2B3RA

Crystal structure of the c2 domain of class ii phosphatidylinositide 3-kinase c2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containi
publication title Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2alpha.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2b3rA00
1UOWA 2YOAA 3JZYA 2K45A 1HE8A 3PS6A 4IHBA 3TL5A 2CJSA 5JHAA 2K4AA 3GPEA 1V27A 2CM5A 2Q0ZX 3ZVVA 4F93B 4NPJA 5EDSA 5JHBA 4ANUA 3R7QA 4FHJA 1DJGA 2KI6A 2WXGA 3QR0A 3KWUA 1BDYA 4ICWA 4EZJA 1E8XA 4HVBA 1DJIA 2UZPA 4KITB 1W16A 2CHXA 3HN8A 1QATA 4DNLA 2EP6A 4GNKB 4NPKA 3MJWA 4XE0A 4XZ4A 1UGKA 2K3HA 4PS3A 3ENEA 2DMGA 2ENPA 3DBSA 3B7YA 3ZW3A 2ENJA 5G2NA 1QASA 3HHMA 4FJZA 4G11A 2CHZA 2D8KA 2WXQA 2X38A 1WFMA 3SD5A 3HIZA 2JQZA 2WXPA 4V11A 2YRBA 3ML8A 4KZ0A 3PREA 3APCA 1DJWA 4LCVA 3OAWA 4KZCA 2ENQA 4WWPA 1TJMA 4FJYA 4LT7A 2WXFA 4PS8A 3P2BA 4QAMB 4TV3A 3TWYA 3L17A 4NP9A 3TJPA 2WXMA 2ISDA 2QZQA 1GMIA 2V4LA 1RSYA 2CM6A 3QAQA 4NS0A 2NQ3A 4TS6A 2CHWA 4ICXA 2DMHA 2BWQA 3ZIMA 5KJ7E 4QJ4B 4AJWA 4ANWA 3M7FB 4FA6A 1BYNA 4OVVA 2A5UA 4Y1SA 4ANXA 4LDCA 5H4ZA 2FJUB 2WXLA 3IBEA 2Y3AA 1E8WA 2K8MA 1DJZA 3DPDA 3L16A 3QR1A 4EZKA 4GB9A 4ANVA 4FADA 1WFJA 4L1BA 2WXOA 2RD0A 4JPSA 3W57A 4PS7A 2N1TE 2LHAA 3L4CA 3L9BA 4HLEA 1RLWA 4URKA 1CJYA 3F01A 2CJTA 1E7UA 4FULA 1BCIA 4J6IA 4F92B 1E8YA 3L08A 3L54A 3L13A 4TUUA 5H4YA 1DJHA 4WWOA 3NZSA 4Y1TA 3NZUA 2A4ZA 4F1SA 3QARA 4FLHA 3PYCA 1A25A 4WAFA 4WEEA 3APDA 5CCHE 1DJXA 3APFA 3T8MA 3RPBA 2FK9A 1DQVA 1K5WA 2WXNA 3KWTA 3NSJA 3F04A 3CSTA 2CHDA 3FBKA 3QJZA 2QZ5A 5CCGE 4QJ5B 2R83A 4XX5A 5CCJA 2WXKA 1YRKA 1UOVA 1DJYA 1E90A 4A55A 3F00A 4IQHA 3PFQA 5T8IA 4BGDA 2B3RA 4F91B 4DK5A 3R7RA 3N5AA 2Z0UA 1E8ZA 3S2AA 2WXRA 1RH8A 3F05A 4FHKA 5G55A 3ML9A 1E7VA 4MJJA 4QJ3B 3RDJA 3IM1A 4L2YA 4AOFA 4L23A 3CSFA 2WXIA 2WXHA 2ZKMX 4L1LA 3FDWA 3OHMB 3LJ3A 4OVUA 3W56A 1TJXA 3PRZA 2WXJA 2NSQA 4EZLA 3QK0A 4WWNA 4BFRA 2Q3XA 1W15A 2NCEA 1DSYA
chains in the Genus database with same CATH superfamily
1FCGA 1GPOL 1JF5A 2R27A 4F3FA 4F7PB 2JQMA 4LLYA 2GHWB 2GVYA 2ZZUT 4F7TB 1OTTC 4B5EA 2VDKH 2X3BA 1RLBA 1PW3A 1UWXH 3QNXB 1A6VL 1R3KA 4JM2D 4MAYD 4A2LA 2IBZX 3KWUA 1CLOH 1L7IL 3GBNH 3ARDC 3I75B 2KPWA 2ESVA 3RY4A 2JKIS 3BGAA 3TA4D 4MX7A 4RFEA 4A2EA 3MLVH 1DBKL 1KPVA 2NUPA 3UEZA 5TK2A 1D6VL 2RCSH 3KHQA 1PAMA 1WAAE 3C9NB 2HFFA 1XX9C 1A66A 2DLEA 2OMYA 2QGEA 3KLSA 2ZONA 3AY2A 4C56D 5F0MB 5HI3D 3N1QC 2ITEA 3WIFB 4MWFB 1NGZA 5D1QD 5BVPH 1HSAA 3M45A 1L0YA 4LCVA 5FFOA 4PAZA 4NKMB 1J8RA 3FTUA 4XCYB 1AO7E 3CVIH 2WXFA 1I8UA 2W1NA 3OJDA 2V4LA 3FO9B 3HNTH 1AXSA 1IC4H 3DGCR 3ZIMA 2EDNA 3EJYC 3ZN6A 2TSBA 3BWAB 5TE6L 5JXED 4UIMB 2IOOA 5C08D 5HY9A 5F7EH 3P9WB 3HRZA 4YSEA 2J1WA 4G2AA 4PVBA 1EHLL 2DI9A 5ESQB 7FABL 1KIRA 1P7QB 4K07A 4AIEA 3D5OF 3JYCA 3GXPA 3HI6H 4B6ZA 1TTUA 3BT2L 4L3EA 1H3XA 5HDBB 1NCGA 5AZ2H 4FULA 5E95B 3I84A 1IZKA 4NKQB 4H26B 3ETBJ 3WNNA 4GUQA 4JGNA 3AWEA 4PLJD 1G5GA 5DFWH 2OV0A 4PJIA 1S9XB 1FE8L 2ADJA 2HMIC 1M56B 3CDFA 5CBAB 4XPHH 2EVFA 2Z93B 4ZXBA 4PJDB 1W72H 3QFJE 4PYHA 1ANUA 2I07A 3IJ9A 4I4WA 3TU6A 1NM9A 3NCMA 4BD4A 5L9DH 3DUUA 2AK4B 5KSAB 1EZLA 3GZQA 3UBXI 1A4KA 1KYUA 1J5IA 1CC3A 3RVTD 4B50A 4U05A 1CXHA 3LMJL 3QUYA 3WDHA 4HJEA 5LAXA 1RZQA 3QXDB 1SXCA 2J72A 4M1GL 4TNGA 4XVUD 4FHKA 3W9DB 1FFRA 4P2QE 1OGAD 3RBSA 3LHPH 4JZNB 3K5RA 5HVHC 1N5YL 5JMRA 1JF1B 2WVTA 3FN3A 2H45A 2VJXA 4WNQA 1BVKA 2P5WD 4ZUUB 1TVHB 1ERNA 1TQBB 1BFTA 1UADC 5DJYA 5I30L 1FIGH 3SDAB 4AKOA 5IG7A 5L4IA 3SPVA 1OPGH 2DKUA 4N2FA 1JZFA 3F6JA 3KWVA 3P4MA 3CDGB 5DVPA 1IARB 3VCLA 3LV3A 1XIWC 1Q8MA 2NR6A 2CXGA 3HVDA 4MDJB 4N5EC 3FFOA 4PG9A 5DYOB 2Q87A 3RWCA 3MPCA 2IXQA 3UAJC 1DZBA 3RWJA 3PAUA 2IDQA 2K6WA 2OMNA 3O41B 4RRPG 1LEKB 3EDJA 4GRLB 5K9OA 1Z66A 4RQQB 3AVEA 2BNRB 3BN3B 4JG5A 4WFFE 4J1UA 1H8SA 4I18A 4XHJD 1MCLA 3C60A 4NDMA 2EKSA 5D7IA 4S2SA 2WTRA 3PDGA 3FYIB 4FTDA 3IMSA 1BM7A 2NNAB 3IGAB 1JFQL 3FT9A 2IFFL 3ARQA 5I6OA 2W07A 3TA3A 1N5AA 2F8IA 2LABA 2VYRE 2AERT 3JVFC 1MCWW 4H8VA 1U42A 5J12B 1WZMA 2ENQA 3O6MH 1QSFA 5DUJA 5B39A 4BK5A 2H3NB 5DR5H 1OAJA 2WP3T 2FECI 1BAGA 4PJXE 5FGCE 4JDEA 4PJAE 2Q8BH 5ENWA 1RSYA 3FRUA 2F5AL 5CJOH 2DWTA 4YDVA 1DFBL 4NZTH 5CU5A 1S7TA 3GHEL 3DETC 1X5KA 3ZYZA 3WSQL 2ETWA 3U9WA 5ABZA 4LHUD 4OKVA 4PQXA 2OMVA 5EIIB 1NLBL 2YN5A 3BRDA 3IDYC 1RJCA 1HH6B 1R6VA 2JB6A 4ODWB 4QRRE 4XNZC 5C7XH 5K59E 1UXSB 1NGPL 2OCFD 4N8UA 4TUJA 3SIKA 4XVSH 5AQ0A 1PD6A 1D7DA 1SDDA 2DIJA 3DMMB 4N2IA 4UIKH 5KVGE 4AIOA 1HJCA 1VENA 1AQKL 1FFOB 3GTVA 1BOGA 3BVDB 1SXNA 4LE8A 3WFEH 2EIZB 2P9RA 3NIGE 2F53B 3B9VA 3CK0L 2ZXDA 5GSVB 5GGSY 3RU8L 4KNQA 3U1QA 5B8CA 3NCYS 3IMRA 3NTCH 3FQNA 4PJCA 4PV1C 2ZSVB 4D7BA 1DQVA 1BYOA 2Z7UA 2RH0A 1T7WA 4AQ1A 2IGFL 4XZUA 3F7QA 4Z0XB 5HBBA 2F68X 1FNGB 1PBYA 1NCWL 2HG5B 3QUXB 5MEOB 4Y4KB 2N7SA 2VN4A 2VDLB 1GZQA 4MMZB 3HG2A 1SUJA 4PS4L 1AGCB 4ZRGA 5GS2D 3ML9A 2P5PA 4ISVB 1KLUA 3GUTB 2VXVL 4NQEB 1PZDA 4L3EE 1TCMA 2O72A 3KE0A 4B0MM 3AB0C 5BO0D 2I60L 3GI9L 1X7QB 3QK0A 3BFQG 1OT4A 3CHSA 2YGQA 3HLAA 5I71C 4HUKB 1N6QL 1GXEA 3QJQB 3GBMH 4X4XB 1OLLA 3U0TA 4EOWL 4EUPA 1YG9A 3KYMA 3QDAA 5EF2A 3C8HA 1EUUA 4TVPH 3O2VH 5CILL 3R0MA 1PMYA 4X6DA 3KL5A 1DJGA 1VIWA 1NBVL 1URZA 1YNLL 3HE6D 4HUWB 1GGIL 4QRSB 2MPAH 5DRNB 3NPZB 4BZ1L 1KJ2L 3RY5A 1NCHA 3BUDA 3TNNB 3SO3C 4DPAX 3HZYA 4J4PC 3Q8BA 1E3XA 4K3DH 2YWYA 3IWVA 3M1BB 2PXYC 3QDGB 1C5BL 4PP2B 4YDJA 2QEJA 1D5ZA 4RGND 1SN5A 4J3TA 5DK0B 3EO1A 1J8SA 3OQ3B 4BGLA 5JA9A 3W3BA 4YXHL 4HEPA 5BV7B 1OAYH 1ZK5A 1M9SA 1TZGL 5D5MF 3DOSB 1IEBA 1LE9B 2D0HA 1GL4B 3OHXB 1BQUA 3QO1B 1E5CA 2D7PA 4NQUA 3Q2WA 5JIDA 3IPFA 1JZIA 4A2GA 3FFCA 3EFOA 3ME0B 3NMEA 4ICXA 5B3SB 1RHHA 4UI2A 4FABH 3DX2A 3ARXA 4WUKL 1HZKA 1NBCA 2ICES 2K70A 1IGFH 4UV4H 5C09B 4QI3A 3B56A 2X0UA 4HISA 4WFHE 5D7IE 3QEGL 1MRCL 2UV3A 2LLLA 3F6LA 4UDUB 3P77B 1NJ9A 3JSSA 3W57A 1JWMA 1L9NA 1NOLA 3U83A 4DVRL 4YXLL 2YC1B 4NAQA 2Q8AH 4L37A 4B9YA 3EXJA 1P53A 3N1MC 2QSTA 4XNYH 1Y7VA 2PW1A 4XNBA 1IGYA 2DL9A 4IJ3B 4PGBB 2ZCHL 1S6NA 5T3ZD 3Q06A 3GSNL 5GRVL 2C7UA 1UHVA 5F9WB 3T8MA 2VDOL 2FJHA 4F8OA 1L6XA 1HDMB 5AKVA 1KIQA 4KMLB 4KX8A 2CE6A 1I1AD 1FSKB 4D3CH 2AGJH 3UBXA 4EQ2A 4P5TB 2YA2A 3LIZA 5IM7B 4LXFA 4CGTA 3CE1A 4K5LA 5K39B 3VD7A 2CDEB 3Q8FA 1CFVL 1YYMH 1QRNA 3N1GC 3TYGL 3ETSA 32C2B 4X5RA 1I4FA 4KQ4H 3TVMA 4F20A 1F8TL 2WXHA 3H7BA 3BAIA 5ADOL 2D03L 2G5UA 3OLIA 2Y5TB 3REVB 3KVPA 3RIKA 3STZA 3CZUB 1F90L 3T4AB 1CE6B 4UT7H 3MRDA 2EYSA 4Y16A 3X3FH 2G3ZA 1T66C 3VX0A 3O6FD 1DUZB 3P9LA 3ABKB 4M7JH 3UTSD 4L9LC 2HRGA 3VD9A 2QLYA 3TO4C 3N1FC 1CU4H 4ZFGL 4EI5D 5IJBC 4YHOL 3D2TA 1AKJD 4ONGL 1CDUA 3GSRA 5JW4N 2BVPB 1KYFA 1S7RA 2EP6A 5DS1A 3SDCD 2ZNXA 1FG2A 5LQBL 1WUZA 1N12A 2P45B 4XBPA 3UGEA 5ICZA 5IVXF 4JZJA 5D4IA 2X4QB 2ZCLL 3MRNA 4NHCH 5CZVH 4ETYA 5I26A 3MZGB 1NFKA 5GZND 2CO4A 1K2DA 1AO7B 2DYPD 4IU2A 1PYWA 3RFRA 1GS6X 4OGYL 1U8IA 4GQZA 1U8JB 4YE4H 1LMIA 3T3PB 3EOTH 1FLTX 3GRGA 5GIRA 2MKLC 1EEQA 3FU7A 4DZ8B 3SY0B 2UXVA 2C1OB 2G9HB 4L48A 4X6DE 4XCNA 5F7YC 2ZP8A 2YA1A 4H8QA 1PQZB 3HI1A 1TYEB 2DQDL 2EABA 2WO3B 3N42F 4M43L 4QTIH 4WGWB 5CJQH 1N59A 4J23A 5KYXA 3MRHA 2X88A 2NTFA 4JUTA 3G6DL 3S5ZA 4OLXL 4X4ME 3T1FB 3V5KA 1Z9LA 3SKNB 1II4E 4X6BA 4ZZKA 1BJ1J 1ZHLA 2WJ7A 3VWKD 2F74B 3D0LA 1ONQB 3H2WA 1ZS8A 2YZ1A 5KVEL 2C3WA 1J5DA 1IAII 4RCAA 5AOMA 4KTGA 4F9LC 4JMNA 1BIIA 2Q6WA 4E41A 4NXSA 4L0PB 4DESA 1R3HB 3NEOA 4KKLD 4NAMA 3NOIA 4GQ9L 5C0EA 3QFJB 3KYOA 4Q9BA 5JR1H 4JGJA 2YD4A 3FO0H 1WYJA 1QRKA 2PW2B 5F89A 4BUQA 1CBVH 4KQ3L 3UCQA 4GMSL 5E2UH 1OP3H 4RZCA 2WD0A 1XZWA 2VN3A 3EDDA 4U6HA 4YHYC 3QE5A 1FFPB 2CBMA 5F7AA 4ZUVB 3F5WB 5FDWB 2DLFH 2VLKD 3QUZA 1YSOA 2ICEB 1G0YR 4P2QB 4WJ5B 4X7EC 4D94A 4MD5A 5KYWB 1L9RA 1DL7H 1SMAA 3FQ4A 3SZKC 3DVIA 3ZTDC 2A9ML 2WXIA 3QIUC 3D18A 1CLYL 1EDHA 2CPUA 5KANG 4AQEB 3GS7A 4L29A 5CHNB 1E4XL 2NSQA 3L2MA 2R1XA 1UD6A 2VMEA 1DSWA 3EYFB 4QEGA 4GG6E 2VN5A 4G42A 2JKRM 3KDMB 2BK8A 4YVUA 4ZPVB 2PPDA 2IQ9L 1SM3H 2GJ6E 2Y0SA 2H32A 4DEWA 1MDTA 2XQBL 4BZ2H 2YJLA 5DWUH 5T1DH 3LKRA 4U6YB 4V1DD 3O2WL 5C6TH 3RTQD 1RIUH 4I85A 3TONA 2CMRH 5GXBB 1GOGA 3VU1A 3UP6A 4A37A 2C3XA 3V5DB 4Z95H 5IW6A 5GZOC 5CBEA 5EU7E 5IHUL 1QRNE 4FQ2L 5C0AE 1R0AH 5GRWA 1IBGL 2XWBA 3KPQA 2FVNA 4R6UA 1RZFL 4DN3H 2MOGA 2EYTA 4OFYA 4HUCA 2WUBH 4WSGA 3U6XS 2Y07L 2IANE 3CVCA 2IV9A 2W94A 1H9DA 4PJXB 4P59L 4IMKC 3GUFA 4PJAB 3HG1D 5DMGD 3RVUC 3TN0C 2E9IA 4PRHD 3AG3B 4P46A 5AD0A 1OWWA 2VUYA 1GKOA 2J8UE 3Q6FA 4HZLA 3BGFC 3UTTD 3MO1A 1CI5A 3RP1A 1TJIL 2CRZA 4DQOH 1WT5A 3CSYB 3O3AB 1IL1B 1JHKH 5D93C 2VAAA 3LQAH 1GCYA 4PJ8D 4G8EA 1JGUL 1IAOA 4KNTA 2AXGB 2EACA 1ZEAL 2HKFL 2OYKA 4HG4K 1F6AB 1RK1A 4QRRB 4RESB 5I1HH 2D9CA 5JNYB 5DHVA 3GTNA 4PJ5D 3A22A 1GC1L 1A6ZA 4KHTH 4L5FH 2BVEA 4LL9A 1KT2B 1KJVB 2GJPA 4F8LA 4HK0A 2IALB 2NX5A 1OPOA 4YHKL 2E9GA 2D7NA 4IRSB 3H7LA 2FR4A 1I3RA 4F7EA 3MOBH 1PKQB 3TO2B 1WA2X 3KPLA 1KTDA 4PJ9C 4GO8A 5C0BB 4PRIE 2ZF8A 4WHTA 3OKEB 2F61A 5CGYD 5I15H 1SXBA 1WP6A 3CHOA 1ICTA 4LU5L 4A2DA 5EN3A 2R4SL 1QW8A 1K5NB 4URTB 3NACH 3IMBA 1A3RH 1NWOA 4GRWH 1F02I 4M1DL 1D6EA 4OZGE 2NW2A 3N06B 4NC1E 4F9PC 1JNNL 1RUQL 3RYMA 2WXKA 2A9DA 3ECBA 2OXGA 4HC1A 3DX1A 1OHQA 2WN3A 3MNWA 3WV0A 4Q4IA 3RPIA 2EEXA 1KCSL 3TT3H 1ETB1 2G60H 4E41E 4GKZB 5IBUG 5KVDL 1HNGA 5EIIG 1OOAA 4BFIA 5IMLB 5JQHC 4E0RB 1UENA 5C92A 3IFNL 3NK4A 4GW4B 1PD0A 2ZAHA 5DMIH 1K8DA 2YOAA 1F3RB 1XF1A 3CXDH 4H8WH 2IADA 4A7VA 5TDPB 5GS0L 3OSVA 3W2DL 1HHIA 3HS8A 1EEUA 1GIGH 2GI7A 3ES6B 1OLZA 1BQHB 4U7SA 5E5MA 1KB3A 1N4XH 4G80B 2H41A 1I9JH 4B27A 3TF4A 3MREB 4P3WA 3UADA 5SX4H 2DQTL 4XMKH 3FW6A 3CXFA 5E94A 1IM9D 3V0DA 4B9IA 1MJ8H 3ARBC 5IG7B 5AB0A 1F18A 1IJ9A 1Y07A 2W88A 4ZW3A 5K9QG 4ZTPH 3ZU8A 1T1YB 3TASA 3W37A 2BOCB 4LPXA 1F45A 2UY6B 4TQPA 4JPIB 1S8DA 3UGXA 1LNUA 2AV1A 2F19L 4RRPM 1T03H 2BIPA 2CM6A 1INEH 3L5JA 3V10A 5C71A 1N6VA 1H3UA 4Y4FC 4Q89A 2X4SB 3QXUA 4FQHA 2AKRB 3CSGA 4M5TA 3OC8A 4WSJA 1DQML 1V55B 5JLZA 1I8LC 3WUWA 2CO6A 1FNAA 3NSDA 1E8WA 1UWEH 3QR2A 1E9OB 4JVUA 2W07B 4XO9A 2VB5A 3WFBL 4TF4A 5LGJA 1N0XL 4JFDD 4P2RA 3RVWD 3JTSB 1UH4A 5EOCJ 2PCXA 4G5AA 4J8RB 4XGZA 3ZSSA 3BCFA 4M7KL 4Z7QE 1KGXA 2IWEA 1JCKA 4WEBL 3VXPB 5KSUB 3FRUB 2CUAA 1R24A 4B9KC 3RIAF 4OLZL 3HMWL 3ZQ9A 4XNUH 3V4PA 3CLFH 4YL9A 2IWGA 2CCVA 4UCFA 5EF3A 1BGXH 5F6IB 2VDLH 4ECNA 4L3FA 5KZCB 3FN0H 2G0LA 3WYRA 1ZLVK 1M6OB 2ADFH 3B5TA 1CFTA 2ZX5A 1UUNA 3II3A 3QI9A 1HHJA 4L4VD 4OKVB 1FL6B 2CUMA 2VSKB 2XWTA 2NCMA 3VI3F 2BW4A 3HZMA 2CIIA 1IVTA 2AMGA 5GGSB 2YPVH 2DH3A 4NQDD 2I85A 5HGGS 3QYNA 4JQXA 5B3JE 4LL1A 4W4OC 5EU3A 2Y2TA 4MQ7A 3BP4A 1OCCB 3K6IA 2NX5E 1YN7B 4Y4HC 1BPVA 4HS8L 2WWMD 5HYSG 5FC9A 5I1AB 3FH8A 4IMLB 5K1VA 1JPTL 2N3JA 5JXAL 2Q10A 3ARFC 3G5XA 1Z0NA 5HYJE 4I3SL 1QSZA 5F1NB 4Z7OF 2OK0L 1OCRB 3WS6A 3LPPA 3BRFA 3KLDA 1BZDA 2R51A 4WTZA 2DM7A 5E2VH 4FHJA 1B4TA 3WL9B 4QNPF 1NOFA 2B9AA 2OTUB 2CNZA 1S3KH 1D5IH 2COQA 4Z7UF 5BV7H 4LP5A 2D7OA 2GTZB 4NKIH 4AM0Q 5L88H 1ETJA 1QTPA 1T20A 3I74A 5I1GL 4ACPA 4JFED 5E2TH 3LAFA 4M02A 5HHMD 3V6FB 3HLAB 4OQTH 1LO5A 1NIBA 2PO6D 3AUVA 3OGCB 5HHNB 2MCMA 4ZNEE 1IFHH 2IDTA 5GGRY 1SXAA 4IGBC 3Q1SH 3U9UA 2JKJA 1TCRA 3LQAC 1XH2A 4K94H 3VFGH 3L17A 2AV7B 3QWOA 4ZAKA 1JD9A 5LN4A 3KLQA 5FUCE 3K80A 3MCLH 3M8OH 4I1PA 3FONB 1DE4A 1XAUA 2EIJB 4FI8A 1MFEH 4LRNL 4PJEB 5H4ZA 4M1CD 3GMLA 3NRFA 5H94B 1ORQB 3VFNB 3GXUB 1U3NA 3SJVA 3NFSL 3P3RA 3GJFK 1OWRM 3RI5F 3SDXF 4JFFA 1B0WA 2BWDA 1MI5E 4O02B 2MHAA 2CK0H 3K0YA 3WS3A 4FZEL 3X12B 5DQ9A 3L3GA 1P5VB 1TETL 4LARH 2KYIA 1U8CA 3RX8A 2VQ1A 2YD7A 3FTSA 4YLQT 5KYNA 4UQBA 2FO1A 2R2BA 3KPNB 4J6IA 3KNBA 4DPCX 4F37F 3VXSD 1E9QA 3EFOB 2WLZA 3KBFA 3FTWA 3QB7C 4UTAH 4F15C 5I8CA 1DZ0A 3HC2A 4G43B 2GYSA 4EO5A 4IK6A 3CN0A 1KBWA 43CAB 4DAGH 4EEEA 2R1WA 5AW2B 3ZT6A 2VIRB 1H3PH 4N90E 4FE9A 3S2CA 1EERB 4FMVA 4KRPD 3LQZB 1KGUA 3D2UA 4NENB 3MV7D 2BNQD 4W9CC 3EGDA 5C3IA 1TKWB 3OR6B 4OF5A 4D9LL 2VDRH 3BPNB 5CR1A 4GG6B 5C9JB 1KCBA 4H8WC 2YEZA 4GXUN 5DEGB 1CICB 2VC2L 4LAQL 2GJ6B 4WKZB 1VACB 2FGWL 1W15A 4ZD3L 3BQUC 2DMKA 3LD8C 3B3BA 4FNLH 2ZTBA 5CINL 2QGDA 5E8NB 1T80A 3RDTC 4P4KA 2EC8A 3MXVL 5DUBB 3QH3B 3TBYA 4BM7A 5I75C 2BP0A 5MI0B 1T83C 2EXYD 3MV9D 3OXRB 4NOFA 4U3SB 4S1SL 3HAEB 5IMOA 5C0AB 4OF6A 3T0EB 2MCG1 1XB8A 4JR9L 5EBLA 2J1YA 2C9UA 2BOBA 4K8RL 2K8QA 3VB8A 4XOAA 4CVXA 3SBWA 2R9HD 2OJZL 5IB1A 3B2PA 2IANB 4KXBA 4FEIA 5I1LA 2D8KA 2HLAB 4OZFA 3ZXAC 3QDMA 4PTUA 1YEJL 1K4CB 4OW6A 3ML8A 2WK2A 2J8UB 4N8CL 2HT3D 2Q20A 2R4RH 5FHBH 1Z5HA 4LCWD 4MMXC 4X9GA 3VD2A 5IJKC 2G75A 1BFOB 4HH8A 2BZCA 1AQDA 1MNUL 4XWOD 2FLBT 2DH2A 4FNQA 2BNUA 4CMMA 3WKQA 1BD2E 1P1ZA 3FB7B 3LKQA 3PNWB 4ZDHA 4LIQL 2IPTH 3FUKA 4ZFFB 1G7MB 4F27A 4JL1A 1GGCL 1X5XA 1B4JL 4O58H 4G8IA 3H2PA 2HX7A 3I50H 2R23B 2GEQA 3Q2NA 4XT1C 4R5TA 4E42B 4FFVD 4DUVA 5CGMA 3LEVH 5CCKH 5DC2A 3Q8EA 4OM0H 1H8NA 2ZYRA 4Y4KC 2ZX6A 2QMJA 3A6CH 5D71H 1QFOA 4XB8A 2ZOKB 2J6EH 4M4RB 4MMZC 4PRIB 5JZ7D 4DVBA 4KK9C 2F7OA 3W1ZA 1DLFH 5CEZD 2HVKB 3GBEA 2Z31B 3C8KB 3IB4A 5EZLB 3DGGA 4O2FB 2AJXH 2NTFB 4OZGB 1XZ0A 3MLRL 4HH9A 4OJAA 2YARA 3GI8H 4C54A 1U3HC 1G7IB 3FB6A 1KB5L 3OX8B 1OGSA 2I24N 4OM1L 1V3MA 3GB7B 4CUCA 4Y2DB 3SJVE 4DUXA 2Z8WC 2R83A 3WBDA 4JFFE 1GGBL 2A74B 1WBXA 4LHJB 2VXSH 1N0LA 3JTBA 3QJRB 1M7XA 2NY3D 3O9WC 4Z3HA 4UILH 2JFCA 3N2JA 3ULUF 3H6AA 5C0JB 5D8JH 2EAEA 3K2UH 2BC4B 1TJXA 5KBMA 3FQWA 3QNZB 3HS0B 4R7DB 1D9KA 4XCFL 5ISZE 4A6YB 5HYFA 3N40P 3BHBA 3L5IA 1H5BB 3SDYL 4JJ5B 1ZT1B 3RVXD 4ZW5A 5JHAA 2HRLA 4L8SB 5E00B 2VLJD 4C47A 1XVSA 2ZG3A 4MJ5B 3GSOB 4PJBA 4FA7B 4YE0A 3Q44A 1MWAA 1SZNA 3D25B 4WTQA 3PJSA 4MD0B 2KC0A 5MERB 4MAYA 1XH3B 5IBTH 3O8XC 5KBLA 2YUXA 1E5UI 2D3JA 4CU8A 3WKML 3O3UN 4IU3A 5DD6B 3S5LA 3FPXA 5IQNA 2OJEA 1JJUA 2EICA 3S98A 4QHKJ 1QSEE 4TOYL 3U4KA 3OJ2C 1SYVB 4K94C 1L5GA 2NPLX 3HN3A 3HZVB 3VWJC 2CCLA 5JPMC 3MR9B 3QSKB 4DTGH 3ULVF 4EKXA 2WVSA 4WW2B 1SUHA 4KDTC 3PXLA 5JIIA 5AKTA 1DBMH 4WQOA 3WXWL 1QLEH 2WXMA 1F4AA 2GFBB 1JD7A 3CZNA 2ADIA 4TSAL 5KVGH 1ZVSB 3KYNA 1N70A 2G3NA 1JPGB 2BVYA 3R1GH 4OVVA 5FB8A 3U36B 3GHPA 2J3SA 1DDHB 1HKLH 3BSZA 4XMLH 4X7TA 5BXFA 4Y5XC 5C0NC 5CD3B 4G5ZH 5F9WC 1JVOA 2FYYA 3FOLB 1JAEA 4DGVL 1QFWI 2HRHA 1XTMA 3G5VA 2UXTA 4Z7QB 5JXEA 5E9DD 3TIEB 5DJCB 1ID5I 5C08A 5ITFB 1HNYA 3QRFM 3QUHA 2MFNA 1NFDF 3QDME 4HKXB 3PL6C 4X6EA 2CSPA 2AP2A 4HQQL 2XA8L 1RLWA 4FJ6A 3BP7A 3HLKA 4KZDH 3X11B 5H4YA 4G6FB 3RNQB 4TTDC 3UX9B 4Q14A 3SN6N 4FTVD 3L4UA 1R46A 5J6HB 1FQ9C 3J8F7 3G04B 1OTTD 4N0UA 1XGPA 2UZYA 2QKSA 4R90H 3I9PA 4GFTB 2MNJB 4FQLH 1KEGL 1AY1L 2YK1H 3ARDD 5GJSH 2K78A 5KS9F 1NGXA 2PWGA 1ZANL 5CEYB 1JGDA 1F1DA 2EDWA 5T3XD 4G3YL 4X6CF 4U1MA 2FT7A 4YFLF 5FLVA 2BSBA 4JFXA 4W6WB 2WSKA 3LH2L 3UYPB 3BKMH 3CIQA 3IM1A 3EOBA 3HA0A 1I8KA 4PJGA 3DNKA 3KLAB 1SJHB 4H0LC 5HYJB 2PP9A 4G8FA 4DETA 2AABH 3UTQA 4WGVB 2CLVB 4S10A 3NCJH 5T1JA 5B39G 1J1PH 3BVNB 3ESMA 3NN8B 2A6KA 3N0AA 1J8HA 1EMTL 2CJSA 1I31A 1SF5A 3TJEH 2BHYA 5CFHA 2CUIA 3C8DA 3RY6C 2YSSA 2WQSA 2VXTL 1MCJA 5DJ8B 2WXGA 4M29A 4MTMA 2A9NL 4TNFA 4DN4L 3NESA 5KSVB 1KCVH 5TF0A 3QWRA 1P7BA 4PV9B 3WFCH 1MFAL 1OAZL 1Y0LA 3MJWA 3TT1H 5JHLA 4NM4H 3GJFA 4YBLC 3VXRA 4X6FB 3X3GH 1HOEA 3IWUA 2VISB 3SOBL 1A7NH 2YD8A 3VI4E 4BFGA 1MEXL 2PETA 3G6JE 2NW3A 1M6UA 2M8XA 5IHZA 2XTJE 4KNSA 1UURA 1V5JA 1KV7A 2VLME 5MEND 4NN5B 4PJBE 2BSTB 3DRTA 1SY6A 2YZ8A 5J3HD 1IBYA 1TJHL 5IEHB 5HTSA 3MGOA 3L5XH 1IT9L 4K7FA 1MI5B 2JCWA 3CUPB 4P07A 3K72B 2XWDA 2WIMA 3QORB 4PUBL 2DJMA 5EZJA 2OR9L 5KN5A 2EUZA 3NJNA 2C3VB 4YSSA 3KGTA 4LHUA 5ITBH 1F0LA 2WBJC 3JWDH 4TLSA 3H3BC 2UUDH 3MA9L 3HVNA 4X5XB 4P5SA 4OZ4B 1KXQA 4EPSA 3KLHC 1FLRH 3MBEC 4TPRH 2FIKB 4O2CA 4PRPA 2R2EA 3PABB 5DJ2B 4C56E 3FT0A 3QW9A 4A68A 2XIBA 5D1QE 2AEPH 1CVRA 4FQHB 4HMDA 3SDDD 4EUPG 2YD5A 4MCYB 2PPCA 3NJFA 1C08A 4HBQA 3ZTNL 1XIWD 4P2AA 4N5ED 5DUPH 5HHOA 3WTWA 3O3DA 4IBYA 1EJOH 1NSNL 2DS4A 3AGWA 1WICA 2WWOA 3HR5A 3B6SA 3QAZC 3MRMB 1HX0A 5GHWL 4PB9H 3FSOA 4K7PX 4NJ9L 1NKGA 5F1IB 1HESA 1O7DE 3NAAL 5HDWA 3U4BL 3FQTB 5C08E 4IS6A 1T7ZA 3LRSB 4U33A 5CR8A 3S2AA 1ZMYA 4WF7A 3NCFB 3V2AR 2W65B 4X8XA 4WI9A 4G1MA 4ZFZA 4GW1B 5FOJA 3ZZSA 2ZD0A 4RISH 5ANME 1MHHB 1J9RA 2ED9A 2ZAGA 1ODAA 5JORB 1HHJB 2Y6TE 4WENB 3DHJA 1DVSA 3T0AA 3U30B 3A6BH 2P8MA 3COOA 4N0UE 3TL5A 3HZMB 4XRCB 3QQXA 1UD8A 1FZJA 3FQRB 2WLYA 1E28A 2DY2A 3ASOB 3QPKA 3BDXA 4DK3A 1A14L 5D6CA 5TGBA 3DETD 3EKCA 1KYAA 1BG1A 3EYVB 5D7KE 4EUPH 3SB3A 2ZKHH 2M83A 4AW7A 1U36A 1QEWB 4QRPD 4UUJB 3US0A 3OMIB 2CRIA 4AENA 1JXKA 3B7YA 2GW5A 3AAZB 1VCAA 3QJFB 4G11A 3TJHD 4WFED 1OSZB 1EH9A 2CBQA 2JXMA 3WAKA 1IC5H 1OGAE 4E9SA 3RJOA 5F3BB 4XPFL 1RY7B 3QJSB 1CTOA 2Z1KA 1PSKL 2DTMH 2Q86A 5LB1A 3CZGA 2QQKH 3LKNA 1J8HE 4HULB 2AXHA 1FNEA 5G5DA 5C0CD 3PWVA 3TJPA 2OYMA 1BD2B 3NCYP 4BE5A 5JHMA 3NIDF 4AK2A 5GGRB 1QAWA 5GRJL 3FL7A 4KUCF 3O4LA 3CSPA 1AGFB 1GYWA 2X9ZA 4JN1L 2ED6A 3S4SA 4Q9QL 1JK8B 2ZOTA 2E56A 4MDRA 2VO8A 4XNXL 1L7TH 5BRQA 2OTWB 2DPKA 1NC4D 5HJ3A 3BZ4B 1IJNA 1EXUB 1KGWA 2WMPB 5FFLA 3C5SA 1XF2B 2QKIA 5MEQA 1RU9L 2PPAA 1XB3A 1XGYH 2FJFA 3DX8A 4I88A 2MTAA 3FT3B 3LQMA 2YRPA 4CC4A 4ZXBC 4OIFA 4MXVE 1TQUA 2XCMC 4NNPH 1M05A 1HCZA 1CGTA 1PZ5A 1V7NL 2OZ4A 2R15A 4PRBB 3D39B 4JG0H 3ZQXA 2MHAB 1IU1A 4H8UA 4U1IA 4FCHA 3WS3B 5I18L 3GSXA 5EFIA 3RGHA 1IB5A 4QXTA 4R96B 2VDNL 4HIIA 4J4PD 3QUYC 4LEBA 4O5LL 3N0PB 4PGCA 1LDPH 3LKOA 4TQIA 1E6OL 3QUKA 2PXYD 1OGTA 3BQVA 1UTDA 1KN4L 1T6WA 3F7VB 3L3HA 4IIQA 5ISZB 1CXFA 2B7DT 4P99A 5I1KH 5C6PB 3UAEA 4EZLA 1PPIA 4YPGB 4K0OA 1BVLA 2Q3XA 4ZYKA 1X9RA 2CR3A 3S7GA 5AG9A 1TQVA 2CM5A 1P84J 3KPRA 2XWEA 3MRFB 2Z91A 1TQTA 2NR6C 4N2HA 4NRXA 1N18A 3FULA 1QA9A 5EUKA 4HGWB 4JRYD 3RAJL 1RZGB 3O45A 3CDZB 1BQRA 3FB8A 1AKJA 1CZ8H 2JLLA 4YSQA 4M6OL 1WZKA 4AUJA 1JOIA 4HUXB 3N9GL 4I18C 1QSEB 2YAOA 3WIHA 3C60C 4R7LA 1XGZA 2ZCKL 3MRCA 1E27A 2N01B 4CU6A 2A4EA 4ENZA 4Y5YB 5GGQL 1AVAA 3TA3C 3GD1C 1LO2L 2FTAA 2XWJA 1NMCB 1VADB 3QZWA 4HWNA 4TVSa 4XI5C 4ZOEA 5J8OA 2X6VA 3QJTB 2DYPA 2WQUA 3D69B 4XP4L 5INCA 5IVZB 4BK5C 1FV1A 5DHEA 2X1OA 2LQRA 1MW1A 1YJDL 4Q74A 4F1ZA 2WUCL 3BJ91 3DV4A 4LLVB 4NXKA 4PY7A 1S7XB 3SHSA 4TNEA 3VMPA 5AG8A 3P3TA 5H2BA 5C7ZA 3E7JA 4BCXA 3JWDC 2J5WA 4XN1A 1KJ2B 3OF6D 3CPLB 1MLCA 4DF9A 5LXVA 4JO5A 2XPZA 2RBLA 1QQDB 3QDMB 3LN5A 3DBXB 2VZTA 3IRCA 2P7TB 1ZIBA 3IU3A 5D5MA 1N26A 3VWKA 4OF0A 3WLWD 4RGNE 2G75B 4KUCD 3B7SA 1NMAL 2IDFA 3MKKA 3ZDYF 1OZUA 1IKFL 3NEXA 4CMMB 1T66D 3BDBA 2AJSL 1HXMA 3IMWA 3TO4D 4N1EA 3ASNB 4GAYA 4MJID 4YBQD 4HX1A 1TLKA 1I8MB 4AZ8B 5T1MB 2JKLA 4AQ1C 2NY1C 4GMTH 2H6PA 2J55A 2J73A 3JXAA 4JY4A 5IEKA 3OMZA 4F7MB 3QEQA 4H25B 1KB9J 4PRAB 1OALA 1WSST 3QC5X 3S3DB 4A6YH 4HWBA 2P28B 3ZE0B 4DGYH 3WEXB 3U6XA 1WVZA 4S1DC 2H4EA 5L2JA 3HEIB 4DOHE 4R7NA 1E67A 1INQA 1SRDA 2YBRA 4MNHA 3REWB 2N4IA 1WC7B 4JE0A 5EO1A 5JIMA 1SEBA 3U7WH 3L3KB 3TBVB 2X70A 3GSNB 3HBPA 4ZZFA 1V27A 5AENA 4NO3A 2VDOB 5T3ZE 1QBBA 2FWLB 4XMPL 4QOKB 3N43B 4YZFF 2FQGA 4YSRA 4U1SA 3ZHNA 4AVKA 1F4WH 3HN8A 1MJJA 3TYFA 1PZ2A 2H32H 4OJDH 4V1DA 4E9TA 4WWKB 3TNMA 2ADGA 2FDBP 2A83B 2F5BL 2PYEA 2KQNA 4OLWH 5DD3L 3TPKA 3UJJL 3DO4A 3MJ8B 3VI4B 3RIAK 1QYGH 1HZHH 2KQMA 4CADB 3G6JB 3N3EA 3RWIB 1XCTA 3ZL2A 3CVDA 3SCMB 5B38A 2XTJB 3NJMA 1UZ8B 2B5IC 3UPCA 1HEJC 4CC1A 2HT4D 1ZY9A 2R56L 2FB4H 3FC8A 3ASWA 3LEXA 5FW6A 3AJ7A 2AJYH 1CI3M 2X2JA 4CBZA 1ADQA 5DTFB 3WN5A 2GSIB 3N85L 3PJSB 1G1KA 4KO7A 2QPSA 3UTSE 2HTKC 3BUBA 4JM2B 4MAYB 4N1CA 2EVGA 1UM6H 1NM4A 4W81A 4DP6X 4PCTA 4YO0B 1Q72L 4JHAL 3CHPA 1YNKL 3GSWB 4Z77B 2PWDA 1BQKA 5IVXA 4MS8D 3VNZA 4LPWA 3QA3B 4UQAA 5HDLA 3L1GA 3UGUA 2BSRB 1E4WH 3GMOB 4JPQA 1E9PA 4JVPA 2FIRT 1AR1C 3Q3GB 3VACA 2FCBA 4C56B 3FNKA 4PJ5A 4QT5A 4PS7A 5L6YL 3QIUD 4RFOL 4UZUA 5D1QB 5I8KL 3B9AA 4JFHD 5DHVH 2MOQA 3T4YA 3CZFA 2IMMA 3MI6A 3U1PA 3SBQA 4FFTA 1TEFA 4LSTL 1TITA 1X9QA 2IDUA 3DX3A 3PGCA 5ALCH 1CLVA 2Y2YA 3E3QC 2P80D 3FUMA 5F7UA 4O51A 3CZJA 1SOSA 4L1TA 3HG3A 3EH1A 4M62L 4LKXA 2OMUA 1I8IB 2ZSWA 3D85A 5GZOD 4Y1AA 2VABA 5I8EB 3FO2B 3T04D 1B2YA 2BSSB 3RTLA 5D5ME 1B6DA 1ET5A 5EOCL 5ANMB 1FORL 2FO4B 3BZFB 3DJZA 4HP5A 2R8SH 4JFYA 1Q90A 2M1KA 2V17H 4PV8B 3TVMC 3TEWA 3CSBA 4JK0D 1A21A 1DANU 3IS1X 4JGMA 4HC1H 3RVUD 1HE7A 4EI0A 5IB5A 5T33L 5IJVA 3INOA 2O5XL 4JPWH 3PS6A 3UYRL 3RI5K 4HBCL 3M1CA 1NGXB 5I1IL 4AT6A 1MCOL 4NKOB 4XC1L 3PXJA 3OB0K 3PHQB 4JG1L 3KWWA 4LAJH 4HALA 2C1PB 2O5ZL 5D4QA 4KITB 4YSOA 3WUWG 3B2VL 2FBJL 3FT4B 3HPJA 3EZJB 1T5WB 4F37K 3FRPA 3VXMD 1GPOH 2VLKE 2OMWA 5LXGL 2GPZA 5DQJA 1OGAB 1PZAA 2BCKB 3R06A 3KR3H 2FSEB 4JZJC 4PTTA 1IC7L 4DEUA 2P5WB 1EFXA 4OFQA 1L7IH 1V3JA 3DX6B 5DD5H 1ZLDA 4ZMQA 3VXUD 2Y06H 4PJ9D 3NH7H 3HC4L 4BSVB 3RB7A 3F64A 4NQVA 4C55A 1U8OB 1AACA 3BN9D 3KBEA 4K15A 4MJ6B 3RBGA 1JN6B 3KXFD 1PIGA 2FX7H 4AH2B 4FP8L 5T5FA 1K6QH 4JANA 3E6HB 1NIAA 4V1DE 3V4VB 3X14A 4NC1C 4NO0D 5IFJA 4ZS7H 3FSAA 3L16A 1YY8A 4OIIH 4Y9EA 1ZTXH 2A6DB 2XIDA 3O11B 2XTLA 3LNGA 3NFNA 1FPTH 3MYZA 1HHKB 5BRZD 3HE7A 5LAPA 3U4EA 3MRIA 1LO3H 3F01A 2VDKL 3PWLB 4NZRH 3IJHB 3P4NB 3P9MB 1CLOL 4F2FA 4WNSA 3ZY7A 2R2CA 1MSPA 1DVTA 4LSQL 1IAIH 1EHKB 1XXFC 4UYPA 3U0PB 1P4UA 4PRHE 1CFBA 3JV6A 3MLVL 5FW8A 2CZNA 3OKMB 4OCSH 4YHIB 4GLRI 1Q9LA 2H0PA 2RCSL 4PB0H 4WTZG 4ZPTA 2XQYK 3RB5A 3SKMA 3GSUB 4L8CB 3V4PH 3WCYA 3Q13A 4QRFA 1ZXKA 4L4VA 4AIZB 4B7IA 1AHWB 1NAMA 5BVPL 1L0PA 2XETA 2YSTA 5ECJE 1AANA 4WO4A 4KRNA 4AJVA 3CVIL 1R3LB 4PJ5E 5DYFA 5GSRA 4O4YH 3ZL4H 4NQDA 3HNTL 3FDWA 2V2WB 1IC4L 5D1ZB 3L3DA 4XH2B 1UA6H 4LCYA 2RJMA 2H0FA 3ZTCC 3DXAD 2NCEA 1J8KA 1M1XB 5EUOB 5J11B 2ICWI 4N20A 4MA3A 3SQBA 4DZBA 3CH1A 3MJ9L 2VZ3A 5F7EL 4HWEH 1UUSA 1I82A 3NFPA 1J11A 4PW4A 4B9GA 5BS0D 4APXA 2IV8A 4WVRA 5K9KA 1Y6MR 3HI6L 2UWEB 3TTSA 4A2MA 2MQ0A 4O9HH 5F6HI 4CN1A 4EIUA 5AZ2L 1GJIA 2WNWA 1HQRB 3V7MA 2IAMB 4RA3A 1BAWA 2DWDA 4IRJB 1NEZB 4NKDA 4MLIA 4XPHL 1W72L 2M26A 3H9SD 3SKOB 3AROA 3ETBF 5L9DL 1ZA6A 1IQWH 3BVUA 5I1JL 4QXUH 2IDSA 2BP8B 3UG4A 4DGIL 2DQ6A 4WK2B 2B8OT 4YDIH 3S36H 1L4IA 2BY3A 1OAQH 1OTSD 2YD2A 5CJ8A 3QPQC 3ROLA 3C5JA 4F33A 1WT5C 3BP5B 3HE6B 3VG9B 3IFOB 3O4OB 3LHPL 2MJWA 2ZYHA 1U93B 1O5DT 3QQ4A 2CA3A 3VVVA 1FIGL 1X7SA 3BIAX 3FHAA 4PJFF 2CD0A 1OPGL 4NUJB 4RGNB 2BHUA 4L3CB 3VRIA 4GQQA 4Y4HD 4GT0A 3L4CA 1WF5A 5AOKA 2F08A 1BJ8A 1MCEA 5C07B 5CEXB 5K1JA 3B9KA 4QAWA 2YD1A 4R4FH 2EILB 2OSXA 4W9EC 2HKHH 3ARFD 3ZDZF 3BH9A 4M56A 2DWEB 4AITA 2OULB 2VITA 2VM3A 5F1KC 5LDUA 2ROXA 3MGTA 3HG4A 3WJLA 2DAVA 3MRRA 4RETB 3HPLA 1ZHBB 3OKOA 5F8QC 3S4SB 1IBFA 3I6LE 5IQ9B 1U58A 3BT0A 1WITA 1GYUA 3PQYD 5E70A 1U8KA 5HHVH 1UXMA 3HHRB 1QNIA 4NRZB 3II2A 4LLWB 5BRPA 3MZTA 1CT8A 1U8PA 5EEYA 4XCCL 3L1FA 4LNRA 4JDZB 3V9EA 3Q05A 1SFHA 1VFBA 4UNIA 3O6ML 4DOHB 1X7TA 5I66A 4R2GC 5DR5L 1CD8A 1MELA 3VQ2C 1IM3D 3V7AE 4JX0A 2Q8BL 4OZFG 5F9AC 1HL8A 4DO4A 3MV7A 2FX9L 2BNQA 4JFDE 5CJOL 4ZMZA 2E8ZA 4Q9RH 3P1VA 2LT9A 4IGBD 2YEQA 4DP8X 4M3KB 3MBXH 3X1GA 5DJZB 5CO1A 2A1WH 4JRLA 3AUWB 5DDHB 3VI3A 2Y1VA 1B2WH 2X09A 4N6RA 1YEEH 5FYJD 1W2KT 4LP4A 4NHUB 3EH4B 4LGRB 5EFIB 2KT6A 5C7XL 2HT2C 3UZQB 2IIJA 1FVDB 1I1AB 3EJPA 3F7YA 2VXVH 1CK0H 3AY4A 4HIEB 4L4VE 4P2YA 4X9BA 5EOQH 4MA8H 3IDGB 4XVSL 1OGTB 1YAZA 1OL0A 1OE1A 2V5RA 2ZUVA 4MD4A 4UIKL 3I9AA 4Y19A 1BVNP 1I9IH 2PWEA 3WFEL 5I16A 4NQDE 1T1XA 1GW0A 3C6LB 2H7WA 1AD0B 4GKOA 1H3TA 3TBSA 3GF8A 2VJ0A 5CILH 3ULSB 3ZKMC 1JNJA 4IBUA 3EYUL 3NTCL 1M1SA 1OSPH 2HN7A 1NBVH 4ZSOA 1HEZB 1QR1A 5ICXA 4KK6C 4BXSV 2FH6A 3LPFA 4ZUSA 1KJ2H 3O6FB 4LT7A 4R83A 2FL5B 3F7LA 4HF5H 3UTSB 4OZFH 4C4KT 1XSKA 2A6IA 2MOVA 4JZOA 4EI5B 4Z7UA 4GW5B 2RTTA 4J2QA 4KJYA 2B08A 5E8DH 2X28A 2DOCA 4R84A 2HRPH 4N3TA 3BH8B 2WBWB 3B2UC 5GISH 2EIMB 4AY0A 3C2AH 4YXHH 5DEZA 4PGDB 3SDCB 3SPJA 1CTNA 4EBQH 4YSCA 1WFJA 1VLXA 5GQBA 1A4JB 3GBML 3PWNB 5CWSB 2GBAA 3BGMA 1OW0A 3O2VL 5DJAB 5HHME 2AJZA 1XV8A 2X4OB 5GRVK 2E27H 3CFUA 3BQUD 2MPAL 2PMZA 3BKJL 3L3JA 1MH5B 4PY7B 2VXQA 5D7EA 2WY3B 2VMDA 1XXDC 3WNPA 3PYCA 1T0MA 3B43A 3QEGH 2UYLB 3CFJB 4IIZA 2WSDA 4X98A 5FYJU 4K3DL 3QI9C 3VFRB 2BVUA 3UP1A 2XFGB 3SDXA 3ISRA 1MZZA 1OO2A 1MDAA 3FBKA 2X1WL 2Q7NA 2QZ5A 5D5MB 5CCGE 3F58H 3GXMA 1XMEB 1RL1A 1I9RL 1T0PB 5SWQA 1Z7JA 1M7DB 1OAYL 4N8PA 3TCLA 4HOMA 3H9YA 2IGLA 3P3UA 4JQXC 5SWSD 2FZ3A 2JI2A 2E4TA 2FWOA 1RULL 1G7QB 4UNTA 4YXKH 5DZNA 2KKQA 2O6CA 1LWHA 3QWQB 3MJ7A 4B95C 5JO5A 1MKFA 3DIFA 4F5CE 4FABL 4FMKA 1JCVA 4ANXA 2E7CA 3PHOB 4UV4L 1IGFL 3VXSE 4DKDC 4TQ8A 3WS6C 3GPEA 4QHPA 5J6SA 1U8HB 2VW7A 5T1KA 4Q4EA 2R1YB 1ZT7B 2ED7A 4ZG1A 5FCSH 1F8TH 4YFLI 2VLJA 2D03H 4KO9A 1Q1PA 2VLKB 2SEBA 1FYTD 2Q8AL 3GMMA 4XNYL 3S37H 2WLIB 1LK2B 1MWAH 4UYQA 1C9SA 1WZAA 1M7IA 1MUJB 3VFUA 3MV7E 2BNQE 1COBA 5KVFL 7TAAA 3NDYE 1AIZA 4IW4C 2FNBA 4KZ0A 2V2XB 1Z9MA 2VC2B 4DKFH 3NA9H 4KK9D 4HCRH 1TJMA 3OZ9H 4QGYA 4AEHH 2AGJL 3CLEH 2UVEA 3VI3E 4J27A 3RWFA 4ZAKC 4Y2OB 2YUZA 1AS8A 1YYML 2UXGA 2L7UA 1IGIH 1U3YA 3FQXB 3RTQB 1U3HD 4KQ4L 3MV9E 4EQ3A 3B2DC 5KAQF 2CDFA 2GITA 2WXLA 4AG4H 1OQOA 3MLZH 4OFPA 3MRGB 1Y1UA 4HIHA 4OCNC 4R97C 5AW6B 1ZLVH 3O9WD 4UT7L 3E9UA 3X3FL 1T04B 2AK1L 4CVUA 3FMGH 2OMZB 4X80H 3BSZH 4M7JL 2BM3A 1JL8A 1MIML 2ZXEB 1CU4L 5DXWA 2JWYA 4ZSOE 4N4YB 3VXTB 5A16A 5F9JB 3HG1B 3WO4C 2A9CA 4EXPX 4PRHB 4QNPE 1F42A 1YUKB 3G6DH 2H26A 4OLXH 5LGHH 2JKSA 1BLIA 2OXHA 1J48A 2NY4C 4XP6H 4Z7UE 5FOBA 3UTTB 5SWZA 4LCWE 4WKXA 2Z64C 1FH2A 3CU7A 4FTVA 3WEMA 2G4EA 2VNCA 4PJ8B 1XBRA 1W0VB 2V2TB 4AYFA 3QIBD 5FCUH 4NHCL 5IR1B 3ZRFC 2WOBA 3V6BR 4QJ5B 2WLLA 4CSZA 3MFGB 3O8XD 5CCJA 1E2ZA 1YRKA 4TSBH 4YE4L 1JVKA 2XFXA 3P2DA 2OZNA 3EOTL 4CSPA 3IN2A 4K3EH 2Y6SD 2B1AL 3VWJD 4B9FA 4DP4X 1J0HA 4GMSH 1D3CA 2HUEA 3OLGA 4GAJH 3T65A 1M2OA 4WWNA 5CJQL 1A8ZA 2YPLB 9CGTA 2LVEA 4M4PA 2BMKB 4ZFOA 4TUKL 2QR0A 3VXQA 2WBXA 1OB1A 5D96C 4P4KC 5CEZE 4NIKB 1JGEB 3SDXE 2J44A 4GUPA 3OAZH 2HLFC 5IF0A 3CFCH 4WHDA 1KB5B 2MNUA 5J6GB 5K33A 1ACYH 1E4XH 4LLDB 2G5BB 3OKNA 2BZDA 3I02A 2XACC 4KKZA 3FUDA 5DFVC 4CAGA 1UGKA 1G7HB 5JR1L 3SBWC 1KDJA 3FO0L 4LHUG 2XPGA 3PL6D 3H6JA 1S5HB 3HIZA 4HFWA 2PP8A 2UXFA 4ZUTA 5KG9A 5B4MC 1TOXA 4JFWA 5ANHA 3U2SA 4NFCA 4OUUB 1AZNA 4YQXH 5E2UL 1KXTA 4FJYA 4TTDD 2BY0A 4ETQB 3V4VH 1ETZB 3D6GA 2DLFL 5DJ6A 1JWSA 2A0LC 2FEDC 4Z23A 1N2RA 3E9TA 4PY8I 2W0PA 1F11A 2IC2A 3DI3B 3MTRA 3AXIA 1KG0A 1DL7L 2VLJE 5AAMA 5SV3A 3O0LA 3FJTA 1H9VA 4TSCH 2Y07H 1IAIM 3R06B 3L81A 4G6AC 4PYGA 3RNKB 1C5DB 3F85A 3K3QA 3M07A 2FRGP 5E4IA 1IM9B 1RP9A 2CWRA 1YY9C 2ARJQ 3MA7B 5SX5H 1XF3B 1JBJA 3MRBA 3UZEA 4CRPA 1SM3L 2Y3NA 3EOAB 3K6FA 3LNHA 4N8VB 3ILPB 1R75A 4BZ2L 1P5UB 5DWUL 3RWEB 1MRDH 1VF5C 5C6TL 3BAEH 1RIUL 4RWHA 3DIVA 1TPXB 2CMRL 3UDWA 2V33A 2HJKA 5IFHH 2ITDB 3FKUS 1UT9A 3VTAA 3BMWA 4Z95L 2AEIT 3VDAA 1GC1H 1RZIA 4MGXA 4N2MA 1UVQA 2P3YA 1X5JA 5CZRA 3G5ZA 1R0AL 1LEGB 1VKXA 3SDDA 2Z35A 5E8PA 4DN3L 3OLEA 4R8WH 4EN3A 5IWLA 1NFDA 4D8OA 2WUBL 3V0IA 3ZT5A 5E1AB 1VEPA 3WGUB 5ICYA 2ZKWA 1HU8A 4F91B 3RFZB 1XGUA 2EDMA 1BEYL 4JFDB 4FG0A 4H4NA 1T1ZA 4ZUWA 1RJLA 1CCZA 5EC1A 2Y1YA 1IC1A 3FK3A 3LJ3A 5AYTA 4HLZG 4DQOL 5IMMB 1BXXA 2PYFB 1UA3A 3EUUA 4H1LA 4M1DH 5EPMA 1JHKL 5FA3A 2IBBA 3MRLA 3LQAL 4XP9H 1D9KC 4KBPA 1FNSL 3HNSH 2XTJC 2HJFA 1EX0A 1KUMA 3CH8A 5FYJL 5I1HL 5KS9A 1LL1A 3II1A 1R3JA 1XF4B 3L7FB 4FFYL 3BKCL 4FTVE 4Q56A 1IAKA 4L5FL 5GS2H 5INDB 2OP4H 1GOHA 3BYYA 1KCSH 4EKJA 4X6CA 4HGMA 2XNAA 4UQ3A 1NICA 1ZCRA 3NABH 2HVJA 1S78C 3UPAA 1BVOA 3LRLA 3B1TA 2XBDA 3NRQA 3KCPB 3DPBB 2F8XC 2AVGA 3S4SG 1DQJA 3WMPA 4GNKB 4MAYC 2J88H 3MOBL 3L3DB 4QHUA 2YUVA 5FPIA 5T3XE 5D1ZI 3PGDA 5LG1A 4F7CB 1UZ6E 2A3TA 3R8BB 3APNA 5I15L 4K7PY 1WCBA 3IN0A 1NCCH 4K5NA 4JREC 4JKLA 3MBED 1G0XA 1RSFA 4PGEB 4HS6A 4KZCA 3NACL 1SHSA 2Q7YB 5HI3C 3TH2T 3BUTA 4NP9A 5D1QC 5E7FA 1HILB 4MXWH 4POUB 3SE8H 4HLZH 5IJDC 4YDMA 4C59B 4QJ4B 1HEHC 2O1AA 4QO1A 4AJWA 2APXA 3VH8A 1T7XA 2G60L 2RQEA 3T9WA 3V0VB 4AV0A 2BVOB 1GZPB 2DWDB 3LPWA 3AW5A 1VERA 5IBLC 1JWUB 1B6UA 1H15B 1K4DA 1YNTB 3BPCA 4AM0A 3NBNA 1DJZA 3L3OB 2XWXA 1F3JA 5DMIL 2Y7QA 2ALAA 4JFEB 5JXEC 2F19H 4MS6A 5HHMB 1JTTA 4D2NA 3U9PH 1ZA6B 3VSUA 5FR3A 2Q3AA 3ATEA 3CFKA 1MFMA 3CXDL 4H8WL 2XJLA 2GABA 2PO6B 2RIKA 5DJXA 2VSMB 4OKDA 1NFIB 1QFWH 3BWUF 4ZW6A 1MZYA 1DQMH 4TKWA 1C7SA 3BO8B 2X89A 5IIEB 1VEMA 1N4XL 4ONFH 4U3HA 4NBZB 1I9JL 4PRDA 2KZ1B 1FZKB 2YJQA 1MHCA 3AXLA 3LXAA 5MENE 4MA1C 4XMKL 4JO8A 1C7TA 3KL0A 4H8PA 3CNKA 3MCYA 5D2NB 4FEMA 3QQ3B 1UYWH 4LPUA 2ESVD 1MJ8L 5DLMH 2O61A 2GSGA 2ZXQA 3AABA 5EH1A 3MLWH 4RBPK 4B9ZA 3ULVE 2EDQA 5FW7A 1J86A 5ACZB 4ZTPL 3PDDA 3CFEA 3CXHJ 4UINH 3V0FA 4AXWB 5T3ZH 3RQ3A 2BDNL 2W9DH 1E3ZA 3RVTC 4E9QA 2KLRA 2X4RB 2QQLH 3KWXA 4E9VA 2NUTB 4ODXA 1T03L 2V0AA 5E5RB 1RK0B 1RMFL 4Z76A 4FG6D 5BQ7B 4XVUC 4IOIA 4IBSA 1EPFA 3QZWG 4NWUH 3HN5A 3OKOB 3VXSB 4KO6A 4WRLA 2WLHA 4RAVA 1UWGH 4JQIH 1EJ8A 4LEOA 4AYID 1MCDA 1UWEL 3FUFA 2FBOJ 1U8PB 3P11H 3P02A 4KMTH 2E47A 2W80C 3LXCA 5EOTA 5AZUA 5HPMB 3JZ7A 1T2QH 4GKSA 2H1PH 4TMPA 1EBPA 2HJLB 3TWCH 1GKEA 1BEXA 4LKCB 3BAWA 5ESAA 2VUKA 3WD5H 1WBYA 1A4BA 4IDLA 5C0DA 3IRZA 4KRPB 2XRAH 4L8BA 1XF5A 2HG0A 2YS4A 1MFBH 1MLBB 2BNQB 3L5HA 1XD0A 4XNUL 3CLFL 1PLGH 1WAEA 1ZHNA 5EZIH 1IQDB 1BGXL 4OLVH 4YHNB 2QMKA 4XHJC 5G4MA 3FN0L 4WI0B 2ADFL 1WJ3A 3AU0A 3HKFA 4OJFH 3PY9A 3EBGA 4XVTH 3JTTA 3U48A 2NY5H 3AREA 4YK4B 3B2MA 4D9QD 3K6NA 3MX0A 3SYAA 2DEXX 1J9TA 3L5WB 3C08H 3BAXA 2GUOA 2XWRA 2YPVL 4IEFB 3I6GA 5DLLA 4ZXBD 5IQOA 3PWUB 3GLAA 1YEFH 3MV9B 3V6ZB 2N59A 4M6MH 5I17B 3ZJAA 1AXTH 5GJTH 4AWJC 1RERA 1N8ZA 2IH9A 2MSPA 4JN2B 3UYRH 1E3FA 3K8MA 5I1DB 3FFDB 2FNWA 5EO0B 4DEPC 1CWVA 5JW5A 2IFGA 3ZUNC 1Q0EA 3WY1A 4ELMF 3TZVD 4ZSOB 5L2KD 1CG9A 2X3AA 4M9OA 1AC0A 3BVTA 1NMBH 4QRTA 4WFEE 1RUMH 3L7EA 1MFNA 5E2VL 1NCJA 4XCEA 3WFHB 4D0DB 4KJYB 1Q9OA 4LCWB 1EDYA 3QWNA 1QNZH 3MBWA 4E5XA 1S3KL 2Q76B 1Q9WB 1D5IL 3MXWH 2Z34A 5BV7L 4G59C 2VLLA 5C0CE 2E7LA 4M5SA 4NKIL 5L88L 2NR6D 4YDZA 4FZ8H 4N26A 1YN6A 3C5ZD 3KWTA 5J11C 1KIUB 1TETH 5M95B 5E2TL 2X4PA 4MJIA 3MOQA 5I1EL 4OQTL 2XN9A 1HL4A 1XL6A 2GJZB 1IEAB 1I7RA 3MJ6A 2XXFA 3TBWA 1IFHL 2KLTA 2D31A 2BSEA 4P5KA 3SGDI 3SPIA 3T8XB 5J57B 3Q1SL 5IT2H 3C60D 1B4RA 4W9DC 5HGBA 4R3SA 43C9A 1DO6A 2YKKA 4K94L 4YGAB 2AJ3B 1JXJA 3PV6B 3E0GA 4L1HA 5DRZA 1ES0A 3SYPA 3TA3D 5B38G 3MCLL 3M8OL 5D55A 3ROOB 3WJJC 2NZIA 3CDYA 3H0TA 1NH6A 1TTAA 5F3HA 2DEYX 4M8QB 1MFEL 1QSFD 3HW7A 5DFAA 2NY7H 4F8QA 2DQEH 3PPSA 3QS2A 4Q2ZA 1I1CA 4F93B 3L4WA 4X9FA 3SO5A 2VR9A 3HS9A 3GEFA 5IW1B 2A6JB 5HHQB 2CK0L 2G2RB 1XR8B 3G9VA 3R18A 1T22B 2CHXA 4GOSA 3QNFA 1JK9A 4GSDH 4NPKA 3BAJA 2C3HA 3GGWA 2NY3B 4H0GA 2VE6B 5CMAB 2D73A 2IGTA 1KGCD 2EXTA 1TU2B 4KRLB 4NQSB 1GTFA 4ABVA 1G6RA 4ZQKA 3U4AA 3IXAB 1GSMA 2JI3A 4JNXA 5H35B 2O26U 3B5GA 4KGJA 4UTAL 4YDKH 2ATPA 5JPNB 4PWFA 2P5ED 3FQUB 4B5ZA 3OAWA 4TYUA 1LEIB 3MLSH 1EZVX 4KKNA 3BWZA 4ZMYA 4NOBA 4DAGL 4NPYB 5IGXH 3GKWH 4MCZB 1H3PL 4Z6AT 3NG5A 1KNOA 2NQCA 3LS5H 2IJ0C 4HXBL 3DRQB 2NY1D 2WINA 3RGBA 3MQIA 2VDRL 2WQAA 4R9HA 4BWWA 1ADQH 1BM3L 4OB5H 4OFVA 4A7GF 5DVNA 2VRQA 1F1AA 1RZKC 3HUJE 3LZQA 1KC5H 1KFGA 1TF4A 4FNLL 3V4LA 5D9SB 4ZOCA 1WBZA 1TNMA 4KFMA 3DV6A 4PLOB 3W5NA 3GIVA 2W91A 2NDFA 2KUTA 5FO2A 1MRFH 2QHRH 2QKIC 3B9DA 4LSVH 4O00A 3NPSB 5C2UB 5BJTB 2CAKA 5L4JA 2APTA 3IJEB 5ELIA 1BF5A 4E9LA 2ZXCA 3Q2LA 5J9PB 5DRXA 3NIFB 5A2AA 1S7WB 1S9WA 2YQ2A 4CC4C 1EJ6A 4B60A 1IO4C 1YA5A 3KPOB 2H3XC 4I0PD 1ZSDB 2ZJSH 5I6NA 2CKBB 2EEAA 1OARH 2B59B 5EIQA 1ZV9A 2CIKB 2P8LA 4H44C 4KROC 5DGRA 3MLUH 5E9DB 1GOFA 1VESA 2R4RL 2CJUH 5FHBL 5C0IA 3W0WA 2B2XH 1DQTA 5MP6H 2BHFA 3I3DA 4HKJB 3WGVB 4BUHA 2L7QA 3FHEA 4IIQC 4JM4L 3VFSB 4DJMA 1UJTA 5TJWK 1EWHA 2J8HA 4C4BA 2IPTL 4LEXH 5FDYA 1NGWB 4N0FB 4B0MB 4ELKA 4XNMB 4N1HB 1DO5A 1MFDH 1MF2H 4O58L 1L9PA 4APQA 3B3IA 4JCLA 3ATAA 1LK3H 5F9OH 3FFCD 3I50L 1XR9A 4I0KA 3ARDB 1XO8A 2F1AA 2OX5B 1K8IB 3O6FC 4KKBC 2VM9A 3LEVL 4MJIE 4R7VA 4RWYH 1E8XA 2XN9E 5HI4C 5CCKL 4HVBA 4OM0L 3MUGA 3A6CL 2F1BA 4K5PA 5D71L 5CN2A 1QATA 1CGSH 5IB3B 4BYHA 3HJEA 3LZLA 1LJMA 3S48A 5EEXA 4MMYA 2J6EL 3D0VB 1AFVL 2NY5C 1FO0A 1DLFL 2XWCA 1GY2A 1U8NA 1AR1D 3BZDA 2ZYSA 2CHZA 1UZGA 1WIPA 4HIXH 4OLUH 3W39A 1KCUH 2AJXL 3VXMA 5E8OA 3V7AG 2QR0B 5AVZB 3GI8L 3PREA 3O2DA 1Q94A 4U6XB 1UOKA 4L9DA 2NXYD 1AP2A 1R33A 3HI5H 5IF0B 3VXOA 1VHPA 3LYRA 3PWPA 4RMUA 3PUCA 5IROA 4ODSH 2VXSL 5CLZA 4M6AA 3OKNB 4FC3E 4HS3B 4PVMA 2X6BA 4UILL 2IG2L 3M7FB 4J3SA 4RIRB 4DO6A 3HC3H 4TOYH 5J4MA 1IIIA 4R4BB 3WKYA 3IVKB 2G3XA 4FQQA 3M17B 1YHPA 4HMEA 5D8JL 4AQZA 4CVZB 5I9QC 4HWZB 1OK8A 4U1JA 5GGUA 4OV5A 3K2UL 3Q43A 2XKNA 3KXFA 5ES4B 2AS5M 3VQLA 1ITCA 2CK2A 3EJZD 2DWSA 3MACH 3GMPA 5HGHA 5T5FH 4L8DB 1PY9A 4NO0A 5B7FA 2ADYA 1XSOA 1SXSA 3VWKC 4FXLA 3B8SA 4MJ2A 5TDOA 4HKZB 4P57B 4A7SA 1AI1H 5JA8B 1TZHB 2A2QT 3CG8A 4OD1H 1PCSA 4Y16D 5MENB 3MUHL 1A1NA 5IBTL 3IEAA 4BDVB 4I3GA 4EJ1C 2XG5A 4J5VA 1BZQK 1YQ2A 5IMKB 3FT1A 2XA8H 4S0SD 4X7DC 1HVXA 5HVWA 1SJEA 3T0BA 1UEMA 2M2DA 2H47C 5DJDB 4DP7X 3L6FB 3K1KC 2P48B 2GKIA 1XGTB 4ORGB 4DTGL 3R0NA 2FQDA 1WLHA 1KLGA 3U6RB 4G9DB 2OYPA 3MYJA 4OZHE 5HVHB 2YGVA 1O9VA 1QLEL 4NO2A 4XNAA 3UZVA 5AAPA 5HGDB 1NUGA 5AW1B 5KVGL 1KEGH 1AY1H 2O4EA 1A1OA 3BSGA 4FN0A 3D4CA 3R1GL 3D3VB 4JFHE 1C16A 4KXZI 2YOCA 1HKLL 3SQOH 4XMLL 3WIIH 4EI6B 4G5ZL 3NQIA 5F7HA 5I74B 1XIWB 4LSRH 1CL7H 1QD0A 1N8OE 1NCDH 2ZWNA 1QMUA 3DK2A 4LOFA 5TH2A 1CR9H 1QO3A 1BAFH 4UTBA 3CFIC 1QBMH 4CW1B 1ZGLA 3GIZH 1UB5A 4EZJA 5D7JA 3Q48A 1T1ZB 4ZUWB 4UQ9A 5F1SA 5I23A 3EFFB 5BS0A 1UJ3A 2EQDA 4KZDL 3JBG7 3RTQC 2NNCA 3D48R 1CMOA 1A47A 4QHMB 4R0LA 3ZRSA 3BKYH 3WLBA 3O3EB 5A6IA 4H1LB 2EINB 1QVOA 4C58B 2X38A 2OQJA 2I27N 2K7QA 3DX7B 4LLQA 4OAWB 4R90L 4FXGB 4BEIA 1AZBA 4FQLL 4JFTA 1J7VR 1KXVA 2HYMA 2YK1L 2ZP0T 5GJSL 1YMMB 4B9CA 3MRKA 1UM5L 4CNIA 4MCMA 3FOMB 2OLDA 1HCVA 3KVDD 4J3OD 3EYOB 3H9SA 5I76B 4WW1B 4F2MA 1NA8A 3WN5C 2AQQA 2IH1A 5HGAB 2Z0BA 3GJEA 2F9BT 3K6DA 1QFWM 4KY2A 4ZTEA 1YMHB 4NX0A 5TD4A 3SOBH 3BKML 3K81A 1JHTB 4LDCA 2VR6A 1NBQA 3ZO0A 2I69A 4K23H 3BDYH 3E8UH 4IK7A 4P4RB 4QRPB 3QUZD 2AABL 3IDYB 4FG4A 1ZHKB 4I9XA 5T5NF 4YN3A 5A2BA 1AGEB 4FNUA 4XNZB 3NCJL 3UIYA 1J1PL 3LB6D 4Z7VF 1IFGA 4NYLA 4AQAB 3VXME 5KTEL 2XXMB 3TJEL 4PJHF 1NLDL 1U8QA 5GRZA 4WZ9A 3AQZA 1TJHH 2DTSA 3DOIA 5EU5A 4OIAA 5KVFE 3QQDA 3LZFL 4OIBA 4AIXA 1YZZA 2X87A 1JGLH 1KCVL 1KENH 2WP3O 5C0CB 1U92A 5MEPB 4Y0GA 2NYKA 3WFCL 2PNDA 3VXUE 3TT1L 2D7TH 3VSVA 2VGLM 4GI8A 4NM4L 3VD1A 1DQLH 3T0DA 2DZEA 2FHCA 2N7BA 1I75A 5JHDA 3K46A 3X3GL 1E42A 2YAEA 3DDGA 4MQXD 2XZAH 1JPFA 3KXFE 3D4GA 1A7NL 1QG3A 1JNHA 5C0RH 3K1DA 2D2CC 4NI6A 1MXGA 4X99B 1NC4B 2EDHA 1S5IH 1YPZB 5I6MA 4QRQB 1I1FB 5EWIL 4LCCB 4OFYD 3PUUA 3AB0B 5EBMA 1U91B 3IPEA 5BRZE 1E40A 2RA1A 2VDKB 4U0RB 3MV8B 1NSNH 2FJSA 2X10A 2OAAA 5FYLD 5I71B 2JTDA 5CP3A 3T2NH 1H0DB 2E9WA 1TQCB 1J0YA 2W9EH 3L5XL 5GRUH 3X1BA 4P46D 1JG9A 4KNUA 4GG8A 2CO2A 3N44F 3UPRB 3OKKA 5EBWA 3QPQD 4LCUA 3IXTA 2APSA 5ITBL 3NUKA 2EE6A 2N56A 3JWDL 4YAQA 1W16A 2K1MA 4GO9A 1W0WA 1OY3B 1QPPA 4TPRL 2PXYB 4I13B 2BIIA 3K6SA 2AEPL 3QIWA 3EG9A 1QLFB 1FL3B 4NQCA 1ILUA 2DLIA 4NZ8A 1TZAA 4P3DA 3ARWA 1YEGH 2NX5D 5DUPL 5BQDA 1EJOL 4L4TD 4LSPH 4WI7A 2UZXB 4PB9L 8FABA 3A5VA 1JSYA 4U1KA 3DXAE 1BF8A 4OCXH 1L9OA 1WBYB 2Y5EA 3EJCA 4KUZH 1SOQA 3LVEA 5C0DB 4L8BB 4JRYB 3SE3A 1FVEA 1IZJA 1IBBA 2V5MA 1BWMA 3HUJB 5BS0E 4XPFH 5DZAA 3NCWA 4QF1B 4RISL 1N19A 3A6OA 3M88A 4HT1H 1R5IA 1TVBA 3MRQB 4FNTA 3DGDA 3P2TA 4R2GD 4HSCX 1CGVA 3A6BL 1W72B 2KBGA 3HE7C 1DEEA 3HZ3A 2ARJB 12E8H 2H9GA 4D0CA 5C3TA 4G8GA 4HUMB 1KIPA 2UY7B 1ZWIB 4MZIA 3VGHA 1S7VA 2AVFA 1Q1JL 3ARZA 4OLYH 3H9SE 4UMGA 2MTPA 1JV2B 2HWZH 1YVLA 2ZKHL 1JMXA 4MNGA 3T3ME 2EYRA 4JLRB 4Z7IA 1B90A 3FU6A 3H56A 1WA1X 2P8PB 4DP0X 3BP6B 4DFIA 4MYPA 5FIEA 2HT2D 2XZQH 1KPUA 1LP9F 1SN2A 2F54D 3FS9A 3QFGA 3BXNA 2H8PA 3BW9A 4PJFA 2VXQH 1LM8V 4XMVA 4NGHH 1IC5L 2R2HA 4Q7DA 5CSZA 4HV8B 4GLRH 3S96A 4ZOBA 5F96H 1AIFB 4GRMB 5CEZH 2H6OA 1KV3A 3QCUH 4DK5A 4WO4C 2QQKL 4Z8FH 2WVVB 3L9EA 4G7YH 2FSDA 4EZMA 2JCCB 3ZE1E 1AD9B 2HVBA 2PP7A 3ZKMD 3RZCD 3DA0A 3NJLA 1VFUA 1OT1A 1MPAH 1DN0A 1IC0A 2AQPA 3KPSA 5B1KA 3OJMB 1DVFD 4HOXA 2JK5B 5SV4A 3VXNA 1R9FA 4KK6D 2R69A 3O6KH 4U1LB 2ZX7A 3OKDA 4JFOB 4L9LB 5C86A 1MNNA 1BZ7B 3TO4B 5CIPB 3WE6A 1KMGA 1EQWA 5DC9B 5JHDE 2X5PA 1L7TL 3U7YH 5C6WH 3U46A 4FI6A 4N3UA 4U1NB 2VR5A 3B2UD 2JKTM 3I9IA 3CN3A 3TTYA 1S9YB 1J1OL 3UMNA 3PQYE 4FDWA 4KMQA 1BREA 2GK0A 1DSFH 1H8OA 3GNMH 4HPOH 4XHQA 5CLTA 3UBFA 1HYSD 1XGYL 3LZOA 1VZGA 2XV2A 5F0PB 4AGQA 25C8H 3FQYA 3GTTA 1FYTA 1Q4NX 4P2RD 1TZIB 5F93C 1OF2B 3VRLF 4JVWA 4LLUB 1FDLH 4AYSA 4E2OA 3MNZB 1WK0A 1Z9SB 4NNPL 1SVBA 4UM8B 5AVWB 2IQAA 4JG0L 2CU9A 2A73A 3A4EA 2X6AA 3BYTA 4L0ZA 5HDBF 5E7BA 1NKRA 3QI9D 1LDPL 3O3BA 3DK0A 5FYJE 1KN2H 5L8KB 2E59A 3N40F 1RD6A 4NUPA 1LO2H 3GBLA 1XGQB 3CCHB 4PJDF 4U3XA 4W70A 5DVKA 5ESVA 1HOCB 3BZEB 1CFSA 3X1FA 1YC8A 3DURB 3EJQA 4WI8A 5EEZA 1RJYB 4M1CC 5HHXH 4BH7B 1PG7W 2DJUA 4ENED 4X42A 2YRZA 5F3FA 5JUEL 3POCA 2V7NB 3JT0A 3BCDA 1AOZA 1FGNH 2YD3A 3B9KC 4ZO6A 4YHZH 3L54A 2PN5A 4DO5A 2CKBH 5IV2A 4FD0A 3S36X 1XGRB 1MWOA 2GC4C 5I2IA 2V7HB 4XP1H 1CZ8L 5IY5B 1DQQB 1QHOA 2A4ZA 2GAZB 3I3BA 1ZLWK 3IF1A 3WJLC 3A67H 5FEBA 4HKBB 3E6FB 1RIHH 1MQKH 4X0KB 3MRJB 2CLRA 2Z7YA 4PJ7E 4YHYB 4LGSB 5KSBB 2YPKA 1J0KA 4OZIE 3KS0H 2CLZB 2OR7A 4GAFB 5E56A 4N68A 1YEDA 1ZT4A 2V8MA 4OZHB 1KJMA 2CBPA 3QIBA 4IOFC 1ORSB 1IKFH 1PX3A 5CD5C 4G70B 2X7LA 4AGPA 1I3UA 3V79C 1CD1A 1ZV5A 3QIUB 4ANKA 3QNYB 4G8GE 5J1AB 3UROR 3I9GL 3PLYA 3HBQA 5GS1B 2VLRA 3NZHH 2PWFA 3RKPA 2FHBA 2IOMA 3TP4A 3QJUB 4QY8A 1XWVA 1I7ZA 3K8KA 3AU1B 2FECL 1GYCA 4A66A 3IFPB 5FO9B 5ETUB 3K7UA 2GY7B 5D2LB 5T3XH 3QDJB 4ZAKD 3ZDXE 2Y22A 4UT9A 1YEKH 5GGTA 3MLTA 3ESUF 1E4HA 2J1XA 3RHWF 2OTPA 3AY4C 3VFOA 1VZIA 3ZOAA 5C0FB 5FA4B 3VFVA 1WFNA 3FU0A 4I0CC 2NY0C 1B4LA 4TULL 2EXYC 2Z8RA 4XE0A 2J25A 1THAA 2YBGA 4XMUA 4HIJA 5J1SC 5DZ9A 3CHXA 3ENEA 4JFFD 1F58H 3EJJX 3WY3A 5FM4A 4BKSC 2Y1AA 1YUHB 1TDQA 5SWSE 3R4DA 3KPSE 5EORH 1T4KA 2R9HC 4N2EA 3TN0B 1PDKA 1SDAB 1NC2A 2DIBA 2DWYA 3B8YA 1NEPA 4GMTL 3U7AA 4GXFA 1PNDA 3OXSA 4PVNA 1EAPB 4YC2C 5F97E 4IHOA 3KPMA 2NY4D 3BGFB 1JZHA 2X2YA 2QGBA 3LZRA 1VGKA 4QKXB 4A6YL 4V2BA 5D93B 1D5BB 4DGYL 2FT6A 4Z78B 4H5SB 2X05A 4XWOC 1UQSB 4JY6B 1QPXA 3DUHA 5B22A 4PCSA 5C3LD 2ICCA 4BWTA 3IDNA 4N2NA 5EIVA 5E08H 1E30A 4M61A 1ACZA 2QQNH 3D2UD 1FYTE 5ERWB 5IJCC 3FO1B 1CLZH 6PCYA 1T6VN 3U7WL 4Z5RB 2F7IA 5IW3A 3UJIH 3V95A 2ATAA 3MNVA 4ES8A 2JKNA 4S1QH 4K73A 1OW0C 4FFVC 5FO7B 3ULVH 1FL5A 4H1LG 1RUPH 3VXUB 5A6MA 4PJ9B 1NGYB 4G83A 2GIMA 3CFDA 1CD9B 1F4WL 4GEIA 1TENA 3ESVF 1GZHA 3E2HC 4JKMA 3PWJB 2DIEA 2J2ZB 5JZ7C 4P4KD 3GRWA 2AK4D 5KSAD 3BMVA 3MHZA 4OLWL 3VFPB 4UBDD 1QYGL 1HZHL 2ITFA 1CFNB 1U4FA 2RACA 4NBXB 3GMPB 1DVQA 3VG0H 1B0GB 4QXWA 5F88A 5E6YA 3H9HA 5KJ4A 4ZMOA 1JF6A 3CFBB 4BH8B 1G9MH 2BS71 2FB4L 5EU4A 2Y36L 4RH4A 5BRZB 1FJ1A 3VM7A 2AJYL 4Q9CA 5E23A 4HD9A 3MN8A 4LBEB 5DVMA 1CIUA 1TFPA 4YGVA 1KBVA 2CGRH 4IOSA 4E36A 5FYLL 4X4YA 1UM6L 4KVNH 2F58H 3QXAB 3T5WA 2XYCA 1GAFH 2VSDA 1WAPA 1A2YA 2FEDD 1Y18A 3ZZ1A 1IGTA 3LN4A 1E6JH 2TRYA 1RZ8A 4QTHA 5ID0A 1E4WL 4H1LH 2EO7A 4MBOA 1HC1A 5IOPB 1G7PB 3RL1A 1TMQA 5AYQA 4G6AD 1KYOJ 2X1XR 3UZVB 2HFEA 1BSIA 3G5YB 5I5RA 2OL3A 3L2NA 3S8WA 1T5XA 1YY9D 3ARPA 3QT2A 1WZ1H 1T0NA 3AS2A 5AYUH 5I1IH 4K7PH 1OP5K 2W0FA 2XA3A 1W8NA 4XC1H 3GMNB 5BZXA 4KH9A 3APCA 3G08A 3QCVH 3DXAB 2ZXBA 5LBSH 5E8EA 3RWHA 4ZFQA 1WS8A 4FXKA 5JQ6H 4FXTA 4Q6IA 4QAMB 5D1XC 2FATH 4LF3A 4Y4FB 2DI7A 3S8GB 1C12A 2Z8SA 3EHBD 4WY7H 1QTSA 4YUEH 4PU2A 5TQ0H 3GS4A 3K2KA 2XV6B 2Q9OA 2V17L 3D4ZA 3QEHA 1RZ7H 2I9TA 5HYQB 3T2OA 3QJVB 4M8RA 1CDCA 3TBTB 4HC1L 3FT2B 1T89A 2DV6A 1UWXK 1R5VA 1QTYT 1ESOA 4JPWL 2DQIH 5TDNA 4JDVA 3MLYH 4HPHA 3VFMB 3WENA 1MHEB 3MFFA 2MQGA 4J3VA 3T3MB 4Y89A 4NLAA 3T77B 4A67A 3UMTA 3CDCA 5F9DC 3KJ4C 2V37A 1JIBA 3LCYA 2EEBA 4KHXH 1EEYB 5I0YA 3BEVB 2BVQA 1NUNB 4HJ0D 1PY4A 3T0XA 1G7JA 2VWEC 3NSJA 3QUXD 3DSNB 4RAUB 1S78D 3KR3L 4D9RD 2W81C 4ODBD 2GBUA 5ID1A 1OCZB 1OOWA 4XODA 1MG3C 4ONHB 2R29A 4NYLB 1MCFA 1OZTG 3ELQA 5T8IA 5JDSA 4LSQH 5DEFA 3ZE1B 1ZA3A 5DD5L 1E8ZA 2Z92A 1BJMA 2Y06L 3NH7L 4BINA 4Y4HB 1J05B 4AEFA 3MUJA 4G9FB 4N0CC 3D12B 1EO8H 1M71A 1X9LA 3ARFB 1BX2A 1TR7A 2FX7L 1QUNA 4UQ2A 3S9DB 1K6QL 3BEWB 4GUOA 4F8PA 1NBYA 1R5WB 5KYUB 1YDPA 4AV4A 4ZS7L 2G3MA 1LO0H 4OIIL 1ZTXL 4WI5A 1JZDC 3DVFA 3PQYB 3FB5B 3OR7B 5DI8A 3T3PF 2JIXA 2Z4QA 1FPTL 4PD4J 4XBMA 3T1WA 5DZJA 1ED3A 3ULUC 1QLRB 4LP8A 1HN1A 1LO3L 4NZRL 3IKCA 3IETA 5IBLD 4LDLB 4HHAB 1M53A 4KDVA 2VMJA 3P3YA 1J5OH 1IAIL 2DL2A 3WMQA 1IM3B 2CRMA 3MJ9H 2OSYA 5FHAH 1S7UA 4RDQG 1WFUA 3AACA 4OCSL 4D8PB 1P2CB 1B0IA 2E75C 3Q2VA 4PB0L 4IGBB 3X2QB 3OPZH 4B96A 3V4PL 4LCUB 1XCQA 5DRWA 2EE9A 1J10A 3T6VA 1A02N 1FC1A 1G1OA 3NJXA 4YHPA 2XHNA 2DQFA 4AEIH 4FA8A 2E6QA 3TESA 3K71A 2B4CH 3RWDB 1C5CH 5C09D 3IJ8A 4X9IA 1TSHA 3CVHA 3H3PH 4O4YL 4PREA 5AAMC 1HSBB 3ZL4L 3WHXB 3GXDA 2LFGA 4J28A 3Q1EA 3CPUA 4UV7H 2Y69B 5D7KD 5J3HC 1UA6L 3MOAH 1ROWA 5KVMC 3P0YH 5I1JH 3L3IB 3LSOB 4GB9A 3ULVC 2LR4A 2PCFB 4DGIH 3ZLQC 5BZDA 4CL7A 1T0OA 3DYMA 3UZEC 3P73B 4HWEL 2AI0H 5DD0H 1CJYA 1MVUA 3FCSA 1DDTA 3TZVA 5BVJB 5L2KA 3VMOA 4PFEA 3DKHA 1VCBC 3FCTA 4O2EA 4GRWB 1GRWA 3DVGA 5BZWB 1JZ8A