4LGSB

Ricin a chain bound to camelid nanobody (vhh4)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
QVQLVESGGGLVQAGGSLSLSCAASGGDFSRNAMAWFRQAPGKEREFVASINWTGSGTYYLDSVKGRFTISRDNAKNALYLQMNNLKPEDTAVYYCARSTVFAEITGLAGYQSGSYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
total genus 34
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgsB00
3CK0L 5DK2A 3E8UL 1FFOB 1SVZA 1QBAA 4JFFA 3GKWH 2CLZA 2YUZA 2D7TL 2F5AL 3PXJA 5GGRB 3ZDYE 3DNKA 5CCKL 5LGJB 3DWTA 2AK1H 1J12A 2YS4A 1R24A 4ODXB 1D5ZA 1T7ZA 3QCTL 4XNZC 1QUNA 2Z91A 3PWVB 1XGRB 4U2YA 4UV7L 5EUKB 3T08A 3ET9F 5DZLA 1P2CB 2VDNH 2CLVA 4R7DA 4GAGL 4JFXB 1GH7A 3JTTA 3GMPA 1NUNB 2AJYL 4N5EC 2W0PA 3PWLB 1KFAH 4PJHF 4DKAA 2XQBL 4OKVA 4WIQA 1WUNT 3BVNB 2AK4E 5ALBH 3O4LE 3HPLB 2AK4B 3O4LB 5JMOC 3D18A 3VFVB 5GS0C 3TFKD 4W6YB 4Q9QL 3VXTB 3MLYH 4QWWD 1WQVT 1QBMH 4HUUB 4P9HC 1QPXA 3CSGA 3ARQA 1E4WH 1X5AA 4X5XA 1T1YB 5E8EA 3V7AE 3NPSB 3MCG1 4YHKL 4GKNB 4JANB 3EOAA 2MQCA 3GRWL 2DI8A 3NFSH 3QH3A 4U0RC 3TBVB 5EBLA 5DT1H 4CJ0A 4H1LH 2ZKHH 5H8DA 4G8EB 4OM0H 2Y36L 3H7BB 1M7XA 2VQ1A 4P3WA 4XH2B 5IT2H 1CLZH 1NMCC 1NL0L 3EZJB 1OGAA 1A2YB 5JW5B 1DJSA 4GRLB 2YPLD 1FAIH 1H5BC 4PIRF 4HZLA 3MV7E 4XMLL 4HIJB 2DQGH 3MV7B 5C0CD 3QXUA 3FQRB 1K8IB 5DC9B 1EHNA 4NKDB 3A67H 4NZUH 1HYSC 3UMTA 3Q48A 4K55A 3TP4A 5FYKL 4OCXH 4BZ2H 1VA9A 3O3EB 5HHQB 5IV2B 1OHQA 1HHHB 4KKNA 3NGBB 3WS3A 2VLRD 1GXEA 5IFHL 5HGAA 4TVPL 2NY0B 5KN5A 3N1FC 5A16A 1G6RB 2WLYA 5TDPB 5FYKD 1BGXH 3GI8H 1LO4L 1UWGH 4U1JB 4HH9A 4JKKA 4HJGB 4PGCB 5ICYA 4FOMA 1MI5A 1VFAB 2R0LL 4TVPD 4LLDB 2V5MA 4I3GA 1JK8B 3C60D 5DZOA 1OTTC 3SGKC 1CFNA 3GUTA 1RMFH 3WSQH 3WNOA 5JQ6H 4RFNB 1W8NA 4EOWH 4H0HB 4HUVB 2VABA 5DJ6B 3F12A 1OCWH 1PLGH 2QADB 3MFGB 3O9WD 5LJYH 4L3ED 1JMXA 4WW2B 5IFJB 3FOLA 1RZ8A 5J89A 4GG8A 3DX6A 3VXPB 5ABDE 1FDLH 1W72A 4PJAF 3SCMC 1MHCB 1CICB 4EVNA 1AI1H 1I85A 5J4MA 1A6WH 1OOAA 3X12A 3RWGB 3UBXA 4NKOB 2YRLA 3WFBL 1JPTL 1N3NB 2DAVA 3MA9L 1FH5H 2FHCA 5E9DD 1QOKA 2EDKA 5HD8D 1T7VA 5JDSA 1KIRB 2OCFD 3WCYA 3FB8B 3HNVL 3WIHA 3CU7A 4F7CA 1KBGL 4LHJB 1V3KA 2FWOB 2IMNA 3WHE1 1FFNA 1WICA 2VNCA 1JFQL 2E9IA 1NUDA 4N0FA 2DMKA 5C0GA 2G9HB 4YDLB 2DQHL 4P46D 3FB5A 4CMHC 2AJSH 2ITDA 2RHEA 4GUPA 1DLFL 4TPRH 2OL3B 3S35L 3QWOA 1TFHA 1LEKA 3KXFD 1INEL 4UV4L 3PDOB 4OZFH 2YD3A 2C4XA 4XVTL 1T4KA 2FD6L 5FUCC 2I24N 5IHBA 5E2TL 4QRRE 2ITCA 4TSAH 1HILA 1RJLB 3GMRB 4QRRB 1C5BH 2VH5L 4PBXA 3HI5H 1VFBB 3WFEL 1D9KC 4F57L 3NFPA 3VW3L 2OR9H 3KYKL 3MRLB 1HHKA 1U3HA 3HCVA 2EH7L 3ARGB 1ZHKA 2YXMA 2OQJA 1L6XA 4NKMB 2X4PB 3DYOA 3LPWA 3T1WA 1MLCB 2PO6D 3BQUA 2NYYC 1DEEA 3EDEA 1I1CA 3SKOB 4NT6B 2HFFA 5HHMD 3MLSH 2O61B 1X3DA 1FVCA 2HFTA 4JPVH 4J23A 1DFBH 1F11A 1HSBA 4W81A 2R23A 3BDYL 5K93A 4JFFE 1J1PL 5HVHC 4MJ4A 2J12B 4JFFB 2FGWL 3MZGB 2CLZB 2BVPA 2A9ML 3BP7A 4X6DA 2HLFC 5SWQA 4QHUA 4MJ2A 4NZTH 1MEXH 3PGCA 3B4NA 1R24B 1X5JA 1D5ZB 4R3SA 4BQBA 4HFUH 1TJGL 2WWKO 5L0QC 2C4FT 2Z91B 2F53A 2ZPKL 3OAYH 5T3XH 4M7ZC 1NGPL 2AJVH 2CLVB 3VWKC 2MWCA 2JIXA 2BNRA 2D0FA 1FYHB 3RVUD 3JTTB 3GMPB 5IF0A 1HWGB 1V3JA 5BV7B 1DBJH 3VJ6A 4OKVB 4FABL 1WEJH 4PR5A 1EJ6A 1YNKL 2UVFA 2YA2A 3RGVC 5BRZD 4R8WL 2D4FA 4QHKJ 4Z7VA 5IB4A 3D18B 1D5BA 5GRUH 1J1XL 4XAWH 3V52L 4H26A 2XTLA 1TMCB 1NPUA 3CH1A 3LKRA 4HGWA 1GVIA 3KHOA 4X5XB 5E8EB 3F58H 3R1GL 3EOAB 4XNXH 4KQ4L 3QH3B 2WBKA 4G9FD 3U46A 3S88L 5EBLB 4MAUL 4ETQA 5TF0A 1Z2KA 2VQTA 5CLWA 2VQ1B 1QSFA 1S7XA 3S97C 1OGAE 3P0YL 4P2OA 1WAAF 3H2WA 2AP2A 1OGAB 3T0WA 3CLFH 1O7VA 4M6NL 1JTTA 1MWAA 3KGRA 4S1DD 1K85A 5CIPA 2Z4QA 3PWPA 1WIUA 4HZLB 5E4IA 4OCSH 1DEDA 2ERJC 3RBSA 3MNVA 4L9LA 4FXGA 3O3AA 4HWEH 4UB0H 1R0AL 4NKIH 1N0LA 3WS3B 2ZUVA 2I07A 5HGAB 1U0QA 4PLKD 1LO0H 3AAZA 5A16B 3BIKA 3ZSSA 3SO3C 1I9JL 3BKCH 4HH9B 3WNMA 4PJ8A 2A74A 1NGQH 1MI5E 4QNPE 5ICYB 1L9MA 1INQA 5IHUH 3T09A 1WK0A 2VZSA 1MI5B 1D5IH 3WFZA 3GB7A 3CPLA 4LHUG 5J9PA 4HAGA 1CFNB 1RZ7H 3GUTB 1NMAH 3SQOH 2V9RA 4AG4H 1E4XH 5EZIL 3I02B 3QSKB 3TH3T 4R2GD 4ONOA 1H3WM 2VABB 3F12B 3GSUA 5T1LD 2DIBA 3EYOB 4H0IA 3FOLB 1RZ8B 1SM3L 4GG8B 3DX6B 4UAOB 1W72B 3RRQA 2IBBA 1P7KA 4Y4KC 4HJ0C 5IQ7L 4EVNB 3FQXA 3STBA 1MFEH 3P40A 4GS7C 1PG7H 5F7EL 3X12B 4Z7UA 3UBXB 3CDGA 5I8OL 5EULV 2VDLL 2BY3A 1ADQL 2YA1A 5JDSB 3TVMD 4XP1L 1Q9WA 4F7CB 3TPUA 1ZANL 1EAJA 1ND0A 1X5HA 3CZJA 1OSPH 1FFNB 3CMOH 3EDKA 2DWDA 4Q9RL 3ULUH 4N0FB 1MELA 5C0GB 3FT3A 5FDWA 3FB5B 5LXGH 2ITDB 3GMMA 4GUPB 1CFBA 4ZOCA 2XTJE 2AQ1A 1TJIH 3QWOB 4NKQB 3NABH 3AM8A 1LEKB 1PW3A 2XTJB 5FA4A 4XWOC 3GBML 3KLHC 1CIUA 3O4OB 3NH7L 1T4KB 1S8DA 4IRJC 4D0BB 4JAMA 2W65A 3QCVH 2ITCB 2YBRA 1A8JH 3NA4A 5DD5L 5CZKA 1HILB 5IBTL 4ZNCD 3LSOA 3DXAD 4L4VA 5HVWA 4OV5A 3NFPB 3L9RA 5I1EL 5JZ7C 5TE7L 2HTLC 3VGDA 1HHKB 1U3HB 3HCVB 5DK0A 5CUSL 2DTSA 1GGUA 1ZHKB 5F72S 2N4IA 1JPSL 1KJ3H 2OQJB 4X9GA 1U2CA 2FBJL 4ZS7L 5EBMA 3NCJH 4MD5A 1OAYH 4NOFA 1QTYT 3H7LA 3JWOC 3BQUB 4JPWH 4L8BA 3BSZH 1DEEB 5TFSH 1ZT4A 5I18H 2HFFB 3L5XH 2CDGA 3B9DA 5I75C 5JIIA 1FVCB 1IT9L 1H8NA 5I1GL 4HX1A 4FP8H 4D8PA 1JHKL 5IESL 5KBNC 1CGTA 1F11B 1ZLVK 1HSBB 1LO5B 1XFPA 2R23B 3CD4A 3QUYC 4LLYA 4TRPL 1HKLH 4E41A 3BDBA 5I71C 1OP9A 1T20A 5CILL 5I30H 1AE6H 4JQXA 4X6DE 1E4XI 2BVPB 1XGUA 1OP3K 3BP7B 4X6DB 5SWQB 4QHUB 4K07A 3VXRA 4NQTA 3PGCB 1QSED 4R3SB 1NSNL 1RIUH 2NCMA 3ULVD 4ZODA 2XPGA 2HKFH 4KJQD 2F53E 2F53B 35C8L 3UTOA 2BNRE 5C0DA 2IF7A 4FQLH 2W07A 5FHAL 2B1AH 1IGFL 2BNRB 2JIXB 4DFHA 1F8TH 6FABH 2V2TA 5KSAD 3C08H 1AXTH 1YEIL 5IF0B 2JKXA 3DIFA 1YECL 1R5IA 1T1XA 2ED9A 3IFPA 5DC0A 3N1QC 4K7FA 3VJ6B 1CF8H 5D1XD 4FN0A 5HI3D 4KI1A 4PR5B 3MGTA 4HULB 4N0UA 4DW2L 2Z31A 2OXHA 1HQ4A 4Z7VE 5ECJE 3M17A 4Z7VB 5IB4B 1NKOA 2RFXA 1D5BB 3WFHA 4CKVX 3MJGX 4NO0A 3TBWA 1ZKAA 4H26B 4OLVH 4TUKH 4U6TA 1BX2A 2YPKA 4YO0A 3CH1B 3LKRB 4K2UL 3TN0A 4HGWB 3VFPA 1EEUA 5D2NA 4FZEH 4MAYD 3NTCL 3CZFA 5IFAH 3U46B 2J4WH 2AGJL 3QIWD 3VXSD 5DD6A 1N6VA 4APQC 4S1RL 4ETQB 2YD9A 4NZRH 4WCYL 1QSFE 3JSSA 4ORZC 4B0MM 3V79C 5DRXB 1QSFB 2NQCA 2J88L 3J7HA 3X13A 4YXHL 1S7XB 4AJ0A 4P2OB 2PN5A 3MR9A 1PY4A 3T0ED 1MWAB 3PWPE 2QSCH 5T3ZE 5CIPB 2SEBA 2Z4QB 3PWPB 3OJMB 3TCLA 4HK3N 2BRRL 3UJIH 4HMEA 4GSDH 3MNVB 1KULA 4L9LB 2BSRA 5D70H 4HUXA 2O5XH 4FXGB 3O3AB 4S2SA 3HMXL 1UH4A 1XGQA 2WQRA 3F6IA 5TDOB 2ZZUT 3VI3F 5DFVC 2VDML 3WL9A 3H42H 3EDJA 5J12B 4W4OA 4PGBA 3D3VE 4FFYL 4DKDC 1WBYA 1YJDL 3FL7A 2I07B 3KPRD 4OAWA 1KV3A 3AAZB 1A0QL 4YHNA 1OP5K 3BIKB 3PJSA 1S7WA 1G84A 4J3UA 5I1CL 1UM4H 5L8LB 1WZLA 4P59L 4PJ8B 2A74B 4M6AA 1LP9F 1XGYH 1INQB 3ZYJA 5DD3L 3GB7B 2NX5A 1UWXK 3CPLB 5J9PB 1JE6A 1RI8A 4XP9H 4JZJC 4HPYH 3HUJF 5L2KD 5FM4A 3UJTH 1JYXA 5E24E 3MOAL 3DLQR 3B8SA 3H0TA 3CVIH 4Y4FD 1QLEL 3GSUB 4KY1L 1KXVC 1TENA 5FGSA 1E6OH 4H25A 4QEGA 3FO2A 4NHCH 2DQEL 3JWDL 1P7KB 1HH6A 1MF2L 2P49B 3FQXB 4TSCL 2HMID 4Z7UE 1F4WL 4CUCA 1J10A 2HAZA 4IOFC 4Z7UB 3GNMH 3CDGB 2B0SL 2DQCL 4OFIA 2G60H 3UYRL 5B38G 3OF6D 2KDGA 2OM5A 1JYWA 5KSBF 1G7IA 3GHEL 1Q9WB 3X3GH 4G7YL 3TPUB 1ND0B 3DETC 4IIQA 1YNLH 1XF2A 4OF3A 1YEHH 1I3UA 5GZND 1W0WA 2DWDB 5IUSA 1JYNA 3O81A 3BN3B 5GJSL 4OF0A 5FDWB 2GY7B 2JJSC 1C1EL 2DQUH 3CDFA 15C8H 1BHGA 1T2QL 3GMMB 4I8DA 2B39A 5I17A 3V7MA 5SX5H 1T1ZA 3UPAA 1UB5A 5FA4B 4K8RL 1TCRA 3UDWC 2VDOH 1S8DB 5EORL 4JAMB 4I4WA 1GGCH 1LMKA 4WI7A 1TPXB 2W65B 3QXDB 2P5EA 2YBRB 2FX8L 4AEEA 3LSOB 2AJ3A 4HK0A 1F4XL 4MWFA 2VWEE 4OV5B 4K8RD 3L9RB 1QLFA 3TA3D 3O6LH 5F93C 4OCLC 1A6TA 4GW1A 5DK0B 3HB3D 4XPHL 5JA8B 4K94L 4PV9A 4FQ1L 1RHFA 3D39E 3OHXA 4MD5B 3U36A 4OLYL 3ARUA 1UVQA 5ID1A 2RBLA 1M7DA 3D39B 1QHPA 4L8BB 4Q74A 3CSBA 1P84K 4JRYD 4AQOA 2PTTA 4H8WL 2CDGB 4HX1B 4D8PB 4AMKH 1UCTA 4LSPL 4QT5A 5SX4I 4E41E 1G6RH 4LLYB 1CVRA 1IEBA 4E41B 3P9WB 1Q94B 3NGBC 1T20B 4NOBA 4XHQA 1GGIL 1A1NA 4WFEE 1XGUB 3VXRE 3MXWL 3HE6C 1KELH 2PCPA 1CFVL 2D7QA 3VXRB 4LDLB 4LPWA 4HXBH 3EDDA 3ARFD 4C56D 1BEYH 2XPGB 2ZSVA 1A6UL 3SJVD 5C07A 5CD5C 4M7KL 2VTFA 5C0DB 3VGGA 5FCUL 3F5WA 5TF1L 2L4OA 1HYRC 2V2TB 5DUBA 5IMMA 2X5PA 3DIFB 1HWHB 1R5IB 1RPQA 1T1XB 3IFPB 4K7FB 1NAMA 4RFNC 3MGTB 1YY9D 2Z31B 4OLUL 4C58B 1AJ7L 3S4SG 1HQ4B 4XP6H 4UOW0 4XWGL 5IM7A 1DVFA 3M17B 3AMKA 2RFXB 2L7UA 3INUL 4WW2C 3WFHB 4NO0B 3TBWB 4NQSA 1QPPA 3SKMB 1CICC 1KEGL 1BX2B 1J7VR 1FBIL 2CLRA 2YPKB 3EUUA 3WKML 1FGVL 3ZE0E 4YO0B 5D2NE 4XCCH 4LSTL 4JPKH 5HI4D 3TN0B 3TWCH 3VFPB 5D2NB 1AO7A 3OJVC 3CZFB 3O6ML 1K6QH 5DD6B 4KK8C 2DLEA 2E3VA 2J6EL 1BFVL 3L3GA 3G6DH 4YPGB 1BBDH 4LKXA 2XG4A 1IKNC 4WO4D 3GSWA 3MR9B 4OZ4A 1Q38A 4P0DA 3W2DL 1KB5L 1I9EA 4PRBB 1I9IL 3G5VB 1Z3GL 2SEBB 3MLVL 3NIFF 4ZPTA 3CFIC 1EFQA 1V7NL 2F15A 5E8DH 2B4CC 3DECA 2BSRB 2FECI 2DS4A 2ATKA 4HUXB 4JQIL 5CP3A 4MYWB 3SO5A 3LEYL 5F7YC 5DA0B 5GISH 4PJEF 4S2SB 1BLNA 1XGQB 5HHXH 1RQ5A 1CXKA 4TOYL 3WL9B 4LLWA 1FVEA 2GSGA 4PGBB 3QO1A 1UENA 1WBYB 1VEOA 2A0LD 4ZUTA 4OAWB 4TULL 4YHNB 5KANG 1IAIM 1ZLUK 5CEZL 3GSOA 3PJSB 1HEZA 1S7WB 4QXWA 2O93L 1CN4A 1P84J 2FEEI 3KWWA 1H8OA 4L4JA 1BAFL 4MQSB 4PRNA 3S5LA 4U1MB 1QD0A 2NX5E 3WS6C 5KSVA 3PGFL 2NX5B 1V05A 3AY4A 3GRWA 1I7UA 1A7NL 5IHZA 3RVXC 4WWKA 2AQ2A 1OAXL 1BQLL 5C0CA 4MA8H 4XAKE 2X42A 4FNLH 5IBUB 2OI9B 5M95B 3H0TB 3QA3A 3TO4D 2FX9L 2DKMA 1T5XA 4A6YL 4LOUD 4H25B 3FO2B 2FX7H 5CJQH 3EJYC 2VLRA 4M6OH 1IILE 1HH6B 3NIGF 4ZAKD 3VXQA 5DUPH 4UILL 3NAAH 2NY1B 4L4TA 3BISA 3E6HA 4JFPA 5AYUL 2BNUA 4ONGH 1G7IB 1DL7H 5F7DA 2IEPA 2L0DA 3VDAA 2HJKA 4IIQB 1XF2B 3SDAD 5BV7C 1LEGA 2G5RA 4B7LA 4HCRH 1W0WB 4KDWA 25C8L 1KJMA 3OGOE 4MNQD 3VFTA 2I26N 1AFVH 5I17B 3D5OF 4LQFL 1T1ZB 1UB5B 3O9WA 1JTPA 4L3EA 2ZWLT 4F9PA 5GGTA 3TBSB 2J8UF 3CXHK 1KJ2A 4U3HA 5GS0L 1IC1A 4ZUUB 1TCRB 2W91A 4BH7A 4LGSB 3MACH 4PGEA 4P9HL 4JREB 1T6VN 1GPOL 2P5EE 2JB6B 5JTWA 4I4WB 2GFBA 4OT1L 3HLAA 2P5EB 4YPJA 4JHWH 2F58H 4HIHB 1ORQA 3O3DA 4BSVB 3U0WL 2HP4A 3QR2A 3MGAA 4W6WB 4HLJA 2AJ3B 4HK0B 5E9DA 4MWFB 4LP5A 2O5YH 3VRJA 1MAJA 1QLFB 4R4FH 4RMUA 4BFIA 5I1JL 1RU9H 5T1KA 4I3RL 2X4UA 1A6TB 4GW1B 5D7LD 3V6ZA 3CVHA 2AW2A 2NY7L 3SDDD 1MIMH 4PV9B 1GRWA 5D72L 3QXTA 4KI5E 1CGSH 2HG5A 3OHXB 1ZS8B 3U36B 1UVQB 4LCCA 1UYWL 5ID1B 1M7DB 4HKJA 3RAJH 1NGWA 2J3SA 3WLWD 4PJBA 3L5JA 4PJ9D 4PB0L 2PTTB 5DJYA 3QEUA 2WIIB 3PIQA 4NDMA 3HG1D 2O5ZL 5KVGL 1FPTL 3QEQD 1FO0L 4ALAL 5JIKA 4QT5B 3P0VH 4BKLA 3KXFA 1IEBB 1ETZA 3L1OL 4UDTA 5INDA 2D7MA 5DQDH 1A1NB 1ZVSA 1A3LL 2PCPB 1VPOH 5KVDH 2MMXA 1D5MA 2ZSVB 3GIZH 1HYSD 5C07E 1OAUL 4IDLA 5C07B 3NOIA 4K71C 5IP4A 5DGQA 4ODSL 3X3FL 2ZCKL 1OY3B 3N50A 5HYJE 4M62L 3F5WB 5DUBB 2AJXH 4N9OB 3SBWC 3RFZC 1TNMA 1MIEH 2PO6A 4HC1A 5JOFA 1KF9B 4P3DA 1AQKL 3I3DA 3DTXB 3MODL 1NAMB 1W72H 1OAZL 4HPOL 1J0YA 1G0YR 1BFTA 4DUXA 3C09B 3JV5A 1GYAA 4MD0A 5IM7B 3LVEA 1DVFB 1VFMA 2P8PB 2BVEA 1M1SA 4OTXH 5IQ9A 3OV6A 4U7MA 4YDJA 1OTTD 4XC1L 4ZO7A 5BOPA 4I9WD 1I85C 1FNHA 3H9SD 2FCBA 3D9AL 1AO7E 3F6LA 4XCNA 1AO7B 3GK8H 1IM3A 3U4BL 4DAGH 2CD0A 2WUCH 3O2VH 4TNWF 1FRGL 3L3GB 1SEQH 4X9FA 4LKXB 5GGUA 3IB4A 3CXHJ 3V95A 4P5MB 4ODVL 3GSWB 4JGUA 2DQIH 3QULA 4OZ4B 5ALCL 1C12A 3TT3H 3ARED 4FA8A 4ENEC 5HBBA 4X7DC 4ZPTB 3MLUH 5BRZA 1J18A 3VGHA 1NH6A 5EOTA 2ATKB 12E8L 2HWZH 2XTJC 5ENWA 5JXEA 1DBKH 1NC4D 3IAPA 3O4OC 5E4EB 2VJXA 1VEPA 1BLNB 1U95A 3QBTB 4C54A 5JW4R 2X1XR 4LLWB 1UM6L 2X1QA 1FVEB 2GSGB 5AAMA 3VFGL 4LAQL 3CC5A 3QO1B 1F6LL 1C08A 2IC2A 4UT9L 5EU4A 1U3JA 4YQXL 4G9FA 3GSOB 2DL2A 1HEZB 3I2CH 3RTQA 3HHRB 1U3HC 3KWWB 2DWEA 4PRNB 2WP3T 4YWGH 1MCPH 4D9QD 1VDGA 4F80A 5KSVB 3CJJA 2GJZA 3VXUD 1WGOA 2YPLE 3ARDD 3AS3A 4UT6H 1I7UB 4PTUA 3U1SL 2ZNXA 3BUTA 2V9TA 3BQUC 3W39A 3QO0A 5IKCA 5IHZB 4WWKB 4OFPA 5C0CE 2X4NA 5EO0A 4QRQA 4LVOB 5C0CB 2A6JA 5HVGB 3TH4T 2IPTH 2QTEA 1IM9A 1UZ6F 2ZCLH 4Y2OA 4OCNC 4PJXA 3QA3B 4M9PA 4IRSD 4TSBL 1RIHL 5A2FA 4ZD3L 4BA8A 1T5XB 3RVWD 5LKNA 2VC2H 3S37L 2VLRE 1MFCL 2VLRB 3KG5A 2YRPA 3LN9A 2ARJQ 3QHFL 3VXQB 1I9RL 2ILLA 4M03A 2EXWC 5CZVH 1MREH 5FYKE 1HNFA 2C4FU 4L5FL 5T1DL 3UBXI 5C6TH 3KLAA 4B7IA 4L4TB 3GDBA 4R26H 3E6HB 4JFPB 3MUGA 2BNUB 4OLZL 1HQRA 3BX7C 2LE9A 4TVPE 3LZFH 2VITA 4R9HA 5J3HC 1L0YA 1WISA 4PJGF 5F7DB 2HJKB 3BGFB 4FHBD 4KJWC 5B3JE 2Y7QA 3S96A 4PRHD 2ZCHL 1BOGA 1FGNL 2BC4A 1G9MH 1IRAY 1LEGB 1QKZH 1QA9A 1X9QA 3DBXA 1A9BA 1S3KH 1PEZA 1KJMB 3MJ9H 2VZVA 3VFTB 4OZIF 1G7HA 1KIPB 2BSED 4ZYKA 4NP4L 3L7EA 5T1LA 4L3EE 3JV0A 3O9WB 1NCAH 4L3EB 5TH2A 5LBSH 1KJ2B 4D3CH 4I77L 1X5ZA 2Z8SA 4BH7B 4FXLA 4PGEB 1HHIA 2GFBB 5CWSA 3HLAB 1LE5A 1ORQB 5E9DE 3O3DB 2RAMA 5EG6C 2DLTA 1GHFL 5E9DB 1MWAH 4UINH 3VRJB 3CAFA 2FH6A 3HFMH 4XVUD 3TVMA 3QUXD 4BFIB 5EU7E 5T1KB 2X4UB 2EZ0C 3V6ZB 2H9GA 3CVHB 2ZP0T 3W11D 4KDTA 1U8PA 4JVWA 2FLRT 5F7WC 2HG5B 5HHOD 2YSSA 4LCCB 4PJBE 3Q1SH 4PP2A 1KCVL 4HKJB 1NGWB 5F44A 1IEHA 4PJBB 5BJTA 4P46B 4LNVA 4L9LC 5DJYB 5FEBA 3QEUB 3PIQB 4NDMB 4J1UA 3UTPD 1K4DA 1Y6MR 1SY6H 1PGRB 3FRPG 4FQXC 1ZK9A 3KXFE 4FQCH 4Z0BH 3VD7A 4BKLB 3KXFB 4GMTL 5KS9A 1ETZB 5INDB 4J12A 2WV3A 3LS5H 4KROD 5EO1A 2M8XA 1ZVSB 2MPAH 5BMFH 4OLWL 1XF4A 3ZDYF 2P8LA 2BHZA 1GAFH 2VXTH 3DXAA 2PXYA 2H41A 1D5MB 3ZKND 2V2WA 5F1IA 5D1ZD 3AMLA 3JWNC 3FN3A 4IJ3B 1ZVHA 1F13A 2QHRL 5KTEH 5C0AD 3C5ZA 3FO0H 1B4JH 4P99A 4Y16C 4J2XA 4JR9L 5C6WH 5K59E 2JJUA 2PO6B 1LWRA 5JOFB 4HWZA 2UZYB 5HHME 4P3DB 4S10A 1RURL 3NVQA 5HHMB 3KYNB 4X6FA 3OZ9H 2NMSA 4OJFH 3OAYK 4MD0B 2IPKA 2DQTH 3V9FA 2UVEA 2EC9T 3WBDA 5IQ9B 4YDJB 2UZIH 5F7HA 2BRQA 1JF5A 4H88H 5JW4M 4YR6A 1DBAL 5LCVH 3S36H 4WFGD 4CJ1A 3PWUA 4YX2L 4BYHA 2PW2A 2C5DC 4XTRD 4NJAH 4XCNB 1Z9LA 3DX7A 1GZQA 5GSRA 1UJ3A 3IDGA 3FAWA 1IC4L 5FO8A 5GGUB 5KSAA 5FV1L 2KQNA 5KVFH 4X4MA 3WXVL 5IR1A 3QFJD 3QULB 3S34H 1CDUA 2CRIA 2FJHA 1C12B 1X6NA 5I15L 5D1XA 4LRNL 4YE4H 5BRZE 3UX9B 4RZCA 3V5KA 5BRZB 2FR4A 5BVPH 1X5YA 2EECA 1MCBA 4KZDL 5EOTB 1OD9A 3AM8C 5ENWB 2ZJSL 1JHLL 4FXKA 1NGYA 1NFKA 1U95B 4H20L 1FNSL 3SKJH 4XB8A 2HJLA 4YDKH 5E6ID 1HHJA 3CC5B 5EWIH 5CS7A 4MAYA 4LLVA 1I8MB 1C08B 1H15A 2WANA 4BH8A 4G9FE 1AGBA 3VDBA 2HT4D 3RVVD 1PYWA 2Q86A 4G9FB 5CSGA 1IGTA 5F7UA 1BQHA 5ITFA 2VWEC 3QIWA 5D4QA 3HZVA 1OWRM 5LGHL 3RTQB 1OM3H 2D9QB 1M05A 2DWEB 3DV4A 1IZJA 1RV6X 5DR5H 1JRHH 4IRJD 2GJZB 4K3DL 1VCAA 4PTUB 3CH8A 3W39B 3QO0B 5IKCB 3RNKB 4CDGC 5C0FA 5DHVA 1VFUA 1YQ2A 2X4NB 2YKLL 3JWOL 3O2WL 4QRQB 5EO0B 1DN0A 2A6JB 2BDNH 2NZ9D 4ZO6A 4JKMA 4CDHA 4HXAH 2HTLD 4Z0XA 4PJXE 2IBGA 1IM9B 3HAEG 2IH1A 2BFVH 1EMTH 4PJXB 4JDTL 5MERA 4EEEA 4WW2F 1JZ2A 2HT3C 2VXUH 4JY5L 4G5ZL 1QNZH 5CJXA 3KPRA 3GMNA 1YQVH 2GT9A 5DQJA 2C7UA 5C3LD 3KLAB 5LAXA 4R7NA 1LHZA 3MUGB 3OR6A 1HQRB 1KN2H 4NGHH 5C0RH 2VITB 5D71L 3VRIA 1RFDH 4U05A 4WUUD 2Y7QB 4L1HA 3S96B 4PLNC 1BOGB 1GCFA 3KYOB 5TDNA 2BC4B 3GSNL 1CTNA 1QA9B 3DBXB 3Q6FA 1A9BB 5MP6H 1JGVH 4LSDA 1SJEA 3L95A 2Z31C 2D7PA 2BX5A 4NQCD 1RUKL 4XNYL 5J7CC 1G7HB 4R2GB 1WAAA 3D0VA 4Y4FA 4ZYKB 3L7EB 2FO1A 5T1LB 3RA7H 5BS0D 4F37F 4PRPA 5ELIA 1IC7L 5TH2B 3LKSA 3H8NA 1QG3A 5FA3A 3MROA 4KRMB 4R90H 2HYMA 5GGSA 5HDBE 5C70A 2NXYD 2AI0H 2RB8A 2W9LA 3TN0C 5D2NC 2BVQA 2NXZB 3WDIA 2ED7A 1HHIB 3SE4C 3DSFH 5CWSB 2EDXA 3V0AC 1LE5B 5JQHC 4GQPH 2PKDA 3RU8L 1YNTA 3OF6A 3IKKA 2VR5A 4YBQC 4KPHH 4G3YL 2VERN 3TVMB 2CSPA 2H9GB 3QHTC 1MHHA 1LK3H 1UWEL 4M5ZH 5F9WB 1U8PB 3VMNA 1EEZA 4EDXA 3A6BL 5HYEA 4NO5A 2YSSB 3L3KA 1EAPA 2WIMA 4HS8H 1JGUL 4PP2B 4XMKH 3QZWG 3CFKA 4DGVL 3BIAX 5BJTB 1NCBL 2OMBA 4J1UB 1K4DB 2NY3D 4K3JH 5KS9E 3N85H 4Z7WA 1CT8A 3LMJH 5KS9B 3ZDXE 5EIVA 4ZUVA 5EO1B 5FYLH 1XF3B 3P4OA 1LD9A 1YYMH 2Y06H 1S9YA 3DXAE 1XF4B 5EBWA 5ITBL 2P8LB 3VGAC 2DDQH 3DXAB 1BFOA 2V2WB 5F1IB 4DGYH 1CU4H 1A3RL 3D48R 3DRQA 1AGFA 4JKLA 4P2YA 3DUSA 2VR9A 5HYQA 4Q0XH 4FQIH 4MXWH 4WEUD 3C5ZB 1QFUL 1I7RA 2OTUA 4DWHA 1ACYH 4IDJH 1L0XA 3QRFM 3QG7H 2RCSH 4NJ9L 1N6QL 2EKSA 3MLPA 4HWZB 1CLYL 4KV5E 1HI6A 2VYRE 4K23H 3D25A 4HIEB 3BEVA 4X6FB 4Z8FL 4G6KL 1BJ8A 4HUWA 4KMQA 4ZS6C 1CDIA 3LDBB 2QSVA 4KKAC 2IPKB 1K9TA 5DI8A 3GJFH 1JPFB 3WUWG 1JNLL 1FV1A 3TO2A 5TQ0H 4YHYB 4MX7A 3O2DA 4EI5C 1DQQA 3IDYB 5F9DC 3WO4C 3ULVE 3N06B 1H9VA 3PWUB 1C5CL 2NY1C 1ES0A 3ARFA 4C56A 2PW2B 1IE5A 4RFOH 3B2VH 5JORA 3DX7B 4KUZL 5DUML 4JM4H 1F3RB 3UPRA 5GSRB 1UJ3B 2WW8A 3BPLB 4QGTA 1CGXA 3IDGB 5TGBA 3EOTH 4OB5L 3QIUD 5FO8B 5I74B 4IOIA 4X4ME 3QFDA 5KSAB 1LO2H 3GI9L 5IR1B 4YGVA 2FJHB 3QEHB 3LB6C 5D1XB 4M43H 4YFEA 4RZCB 3V5KB 2BJML 3BWAA 7FABL 2FR4B 4OIIL 4KVNL 1HINL 4FXKB 1IGCH 4WI2A 2BVUA 3FQUA 1ACZA 1MHPL 4JREC 4KK9D 5GSVA 2HJLB 1CLOH 3BGMA 3ZKSD 2VXSL 2BXYA 3BXNA 4MAYB 3ZKMD 5F3HA 4Z6AT 4LLVB 4BH8B 1H15B 2GY5A 3IRZA 5GS2H 1CCZA 1G9EA 5FUZH 1PYWB 2Q86B 2DQDH 3KHQA 1IGTB 1BQHB 5ITFB 3QIWB 5CSBA 3HZVB 3ZKXB 2KZWA 4YHPA 3CLEL 1M05B 3DV4B 5I0DA 3HE7D 4X5WA 5SWZD 4QNPF 4WO4A 5IB2A 4UU9A 3T0EE 1SYVA 4XZUA 4BZYA 3AC0A 4NNXA 3T0EB 2XA8H 5F96L 1AKJD 2A6KA 2D3VA 3NA9H 3KJ6H 1PX4A 2DBLH 3QQ3A 1FLRH 1RJZA 2CGRH 5C0FB 1DN0B 4CADA 4JHZA 2ADIA 1CL7L 2OMNA 4Z0XB 4JO1H 4NWUH 2IH1B 4Z78A 3I75A 4UIKL 5MERB 3VRLE 3X11A 1KB5A 4UTBH 4KU1A 3RZCC 3MRQA 2XIDA 1LILA 2JJTC 4KKCD 3KPRE 3V0WH 4D9LH 1A7RH 5F7NC 3KPRB 3GMNB 2ZG2A 2GT9B 5DQJB 3UO1L 1VSCA 4LLAA 5I8EA 2YC1A 2C7UB 1RZIA 2IGFL 3TC9A 2A2QT 2IPUK 4R7NB 2YEZA 3RWEA 3OR6B 2ZNWA 3ULSA 4ZTPL 3T2QA 3VRIB 4JO3H 1RZKC 1F4HA 3ZL4L 5TDNB 4W68A 1U6AL 3Q6FB 1FFRA 3PHQA 1SJEB 3E3QE 4HJJH 3V4PL 1NJ9A 3L95B 1VGEL 2NY4D 4NM4L 3LIZL 5CFHA 1DVFC 4OCYL 4WV1C 4YBLC 5CD5D 3QJFA 4G6FD 3D0VB 4Y4FB 4UT7H 1N5YH 4PRPB 2W9DH 1YEKL 1X5IA 4BFGA 1G6VK 2GQHA 1J0HA 3CK0H 3E8UH 3LKSB 5FA3B 3MROB 5GGSB 4EN3A 2N1KA 2NY2B 4JFDA 2D7TH 3CIQA 2BVQB 5IVOA 3QCTH 4A6YA 3LD8B 3U9PL 1Z9MA 1YNTB 5DJ0A 2CUIA 1MJ8L 4UV7H 3P9MA 3QQNA 4J3OC 4O2CA 1MHHB 4GAGH 3EDFA 4J6RL 5CP3H 1EEZB 2J7LA 4KAQL 4EDXB 4KTEL 4LNRA 2DTML 1IAOA 1KB9K 2EO9A 4NO5B 2AJYH 2F5BH 4EDWL 4HUNB 1W0YT 3L3KB 4LIQE 5DSCA 3MJ7A 4MNQA 2XQBH 4PBVC 2DQJL 1X5XA 3CFKB 2P8MA 4X4ZA 4DVRL 3MPCA 3C9NB 3VD5A 2OL3L 4WWID 2B4CL 2YWYA 4Z7WE 5E4EC 4QWWC 4Z7WB 1CT8B 4Q9QH 1DR9A 2Q20A 2D03L 4WY7L 4GJTB 2LQRA 3E0GA 4X6EA 4ZUVB 3MOBL 3P4OB 4LGRB 3R0NA 1LD9B 4X6DF 1S9YB 5EBWB 4Y5VC 1TXKA 1BFOB 3BESR 3DRQB 1AGFB 5F6HI 3DUSB 3VXNA 5HYQB 2QQNH 1MRCL 2Y36H 1DQJA 4RMWA 4JKPL 4M8QA 1F3JA 1I7RB 1PD6A 2OTUB 2GJJA 3SDDA 1S9KC 4M5YL 1NL0H 4OF7A 5AAWA 1XGTA 3U7AA 2EKSB 3S9DB 5C2UB 4LVOC 5F1OB 1QVOA 1HI6B 5ADPH 4XMLH 4OCMC 3D25B 4BUHA 1DQML 3HG1A 3BEVB 4HUWB 3QEQA 3GZKA 4LPCA 2C3WA 4Z7VF 5DI8B 2BSSA 1C7SA 5E2VL 2ICWJ 1TITA 1FV1B 3TO2B 3LN5A 3R06A 3RVXD 1S9WA 4MX7B 1DQQB 4PGDA 5CEXA 4C56E 5IFHH 1FO0A 2GITB 1ES0B 1T1WA 3ARFB 4C56B 3SJVE 1IAIH 2Q3AA 4I13B 4HLZH 5JORB 1KCLA 2H8PA 2L7JA 3OWEA 3UPRB 2DICA 3BMWA 4JM2D 4HWBL 2DF3A 5TGBB 3BGFC 2AXHA 5CSZA 3EJYD 2R0LH 2WWMD 3C60C 4IOIB 3U9UA 3QFDB 5ACLA 1KLFA 1H3UA 5DD1L 3MFFA 4LP4A 3RIFK 1DQLL 4YGVB 5BV7L 2AQ3A 5BXFA 1NBZA 2WNGA 3PG2A 2OX5A 4LU5L 4ZUWA 3WHXA 3MCLL 1BZQK 3BWAB 4M48H 3O9WC 3GM0A 4NC1E 5C3TA 4WGVB 1I3VA 2B2XL 4POZC 1EO5A 1SBSH 3SGKA 1S7SA 3FQUB 5CBAA 1NBYA 1OTSD 5ID0B 4F37K 4JY4A 4RGOH 5GSVB 3BGMB 1OVZA 3HZKA 3BXNB 5F3HB 4LRIA 1KB9J 5GGRY 5F9JA 3WFBH 1ITCA 1JPTH 2LU7A 3QHZL 3MA9H 4PUBL 1WCQA 3DMMD 3H3KA 1RY7B 3OKKA 1MCCA 4YHPB 3KDMA 1JMZA 4WI6A 4MZ2A 1U8NA 1UXWA 3HNVH 5SV3A 3SCMA 4X5WB 1UKTA 2CKBA 1KBGH 4WO4B 5IB2B 4UU9B 1SYVB 4XZUB 4NNXB 5T1MA 4XP5H 2A6KB 1MNUL 3MO1A 3QQ3B 1JFQH 4P46C 1RJZB 5E8PA 4K7PL 2DQHH 4CADB 1EGJA 3ARXA 3RX8A 3MC0A 3S6CA 2ADIB 2YRZA 1DLFH 3QCUL 3E6FA 1KPRA 4Z78B 2JCCA 3S35H 3I75B 1NC4A 2EKJA 3RKDD 5I73B 5A2LH 3X11B 1KB5B 1FNEA 1KCSH 3MRQB 1NCTA 4XVTH 3ZO0A 2FD6H 4NUGL 4U1NA 3SE9L 4GXVL 2VISA 5DQ9A 5E2TH 2AJUL 3IJHA 4Z7UF 5I8EB 2YC1B 2VH5H 1RZIB 1CG9A 4WUKL 3WFEH 5JPMA 4F57H 5D5MA 3VW3H 2YEZB 3KYKH 2R29H 3RWEB 2QLVB 4JG0L 2KH2B 2EH7H 3ULSB 3SDCD 5L8KB 3O6KL 3WN5C 3VXUA 3ARDA 2PO6C 3IDJA 3MJ6A 4YGAB 4F7PA 5I6XC 3RWJA 5CGMA 1L0QA 4P5TD 3C6SA 5HYSG 1SYSA 3PHQB 3G9VA 5FYJU 3K1KC 1NJ9B 4Z7NE 3MRCA 1ZLWH 5KVMC 4ERSL 4HS6A 1HDMA 5CD3A 4CVWA 1NEZG 3QJFB 1AXSA 4IRSA 3JZ7A 4YH6A 1U3ZA 5C08D 2R4RL 3BDYH 5GS1B 4JFDE 3QUKA 4EUPA 1T3FA 3BKML 2FGWH 4LSRH 4JFDB 3S37X 4EN3B 3TYFA 1KENL 1NUFA 2A9MH 3MA7A 4F7TA 3VGEA 3MXVL 2DJUA 1TJGH 4A6YB 5D6CA 1A7QL 3B9KC 3U30B 5DJ0B 2YUVA 3AS2A 5K9QI 3B9EA 2E7MA 3P9MB 5DJCA 3RVUC 1NGPH 5D93C 3WIHL 4S0SD 1KCUH 4O2CB 4PRHA 5H94A 3EJZD 5J0BA 3VFUA 4LNRB 1IAOB 5E7BA 4MNQE 4XNZB 4AEIL 5DSCB 3MJ7B 4MNQB 5ALBL 4FABH 5ILTL 4H5SA 4JDVA 2P8MB 3OX8A 1YNKH 1HNGA 1UM5L 1OQXA 5FM5M 4R8WH 1G0DA 4ZOBA 3VWKA 3MLYL 1L7IL 2GK2A 2AJZA 4GMSH 4RRPG 3IFLH 4KC3B 1J1XH 4X6EB 1E4WL 1TZIA 1CQKA 3OMZA 3RGVA 2XRAL 3R1GH 4LSVL 5E2UL 4KQ4H 3SE3C 3S88H 3DV6A 4OM0L 5D7LE 4MAUH 5E0QA 3VXNB 5IT2L 1I3RA 5D7LB 2YZ1A 1DQJB 2FDBP 4M8QB 1F3JB 3MLRL 3RQ3A 3SDDB 4M1CD 3P0YH 1PKQA 4JPIA 3EBAA 1WLHA 4Z76A 5J8OA 3O6FD 2EEBA 3B9VA 4YC2C 1XGTB 3EYUH 4NC2B 4M6NH 4Y1AD 2OS7A 4PJCA 3V4VL 2H1PL 2GK0A 1QVOB 2R2BA 1FZMA 3HG1E 4HAFA 4H1LG 3HAEH 3HG1B 3QEQE 4U1SA 3QQ9D 2QL1A 3QEQB 3TM6A 1FIEA 4U1GB 4KJPD 4MB5A 2BSSB 1Q9KA 3IU3A 1R0AH 3ZLQC 2B5IB 3LN5B 3R06B 4WVRA 1U92A 1S9WB 1CXEA 2P44B 4GRMA 2EE6A 4PLKC 2I9TB 2EYSA 5J1SC 4PGDB 5CEXB 1AXIB 4YBHA 4JFQB 3ZE0F 3CU1A 4UNUA 1FO0B 3AUVA 1T1WB 1BGXL 4M4PA 3GI8L 4GT7A 5B39A 5D1ZA 3BD5A 2HVJA 3HA0A 3JUYA 1HCFX 2H8PB 5C0AA 2WINA 1OTUC 4OI8A 1ZT1A 2XN9A 2VE6A 3BH9A 5CSZB 3U9UB 1A1MA 3LKOA 4Y2DD 3MFFB 1UB6A 3WSQL 4RCAA 2UUDH 5BXFB 1NBZB 1L6ZA 5C0IA 3TZVD 3WHXB 4ZUWB 4R2GC 4XP4L 5EZIH 1M71B 1PLGL 3FMGL 1BD2D 5GRVL 3ZE2E 1IGML 3BP5A 3LH2L 2C3XA 4WHTA 4I9WE 1S7SB 3KPSD 5DEGB 1I1RA 2CXKA 4PRID 5CBAB 3H9SE 1NBYB 4JY4B 3SE8L 1A6WL 2OSLA 1FE8L 5IQ7H 4PY8I 4XPFH 3HZKB 2XZZA 4D94A 1DQDL 3TNNA 5D1QC 5F9JB 5I8OH 4J3XA 4A2MA 5GZOD 4KK5D 2MJWA 2VDLH 3GGWA 3TVMC 4N9GA 1ADQH 2DIAA 1EERB 4XXCC 4XP1H 3PWJA 1U8NB 1U8KA 1UXWB 3SCMB 5F9WC 1V7ML 2CKBB 5KVEL 1PG7X 1NAKL 1ZANH 3QXAA 4BSWA 2HKHL 4TQEL 2V5RA 3Q6GL 2P5WD 5T1MB 4AT6A 5ICZA 3MO1B 4Q9RH 1U91A 5E8PB 5T3ZL 4TPRL 4NC0B 2JCCE 1AR2A 1PJ9A 3E6FB 5A2KH 2EZ0D 4I3SL 1KPRB 2JCCB 1UC6A 3PF2A 1NC4B 3GBMH 4JY6A 1FNEB 1A6ZA 3NH7H 4U6XA 4NCC2 1B2WH 4ZFZA 2VISB 4CMHB 1C5BL 3BPCA 4G6AD 4G8GD 5DQ9B 3IJHB 5DD5H 4PD4K 5IBTH 3CFBA 5D5ME 1PVHA 1CG9B 4FQXD 1P5VA 5JPMB 3HPJA 5D5MB 2ZUTA 1T7YA 2V5TA 4RDQF 4D9QE 5I1EH 3ARBD 5TE7H 5JHDD 4RMQA 5FUCE 4PLJC 3VXUE 4JFHD 5CUSH 2PF6A 4BZ1L 4IRJA 1J87A 5IBLD 3VXUB 1T7WA 3ARDB 3GSVA 2FBJH 4ZS7H 4U4BA 2Y25A 1GJIA 2WWKT 4F7PB 3RWJB 1TZHB 4HGMA 3HC4L 5HYIA 3C6SB 1SYSB 3MLSL 1PEWA 3VFWA 2QJDA 3BJ91 3OPZH 3MRCB 4JPVL 4RQQA 4K7PY 4HS6B 2E9BA 2LVEA 1IT9H 5I1GH 1DFBL 1HDMB 5CD3B 2EC9U 4IRSB 1AXSB 1JHKH 2R1WA 3MLTB 1IAKA 5IESH 3QNZA 5KOVC 4TRPH 3SN6N 4M61A 5D8JL 4N0YL 3QUKB 4EUPB 1T3FB 5CILH 4P2RD 3QPXH 1IGJA 1KGCD 3TYFB 1CDBA 3MZTA 3UTQA 3MA7B 4F7TB 3ULVC 2EDYA 5TPWH 4MNHA 4Q9BA 1NSNH 5ERWA 2V5YA 3P77A 5D6CB 2H32A 1QLRA 1KXTB 3RX7A 35C8H 5DJCB 5EN2B 5I74C 3B2UD 4PRHE 4WUUA 5FHAH 1IGFH 4PRHB 1B9ZA 5H94B 5LQBH 3VFUB 1YEIH 4XPBL 5D1XC 1YECH 4KI5F 5HI3C 3FJTA 5DRWA 5T3XD 2F8OA 4H5SB 5F7MC 4JDVB 4NQCA 3OX8B 4DW2H 4X8JA 2YXFA 5BS0A 3VWKB 1MJJB 5E7FA 4ZSOE 2AJZB 3GSNA 4QRTB 3RIAF 4Y8AA 4P4KD 4ZSOB 6CGTA 2AXGA 3W0WD 1JI2A 4MAYC 4K2UH 5FB8A 5C09D 1TZIB 3FT4A 2XOTA 1JL8A 3RGVB 4NQED 3WEXA 3CDCA 4GXUN 3NTCH 3ARYA 3QIWC 1G7MA 2HH0L 3OXRA 3EYFA 3DV6B 4FMFA 2APFA 2AGJH 4S1RH 4M4RA 5DHVH 4WCYH 1I3RB 3ARTA 4DZBA 4MLSA 1PKQE 3VXMD 3U4EA 3QDJD 4YXHH 1P6FA 2VDRL 1PKQB 4JPIB 1KYOK 2P4AB 3T0EC 4Z76B 3MV8D 2B1HL 4PJCE 5CKAA 4PJCB 3DRTB 2HT2D 4WJ5A 2GK0B 3T1FA 1QRND 1FZMB 3RPKA 4APQA 3NPZB 3UTPE 4KMTH 2BRRH 2FO4A 1WIPA 4LSUL 3N9GH 4PD4J 3GMQA 1HIML 4AQ1B 4XPTL 3HMXH 1AD9A 1Q9KB 5BW7A 2EDNA 2XWBA 2CO7B 5E6ZA 2ICES 3GFUA 4KROB 1WWWX 3G08A 1U92B 2VDMH 3BKYL 5CJXC 1LO0L 2ERJB 2EYSB 4FFYH 4O02L 1JWSA 5L6YL 1A0QH 3DURA 1T22A 3UTZA 5B39B 5D1ZB 4FMKA 2PYED 4YUEL 5C0AE 2HVJB 2WMPA 5I1CH 1FVDA 1PSKL 2BVYA 5C0AB 2WINB 1UEMA 4P59H 5C2BH 1ZT1B 1I8KA 2VE6B 3EFFA 3BH9B 4AH2A 3PQYA 5DD3H 1A1MB 3HR5A 2WSKA 5JW4Q 3LKOB 1UB6B 5JOPD 3SQOL 1J8HD 3C8KA 4HUKB 3K4AA 5DVKA 3ZSTA 5C0IB 5I9QC 3FRUB 4Y4FC 3MOAH 1Q9LA 4Y7MA 1QLEH 1BZ9A 1FIGL 3BP5B 4WHTB 4F7EA 1T80A 2YD7A 4QRUA 2HMIC 3C2AL 3VH8G 3JWDH 4WFGE 2OSLB 1RD6A 1MF2H 4TSCH 5A1AA 3TNNB 1LNUA 2DQCH 3CSYA 4UDUA 3UYRH 2BHUA 5MHSD 4K3EL 4N9GB 3AGVA 5FUOL 1U3YA 3QIUA 1CD1A 4XPGL 1U8KB 4GFTB 5LGKA 1MQKH 4G7YH 1OSPL 1YMMD 4GH7B 3CMOL 1L9NA 5GZNC 3QXAB 1FNLA 5FGBA 4DEPB 4BSWB 3I50L 4YIQA 4AT6B 5GGVL 5ICZB 1U91B 4TTDC 5GJSH 5EUKA 4OI7A 1C1EH 4PJIE 1T2QH 2CDEB 2BCKA 1II4E 4KRPD 4PJIB 2APXA 2OJEA 3PDGA 1N4XL 2BHYA 4BELD 3ULUD 4K8RH 1FYTD 4LVEA 4PB9L 4JY6B 3H3PH 1A6ZB 1GGTA 5E6IB 4U6XB 3PHSA 1E6JL 4JCMA 1VADA 5EORH 4ZFZB 1KYOJ 2AK4A 1OSZA 5MEND 2EDDA 3BPCB 2RGSA 2FX8H 3TA3C 1FAKT 1F4XH 4ELMA 3VGBA 1A6PA 3HPJB 3QWRD 4UI2A 2A77L 4WHDA 3FAXA 4ODWA 3HB3C 2LU4A 2NY5C 3UDWA 3HE7A 2NW2A 5SWZA 2D31A 2E8ZA 1DSFL 4IRJB 4XPHH 4LSSL 1OAYL 4K94H 4JANA 4FQ1H 3GSVB 1UXSA 3BSZL 2MSPA 4OLYH 3MRMA 4KKLD 1AP2A 3EJJX 1FJ1A 3VFWB 3BN9D 5EOQL 4H8WH 4Z5RA 3BIBX 4RQQB 4X9IA 5HI5C 4JFOA 1EPFA 1IAKB 2J1KA 1A2YA 3QNZB 1IMHC 4JVPA 2CK0H 2R15A 2YD6A 4M61B 3VD3A 1JF1A 4HIJA 1IGJB 4RWHA 1GGIH 4NWTL 1J1OL 3FN0L 3MXWH 3ROLA 3UTQB 3ARFC 4CAGA 5I75B 1RIUL 2E6PA 5CJBA 2FZ3A 4P9ML 4EQ3A 4MNHB 4HBQA 1QBLH 4N90E 4WENB 5ERWB 3P77B 5IMKA 2H32B 1QLRB 1HHHA 3BFOA 4WUUE 1KTKE 1KCRL 2F19L 4M7KH 4EI5D 4WUUB 5FCUH 3HE6A 5TF1H 4YHMH 4U1JA 5DRWB 4NQCE 3RZWA 4PJBF 4FQPA 1JGEA 4NQCB 5BS0E 1JBJA 4OLUH 4X8JB 1AJ7H 4YDVA 5BS0B 4XWGH 3INUH 1NCWL 2WBJD 3AXLA 3GSNB 3RL2A 1CDGA 1BF2A 2C9AA 3ZT6A 5DJ8A 2AXGB 5HI4C 2V7NA 1FBIH 3WKMH 4LSTH 5FB8B 3FT4B 1GIGH 3WEXB 4NNPL 4JE4B 2EDTA 1XF1A 1W0VA 5DD0L 4F2MA 5IOPA 1G7MB 1B6UA 3OXRB 3EYFB 5AYQA 2JJVA 3UYPA 3CFEA 4LDOB 3WKNA 4N8VA 3QIBD 1CICA 1TZGL 1BFVH 2AAVA 2J6EH 2ZUUA 5DVOA 4AY0A 4DZBB 4WO4C 3K4ZA 2YD1A 4HMCA 2QSCL 2CPCA 1T0MA 4HZAA 3W2DH 5K59F 1I9IH 3UJIL 3MLVH 3T1FB 1IAMA 4APQB 4UMGA 1V7NH 1JGDA 3WIIL 2FO4B 3BZDA 2NY3B 5EPMA 3GMQB 2FWOA 3LEYH 4BQ9A 5I73C 1IKNA 4LPYA 1ZE3C 1KC5L 1AD9B 2AABL 4JB9L 2XWBB 2G9HA 3G08B 4TOYH 5E70A 1MH5A 1RK0A 3EYVA 1D3CA 4GOSA 1JWSB 4TULH 3DURB 4FFWD 1T22B 3UTZB 4N1CA 5CEZH 4Q6IC 3QQ4A 1FVDB 3GJFK 5ADOL 3RZCD 1BAFH 1T0NA 1I8KB 3EFFB 5MEQA 4AH2B 3PQYB 2M1KA 3PGFH 2R9HC 1BZ7A 3HR5B 4XP9L 1RZKL 3S3PA 4GBXD 3SDYL 2KUTA 1A7NH 1JZ4A 3C8KB 5FM5O 2BMKB 1BQLH 4JO2H 1WTGT 2X4QB 4OZHA 1V3LA 3MRLA 2AKRA 1NAML 3HI1A 4XVJL 3VG0H 1WVZA 3TO4C 5SWSD 1Q9LB 3K81A 4LOUC 4N1EA 2FX9H 1BZ9B 1WBXA 4NHCL 5GS1C 5F70A 4F7EB 4WDIB 4XMPL 5IIEA 4ZAKC 3SKOA 4QRUB 2IAND 2OP4L 2EH8H 3RDTD 3OG4B 2X09A 3G5YA 3T77A 2XT1B 3KPLA 3KPPA 4UILH 2P42B 2R2EA 3U30C 1LNUB 3CSYB 4UDUB 4TUOA 1CIDA 5AYUH 4TTGA 3QIUB 4D0DA 1CD1B 1HOCA 1P4IL 5AWNL 3AU1A 2UWEA 2YPVH 2OZ4H 3SDAC 1TIUA 1FFPA 2PYFB 2ZOLA 5ETUA 5JLZA 2JTDA 4YIQB 5I16A 4LVNC 25C8H 2A9NL 15C8L 4HWBA 1KTLA 4U3XA 3IS1X 4OQTA 4E42A 2BCKB 4L1DA 2OJEB 2Y6SD 3DX9A 4RAUA 5M94B 4PJXF 4P3CL 3RY6C 3TJHD 4LCIL 1PY9A 2VDOL 3V6FB 4Q7DA 5GS0H 1D5XA 3KS0H 5KW9L 4P9HH 1VADB 3IGAA 1NFDA 4OT1H 1OSZB 2X10A 3D69A 5CAYB 1BMGA 1U8JB 1AY1H 4ELME 3U0WH 3V7AG 3DMMA 4UNTA 4ELMB 1BP3B 2IBZY 2MNUA 2VSCA 3MV01 4ODWB 1X4ZA 3LEVL 5SWZE 3ZE1E 5I1JH 4J8RA 3HE7B 4I3RH 3SDDC 2E27L 2NW2B 5EU6A 5SWZB 2D31B 3GEWB 2NY7H 4TYUA 1MCEA 5D72H 4GRLD 4C83A 1UXSB 1AD0A 3FQNA 3WLWC 3MRMB 3U0TA 1UYWH 4O51A 4PJ9C 5DZNA 1AP2B 1FJ1B 5GGVY 3GHBL 4PB0H 5DMIL 4OGXL 4Z5RB 4U1GC 4AMKL 2O5ZH 5KVGH 1FPTH 1REIA 4JFOB 1VGKA 1FO0H 4ALAH 1UACL 3IFNH 2VAAA 2B5IC 1KLGA 1JPST 5IW6A 2J8HA 1JF1B 4D9RD 2EDLA 2VDKH 2RIKA 1KELL 3BP4A 5HDBF 1A3LH 3ROLB 5IEHA 1U8IA 4CU7A 2N7AA 1FL3A 2FZ3B 3IDXH 4LDEB 4LMQI 5FOBA 1XIWD 5IMKB 2P7TA 3IYLW 5JDJA 1OLZA 1OAUH 2IFFL 2ADJA 3M45A 5K9JL 5E08L 3RUGA 4FG6C 3X3FH 2ZCKH 3HI6H 4M62H 3HE6B 1MCOL 1S7TA 2EDJA 4LPTA 4RMTA 2FBOJ 4P5TA 1M4KA 3FHQA 1AQKH 1KPUA 3T65A 4L3CA 4NQUA 3MODH 3UJJL 4DGIL 2NY4B 3K2UL 2DI7A 1JGEB 4HPOH 4PG2C 1Q0YL 2IQ9L 5C08A 4O9HL 4YDVB 5CJOH 1VB9A 2BOCA 2X1PA 4LFHG 3AXLB 3RL2B 1NGXA 3SBWA 4A2LA 5GGTL 1A5FL 1KJ2L 5KS9F 4BQCA 4XC1H 5DJ8B 3MX0A 4JPKL 3Q3GA 3TWCL 3ZDXF 2V7NB 3I02A 1Q0XL 3EYSL 4WNQB 4LRIC 1WV7T 1T2XA 1O0VA 5GRWA 1SVCP 2EIBA 3D9AH 2VKXA 3EYOA 1QR4A 4J7RA 1W0VB 4F2MB 5IOPB 3U4BH 1I1YA 3T0DA 4POZD 3CFEB 2W0FA 4N8VB 1FRGH 4TNVF 4FTVD 2GCYA 1YA5A 3CVHL 1EFXD 4CRPA 4S1SL 3SEPA 2KQMA 4RMRA 3ARSA 4ODVH 2HTKC 3AREC 5ALCH 1T0MB 4W4NA 4OF8A 1Q8MA 1EH9A 4ZMAT 3WJJA 4KV5F 1JGDB 4RRPA 5HDLA 2R1XA 5EPMB 1RHHA 4AIZA 5INCA 1U8QA 3EOBA 2CXGA 1EBPA 4OFYA 2E7CA 4U33A 1P4LA 3CXDL 2H6PA 5E5MA 5F6HJ 1UM6H 3VFGH 3DHMA 4LAQH 3EYVB 1MH5B 1RK0B 1T5WA 4AIOA 3H9ZA 1QACA 1YEEL 2E5EA 2VXQL 3ULVF 4Y88A 4YQXH 1E0OB 1ODAA 3V5DB 4LAJH 3QQ4B 1B0RA 4HIXL 1A22B 3ARGD 1S7RA 4D0BA 1T0NB 1MFDL 4X7SL 1Z0NA 3ARDC 4QTIL 5MEQB 4AK1A 1GC1H 1BZ7B 3WJLC 2CIKA 3U1SH 4Y1AA 4J3SA 4U1IA 3T04D 4OZHE 4HC1L 2WZPD 4MA8L 4OZHB 5FHBL 2AKRB 1MCNA 2D4DA 3HI1B 2PUQT 4IRSC 3UZEA 4CNIA 1CE1L 3RVWC 4GRWE 1RVFL 4TSBH 4ZO8A 1RIHH 5CLTA 1WBXB 4ZD3H 4GRWB 2E8YA 3OJDA 3JV4A 1N5AA 4M6OL 3S37H 2DLFL 5IIEB 2WP3O 1MFCH 5DGRA 3HRPA 5HSFA 3IFOA 3FFCD 2CKNA 3G5YB 1I9RH 3T77B 4L5FH 3KPLB 5T1DH 3KPPB 1LO5A 2R2EB 1F2XK 4ONGL 3SY0A 4TUOB 4KRNA 4JM2B 5DRZA 1XR9A 2FEDC 4D0DB 2UWEE 1HOCB 1MCSA 4OM1L 3AU1B 2UWEB 4Y2DA 1FFPB 2ZCHH 4HCRL 2ZOLB 5ETUB 1U8LA 3CFDA 5JLZB 5I16B 3EYQD 3B9KD 1KTLB 5D6DC 1AFVL 2C1OA 3SGJC 1BD2A 4NSKA 5EC2A 4E42B 5FIEA 2BOBA 3DX9B 4RAUB 1OL0A 3ZTNL 4MCZA 4NN7B 1KUMA 4PRIA 5BQ7A 3VRLF 3MACL 4I77H 1MJUH 1D5XB 4QHKI 1NFDE 4OGAC 3BW9A 2F58L 4JHWL 2HLAB 3IGAB 1NFDB 2CJUL 3D69B 1EK3A 4XVUC 3B43A 3DMMB 3QUXC 2W38A 3QWQB 1GZPA 5DVNA 5EU6E 1FC2D 4J8RB 3W11C 5E6YA 1AHWC 5EU6B 4AL8H 1RIVL 1ZGLA 3L3OA 1YC8A 2P5WA 1X5LA 5T33L 4C83B 4YHOL 2FJFA 1AD0B 3FQNB 1MUJA 3U0TB 4O51B 1NLBL 3NCCB 3ZHLA 5DRXA 4E0RA 1MQ8A 1R3JA 1VGKB 3IU4L 4MA3A 5DWUL 2VAAB 4GMTH 1KLGB 4KROC 5EA0L 5EB9A 5IW6B 3MREA 5GJTL 3WUZA 3BP4B 1VPOL 5KVDL 2HRPL 4G8GA 1DTUA 1MRFH 4EBQH 4MDJA 4OLWH 3ZKNC 5IEHB 1U8IB 1FL3B 3D2UD 5D1ZC 1ZLWK 3MGOA 4FQXA 3TJEL 4OZFA 5FOBB 4U7KA 2P7TB 5TDOA 3ARBA 5JHDA 3RUGE 2QHRH 2ADJB 3V6OC 3VI4E 3RUGB 3D3VA 4HSQA 1UT9A 5BZDA 2VZ3A 1U42A 1S7TB 5TQ2L 5IG7A 2F54A 4P5TB 1P6AB 1KPUB 1RURH 3NZHL 3T65B 4L3CB 4K71B 4LHUD 1OTUD 2R56L 5C08E 3G9AB 5C0BD 3AVEA 1F3DH 5C08B 4CW1B 5HYFA 4Y16A 4KUCD 2BOCB 4Z7WF 1NGXB 5B21A 1DZBA 1FZKA 1H3PL 4P2RA 4NFBA 4WTWA 3Q3GB 4ODBD 4QHLA 1DBAH 4PLOB 4TUJA 4XTRC 4YX2H 1CXHA 2XZAL 1PDKA 3GK8L 5F6IB 1A7OL 1PG7W 3UBXG 5C7XL 1I1YB 3MQIA 4QCIA 4L8DA 1SEQL 2W0FB 4XHJC 3LQAC 2GCYB 1IC4H 3S36X 5TE4L 4DEPC 3WXVH 1A02N 5D1QD 3TESA 3VCLA 3MLUL 4LRNH 1P5UA 3QUML 4R97B 3UTTD 1T83C 1RJYA 2R1XB 5BZWA 1RHHB 4AIZB 5INCB 1FZJA 1U8QB 3EOBB 2Q8AL 4P4KA 2ZJSH 1JHLH 5JNYA 5JUEL 2EDRA 1F5WA 2XNAA 5E6IC 1EXUA 3W0WA 4EXPX 1P4LB 1FNSH 3KYAA 2H6PB 5E5MB 5C09A 1T5WB 2HT4C 4NQEA 3RVVC 1QEWA 2DLHA 3P4MA 2XKNA 4WU5A 1B0RB 2EEDA 1EVUA 5LGHH 2C1PA 3J8F7 2R0KL 1G7LA 1S7RB 2JLLA 1UADC 1URLA 3HTLX 4XBEL 3UC0L 3QDJA 3VXMA 5JXAL 3QXDA 2EXYC 3MV8A 4Y1AE 4K3DH 2CIKB 4H1LB 4ZXBD 4Y1AB 1YYLL 4U1IB 4EJ1C 1Z0MA 5DHXB 1P7QD 5F89A 2NZ9C 3O2WH 4Y5YC 1BIHA 2YKLH 3JWOH 3T8XA 5D96C 1H3GA 3OQ3B 5CINL 4PLJD 4CNIB 4PS4L 1CZ8L 2LVCA 3CMGA 3IS0X 1N0XH 3REVA 3OJDB 3D39A 3TT1L 2H32H 2VXVH 3JV4B 1N5AB 2ZUQC 4GAJL 1B3JA 4LEXL 4JY5H 4G5ZH 2AXFA 2UUDK 4OCWL 5H35A 5E8NB 3IFOB 3O8XD 3AB0B 4MVBD 4FFVD 4WI4A 3F7PC 1RUML 4ZFGL 3BZFA 4QF1A 3ULVL 2NY6C 5J11B 4GXUM 2EDHA 1MRDL 4ZNEA 1Q94A 3SY0B 2A6IA 2XKUA 5DRZB 1XR9B 4O5LL 4X4XA 1BWWA 2JF1A 1SEBA 5BOZG 3HN3A 1QKZL 4Y2DB 1U8LB 2FHBA 5GHWL 3CFDB 1J8HA 9CGTA 4LQ1A 5FYJH 4LCWD 3BMVA 3GM8A 3T0BA 1BD2E 3UZVB 5DLML 2C1OB 4YHLL 1BD2B 1RUKH 4M7LT 4NSKB 4XNYH 3GBNL 5EC2B 4KHXL 4KK6D 4PY8J 2BOBB 3MRGA 4UTAL 2FIKA 4MCYA 4PRIE 4MCZB 1IC7H 1TNNA 2NXYC 3ILQD 5I1IH 4PRIB 5BQ7B 1ED3A 4WFFD 2ATPA 1MAML 1UZ8A 1TVHA 5I1DA 2I25N 3MV11 3BW9B 1MCWM 3MUZ1 2R39A 4FRWA 4XPAH 4K9EC 2IBZX 4ELKB 3RU8H 2ZUSA 4PJ5D 5GRXG 3SDXA 2DD8L 4JEGB 4DCQA 1N26A 2P48B 2MKWA 3F7RA 3SKMA 1GZPB 4G3YH 3IRPX 1QSFD 1GSMA 1YMMA 1MCDA 4IRZL 4J4PD 4GKOA 2P5WE 1ZGLB 3SE4A 3L3OB 4B50A 2P5WB 4CVZB 4RAVA 3PP4L 2FJFB 1MUJB 1NCUA 5LWYL 3V8OA 3IDUA 2LABA 1JGUH 5GGQL 3K4DA 4WHYG 1N7ML 1Z9SA 4DGVH 4QKXB 2NY3C 4YPGA 1NCBH 1NFIA 4E0RB 4Z7NF 4PJ7A 1R3JB 4MA3B 5BW7C 1K3ZA 1FYTA 4OGZA 1C7TA 3G5VA 4PRBA 3FO1A 3MREB 3VGFA 1OLLA 3KR3H 4G8GE 1GAFL 5MENA 4G8GB 4MDJB 5ITBH 2A1WL 4M7JL 1ZWIA 3MGOB 4FQXB 4U6HA 4OZFB 3QWRA 5JHDE 1YEGL 1A3RH 5FYKU 1NCCH 5C0NC 5HDQL 1R6VA 3ARBB 4BSJA 4JFHE 5JHDB 4PJ8D 1B4JL 1NLDH 4PJDE 1CR9L 2C3GA 1QFUH 3UROR 3D3VB 3OKYA 4LSQL 5BZDB 1R3LA 3X17A 2F54E 4NJ9H 1N6QH 5IG7B 2F54B 2FL5A 1T21A 5I8CB 1CLYH 5EC1A 2VUOA 1KACB 1A21A 1MCKA 1NUGA 3GJEA 4U1MA 4Z8FH 2ESVD 1HCVA 4G6KH 3F7QA 4WEBL 1GGYA 4Y16B 5SX4H 1BVLA 2UZIL 4P2RE 1KGCE 3RY4A 1JNLH 1FZKB 5HTSA 4P2RB 4Q97A 3KAAA 1F02I 1JPGA 2NPLX 3GSQA 2EDBA 1Z9OA 3NMEA 4QHLB 5CEYA 2AXJA 4TUJB 1C5CH 4NJAL 5CBEA 1X5FA 3ZHDA 4BM7A 4ZO9A 2R8SH 4XX1G 3TIDA 1MFBL 4KUZH 1OAKL 3QIUC 4QCIB 4L8DB 2R0WL 2Y5EA 4EI5A 5C8JA 1BQSA 4OB5H 5KVFL 3VE0A 5DJ2A 5FGBC 4KTDH 3GI9H 4RSVA 5EZOL 5T3XE 4LKCA 4YE4L 5DJZA 4XCFL 1ZEAL 3VCLB 2MCPH 4LIQL 2AEWA 5I1HL 2DL9A 2BJMH 1RJYB 5BZWB 7FABH 1FZJB 2P24B 4OIIH 4P4KB 3RBGA 1HINH 3W0WE 5JNYB 3SKJL 4KK9C 2XNAB 2FB4H 3NCFB 1EXUB 1MHPH 3W0WB 2B20A 5C09E 3ZKMC 2V5SA 5E94A 4TTDD 5C09B 2VRAA 2VXSH 4NQEE 5T5NF 3NCEB 4XNUL 1ZMYA 3BDXA 4NQEB 1QEWB 1RULL 1FL5A 4L4VD 3K8MA 3P4MB 2XKNB 5F88B 4RGND 1JZ7A 4G8FA 4RA0C 3TBSA 5B4MD 4ZG1A 1O5DT 2VLMD 1OM3L 4J3TA 3VA2C 4RBPH 4ZUUA 4WU5B 5I8KL 4XNQA 3HE7C 2VSDA 2ADGA 2C1PB 3CLEH 3VXME 3QDJE 1G7LB 1YEJH 5EOCL 1JRHL 2JB6A 2ADFL 3MV8E 3VXMB 2NY5L 3QDJB 4CVUA 4HHAA 1JN6A 4I2XA 5EUOA 3MV8B 4HIHA 4BSVA 3EW3B 4KRLB 5F96H 4OLEA 5F89B 1B88A 5EZJA 2CR6A 4HXAL 3W5NA 3T8XB 3DGCR 2VDQL 1CL7H 1EMTL 4UIKH 1ZS8A 1J0IA 3ZE2F 4FQJL 3REVB 4KKCC 3LQMA 1IGIL 2IG2L 3A6CL 4F9LC 2IAMD 3O2DL 4BQ6A 1OF2A 2WIIA 1CGUA 1EUTA 2AXFB 5H35B 3VXRD 4JHBA 3VWJC 4WRLA 4ZTOH 1NMBH 4LLMA 3BZFB 4QF1B 5HI5D 3UO1H 4ZNEE 1UJTA 4LK4A 2IGFH 1CGYA 3WD5H 1F42A 5HPOA 4MMXC 2A6IB 3B5HA 4OUUA 4MS8D 3RZCA 4X4XB 2JJTA 4ODTL 2X1OA 4ZTPH 1SEBB 4OFDA 5DMGD 4JKWA 5JOPE 5KZCD 1J8HE 5E95B 1J8HB 2AEPL 3PXHA 5A2IH 1U6AH 4JG1L 2NY4C 5DHYA 3V4PH 1R3HA 4DZ8A 1VGEH 2Z0BA 4NM4H 5SWSA 3LIZH 2E7BA 1EEQA 3MLWL 4U1LA 2NTFA 1DN2A 3LKPA 5HYJA 2JCCF 3MRGB 2QSQA 2FIKB 4MCYB 4R90L 3QXVA 5HHPB 3VG9C 1EHLL 2IANA 1ED3B 3DTXA 5JHLH 3RDTA 2ATPB 1UZ8B 4KKBC 4QHNA 1TVHB 4WTZA 5I1DB 2ICWA 2EYTA 4WV1A 3JVGA 2P8PA 5MHSE 3BYTA 3SDXE 4R0LA 1KEML 3U9PH 4O58L 2PNDA 4XCEB 3SDXB 1WJ3A 4IMKA 4DCQB 5D7SL 5D5MF 1DLHA 3PV6A 1QHOA 4YXKL 4ONHA 3UZQA 2YZ8A 3W9DB 4X7FC 1YMME 3DVIA 1N6UA 2R2CA 1YMMB 2HFEA 4HH8A 3FCTA 4KAQH 1S78C 4RAVB 2FATL 2DTMH 3MRRA 4EDWH 5J13B 4Z77A 2KKQA 4KZEL 3I6KA 4PJ7E 1QFOA 4DVRH 1A9EA 1NFIB 4KRPB 4PJ7B 4GW4A 1A3QA 1JNNL 2OL3H 4LLQA 3ULUE 2B4CH 1MJ7H 4P5MA 1FYTE 1JTOA 3T3ME 1JZ6A 2V17L 1FYTB 2D03H 4WY7H 5IMLA 2OTPA 3QEGL 5DEZA 3FO1B 4NO2A 4MLIA 2Y06L 5MENE 3MOBH 4G6ML 3DVNA 5CZXD 1CL7I 5MENB 2PW1A 2HFGH 2GYSA 3LOWA 1ZWIB 4U6HB 5AZ2L 4MXWL 2MOVA 5KAQF 5FYLD 3BGAA 4JQVA 3P2TA 1MRCH 4S1QL 4JKPH 2MCG1 3FO9A 5L9DH 5AZEH 4M5YH 3DUUA 3G5ZB 1R3LB 2HN7A 5I19L 2CUHA 3BRFA 4Y5VA 3VGAB 3I6LD 4H8WC 2FL5B 1MPAL 1T21B 2IADA 1I8IA 2XY2A 1S5IL 5EC1B 1PZ5A 4HBCL 3GJEB 4MA7L 1DQMH 3WE6A 3TBYA 4P5KA 2WUBL 5IBUG 1T89C 1BVLB 1G9NC 2YPLA 2R9HD 1ZXQA 5CMAA 5E2VH 1ROWA 1BBJA 3AROA 3QUZD 1JPGB 3BYYA 4DUWA 3GSQB 3STLA 3CCHA 5CEYB 5HGHA 1J11A 3NCMA 5CBEB 3MBXL 1F90L 1OGTB 1SQ2N 1XIWA 3S3JA 1CXFA 4JM2C 2DOCA 3TIDB 3B5GA 3DI3B 1TCMA 4RDQG 5GIRA 2WWMC 1DUYA 4EI5B 5C8JB 3WXWL 3SGDI 3L3JA 3WO4B 3VE0B 4UBDD 5DJ2B 4NZDA 3VDCA 5F7LB 4L8SC 4OFVA 4LKCB 3V2AR 4M7LL 5DJZB 5BV7H 4PJCF 4LU5H 3V4UL 3MCLH 4LPUA 3Q0HA 2ED8A 4KQ3L 5HHVL 1AH1A 4Z7QE 3C60A 3EO9L 4NN7C 4OD1L 2B2XH 3IJSA 1OTSC 3VMPA 1LK2A 2M26A 1Z5LA 4MJ6A 5M7QA 3QI9D 3PNWA 3LQZA 5E94B 5GGSY 1KIPA 1BFSA 1CBVL 2P47B 3Q5TA 1RZJH 2DQDL 5GRYA 1FL5B 4HQQL 3DMMC 4G8FB 4M1DL 3QHZH 4PUBH 1T03H 2ICCA 4HMDA 5EFIA 1JNJA 4JRXD 3B9AA 4NQXA 2QQLL 4XNQB 2ADGB 1L7TL 4KXZH 4FTVA 4I2XE 5EUOE 1EFXA 5GS2D 4HHAB 5J06A 4I18C 1JN6B 4I2XB 4M00A 5EUOB 4C4KO 3U48A 3NA9L 3KJ6L 4KI5D 4MNGA 4X7TA 1MNUH 5EZJB 1P1ZA 4K7PH 1OARL 2DM4A 5I2IA 7CGTA 3RKDC 3QCUH 5ESQA 4EIZC 1XR8A 3HNTH 4UTBL 1ZSDA 3MOQA 4S0TD 1IBGL 3MLZL 1BECA 3UXFA 4XI5C 3V0WL 2QHLA 5JR1H 4P46A 4QXGH 3QAZC 1OF2B 3MJ8B 5F9OH 4MSWA 4NUGH 1WT5C 4C59B 2LV4A 4F8TA 3SE9H 4GXVH 3LRGA 4JZOA 2AJUH 4HW6A 5A3ID 4LLMB 3S35X 4WUKH 3M8OL 3IF1A 1MCQA 4OUUB 3SDCC 3RZCB 4JO3L 5B3NA 1KIQA 2VN4A 5IGXH 4JG0H 3EGSA 5E56A 1KTDA 2EDQA 3BE1H 4GBXB 4P5TC 3HZMA 1EUUA 3E2HC 3EFDL 3BD3A 5B8CA 1CFQA 5DF0A 1FLTX 5DHYB 1KNOA 5SWSE 1R3HB 4RMVA 4DZ8B 3LKNA 5SWSB 3K7UA 4YXLL 4U1LB 2W9DL 2NTFB 4FG6D 4N8CL 4WI8A 4PJIF 3LKPB 2YMXL 3OKDA 3WN5A 1HXMA 5HYJB 4P49A 3W82A 5ANMA 2R4RH 2IANE 2IANB 3KYNA 2OK0L 3BKMH 3RDTB 4U7SA 1KENH 3KPMA 4QHNB 3FFCA 2ICWB 2EYTB 3HS0A 3MXVH 5F6IC 4YBLB 4WV1B 4D2NA 1RUQL 1AO7D 4WW1A 5GQBA 4R0LB 3IAGC 1A7QH 2DJ4A 4U6VH 1DLHB 3PV6B 4NN6C 4ONHB 4ZFOA 3EJZC 1RK1A 2X41A 4N8PA 3WIHH 2CKBL 1OAQH 2F5BL 2HFEB 3F8UB 3FCTB 5F3BA 3MRRB 4JFZL 3B9KA 4AEIH 2D7NA 3DJ9A 3SPVA 4MD4B 3WJJC 4R97C 4Z77B 5ILTH 2VL4A 3S7GA 1U2HA 4KXZI 1EGJL 3I6KB 4YK4C 4GQ9H 4XVSL 5TE6L 1A9EB 4O4YL 1UM5H 4GW4B 3TCXA 4HCRA 4LLQB 1I3GL 1L7IH 4GAYA 5DA4A 3ME0A 1Q72L 1Y18A 2HTKD 5IMLB 4NO2B 1KN4L 1UCBL 3DVNB 2PW1B 4UNVA 2XRAH 3IXTA 5DMYA 4LSVH 5E2UH 3C87A 2QQNL 4Q58C 3H9YA 2N56A 4M1CC 1UKSA 3MLRH 4DOHE 3O6FC 3FO9B 3S5LG 2P43B 3P11L 1I8MA 3DUUB 4DOHB 2HN7B 4WI3A 4Y5VB 4EIGB 2EE9A 4WWKD 1NDMB 4DN4H 3BO8A 2IADB 3O0RL 5ADPL 2QBWA 3V4VH 1MCHA 1I8IB 3SE3A 5J6GA 2H1PH 5MI0B 1PZ5B 3C6LD 3SOBL 3QQ9C 4LGPB 2ZUXA 1Y6KR 3PGDA 1DANT 4KJPC 2Q8BL 3WE6B 3TBYB 4P5KB 4HKZA 3MLXL 3OJ2C 1E4KC 2YPLB 2GTZA 2X9WA 1QRKA 3RNKA 4D9RE 5KJRL 5CMAB 1BBJB 3S8WA 4G7VL 2C26A 3AB0C 3STLB 3DO7A 3CCHB 4N0RA 5HGHB 3LN4A 1UH2A 3D2UA 1IAIL 5J11C 4L4TD 1AIFA 1XIWB 4PJFA 1Y0LA 5E99H 3D85D 5IEKA 2YA0A 5GIRB 1DUYB 3CFCH 4Y2DC 3L3JB 3EHBC 1U58A 3QRGL 3TZVC 5H37G 1BJMA 4HLZG 1HHGA 4LHUA 4M48L 4XP4H 5K9OA 5C0BA 2FEDD 5C86A 1BQUA 3G5XA 4F33B 3FMGH 2AERT 3C60B 1IGMH 1SBSL 3LH2H 4HGKC 3KYOA 1RUPL 3MMEA 4YHZL 3IJSB 1SHMA 1LK2B 4HF5H 4MJ6B 1Z5LB 4RGOL 3BUYB 5F8QC 2DB8A 3HR6A 3SE8H 1FE8H 3PNWB 3LQZB 4DTGL 3KS0J 4OGYL 4X6CA 1WCBA 1G7QA 3VFRA 5GZOC 4KK5C 1DQDH 4KFZC 3PE9A 3VXOA 4ONFL 3QPQC 1LDSA 4FTVE 5EFIB 4NQXB 2DI9A 5T1KD 5K9QG 4FTVB 3T0AA 3HNSL 1EFXB 1V7MH 5KVEH 1NAKH 4OGAD 4XP5L 4MNGE 2HKHH 4TQEH 5D1QA 3Q6GH 4MNGB 4X7TB 4WHYH 3KVQA 5CIPH 1P1ZB 5T3ZH 3UTTA 3IETA 5I2IB 4XXCA 1DP0A 2AV7A 2F74A 2BP3A 5H2BA 1FSKB 5ESQB 3CNKA 4I3SH 1XR8B 2YHGA 1ZSDB 1KCSL 2ARJA 3T3PE 4JZNA 2Z92A 4YZFE 2DYPD 3QUMA 1G0XA 5C6PB 4G6AC 4FZ8H 2AEIT 4MSWB 1JGLL 4JZOB 1YN7A 2H26A 3ARBC 2R29L 1S7QA 3IF1B 4DKFL 1B4RA 4OF6A 1GC1C 5IBLC 1KIQB 1XF3A 3EGSB 4U2ZA 4BZ1H 4L3AA 1KTDB 4ZXBA 1IC5H 3HZMB 3WO3B 4U1HA 1LGVA 4Y5XC 4HG4K 1I8LA 2Y72A 1P7QA 1KSRA 3HC4H 1H0DA 1XZ0A 5B8CB 4OD3L 1CFQB 1XGPA 4HT1L 1KNOB 2GSIA 3LKNB 1RZGA 1PZUB 1RUAH 3JBG7 4LARL 3WN5B 1ZT7A 3OXSA 1LDPL 3OKDB 5ANME 1HXMB 5DK2B 4M6ML 5ANMB 1QSVA 4LSRL 2R4SL 5I6XB 4MGXA 5D8JH 4N0YH 4F15C 1SMOA 3FFCE 4HIEA 3KPMB 3O8XA 3FFCB 1QFWL 3VU2A 3HS0B 3NN8A 4MXVE 3THML 1QSZA 4WW1B 4UQ2A 1JPFA 4BK4A 4ELMF 4RISL 3B2UC 3BP6A 4R7DB 1KCUL 1R3IL 4ZFOB 1EJOL 3EAKA 4ESKA 1RK1B 3LQAL 5HDOA 1QSEA 3ECBA 2A73A 3ZE1F 5IVNA 1IEAA 3ALWA 4YFLI 1IZKA 2W60A 4XPBH 1EO8L 5F3BB 4LCWA 3B9KB 3I9GL 1F6AA 3SPVB 8FABA 3SKUD 4GLRH 4WI9A 3MYJA 3PP3H 3KLSA 3OKOA 4XHJD 4GMSL 5D93B 5EU5A 4L8CA 3IFLL 3IDIA 5JXED 4P4KC 1MY7A 1NCDH 4GAYB 5F1KC 3MJ9A 5DJXA 1Y18B 1NCNA 3QEHA 5ACMA 3ZDZE 1F58H 2AS5M 1ORSA 1XCTA 4YJZL 3P4NA 4IEFB 3V6BR 3IXTB 4PJ5A 1OW0A 2HH0H 1NBVL 3RTQD 1TTFA 4QYOA 2DM7A 3WLBA 3OL2A 4DK6A 4R4NC 1GL4B 4DJMA 4J4PA 3F65A 1C16A 2VDRH 3EYUL 1ULVA 3R4DA 2B1HH 2HT2C 3BO8B 1LO3L 3RPIA 3VXSA 3TF7C 1U41A 5J6GB 3DI2B 2XZCH 1IM9D 5IWLC 3OB0H 3MV9D 4LSUH 1OT1A 3PGDB 4HKZB 1CK0L 1HIMH 4M8VA 3N0PB 3T0EA 2EXYD 4XPTH 2GTZB 4YC2B 4JHAH 2Z8RA 4JN1L 3BKYH 1SY6A 3T2NL 5KN5B 1NQBA 4O02H 3DO7B 4CN4A 3KJ4B 3R8BB 1KTRL 1DBMH 3LN4B 5BO1L 5L6YH 3D2UB 4HG4J 1F45A 4PJFE 3K46A 1AIFB 4LVHB 1TQBB 4YUEH 4PJFB 1Y0LB 3LEXA 4PP1C 1PSKH 3OKNA 1IFHL 1ZLSL 1BM3H 3P30L 5IEKB 1HZHL 3WFDL 2ORBL 4XC3L 1U58B 2BY1A 3RNQA 2NY6D 4HWUA 2X70A 5IJKC 3N1MC 5C0BE 1HHGB 5JOEA 1CGWA 2ESVA 4LHUB 4OI9A 5K9OB 5C0BB 4YDIL 3G5XB 2PTUA 4FQ2L 1FIGH 3MMEB 2G2RA 5FDYA 2ZOKA 3CX2A 2XACC 4NRXA 3C2AH 5L2KA 4XPFL 4X6CE 2NXZD 4GLRI 1QYGL 4X6CB 4MJID 1WCBB 3EKCA 1G7QB 3VFRB 5IB3A 3DOSA 4V2BA 4Z95L 2I9LA 3VXOB 4K9EL 4K3EH 1A47A 5DYOA 4NFCA 3D6GA 5FUOH 4XPGH 3MRNA 2XZQH 5B38A 4MQXD 1DBBL 5L88L 3I50H 3MBEC 2Y07L 5D1QB 5J13C 3T4AA 2V6HA 5GGVH 3UTTE 4OZHF 1CXLA 5EIQA 3UTTB 3IETB 4KRPC 2AV7B 2F74B 4Q9CA 5H2BB 5DC4B 3BKJL 3ULUC 1FC1A 1N4XH 4TNWK 2QQKL 2ZSWA 4GRWF 4GKSA 2ARJB 2ARWA 1MCWW 3C8HA 5JW4N 4JZNB 4PB9H 2Z92B 1B2WL 2FIRT 1P4BL 5JW3L 3QUMB 3BPOC 1E6JH 3C9NA 4AEHH 3X14A 2PXYD 1YN7B 2H26B 3LAFA 1S7QB