2B3RA

Crystal structure of the c2 domain of class ii phosphatidylinositide 3-kinase c2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'GSGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containi
publication title Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2alpha.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2b3rA00
1TJMA 3LJ3A 1A25A 3QR0A 4FLHA 2CHDA 1QATA 3OHMB 1E8XA 3PREA 4MJJA 4ANXA 2CHWA 4LT7A 4XX5A 2A4ZA 4ICWA 3F00A 1BCIA 2CM5A 4WWPA 4FJYA 4HLEA 1DJHA 1TJXA 3L9BA 2N1TE 4ANVA 2LHAA 4URKA 4KZ0A 2BWQA 3QJZA 1DJZA 4V11A 5G55A 4DNLA 2WXRA 2UZPA 3F04A 2WXOA 3R7QA 2Z0UA 2WXIA 5G2NA 3APCA 2NQ3A 2K3HA 2V4LA 3L17A 4WEEA 3QAQA 4XE0A 4AOFA 2X38A 3HIZA 2WXHA 2NSQA 3NZUA 2YOAA 4QJ5B 4PS8A 2RD0A 3KWTA 2CHZA 1BDYA 1DSYA 2CHXA 3ZIMA 4OVUA 2WXPA 4GNKB 3R7RA 1UOWA 5CCGE 3NZSA 2ENJA 3PFQA 2A5UA 3ML8A 3KWUA 4BGDA 4L23A 4L2YA 3L4CA 3JZYA 3QR1A 3ZW3A 1YRKA 1DJWA 2R83A 2WXGA 3FDWA 1E8ZA 3OAWA 4JPSA 4WWNA 1K5WA 2Q0ZX 2Y3AA 4NP9A 4FA6A 2B3RA 1RLWA 4TUUA 4F92B 4KITB 4LDCA 1HE8A 2ENQA 1V27A 1DJXA 1W16A 2CJTA 1E90A 1W15A 2WXMA 2ISDA 3APFA 3F05A 3PRZA 3RPBA 3ZVVA 4F91B 1E8WA 1WFMA 3PS6A 3APDA 4FJZA 4FHJA 3TJPA 3F01A 2WXLA 3DBSA 3CSFA 4KZCA 2JQZA 3ML9A 3N5AA 3SD5A 1QASA 3L13A 1DJIA 5JHAA 4PS3A 4OVVA 4FADA 1BYNA 1DJYA 3MJWA 4TS6A 5KJ7E 4GB9A 2NCEA 4EZLA 3FBKA 4ANUA 3CSTA 1WFJA 3DPDA 3PYCA 1E7UA 4IQHA 1DQVA 2FK9A 3HHMA 2WXFA 2WXKA 3L08A 3RDJA 2DMHA 2D8KA 1RSYA 3L54A 3P2BA 3QARA 4AJWA 4A55A 2WXJA 4F93B 4WAFA 4TV3A 4XZ4A 5JHBA 1CJYA 2QZQA 2K45A 4BFRA 1GMIA 2CM6A 4ANWA 3TWYA 5CCJA 2WXNA 2QZ5A 5EDSA 4FULA 2EP6A 3ENEA 4LCVA 3HN8A 4FHKA 4WWOA 1E8YA 5T8IA 4NPKA 3NSJA 3TL5A 3IBEA 2CJSA 2FJUB 2K4AA 2ZKMX 1RH8A 3L16A 4L1BA 4Y1TA 4DK5A 4L1LA 2DMGA 2YRBA 3M7FB 4J6IA 4QAMB 2K8MA 4Y1SA 5CCHE 4F1SA 4EZJA 1E7VA 2KI6A 3W56A 3GPEA 3T8MA 4HVBA 3IM1A 2ENPA 1DJGA 1UOVA 2Q3XA 4IHBA 4NPJA 4QJ4B 3W57A 2WXQA 5H4ZA 4EZKA 4NS0A 3S2AA 4QJ3B 3B7YA 4G11A 4ICXA 4PS7A 5H4YA 3QK0A 1UGKA
chains in the Genus database with same CATH superfamily
4L3ED 1HN1A 4L0ZA 1IE5A 3JT2A 3QJVB 2CGRL 1A7PH 2XFGB 1JPGB 2P5WE 5BVPH 1OHZA 2DM3A 2YD1A 2ZOLA 2PN5A 5DI8A 4FEMA 4GEJA 1JXKA 1AR1B 3UC0H 1I9IL 4WU5B 3EGXB 1E4WL 3AB0C 3KXFB 4KKAD 5BCAA 3BSHA 2WN2A 3MRQB 4U0RC 5GS0C 3U0WH 2XIIA 1QI3A 1DQTA 5F2FA 3OWRA 1RKRA 4XE0A 3LKNB 2X38A 4HZAA 4WGWB 5ETUB 1TQVA 1NEZA 1WZMA 4ZAKD 2E9IA 4GKSB 3DJSA 1YMMB 3TBVB 2DLHA 4AQEB 3NZSA 5I75C 3JSSA 3WO4B 4HCRA 3SDDA 1FBIH 4OZ4B 4O5LH 4X6BA 4TNEA 1RUMH 2H4EA 4L4VE 4NQUA 5H8DA 4JO5A 4YAQB 3FYEB 3GLDA 4OAWB 4YPGA 1OT1A 2J55A 3CFCH 2ENQA 5EN3A 1QEWB 5BQ7B 5EU3A 2WK2A 4YL4A 4ALAC 1TTFA 1YEEH 5D7LD 1S9YB 3VXOB 2W0KA 3ZK0A 1AXTH 1MVFA 1WFIA 5AVQB 5GS0L 5LCVA 4HUWA 2D3JA 1GY1A 3HS0A 5J6SA 4LP5A 2GI7A 1WCQA 2UWEB 4JFDA 1DFXA 1AO7D 2N59A 1X7QB 3KG5A 1J05A 4IBZA 5KBPA 5L8LB 5LGJA 1NAKH 1S7TB 4AIXA 3DI2B 3WN5A 3B7SA 1IGYA 5A2BA 4Q7DA 1TQWA 4XVTH 2LT9A 1ML0A 3EGDA 4WNSA 1D7FA 3FCTB 2V7NB 3BUTA 2OJZL 5CCKH 5DHVA 3RWCB 5FA3B 5I8KH 5KG9B 3QUMH 4N1EA 5T8IA 3QXAA 1PKQA 3RWDB 4E42B 1M9WA 4N2MA 3EO1B 1QSFD 4IJTA 4QI3A 4UQ2B 4X4ZA 4AJ0A 4ALAL 3RRQA 3MV7E 1CTNA 3A67L 3EZ8A 2QPSA 1C5BL 1BBDL 4PP2A 3D4YA 3O8XC 5DC2A 5FO7A 2NZIA 2FHCA 2I60H 3O6FA 3T3MB 4G9FE 4PJXA 3TWCL 3WTTA 1WCBA 4F15B 4P49A 1Y1DA 4JY5H 4XB8A 3SODB 1FO0L 3V9CA 5F7AA 1SGKA 3MRKB 1R4XA 3U4BL 4EN3D 4MMXA 1ZLUK 1KPUB 4PV8B 1M7UA 4LEXH 3D2UA 4XWOD 5F3HA 1BYPA 5KS9A 3HS9A 1TIUA 2AJXH 4L8SC 2WIIA 4LDEB 1MAML 4G8GB 5EU4B 1A5FH 1UVQA 1UCTA 1KBKA 4PR5A 1K3IA 4K5LA 1UD8A 2ESVD 4H5SA 2OBGA 5K33A 5C9KA 2FEEI 2HT2C 3CZFB 3HZKA 3SGEI 3PAUA 1KDJA 4W93A 4NO2A 2EDMA 1OQXA 3CUPA 2H2SD 3FRPA 1DVXA 2O61A 1XH1A 3GS7A 2IDSA 5E4OA 2K4WA 1E3ZA 1UADC 1PQZA 3ZUCA 4HIJA 4Y5YB 4WO4C 2ZUVA 4NNYB 7FABH 1JF6A 5B1CA 2C3VB 2MEJB 3RLSA 1D6EB 1UEMA 4PS8A 4XT1C 4U05A 4UT7L 4UINL 3S34L 1NSNL 4DCQA 2J8UB 2K1MA 4NM8L 5BS0B 4HKJA 3V4VH 1INDL 4Z76B 1KJ3H 3QYNA 4EI5C 1BVNT 3IDNB 1RLWA 3KPPB 4FC3E 5B39G 5IFJB 5EB9A 3L3OC 5IJBC 3UP6A 3H0TB 1VFUA 1B6DA 1CLYH 2C4XA 4OCSH 2EEDA 1BXXA 1WFMA 3GUTB 3EYUL 3J07A 3K91A 1HS6A 2BMKA 1N6QL 1BFVL 2WNXA 4JFOB 4PG9B 4L4TD 5JOPD 2X2JA 2J6EL 4TLKA 5D7SL 5ABDE 1U8QB 3PIQB 4R7NB 2Z92A 2BNQB 1G9EA 1CCZA 2P49B 4OGZA 1I9RH 1OB0A 1AKJD 1X5ZA 1CLOL 4CMMB 1AGDA 1U3HA 5F9WC 1AXSB 5FO9A 4LNRA 5AD0A 1J7VR 1A1MA 4BFRA 4Z6AT 3Q2CA 3HG3A 5T1DL 4NZDA 3QUMA 4X99B 2W60A 1GOFA 3CHQA 2W0LA 1ZCRA 4Y4FB 3MOAL 5C7XH 3RQ3A 5A16B 9CGTA 2O6FA 5B1JC 3B1TA 3IBEA 1SDDA 2WOYA 4I5BB 4TM9A 2JI2A 4I7ZC 2VLKD 1E67A 1JV2B 4G6AC 3ABKB 1EEQA 5BRPA 3F12B 2FH8A 3NESA 1SNRA 2VABA 3T65A 1YAZA 3LXUX 5FUZH 4NKMB 4XO5A 5ICZA 1ESOA 1UA6L 3CXHK 2MSPA 1Y0LB 2OW7A 1PZUB 1A6UH 3BH9A 1KTLA 2NNFA 4PJ9C 5E5MA 3Q2LA 1A9VA 4GG6B 3ZE2B 4JKMA 2YZ8A 4ELMF 2DQTH 4L3EB 4Z3TA 2OSXA 3D18A 1PX4A 3N1GC 5F70A 4S1QL 5IQLA 4A1RA 4E9SA 4CJ1A 1FL6A 1G1KA 3JBG7 3M17A 4LKCB 5FYLH 3B2PA 5JW5B 2O6CA 3V0EA 1N59A 1QPXA 4H8WH 5BV7H 1GGIH 1TKWA 3TONA 2CRIA 2LLGA 5E00A 2YZ1A 1J10A 1NCAL 2BZCA 5B8CB 2LABA 2YD6A 4OF7A 3O41B 3T3MF 5MEQB 4B27A 5CWSB 2Y72A 3R0MA 1NMAL 4O4YH 4G7YL 4PW3A 4ESKA 1JDDA 1BEXA 1XGUB 3U7AA 2JKNA 3LZRA 1I3VA 4FG2A 5TH2B 1S7UA 1FV1A 3B9KD 3PL6D 2ZCHL 4F1ZA 3HFFA 1K85A 3RX9A 1KB5B 4ZAKB 5DVOA 4BQCA 2X9ZA 3V4VA 5AL8A 5CZKA 2P47B 4PWHA 1WTGT 3PGDB 2CKBL 3UTSD 3Q7JA 3N91A 5EF1A 4KGJA 5ABAA 5IQ7L 3KM2A 4WWNA 1TENA 4Q9BA 3L3IA 1MHCB 4P5TD 4DHLA 3QRLA 1IJNA 2JCCB 4ODWA 2DQJH 3TH2T 3QJXA 4XZUB 3NYKA 3VFMA 4POZC 1TZHB 5HYQA 2VJ0A 3W5NA 1IC4L 5D55A 2KL6A 3ES6B 3ZKXC 3HZ3A 2PUQT 3CFDB 5ADOH 4JFFA 1T04B 1ZLEA 4DKAA 4U49A 1MCBA 2XHNA 4FNPA 4I9WD 1SVZA 1CT8A 1Q9LB 3IMUA 1CDYA 1HDMB 1UD6A 2EDNA 3E0GA 5GGRY 1NFDE 2J8UF 2R39A 2Y06H 4K8RC 2X0UA 3UPAA 5LWYL 2BIIA 4MA1B 1AIZA 5JPNB 4F37K 2WSDA 3C2SA 2DB8A 3JTSB 1OP3K 1PYWB 3I6GA 4DT2A 2FT7A 1KCWA 3D5OF 4HLZG 3EJYD 1H3TA 2QQNL 3IFLL 3BXNB 2JVUA 3QDME 4PRIE 1E8YA 5D1QD 2E9WA 3N85L 3H54A 3SBWA 5JNYB 2GJ6E 3ME0B 4XMUA 1S9XB 3ARED 4NKOB 5J11C 2MOQA 4Y2LA 4YHOL 5AVWB 2QFRA 5HY9B 4L5FL 4PJDB 3VGAC 2HG0A 4OKVB 5KN5A 3VFGH 2EQDA 4NO5A 4Y2DD 4K7PY 1MCHA 4K8RL 4EN3B 1I1RA 4RRPM 1RZGA 3ZL4H 1MCEA 1G5GA 3QFDB 5IMKA 2ZXCA 2Z31A 2YBRA 1TO4A 2QKIA 4WEUD 4G2AA 4N87A 2EUZA 3BH8A 2L04A 1C5CL 4RDBA 4JZNA 5A43C 3V8CA 3K6OA 1CBJA 4LPUA 4FP8L 2ESVB 1B4TA 3TT3L 3UTZB 3RU8L 1V54B 3UO1L 3AT0A 1LO2L 4XMLH 1SLUA 1B2WH 1DVYA 5LHDA 1FPTH 4ZW5A 3K5SA 4B3EA 1U3JA 3IJ7A 1D7DA 4KFZC 2DWEB 3F7YA 1MCOL 1NWPA 3IDXL 3VD3A 1BGXL 2WXPA 2Y2TA 4I3RH 2DEWX 4JHBA 4AH2A 1P4BH 4GG6F 3ZE2F 4XVUD 3H7BB 2YXMA 3E6FB 4PGDA 4LASH 2CJUH 2VAAA 4QD2E 2XZAL 1OM9A 3KD4A 2VLRE 3UJTH 5KTEL 1E5AA 3OXRA 4QYAA 3QIUC 4I18C 2MCAA 3QVAA 2WSKA 4LVOB 1A6AB 1EGJH 2X0WA 3MBWA 1SBSL 7CGTA 3M1BB 4V1DD 3INUL 2GJRA 1LEGB 2EABA 4ZUUB 4LDOB 4DAGH 2YAMA 5CGMA 3ARGC 1YEDB 3WS3B 3CHPA 1QUNA 3A6OA 3GSNL 2PP9A 1YZZA 2MHAB 5LQBH 3NCCB 4JCMA 4G6ML 4HS6A 2J21A 4MJID 4XPGL 4APQA 4XP5L 1L9SA 1FC2D 3MCKB 4XVSH 2E4FA 2YPLD 3O9WB 4ZW7A 3QJHA 4BSWB 3W3BA 5MEND 1N10A 2BDNH 3V6ZA 1AKJB 4F93B 1VGKA 3VGGA 1JAEA 2YA0A 2P44B 5F9DC 5BQDA 1JP5A 2JCCF 4WCYL 1H9VA 2ICWA 2V5TA 4N3UA 4WNJA 4G5ZL 4MJ5A 3KLAB 2E46A 4AQ8C 1JMZA 2CIIA 4M8UA 4QRPE 3CN4A 1CFNB 2UV3A 2I69A 1Y18A 3F5WB 5DGQA 1ZHKB 4F58L 2AABL 1C9SA 3CBRA 3IN0A 3KLLA 2ZG2A 3O6LH 4WFGD 2ORBL 1ONQA 2XQYG 1W0YT 3GEFA 4NUJA 3IB4A 2FQFA 2LVEA 1LMKA 2QSQA 2YGPA 4QJ3B 5B4MC 4J3TA 1LP9B 4LEBA 3BGMB 4G8IA 4XPHL 3L8QA 3WNOA 1U8MA 3SDCB 2M8XA 5D4QA 2NQCA 5I8OL 1U58B 1UB6B 2AP2A 2C3XA 2ODHA 2R51A 5HJBA 2OV0A 3WJMA 4B6ZA 3BDYH 2YK1L 3B9EA 1SVCP 1EZVX 5EULV 4F8TA 2LLLA 4OIIL 5EF0A 5F6IB 2ZF8A 2BHZA 1SLWA 1NPNA 4PJDF 3CU7A 1FAKT 3TH3T 4YX2H 2EYTB 5BUGA 4PRDA 1ZGLP 2ZWNA 3ZTDC 3GBNL 3OJMB 2FECL 3CLFH 5IMOB 1OPOA 3QFJE 4LSUH 4MD4A 3NZUA 5JA9A 3GHBH 2YRZA 3KYAA 4ATWA 2CO4A 4GG8A 3Q8FA 3PL6B 2EC9U 4WU7B 4UDTA 2OQJA 1PCSA 3UCRA 3ULAB 2PNDA 1KV3A 1WE5A 3UTSB 2ADFH 4X8CA 2QTEA 1JNHB 1Y7VA 4RWYH 3T6XA 2PTVA 1EGJA 1J1XL 1T1YA 1A47A 1NJ9B 3FU5A 4P5TB 1PEWA 3QQXA 5B3JF 1KLGB 3LPOA 2OJ1A 3FFDB 2F61A 2P5WD 4Z77B 1KBVA 1A7QH 3PP4H 4L3AA 1S4IA 4FL4B 1QBML 1JNNH 3N50A 4LE8A 4E5XB 4OZGE 2LFGA 3LRLA 4LOUD 4AL8L 2CSPA 4DP1X 1OTUC 1N7ML 1HSAB 4HLZH 2FH6A 4M1GL 4U1MB 4Y19B 3TA3A 3BO8B 4W6WB 3QZPA 3HR6A 3NCMA 2WBXA 3BPOB 1G84A 1PZCA 3FT2B 4Z7NB 3GXUB 5DK2B 1ZXKA 5JO5A 3B6SB 4A67A 5DA0B 1EUTA 4PJEE 4UT6L 3EXJA 3CFUA 4HJGA 2X87A 3PQYB 5J57B 4L3FA 2GY7B 4JFHE 4A55A 3S88H 1G7HA 1FFPB 1EMTL 3IETA 4ZFQA 3KW8A 4YNYA 5C0IB 4F2FA 1FJ1A 4J3OC 4PCSA 3VRIB 2GIYA 5F0PB 1RMFH 4HKZB 3BZFB 4PJCB 4Y9EA 2YAOA 2JKSA 1BQSA 1DQMH 1HXKA 3LQZA 4DOHB 4DKTA 4L4VD 4YSAA 5D1QB 4DQOH 3CX5J 4HWEH 1P5VB 1U8KB 3LZFL 4J8RB 5FGBA 1JBJA 3AREB 2QVTA 5J1AA 4XNAA 1M7DA 1YUKB 4Q9QH 4DN3H 4NAQA 2CDGA 1QRKA 4Y2DB 1I9IH 5LB1A 4MCZB 5IVXE 5E51A 1GPOL 3LV3B 3I2CL 3ULVH 1HL5A 2GHWB 3FTSA 3L5IA 1YECL 1TG8A 3ATEA 3IJ9A 3KYNA 4NO0A 5J1SC 2D3LA 4AVKA 3LNEA 5CGYC 2CIKA 1HCYA 2P3YA 1T4KB 4AMKH 1BZOA 1OSPH 3VXUB 4D7PA 4AEHL 1TQBC 2J43A 1JTOA 5FLUA 1IO4C 4MWFB 1A4BA 1DEDA 4WEMB 1HH9A 3MCG1 2WVSA 5B22A 3P0GB 3P54A 3DO7A 5JYMA 4TVSa 4IRSC 5HBBA 3HB3C 3GK8L 3TBWB 1WAPA 4TN9A 5CN2A 3REVA 3WEMA 1LP9F 2YAPA 3RVWC 3MV7D 5AL0A 2ALAA 4M8VA 1TCRA 2YFNA 2OZNA 5I6XC 1MCCA 5DI8B 4CSZA 1N5YL 2VCOA 2BOCB 1LO3H 4G9FD 4W4OC 2D7TL 3BAIA 2D7NA 1Z9LA 4K07A 4JRYA 1A14L 3BP7A 3CD4A 1GYUA 1P1ZA 4KROB 5D7IE 4NRXA 5E5RB 2VLME 2EZ0D 2Z7UA 1HL8A 3LRGA 5LJYH 5KVGL 5D72H 2VMFA 5CEYB 1IC5L 4FKHA 1PJWA 5GGSY 4FHBD 1CXKA 4FJZA 5I1DB 3NJFA 1R0AL 1JZEA 1AXIB 1VERA 3S6CA 5I0DA 2I24N 1U3ZA 1FNGB 3ARDC 3U6RA 4CBPA 1SY6H 1Z3GL 2EE6A 3SDDB 2HJFB 3IGAA 1JGUL 2OJZH 3MLSL 3D12B 2QJDA 2VW7A 4BUGA 5HI5C 1PLCA 4O58L 1UM4L 4FERA 5EDXA 4NNPL 4IJ3B 3TBCA 3CVCA 1YJDC 1IB5A 4MJIB 2XWTB 3FSWA 4YGVB 4ZO6A 2F5BL 3LQAL 1C5BH 3FTGA 2ZKXA 2CRZA 5MENB 1OGSA 4AXWA 1FO0H 1U95B 2BW5A 4QAWA 2WNWA 3U4BH 4M1DH 1O7DC 1ORSB 3D07A 2XVBA 4OQTL 3FUNA 4YIQB 4NKIH 3QB7C 3AROA 4L1BA 1MFNA 3RDTA 5EZLB 2LU3A 1MAMH 3HOGA 3CVBA 2A0LC 4OGAC 4PY7A 4Z7NF 3AQYA 1IGYB 2A83B 1TT6A 5MI0B 1MDAA 1CGWA 3EGDB 1EBAA 4U6XA 4WWKC 2VXSH 4YDLC 5BRZE 5DHVB 3TV8A 4UBDD 4FFVC 5EOTA 2FX8H 5IQ9A 3LKOB 3K6NA 3O6MH 1ZSDA 2FO4A 1AHWC 1MOEA 4UI2A 5I1LB 1XWVA 2O30A 1NBVH 4PJCF 3KS0H 1E42A 4M4PA 4PP2B 1OTTD 4Q52A 5FO7B 3O6FB 5IGXH 4PJXB 4Q2ZA 4KZ0A 2AS5M 3S34H 2G9HA 4ODSL 4NM8H 4MMXB 5IB1B 2HLAB 2ZCKL 2WVTA 1GCYA 3X1FA 4X7SL 5F3HB 5HTSA 4XAKE 5IVXA 3KNBB 3NJNA 5KS9B 2XBTA 3VE0A 4AE0A 2WIIB 3V52L 1UVQB 4PR5B 4ZNEA 5CBEA 3H3PL 4H5SB 5I5MA 5I76B 3OZLA 3C5SA 3EYUH 4MQ7A 3UROR 1N6QH 2IPUG 3HZKB 2VZOA 3UERA 4P46C 4XC1L 3PWPE 1R34A 5C0CA 2E47A 2O61B 2EDEA 3CUPB 3FRPB 1WC7A 2EO9A 2J6EH 5FK9A 2F8OA 4AK1A 1HL4A 5FV2A 2ZWKA 4HIJB 1N8ZA 2FIKB 3DK2A 3K0YA 5EWIL 2QLYA 4AT6A 4M6NL 4I1PA 5DWUL 1SY6A 4GOSA 1KTDA 2QSVA 1IQWL 4OTXL 2P5WB 1KBBA 2X4UB 5DC0A 4DCQB 5T1DH 5C6TL 5AB2A 4GB9A 1NIDA 3MOAH 4JN1L 2P4AB 3DX2A 3WHXA 4NQXA 1I8AA 4WVRA 1G7LA 2EDJA 5A3ID 4EUPB 2PW2A 2JFCA 3D39D 1F8TL 4PG2A 5AAWA 4Q9RH 4JPVL 2ZNXA 1PZBA 3PHOA 3OKOA 5D7IA 3S5LG 4ELKA 3S8GB 2XI9A 5D7JA 4JG1L 1OSEA 2VM3A 4YDNA 1BXUA 2K45A 3TC9A 1X5GA 1OGTA 1MUJA 2LLNA 2HX9A 4FNRA 5CCJA 2B20A 2BMKB 4GAYA 5F0MB 4ES8A 1UA6H 4PJ6A 1TEGA 3GMNB 5DS1A 1BLNA 2G4EA 1MCFA 2Z92B 3BFQG 3POCA 4ZFFB 4C55A 3LKPB 4L4VB 2BRQA 4QTFA 2B4CH 3LX9A 4S1QH 1FG2A 1AGDB 2NXZB 3US0A 5FO9B 5F8QC 4LNRB 1MCPH 1A1MB 1D5XB 4L8CA 5DJAB 4N9OB 4P5SA 3QUMB 4HDIA 5A6LA 2W60B 2XKSA 2Z7ZA 1MFCL 4FXKA 1H9DA 2XWBB 2AQSA 5HHVH 4YLQT 5FM5M 1BMWA 3MAWA 1NMAH 3QC6X 4KNTA 2GBTA 5IEHB 1MRCL 5FFGA 1CI3M 3D3VE 3BGAA 2ZWLT 3FB8A 1JVLA 2IC2A 1OB1A 3SGEH 2X6AA 2VABB 2WYZA 3T65B 5JPMC 1X7SA 3IRZA 4IIZA 5GRWA 4M43L 1ECZA 2EICA 3MNWA 1P4UA 3ILDA 3KJ6L 4HSAC 4MMZA 4OJEH 3T2NL 3WE6A 2ZX5A 1MWOA 4DWHA 5IQ7H 3QDMD 1KTLB 4PRID 3RZCC 1TEFA 3L9RA 4ZSOE 2PPAA 2RACA 4HBQA 3WEBA 2GJ6D 3LRKA 2PXYD 1PZAA 4OCRL 3HE7A 3M17B 5KANG 3MV7B 3N3EA 1TO5A 1N59B 3F7VB 3RWHA 2X70A 3GXIA 5CEZH 3ML8A 1TKWB 3U9WA 1E30A 2WO4A 4G7VL 4G9FB 3CHOA 4G8FA 3VQ2C 1MG3C 2X4SB 4F8LA 1IC1A 5EOCJ 4PJXF 4UB0H 4K71C 2QGEA 3PJNA 1UUSA 5JXAL 4LCCA 2WY3B 4TF4A 3O4OB 1HAUA 1S7UB 1H5BC 3CQFA 5D4JA 5TQ0L 2FNWA 5EG6C 3RTQC 1CICA 4JRXA 3LS5L 3RI5F 5KS9F 3OJ2C 3V4VB 2BY1A 4P06A 3GSQA 4XBMA 4UQ3A 2K78A 2O5NA 4U1GB 5E6RB 5JIHA 2ARWA 2QQNH 2R23A 4GBXC 2A6DB 1TNNA 2H0EA 4LLMA 2Y0SA 1HWHB 2AXFB 3CSTA 4AV0A 5I5JA 5CLTA 5JW4M 4EQ3A 2WXKA 4YHOH 2EYSB 4C56E 1YLBB 2NNXA 3C5ZD 4L5FH 3FTWA 4WAFA 4ZMXA 1X6NA 4S2SA 2AK1H 3GKWL 1JK8A 4ZPVA 3IT8D 4K0OA 3SDYL 5EDSA 2MQ3A 2JIXA 2PCXA 1KEGH 4X6CE 4JFFB 3K5RA 2EO1A 5EC1A 3WEXA 4CKVX 4K8RH 5HJGA 4WJ5A 3LS4L 1ZEAL 2VLRD 3O11B 3MRFA 4N2HA 5KSAC 2W59A 3BVUA 4N8UA 1F58L 3K74B 3UYPA 4AWJC 4MJHA 1QR4A 4I2XA 5DJ6B 2ARJB 1EO7A 2X42A 4FP8H 3DTXA 2OS7A 5ACZA 2A9NL 5IROC 1F3JA 3EZJB 1LO2H 2VQ4A 4OCYL 4FAAB 5JR1L 2BSTB 5HD8C 1F2XK 2LAGB 4NLAA 2K70A 4OSUL 3TU6A 1L5GB 1FNEB 2B14A 3GNMH 4HFUL 1BOYA 1BQHG 1WISA 5AW7B 2N1TE 4MVBD 2J1WA 2WUCL 4DPRA 5F7DA 5KN5B 2H1LM 5IEKA 2YD2A 3O45A 4NO5B 3U1SL 4AGMA 1QQDB 3Q5YA 4ODHL 4KQ3L 1Z1WA 2P43B 4AV5A 4KKRA 4JM2D 4U3SA 1IU1A 4NUPA 4QRPD 1NCCH 3BQUC 4H8PA 4OLWL 2V0AA 4AIEA 4DETA 2YHGA 3Q6FA 5KTEH 2RB8A 1NWOA 5IJKA 3POHA 4GKZA 5GS2H 2D2OA 2Z31B 2QKIB 4DW2L 5I0ZA 5BV7B 3Q43A 1JZ4A 5HDBE 1E4JA 2Y4SA 4JG9A 2FRGP 1BREA 4FG6C 4NKQB 1GIGL 1MEXL 4H40A 1IBFA 1CFVL 5SX4I 4BCZA 2X2YA 4YR6A 1IBHA 5CJXC 4KK5D 4KPHH 3GSNH 3H7LA 4XRCB 4JAMB 5E1QA 3RVTC 2CU9A 1CYWA 4G6MH 1TJHH 3FFCE 4XP5H 1SXZA 2XV2A 3D08A 4AQ1A 3T3PE 3NGBC 3QPXL 2ZXWB 3H53A 2D7OA 1S5HA 1NICA 2WLMA 3DBSA 3MBXH 5CGTA 5DFTA 5FW7A 5JQIB 3ML9A 1TTRA 4AH2B 2E9JA 4WCYH 2AITA 1JRHI 5FX3A 4G5ZH 2ADYA 1N70A 2IGFH 3A6BH 2Y7QA 5EIIG 1GVIA 3UJIH 1KCSL 1YEIL 3U2SB 1I3UA 2G5RA 1PFCA 1B9KA 4UWQB 2KDGA 2XZQL 3JWDC 3PWJA 3TX4A 1TTUA 5D2NA 3QFJD 2XKUA 4P05A 5F3BA 4XO3A 3BVNB 1IJ9A 4DO6A 4ZOAA 1O7SA 1Q9OA 1A2YA 1T21A 2LTQB 3CU1A 4XNUL 2F1BA 4H4NA 1UKTA 4I0PD 4RAUA 1AS8A 1C16A 2D4FA 4RMSA 3VFSB 4B9CA 1QUNB 1FH5L 2A6JA 2W65B 3ZTCC 3T4AB 4B7LA 3VXTA 4APQB 4UCFA 5CILH 1G0YR 4QRBA 4C4KO 3HN3A 4AGNA 4LCWA 3EFFA 4ZD3L 5HJ3A 1CQYA 4KXAA 1A1OA 3FSZA 3V6ZB 4C56A 3EOTH 4AKOA 5DS2A 4K55A 3EF7A 4OIIH 2AXHA 3MBEC 5TE6H 2BFGA 1EERB 4MJ5B 4QRSA 3T0BA 1OT2A 1I1YA 2BIPA 2DLFL 3G5YA 3N40P 1BD2A 2CIIB 1M6OA 3LCYA 3JWDL 4TYUA 4UV7L 5L4JA 5TJWK 3AY4C 1Y18B 3N55A 3GBNH 4HS8L 3LH8A 3SYPA 4HC1L 3ESUF 4F8PA 4FA7B 4LLQA 4PGCA 5TF1H 1MFUA 1QI5A 4FYRA 3VTTA 2FATL 4UDUA 1ONQB 4ZPTA 3SGDI 2AI0L 4HK3J 4JFHD 1A3LL 4PN6A 3VG9C 1G0DA 3CHRA 2VN4A 4LLYB 1G9MC 2AZUA 2DBLL 4PJGA 3W0WE 3B2UC 1NEPA 1MNUL 5H94A 2CRMA 4NIKB 1O0VA 3UACA 3KR3H 4G8IB 3FZUC 2SEBB 1J1XH 3IE9A 1MCRA 2NUPA 3QDMB 4MNGE 1FGNH 3QXDB 5CBAA 3KPSE 3ZT7A 2GJ6B 3I9AA 3WJMB 2PXYB 2B16A 1HILB 1NCUA 4GAGH 4MD0A 3R7RA 2N56A 4KMTH 1QBMH 3FFOA 1JIBA 1Q4NX 1UC6A 4AL8H 3GSNA 3EDFA 2W07B 5F96L 2R83A 5A7EA 2Y3AA 1GR7A 5D1XE 2NY0C 2PW1A 1IZKA 5B39B 4LNVA 4PRDB 1KGUA 3DUHA 4ZS6D 3QHFL 3NFPB 4GW5B 4HISA 3QAZC 3CG8A 4Y0GA 3APFA 1N2RB 2J73A 4E0RA 4YHYC 4PWEA 3NPSB 4NQTA 8FABA 3MRGA 1UWXH 5GS0D 1G9ML 4UDTB 4FMKA 2GQHA 1HKLH 2HRPL 4YSEA 3LNDA 4LSTL 3KLHC 1TQSA 5JLZA 2XXFA 4AGQA 2FSDA 4HSQA 3LNFA 1NC4A 2WO2B 2GI0A 1UH2A 1MHHA 5IR1B 3LQMA 3DYMA 2HFEA 3LZFH 3WFZA 2X4TA 4XBGA 1CS6A 3U48A 1F4XL 3V55A 3HKZA 3C5ZB 5DEFB 1USQA 5ALBH 1JGIA 1Q9KA 3VFWB 4JGNA 1PIFA 1GTNA 2EP6A 1G9HA 3WUWG 1FIGL 3VDBA 2FJSA 4PU2A 3NACH 1I8LA 1GPOH 2PYEE 3I2CH 1NGYA 1YG9A 2VDPL 2VLMD 1IM3D 1YECH 1UENA 5D7JD 1E3FA 2YAFA 3CVIH 4HJGB 3I84A 4LLAA 1E7VA 4QEGA 4NHCL 1OPGL 3C6LA 1G7HB 2VJ8A 3OKKA 3H2QA 4YNYB 1FJ1B 3QDAA 5AYTA 4AEHH 5KVGE 4TQIA 4QHPA 2Q20A 5LBGA 2YUXA 1FNFA 2CCVA 3CFNA 1FUNA 2JELL 2XWJA 1MKFA 4PJ5A 3KZ8A 3LQZB 5EOQH 2NDFA 2GSIB 4PVNA 2FBOJ 2QSCL 1UZ8B 2DWDA 2NTFA 4NQEE 2BNUA 3Q8EA 3P73A 2C9SA 4QPEA 1YYLL 3EFDL 2EH8L 3ZHNA 1M7DB 3TBBA 1N5YH 3L4YA 5AW3B 2C9AA 1M1XA 2EDKA 4B53A 3O8XD 5I1IH 4MA7H 2CDFA 3UZVA 4FQHA 4XH2B 4JM2B 3WFDH 5DVKA 2GVYA 5FHBH 4QRPB 3NCFB 3HZMA 4K9EL 3ARBC 4Z5RB 1E0OB 4X5PA 5KVGH 1DTUA 1IC5H 1PF3A 4JGJA 5LLIC 3ZTJH 4M9OA 1R0AH 2CIKB 1ZPUA 4RZCA 4H0HB 4XCCH 4XNMA 1G7IB 2BOBA 2NLJA 1KLUA 1JZ7A 4N25A 3RZWA 3SCMC 4IGBA 3SPJA 4ZO7A 1E8ZA 3ZN6A 3EDEA 5E8EB 3MLSH 1HH9B 2JQAA 4R3SA 5D4HA 5BRZD 4OZHE 3DO7B 1UM4H 3FO9A 1SMAA 3W0WA 3C87A 3RL2A 2HT2D 1AFVL 4MAUH 4PJFA 3HG2A 3APDA 2F5BH 2PP7A 3I50H 3LQAH 4KZCA 4WIQA 1TCRB 1A6WH 5BOZG 1J8RA 4O02B 4OVVA 4TULL 4WO4D 5IKCB 2MMXA 4YHLH 1CBVL 2EE2A 1E50A 1QNZL 3MMEA 2K3TA 4M7KL 4HZLB 4NN5C 1P1ZB 3DPDA 5F7KC 3OB8A 2IFFL 3DV6A 4FKEA 1KXTA 1RUAL 1ZE3C 3LAFA 4WKZB 4QY8A 4J2QA 4XAKD 5CJ5A 2R0KL 1RZIA 2E59A 2AANA 3SPGA 4APXA 4EI5D 1WUNT 3QFJB 3WUZA 3MXVL 1JMXA 5K59E 4P23A 4ZFZB 4WFFD 4I0PB 3BKYH 3WMSA 4DVRL 4EIZC 3F6IA 2EUXA 1Y07A 3IGAB 4EBQL 2VDOL 32C2B 4KDVA 1OAQH 1BVZA 1E9PB 3PWPD 2DQIH 4FXGB 4XNYL 1UD3A 5D9SB 4YVNA 5IVZB 4FNUA 4KQ4L 3REWA 1KULA 5LAXA 3VFUB 1F1GA 1S3RA 1QAWA 2DLGA 4BRJA 3TP4A 4CW1B 3GTNA 4N2CA 2C9RA 4AJVA 1ACZA 2XZCL 1EJFA 2AAVA 4HJSA 4ICXA 2WKOA 1WT5C 2BY0A 4G1MA 3ETSA 3ZIMA 1VGEH 1XH2A 3NFSL 4OZGB 1TJMA 2ZCKH 3FCGA 1ASQA 5C07A 2AJUL 1FZJA 3FQTA 4X7SH 3WENA 3UTOA 2X12A 1ZA3B 4AQOA 1KTJA 1FE8L 3DX8B 4N26A 3V52H 4PRHE 4IIQA 5I1KH 4ZO9A 1CDIA 4PJEB 4R5XA 4PY7B 3VFRB 5JMOC 2KLRA 3H3PH 2DQGH 5GGTH 4XHJC 1DVTA 3UAJA 3R7QA 4G6AD 4U6XB 5ISZA 5F0LB 2P28B 4GW4B 5AAPA 4OLYL 5E2UL 3U30C 1IAOA 1UWEL 2G0KA 1ZHLA 5C0AE 3ZL2A 5IQ9B 3WFHA 1ZSDB 3ARFD 5EWIH 4ODTL 3QNXB 2FO4B 4M6NH 3KL0A 4R90H 5F0JB 1P7BA 1D5MB 1QLEL 5DWUH 1EO8L 3SEPA 3UXFA 5JHLH 1H3GA 1OEZW 1OP5H 5L8JB 4PJ9D 2GITA 5C3TA 2B1AH 3IS1X 2WB1A 2Z4TA 1B6UA 2HN7A 5C6TH 1W80A 1CUOA 2B3RA 4JN1H 1MCIA 3HJ0A 2XV0A 5HVHB 2X3CA 4K7FA 2AV7A 3A4AA 4DK3A 3V4PL 2EYRA 3QWNA 5HGGS 3VFOB 5IVXB 2MTAA 4UAHA 4JPVH 2X3BA 5DJYA 4Q56A 4GAJL 4ZK8A 3D0LA 3D7PA 3AB0B 3D3VD 2XLLA 4JG1H 5AWNH 3FT3A 1X5YA 5CBEB 4MXVE 1D5ZB 3GSRA 2HVJA 3C5SB 4M5SA 1K8DA 4MQ7B 5AW2B 4GQZA 4YHIB 1AZZC 2FHBA 5T3ZL 4A63A 1XF2B 4KRLB 3JTBA 4JJ5A 2EXSA 4UAOC 1LXMA 4MQSB 1FZKA 1N8ZB 4OZHA 2X2UA 5L9DL 3DVNA 5I75B 1RPKA 1QFWM 4GP5B 1CYGA 1K8IA 2CM6A 1CGVA 1KTDB 1T20A 5AW6B 3ZOAA 4G9DB 4HF5L 4JO2H 3HHSB 4L0PB 2AQTA 1ASOA 1MFCH 4RMUA 4POZD 3ZKQD 3IYLW 2K7PA 3WHXB 2GTZA 1I7ZA 2WP3O 4LSQL 1JI1A 1E5CA 1TITA 3VYOA 5D7IB 2KQMA 5TDPB 4ELKB 4F1SA 2DWYA 4JB9L 3FOMB 2DKSA 3S8WA 1IM3B 3V6OA 2VUKA 3ZIYA 5D7JB 1QX1A 4DO5A 3EKCA 1FO0B 4ZJ9A 4K8RD 2DW5A 5IESL 1NGQL 5KVDL 3MV8A 1KOAA 1OGTB 1MUJB 5AALA 1ZS2A 5G5DA 3R1GH 2IG2H 4OGXL 4Q14A 4ZUWA 1V3JA 4WHCA 3FOLA 1J5CA 4A6YH 2WGXA 5AVXB 3T2NH 1BLNB 2YGQA 2CHDA 4LLWA 5LNEA 3PNWA 5IBTL 4LVNC 3AMKA 3UTTA 3IMSA 5G4OA 1A8JH 4QRRA 1RLBA 4GAAA 4JQVC 5GGTA 1PIGA 1SUHA 4C56D 4K7PX 1FG2B 1A64A 4Y9CA 4C4BA 3VQLA 5CZVL 5CU9A 1A7BA 4L8CB 1FZMA 2PTTA 4GS7C 2AV1A 3RHWF 4HDIB 1AHKA 43CAB 4NKDA 4FXKB 2K3HA 2QEJA 4HW6A 1AS7A 3JV0A 1KWGA 4M8QA 1BF2A 2OULB 4AOFA 1XQ4A 3TN0A 2BXYA 4KXZI 5B3NA 2IAMC 3SHSA 4FKKA 5JHLA 4PP1C 5JXAH 3DMMA 2VXVL 2NY3C 3E8UL 4E9XA 5TQ0H 5AZUA 2YQBA 1LWRA 4H88L 4AM0B 4OI9A 5E2WL 1OB1B 4PRHA 3LS5H 4E9LA 1R3LA 1RSFA 4L8SB 3U36A 5D8JL 3MNWB 5DUBA 3WE6B 4PJEF 4MMZB 5ANHA 1F00I 1P7QD 4KZEL 4YDIH 3BEVA 1M2VA 5BRZB 5GSVA 2CLZB 2XIBA 3L9RB 3MJ9L 3X13B 5IB5A 4QWWC 5IJVA 3ULVF 5FAAA 1MVYA 4IOFC 1T0MA 3WUWA 4M02A 1XD0A 3RWHB 1MFDL 2FWLB 2VERA 5JIIA 1WS8A 4XE5B 3QO1B 4P2OC 3LS4H 1A6TB 1ZEAH 2YD0A 3T0DA 2QHRH 3O2DH 4LCCB 5F7EL 2AEWA 1F58H 4KHXH 5ESVA 1ZVHA 3LYRA 3UEQA 4HWUA 3SYAA 4N2FA 3ZR5A 4KKCC 2NYYC 4GQPH 2XDHA 2OMUB 3CNKA 4MDIB 3QIUD 4QF1B 5SWZD 5IVXF 4AYDC 4EI5B 4FULA 4YH6A 2BX5A 3EO0A 1R3HA 3GSQB 4K3EL 1RZQA 4G6JH 1IUZA 1KCKA 5AVRB 3MRMB 2A9NH 1MWAL 3CMOL 3ECBB 1ROCA 4OCYH 1S7QA 3RPIA 3PWPB 5JR1H 4P2CG 1OCWL 2F18A 3ARGD 4O2FA 4DH2A 1XIWA 3FFCD 4OSUH 1J5HA 1PG7X 2YC1A 1IKNC 2EH7L 4S2SB 4KO6A 4PIRF 4A6YA 5ILTL 1JK8B 3GDBA 3U1SH 4ODHH 2JIXB 3QYMA 4KQ3H 2ZXGA 1EXGA 2Q76B 4WJ5B 2F74B 5A2LH 4OLWH 4UIKL 1TCMA 3KPLA 4DP6X 1UUNA 4GSDL 2BSSA 3TIEA 1TSHA 4I2XB 3FQ2A 4WGVB 1ILUA 1AZNA 3HBQA 4A2LA 2CQVA 5D7IF 4Q97A 4B41A 2DMCA 3DTXB 1XV8A 5CLXA 5DHMC 1OLZA 4F5CE 1CFVH 1G7PA 5I30L 3MUY1 1F3JB 5C2BL 4TQ8A 1WITA 1J1PH 2HT4C 5B4MD 3OPZH 3ARFB 2NY1C 5D1ZC 1U21A 3QPXH 3L4TA 5CCGE 3HNTL 2Y1AA 1JWSB 3FAXA 2WQUA 5IEKB 3O45B 4L3CB 1CIUA 4PMFA 1YQ2A 3AS0A 5DMKB 2FDBP 2A4CA 1H6FA 2L7UA 3MROA 2VOTA 1HI6B 3QA3B 3OMIB 3GKZA 1YEIH 1QA9A 4D0CA 3Q6FB 3KBFA 1KFAL 1PKOA 3FC8A 3CLWA 4GKZB 4MS8C 2DQFA 1ZT4A 3Q44A 3OAZH 4CU8A 1NMCC 3O3UN 3Q48A 2OR9H 3D3VB 4R8WH 2KHAA 4IGBD 3GJFH 2XQYK 1NFIB 2QHLA 2VTFA 4OB5L 1ZIAA 1QR1B 1AD9B 3W0WD 3O2DA 4Z3HA 3ZZLA 4H0LC 2AXJA 2DJSA 3L08A 4MZ3A 4U6VL 5CMAB 4P4KA 4AQ1B 4X5RA 2DOCA 2BZDA 3CK0L 4WHDA 2ALWA 1GMIA 1S5HB 5PAZA 4ZD3H 3KPSD 3UFIA 1XGRA 3CVDA 3DGGB 3QQDB 2UX7A 2YPKA 1CGXA 2YAHA 3U4EA 1J0KA 3GMMA 2YIHA 5AUMA 3UIZA 2ZUSA 1T0NA 4PMEA 3JXAA 5LBSL 4HEMA 5D1XD 3LDBC 5KW9H 2HA1A 4HS8H 4PJHE 1OTUD 1TZ8A 1RP9A 2UY6B 3PWJB 4HC1H 2D2CC 3KEHA 3TJEL 3OB0H 3EG9A 5F3BB 3KPOB 1BQLL 1M9SA 2AK4A 2AKRB 2QPDB 1ET7A 4J6RH 1IGCL 1T21B 1KLFA 1UD4A 1K5NA 2XG4B 3LKSB 4X50A 2GG1A 4CU6A 3BYYA 4GUQA 1C16B 3MNZA 1U42A 2DBLH 1E4XI 1KYUA 3B2VL 2F53A 1MNUH 3IMRA 2A6JB 3CTTA 3C5XA 2HTKD 3GMLA 3S8FB 1LLAA 3QUYC 4J3OD 1W72H 1LEIB 2X89D 1VESA 5E03A 1OD7A 4OI7A 4JJHA 5K9KB 4G8AC 4JFPA 1O9ZA 3OQ3B 4LCWB 1A6VH 3EFFB 5HJ3B 4MFHA 1A1OB 1OALA 4C56B 2TRYA 3II1A 3WLBA 5EHFA 3TPUB 4WHYG 5J11B 3N43B 5F96H 1I1YB 1T89C 3APMA 1QSVA 1JFQL 2XU9A 3EAKA 2AJVL 3MR9B 3OKYA 4LLUA 4WLCA 4X6CB 5C0BE 2PYED 1EA9C 1WF5A 5DRNB 3UZQA 3GS0A 3QHFH 2ZG1A 3ZZQA 3DGDA 2HVKA 1N0LA 2ZX7A 4NENA 2PLTA 2NNRA 3US1A 1D5BA 4HIXL 1YYML 3CZNA 2XY2A 4UDUB 5E9AA 3SE4C 4ZPTB 1DQQA 3KPRA 5MP6H 4BGDA 5DK0A 1FFNA 1W6WA 2HRPH 4PJGB 4X8XA 1CB4A 5AKVA 4NUQA 4K9JA 5H94B 3RGVA 1OGAA 4W6XB 4PRNA 1P7QB 4F5CA 3HW7A 2DI7A 3ASOB 3PWUB 1PEZA 3TV3L 2VB5A 3F2LA 1G7JB 3CBKB 1NUDA 4Y4KA 5CBAB 1QSEE 1ZANL 4OJCA 2YKLL 4NQED 4YHZL 3GJFA 1JRHH 2Q7NA 1F4XH 1L0XA 4IRSD 1Q9WB 3VI3A 3HB3D 2FWUA 4RNRA 3SOBL 4CDHA 4RGMC 4JANB 3FT4B 1BMGA 1RL1A 3GSNB 4YLCA 2GBVA 4FGMA 1FIGH 2XPYA 4K15A 1A1NA 2QQKH 2PW1B 4KAQH 1IKFL 3GGWB 4LLVB 5F9JB 3S5LB 2OMZA 3DGCR 3EDDA 1FNAA 3GZPA 2VDPH 2XZZA 4NC2B 4YBLC 1C7SA 2XFXB 4Z7AA 4DEWA 1KN2L 2JJVA 4WW1A 4R7DB 3O2VL 1T7ZA 1JHLL 2VQ1A 1P4IL 3QIUB 5TDNA 4FHKA 4KX9A 5HDBB 3V5KB 1MJJB 4E2OA 1WBYA 2CLVA 2UZIL 2RFXA 1OSYA 3TL5A 1AP2A 5JLZB 2R4SH 1AE6L 1LDPL 3I75A 2C1OB 3RJDA 4DKEL 1KB9J 2JELH 3ARDD 4NRZA 1MHHB 2CO1A 3H9ZA 5I1HL 3S35L 7PCYA 2QSCH 3GPEA 2X4TB 4XBGB 3VTAA 1T83C 3P0VH 5EFIA 3WE1A 3E1F1 3FFCB 2ETWA 4RX4A 5IG7A 3EFDH 2EH8H 2R0WL 3T3PB 1K3ZA 5ELIA 4M62L 5FW8A 1Q9KB 1HH6B 3MV9E 1HVXA 3P9MA 3NCBB 3GSXA 1W72A 3U6XS 3BEWA 5LGKA 2B1OA 5IW6B 4OLVL 4OF8A 1NGYB 4LT7A 4NCC1 3DX9A 2A4ZA 3QNYA 4K9EH 5K9QG 4MYWB 3SY6A 4IBQA 4HLEA 3SGDH 2G5BB 1FCGA 1MHPH 4ZMLA 4L8DA 3T08A 1H15B 2M26A 1NCTA 1BECA 2VR5A 2OL3H 3O2WL 4Y2OB 4KGLA 1EBPA 1TFPA 4C57C 4WV1A 4F7KA 6PCYA 4OGAD 5DF0A 1I7UA 1Q90A 3ZRCC 2W81C 4HUNB 4A2DA 4OFYD 1KGJA 3DVGA 3DSNB 2GJJA 4WWKD 5TFSL 1AFVH 5KAQG 2NTFB 1BJMA 1JV5B 1A3RL 2BNUB 4XMVA 1ZK9A 4FFVD 4WK4B 1AGEA 4L8BA 3S2CA 3DLQR 1XH0A 5SV4A 5TK4A 5KBNC 2VZ3A 2JSFA 4TULH 1M1XB 4CC0A 2Q2EB 1OIOA 4M29A 4FQHB 3TN0D 2QR0A 4JL2A 4AGOA 4LQFH 4X4ME 1OV8A 3WXWL 4AYGA 4F3FA 3P77A 1UJ3B 1UFUA 3D85A 2ERJB 4DGYL 3RWJB 3N43F 1RUAH 3HZMB 4X4YA 2EVJA 1AR1C 2WXLA 2YEZA 4LFHG 4N1CA 4FRWA 2R0KH 2J1XA 4X6CF 3BKJL 3MRBA 4XNMB 3MXVH 4YEEA 2BOBB 3C60A 2NLJB 4JKLA 1KLUB 4IGBB 3S48A 1OK0A 1J9TA 4DVRH 4PVBA 5MHSE 3LPWA 3H55A 3ZDWA 4EBQH 3ZHDA 4R3SB 2G2PA 1HHHA 4XNYH 1WUZA 3FO9B 5EOCL 3PAYA 3W0WB 3RL2B 2BSRA 2VKXA 2WLIB 4QNPE 5MEOA 5C0AD 2FL5B 1HZHH 4PJGF 1IEHA 2WXJA 4QKTA 4PJFB 1DLHA 1SYVA 3WO4C 2HP4A 4OI8A 4YC2C 4QHLA 4XPFH 5JIKA 1HWWA 2VZVA 3HC4L 3HN8A 1SN5A 3OR7A 1CZ8H 3C9NB 2E7LA 1S3KL 4KO7A 1I85C 4FQ2H 4ZRGA 2WVUA 3MMEB 2WLJA 3Q1SL 3V0VA 4Z7UA 3DROA 2YUVA 4XXCC 2AJUH 3DV6B 5JIQA 5D1XB 3NFNB 4B50A 4MRCA 3MOBL 1KNOA 1FE8H 5KYUA 3VFPB 1QNIA 1M7IA 1DN0A 1RZIB 4TQPA 5J6GB 3S2AA 1RJZA 1A6ZA 2ITDA 4PFEA 1EK3A 5E99L 3V4UH 3PAZA 4O51B 4WHYH 1FVCB 4WUUA 5C71A 2L7EA 1PGRB 3A21A 4M7LT 3QEHA 2VL5A 4G5AA 1I1CA 2OMBA 2IPUK 5E2UH 2Z1PA 2FSEB 5AOLA 2ZSVB 3SDAA 4ILDA 3G6AB 4KHTL 1XIWD 5CEXA 4FQPA 4KTYA 1AAJA 1KPVA 3P3UA 1BQHB 1AQ8A 5EO9B 2AEOA 2NZ9C 4GRMA 1QLEH 2AJSL 2OL3A 4PY8I 3TEYA 4HH8A 4X5XB 4PJAE 5T3ZE 2ZAHA 1FC1A 4Q9CA 2BRRH 1U3YA 4HQQH 4AYID 4I89A 4S0SD 5HP5A 1IM9A 4Y5VC 1OHQA 2BNRE 3HIZA 3T3PF 5DRZA 1TZIA 2XV6B 3H3KA 3IDJB 1JNLL 4I0KA 4ZUTB 4Z7OE 4F15C 2C9XA 4I87A 4CDGC 5FWRA 5AG8A 4LU5L 5DXWA 3KCWA 1AQMA 4DESA 4DF9A 3CFEA 3CFJA 4IIQB 1D6VL 1S9KC 1M3JA 1R24A 3GFUA 3FT1A 3X11B 1YY8A 2MWCA 3T04D 5E08L 3UBHA 1IAIL 3EH1A 2WGNB 3DXAE 2ICWJ 4JFEA 5T3ZH 1IAOB 2CJTA 4PV9A 1MW1A 4UILL 1Q38A 5KVDE 4JPWL 3DX6A 5LG6A 3K8KA 5J9PA 1TQBB 3PDOA 4B9ZA 4HAGA 3ZDYE 1NOAA 4KWUA 4NDMB 3RZCD 1EIBA 4NQEB 4RMRA 2GITB 5KJ7E 4IRSB 2CR3A 3PWLB 2JKIS 3HUJE 2OTUB 3BAEL 4Y5YC 5EIIB 5C0NC 1S2EA 1SHWA 1LO0L 3VWJA 4LRNL 1GGCL 4JDEB 4IBWA 1RK7A 4WRLA 2CDEA 3SE8L 1RV6X 5I6XB 3CC1A 1EFXA 4JN2A 1N19A 3GBEA 5ECJE 1JN6A 4GXVL 1JXJA 4F7PA 3D0LB 3UL4A 4P9ML 4TXVB 5F1NA 5KVDH 3GSRB 1MW2A 1K8DB 1HHIA 1DZ0A 4OGXH 2WLKA 4BK5A 2CJSA 1TVHA 1CI5A 3RTQD 3PWNB 3QORC 5A6MA 4OU3A 3WKMH 4BKSC 3VA2C 3ARDB 3A0OA 1R5VA 1BVOA 4OFDA 4OZHB 1CXLA 1R3KA 3DVNB 1HFUA 4GBXD 4IHBA 5JXEC 3NABL 1OF0A 3VX1A 1K8IB 1MN4A 1T20B 5E0QA 4EI6B 4M9PA 4FQJL 4L9DA 1VENA 4PJFF 3TNMB 4DP5X 2XXCB 3O3BA 1QPPA 3AW5A 2BVPB 4LOEA 5DJ0A 5JORA 4JQIL 4MMYA 3LXAA 2NNAA 4DUVA 1H19A 4PSRA 5LGHL 1I7ZB 4LDLB 1JPFA 3ECQA 4KRMB 1BBJA 3A23A 3BUDA 3NCYS 1B3JA 5E4IA 5BMFL 2VXVH 4G43B 4TLTA 2IJ0C 4HUVB 1NIAA 3DHPA 2BWQA 3QDJE 3N42B 2HB0A 4NQSA 4XMTA 1DO6A 1ZS8A 4XMXA 3CIQA 3AACA 1RQ5A 3MZGB 1IC0A 4MSWA 3FOLB 2OMVA 4KO5A 4RGNE 5HDWA 4KZEH 1LVEA 1Q0XL 4I0CC 4PD4K 5FOJA 3K8MA 3PNWB 5K39A 4DP0X 2E0PA 3MNMA 4N2AA 3MJ9H 3SQOH 4IDLA 4Y1AE 2AVFA 3IN2A 3E9TA 3KPQB 1T03L 1JXGA 4UNUA 1EZSA 1BIIA 3VB8A 5HD8D 2PTTB 4LXFA 5CN1A 2AV1B 1CDBA 4PJAA 1KJMA 4HP5A 1CMOA 1CF1A 4K94H 1KELL 2I9TA 4LIQL 3NRQA 4ODVH 2IALB 1BSIA 5EO0A 3TN0B 1UM6L 4JHVA 2D3VA 3OVUB 4YE4L 1ZT1A 3BRGC 4JG5A 2F2HA 2VZTA 1UB5A 3DTDA 3KYKL 5F7EH 2WZPA 3TF7C 1XBDA 3SD5A 2JXMA 3X1GA 5B8CC 5IB3B 2EIEA 3BQUD 4PJBE 3U9PL 1DEEA 4B3VA 4JM4L 1NA8A 4PRHB 3UYRL 3FW6A 4KKAC 1NGZB 1R3LB 2EKSB 2EDQA 2C3GA 4M61B 4ABWA 3HNSH 3IJYA 3QWRA 4OT1H 4WK0B 4KXBA 4OLZH 2OSWA 3T0WA 5L6YL 3CWGA 1MWAH 3CMOH 3BEVB 3E80A 4FG6D 5BJTB 3RP1A 4NZUL 5GSVB 2Z64C 4KJPC 1MRFH 4KV5E 1E43A 1XSJA 2I9LA 4X2UA 1F6AA 5IB5B 1FHGA 3VXNA 3WEAA 1TF4A 2H32H 1DQLH 3FYIB 4KOCA 3WUWB 4KNQA 4FXTA 2V5MA 5FHAL 5ILTH 5CIPH 4GH7B 1UXLA 1MI5E 3VRJA 3EW3B 2VO5A 4UZUA 5LN8A 2K8MA 5DD1H 1E6JL 5B38G 4UIKH 3QJFA 1UFGA 3HMXL 2JB6A 4XR8C 3N04A 4P48A 5I17A 3QJOA 3C8DA 2HG5A 5I1GL 1BZQK 3X1EA 1H8OA 2ZKYA 3IFPB 1N5AA 3NIGE 5FUOL 5HDRA 1ADQL 5H4YA 2VUYA 3NJMA 3EO0B 1AI1H 2NQDA 4MA1C 1NM4A 1B2YA 1P6WA 4FLHA 4JZJA 4AIZB 6FABL 1CE6B 5I30H 5AW9B 4DGVH 5JPNC 3PUUA 5C2BH 3OQRA 5FYJU 2DEYX 2EXWD 1WAAE 3DWTA 4C59B 3UGEA 4E9TA 2KT6A 4ZFGL 5IVNA 1KYOJ 4KU1A 1JGEB 4Y7OC 1WP6A 4BFFA 1XIWB 5AAMC 2E7DA 3FUHA 3GBLA 1G94A 4WEBL 3BWAA 2VQUA 1XSKA 1SEBB 3QXUA 4M7JL 5F89A 3SO3C 4OZHF 3TTSA 4A6YB 2YEVB 2ATPB 1I8IA 2PO6A 2XXMB 4KXZH 4JFQA 3QAQA 4P5MA 2WYIA 3NIDF 3AXLA 3MJ9A 5AFAA 3CXHJ 5I1AA 1VFAB 3KWWB 4NXKA 4K3HA 2OZ4H 1WIOA 2BSSB 2WAHA 2BIOA 4UM9D 3SKNB 3S97C 1N0XL 2CGYA 3T6ZA 2Q87A 1K5WA 3WFBL 3OLIA 1B90A 1Z9PA 1ZGLM 5KEZA 3LSOA 5I6MA 3ISWA 4YO0A 3RG1C 1GMEA 4PB9L 2O4EA 3N42F 3DUUA 1RJCA 1XEDA 3T2PA 4DP9X 3BP4A 3TJPA 1T2QL 4U6VH 1P9MA 3DSFL 1F6LL 3N5AA 5K59F 5IFAH 3CK0H 3O81A 2WTPA 4Y1AA 3RZCB 2WV3A 1C08A 4J23A 3T2LA 3CFBA 2EIKB 3JQOB 2VDML 2YD3A 4LL1A 5J8OA 1AMXA 2X6BA 4FCHA 4HWBH 4RAVB 4K3JH 5LBSH 3PU7A 3J27A 4CMHC 5C0BD 2D8KA 4UZSA 5T3XL 3S96A 5D7EA 1AQHA 1U33A 2AQNA 3MN8A 3QPKA 4G6KH 4JO3L 4EI0A 5C3LD 2H32A 3VTMA 1ZT4B 2NY0D 3EYQD 5GRVL 1W0WB 3TJEH 3QHZH 3MXWL 3WNNA 1WV7T 1HSBB 5L4MA 3C60D 1IGCH 1IEBA 5CIPA 4DGIH 4NHUA 1L9TA 2AFNA 5L2KE 4Y16A 1E2WA 2ZKMX 2WQWA 4D3CL 5KVFL 3ASWA 3B2VH 1MPAL 1AOHA 1H5BB 1OANA 3FUDA 4LVOC 5I2IB 1BZEA 3RTQB 2O6DA 5KVEL 4QXTB 4MNHA 3KLHD 1E6OL 3SE3C 1EQWA 1V55B 4I3SH 3ARQA 3KEDA 3TO4A 1DCEA 1PZ5B 2XWRA 4GBXB 3DRQA 2P5EE 1QSED 1TZAA 4UNTA 5FDWA 1N4XH 1XGRB 2EDYA 3OG6B 4LGRB 5CR8A 1AGFB 2F1EA 3U9UA 3WSQL 4PBWD 3O9WC 1DQKA 3Q9QA 5AUMB 2FWOA 4UQBA 1T0NB 3SPIA 3MTXA 2A9AA 4JPKL 4WWPA 3S3CB 3WV0A 4L1SA 1AD0B 4QHMB 3HC3H 3TBTA 2ZUXA 3IDGA 4Y88A 3DRTB 4OV5B 4ZS7H 3OSKA 4KI5F 1SOQA 4HIXH 4BFOA 1YYMH 1BVKB 3F58L 3FO0H 1T6VN 2NY6C 4R4FH 5J1TC 1K5NB 3HPJB 5HVGB 4LVHB 5LXGL 1CE1H 2X4QB 3L17A 4PHXA 4ZOBA 1CD0A 2ITEA 1YPZE 2A6IB 4IMKC 1V8HA 1KUMA 4JFZL 2VMCA 2UXVA 1GGUA 2EVGA 3M6DA 2D73A 2OZ4A 3GXPA 1ROWA 3EUUA 4M8RA 5I74B 4MXVF 4QRTB 3Q6GL 3JTTB 2X7LA 4F2MA 3WTYA 1WIPA 3CDZB 4PCYA 3ZHKA 1YRKA 2ZX6A 1KMGA 3FDWA 3SOBH 3WLBB 1RI8A 1T0OA 3MCYA 4ZW3A 4HX1A 3SDCC 2DAVA 4NQDA 4G80A 3IK2A 3MV9D 4XN2A 1RAMA 1JUFA 3GO1L 4B9YA 3ZRSA 4B5EA 2ENSA 4LLUB 3RPBA 5F9AC 2IGLA 5LDSA 4F9LA 1AIFA 1CYXA 1EAQA 4RFEA 5F6IC 4CC4A 1NPJA 2HVKB 4ZMPA 1MLCA 2BP0A 4ZMVA 4MZIA 4NENB 4P3DA 3MLZL 3STLB 1D5BB 1KN2H 3L3DB 4FI6A 1VIWA 2GT9A 4LMQE 5LAPA 4FQLH 2RGSA 3WELA 1DQQB 3BQUB 3ARBD 1JHLH 5DK0B 5D4IA 2VXUH 1HU8A 1P4IH 4HWBA 1FFNB 1KIPA 2I7SA 5LBSA 2A74C 3HLAA 2UZIH 2YR3A 2J56A 1AE6H 4RH4A 3RGVB 2IDQA 4R5VA 4P04A 1GJUA 3N0AA 3S35H 5JHBA 3KS0J 2NYKA 3IDMB 1ZLVK 1AHMA 1JS4A 3GJFB 4U1KA 3A22A 1QYGL 4N3TA 3QUKA 2DBJA 1DBML 5EBLA 1XGPB 2J8HA 2R0WH 4RNRB 2A9MH 2BH0A 1KEMH 1YNKL 1SJXA 2DTML 4LARL 1FORL 4ZXBC 3DURB 1CURA 2HAZA 4PCTA 1KCBA 2PYFB 3MGTA 3L16A 3F84A 4GO8A 3MJ8A 2XX0A 1HKFA 1A1NB 2ZYSA 2E6PA 2IBZY 1I7TB 1EFXD 4OLVH 2OMZB 3H1ZA 3ZJAA 1NANI 2C7FA 5JA8B 3IMWA 2B2XL 1IBDA 3D09A 1KXVA 4Q58C 1CFSA 1T1XA 5E1IA 5D2LE 5JDJA 4FF9A 5GHWL 1GZHA 3MLWH 4B9JA 1XGTA 4CKQA 1EAJA 2VR6A 3BPOC 3QIBC 2A9BA 4WW1B 2VQ1B 1KYFA 3O2WH 3MZTA 1U8LB 1WBYB 2CLVB 2D9CA 4DP2X 4H44C 5KYXB 2R2BB 3WY3A 1AP2B 4PJ8A 5MHSD 4D9RE 1S7SB 2VAJA 3VVVA 1C12A 2AXWA 1RIHL 3KHOA 2YN3A 1IEAA 3KPMB 4WJKB 3V6BR 1LE9A 2FNBA 5TFSH 5DUML 4HWZA 2WJ7A 1A3RH 5EFIB 3K1KC 4J3UA 3EJYC 4HALA 3Q3GA 2E75C 5IG7B 5F1OB 4NI6A 1F18A 5A2CA 1EX0A 1IARB 5D1QC 5FO8B 2PCPA 3P9MB 4QRUA 3AREC 3GSXB 3QZNA 4JQXC 4L18A 3GT6A 3BEWB 1EPFA 1DSFH 3WXWH 2HFTA 1L0QA 1G0XA 5K1JA 1BW8A 5FA4B 1QACA 1WZ1L 3MA9L 3K2MC 2A5UA 4PJHB 1MCKA 3BKJH 4L8DB 3ZW3A 4JPSA 1K2DA 1W8OA 3UBGA 2F5AH 3WJLA 5FYKL 2A3TA 2R69L 3L1FA 4IU3A 3S3JA 2EO7A 2F8XC 4HYTB 4WV1B 3QWQB 4MX7B 3ZZ1A 3RY6C 2YD4A 3P9LA 1I7UB 1YPZA 1WIUA 4DTGH 3PGCB 4X6DA 5KUMA 5DRXA 4KK9D 1KV7A 5C0RL 1U8HA 4ONFL 2AF2A 5A2JH 1LD9A 1SYSA 1RXLA 1BFOA 2VLJA 5G4NA 3BSZL 1R6VA 1SDYA 4J28A 3RPKA 3LZOA 1FF5A 3LH2L 1OE1A 5KWYC 3K4DA 1EEUA 2QR0B 3UBXI 1R33A 2BNRD 4MDRA 2ZWZA 3D85B 2W9DL 1QKZH 3FUEA 5C0BB 2OXHA 2GHZA 5IK3A 2YEZB 1BOGA 4XVUC 3AM8A 2Z91A 5CJQL 1NINA 3FN0H 4XCNB 4YK4C 3FU6A 4LCVA 3MRBB 4N8PA 4KROC 1L9PA 5E99H 1BM7A 4AEIH 3C60B 1NIBA 2P8PA 3SO5A 3DXAD 2A77L 2VDPB 4HUKB 5LGYA 4QXWA 2XN9E 1R17A 1Z9MA 4WI2A 1U9KA 1G7QA 4KHTH 3P40A 5IB4A 5E8DH 1FG9C 2P7TB 3COOA 4CJ0A 5SX5K 2DQHL 3SDDC 1M3IA 4BKLA 4B9IA 5IP4A 1ETA1 2QSTA 4LAQL 2BINA 3NT0A 1QSEB 1QOKA 1UURA 4ELME 4M93C 3X1NA 3ATAA 3MLVL 4YHKL 2EC8A 5IHBA 1MFVA 5HHPA 4I1RA 3ULUC 1YCSA 2IMMA 3FJTA 1PZDA 3GMPB 4KNSA 3V0VB 4N0FB 4Z7UB 2CO6A 4QT5A 5DVPA 1NUNB 1Q1PA 2UUDK 4N2BA 1ZVNA 4WI8A 3JV4A 2Z9TA 1QI4A 5KYUB 2FEDC 4DSYA 1IC7H 1M7IB 4MB1A 2IADB 3G6DH 3SKOB 2A1WL 1DBBL 3SSGA 1RJZB 2BIQA 2ITDB 1KGCE 3DOSB 4N0UA 1T6BX 2V4LA 5DHDA 3ATDA 5E08H 3H8NA 3QSKB 1DQJA 1MIEH 1NLDL 1IAIH 3QEHB 3O0RH 2VL5B 3HG1E 4RRPG 1TTBA 3MJGX 1LK3L 2RD0A 3G5ZB 3WN5C 3B5HA 3SDAB 4UILH 2V2WA 4G8GE 4K3DL 5BOJA 5J7CC 5MI0C 1PAZA 3R06A 4GFTB 1DR9A 1WGVA 2WKGA 3HI6L 5EMYA 4LF3A 4Z23A 4ADJA 4X5QA 1VFOA 3ULUL 3MA7A 2DKUA 3OHXA 2OYPA 4NC1C 4F92B 3BAEH 1JVKA 4XOEA 2R1XB 3OAUL 1REIA 2P45B 2GSMB 1P53A 2P52A 3CZGA 3MV9B 3JYBA 3MYJA 4LFHD 4OM0L 4EKJA 4ZX6A 5EF3A 2NX5E 5E2VL 3SE8H 3BIKB 3O6FC 5LCVL 1DLFL 3M46A 4LHJB 4TRPH 1JPEA 4H7VA 4FQXA 1EDYA 4GXVH 1F2QA 4MMXC 1QFOA 1DUZA 3CFEB 3CFJB 3MJWA 5FEBA 1P7KA 2IAMD 2NDGA 5JHMA 2J8UE 2Y9RT 1E9OA 1R24B 3OZKA 3QDJD 4PP1D 4Z0BH 1JZ3A 1YY8B 3FBKA 5HYJA 4WFHE 1NPUA 3OKNA 2NY3D 2EDLA 1O9WA 5IOPA 3HHMA 3ZX1A 3MLPA 4IHOA 4KVCH 1IL1A 5CM1A 2A2QT 4XNXL 2ADJB 3OKLA 1NKOA 4RGND 1UWGL 2XJLA 4KI1A 3BH4A 4KMLB 4L37B 2VDKH 1GSMA 5F7BA 1OCOB 3NABH 1IFHH 1T1WA 2ODIA 1EXHA 2H6PB 3VAEA 3I6KA 4GQQA 4DUXA 3G3LA 2VDOB 5KSVB 4LSPL 1G7MA 3GB7B 3BWSA 4PI2A 3ZYIA 3VWJB 4IOFD 2EXYD 4JQIH 4XP9H 5GRYA 1SVBA 5LGHH 1CU4L 4EZJA 2CDEB 2P9RA 2OYLA 2XNAA 3VYPA 1EFXB 1UACL 2Q3XA 4LEEA 5F7UA 2XWXA 1JN6B 4M6OL 4F7PB 4LOUC 2V5YA 2ADIB 2HKAA 4U1SB 4P2OD 4D94A 5ERWA 3P4OB 4NN5B 4LIQE 1UXMA 1LNUB 1XXDC 5BVPL 2IQAA 4PS7A 5F1NB 1S7XA 3FONA 4IU2B 1HHIB 1YY9C 2OMWB 2NYYD 5BVJA 3HAEG 4DEPB 1NGWA 3FQRB 1XEUA 5CAYB 5HGBB 2CM5A 4P2RE 3U0WL 2HFGH 1F3DJ 3IBOA 3S4SA 3MRIA 1DJZA 5G55A 3T77B 4GSUA 2WOBA 5E95B 2P42B 4Y9GA 4FFZL 2NXYD 4U4BA 3L1GA 1QTSA 4Z1PA 1RULL 3ULSB 2Y6TE 3MUGB 1X4XA 5DJ0B 1FBIL 1KELH 2NNAB 2EDFA 4LIQH 1MI5D 1U3HC 2NXZC 1OD9A 1UM6H 1JPFB 2XXGA 4NGHL 1QLEB 1BBJB 1FN4A 2B59B 4NUGH 5K1NA 4KC3B 5AW8B 4F24A 4F7TB 1URZA 2FJHA 3CFCL 3Q2NA 4HEPA 4Z7UF 3MRNA 3BDXA 4NQSB 1YEEL 5GZNA 3UYRH 4M4RB 1R47A 4UANA 4D0DA 4V2BA 3N1FC 3V4PB 1XCTA 1KT2A 1BZ7B 3H6JA 4P4RA 5L6YH 3DPBB 1SJEA 4DUWA 3X14B 5DHXB 5IMMA 3WIFA 3ABLB 1DBAL 5BZXA 1CDGA 3S37L 4ABUA 1NAKL 4GFXA 1AZCA 3U30B 4KXCA 2H3XC 3SQBA 3VFNA 1H3UA 4XMPL 2HT4D 4GXUN 3SPHA 5I8CA 4ANUA 3IE4A 1USZA 4XVTL 4PJAB 5D1ZD 1KJMB 1QLRA 4MAYA 4B60A 1QTYT 2I9TB 4TNGA 5CCKL 1UXSA 5I8KL 3CPUA 2JCCE 2X9WA 1KTKE 4GT0A 4UU9B 5EO0B 2X9YA 1CFQB 1JDAA 1AHWA 1DVFA 5GGQH 1Z6JT 1O5PA 1ZT1B 3CC5A 3HMXH 3MJ7A 4NNXB 2VC2L 1U41A 2ED7A 2QELA 2JXMB 3ETTA 3MLUL 4LVEA 3P11H 4Z7OB 5I1GH 1VKXB 3JUYA 2V7HA 1HOEA 1QLFA 2I60L 3GHEH 4MRBA 5FUOH 1IGMH 3CSBA 4MS8D 1GL4B 4JQIA 3U25A 2A73B 2FGWH 1GZQB 5BZZA 3VRLE 5HYIA 3O4OC 2QVMA 3L95A 3D50A 5CD5C 3IJYB 6FABH 3IJHA 1EVTC 1N12A 4LEXL 2B08A 3HPLA 4O9HL 1EUUA 1DJGA 1NBYB 2Q7AA 2I9LB 2XBZA 1PX8A 2JK5B 3EH5B 2AJXL 4U1GC 1LEKA 1VFBA 2MRYA 2APFA 3VXNB 4WEBH 5DD6A 3ZDYB 2DYRB 4M7JH 3IWUA 1C5DB 3WS6A 5D1ZI 4P46A 4RGOH 1G4RA 2COQA 1FL3B 4Q6IA 3VRJB 3W11D 1G6RL 3HUJB 3VCLA 1NFKA 5CKAA 4AYFA 3LIZH 3NUKA 5DRWA 4Z7QB 3FQWA 3ZKSD 3VB9A 1TJXA 2X4RB 3BPCB 2JB6B 4N8VA 4FE9A 3HKFA 1GW0A 2PMZA 3QJZA 4WTZG 3GSUA 3MRDA 5D6DA 2HG5B 1SN0A 1OK8A 3OM3B 1H3PH 2DQMA 1E28B 3VFTA 2Z6FA 5T3XE 1E4KA 3NZ8A 2YAQA 3WFBH 1UXWA 3RKPA 4MNQA 5L2KD 1L7IL 4PJ8D 4JFWA 2G60L 2J5LB 4JZJB 1JZ8A 3V4VL 1AZRA 1J0HA 3AWEA 3WTVA 4ENEC 5DS8A 1OZTG 1S5IH 4HIEB 4XXDB 5F3FA 3QDGE 1T2QH 4MJ4A 1TFHA 3DSFH 3T6QC 4KKZA 3B9VA 5KVFE 3OMNB 1GZPA 2WW8A 4OUUA 2ZAIA 4OCSL 1QZ1A 2KZBA 3W2DH 3AG3B 1S6NA 2P5ED 2Q0ZX 4UYPA 5KVEE 4GJTB 5F89B 3SBWC 1MJUL 5B3JE 4R4BA 3AWFA 4QNPF 4WGKA 1I8IB 2VDMH 2OCCB 3DOHA 4JFQB 3AXLB 4LCYA 5CO1A 3I02A 4NSKB 3PDGA 2WMPB 1K4DA 4M48H 1BQRA 5DQJB 1UHVA 4GS7B 4BRVA 1CVRA 3ZKND 6CGTA 5L0QB 1GOHA 5I1AB 1CGSL 4A7QA 4NT6B 4HWNA 4S11A 1I9RL 3V7AE 3MXWH 2WN3A 5FGCE 2AJZB 1U3NA 2IAMB 1I8KB 1A4CA 1SXSA 2Z31C 3LSOB 2QKIC 4AUUA 4JPIA 4D3CH 2NY3B 3MRCB 4H8WC 1MPAH 1ZLWH 5BV7C 5AENA 5C7XL 1QVOB 3BP4B 2R1YA 5KVEH 1DQIA 4RGNB 1E6OH 3X12A 5EEVA 5AVTB 1XBRA 1KCUL 2NW2A 5CSZA 2HJLA 3EYOB 3WEOA 3HVNA 4Y1AB 3LKQB 3Q8CA 1RJLB 1X5XA 1M05B 3BSGA 3DJRA 1X6LA 1CQKA 4IDJH 2VR3A 3V2AR 1J48A 2E8YA 5LVEA 3WXVL 4MQXD 1MWAB 3WSQH 4BWUA 4YUEL 2DL9A 4OLEA 5C7ZA 3HAEH 3V0HA 3LN4A 4MD5A 3C08H 1NH6A 3L45A 4PJAF 4Q6YA 4F7CB 1KPRA 2DQTL 2H32B 5IJDC 2VW6A 2CO3A 3UCQA 4KZDH 5FYLL 3QW9A 4P2OB 4EIBA 1P7HL 1IEBB 2CUIA 3N0PB 5BV7L 4H8WL 5FECA 4GSQA 1TVBB 4PJBB 4RRPA 2FEJA 5LXGH 4Y16B 2EAEA 4Z7OF 5IZ7A 3LIZA 1R75A 4MCMA 3HCVA 1HCVA 4ZTEA 3NK3A 4AZUA 3BAJA 3CLEH 2I7OA 3QT2A 4D7BA 2LTQC 4X4XB 3FB7B 4MNHB 2W94A 4JRLA 2DZEA 5EZIH 1CG9A 4MHHI 4EVNB 3DRQB 4PTTA 4BFGA 3ILPA 2IBGA 2K9UA 2NXYB 5FDWB 5T33H 3L48A 1EXUA 3IJEA 5E70A 4APQC 3L6FA 3UC2A 1KG0A 1LP9E 1NEZG 4J2XA 4YE0A 3EJQA 3GM8A 3W9EA 1WK0A 1WWWX 5HHXL 3GO1H 3SDXA 4ZMWA 3FU0A 5ICXB 2FWOB 1IBZA 2WBJA 5F7LB 2R29L 3ZDYF 1MNNA 1MVUA 4QHUA 2JF1A 1KCRH 1T1ZA 1GH7A 4H1LA 3HI1B 2DQJL 4P2QA 4W9FC 1J5OL 1QTPA 3BZEB 3MLZH 3NA4A 3HUJF 4X0KA 4DPAX 3JWNG 4Z7QF 2OMYB 4AVJA 4AQAA 4L29A 3B9DA 1N26A 2J8OA 1X5AA 4JKNA 1V3MA 2JKXA 1W6LA 3RX7A 3OAYK 4PWGA 2PKDA 3NIGB 4G7RB 1FH2A 3KDMA 1E8WA 4GLRH 3AUWB 1NBZA 3QQ3B 5A2KH 5KSAA 4D9RD 3AXHA 5EU7C 1RUKL 2Y06L 4MLIA 3QI9A 2YGVA 4V33A 2HJKB 4I88A 3QDGA 4BM7A 5KAQF 4XMKH 3SGJA 1QYGH 4PJ7E 2YUWA 3B3IB 4LARH 1FLTX 1WFJA 2EEFA 2MPAH 3C8KA 1FORH 4HX1B 5KSUA 4F80A 4FTVA 4NQDB 4GO6B 3FQNB 1JUFB 5I6NA 4PV1C 2PXYC 1SOXA 3BUYB 5DDHA 4BELD 1AIFB 2HRGA 4FQXD 3MU3A 2AEIT 2B2XH 4LP8A 4RFEB 4NOFA 4U1NA 1MLCB 4Y8AA 3MFFB 5E1HB 4YXLL 2KBGA 1XDTT 5I82A 3WJJA 3EOAA 2GT9B 5C0GB 4AVIA 4H13C 2TRHA 1KIPB 3Q2VA 4Y1TA 2KMWA 1J8HE 4ZW8A 3NPSC 2WKLA 5GSRB 5IBUG 1JD7A 3IU4H 1NMCB 4I77H 1PG7W 1QRNE 3WLWC 2Z7WA 3PQYE 1UJTA 3QR2A 4J5VA 5E6IA 3NQKA 4U1KB 4MKTA 5DZVA 2OYMA 1ZDSA 4LGPB 1Q8MA 1A3ZA 3MRRB 2JE8A 2GYSA 2WNKA 3FKUS 3MJ8B 1B0RB 4DOHE 1BZ8A 2RALA 4N8CH 3ZBMA 1CLVA 3G6JA 5F7NC 4XMLL 1B2WL 2HFFA 3P2TA 3HEIB 1CFSB 2R9HD 3MA9H 3LD8C 3OC5A 3TA3C 3L81A 3V0WH 1L3WA 3G5XA 3LDBB 4JRFA 4I3RL 3EHBB 5FYKH 1X5FA 3OF6D 1HHGB 5TGBA 3F8UB 2FR4A 4LASL 2CJUL 2YRLA 4FFTA 4PJ8B 4N6QA 4XWGL 5L2KB 3BW9A 3QUZA 2XVLA 1GAFL 4PJBF 5E94A 5J13C 3MLYL 2OMTA 2XN9D 4IEFB 5HHME 4JDZA 2BY2A 5B1BB 3LMJL 1JF5A 4FD0A 4NERA 2FVNA 4HS3A 1TR7A 3BSZH 1D7BA 3VXPB 3LRSA 2EJ1A 4GKNA 5I6OA 2NZ9D 1U0QA 2WAQA 2PCPB 5E1AB 5FGBC 4KV5F 4AYMC 2FJFA 2ZPKL 1JL8A 2VSDA 4PREA 4FHJA 3CSFA 5F7FA 1LQSR 3GMOA 1PDKB 3F65A 5MEPA 3IGFA 3CV5A 1TLKA 3RBGA 4XVSL 5E8OA 3N1PC 5CJQH 1XGQA 2W9EH 1MAKA 2XA8H 1EJ6A 3FQUB 2BDNL 2WCPA 4YDJA 1RP8A 3DDFA 1K2DB 3K2UH 4IRJA 2FK9A 4XO8A 1KGCD 4MJ6B 2WUBH 4UV4H 3VNZA 2WLYA 3LRMA 4IBVA 2A77H 1YPZB 3HG1D 1LGVA 5DHYA 3TM6A 1X5LA 1N64L 4A7GA 2R56L 1DUYB 3SPVB 1IBYA 3NIGF 2Z4QB 4FG4A 4G8GD 4B9KC 1MJ8L 2L3BA 2Y5TA 4NYLB 2P8LA 1DBJL 5KJ4A 3FRUB 1GTFA 4LAQH 1BFOB 1MW0A 1AACA 1QFWI 3T1FB 5L88H 4PJ7A 1WAAF 3RY4A 4YHKH 1CO1A 4MDJB 4J6IA 1NANH 5B38B 3THML 4KTEL 1AZUA 2J20A 2RA1A 4N28A 3JWNE 2F7QA 2E27H 4OFQA 1FGVL 2ENPA 4YS4A 3BUIA 2NX5D 4RGMB 5C0ND 3ULUE 3T09A 4NS0A 1BOGB 3LKRA 1EVUA 1JJUA 2Z91B 3BCFA 2A1WH 3PV6A 5T1KA 4X8JA 4G1EA 3CZKA 4ODXB 2P8PB 3OKDB 1NLDH 4WNQA 3FB6A 4WFHD 5EIQA 5JDSA 1G5AA 4JFDE 1WA2X 1RJYB 5H2BB 4Y9BA 5FKAA 3EH2A 2IOIA 3QEQE 1G7QB 5DR5L 4I0PC 4TNVF 4LSUL 3TCLB 3VSTA 4N0YH 1T5WA 2MIZA 1YUHA 3QORD 1MHEA 1ZT7B 3GHBL 3JWNH 2YMXL 4QXUL 2WLHA 5AG9A 4M3JA 1ID2A 4OLUH 4ETQA 3O3DB 3KLQA 1KN4L 5JXED 3IS0X 3B2MA 2GY5A 1MIMH 1OT4A 3UABA 2BHFA 1PKQE 4NFCA 3VO0A 3T0EA 2ADFL 2XVGA 1D9KA 4CU7A 2CO6B 4QT5B 5E2VH 4D8PA 3VXQB 3PFQA 3JV4B 3L3GB 3CVHH 1NKGA 3SD2A 5C0JB 4PJXE 3AITA 2Z34A 3FSVA 4OCNC 2AZAA 2K8QA 5D2LB 1A7QL 3PP4L 4YDKL 1ZHBA 5SWQA 1ITBB 4WKXA 1JNNL 4N0UB 2WYHA 1DQJB 2DYPA 3NEOA 4UQCA 3RDTC 4PGEA 2Q2LA 2Q86A 4YHPB 2N01B 3L5XH 4FI7A 4XNXH 4AC4A 3CQPA 5TD4A 3BOVA 2Z8WC 4HT1H 2DS4A 3T0AA 4P2RD 1QFUH 2P24B 4YFDB 4Y4HA 1OP9A 3QXWA 2H26A 2J2ZB 4LF3B 5AVYB 3ULVC 3GUFA 1NTDA 4HV8A 1HEZA 4P5KB 3ZDXB 3S88L 3FUFA 4MASA 3F7QA 3MA7B 2Q6WA 3OHXB 4PRPA 1G9NH 5J5EA 4AMXA 3TZVA 2VISA 3D4CA 4N9GB 5IREA 2FJGB 5DJXB 4NI3A 1CU4H 1DQML 2G2RB 1CD9B 2CR6A 4GXFA 4TVUA 4K23H 1UACH 4ZMNA 5J12B 4HWEL 4FQXB 4M6OH 1WEJH 3K7UA 2IWKA 1DUZB 1P7KB 5HVHC 1OAKH 4Y9FA 3F6LA 1A4JA 5I8EA 1I1AA 1AC6A 5HYJB 4Q9QL 3OKNB 4ZS6C 4DN3L 5SV3A 3H6AA 4QRQB 4IHOB 2ZUTA 1IL1B 5D6CB 4PPTA 2BVUA 3OKLB 4X5WB 5DJ2A 3V6FB 2R2HB 2QVFB 3NJIA 5I16B 2OXGA 3OXSA 1PSKL 3ULVL 3NH7H 1OCZB 2IDCA 3F7LA 1XF1A 3NRFA 2VDNL 3WMPA 4TVPL 1WFNA 4FFZH 1YPZF 3FO1A 4KJPD 4KK6C 4C83A 3KYOB 4AMKL 5BZDA 1OSPL 1RULH 2EDTA 3LN9A 3SCMA 3WNMA 1QABA 5JOEA 5DJ8B 5INCA 4N2KA 2FLBT 5GXBB 1VF5C 1H6TA 4YC2B 3ZU8A 4EIGB 3MLXL 1J87A 2CXGA 4F57H 2XNAB 3U4KA 4NGHH 2RCSH 1WWBX 1VHPA 3HZVA 3MKKA 4X83A 3HHRB 3WNLA 3AABA 4FFWC 1B0GB 3UDWA 5ERWB 2AJ3B 1ERNA 2BP3A 1S7XB 4QHKI 2RAMA 4EOWH 2AQ3A 2DYSB 1LO3L 4PG2C 1HT6A 5AAWC 3ESNA 4YDZA 3TYGH 4H0GA 5D7JC 5H35B 3CVHA 2ID5A 1U91B 1QO3B 2G3ZA 3C6SA 5FDYA 1VZHA 2VRAA 5D72L 1DBAH 2XN9B 3QEQA 3S37H 3RJOA 4Y7MA 4NOBA 4NP9A 3US9A 2BVQB 4XMPH 1EHLH 3TVMA 5F9OH 1L9OA 1SY6L 1JGDA 2X1OA 4IK7A 3CSGA 2MCPL 1OAYL 3RWEB 4YXHH 2IQ9L 4UM8A 1JWMA 1GC1H 3GIZL 3OX8A 4UOQA 2LR4A 4ELMB 3B1UA 4LSDA 4AITA 4IMLA 3FMGH 4J3SA 4S1DD 4J1UA 2NSXA 1FSKC 2ENYA 1J1OL 1FN4B 3CIAA 1XF5A 3RNQA 1TUPA 2VC2H 2FJHB 3MLUH 4FXKC 1S46A 4Y5VB 3UBXA 4OIBA 1WPCA 4GQ9H 4XXWA 3P02A 4M3KB 1WT5A 5T3XD 3VU2A 3MFGB 1CFMA 1F97A 1OQOA 2MKLC 1XCTB 4M1DL 3PG2A 5D2LF 3VXRE 4NZRH 1NUFA 5CZRA