 2QHRH 1FLRL 2EEDA 4I0PA 4XWGH 1CFQB 4PP2A 2VQUA 3C6LD 3BAEL 2ENSA 1DQLH 3STLA 5GJSH 2X42A 3UPAA 1A6VL 1GGYA 3RPKA 3P9MA 4GMSL 5TPWH 1IRAY 4AEEA 1Y0LA 4M62L 2DQGH 4R7NA 3SE9L 1VB9A 5IKCA 5I6XC 3MO1A 4POZC 3SO3B 3C8KB 1CGSH 2A73A 5EG6C 3U79A 2Z93B 5SWSE 2ERJB 2FO4B 1F4AA 4KHXH 4S1RH 5H37G 3RVXC 3K46A 5ESAA 4PJFE 5FF6A 4Z7QE 2DIAA 5HI3D 5FO7A 4YX2L 2EC9U 4J4PA 4YDJA 2GJ6B 4R7NB 5DSCB 2Q86A 4DZ8A 5A1AA 5KVGL 3MLZH 1KTLA 4HCRH 1FHGA 3CU7A 1FYTB 3P77A 1EO5A 2BZDA 4I3SL 1LNUB 1K4CA 1JI2A 3Q6GL 4BUGA 1KCLA 4X8JB 4HHAA 4WNQA 3NIDE 5D1ZD 4OM0L 3O3DB 5D2LF 2CDFA 4P2RE 1MRFL 5E8PA 4AT6B 5DO2C 1GSMA 2LAGB 1V7NL 1I8MA 4O58H 1TZIA 5T1KA 1E4XI 5IMMA 2HT2C 3SDDB 4HJGA 5DJXA 1ZLUH 2E27H 3QISA 3DVGB 4ZUUB 1I8KA 1ZHLB 4APQA 5L7XH 1CLCA 5CJXA 4UUJA 4PJIF 4Z7WF 4YZFF 2Q7YA 3WFBL 5DGRA 3C5ZC 5B21A 1B0RB 3KG5A 1OPGL 5CINL 4LLYB 4K8RL 1I9IL 2WBKA 3BQUA 4M48H 4WW2F 1YEEL 1JGLH 2EXWC 4Z7UA 2EDRA 1V7NH 1DUYA 4DGVH 3LQAH 4Z0XA 1QYGH 4HUVA 1J1OL 1NMBL 3MZGB 5L2JA 2I5YH 4MXVE 4WO4A 2HJLB 4RIRB 1JFQH 4TNWK 5KJRH 4E42A 3C2SA 5EUOF 4YHIB 4I3SH 1XGTA 5JO5A 2VH5H 3PXJA 3W11D 2GSGA 4X4MA 3GSNA 4FQXA 4OJFL 2H2PC 3EO9L 2D3VA 2D7TH 1EPFA 4E41A 3LPWA 4Z7OE 5MEQB 1IM3B 2LABA 1J88A 3LQAC 1NBZA 3OZ9L 5I1EL 5CJ8A 3CVIL 4NZRL 3C8DA 1YY9C 5IB1A 2EO1A 5EA0H 1J0KA 5C0CE 3RWFA 5EUOB 4N0YH 3RVVC 1WWCA 4I3GA 5C71A 2J8UA 4MX7A 3E2HC 4LKCA 2VMFA 3TBTB 4G8IB 1PZ5A 3BE1L 4XP1L 4K94L 4P5TC 4Y4FA 4Y19E 3O2DH 1JHTA 5ESVA 5KSAC 4WTZG 5I74C 5CS7A 5IFAL 3GNML 5EIQA 3E0GA 1PJ9A 3QDJE 3TEUA 3KR3H 4TVPL 4WU5A 5DDHB 3P3YA 4FHBD 4QHKI 1EUUA 3HMXL 5IB4A 1M7IA 5FDWB 3FN9A 4IMKC 2VLRE 4KTDH 5AYQA 5ICZB 3QI9D 1CL7I 2YA2A 5EOTA 3TZVD 1JHTB 3MRBA 3SCMC 4CNIA 2ZP0T 4KRPB 5IB5A 5J13B 3GMOB 2CO7B 3T2QA 1FYTA 3U7YH 4JQXC 4UT6H 3O9WD 4GMTH 1D3CA 2YD5A 1FNLA 2EIZB 5D1QC 3U0PA 1MHPH 4APQC 1UWXH 5ID0A 2A83B 5E2TH 4D9LL 2DLHA 3QBTB 3BVNA 3DXAB 3V4UL 2CDGA 3KPSE 1G84A 3MMEA 3W0WA 4C54A 5J9PB 1KIRB 3D85D 5KJRL 3P11H 5CKAA 2HJKA 4X7SH 2YPLE 4OFIA 3GSVA 4W6WB 2NR6D 4PBVC 4UNTA 4XCCL 1X5ZA 3N1GC 2VLRD 4NZUL 4R7DB 5FB8A 1AR1C 1EVTC 4FQ2H 4GKSB 4J1UA 4Y2DD 1HZHH 3QDJD 4QHNB 4XVJL 3TVMD 3MYJB 2EEBA 2QHLA 4H8WH 4Y19D 3MRFB 1AO7B 4U0RB 2XXMB 3P4NA 2CUHA 4NCDA 2P8MA 4NKMB 3ZHLA 2F5BL 4GLRI 4OZFA 4HEME 4HJ0C 2FATL 5GRZA 3MRQB 4OM1H 1T4KB 2JELL 5E99L 4L8SC 5ECJE 4QRRA 2DKSA 5F88A 4DTGH 4KPHL 2NY3D 2ZUTA 3SDCB 1NMAH 1OAKL 4ZNCD 1C16A 4GUPB 1KXTB 5IESH 2F74B 4XP1H 5C6TL 3QCUH 3FB8B 4HS3B 4A2LA 5HYSA 2Z92A 2R0WL 3V6BR 3CFEA 5EC2B 5C0BD 2ZJSL 4NQVA 4HWBL 15C8L 4WFED 4UV7H 5C0CB 3S35H 3TA3C 2BNUB 2A6DB 3GSXB 5E9DA 5F7MC 1MOEA 3AS1A 1NGZB 2JCCB 3MOQA 2EDKA 3MBEB 4YHOH 4R4BB 3UBXB 1JGUL 1L7IL 2EDXA 4AG4L 4ERSL 4PJAA 5J57B 1BVKA 3ALXA 3V79C 3MJ6A 3FQRA 2F53D 4JZJB 4LKCB 1Q9LA 4YGVA 2X1QA 5GJTH 3H9SD 4PJAF 1OTSC 1UG9A 4Y4KD 3G5YB 3SE9H 1BVKB 2UUDH 1ACYH 1NGQL 1RZIA 4Y8DC 1G9NC 2ADGA 4UIMA 3VRJB 5C0AA 5C07D 5A16A 2DDQL 2XG4A 4KHTH 3QHFH 2H3NA 3DXAD 4L4VB 4ODXA 3T4AB 3K4ZA 4YHIA 4MXQD 1IGFL 1MLCA 1WIUA 4JLRA 1N6QH 1W8OA 1UCTA 1VFBB 1NCTA 2GTWA 3RGVA 4OZHA 4JZOB 1VPOL 3UO1H 1TITA 2K7QA 4FQXD 3RJDA 1U8PB 4WO4D 3WSQL 5T3XH 4BSWA 4P3WA 3U36A 1OAYH 4OCLC 3VJ6A 3F5WA 1U8KB 3EYQD 3BEWA 2RCSL 3BUYB 4RGOL 1DLFH 1CFSB 3QUYA 3O2WH 3GIZL 4Z78A 1FZOB 2OJEA 2VXQL 3MV9B 4U6VH 4F58H 4K7PL 1WWAX 4FA8A 3I6GA 3FRPA 3MV8B 4FOMA 2O5ZH 3FAWA 1UKQA 1ETZB 4LKXB 4S1QL 3BH8A 3L5WA 3L9RB 4BQ9A 5JHLH 1UWGH 1HXYB 1A7PL 1CFVL 4BFGA 1BZ9B 2HG5A 1VACA 3B9KC 3SGJC 1ERNA 5F7UA 1FJ1A 4FQLH 1R3IL 4X9IA 2Y6SC 5B8CB 5E6IC 2X09A 4RAUA 4IHOA 1CDGA 3ZHKA 4CU7A 1U8LB 1Q0XL 1Q72L 1VGEL 3TO4D 3ALPA 3RNKB 1NSNL 1OHQA 4F57H 2OK0L 1DUYB 4M6ML 1S7RB 43C9B 2HRPH 1PGRB 5JIKA 5ID0B 2AEQL 5CEYB 1JUFA 2ADIB 3IJHB 1YEKL 5F88B 3OKLB 1J0HA 5MP6L 3ILPB 3X12A 1N2RB 4LGPB 3X3GH 3RWHA 2X70A 3RWEB 2DICA 5E4EC 1KLFA 2YC1A 3D39B 4S0SD 3OKKB 4LSPH 2E9IA 1Q94A 5JOPE 4UQ2B 5GPRA 3S34L 3RKDC 2OQJA 1FN4A 1JZ5A 5DZOA 4EUPH 3ZTJG 4QHNA 3UBXG 5F7WC 5IB4B 2NCMA 1MHCA 1SQ2N 1OWRM 5KANG 3RJQB 3LS5L 4HK3N 5EN2A 2FX9H 5EOCL 3FB6B 3TBVA 2RGSA 3ULUF 1ZHNB 3LQZB 1UWGL 2G2RA 5EOCH 1C08A 1T7XA 3T4YB 1NCUA 2B20A 3B6SA 3WN5C 3HB3C 4GO6B 4XPGH 3V7MA 4NKMA 3V0VB 1CZ8H 3OKNA 2EDLA 1ZVYA 3O2WL 5DHVA 5C0EB 4CJ0A 3MUGB 1T1WA 2X89A 4XPFH 2R23B 1LP9A 3GRWA 4TUOB 4P2RA 2ESVE 3VD9A 1FAIH 2CMRL 5EZIH 4U6HB 3QO0A 4A6YH 2R2HB 3OJVC 3GMNA 3IETA 5MP6H 2R29H 1BLNA 4N90E 4JLRB 2BXYA 2F8OA 2W9DH 3ES6B 4MXWL 1J1PH 4LSVL 3VDCA 5E03A 2FO1A 3L7FB 1SY6H 4P2QD 1WBXB 4MAUH 1NSNH 4C57C 2XWTB 1NLBL 3MC0A 3P9MB 2PXYC 4OF7A 3UYPA 5ADOL 5C09D 4DK6A 1GRWA 2HFGH 1V3JA 3MRNA 5E8EA 3C5ZB 4I18B 4BQCA 3PWPA 4ZAKA 1A02N 2MNUA 4NUJA 3VFRA 2N56A 5BV7L 2Y7QA 4R90L 4P4KB 3VXRB 1UACL 1DUZB 1C5BL 4RBPK 5E8DH 3TESA 3M1BA 1RJZA 4BQBA 1UA6H 1TJHL 4ZPTA 4NRXB 4Z95H 3D18A 3CSBA 2R9HC 3DROB 3TO4C 4NKDA 4KI5C 2AJYL 3BZEB 1MWAB 1KCSH 4PJIB 5GQBA 2BERA 1PKQA 4HJJL 5DDHA 2HT3D 1U8JA 1A7NL 4F7PB 2C7UB 5D7KD 1MRDH 1E4XH 1YN6B 1I7ZB 5E94B 3P0VH 3JWDH 1ZA3B 4JCMA 2BNRE 1XGTB 5JO5B 4ODUA 5FUCE 1INDH 4GRLB 5B3NA 1LP9F 1ED3A 3PWLB 4OLEA 4PG2A 1MHHB 4M6OH 1QEWA 3ZDYE 4X5WB 3EDEA 2HP4A 4QRPD 1MUJA 2F19H 1A6PA 1BOGA 4P23A 5H35A 1XGPA 2RR3A 1I1FB 2O93L 3WFHB 5HHXH 2OQJB 4OCYL 4Y16D 4P46C 3VRLF 3WBDA 5D2NB 1KPUB 1W72A 3AXLA 4XXDB 4PJ5A 1AI1H 4N1CA 1P7HL 2FWOA 5HHPA 1A8JH 3D3VB 1JBJA 3PGFH 1G9NH 1D5IH 2NY2D 2YN3A 1MREH 4XAKE 1G1CA 1C08B 1T2QH 2EE2A 4N0FB 5EU5B 3IDMB 3VXMD 4RGNE 2AJSH 3QUYD 1MRCH 3BZDA 5IQ7L 4PJDA 1NMCB 4Y4KA 3E1F1 1KSRA 1ZGLP 3MCKA 5JMOC 1NPUA 2M1KA 2WUBH 1AO7E 4X6BB 3A6CH 4OZGE 3WJJA 4PRHE 3DNKA 3RGVD 4KDTA 1KTLB 5BS0D 3OAUL 4JQVA 2VXQH 4U6VL 3BESR 2IBBA 2X4RB 4O9HL 4YR6A 2CJUL 4UT6L 5DD0H 3SDAD 3OB8A 3QXAA 2F74A 3MSPA 4IIQB 5F1IA 4TPRL 2W59A 5IUSA 4X6FB 5E5UB 1S7XB 4MNGB 4QXUL 2FL5B 5JW5B 3IDYB 1MHEA 4RGNB 4WY7H 1NGWB 1TMCB 3QEQD 5IROA 4PG9B 4KKCD 4U33A 4YBQC 1MNUH 2DB8A 5D7LE 2H32A 2E27L 1GZQA 5BV7C 4ZQKB 4WW1B 5DT1H 4FFWC 4LLMB 1U3YA 5IEKA 3FAXA 4UI2A 3ARFA 2CJUH 3OV6A 4GKSA 4J1UB 4JFHE 1MLBA 4GG6B 2PXYD 1OVZA 4UOW1 5D2LE 1TVDA 3ARWA 2FX8L 1IC4H 3SY0A 3BP4B 1BF8A 3AM8C 3R4DA 3DSNA 4ODBD 4PGEA 4OSUH 4Q0XH 2IH3B 2X4NB 4G8GD 4BFEA 4NKOA 4WWKC 4UQ2A 5E2TL 5EWIL 1JHKL 1X7QA 1AQDB 1X5JA 1ZSDB 2CQVA 2DBJA 2UWEE 2VXUL 3SGDH 3WLBA 2GFBB 1H3PH 4ZS6D 4L1DA 5TGBA 4PRHD 1FFRA 3TCLB 1B3JA 4JPKL 4KJWD 3U7YL 4EXKA 1BGXL 3O41B 1C12A 5B39B 4KJPC 3VXTA 3VE0B 3V5HB 1GZPA 4EIGB 1UJ3C 2CKBA 3BZFA 4P46D 3DV4B 5F9AC 1JNHB 2MQCA 3IU3A 1QYGL 3BDBA 1JWSB 2D4DA 3IF1B 5EC1A 3F58H 2Y36L 1S7SB 3QIUB 1QP1A 2F54A 3DUSA 1OQOA 1A3QA 4KJYA 1IGTB 1JGLL 4CBPA 1KEMH 5DT1L 4IMLA 4BELD 2AV1A 1PKQB 1D6VL 5FHBH 4I13B 4NRXA 2FYYB 3BKJL 1JPGB 1YPZB 3PDOA 5L2KD 2AK1H 5IBLD 1IGTA 1FZMA 3FFCA 1HHJA 2FEDD 3KPOA 5CSZA 3A0OA 4PRAA 4DUXA 1ZT4B 1PBYA 4LDOB 3KJ6H 3QUZD 5IF0A 2VLJD 2WNGA 1UM4H 5I0DA 2D7TL 3DVNB 3DUHA 4X4YB 1AE6H 4JHZA 3Q6FB 3DYMA 5DJYB 2DLFL 5IB2A 5D7KE 3MUHL 5E2VL 5ANMA 3OF6D 5C0IA 1AC0A 3U0TA 3DURB 2PCPA 5KSVA 3MLZL 4AY0A 1P69B 1RUAL 4V1DE 2EDDA 1BLNB 1NCWH 4PPTA 3J8F7 1QSEA 4PRDA 3HC4H 3S97C 3KJ6L 1R5IB 1EBAA 1GOHA 5BW7A 3PXHA 1KN2H 2P45B 4GKNA 5DMGD 3WXWH 4ZFOA 5C0DB 4M48L 3O3BA 5B38B 1YY8B 2FX7L 4RSVA 4HH9B 4PGJA 4PD4J 3QRGL 4KDTC 4YHKH 5AWNL 5D1QA 5A2FA 4MWFA 1Z5LA 4XMPL 4NWTL 4POZD 4PLNC 3UYRL 4LRIC 5C86A 2I9TB 1WICA 2NY1D 3RZCD 3F7RA 4YBQD 4AQOA 3ET9F 1ZVSB 3BWAA 1D5MA 3UJIH 3FT2B 2JIXA 4U7SA 4NRZA 5F1SA 4GKOA 2BVPA 2XNAA 4L8CB 3EFFB 4E41D 5KANI 4RA0C 3QUZA 5HHOE 1UB5A 5BZWA 3BIKA 3JV4A 4PRPB 4UT9L 3RTQB 2E7CA 1YEIH 3KLHD 1D5MB 5L0QC 3S7GA 3ULVL 4NNPL 4GRWH 4MDIA 1FVEB 4X9FA 4RZCB 1OAZH 4EUPB 1PX4A 1QBML 5DVNA 3RVVD 3WNOA 1FZOA 1RURH 1KELL 4U3CA 4Z95L 1LGVA 5DO2D 3ARED 4R97C 4XVUC 4RCAA 4UDUA 3WUZA 4QWWD 5FGCB 3VWKD 1E0OB 4JANB 4F37F 5JUEH 3G6JB 5DJDA 4YQXL 5AZEH 1IC4L 4F7MA 2YRPA 2X4TA 4WI3A 3FT3A 3RDTC 1OP3K 2N4IA 1RZ7L 2ZCKL 3UJJL 1E27B 5CUSH 1I7TA 2V7NB 1Q0XH 3PNWA 1PFCA 3BDXA 1LP9B 4PJXB 4M6NH 4M7ZC 4FTVE 2XWBB 2MTPA 1JJUA 4A6YL 2YC1B 4OCXH 1Y6MR 4GS7B 4CJ1A 3QUMB 5EBWA 4MD0A 1WC7B 5DMGC 3FCTB 1A9BA 2HT2D 1MCKA 2VLJB 2QBWA 4M61B 4YHYB 4HW6A 3ARBB 2EXWD 1SYSB 2BVTA 5FHAH 3CXDL 1AGDB 1U8PA 5TQ0H 4DN3L 3DURA 3WHE1 5AAWA 4OM0H 3ZDYF 4QRRE 2A9ML 4QRSB 4RGOH 4JHWH 2Z91B 3TFKC 5IK3B 2J5LB 1LP9E 2OS7A 3MCG1 5J89A 5IQ7H 2D7MA 3V52H 1JVKA 3RVUD 4ONGH 4QO1A 3TO4B 1FC1A 5HYSG 1FFNB 1UKTA 2FECI 1HH9A 4MWFB 3LKQA 1VCAA 2ATPA 4XMKL 3SE3A 3PABB 3MA9L 1FNHA 4S1RL 4YHLH 3MRMB 4CN6A 2H32H 1MAJA 5IVZB 4MJ5B 3B3IA 1LO2L 1QBAA 5FA3B 3RWDA 2VQ1B 4CVXB 3JV6A 1TTFA 4YDIH 3D0VB 2H1PH 4PRDB 3ZSTA 3L7EB 4WU5B 4HH8A 3V8CA 5HVWA 3BN3B 4BH8A 4GBXD 5I1GH 4ELMA 2GIYA 4PJ8A 2V7HA 1HSBA 5C1MB 3PL6D 5FHAL 4ZUSA 1FLRH 1S9VB 4XPHH 5F72S 2IBZX 3K1KC 1YYLH 2R0LH 1TPXB 4EDWL 1E4XL 2VL4A 4OCMC 1RVFH 4JHWL 1AC6A 3HZYB 3QDJA 1YY8A 4S1QH 4Z7WB 1W0WB 4Y19A 4XNQB 5TQ0L 3GGWA 2VO5A 3BO8B 3KPQA 2CLVB 1W72H 4HG4J 3WL9A 2IMNA 3SKNB 5K9OB 2ED8A 5DRNA 5BJTA 2AV1B 3JBG7 4XNZB 4RFOL 4QCIA 3SY0B 4NQDE 4QRUA 4HIIB 1T03H 5FDWA 2ORBH 1HHIA 3VFGL 4Y8AA 3VG0H 1XGYH 1FORL 3VGDA 4PJGA 1NUGA 3T77B 5EC2A 3KPPB 3RDTD 4CMMB 1EZVY 2APVA 3QO1B 2J12B 4OQTA 3HI6L 1AR1D 4Y2DC 2ZCKH 1INEL 1JNLL 1KELH 4KH2A 3KPLA 2FL5A 2NR6C 4R4FH 5D7LD 3MRQA 1JZ2A 4OD2B 3RWFB 4CU8A 3O45A 2DQUL 3KXFD 4JKKA 3MREB 2NXYB 1FAIL 5EZIL 2PTVA 2HKHL 1JYXA 1LE9A 1YEIL 3BRFA 4PRNA 5I18H 1OM3H 2P5EA 1H0DA 3NFNA 3GHEH 1TQCB 5GZOC 1EX0A 2YPLD 4U1SA 3I6KA 3DVIA 4PJ8C 4R4NC 4ZXBD 1UB5B 1RUPH 1A3LH 3KLHC 2E7LA 3EOTH 4D0BA 1T6WA 5DD6A 3B6SB 5HHVL 3VI3E 2JE8A 2VDML 4P2OC 2HT4C 3GJFA 1DQJA 3UYRH 4X99B 2Y25A 5IMKA 1RJCA 1GHFH 5E8NB 4S2SA 4KAQH 3HMXH 3QFJD 3WJLC 5DI8A 3CSPA 4TOYH 4MNGE 1RIVH 5FM5M 5ITFA 1CDIA 1NUFA 5CZXD 4WI4A 2R0ZL 1MJ7L 3MOBH 4ZFZB 1MWAH 1SMOA 4KI1A 1S9XB 2GY7B 2ZCHH 5LWYL 1PG7H 1U8QB 2EE3A 5GS2H 4H25B 2KL6A 2F5BH 2CIKB 3IDIB 1EO7A 4O2EB 2WWMC 3HNSL 4K2UH 4R8WL 3IKCA 5HXMA 3MLUH 4P23D 1JMZA 2PCPB 1CXEA 2UY7A 1HOCB 1KJ2A 5C0BA 3SJVA 3ZDXF 1P4LB 2NTFA 3BD3A 5I1EH 2ZG1A 5BVPL 3HC4L 4NT6B 1G7LA 4IOSD 2CGRH 5A3IC 3VXSA 4XCCH 4HUVB 3QEHB 1J0ZA 4UQ3A 2LTQB 3P11L 3QUKA 2B1AL 3C60B 3X3FH 3W11C 1CN4A 5C0BB 3EOYG 1TZGL 4M3JA 3FT4B 3OB0H 2O61A 1JGEB 1IT9H 3DMMB 1KUMA 2FJFA 2J4WH 3FHQA 5AUMB 2WUCL 5D6DA 4CNIB 4MGXA 5FO9B 1DEEB 3QJHB 4KGLA 5F97E 3WLBB 1UXSA 1ETZA 5F6HJ 2FB4L 4P2QB 3PIQB 4ZO9A 3DX8A 4H20H 1KENH 2R1WB 3C09C 1KPRA 2CXKA 1NLDL 2OTWB 1NFDB 1I9IH 4XGZB 4U1LB 3BGMA 2CKBB 1NAMH 4GLRH 5JIHA 1NCBL 4PJCF 1Z9SA 5M7QA 4HK3J 3RWCB 1K4CB 4PJXF 1FVCA 4JKMA 4KK5C 3RVTD 4PREB 2ZKHH 4HJ0D 1EZVX 4X5XB 5CIPA 5F7EH 1IGFH 1PEWA 3C6SB 3FO2A 1X5XA 3TBVB 3GM0A 5C09E 6FABH 2HTLC 1A7QL 1CE6B 4PJ8D 3I02A 4YGAB 2GJZA 4P2QE 4JGJA 4YDKL 1ITCA 1AGBA 1BVZA 3QUML 1F13A 2ADFL 5LG1A 3VXPB 4Z77A 1UM6L 4XNQA 4FQQB 3IYLW 4NQEE 3BP5B 4UTBH 5ADPL 3PDOB 3VGFA 1CBVH 2H6PB 1F2XK 1H8SA 1ZLSH 4MAYB 1NGXB 1VADA 1OTTD 1UZ8B 3I02B 3GSQB 3VA6A 2DLGA 2BNQB 1G0DA 5IBUG 2AV7B 1TCRB 1D9KB 2ITDB 2Y9RT 2GYSA 1LEKB 4NQEB 3NIDF 2BHUA 4R96B 3WD5L 2HJFA 5F9OL 4KHXL 5D7JA 3SJVE 1LMKA 3LN9A 3OAZH 1CGSL 4FQJL 2BC4B 1IM9B 2JB5H 1FC2D 2NXZD 4QXWA 4MVBC 2XPGA 3VGGA 4EOWL 1LEIB 1TCRA 5HYIA 5BOZG 4AMKH 3TBSA 2DWEA 1CQYA 3MLXH 5GISL 3HB3D 1N4XH 1DE4B 4KQ3H 1S5IL 2AJZB 4GW5B 4NCC2 2OSLA 2UVEA 4ZOEA 5C7XH 1A1OA 3RL2B 3MRCA 4G7VL 3LEYL 3PDDA 3M1BB 5DZNA 5DA4A 3VCLB 1IGML 1ZLUK 4ORGB 2WK2A 2PO6D 1IKFH 4FABH 4WFFD 1I4FB 4RGNC 4WDIB 5ACLA 5J6GA 5FA4B 2DMBA 1JYVA 4D3CH 5ERWB 4HG4K 3NFPA 4HKZA 3ZKQD 5BQ7B 4IHOB 1IAKB 1NCNA 3UX9B 1C7TA 4F37K 2W0FA 1ZS8B 2WWKO 2JF1A 3T0EC 3X14B 1SVZA 4F80A 3HZKA 3RUGB 5GRYA 3TO2B 5GGUA 3FL7A 3KDMB 2VKXA 1P9MC 1Z0MA 4YHYC 2BJMH 5ADPH 1QBBA 4R8WH 3B2UD 3T3PF 5FUOL 1MI5A 1IC7H 2E3VA 1V3LA 4YBLC 3BIAX 4MDJA 4ZUVB 5GGVY 5D1XB 1QA9A 3GUTB 3RVUC 2V2WA 4TSBH 4K7FA 5E6ZA 2A6KA 1MJ7H 5F9JB 5T5NG 1P2CA 1KJ3H 4JN2B 5IVXA 2AXFB 1LK2B 3QUKB 4U05A 1S9VA 5L6YH 2EDOA 3EOAB 3HE6D 2YEZB 1ED3B 3PWLA 5D96B 3FB6A 2KUTA 2X4TB 5INDA 3BPOB 2CR3A 4GRLC 1OGTA 2I27N 2PXYA 3VXSE 4KZEH 5C0AB 1MCJA 2VLME 5HD8D 2ZG2A 1F6AB 1V05A 5D7IA 4I5BB 3NAAH 5JW3L 4M7LT 2X5PA 4S11A 4H20L 3JWNC 1RUQH 2Z31A 1NJ9B 4N0CC 1K8IB 32C2B 1FDLL 1CL7H 1I9RL 2G9HA 2JIXD 3VRLE 3IDNB 1C5BH 2VDRL 4P3DA 3L3KA 5BCAA 2BVOA 2C1PA 4X4ME 1NCCL 1QO3B 5EBMB 5D9SB 1U8KA 1OD9A 3SE8L 3QT2A 5F6IC 4NSKB 4UOW0 3LSOA 5D71H 2AJYH 3EYVA 4EVNA 2F53E 2FJGB 5DUML 3W9DB 4GQ9H 3SDXF 3BZFB 3OAYH 4HX1A 5AEAA 3B2VH 1MJUL 2CK2A 2V5YA 5DK0B 1VEMA 1YNTB 4F9PC 5GGRY 3QULB 3KLSA 3FB5A 3RGVB 1AXSA 1OAUL 4LAQH 1MQKL 5C2UB 2MHAA 2PW1B 5IBTH 5JDJA 4MAYA 2ORBL 4D0CB 3H9SA 1W72B 2HJKB 3FFDB 4CMHC 5CCKH 3HRPA 5L2JB 2V2TA 4XZUB 5CGYC 3I75B 3WFEH 4N8CL 4HV8B 3HE7A 4XPFL 2R0ZH 4PLKD 1CE1H 4FN0A 3S36X 4Z78B 1FPTH 2WIIB 4NWUL 3U7WH 4XNXL 4JFEA 4P9HH 3MJ7A 5DF0A 5CD5D 2VDPL 2X05A 2L7UA 2FJHB 3AB0B 3NIFE 4XB8A 2OLDA 2YMXL 2GTZA 3O8XA 2NY5H 3OMZA 2EECA 1P6FA 4P46B 4PJ7E 4KUZL 3CFBA 4NUGH 1J5OH 2BOCB 3FO1A 4ODUB 3WLWC 4GW1B 3RFZC 5ISZE 1DQQA 2VAAB 4JR9L 3OXSA 1JPST 2V9TA 5FYKE 3ZKMD 1KGCE 4LRIA 4ZODA 3WJLA 4Q7DA 5CAYB 4XNYL 2IMMA 4L4VA 3LIZL 3UTPD 1UQSA 5IWLA 3GHEL 4V2BA 2BNUA 2EZ0D 3AAZA 2OR9H 2XZQL 3NAAL 5I18L 3CCHB 1EMTH 2Y06H 3HN3A 5FYLD 5I74B 1MF2H 1BJMA 2IAMD 4LCCA 3O4LE 4LSPL 2QADD 3JTTB 3REWB 4MJ4A 1A0QH 1U8NB 2AJXL 3ESUF 5DUBB 3W5NA 4WCYH 5I8OL 4GW4A 1U6AL 3CUPB 2IF7A 3QUYB 1CFSA 4Z18A 2HRPL 3HNTH 3ILQC 3O9WA 1I75A 4NQCA 5JHDB 1F4WH 4RMQA 4PTUA 1BBDL 2ADJA 2VLKA 4S1DD 4JHAH 1FNSL 2W0KA 4DWHA 5DS8A 3BPNB 4FQLL 1G0XA 3GJFB 4PLJC 2FZ3B 2JK5A 2X4SA 1ZT1B 4ZTOL 2M8XA 2HRLA 3IJYA 4F7CB 3QEQB 3HMWH 5D7JC 4FQCL 4JKPL 1AJ7L 4XB7A 3PGCA 1VFMA 3HUJA 3QZWA 4DZBA 2AERT 2ADGB 4UIMB 5FYJL 3VRJA 4F57L 1XGUB 4RIRA 2QLVB 1O7VA 3BHBB 4J7RA 4L29B 2NYYD 5KTEL 2QKIA 4XNYH 3VFOB 3OJDB 1P5VA 5D8JL 5IGXH 1OGAD 4PJCB 4P23B 3QDME 2I07B 3O45B 2HFFB 4K9EH 5D5ME 5J7CC 1N2RA 1FE8H 1P4BH 3IFOB 4ENEC 2DIJA 2Q8BH 4NGHL 2YMXH 3LCYA 2MMXA 5DLML 3S37H 3U4EB 1T5WB 3GI9H 4JFDA 5AG8A 4ZFOL 5CEZL 3R1GL 5ACZA 3NZHH 4K7PH 2MQ3A 1EAPB 1HDMB 2OZ4A 3NBNA 1S5IH 3FT3B 4NC1C 3MNVA 2OI9B 1Q9WB 4DQOH 1U8OA 3HAEH 1NGQH 5FYJE 5T3XL 3MCKB 3EFFA 3T3ME 5I71B 1CK0H 4LARL 1JTPA 2YWZA 5FA4A 1XF1A 3F12B 5JHDA 1S5HA 3PV6A 1SEQH 3AB0C 5GJTL 1WBZB 2EDBA 1R3KB 3PDGA 4ZFFA 5IM7A 3NN8A 2BVOB 3QG6B 3QAZC 1Z5LB 3E3QC 1E6JH 2P8MB 4GSDL 3NACH 2QR0A 2HFTA 3LKOA 1F3DJ 4JZJC 3ARFC 1NFDE 4QLRA 2MWCA 3C2AL 1TZIB 5J12B 1NBZB 4I2XA 1EH9A 4IRJC 2YRLA 2ZUQB 2NY0C 3DPBA 1YA5A 1RZ8B 5EC1B 5CJBA 4KROC 2RB8A 4PLJD 2AP2A 3NGBC 4E0RA 4R2GD 3QDGB 4LDEB 3VWJA 3JVGC 4I0KA 4XC1L 5L8JB 3RZCC 3ZE0E 5ITBH 1GGBL 2IBZY 1UC6A 5TFSL 2P1YA 3CH1A 3UC0H 1FLTX 3V6FB 5TJWK 3KWWB 1OY3B 1PG7X 2AK4E 5F7FA 5DVMA 4PJXA 2H26A 4GXVH 5CEXB 2D31A 3QRGH 2V2XA 3CX2A 4MXQC 4XXCA 3F7YA 3T8XB 1ND0B 1E4KC 2PTTA 5SWZB 5EO9B 3TZVC 4U1KB 5C92A 4FQ1H 4DVRL 2VB5A 5AZ2L 3HAEA 4HULB 5KSBB 4FMKA 3GSNB 4CW1B 1CVSC 1NKRA 4UB0L 5EZLB 2C3HA 5GSRB 2FR4A 2BY1A 4IMKA 5CILH 5E1HB 2VDLH 4X9HA 1IQDA 1MQKH 4WI6A 5EIIB 4AEIL 1TETL 2AJVH 1T7VA 4J8RB 1SBSH 1CD0A 1RV6X 5E2VH 2V6HA 3JV5A 2B1AH 4N0UE 2XN9B 5BRZE 3KHQA 3AC0A 3BD4A 4EI5A 3BVNB 1J1XL 3DXAA 1OGAB 1LDPL 4GQ9L 1LO3H 1U0QA 3T0DA 3D69B 2J8UB 2A6KB 3D87B 4BSVB 2P5WB 2IQ9H 1I9JH 4XP5H 1YYMH 5E7BA 3OGOE 4JVUA 3I84A 3B2UC 3K8MA 1DBAL 2ED9A 2VDRH 4OTXL 1KYOK 4P4KA 3VXRA 5DRZB 4YE4L 2E7HA 4JE4B 3Q5TA 1AQDA 1ZSDA 5FHBL 2PYFA 3KYOB 3H9SB 4OF6A 2XWJB 2GEEA 4M9OA 5E2UH 2NMSA 3IGAA 3MFGB 5JW3H 4IS6A 4CVWA 5LQBH 1UYWH 4KZEL 1PYWA 4NQDD 4PJ9A 3S4SA 1KJVB 4FQHA 3EW3B 5GGVL 1DBJH 1OLLA 4I0PD 2NTSP 1D5BA 4BM7A 1BPVA 3L3DB 3MLVH 1DDHA 5D7LA 1U8MB 4XBPA 1NKOA 2X4QA 2JB5L 4JZNA 1H3TA 1ZAGA 4XCEA 4P2OD 4PJ7F 3RU8L 3M8OH 3D5OF 5IFAH 5D1XA 5EPMA 4W81