2B3RA

Crystal structure of the c2 domain of class ii phosphatidylinositide 3-kinase c2
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSGAVKLSVSYRNGTLFIMVMHIKDLVTEDGADPNPYVKTYLLPDTHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGITLPLKDFNLSKETVKWYQLTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Phosphatidylinositol-4-phosphate 3-kinase C2 domain-containi
publication title Crystal structure of the C2 domain of class II phosphatidylinositide 3-kinase C2alpha.
pubmed doi rcsb
source organism Mus musculus
total genus 23
structure length 124
sequence length 124
chains with identical sequence B
ec nomenclature ec 2.7.1.154: Phosphatidylinositol-4-phosphate 3-kinase.
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 2b3rA00
5H4ZA 2WXFA 4TV3A 2JQZA 2A5UA 3CSTA 4Y1TA 4WWPA 3LJ3A 3KWTA 4PS8A 4IHBA 3T8MA 3HN8A 5CCJA 4URKA 2ZKMX 4QAMB 2QZQA 4F92B 3PS6A 4GB9A 3APFA 4PS7A 5KJ7E 5JHAA 1CJYA 2K8MA 1V27A 2WXGA 4KZCA 1E7VA 2N1TE 4FULA 2CHZA 3FDWA 1RLWA 3APCA 2BWQA 3L16A 1TJXA 2CM6A 4FJZA 1E7UA 2YOAA 4L1BA 4AJWA 1E8YA 5EDSA 3CSFA 4ANVA 3PYCA 4A55A 4PS3A 2UZPA 2NCEA 4NPJA 1DJGA 1BDYA 3RPBA 2A4ZA 4QJ3B 3PFQA 5T8IA 3DBSA 2QZ5A 4NS0A 4Y1SA 4FA6A 2KI6A 3IM1A 3DPDA 2FJUB 4WWOA 3TWYA 1W15A 3PREA 3OHMB 1DSYA 2CJSA 2ENQA 3R7QA 3NSJA 1A25A 1DJZA 1DQVA 2ENJA 2WXIA 3L13A 2NSQA 3L54A 3OAWA 4FJYA 4FLHA 4G11A 3QR0A 3S2AA 3F05A 2DMGA 4DK5A 1UGKA 1E90A 2ENPA 4QJ4B 2YRBA 4NP9A 2K4AA 3P2BA 5G2NA 3SD5A 2CHXA 3TL5A 3F04A 4FHJA 4J6IA 3HIZA 2Y3AA 3ML8A 3RDJA 4KITB 3APDA 4FADA 2WXMA 4FHKA 2WXNA 3NZSA 3L17A 1DJXA 2CJTA 4ICWA 2WXKA 3N5AA 4EZJA 3QAQA 4TS6A 2V4LA 5H4YA 4L1LA 3W57A 4TUUA 1RH8A 3L9BA 3QJZA 1WFJA 3QK0A 4KZ0A 4BFRA 4ICXA 2RD0A 4DNLA 1K5WA 2EP6A 4ANXA 2WXOA 5G55A 2B3RA 4XX5A 4LDCA 2WXPA 1E8XA 1RSYA 4AOFA 1QATA 4GNKB 4QJ5B 2WXLA 4XE0A 4MJJA 2D8KA 4L23A 4F91B 3PRZA 4LCVA 3HHMA 1UOWA 1DJHA 1W16A 3QR1A 4WWNA 3ZIMA 3JZYA 1DJIA 2CHDA 2Q0ZX 4L2YA 3ENEA 2WXHA 4HVBA 4JPSA 2FK9A 4OVVA 3GPEA 2Q3XA 3F01A 4ANUA 4F1SA 4WAFA 4HLEA 1WFMA 4LT7A 3W56A 1BYNA 4EZLA 1DJYA 2WXJA 2ISDA 3FBKA 1TJMA 3ML9A 2DMHA 4OVUA 2WXRA 2NQ3A 3KWUA 2R83A 3L4CA 3TJPA 4V11A 1E8ZA 2CM5A 1BCIA 2K3HA 3ZVVA 1YRKA 4F93B 1HE8A 4NPKA 1UOVA 2LHAA 2CHWA 2Z0UA 3B7YA 4IQHA 4XZ4A 5CCGE 1DJWA 3NZUA 3F00A 4ANWA 5JHBA 3R7RA 2K45A 5CCHE 1GMIA 2X38A 1QASA 3IBEA 3QARA 4WEEA 3M7FB 3ZW3A 4BGDA 4EZKA 2WXQA 3MJWA 3L08A 1E8WA
chains in the Genus database with same CATH superfamily
2B59A 4L5FE 3GMQA 4Z3IA 4FFWC 3U0TA 2TRYA 4L4VE 3F83A 4F92B 1BM3L 1JXDA 1KCKA 5E2VH 5ANHA 3V6OA 3MGOA 5JLZB 5AW6B 2YA0A 2VITB 1KEML 3HC3L 2VIRA 3L48A 2QL1A 5KG9A 9PCYA 1WZ1L 1F8TL 5JXAL 3X1NA 3LEVH 1RULH 1AGCB 4X6FB 3ZDYF 1BMWA 3DETC 1MFEL 3QG6A 4YHZH 1K5NB 1NH6A 3KWWB 4WSGA 1KGWA 4HC1L 1J9CT 4ELME 1T0NB 2FIKA 4HCGA 4KPHL 4JFPA 3NK3A 4CSTA 1TZIA 2AJ3B 1I4FB 4GIAA 1TVBB 3DX7A 2VXSH 3LNFA 2X4PA 1TENA 5DZ9A 5KVEL 1BQHB 1ZKAA 3HCVB 3L5WB 4YAQA 5I18L 2EJ1A 1DYZA 3BSHA 3PAUA 3QCUL 4N90E 1NOFA 1ZDSA 4AGNA 1I7ZB 1LVEA 1MIMH 4IOFC 3DTXA 5DD1H 3EOTH 1ZV5A 3FN9A 2LLNA 4U1JA 1I85C 4W9EC 4Z7VF 5EU6E 2WXKA 3OKLB 3OV6A 1PZUB 2ZD0A 3QFDB 3DVGA 3VI4E 2V5SA 4R9HA 3L6FA 3FUEA 4XCNA 4OLZL 1KYOJ 4YHIA 4AMWA 2JKLA 2YBGA 5EF0A 3LRLA 3TZVB 5EBWA 2CDEA 5HY9A 2VSMB 3OJDB 1PLCA 3VMPA 3OR6B 2DJSA 4WNSA 1ZMYA 5C6PB 2WLZA 1CGTA 1HI6B 5FW6A 1FSKB 1U8MA 5K9KA 1DJHA 3VUAA 3VD1A 1D6EB 3U48A 2X9XA 3PPSA 3COOA 3ECBA 1P4IL 5GZND 4EZMA 3MUY1 4KJQD 2CA3A 2LLLA 3F01A 2P80A 4V1DE 4Y1AE 3O3BA 2AI0H 5DO2C 3EUDA 3GS7A 5SX5K 4PV8B 2YBRB 5AW7B 1NSNH 3V5DB 1SVCP 2C1PB 1LEGA 2ZX9A 1RUML 1RK1B 2VR4A 2H6PB 2OYKA 5HYJD 4O02L 1IO4C 3GSRB 1Q4NX 5KYNA 1OTUC 2QADD 3W0WB 3O41A 4PW3A 2OK0H 5GGVH 5HHOA 4AQEA 5EWIL 4IMLA 1ZLVK 1KBVA 2NR6A 2A3TA 3KS0J 3IFOB 5EA0H 3U6XS 2CUMA 1J8SA 2DLFH 5DS2A 3RUGE 1QSEE 4HPYH 4HVBA 2NXZC 1NGZA 2F5BH 3GMNB 3KPSD 3VAEA 1RP9A 1YYCA 2VZUA 2Z8RA 4UT6H 4LRIC 3MJWA 5LN8A 3EOAB 2X40A 5KBPA 4CW1A 4HK0A 3HS8A 4KAQH 3MBEA 4MBOA 5DJZB 4FQJL 4KXDA 3U0WL 4IOIB 1FH5L 5D4QA 4XPFL 5JORB 5F1OB 2QT6A 1Z5LB 2OS7A 1ZVYA 3SDXB 5LCVH 3Q43A 2QHRH 4PJDF 4DPCX 3H7BB 2WAQA 3LSOB 5AVVB 2AQQA 2P43B 4JKPH 3WKML 4NAMA 1DFBH 3O81A 2YFNA 3TF7C 3MRDA 4U1KB 2H32H 4J3OC 3GSQA 1LNUA 2BFVH 5DA0B 1YJDC 1A7BA 1OPGL 2D3VA 1OCOB 4Z7QB 2MOQA 4AL8L 3B8YA 1IE4A 4LKCB 3TWYA 1QUNB 3GZPA 1QMUA 3DKHA 3DX7B 3NFPA 5JXEA 1KLUB 3CD4A 1FO0A 1IRAY 1NFIA 4ODTH 3VFMB 4KVCL 1ACYL 1DQLH 3ALPA 3N42B 4MS8D 4PB0L 5E8PA 3WY2A 4PUBH 2WP3O 4GKSA 5DFWH 1X4YA 4GO6B 3ZRCC 4UQAA 3UEQA 3OMNB 2MHAB 2Q7NA 4QRRE 1Z9OA 3NAAL 1BIIA 2D9CA 5L2JB 2GY5A 4RISL 4LQFL 4ZK8A 5D8JL 4XTRD 3KNBB 3OMZA 3P4MB 3WIIL 4W68A 2XKUA 4TOYH 5LDSA 3SCMD 4ADJA 4MSWA 4WTZG 4ZDHB 1CFTA 1Q0YL 3DECA 5FFOA 3MMEA 2D73A 5BJTA 1HOCB 2QVKA 2NY0B 2V9QA 3HMXA 4PJ8A 2D31A 4LLWB 1KTBA 1VADB 4IRSB 4AZ8A 3RVWD 2R7EA 5HGAA 3R8QA 5D1QE 3VQ1C 4H40A 1U8MB 2CALA 2VE6B 2EZ0D 2YHGA 4KOBA 2JCCB 5I6PA 1S7SA 2A7BA 2NNXA 1UT2A 3A22A 5C07E 3DO3A 1YQVL 2PCFB 1IUZA 3MV9D 4FNLH 4M61B 5CWSA 3PGDA 4LLAA 4U0RC 2A74B 4L29A 1EHLH 3UGEA 1AY1H 4JLRA 4XMLH 3DO7A 3B6SA 1FZOB 4RGMB 3QG7L 2WXJA 4Z7UE 1XF3B 1DL7L 2ZXQA 4FZ8L 1SM3L 1TZGH 2QMKA 5AQ0A 4PMEA 2AJXH 3L3GA 4CA4A 3FB7A 1CTNA 5F96L 4JUSA 5D7JC 3REVA 3BPOB 3LPOA 2NZ1A 4X99B 5SV3A 4IBLT 4BFIB 2V9UA 3PCYA 3QUMA 1WP6A 1N0XL 4JZOB 4ELMF 3NRFA 4GW5B 1TQUA 4QTIL 1UGNA 3QEGL 5AYUL 4DGYH 1XBDA 2HH0H 4JPWH 4B0MB 1J8HD 5FO9B 4I77L 5MI0B 1I8IA 4XVUC 3UTSA 1XZ0A 5EEWA 4Z3EA 3UZQA 4LP4A 2OR8A 2VERA 3D06A 3SDYH 1LO5B 2MWCA 1BQKA 2J6EA 3ATEA 1KJMB 2ZCHL 1N70A 4DAGH 1INEH 2IGFL 3CHQA 3CVHA 2Z7WA 2BP8B 2PF6A 2HJKA 2OTPA 2Z8WC 3LD8C 2ED9A 1PKQA 2IDSA 3MRDB 5FGBA 2NY1C 3CFTA 5BOZG 1IJ9A 1RZFH 3IKKA 1ADQA 3X14B 2ZX5A 1X4XA 5FYKL 1QOKA 2Q87A 2VLJE 4JM4H 2YAHA 1DQDH 3BW9B 5J1SC 4X2UA 3GXFA 1QLRA 4WHYG 1ETB1 1E4XL 1ZA6A 3NPZB 4NN6B 4OZGB 3VQLA 1A5FH 3QXAB 1ZAGA 5C0NC 3IF1B 5KVDL 3CX2A 1DVXA 4EBQL 3QJFA 2WANA 5C0EA 1MY5A 1FWXA 2AXFB 2EO1A 4R83A 3NPSC 3NRPA 3LNHA 3LHAA 3HRZA 3OLIA 4B95C 2E5EA 1EXUB 1KCVH 5I8OH 4B5EA 3SGEH 1SEQL 5I76B 3RAJL 3L1EA 4L37B 1YZZA 4N0UA 1HHJA 4FQLH 2E7CA 5EOCJ 1JZEA 3FT1A 4ACPA 2RFXB 3ARVA 3QO1B 3HBPA 2XN9E 4GKZA 4PY8J 5I0VA 3HBQA 4YC2B 3UAEA 1SYVA 1R3HA 2FJSA 4W9ZA 3RUGF 3VFGH 4BEIA 3IVKA 1KTDA 3QNZB 3QR1A 1KXVC 1JWUB 1AO7B 1WFTA 1MIEL 4KRPC 5F3HB 3S34L 4BELD 4CUCA 3MYJB 1GMEA 3BGFB 5AW1B 1AKJB 1Y18B 3GYRA 1J0KA 3QDJA 3VFNA 3JTTA 4X9YA 2H3NA 5HPMA 4KX8A 3LZQA 5G5DA 3IJSB 4NHUA 4YMPA 3B9KA 1NEUA 4M7JL 5HYQB 2XVKA 2BVOB 4PRPE 3SE9L 5SWQB 1L9MA 4HWEH 3NGBC 1W0WB 3LEXA 2HWZL 5AB2A 3S8FB 3R0NA 4GKOA 3L95A 1HYSD 3Q5OA 4NO5B 4UAHA 1CZ8L 4LCUB 3D25B 3D08A 3CH8A 4XVTL 4G8IB 1BX2A 3LZRA 3K6SB 4W9LC 3UBXI 5FGRA 1EUUA 3RGVB 5IFAH 5DQDL 3QWOA 4HAKA 5IJVA 2QKSA 3WTSA 1CFBA 3B3IB 4FMVA 3K6OA 1K8DA 3BP6B 5IBTH 3SYAA 4P3DA 5DJYA 3HI5L 4JFOB 3VRJA 1WYJA 1PAMA 4JFVA 4RMUA 2KYIA 4HJGA 1HQRA 5C3TA 5ANMA 2P45B 2CO6B 3BD5A 4KHXH 3P9MA 4NP4L 4WSKA 2JH2A 3SGJC 5J11C 1BF8A 5C0CA 4O5LH 3RB5A 2X4NA 3TA4D 2P3YA 3GMOA 4MAYC 4PV9A 4WW2A 3GXMA 2DM7A 3DHJA 3AREB 1HSAA 1TJGH 3BPCB 1KJVA 4U2ZA 1J1XH 4W9HC 4WWKC 1B0RB 4Y4KB 5I8CA 4PWGA 1CUOA 1A47A 2MIZA 1B3IA 1L4IA 2ENQA 4YDIH 5IZ7A 1CVSC 3ARBD 5MEOA 1UWFA 1NDMA 4KQ3H 4JFWA 4HKBA 2WLNA 5AKVA 5IR1B 1JI1A 3C9NA 1RK7A 1GPOH 3V95A 5C9KA 1A6TA 5GGTL 1GVIA 3VD7A 1B0WA 4DERA 2VH5H 2MNJB 2ITCA 4LCCC 3LRMA 4XPTL 3PDDA 5D55A 1BOYA 1JI2A 3AU0A 2IV8A 2OV0A 4IYKA 3MRJA 3TO4B 3QJXA 1XWVA 4DP5X 3JV4B 1EAOA 3LXCA 4K5PA 3PFUA 1HINL 4Z7UF 4TS6A 3SDDD 3FFCE 3GMPA 4L1LA 5DT1L 3TBVA 3HG1E 5AYTA 5CAYB 4LNVA 2VLRE 4ZQTA 1YNKL 5HHMD 3T6VA 1H3VA 5GJSL 3GMRA 2LGNA 3P3YA 4LDCA 3UTTB 1MW3A 1U58B 2EXYD 2FCBA 3AM8A 4PJ5A 3VXSD 4PVBA 1JZGA 4Z3FA 2BS8A 4MMXB 3EFDL 5CLXA 1JZ2A 1KB5L 4JRXE 4E9XA 3QJUB 1WZKA 4S2SB 3ULVE 1KFAH 4JDEA 4LLQA 4R5VA 1GAFL 1A3ZA 1CFNB 3H3PL 2HLFC 3ZO0A 5DEJA 1YNLH 2EABA 1HZHH 1XD1A 4APQB 5DDHB 4JN1H 4NZRL 3AQZA 4Q14A 5CP7B 5CLWA 1OT4A 2Q3XA 2RCSL 3NCWA 1PF3A 5GISH 3FQNB 4K3EH 5DVPA 3V6FA 4Y4HB 1MXDA 4LSPL 4FFWD 1IFGA 1L7TH 3EFFB 4JCMA 3FL7A 5G5DB 4XNYL 2G5BA 2ZNXA 5CILH 2VZ3A 3LHPH 4QRPA 3TIEB 2Y3NA 4NCDA 3NZHH 4FAAB 3U4AA 1E5BA 4DJMA 3MLXH 2AEOA 1O6SA 5EG6C 5TPWL 3DETD 4BFBD 3GHBH 2NTFB 4Z78B 1IZKA 1U95A 3F58L 4ZO8A 3RX9A 2P7TA 2WSPA 5BVPL 4APXB 2EE6A 3H6AA 1CGUA 1EEZB 2A5UA 1ROWA 3A47A 3OKNA 4M7ZB 3V4VA 4OTXL 4F2MB 1OCCB 4J2QA 1GXEA 3GHPA 3SE8H 4L3EE 2A6KB 1BFSA 5I1JH 2OMTB 2WLIB 3CN2A 5GS1B 2I9TA 1HQRB 5ANMB 1FNEB 1GY2A 4BFOA 1MVUB 4P06A 4AW4A 1QLFB 4ZSOA 4L1BA 2JKXA 1OAZL 1CQYA 2YPKB 1RZKC 2R59A 1FA4A 2FUQA 4L3CA 3IN2A 4FTVD 4LF3A 5K9JL 1T1WA 4IOFD 4ZUWB 4UNIA 1YPZB 2BNRA 2NY6C 3WNMA 3KHOA 3QDMA 2D03H 5CEXA 1DCEA 1BYOA 1XHHA 2F61A 5D7LA 2L4OA 3RZCB 4E41D 1U8QA 2NT1A 5LHDA 2ZKWA 4F20A 1FVCB 3GXUB 3WTVA 4FJYA 3JWNC 4FFZL 5DMJB 4IBVA 4F3FB 5D7IB 3NCFB 1A6TB 1F5WA 4OJDH 5DJXA 1BVNP 2I32A 4HJ0D 2QV2A 4NQCD 4QXUH 2FBOJ 4B96A 4CVWA 1HHIB 4XCCL 3MX0B 4UV4H 5L4IA 3C08H 2OXGA 1FRGH 3KD4A 4FADA 2YJQA 5IREA 5SWZD 4P2RA 2I07B 4XMKL 2PKDA 1ODUA 3MSPA 2FT6A 5DO2D 1WQVT 4BBWA 1WA1X 2APWA 1OD9A 5M95B 3D4CA 2E27H 4X5QA 4UTAH 2YZ1A 1PNCA 1JNHB 1O7DE 2Y1AA 3GZKA 5AYQA 3AG4B 1KCRH 3SHSA 1OTUD 3A3YB 4AUJA 1J12A 2VXQL 2ZUUA 4JFEE 2X2HA 1C16B 4I9WD 5T3XH 2Z4QB 3VFWB 3SE6A 2X09A 4L8SB 4UTBH 1JV5B 4XOBA 3Q6GL 1BZOA 2BCMA 3IFNH 4PGCB 5F97E 3FTGA 1FL6B 4DTGL 3SO5A 2EDFA 4PRNA 4J8RB 1D5MA 2OMNA 2PR4L 2Y0SA 3GJFB 3O6FC 1CT8A 1JN6A 3EOBB 2D7TH 3U2JA 3G6AB 4I2XA 3QULA 3UDWA 3SD2A 4G42B 1FC1A 1Z3GH 2VMJA 2JKNA 5IHBA 1AXTL 2BIIA 2R0WL 2Y5TA 4U33A 1OE3A 1MFVA 3O0LA 5C2BH 1RAMA 4GEIA 4UM9D 2P46B 1NC2D 5ISZA 3D33A 3F7QA 1KZYA 1S78C 1PZDA 2WSDA 3QIWC 4XO3A 5FM4A 3RX8A 3ARPA 2IALB 1A1MA 2OXHB 4CDHA 2WSKA 3HC2A 5AZUA 3ETBF 4NFCA 4J3OD 5I15H 5AFAA 3KLDA 1BAFL 2KH2B 2YA1A 1CICA 3DV4B 3T04D 5IKCB 3IRCA 1U3JA 3KJ6L 2MEJB 2R69H 3SY6A 3QCVH 3BZ5A 3GKWH 1F58H 3VQMA 3EH5B 3QFJD 3NEEA 4N3TA 3HE7B 4XO9A 5KOMC 3L16A 4Z3TA 1DE4A 1JWMA 3CXHJ 4X98B 3D30A 5J12B 2X6BA 5C09D 4JG0H 1EZVX 3T2NH 4E2OA 2VLLA 1WC7B 4YPGA 5L4FA 2BSRB 4MCNA 3DOSA 4DOHE 2P5WB 3GSNH 2X5PA 2BZDA 3QP3A 5F88B 5CNHA 3EYVB 2OMWB 3VXTB 3I6SA 1UWYA 2DLHA 2GFBA 4NO0A 3ULVF 5F7KC 2FX8L 2VDNL 5IMOB 3MUGA 2LT9A 3LKPB 4UOW0 4FKHA 4R3SB 4HPOH 1JTTA 5E9DB 5C0BA 5H8DA 4A37A 5A2FA 1QHQA 5KYXB 3LDBC 4YXLH 3V52L 4KTGA 4OZFG 1I1CA 2V4LA 2Y1YA 3JZ7A 5KYWB 4M8VA 4PG2C 5F7NC 1IFRA 3C09C 1XR9A 5T5NG 4NQQA 5DMIH 4HBCH 5I1LA 3OX8A 4I3SL 1MFCH 2P42B 4NBZB 1JK9A 4UWQB 3S48A 2PUQT 5FCUH 1IC0A 3IU4L 5D7JD 5DWPA 4GP4B 3C6SB 3IKCB 1PL3A 3AG2B 2K4WA 1TYEB 4JREB 1BMGA 5ITFB 3GBEA 2IXQB 3WKQA 4DGVL 2X6CA 4OV5A 2OZ4L 1D5MB 4IBYA 1I8MA 4ZMVA 4UB0H 5IQ7L 1T4WA 4ANUA 1NICA 4IGBC 1ETA1 1SUJA 4LLVA 3VXME 4HC1A 4O58H 4UDTA 5C0GA 1AQMA 5DZPA 4ZX6A 4TUOA 5DJ8A 1DQQB 3HE6A 5EH1A 4LIQL 5DMYA 3FOMA 2GJ6A 4XVUD 2WUCH 1C5BL 4G8GE 1UEMA 5E08H 1QNIA 3WFHA 2K3HA 1BFTA 1GW6A 2X10A 2WKGA 2R39A 3STZA 3EUUA 3T6XA 1UXMA 3F7LA 1B4LA 1RUPH 1U42A 1H5BB 3ZTEA 4DO4A 2NY1D 4N8VG 4AM0A 1CTMA 4PRHB 4OZFB 4EE2A 4JHUA 2UYLB 3RIFK 1GY1A 2N7BA 3HN5A 3M07A 5JW3H 3KGRA 3KPPA 3T4YA 3B34A 5PAZA 2AK1H 1G5GA 4IRZL 4JQXA 1DE4B 5C0IA 1EAPA 3IJYA 5IP4A 3PJLA 1MDTA 3GEFA 3LS5H 4FYTA 4EI0A 4FJZA 4PS4L 4JQVC 1BLNB 3IS0X 1XGZA 2UXTA 4HEPA 5HHPA 4X5PA 5C0ND 1RJZA 1J0HA 2W9DH 1TQCB 3ZY7A 2V2TB 5K93A 1AG0A 3BKML 4X8GA 1NLBH 2BH0A 3H0TA 3CFEA 3ZX1A 5F9DC 2GSGA 5EN2A 4FA6A 1KGCE 2ETWA 1ZDQA 1XH2A 1KCUH 1DJZA 3U4BL 3MRBA 1WEJH 3LKRB 2ENPA 1WIOA 3X2QB 4O02A 2A2QT 1OGAD 4AE1A 1DBKL 4TTGA 3RFRA 3JT2A 1CGYA 3RA7H 1IGYA 1A6PA 2OJEB 3CDFA 3SDXE 1KB9J 1YMHB 3EBAA 4JKNA 1LO3H 3GEWB 4H4NA 5KSAC 4OCRL 5D5MB 4N8VB 4OLVL 3WXVH 2MNUA 4BZ2H 3SOBL 4W4OA 5E8OA 4KNQA 4OR1A 3OX8B 4M6OL 4YSUA 3ARFB 1XB8A 5LGHL 2WOBA 3K71A 5TE4H 1KPUB 4Z7QE 5EBLB 2OTWA 4YGAB 4ANXA 2F08A 4HIIB 1OCZB 3K0WA 3B5HA 2ZUXA 4LRNL 2Y7OA 5D6DC 5MEQA 3CFDB 4EKJA 4FG0A 4ES8A 2HLAB 2WMPA 2Z1PA 2WIIB 4WWID 1A64A 5GRXG 4YR6A 3V4PH 1JV2A 4LSVH 3L3HA 4E42B 3AT8A 5AW8B 4GT7A 1H6TA 2XWBA 3VI3E 1P53A 3VCLA 5LAPA 2DI7A 2OMYB 5DVOA 3I2CL 2B5IB 4D9RD 2BO0A 5JR1L 2FBJL 2CXKA 1WFIA 3BUDA 3EOYG 1NUFA 1UWXK 2XI9A 2ZICA 3DNKA 3WELA 4DW2L 5CBAB 1QSFB 5LBSH 4P49A 2ITDA 5KUMA 3T0DA 2YD4A 3BP7A 2FX9H 2F74A 2OCCB 3M17A 1JAEA 4K71C 2E7LA 3STZB 1MLCB 2G2PA 3MBWB 3RDTD 2XWDA 4NQXA 5L4JA 1PFOA 1WZMA 4QOKB 3EDFA 3PPEA 4XH2B 1DO6A 3GSXA 5CUSH 4MJIA 1GCYA 4WW1B 5TDOA 5DI8A 4DK3A 5CR1A 4MA8L 1UQSB 1F42A 3F7KA 4HGMA 3HNVL 4MAYD 2JCCE 2J2ZA 4A7GA 5J6HA 3EDKA 1AQDA 3CTTA 3GUTA 4Y16A 3DROB 3KWTA 1HIMH 5C9JB 4WWKD 1XMEB 2DKSA 2VO5A 4K4KA 4KRNA 4CU6A 1E30A 4RIRA 1MF2L 4WSJA 2XG5A 2CRIA 4D9LH 2YXFA 3FHAA 3M1BB 3ABLB 4DEUA 2R29H 1TJXA 2YD5A 4P57A 4Z77A 3IMUA 2H4EA 1E8YA 2N0MA 3D3VD 1Q72L 3ZHNA 3RVXD 1OAJA 1WT5C 4NNYA 3OXSB 3KPMA 1KGXA 2OP4L 1LMKA 1KN4L 2D3JA 2GITA 4PQXA 4BM7A 2Y7MA 4CU7A 4AGLA 5KOVC 5DD0H 2VLKD 1S5HA 3AS3A 2F2HA 3GMLB 4FNSA 3VXRA 5IB4B 5M94B 3GLEA 3TVMA 3EH2A 3NK4A 5JIIA 2D7OA 4NKDB 1S9KC 1AP2B 4E9QA 2BM3A 1E2WA 4TVPH 4AQOA 1LQBC 3O11A 2HVKB 2GSIA 1AZBA 3CZFA 1ZS8A 5EOQH 2HN7A 3RWDA 2X6VA 2B9BA 1N12A 3K4DA 3T1FB 4NQDD 4KO6A 4HIXH 1X5JA 2ITEA 3RB7A 2HLFD 3ZSSA 3KPRB 3QAZC 5E8OB 2FB4H 5IM7A 5EIIG 1CFVH 4DP4X 3LS4L 2DY2A 4RAVB 1YMMA 3W57A 5JDSA 3PL6A 4Q6IC 2X89D 3ELQA 5C3LD 3IDUA 2G60L 2QQKL 4M43L 1R1CA 2V7NB 3GXIA 4U6HA 2NXYC 2X70B 3ZTNH 4BGLA 5DD5L 3JWDL 4AOFA 5JO5A 1OALA 3KYNB 4FYSA 1U91B 4MCZB 3L3HB 4IDLA 5I30L 5IFHH 4XVOA 3WFBL 1CE6B 3GBML 4YHYC 2DWDA 1OXYA 1GSMA 4QGYA 5FS5A 4BFKA 3WLWC 1D7FA 2WWMC 2QSCH 2VDLL 1KLGA 3WY4A 4TNFA 3GXDA 3LMJL 2JELL 4Z7NF 4OZGE 4UNUA 3HC0B 2R4RL 4U1LB 5T1LD 5ITBH 2EIMB 1A6AA 3SDCB 2C1OA 2F53A 4NQUA 4J27A 4YHOL 4M4RB 3KM2A 3BWAA 1W0YT 4NWUL 1J9QA 3CZUB 4CJ1A 4YXHH 3HHSB 2XTLA 1IM3D 3P0VL 4NQXB 1RP8A 4HD9A 1DQIA 4P2QB 4EQ2A 2YD7A 3FN0L 2PYFA 1TR7A 4FFYL 4M7KH 1OP4A 3PHOB 4HU2A 1MW0A 5HYIA 5J6HB 2ZUVA 5E6YA 4S0TD 5IMMB 4U1IB 3T77B 5EIIB 3RWJB 4FF9A 5T1KA 3QEUB 1DQJA 2W65A 3VDBA 2B4CH 3ARUA 4NQTA 2WM0A 2NY6D 3E8UH 1AO7E 3NT0A 4W70A 2BXZA 4F8NA 1NLDL 5E4OA 3DX3A 3V0WH 3F5WB 4BFJA 2XKNA 2CBQA 4JZNB 3QRLA 3UC0L 3O3EA 4G9FD 2IVFC 3WFEH 1F3DH 2L7JA 2BSSA 4LSSH 3DOHA 3NH7H 1G9NH 4FXKB 2NY3B 2D2OA 2FX7L 1X5ZA 1RMFH 3II3A 3SDXF 4NNYB 4GSDH 1IX2A 2VOTA 4HKXA 5EPMB 3I6KA 5CFHA 1S6NA 3MJ9L 1S7UA 2ESVB 1FV1B 1DBBL 1TFHA 4AT6A 4JFHD 4LCYB 2XKSA 4QHPA 4ZXBC 3VWKB 4XX1G 3BP5A 3GSVA 1DTUA 4AC2A 3HC4H 4Z7QF 4GQZA 2DTML 1UFGA 1M3IA 3ARGC 3FO0H 2MTAA 4NYLB 4RWYH 2DF3A 5HDLA 5HGGS 5C08A 3CC5B 2NY4B 3B5TA 3GJEB 3KLLA 1SDDA 1XGPA 2OMZA 2Y4SA 2V9RA 3ZR5A 3JV6A 4ONHA 5ICYB 1JYWA 2QR0A 4LOEA 1NKGA 4OCMC 3VI3F 3MXWH 4BFGA 5ETUB 5I73C 4GJTB 3TASA 4DWHA 3K6IA 2ZSVB 3KYOA 2YPVL 4HS3A 3CXDL 4J6RH 4LHUG 1NM9A 2P8MB 4PREB 3VXUA 3V5KA 4GRLC 4HUNB 1M57B 2ZIDA 1KTKE 4Y2DC 5K9OB 4AVHA 1LEIA 5T1DL 2KZ1B 3IDNB 5GRJH 4C4KO 4P2CG 4Q2ZB 4PJGE 3O6FD 3UROR 2WWOA 4LHQB 4FP8L 1C7TA 3KVQA 5D1QC 3H4HA 1DVUA 1XGRA 3Q8AA 3CVDA 5T33L 3BWSA 1UM4H 2DDQL 4UILL 3OKDB 1F3JA 2EIEA 3EW3B 1S78D 2JCCF 4PW4A 3C6LA 1J9RA 2W9EH 4JFUA 4PJHF 1T1YA 5HGHB 4HLJA 2J43A 4YH6A 4YNYB 4JRYA 3P1VA 4AEFA 4U2YA 1RXLA 1UB5A 2P24B 5B1JA 3OC8A 1V3MA 1IGIL 4JFDA 2O5ZL 1QNZL 3TS8A 2KZWA 1RFDH 4N9GA 1KOAA 2B1AH 4MXVF 3BZEA 4YX2L 3ZBMA 3CDCA 1MHEA 5GGTA 2FHBA 6FABH 2QPFA 4G3YH 4LHUB 3OR7A 2XXFA 4WJ5B 4EI5B 3TOPA 1I31A 4R7DA 2Z65C 1U6AL 4UUJA 3AB0B 1TU2A 2YD1A 1LHZA 2EDYA 2OSXA 3AT9A 3ZK0A 4AENB 2VN4A 3X1EA 4H5SA 4JL1A 5KJ4A 4DZBA 3T6ZA 2KDYA 1QRND 4NRZB 3UFIA 3MFFB 2GTWA 3I3BA 1JDCA 2JI1A 3WFDH 1M6OA 4YDLB 1IGTA 5LGYA 4A6YL 5DYFA 4AEHH 4M5YL 1A3RL 3D8MA 1T22B 3PP4L 4MKTA 3O9WB 3WNKA 4FERA 1EEYA 4RFEA 4NM8H 2Q1EA 1KB5A 4AT6B 3R19A 5FWQA 4OFYA 5MENA 1R0AH 1DN2A 4GRWH 2B3IA 2HVJA 2EUVA 1AGBA 2HUHA 2Z92B 3FT9A 3PWJB 1VESA 4Y1SA 3CC1A 3CK0L 4NLHA 2R1XA 3DPBA 3N91A 5AOLA 1T04A 4ODHL 3ETBJ 5F7EL 3UZEC 3EIFA 2AK4A 3Q5TA 3V8CA 2Z35B 1TVHB 2VDPL 2QR0B 3U2SB 4W9JC 4DZ8A 4YQXH 3CDGA 1ZOXA 3ZKND 3V5HA 3QQ4B 2CRMA 2X1XR 3QQDA 5AAMA 1HDMA 4Z5RB 3BUYB 1HSBB 2OMXA 3V0VA 3B2XA 3CHRA 4TL4A 1IBFA 1HH9B 43CAA 3Q13A 1W72L 4XMPH 2WN3A 3LQAC 3QEHB 4MD4B 4QXGH 3IRZA 3RE0A 3TTYA 1EFXB 2PXYC 1I8KB 2YARA 4QUOA 1LEKB 4TUUA 4ICXA 4IGBD 4YDMA 4AYBA 4XPAH 1YPZE 4MJ5A 3NVQA 2YLKA 3X3GH 5JUEH 3NEOA 4N9OB 2VM4A 5I5RA 3C5ZC 4YHNB 2O6EA 3TF4A 3N6YA 3ESVF 3MJ8A 4B53A 3CFIC 5HHQA 3G6DL 1MFBH 2G3NA 4OCLC 5D7IE 2IADB 4PTTB 1YEKL 3E1ZA 3U2IA 1ITCA 2AW2A 3FCGA 1F56A 1R3JB 3U6RB 2G0LA 3BSGA 4OKVA 3ME0A 2NW3B 4Q9RL 4JFFB 4OD2B 2ZXGA 3PWLA 3QIBB 1CFQA 4FNPA 2J4WH 3CFUA 2BNQB 3UGUA 3TPKA 1JGVL 5IHWA 1IBZA 5E95B 1KF9B 2DOCA 2UY7A 1MQKL 3G5XB 4WI7A 3SDAB 2EE3A 3BZEB 1AHWC 3ASNB 4FFZA 1S9XA 4QT5B 1FZKA 1QHPA 4KX7A 3S35H 1MFUA 2HT3D 2JB6B 4QHKI 3MLWH 3D07A 3O3UN 3UJJH 1RHFA 2WQWA 1ZT7A 1X9UA 5F7YC 3A4EA 1CYGA 5FKAA 3G6JF 4H7VA 4RAUA 2DD8H 3WEBA 1W0VB 1RUAL 25C8H 2K3TA 2WNWA 3T8MA 4DFHA 1FHNA 3ZE1B 2G2RB 2MH4A 3F7PC 5ALCH 4CVZA 1JZHA 1K6QH 2Q8AH 1Z7JA 3V2AR 1G7QB 1QVOA 1ZLWH 1RL1A 1SBBA 2QELA 4EXKA 1TKWB 4Z1PA 1KIPA 5DSCB 4GINA 2QJDA 1U92B 4TN9A 4M1CC 2RQ8A 2CIIA 2VXQA 4MD5B 2AANA 2XRAL 1XH3A 1A14H 1T4KA 2W0FA 1ZLWK 1N5YH 1I3UA 1AC0A 3AADB 3PFQA 1HEZA 3QZWG 5KSAD 4PJGF 7PCYA 2VMDA 3RWCB 1PNDA 5ICXB 4XAWH 3DV6B 1INQB 1EHKB 1X9LA 1MCNA 2Y06L 1DVYA 1UJ3A 3N1GC 1Y0LA 3O6LH 5JHDA 3C5XA 2UVFA 1HT6A 2CRYA 2J25A 4CVUA 5AVUB 2CPUA 4PY7B 5IHZA 5F7UA 4YHLH 4A7UA 1ETZA 4HS8L 1MCBA 2PP8A 5DQ9A 3SKOB 5K69A 3IT8D 2N7AA 2DM3A 2R23A 1S9YA 5DVKA 4OCYH 1WLHA 3B37A 2FJGA 3APNA 5HYJA 2EH8H 2YXMA 2F68X 2Q7YA 3P4LA 3KL0A 1UCBL 2DWEA 5I24A 2P5WE 4XX5A 3GLAA 1U0QA 4AJVA 3AG3B 1DQML 1MHPH 1Q9KB 2XT1B 2R0ZH 1F4WH 3LZOA 4IDJH 1DDHA 3ULVC 4N24A 2O5XL 1QTYT 3IDMB 4XRCA 3KPSA 4DPAX 4ETYA 2D2CC 3B5GA 4K2UH 2IG2H 4LVOB 3WLBA 2HTKC 4AH2A 5HDQL 2Y22A 1J0JA 1U8CB 1H3PH 2YWZA 3Q6FB 3UCRA 3AU1B 3IGUA 3E2HB 3QZWB 3OLGA 2APFA 5E9DE 2C9RA 2YD8A 1ORSA 3BEVA 4YFLI 4L4VD 5F9WB 4G7VH 3KBFA 5EO1B 5D71L 4HOMA 4P04A 3QW9A 1S9XB 4V11A 1FZKB 2VCOA 2AGJH 2DN7A 1TEGA 3Q0HA 3ZHFA 1A22B 1VFBA 3GZOA 5EZPA 4ERSL 5ACZB 4PTUA 1T6BX 5I1CH 43C9B 2W92A 4FKEA 5J3HC 5I6MA 1G7JB 2V9TA 1UOVA 4LARL 3BVNB 4OGZA 2YEZB 3QXWA 3UTQB 3NZ8B 4JQIH 1BQSA 1NDGA 4LKXA 3UBXG 3Q1SL 5FKAB 2X38A 2KT6A 3PGCB 5ECJE 4ZO7A 2FR4B 4ZD3L 3WKNA 3N43F 3FQRA 4KKCC 3UGXA 2GAZA 3TEZA 2V3DA 2I25N 1PW3A 1UWGL 1GGCL 3PABB 3EG9A 1FG9C 1NBYB 2AXGB 2Z1KA 3V4UL 2LVCA 3MNVA 1FL3A 1ETJA 2AAAA 4U1MB 2RTTA 4N90D 2BWQA 4NRXA 2Y6SC 2I7SA 3WSQH 1JPFB 4AGQA 1JGUL 3IBOA 1VGEH 1Q9WB 3PWUB 2AEPH 1EQWA 5EU6D 1N10A 5HJ3A 1TYRA 1SXCA 2B14A 2X7LB 2BXYA 4OZ4A 1ET8A 4WY7L 5T1MB 2GK0B 2OZ4A 3EF4A 2VKWA 1EAJA 2V17L 1YPZF 3VFOA 1WAAF 3SKNB 2ZOLA 4F15C 2XIBA 4N6RB 5AB0A 2ICES 5CGYC 2H9GA 2X4QB 3OPZL 4PRHE 2ZG1A 1XT5A 3NTCH 2HPTA 3N9GL 1GJIA 2WBJC 2NXYD 2K4AA 1J18A 3UG3A 4XP1H 5GS0H 5D9SB 1KN2H 5D7IF 1NGQL 1UB6A 1R5IA 1UZ8A 4ZO6A 2R2EB 2ZUQC 5IVNA 2GYSA 1Q1JL 1VHPA 3FQ2A 4OF6A 2VDRH 3S2CA 3WLWD 2WWMD 5EZOH 2H1PH 4C4KT 4UBDC 4EOWH 4KZDL 1OWRM 2L7QA 2NY2D 2G5UA 3OSVA 1XCQB 4V1DD 2OL3H 4Y1AD 5D1ZA 4A68A 4EZJA 4GG6B 3SY0B 5EIQA 5AZEH 1T0PB 4TUKH 5E5RB 1MFDL 4XNMA 1O7DC 1ET5A 5DZOA 1X3DA 1HAUA 2W5PA 4XC3L 1NANH 4HETA 5IJKA 3DYOA 4D2NA 4MYPA 3ARTA 4IRZA 4E0RB 1PLGH 5L0QC 1NAKL 3S3DB 3AFLA 1VB9A 1AI1L 1QSED 3Q06A 1U8OB 3WU1A 4WEMB 3ULSA 1T0MB 1H0DA 3SEPA 2VJ8A 3S37L 2EILB 2HFGH 2LTQC 1QSZA 3UX9B 1J8HA 1YEGH 1RLBA 3US9A 1DUYA 3PWPA 3C12A 2JK5A 3N04A 5EF1A 4OSUH 3ML9A 3SKJH 5C0RH 2ZP0T 5F6IB 2FWUA 3BH9A 3I9PA 1MWAA 4HJ1A 2I26N 3RFZB 3AMLA 2EO9A 2X1OA 3S6CA 1FFOB 4WI3A 4F93B 1DVSA 1NDGB 3NA9H 3ZMNA 5C2UB 4X6DB 1V55B 3VFTB 2X1WL 1FNLA 4IKIA 3G08B 5B1BB 1CBVH 4LAQL 4M9OA 3ATDA 4H1LH 2BX5A 1RZGA 4UAOC 1GH7A 2XXCB 4R97C 2R2BB 4EZKA 1VPOH 4YDVA 1JHTB 2ZOOA 3LKOB 4ZXBD 5FM8A 1ET7A 2HFTA 2CCVA 2WLYA 2GBUA 2WIMA 2H26A 4D0CA 3FU5A 1FYHB 1CF8H 1YYLL 1LP9B 1Q0XH 3ARGD 5IVXA 2DWYA 3C5SA 3EYOA 2HX8A 5FW8A 4J3WA 1BAGA 2DMKA 2X4RA 1FZJA 2VKXA 2J56A 4AZUA 4QRRD 2YPLB 3WJJA 3SCMB 2WQSA 4YHML 5CLTA 2AERT 3O4LB 4L4JA 3AAZA 5D2LA 5EZIH 5HJ3B 4GFXA 32C2B 3CUPA 1E9OB 2VR6A 3BDXA 4OZ4B 2EYTB 5JOPE 3UO1H 1R3LA 4QOKE 5FPIA 4JMXA 1NCAH 4GRLD 4RBPH 4G1EB 4NO2A 1NINA 1OGTB 2WYZA 3BAYA 4Y2DD 3DJSA 4YE4L 4KJPC 3OHMB 4DP1X 4O2EA 4HXAH 5BUGA 4C4UA 1OAXL 2C4XA 1KACB 4OFIA 5EUOB 2JKIS 4CN6A 1N4XH 2BNUA 3MV9B 5D1QD 1R5IB 1ZTXE 1RCYA 2ADFL 2HJFA 1E4KA 3VYPA 2GI0A 4XXWC 2ICWB 4I1PA 2KERA 4J1UB 3HB3C 5C07D 1DFXA 2PW1B 3P2TA 3MLYH 4KMTL 3CPUA 5IBLC 1KIRB 1SBSL 2YGNA 4PYHA 3FPXA 1MNUL 4P4KC 4X6CB 1OY3B 2BHUA 4MRCA 1L0YA 3EHBC 3RWHB 4A38A 3GRWH 3L5XL 5LB1A 1TETL 3CZJA 4XNUL 4HMEA 1H8NA 1QFUL 2DQDH 3X17A 2IBGA 4B97A 4UT6A 5EHFA 2CLZA 3OG4B 4PRDA 4L0ZA 2COVD 4YFLF 4AG4H 4WFEE 1HHHB 1WHOA 2VMCA 3OHXA 2P5EE 2ZZUT 4XP4L 1R3IL 3N0PB 1LQSR 1YC8A 3G04A 4L8BA 1AQKH 4OIBA 4NCC1 2CRZA 2AJSL 3IETB 5IQOA 3S36H 3VD4A 2NY7H 3VB8A 2RALA 3ZT5A 4NKMA 4YUEL 5IJCC 2X2JA 3KDPB 3N41F 3QJSB 3KPRE 1DVTA 2C3GA 1F45A 2XZQH 3IJ7A 3ZKXC 2XCMC 1ASPA 5JQHC 4IIZA 1T1XA 4AWJC 1I1FB 4BFFA 3MLSH 4DKFL 3TZVC 1HJBC 4X4MA 3SQOH 3FQWB 3EJQA 4P2OB 2FWOB 3ZDXB 1CPUA 3HZKB 1FCCA 3U36A 2WQAA 1AGFA 5E99H 3US0A 3S88L 2CD0A 3L3IB 4KKRA 4N2CA 4Z3GA 1FSKC 4B3VA 3K80A 4GBXB 4AYGA 3VG9C 2OQJA 4MA1B 3UTZA 2VLJD 3CFCH 3HNSH 3WKPA 4D0CB 1TTAA 3PAZA 5ECGA 3I9IA 2Q2LA 4HUWA 4Q9QL 1E9PA 3W39A 3ZPDA 4GAJH 1IQWL 1SXZA 1PJ9A 3QH3B 4CN4A 2ATAA 5T5NF 4RZKA 3BAXA 4HUKB 3N06B 1RIHL 1BG9A 3C2AH 3X13A 1H3WM 5DQJA 5H94A 3RZWA 4KKAC 4QNPE 1ZVHA 4TNWF 5EDSA 2B8OT 2N01B 3NCYP 4RRPG 4ONGH 3F62A 4CADB 5KYUA 5C70A 2ZJSL 3SDDA 1F97A 2ZOKA 3V0HA 4Y5XB 4JMNA 4JFQB 1B2WL 3PE9A 4YIQA 3VXPA 2A4ZA 1ZVNA 1A4JB 4Z9KB 3LEYH 4OZIF 3IWUA 2DH2A 2UZIH 3VXSA 3EYSL 4D0BA 3R0MA 3KBEA 1URIA 2VAJA 4LVHB 3IXAB 2DKUA 3N0AA 5IOPB 3MA7A 1KY6A 1QO3B 1H8OA 1URZA 3C5ZD 2BSEA 1MI5B 5B3JE 2ADIA 3WE1A 1FVEB 3LZFL 1JERA 1R19A 4EUPG 1G7HB 2WXMA 4UOQA 4IIQA 4AQ1C 3H9SE 4QRQB 4JO2L 1KTRL 3NIDB 6CGTA 3BMWA 3DVFA 3QC5X 2BJMH 4BZ1H 4PJ7B 3X11B 4CVXA 1JNNH 3JTSB 3MRQA 1MW1A 3MOAH 4S1SH 1IEAB 2X12A 3FCTB 3BCFA 2D7PA 4FQCL 5IEKB 1FBIL 2O6CA 1JHLH 3NFNB 4DGWC 3VXNA 4TQEL 2VDKL 4Q6KA 1ZGLM 1FVDA 2XTJE 3SE4C 4D3CH 2E7MA 1OSEA 4CILA 2IAMA 2PPDA 2DQHH 2WO2B 4OBRA 4G6JH 3MJ9A 3LRSB 1P9MC 3LVTA 5JTWA 3HTLX 4KTYA 4NPYA 1M7IA 3LN5A 4H2AA 5JZ7C 4N5UA 5IVZA 4PHZA 2AKRA 3OKMA 3RLSA 2ZCLL 3CFJB 5F0JB 3DA0A 2IQAB 4M1GH 4UYQA 2GUOB 2ZE0A 2NY0C 1LILA 1AIFA 3TBYB 4A7TA 1BPVA 4OLUH 1AZZC 3RTQB 4IRSC 4V2BA 5F89A 1RI8A 2VSKB 4HDIA 4X6BA 4EUPB 4UZUA 1LO0L 1O0VA 4ODXA 1QASA 1WBZA 3RWFA 4LSQL 1E50A 2WQRA 4Y5YA 4E41A 3ARBB 5IG7A 2YPVA 3O8XD 4AYID 1I7UB 2GBVA 5DJ2B 3MLZH 3ZGHA 5CCJA 3ZUNC 1JFQL 3U4KA 5AVZB 1CR9H 2LVEA 4NQCA 3WIHL 4XX1E 5CKAA 1E9QA 1GZPA 1DBMH 1CVRA 2A4EA 3RY5A 1KPRB 4MVBC 4XODA 1J8KA 2Z6FA 1QBML 5BUPA 2GI7A 4LEEA 5DC4B 3MRPA 3TBTB 2DQTL 1I1YB 5SWZA 2YAQA 3OXRA 1KJ2B 3TBSA 2FT7A 5CIPB 1S9VA 4JDVB 3MBXH 4MHHI 1QLEL 5HHMB 1W2KT 2CKBL 2RJMA 3QJHB 3KXFE 3TM6A 4KQ0A 4JG5A 5E9NA 3FCSB 3FFCD 4PP2A 2VJ0A 1BBJA 1PLBA 3C60B 3HG1D 2AJUH 2VLRD 4O00A 5LO7A 3VFUA 3BGMB 1DVFC 1L9SA 3MA9L 2EAEA 3OAWA 5E2UH 4G8FA 2HRPH 5ESAB 3ELAT 4HIEB 3I6GB 4JY5H 1FCGA 3D39D 5DRXA 4ZQKB 5EU7E 2GJJA 1EMTH 2IC2A 4FNQA 1JIBA 4JG1H 5LJYH 4QKTA 2MCPH 3GQFA 3ULVD 1VKXB 4HHWA 4WFFE 3D9AH 4YL9A 4KDTA 1GTFA 3TH4T 2J21A 5BZZA 2JI2A 1JXFA 1XGTA 1R5WA 1SOSA 2HTKD 4G7RB 1F13A 4IBZA 3VD5A 5ILTH 1UD2A 3BXNA 3KR3L 1BD2A 3JV5A 5J13C 2LQRA 4XMXA 4F7EB 4ABUA 2MRYA 3T2OA 4B41A 4UM9A 2PO6A 2FWLB 3P0YL 4HOZA 1NC2A 4IBUA 1ASQA 1XB3A 1FAIH 1VZGA 2VAAA 4TLUA 2WQVA 3OB0K 4Q56A 1PU0A 1D9KB 1WF5A 1H8LA 3KPQB 5I1GL 5J3HD 2KPNA 4HWBH 1OW0C 3FO1A 1IL1A 3REWB 1OM9A 5KS9A 4BDVA 1CLOH 5EULV 5ADPL 3FUHA 5HVHC 3STBA 1EEUA 3O3AB 4KKCD 4ZODA 1F90H 4PJCB 4L3ED 4PCTA 3RPKA 3QFJA 2ICCA 3W38A 3KWXA 5EU3A 2P26A 1CN4A 5DJDA 4NN5B 2KQNA 4XGZB 3KPOB 1UT1A 4FTVB 4Z95H 4UU9A 1NGWA 1D2OA 1ZS2A 4G5ZH 4NPKA 1EZVY 4ODXB 2Y6SD 1EJOL 2R2HA 4L5FL 4JR9L 1W91A 3V7MA 4JVPA 4B9IA 1GMIA 3L45A 5CJXC 3E3QE 1O9VA 3DYMA 3QARA 3WN5C 3VACA 4OM0L 1RHHB 3L8QA 2EO7A 3P9LB 1W72A 3D50A 4AVJA 1CC3A 1QEWA 4YHPB 4LSRL 4BWWA 4WU5B 4NQCB 4A1RA 4QAMB 2R1WA 4KFMA 2R0KH 1DQKA 4L4TA 4DH2A 2RB8A 5CGYD 4IBTA 4JFFE 2GIMA 2O93L 3R4DA 4ZYKB 1F18A 4QRAA 5B3JF 2WBJD 4C8XA 1FJ1A 2XPGB 5B8CC 1ESOA 5HJBA 2BVQA 3HPJA 5I2IA 2KLTA 5E94A 2VR7A 4KKPA 4R26L 4TNVF 3QWRD 4HUUB 4MMYA 1PX8A 4NNXB 1ONQB 4AGOA 4HFWA 1PQZA 2Y9RT 4QMEA 4UBDD 3O3DA 3MC0A 2ZTBA 5CCKL 3AXLB 1A6UL 4G6AC 3KLQA 1BREA 1Z2KA 5FUOL 4YGVB 5GJTH 5DRXB 5EF2A 2G75A 3SGDH 1JRHI 3RGVC 5D7JA 1T89A 4MZIA 1E90A 4NUPA 3ZE1E 1DLHA 3MRIB 2NXZB 4M7LL 1SF5A 4JFED 2FGWH 2J6WA 4M6NH 1LDPL 3HZ3A 2IFFH 4X5XB 4FI8A 4KFZC 1ED3B 4ZG1A 3NZSA 1V7NL 4WZ9A 4HJSA 4OIIL 3BLPX 3I50L 1QYGH 4KJYB 4NO3B 3BH8B 1E5UI 5EZLA 2ZQKA 4HJJL 2G2NA 3H42L 5JHMA 3WFZA 3DBXB 4DGIH 1UYWH 4LEXL 4KH2A 4F7PB 1VDGA 1P4LA 4OZHF 5BZDA 4NSKB 5DZVA 4P9HC 1A7RH 4BH8B 5JIKA 1QTPA 3HZMB 3HUJE 3HZVA 5FWRA 5F2FA 4A6YB 4OCWH 5LXGL 1VERA 2J20A 1EGJL 2XV0A 4XC1H 1UOWA 4NNPL 2IDQA 4U6VL 4WWNA 5E24E 3IU3B 2J44A 3VXQA 1EVTC 1MJUH 4E9TA 3RL2A 2IBZY 4HLEA 3TO4C 1GIGH 2E6PA 4PJFB 1MPAL 3W9DA 4WI5A 1A7QH 3D09A 4OUUA 1VLXA 1R75A 3QQ9C 1KCBA 5DS8A 4JHZA 5IB2A 2VDPB 5LXVA 5EORL 1KLFA 2HPOA 1WCQA 2EECA 4OB5L 5C09B 3FTXA 2MQ0A 4M93C 1MREL 3U82B 5D4IA 2PPFA 3NCJL 4DKEL 5L88L 2BDNL 3FQXA 4KU1A 5FGCE 5L8LB 1A6VL 3O2WH 3S35X 5C0FB 1A8JH 1G6RL 3CLWA 1QI3A 5I16A 5IWLC 2X4SA 4G71B 3DIVA 3S5LA 3WHE0 5F7FA 1INDL 2QLYA 1OAYL 3QIUC 1JYXA 4UDUA 1HOEA 3V6ZA 4B9JA 3KPLB 3MCKA 2R8SH 2DYPB 2O5YH 4H0LC 4KJPD 2D7QA 1LO2H 1OGAA 4OU3A 2PW2A 2A9ML 3ULUH 5TQ2H 4PIBA 1FE8L 3APCA 4TNEA 4Z7OE 3QUZA 3MRFB 1DBAL 2YD9A 5LNDA 3NBNA 1L9NA 4K3GA 2DEXX 4U0RB 1KXVA 1MHCA 3B7TA 2AXJA 4G7SB 1OF0A 3B7SA 4D0DB 1BOGB 2IWFA 5IBLD 2XV6B 3GGWA 2YD2A 1XCTB 4P4KD 3EHBD 1FFPA 2CLVB 3PJSB 3JV0A 4GQRA 4K7FA 3WNLA 4LBEB 4S1RH 5BZXA 2IFGA 5D7JB 4A2DA 1M9WA 3UMTA 2ZYRA 1G7LB 3BYYA 2WKOF 3HI6H 4AV0A 2DMGA 4YLCA 3L7FA 4RCAA 4TXVB 4UT9L 5GS1C 1GCFA 3AVEA 3T3MB 2IH3A 4QRTB 3APDA 2W60B 2E59A 1FO0H 2H3KA 3P30L 3MCLL 2YC1B 5TFSL 4HSAC 5DUMH 3ZL1A 5DLMH 4N5EC 3TEXA 4DFIA 1G9ML 1I3GH 3IFPB 5TTRA 2VSCA 4XNXL 3CSBA 3VXMD 1RJLA 2VDOL 5IQ9A 4J3UA 4M8QB 1J8RA 5BUAA 2XG4A 4QY8B 3ZZLA 4ODVL 4JPIA 4ELDA 5IB5B 1A9BB 5BZDB 1HZKA 3RDTA 2CO7B 4GQPH 5GGVY 4DGUA 1QBLL 3SOTA 4Z0BL 3WDHA 3A6OA 4G8GD 3LD8B 3DIFB 1JD7A 3A23A 2GTZB 4PB9L 4XE0A 2JJTC 4RESB 4Y9FA 2NY1B 5AOMA 4H8QA 2Q10A 3TZVD 5HYEA 3HHMA 2B4CC 5E2VL 3GSUA 3DUUB 1FYTB 1LE9B 35C8H 1ERNA 3IPBA 3NJHA 3OPUA 4XAKE 4XPGH 3ATAA 2XV2A 3FFDA 1F02I 4JPSA 5JW4Q 2WZAA 4IRJA 1QUPA 2PPCA 3FT3B 3HPLB 3FRPG 3T0EC 1D5ZB 4UIKH 4YHZL 1GZHC 4JKMA 1PYWB 3Q3GB 4YDJB 5A2AA 2FVNA 1C08B 4GG6E 3T4AC 2Z31C 4UQ9A 4GMTH 1U8PA 4Q6YA 4R96A 1EHXA 3NPSB 2QMJA 5GHWL 3VSVA 1FNSH 4L05A 2ATKB 4P59L 5I1HH 5DK0B 2VXSL 5L2KB 4KKAD 2K45A 4RQQA 4ZFZB 4TL5A 3B2DC 1SYSA 1PZ2A 2VLKA 4O51B 5TF1L 1KGCD 5K1JA 1N0LB 3I9AA 1NA8A 4NZTL 3RWEB 3AWFA 2W1NA 2NUPA 3U1QA 5J1AB 1OGAB 2C3XA 3D0AA 1PSKL 4HHAB 3MLTA 3BT2H 3QUMH 4FZEL 4QHNB 4L8CB 2Y7NA 3RP1A 3V6BR 1JGIA 2EXWC 4HV8A 3MPCA 4LO9A 5IROA 1S7QB 1B6DA 4NQDA 4UOW1 4KRPB 5J4MA 3D2UA 5EU4B 1GZQA 1QW8A 5AWNL 4XR8C 3ZYIA 5LGJA 4WU7A 2QGBA 1S7TA 2FTAA 4X6DE 3D4ZA 4FLOA 1HK6A 4Y88A 2VDMH 1QABA 4O2FB 1BXUA 3OZ9H 4JM2A 2A73A 3CVHH 3FRPB 1J1OH 5A2IH 4O2CA 1TDQA 1O75A 2HP4A 5MERB 3AY4C 3HUJF 4BQ8A 3LKQB 4QHUA 3MRNB 5I19L 2CDFA 3TT3L 1NSNL 5DHMC 2OCFD 4PWKA 1E6JH 3RBGA 1LP9E 2Z0BA 2WGNB 3F12B 3LQAL 1UTDA 2BOLA 2XN1A 3HG4A 5T1LA 3KCPB 1K72A 4TSCL 1JGEA 2IPTH 2A9NH 2YPLE 1D5BA 4XXDA 4JFXA 3S4SG 1WWCA 4IK6A 3O4LE 4EN3C 4TYUA 5FB8A 1U8KA 4LGRB 3ZR6A 4HPYL 3NRQA 1AE6H 2WBKA 2OCJA 1DN0B 5DC0A 2ALWA 5GIRB 1NBCA 3MRHB 4WUKL 1VJSA 3D7PA 2H1XA 4NFBA 1YA5A 5T5FL 4X8XA 1IFHL 2ICWI 2F7RA 2NY0D 2UX7A 4MAYB 2JI3A 4ETQA 1HESA 4IRSD 5EUOE 3VD0A 1OCWL 2OR7A 3MV9E 4P07A 4PBVC 4QTFA 4WWKB 4X8JB 2X4OB 3TCLB 2CHDA 3C2SA 5ICZB 5MEPA 2N0KA 2VMEA 3CV5A 1OKEA 2QHRL 5DMGD 1H6FA 3CPLB 2NW2A 2ZSWA 2F5AH 1EUTA 1OGSA 3GTNA 3ULUE 4G9FA 2YLHA 3G9VA 2IH1B 3MNWB 4IHOA 2BFVL 2J5LB 4Z3HA 1IAII 5HD8C 5DD3H 5A2CA 4Z7OF 2FYYA 3D3VB 3CFBB 4LCCB 2AJZB 1OHQA 5E00A 4MVBD 5F3BA 2ZP9A 1LD9B 4ZPTA 1YEHL 2EKSA 4ODTL 4JY6A 3RVUC 1T7XA 4XBEH 1YEIH 1MRFH 3EYFB 2VLKB 1H3UA 1ZHNA 4GO8A 3S4SB 5FDWB 1KIQA 3B2VL 4HS6B 4M62H 3BAEH 3KDMB 5GRVL 4IKKA 4MDIB 1IJNA 4HA1A 1MJ7H 12E8L 1L7IH 4JPQA 3KHQA 3STLB 3IEAA 3PHQB 4R6UA 1NC4D 4PP1C 4YLQT 1DVFD 2A1WL 3GI9L 2PABA 3ILEA 3LRGA 4PG9A 5TK4A 4LLMA 1A3LL 4B27A 3FDWA 3LZPA 5KVFE 5AW5B 5J5EA 3VFRB 1HH6A 4MB4A 5JPMA 5KW9L 2HT2D 4U3SB 4UF7C 3JQOB 1G0XA 4L8DA 2Q2EB 3GB7B 2ZUSA 4PGDA 3ZDXE 1H5BC 1WD9A 2BVEA 1BQLL 2VISA 3FB6B 4LQ1A 4E36A 1RU9L 3JWNG 4HD5A 1OB1A 4FNLL 3CN3A 3U1SH 3FUKA 3NFSH 1RZIB 3TLRA 1KG0B 3T65A 2E4TA 2W38A 4MNHB 4OQTL 5KVGE 4YDKL 3TL5A 5HHVL 1I1AC 5EZJA 2IGTA 5CBEA 3GM0A 4ADGA 1XL4A 4OFKA 2J3SA 2WXNA 4I0PA 2I60H 4LBAA 5JIQA 4MA7L 4X42A 4GY4A 4HEMA 1IM3B 1T1ZA 1MVYA 1Y6MR 1ZE3H 3F7VA 1MUJB 1CE1H 3DX8A 1ODAA 3P3SA 3OGCA 1JF6A 4EVNA 3L3JB 1F2XK 3ULVL 4WI0B 3B1UA 1ZLUH 2BWDA 4JPWL 3FZUC 4C55A 3KYMB 2CGRL 4ZAKC 1RK0B 1W16A 3CFQA 4X4YB 2NY6B 5CLYA 5E7FA 4M8UA 3B4NA 3O45B 5BQ7A 3VX1A 1TF4A 1A4BA 1INEL 1ZLUK 2C7UB 1MI5E 2O1AA 5B38A 2BVPB 2ORBL 1ZSHA 1EPFA 4NI3A 5KSVA 5I66B 1QRNA 1AO7D 2WCPA 2X4TA 1VSCA 4D7BA 4XPHH 4F5CE 4GW4A 1RZFL 3NIDE 5HBBA 4KTDL 5FO7B 4FA8A 2SODB 1AKJD 2IWEA 2PWGA 4CMMB 5F3BB 1M7DB 4I9XA 3J07A 1OT1A 4TRPH 1G7IA 4LLUA 1FN4A 4ZPVA 3SE3C 5IGXL 2AZUA 1Z3RA 3BO8A 3HFFA 4GIPD 1IKNC 2GJRA 3KM1A 3IDJA 4JZJA 3TEUA 4OCXH 4UM8B 5IVOA 3RBSA 4P2YA 4C83B 4C56B 1PKQE 2A83B 1VGKA 5FOJA 1D5XA 1M6UA 1SHMA 3MOQA 2OLDA 3HAEA 3GJFK 5ERWA 4G6AD 2OMVA 2GABA 3GTVA 3BI9X 1M42A 2V5YA 2VR3A 3FTSA 1S3RA 2BMKB 3QHTC 2BSBA 3RGVD 4R4NC 4ALAH 4TUJA 3V4VH 3ABZA 3H1ZA 5G4OA 4PI2A 5C0AA 4G59C 4Y2OA 4ZFFB 1NCDL 1YY9C 1JYNA 2GCYB 3I3DA 4NJ9H 4KKNA 3O6FB 2J8HA 4Z7VA 5CJOL 4JHVA 1XSJA 1AOZA 1B9ZA 4N0YL 4F9PC 3BESR 2VC2H 4F9LC 3N2JA 4M6AA 4IGBA 4IKNA 4Y19B 4X7SH 1VFAB 4UV7H 1SEBA 2NNRA 4Z7AA 2E47A 3HS0A 1I3RA 2AZAA 1Z0NA 2GT9A 4R5XA 4AYMC 5A6IA 2Z7ZA 5GGQL 2AVGA 2AXHA 5DHEA 2ZUTA 3QIWB 5E0QA 4N0UE 2DPKA 5EUOF 1DANU 5KBLA 3HIZA 2Y3AA 3II2A 4F5CA 2LW3A 3GIVB 1IAMA 3IAGC 3X3FH 1QQDA 3C5JB 4FQXB 4TLTA 5TGBA 1BM7A 1X5GA 4UI2A 5ESVB 3ULUF 1NCBL 4X80H 1WAEA 1NGPL 3QDHA 2OMUA 5CJ8A 4XVSH 3NJVA 4I5BA 3TO4D 5M7QA 3HZYA 2CJUL 2LFEA 3N3EA 4H88L 3W2DL 3QQ9D 4LDOB 4N2EA 4PLOB 5C0JA 1HN1A 3WIHA 4E9SA 4N8CL 3DVNB 4MMZB 4PWEA 3FONA 1UM5H 1K3ZA 1Z9LA 3U7YL 1M56B 4BWUA 2P44B 3D0VB 3EGSA 1NAMB 3M1OA 3QEQA 1JPTH 2BS71 4IW4C 1KXTA 1IGCL 1UKSA 3DX9B 3PG2A 3TO2A 3WIFB 1YHPA 3PWVA 1HL9A 5DRZB 2CKBA 1VA9A 2C9UA 1YEEH 5DJCB 4H20L 4AQ8C 4I87A 3W56A 2F7IA 3QIUD 4Q9BA 4U4BA 5EO0B 5DWUL 1NBZB 5BV7L 3ECWA 1NGYB 1MZYA 4H8WH 5F3FA 1OP3K 2WLLB 5E70A 3AJ7A 2JXMA 1C5DA 1C12A 4LMQE 2P8PB 3MO1B 3LDBB 2YEQA 1P7KA 2UV3A 4EDWL 1XGQB 4U7MA 3Q2WA 4D8PB 5KN5B 2Y6TE 4LLDB 4UCFA 1AMXA 3PNWB 5DUBA 1IC7H 5CMAB 2WXFA 4BHUA 4KHTH 4HX1A 5IQLA 5GS0C 4TQPA 3ZRSA 3UIYA 2I9LA 4Z7WA 2AABL 3LN4B 3CLFH 2OULB 4HGWB 1Y6KR 3VQ2C 2K8MA 2AQSA 4R7XA 1AHKA 3UC2A 2CMRL 1KBGH 4P5TB 3TV8A 4XVJL 4ZMWA 4TUJB 2KLSA 3WEAA 3RVVC 5E6IA 1G87A 1ZA3B 3N85H 2CIKA 2WZ5A 4POZC 5EV7A 3FQTA 4PJBA 4DVRH 1C8PA 3LNEA 1AC6A 2BFGA 1R6VA 1TQWA 5GZOC 1OAUL 3G5ZA 1DBJH 5AENA 4G8EA 1TT6A 4N5ED 4LLYA 2I5YH 1TIUA 4TTDC 3LPPA 1YNLL 1HZHL 1S7XA 1CDCA 1UZGA 4WUUB 4PSPA 3WNNA 1CGVA 1QFOA 4JN1L 2UZYA 4JHWH 5I6XB 2Y36L 3OAUH 4XP9H 1OOAA 1RUKH 5FA4B 4Z8FL 2AAVA 4K3EL 4F80A 4MDJA 4MNQB 2EIZA 2AXWA 2Q6WA 2ROXA 3FSZA 3ARZA 4FXKC 3VFPA 4QXTB 2NY3C 5FYLE 4FQPA 1UUNA 4I18C 2EVGA 3LHPL 3QT2A 4KY1H 4ZO9A 4QO1A 4G5AA 4HKJA 3NIDF 4AYFA 1X7SA 2HVBA 4EF3A 2LLGA 2DL2A 1JZIA 1JE6A 1R5VB 3VWKC 3GHBL 4NWTH 2PYEB 2VWEE 4PR5A 1GR7A 4GLRH 5FO8A 3D18B 3U7WH 4FMFA 2Z31D 1A6ZB 4FABH 4GUPA 2XTJC 3EGSB 1ANUA 2NY5H 2MSPA 2Y5EA 1ZHLA 4OAWA 1NWPA 3TO2B 4ELMA 3BEWB 5J6SA 4BQ9A 4N0FA 1MEXL 2CKBB 3OJVC 1ZVSA 4NOBA 2N4IA 4XCFH 5TE7H 7FABL 1IQDA 2AVFA 2UZXB 3V0GA 5I1DA 3T8XB 4A2FA 4N0RA 4N2OA 1KEMH 2WBXA 3HC3H 1HE7A 3L3KB 4MX7B 2V2XB 1WZ1H 1E27B 1F8TH 1NIFA 4KUCD 2YMOA 4WI4A 5JXAH 4PJDB 3IDXL 3KWUA 3F7YA 3W1ZA 4ORZC 5DYOA 3GM8A 2D03L 5EIVA 1MFEH 4ISVA 1JBJA 5C97A 5D2NC 2EXWD 2EEXA 1JK8A 3TNNA 5KSAB 4HC1H 5EU6A 3QSKB 4ANWA 4KPHH 4PYGA 3WD5L 3DRTB 3VI4A 3OMIB 2Q76A 4OI8A 3A21A 1KWKA 4GNKB 3F3HA 4Q6IA 2DLIA 5T3ZE 2VYRE 5KVEH 2JKWA 5E23A 3WS3B 5I18H 3QCUH 4UMGA 1D7CA 2Q9OA 5DEFB 2BNRE 1ORQA 2JIXB 1CG9A 5D7LE 1VFMA 2E8ZA 3D69A 3BDYL 5EU5B 5K39A 4YL4A 4EDXB 4ODBD 3OKEB 4GKLA 3GSOA 1MCHA 1IGJB 3D2TA 1EGJA 3PHSA 4HIPA 1DANT 1NIDA 4Y1AA 1J1PL 4CNIA 1KEGL 2JJSA 3ROOA 3LAFA 2Y25A 5H37A 1XD0A 4BCXA 2ZX6A 1KNOB 4N1HB 4NKQB 4WI2A 1QPKA 1G7PA 3BJ91 4AQAB 1MAJA 5DURB 4P2RE 3VRIA 1JWSA 4K71B 3AB0C 1A4KA 4Y2LA 2P5WD 3NG5A 1BP3B 4QRUB 1Q9LA 4XBGB 2ATPB 1TTRA 3EGDB 5EU7C 1KYUA 2VSDA 3BSZL 4JHAL 2D7TL 3BIAX 3ZTJG 2X1PA 1KT2A 4ZTEA 4MTMA 5GGRY 1HL5A 1P4IH 3UAFA 1H3XA 4YDLC 1QAWA 1F4YL 3FHQA 2F54B 4L4VB 3WHXB 3U46B 1SVZA 3RHWK 4F8OA 1RUMH 3GNML 1G6RA 4O02H 4AYFB 4TVUA 1RZ8A 4PSRA 3TA3C 5E9DD 4XXCA 2HFFB 2M8XA 5FKPA 2UWEE 1X6LA 4OJYA 5HD8D 5LDUA 2AJVL 4YBQD 4WFGE 3VW3L 1TZHA 5AOZA 4Z18A 2H0EA 2R69L 4LCVA 1GS8A 4KOCA 3ZHDA 4F7MA 3GKWL 1F58L 1RZJC 3RVUD 3QUXC 1J48A 1WFUA 3WENA 5IW6A 3IS1X 2FJFA 4GQ9L 1E28B 4YSCA 3T3ME 5AOKA 2NT0A 3U0WH 1OSZB 1IAKA 5EB9A 2OJ1A 3GIZL 3DWTA 5J6GA 5E1AA 4XB3A 1J7VR 2MOGA 1TTFA 4PP1D 1N3NB 1D6VL 2NSMA 4YSTA 1V05A 5EC2A 1TCRA 2OPCA 3TNNB 2BCKA 3WKMH 2F1BA 3ZKSD 1FDLH 3FT4B 4HZAA 2FQDA 3QAZB 3B7YA 4UT9A 4AL8H 5ID0A 3R7RA 3QRGL 5IV2B 3D4YA 5D6CA 4HUMB 5EEXA 1ACYH 2D3NA 4HLZH 2JQZA 1FYTE 1CD1B 2NXYB 2Y7LA 3CDZA 1SHXA 1A7NL 4MJHA 1J11A 3SBRA 1FNAA 2EQDA 4J4PA 4MA3A 4PRHD 3QIBC 3U9PL 4YHYB 1RVFL 2IANA 2HYMA 1CI5A 1N2RB 4LQFH 5D8JH 3GSOB 5C07A 1YUHA 2H3XC 3ATBA 2FEJA 2DWXA 2X0WA 1GGYA 3FSOA 4HBCL 4OGYH 4V1DB 4FL4C 3CSFA 1I1AD 1F4XH 1MHHB 3CXFA 3BRFA 3EO1A 5AOJA 1Q0YH 5CZXC 1U3HC 1MCFA 2WLMA 4N2FA 5I1AA 4Z7UA 4JN2B 2BC4B 2OR9L 1DEEB 5L2KE 5SX4I 1S5IL 2CU9A 2A6DA 2CJSA 3K6DA 3CIAA 5JIPA 3MXVL 1MCRA 1DR9A 4ZNCD 2Q20A 3RUGB 1QSEB 5E8EA 2HKHL 1KT2B 3E6FA 1YQVH 2YRBA 4P5MA 4WV1C 1U8HA 4X0KA 4O58L 4X6EA 1YDPA 4ZW7A 4ELKA 1AXIB 3SIKA 3FZUD 5SWSA 5GRUL 1G6RB 3QG7H 3JBG7 1WHPA 1BQUA 3T1WA 4U1HB 4FQHB 4FZ8H 3ZQXA 1RJYA 1W80A 4XOAA 5CZVL 4G9DA 1RUPL 4MQTB 3MLRL 4FEIA 2ZNWA 2VR9A 3ARSA 3MV8B 4GIOA 3FQUA 3CSPA 2BINA 4GKNA 3CX5K 1BQ5A 3ARFD 3V4LA 4NKIL 2CO1A 1BAWA 3MGTB 5JW3L 1RZPA 1A9EB 1N0XH 4OF3A 2P28B 3NEXA 1NUDA 3PRZA 2EICA 4Z76A 2GJ6E 4M7LT 2XFXA 4QTIH 1I7RA 4ZXBB 2HFEA 2Q3ZA 4H26B 3TFKC 4KXBA 5LUMA 5F6HJ 3DX4A 5DK2B 1DO5A 1KTLB 3ARGB 2OKMA 3NJXA 4I77H 4OJEH 3NJGA 4MXQC 4R2GB 1JZ4A 3OF6D 2H1LM 4N0CC 3UZEA 4KX9A 4QRRB 2IGFH 5E2JA 3CFMA 5DZAA 1WH0A 3RVTC 3WEXB 3ZE2E 1MRCL 2F7QA 2ZYHA 1DUZA 3G5VA 4GRLB 4NX0A 4R4ND 1WEJL 1WUNT 3HLAB 2KZBA 4Y2DB 1XGUB 1UVQA 2AQ3A 3U0PB 2MPAH 4HMCA 4CC4C 4DP9X 1JXGA 1YY9D 4F2EA 5JOPD 4QOKD 1GS7A 3HLKA 3JUYA 3LNDA 3QUYA 3R06B 3VG0L 1JZ3A 3RA7L 4P0DA 4LVOC 5D1QB 2V2WA 2JVUA 2VDOB 1ZANH 2XN9A 2ZKMX 4B3EA 3DSNB 1FF5A 5DTFA 3IDYB 5KVDH 4EBQH 3NMEA 4JY4B 1VCBC 1PIGA 2O6PA 1M71A 2W9LA 5T5FA 5TE4L 4F1ZA 1P1VA 1CD8A 3D3VE 3F6IA 4PY8I 4FI6A 4YVUA 4JPKH 3ZGIA 3QQ3B 2GW5A 1SEQH 2YN5A 3RAJH 3V4PL 1P7QB 4LSVL 3ERXA 5FUCC 1EFQA 3ZIYA 2BSDA 2UWEF 2TSBA 3VSTA 4OI9A 3A4AA 7TAAA 1SY6L 1RZQA 3W3BA 1AHWA 4X6EB 4PRPA 4YK4B 1AXSA 3VYNA 5FHAL 5H2BB 4MQSB 1ZT4B 4Z0XB 1MJ8H 4WFED 2HG5A 1SJHA 5LBSL 5LG1A 1MIEH 2P5ED 3S34H 2XZCL 1AVAA 5CHNA 4GI6A 2PWDA 4AY0A 4JVWA 2AMUA 2F7PA 3MRRA 1RIVL 2IO5A 1U8NA 3R4RA 3T3MF 4GS7C 5F0MB 4L1SA 1JVOA 4MZ3A 5IW1B 1NFKA 3LIZL 1DP0A 1JGDA 4PRBB 4KZ0A 1KYAA 3KPRD 3QNYB 4P9HL 4TKWA 2EP6A 1FIEA 1CIUA 1P5UA 4M7JH 2E76C 4U6YA 1M7UA 5D93B 3SE9H 1TQTA 2P5PA 2HWZH 1HIML 1NEZA 2Q86B 2HLEB 1M4KA 1AD0A 3O0RL 3TPUB 1CZ8H 1TZOA 4W1TA 2VLJB 1A1OB 2BY1A 3O8XA 4XVTH 4PJXB 2BLFA 3WE6B 1R47A 1SDYA 2FJHB 4GXVL 5DQDH 4KI1A 1NPNA 1ZWIA 3T2PA 4GG8B 3HI5H 4B50A 1SN5A 5IEHB 5HHXH 1P2CA 3AS0A 1I7TB 1UM6L 5GS0D 3RPIA 1IE5A 2BIOA 2BZCA 3PQYA 1D7DA 3VWJA 3QXDB 1B2YA 3ISYA 1OV8A 2GSMB 4GAYA 4OQTA 8CGTA 1OGPA 2H6UA 4ZZFA 1N5AA 3RVVD 2HMIC 1X7TA 4FQ2L 2FO4A 4P4RA 3MRKA 4POZD 2PXYB 3FFCA 3HFMH 3HG1A 3TC9A 2FSDA 2VLRA 3X12B 4Q8BA 5GZOD 3N55A 3EXJA 1P7HL 3L1FA 1MDAA 4Q0XL 3BPNC 4IHBA 4LEBA 3DX6A 4FXGA 4KTEH 1ES0A 1EZSA 1P0SE 4MAUL 4QI3A 5AVWB 3C5ZB 3I02B 4TTDD 1XSKA 5GGTH 1N64L 8FABA 1M2VB 3TIDB 3ESOA 1IEBB 3FH8A 2VRKA 5TE6L 3JWNE 4JRXA 1M71B 4NAQA 4XPTH 1M3JA 5F6IC 4BKLA 1EK3A 5KEZA 1C7SA 1HINH 2FQEA 3BIKB 1CF1A 2TAAA 5DT1H 1NCWL 5AW2B 1S7RA 3H9SD 1YNKH 2I85A 2NY3D 2BSTB 3HNTL 4B6ZA 5GJSH 4YO0A 3MAWA 3PP3H 3ZLQC 2QSCL 4U49A 1OPOA 1IGML 1UATA 5IOKA 5ALBH 2H32B 1CFSB 3EFDH 4ODWA 3VFVB 1KB5H 1TQVA 4C56E 3VWKD 3GRGA 5DEGA 4HIHA 1OP5H 3F64A 1GAFH 3H3PH 5I17A 1U8JB 3PP3K 5I1IL 1CL7I 4H8HA 1ML0A 1EBPA 2VZOA 4NZRH 4GQQA 4TPRL 4J5VA 4CMHC 2XTJD 1OP5K 3DUSB 3SKMA 4LSPH 4QHLA 1K8IA 5HDBE 3L7EA 4L3EA 2XWJB 3ZHKA 4M7KL 1JD9A 3QUKB 4XNYH 5C0DA 5FK9A 3UBXB 3BUTA 1FL5B 2HXAA 2NZ9D 1ZXKA 4EEEA 4NM4L 3SPVA 2HG0A 4I4WA 4Y19E 3ZE2F 4U6XA 1RSYA 2GJZB 3T08A 1B6UA 2GHWB 2V5TA 2ZPKL 1AKPA 5TPWH 4F33B 1SOQA 3B56A 4HFUL 3F58H 2XA8H 5BVPH 1K4DB 3FT2A 5DD6B 2NR6C 4LL1A 1JHKL 2FATL 4WDIB 5FV2A 3WFEL 4OTXH 3WJLC 5IHUL 1FG2B 2YIHA 3MACL 4NQVA 3IDIA 4FEMA 3RNQA 1HXMB 4B9CA 4M56A 2VTFA 1TTBA 3ULUC 4KNTA 2NMSA 3S97C 5IIEA 3FULA 4KK8C 4OIFA 1CDHA 2LR4A 3RIKA 4A63A 2BP0B 3LV3A 3DMMA 3HRPA 2H5UA 3WNJA 5K1VA 3MBEC 1N9PA 1OAZH 3W81A 1WBYA 3RL1A 3TURA 3UACA 2OYMA 2ODHA 5K9JH 2EH7L 1HHGA 4KJWC 1HE8A 3UYPA 3LNGA 3TNMA 3UG5A 2VL5A 1KELL 1D5IH 4JFZL 3F6LA 4MS6A 4ZOCA 1F6AA 1NFDA 1Z9SB 5L4MA 3KXFD 3MJ7A 4KROC 2JSFA 4R0LA 3RNKA 1OO2A 4FFZH 5FUZL 4WWPA 1AG6A 2PTUA 4LHUD 4DP6X 3D39B 1J05B 8FABB 2Y2TA 4NGHH 4MQXC 3ILPB 2PPAA 4XCCH 3QBTB 2WINB 4PN6A 3V0FA 5JXEC 3D34A 4JFEA 4F37F 1K2DA 2F8VA 4G1MA 5GRJL 2Q8BL 1UOLA 2XPZA 4WFFD 5GSRB 5CEZE 5E2TL 4DK6A 2EUXA 4P2OC 4XNZC 3V0JA 1PDKB 2QFRA 4YEFA 2GVYA 3N40P 1QX1A 1DJGA 5FAAA 1FLTX 3K72B 3VE0A 4H25B 1XGYL 3L2NA 1AJ7L 4PRIB 4GBXC 2C26A 3VXUE 5AUMB 4XZUA 2VXQH 4HH9B 1KC5H 3L54A 3BQUC 3W9EA 1CLVA 4PJ8C 4O9HH 1WDAA 3H9HB 3WUWG 4DO6A 5AD0B 5F7DA 5I74C 2AQNA 3EJZC 3PDOA 4K23L 5D7EA 4DTGH 3B9AA 4MNGA 2GY7B 1QWHA 2QLVB 4QHLB 1I9IL 2OAAA 3KE0A 1I9RH 1OSPL 3VD2A 3QUXD 1Z5YD 5C8JB 4ZOBA 1DSFL 1A4CA 2DI9A 1N59B 4Y5XC 5KSUA 4OT1H 5ENWA 3C8KA 3ES6A 4NQSA 5EUKB 4A7GF 2R0WH 1RSFA 2QKIC 1Z66A 1GGBH 4K7PY 1MCSA 2OW6A 5IB3A 1NCUA 3MV7D 3X1BA 1EFXD 4XN8A 4XNQA 4C4BA 4LVHC 2AV7B 4JRYE 3T6WA 2FEDC 4BK5C 2E7DA 2IGLA 4WUUE 3WS6A 4GSQA 1JF5A 5ADOL 3WJMA 1K4CA 1BAFH 4JFDE 4W6YB 3ZIMA 3CDYA 1KCLA 3NA4A 3KJ4B 4MNQE 3ROLB 5I1KL 2I27N 2QVFB 3I6LE 2XX1A 5GGSY 1OF2B 4S10A 4YDZA 4JHBA 1JVLA 2WBJB 1R0AL 4WNJA 2DAVA 3U4EB 4F7TB 4ZTOL 2ZUQB 3T9WA 1YNTF 2RAMA 3QIBD 1KPVB 5JLZA 2DL9A 2VITA 2WCSA 3WUWB 5A1AA 2VL5B 2JJWA 2PYEE 1MOEA 2F19L 1F6AB 1IB5A 4WEBL 1AGCA 3OKKB 4X6FA 1DZ0A 3FAWA 4TVSa 5FGBC 3DSFL 5CZXD 1U3HD 1K5NA 4K3HA 2IH8A 3GXPA 5H4ZA 3FUJA 3KWWA 4MB1A 1T0NA 2QSTA 4Z7IA 3NABL 4JKKA 2FX8H 2VDNH 4XMPL 5LBGA 5L0QB 4JANB 2QDVA 4Y7MA 2AJ3A 1I4FA 1RPKA 1TVBA 5E03A 2NYKA 4LESA 1LK2B 3TN0B 1XQ4A 2QSQA 1BQHA 3HCVA 3L5WA 2AK4E 3L9RB 4XPAL 3V52H 3X3GL 2LTQB 4EIBA 3RTQC 1I7ZA 3SBPA 4BQBA 4PW9A 5HDBF 3RILA 5IMLB 4HJEA 3QDAA 3NP3A 1QI4A 4L1DA 5CP3A 4I3SH 1MFBL 3OKLA 2LAAA 4KRLB 2FJUB 3QFDA 4IKJA 4X4XB 3QI9C 2VZ1A 3TBBA 3IU4H 2FNBA 2JE8A 4LSTL 1LM8V 1ND0B 3TZVA 4YFDB 5DA4A 4PJAB 1OM3L 2J4WL 3OJDA 1UD5A 2OZ4H 4R97B 5JW4N 2IPKB 3DURB 2VUYA 3K8KA 3OR6A 4HIJB 5IQ7H 3BISA 2H45A 3KH3A 2F18A 4K7PL 3UAJA 1HI6A 1HC1A 4DN4L 1GYWA 4EMZA 1D6EA 3TFKD 1HNGA 4AJ0A 5KSUB 1NKOA 5ENWB 4FNUA 2WCGA 4LIQH 3IFLL 3E8VA 1UUSA 4UQCA 1C5BH 1E4JA 1J86A 1YG9A 2DQFB 3S35L 4MXQD 5IT2L 4OD3L 1F1AA 1AYOA 1YO4A 2VN7A 2YBRA 3CN1A 2Y24A 4PV8A 2DQCH 3C60C 2C1PA 1BYPA 3RY6C 1RK1A 2H6PA 4M48L 25C8L 5F9JA 3GSRA 2FECI 4JK0D 1XF1A 1N6QL 3RVTD 4UIMB 4A2LA 1B3JA 1J87A 1WK0A 3B9KC 3IFOA 3WXWL 1RURL 3ZYZA 1UACL 3GBDA 3KLHC 5J9PB 2DMBA 4OV6F 3GMNA 4WCYL 4KQ4H 3CVBA 1FNHA 4IRZH 4ZMNA 3EOAA 2F54E 1JF1B 5LQBH 2OYPA 2VL4A 3EJSA 2A6IB 2YGQA 4PS4H 1BVLB 1TLMA 1YVLA 1QFWL 1D7BA 2H2SC 3MRGB 3GSWB 5DJZA 2AV1B 3HB3B 4GYBA 4IOIA 5JORA 1Z5LA 1R24B 4PH8A 2V3FA 4E9RA 3BKMH 3SDXA 3O6LL 1LK3L 3BSZA 5DHYA 1T03L 1SVBA 1GHFL 4P4KB 5CCGE 4U3CA 3EHBB 3H7BA 1PAZA 5CU5A 3LSOA 5A16B 4WEEA 1D9KC 1MWAH 4YHLL 4U1KA 3U4BH 1E8WA 4DPBX 4IU3A 1A21A 3QS2A 5EC1B 2H2PC 4LKCA 4K3JL 2EYRB 2NNFA 1QUNA 1DBKH 2DQJL 4OCYL 1KLUA 4AIZA 2CHZA 4LHJB 4GW1B 3VFMA 5C3IA 3SB3A 3BMVA 3ECUA 4HSCX 1XH0A 5JHDE 4NN5C 4OCRH 4L0YA 2YOAA 4DP8X 4OLVH 2X1QA 4GXUN 3U83A 2MHAA 2QPUA 3CWGA 4MXWH 4CJ0A 3VXMB 1CU4L 4KH9A 1MHPL 4U05A 3EO0B 5L2JA 4MZ2A 2VQTA 2AITA 5LGHH 1P9MA 2E0PA 1DLFL 2FSEA 5I0WA 1IV8A 1SQ2N 3RWIB 4EIGB 3KNBA 3P4MA 5B1CA 3FKUS 4G8GB 2WVUA 4LRNH 1BFVL 1VACB 1ZTXL 3ZKXB 5INDB 4XWOC 4ZDHA 2WTPA 3K7UA 1CQKA 5JPNB 5L9DL 2ENJA 3L13A 3OGOE 1HOCA 4EXPX 1S8DB 4LLWA 2X0UA 4LPWA 1VADA 5AZ2L 5HHNB 4IRSA 3SD5A 3AM8C 1OE2A 3ARRA 3F04A 4BK8A 5SX5H 1NL0L 1D3CA 3I2CH 1WCBB 4K9EL 4Z7NB 4GFTB 5JR1H 2VE6A 3VGBA 1FFNB 3QYNA 2JCCA 1FLRL 3VG9B 4OM1L 4XAKD 1OAQH 2AGJL