4LGSB

Ricin a chain bound to camelid nanobody (vhh4)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
QVQLVESGGGLVQAGGSLSLSCAASGGDFSRNAMAWFRQAPGKEREFVASINWTGSGTYYLDSVKGRFTISRDNAKNALYLQMNNLKPEDTAVYYCARSTVFAEITGLAGYQSGSYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system
molecule keywords Ricin
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
total genus 34
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgsB00
1RZ7H 1KLGB 4TQEL 4WI7A 5TE7H 3P0YL 1K8DB 3KLHC 3BH8A 4CKVX 2FHBA 1FORL 4XVSH 1GXEA 1S8DA 4X4XB 4FFYH 5GS1B 4W4OA 3PHOA 2VUYA 4HUWA 3AS0A 5HGBB 4JHAL 4AEFA 4KGJA 2CO6B 3BESR 4RA0C 2XTLA 4WW1A 3MGTB 4I0KA 4O5LL 3VJ6A 1S7UA 3UTQA 5DI8A 2WBJB 5T3XL 1A21A 3GZKA 3BGFB 4HMCA 4WW2C 1U8IA 4QHUA 3O6ML 1FG2A 2XA8L 1TZGL 3T0BA 1TJIL 3HPLB 1N6UA 2BY0A 3D3VA 3KPTA 1UADC 2DQEH 1JWSA 2YA2A 5IVXE 3VXUB 1P4IH 2XZQL 4FQ1H 5CBEB 5GGRA 4JO1H 2WBJD 1MFEH 2V2WA 3UBXI 5F97E 1UGNA 2GCYA 2VDRL 1U92B 5EG6C 2B4CL 5JHDB 2R15A 3PIQA 4ELMB 1QLFA 2V2TB 1C5BL 1F02I 3UJTL 5J1SC 1KCUH 3V2AR 3TT3H 3VXUD 2IADA 1QBBA 5GS0H 1RQ5A 1RMFH 2C3VB 1C5CL 5EFIA 1U58A 1KENH 2XPGA 4QOKB 3FQUA 3QXWA 5DRWB 5JHDD 3H2WA 3O9WA 1B0RB 1TLKA 2Q8BL 1CGWA 1CQKA 3KR3L 3AGVA 4KRMB 1XCTA 3V5KB 5CIPH 3RWEA 1FL3A 2CD0A 4QOKD 3CC5A 4G43A 5I1HL 1NEUA 3JWOC 3VGAC 4JZJA 3PNWB 3WS6C 1T7YA 3DHJA 1NBZB 1Q0XL 3O2DA 1NLDL 2ADFL 4GG6E 3SDXF 3I85A 3SDCC 3JUZA 1TQCC 1SY6L 5DHXB 5F1OB 2J2ZA 3PJSB 4MMZC 4HS6A 4QRTB 3HNTH 3RVTC 3NFSH 5D2LA 2VERN 2OP4H 5I1JH 3MJ8A 2B0SH 4FQIH 5ESAB 2A6DB 2NXZD 1HYSC 2R9HC 5I8OH 4TTGA 2Q3ZA 3V5DB 4YHML 4WFGD 5CINL 2HKHL 2YPLB 2VXTL 5IMOA 4GW4A 4AQ1B 1CD1A 1ZLVH 2A73B 4ZUUB 3WHXA 2DD8L 5ANMB 4RZCA 4NKMA 4QRPB 2VLJB 1LHZA 4UT6L 4JZNB 3TBYB 1LE5A 4OZHE 3BEVB 5DS8A 5B3JE 3QRGH 1FYTB 1A4KA 5EO1B 4NRXA 3Q1SH 4F3FB 1G7JA 5T1KB 4FP8L 3WFHB 3FOMA 3T8XB 2HAZA 4QRPD 2VLJD 5ITBL 3ZTNL 4JHZA 5HVHB 5JOEA 5I19H 3PF2A 5I73C 3FN9A 5H37G 2I5YL 1FYTD 1YPZE 2R0WH 2ZNXA 5T1KD 4FQHB 4P2QB 1FFNA 1KF9B 3PV7A 4OQTH 4Y8AA 5KG9A 2BMKA 4PTUB 4GKZA 3OKDB 4ZFFA 1U2CA 3BQUA 3H3KA 1KULA 4L9DA 1M05A 5BXFA 5J11B 3AU1A 4P2QD 4HH8A 1B2WH 3IGAA 4N8VB 5E94A 2JIXD 4DFIA 4JE4B 1R24B 1T5XA 3EFDH 4LQFL 4POUB 3P11L 3SDDC 4YHYB 2GY7B 3T1WA 1EHLH 4I0PA 1FDLH 1IL1B 1IKFH 1L7IL 1RPQA 4U3XA 4KJWD 1QUNA 5FF6A 4UUJA 3C5JB 3CMOH 2BVEA 5FCUL 4EZMA 2ZKHL 4IDLA 1ZLUH 5MHSD 4M4PA 3W0WE 1N64H 2HVKA 1FO0L 4U1HB 2DMBA 4DTGL 2YS4A 2EIBA 5EO9B 4P3WA 1BREA 3EGSA 1JHLL 2CLRB 5F72S 4RGOH 5C0EB 1CDBA 1RK0B 3O4LE 4ODUA 3NN8A 2D4FA 3HMXL 3O3UN 4N0UE 2MNUA 2NTFA 1YYLL 3OKLA 4OF8A 1KB9J 4OIIL 3UJJH 2EDEA 3LH2H 5EBGA 4O4YH 4DVRL 1WWAX 3WUWB 3C60A 4R26H 5IOPB 1P6FA 5GGRY 4Z0BL 4LHJB 1EEYA 4Q6IC 4C83B 2DL2A 4JG0L 1QHPA 2HRPL 2CDGA 3ARYA 4XP9H 2R4SL 3BISA 3DX7B 3FB7B 4JFEB 3PP3K 5FDYA 2EDJA 1HDMB 3EYSL 4NO3A 4NZRH 3HS0B 2BNUB 1B4JH 4HGWB 2MSPA 3KPRB 2R0KH 3U82B 2H2PD 1VFOA 5D5ME 3L7EA 1L0YA 3VFSB 1T04A 1CF8H 1AGFA 2LFGA 3CZJA 4U0RC 5C0JA 4KI5D 3ULVF 3WS3A 4RIRA 4NC1C 1NMAH 4G8GE 1YQVL 3ARWA 3Q5TA 3KPRD 1BECA 4GBXC 4A6YB 1BHGA 1BD2A 1P4BL 4GH7B 5MERB 2F54B 5DMKB 3GGWB 3NCCB 4HS3A 1AR1D 3O0RH 3TA3A 1U8LB 5JXEC 1FZOB 2NY3B 4IRSA 4J4PA 1FGNL 1BF2A 2HT2C 3DMMC 5CHNB 3FFCB 1UXWB 2F54D 1Q94B 4LSVL 3GMPA 1KLFA 2WIIA 1AI1H 5C2BL 1MUJA 2NY3D 4YFLI 1UKSA 1UB6B 4HV8B 5F7WC 5IW6A 3HPJA 4HKBB 3L3IA 3FFCD 1Z2KA 2FIKB 2VABB 3D9AH 4ZAKB 3UTPE 2AQ3A 4ZSOA 2AI0H 1AJ7H 2H6PB 5SX5H 4K7PL 1A3QA 2J8OA 1XT5A 1QFWM 3GSRA 4RGNB 3SDXA 3SKMA 5C08A 3NPZB 2C7UB 4J3XA 4PJAA 12E8H 4XZUB 3TPUA 1ZHBB 3LS5L 3BZFB 1S9WB 1GAFH 2XNAA 3EOBA 1CGYA 3NPSC 4RGND 3KXFA 3WE6A 1GZPA 3CZFB 3VRJB 1P7HL 4I48A 3WIIL 1JNNL 2VZSA 3SEPA 3UPRA 5BS0E 3IAGC 3S36X 1K3ZA 2IANA 5EU6A 2G5BA 2NY2B 2X1OA 3OKNB 4DN4L 3W9EB 1UVQB 4YHZL 43C9B 4XP5L 1K9TA 5IHZA 3RGVC 1JWMB 1W8OA 1ZANL 2X4NA 3MFFB 3RWJB 1NJ9A 3VCLB 4N1HB 2AK4E 3CSYA 3SDAB 2NY2D 5AYUL 3MJ9H 1A7NL 1AGDB 5CSBA 3KVQA 2IAMC 5AAWA 1MWAA 2RR3A 4X5LA 4ZTOH 4XPFL 2DTML 4RFEA 4UQ3B 5DD0H 5A16A 5DA0B 5FK9A 1ZGLP 1I7TA 3QDGE 4LVOB 2FYYB 2UZIH 1L7TH 2X4SA 4ORZC 2R1XA 3HRPA 1CFNA 4XGZA 3QG6A 1ZVHA 2DQGL 4QF1A 2R0LH 3EYQC 4PRAA 1RZJL 1TZHA 4V1DA 1NCCH 1MCDA 1I9IL 3ULUF 3STLA 1KTLB 4KHTL 1D9KB 2HFTA 3V6FA 3KYNA 2EDLA 1I9RH 5FKPB 1YEIH 4PTTA 4HWBA 4PYHA 4F7TA 5JW5A 1LP9F 4ZO9A 1FFQA 2W38A 3H9HB 3FO1A 1QEWA 3BDXA 5CGMA 2D7TL 1RZ7L 1D9KD 4E41A 4PY7B 4MNQA 4Y16C 5D9SA 2XFXA 4GRWH 1ZAGA 4H26B 4NNXB 5GGUA 3GJEA 4XVSL 2Q3AA 4FFYL 1CVSC 4BA8A 4HFUH 1T21B 1NUDA 1ZHKA 4PJDB 1XF5B 2CIIB 3RRQA 5C0CB 3OBAA 3TT1H 4K8RC 3ZHDA 2NQCA 2W92A 3C8KA 4ODTH 1AD9A 3RY5A 1ONQA 1NGWB 3EAKA 4FQXB 4LSTH 4ISVA 1F4WH 4O9HH 4TYUA 3QEGH 2VISA 4EN3A 2CQVA 3GSVA 1XF3B 3QO1B 1KN4L 2DQEL 5C0CD 4YAQB 2X41A 1P4IL 4OTXH 4K9EC 1CLYH 3VFWA 4JO1L 2AV1B 4NNYA 1MFEL 4OFYD 3I02A 4FQXD 4ZYKA 5E4EB 1JIBA 5H94A 3VU2A 2XN9B 4H20L 3QI9C 1KCUL 3TT3L 5GS0L 1RMFL 4H8WH 4P2RA 3VMNA 2I27N 4P5MA 2VR9A 3VA2C 5CEXB 1KENL 3BWUC 1F13A 1A3RH 2FJGA 4XNZB 2FZ3B 3F12A 4PGZA 1YNKH 1K8IA 5BVJA 4R4NC 1XH3B 2C4FT 4UIMA 3UMTA 4MDJA 4Q58C 1MFDH 3FB5A 3DROB 4G6JH 2EXWC 3SGKA 3SE9H 2FECI 5B39G 4PG9B 1CFTA 1XGUB 1ZT4B 5IIEA 5C0AE 1GIGH 3BKJH 1PG7H 1BVLB 3DUUB 1GZQA 2Z31A 1QSFE 1PSKH 1PY4A 3RWCB 1F3JB 2WLYA 2QQQA 4U1MB 1WIOA 6CGTA 1IAKA 2EIZB 3CDFA 4WI9A 4ZNEA 2A83B 2HTLD 4PP1D 2VL5A 5IR1A 1IAIM 1J12A 2WV3A 4Z7VE 5LCVH 3ZT7A 1HILB 3HNTL 1JF1A 4G8FA 3NFSL 1BBJB 1T7ZA 2OP4L 3TN0C 1J9CT 5ICXA 2B0SL 4FQIL 3TFKC 4WV1B 1VGEH 1LDPH 4CN1A 1UEYA 3KDMB 4LHQB 1HH6A 2WNGA 3E8UL 5I8OL 3MCG1 1CL7I 1OT1A 3OGCA 5TH2A 4ETQB 4PJCF 3L3OA 4TNWF 3FQRB 2VDPH 3IF1A 3MRFB 3NZHL 4CVXA 1MHHA 1MHPH 2DQIL 2ZG1A 1F2XK 1WBYB 3MRMA 4XVJH 3SKNA 5B8CB 2K3TA 3U4BH 3VXMA 1M6OB 4IRZH 4LCCA 1JUFA 2J12B 2R1YB 2EE2A 1MCLA 2HJLA 2OBGA 1X4YA 2EDOA 3QRGL 3JVGA 3CVHH 3OXRA 5A2KH 2ZUSA 1T1WA 1CD0A 2UUDH 3UDWC 4D9QD 4U1JA 1A6AA 2VIRA 1J0ZA 3FT2A 5I19L 1U42A 1DANU 4TSCL 2PTTB 4WWKA 3B9EA 3MRCA 1J86A 1YUHB 3B5TA 1S7QB 2D9QB 3LSOA 3ME0A 4EDXB 4OQTL 5BCAA 1H15B 4L3EA 4HPYH 4JFOB 4F7MA 2EKJA 1HE7A 1T89A 4G7VH 4PY8J 5IVZA 3CFDB 1Q0YH 1GYAA 1O5DT 2YD3A 4RAUA 2RHEA 4KRPB 1E4KA 3MC0A 4G42B 4YDLC 3OKKA 3MV8A 4UDTA 1R3LA 1ZV5A 1NMBH 1F11A 3EFDL 5HYFA 3W11C 4KRPD 3CDCA 1EHLL 5GZNC 3W5NA 1FVEB 1U8NA 1IKFL 2BCKA 1ZHNA 1IJ9A 5DJ8B 3C6LC 4BSWB 4LVNC 4Z76B 5A43C 5EB9A 5F6IB 3UYOD 5ACLA 3IYLW 2UWEE 4MJIB 1ETZA 4WVRA 5D1QB 1N64L 3GJFK 5CUSH 4HWZB 4XPHH 5J1AA 1OCWH 4NCC2 2ENYA 4K3JL 4IOSD 3ULSA 1HHJB 4JFZH 1MH5A 3GBMH 4L3CA 1CFVH 4MJID 4CU8A 1R5WB 3T04D 5D1QD 1WWWX 4ONOA 3EYFB 4JKMA 1KNOB 1YPZB 2NY5C 3B3IA 4PGCB 5DJXB 4D0BB 2NY6C 4Q74A 1FV1A 3FQTA 3UJJL 3HG1A 1ZLVK 1OGAE 3LH2L 4JGJA 3VH8A 1RZKC 1Z5LA 1ES0B 5E8OB 1LP9A 1AXTH 1PBYA 4O4YL 1IQDB 2A74A 4LARH 4LEXH 4XNQA 3E6FB 1HEZA 3FCTA 2VWEE 3PDOB 4G9DA 3MLSH 5A2JH 1KIPB 5HVGB 3TF7C 3TH3T 2D0HA 3QNXA 4U1GC 5EULV 3S9DB 3FQXA 4Y5VC 5E9DA 1B4JL 2IH1B 5JIKA 1S7VA 4M8VA 3V5HA 3V7AE 4G6KH 4BK5A 1CF8L 1AGCA 3ARQA 4U1IA 1FQ9C 1A6WH 4C54A 3BH8B 1NMAL 4NN6B 2V17H 2LABA 1HXYB 1S8DB 2NCMA 4GG6F 1DBAH 3PHOB 5IFAL 1I8MB 4JRYE 1SYVA 1X5IA 2HT3D 4WW1B 4IIQC 3VJ6B 1S7UB 2ZPKH 4N0UB 3UTSE 4P2OB 5DHVH 1U8IB 4QHUB 1U93A 1FG2B 5B3NA 1MJUH 2H32A 3D3VB 5GGRB 1YN7B 5HGHA 2V2WB 1UYWL 1AI1L 3E1F1 4DW2H 1CGTA 3CIQA 3MREA 3BPLB 3D3VD 3HNVL 4ETYA 3LRHA 3D9AL 5SX4I 2C4XA 2Z93A 3DETC 5M7QA 5EFIB 3VXSA 3ZE1E 4PD4J 4OZHF 4NPYA 3CNKA 4J3WA 4EIGB 5CJQH 12E8L 2PYEE 3O9WB 1Q9WA 4KK6C 4D94A 4NKDB 4I3GA 3RWEB 1FL3B 1U8JA 3F7RA 3S5LG 3QXAB 4C56E 4JZJB 1C7TA 2D2OA 5F9DC 4X9HA 1Z3GH 2X70B 3NCEB 5IQ9B 3CFEA 2DF3A 3O9WD 2ZUQC 4XVTL 3LV3A 2OJZL 4XI5C 3LKOA 3OKOA 5I30H 3C09C 4PRBA 4HUXA 3UTTA 1PAMA 1HI6A 3SGJC 2XZZA 3DNKA 1NPUA 1U3ZA 1FCGA 3G08A 4WUKH 1LO4H 3GK8H 3MJ8B 2XZCH 3LZFL 5ALBL 4JGMA 4N90E 4ZTOL 5D6CA 1P7KA 4GXUN 3SOBL 2BJML 2K7PA 1VGKA 5IMOB 4GW4B 4AZ8A 3DECA 3OJVC 5GJTH 2UZIL 4Y5XA 1L7TL 3WHXB 3CH8A 4MVBD 1G9MC 1F2QA 4RZCB 4NKMB 3V9FA 1P5VA 1PEWA 2R0LL 3HI6L 1LE5B 3BXNA 1NCCL 5DS8B 3NCJH 1IGTA 4LFHG 1A4KB 3B4NA 3NCBB 4M6AA 4NRXB 4F7EA 1G7JB 2BOCA 4OLVL 3F7QA 1RUQH 3FOMB 1A1OA 1I9RL 5LXGH 1YEIL 3RX5A 5HVHC 1T3FA 3Q5YA 4GW5A 1CS6A 3HMXA 3S37H 1MCCA 4HT1H 5T3XE 3G5VA 4BQBA 1FFNB 1I3VA 2Z4QA 3JWDH 4UINH 4YHPA 1XCQA 2YRLA 5D93B 5KG9B 5SX5K 2YBRA 4ZFFB 5H35B 3IU3A 3BQUB 1OSZB 3GB7A 4M5ZH 1M05B 5SWSE 5KZCB 4YFDB 1CICA 4EUPG 1NFDF 5CJ5A 1JRHH 5E94B 3TT1L 5IESL 1J5OH 4J6RH 5JA9A 3BQUD 1OD7A 2F58H 4ODTL 1A9BA 2XKNA 3HAEB 5DGQA 2OR9L 4LSTL 1F4WL 3QEGL 1UWEH 4YHYC 5KZCD 3MRPA 4IS6A 2ICWB 3WL9A 4YXHL 1Z0NA 2VXVH 4Y19E 4I0PB 5D5MF 4OTXL 5HGDA 5FHBL 1CLYL 4Y1AE 4LKCA 4XBGB 4CN4A 1ZVSB 5FF6B 1CDGA 1PG7X 3QT2A 1J87A 3KHQA 1O7VA 2APTA 4PJGA 5E2JA 5DK0A 3ARPA 3NBNA 4I0PD 1RJZA 2HVKB 1CXFA 1JRHI 4YDKH 2YK1L 3TJHC 1B6DA 2PUQT 1G9NC 3EGSB 1A3RL 4ODUB 3NN8B 4UDUA 4KZDL 1RIVH 4FQLH 5L7XH 1OOAA 1YNKL 2EDXA 2YD7A 3OAUH 2NTFB 4YGVA 4Z6AT 1MFDL 3NCMA 1FL6A 4G6JL 1OAKH 2Z0BA 4JZOA 4GLRH 3JXAA 3SE9L 3MLPA 4UNVA 4U3CA 5K9OB 1KGCE 5DHYA 3VD9A 1I4FA 1T0NA 5FGRA 3C60B 4ZFOA 1GIGL 1CL7L 3BKJL 3V0WH 4X7TA 2CKBH 1EEYB 4PG2C 1XF1A 1PSKL 5IHBA 2OR7A 2VLRE 1WF5A 4OLXH 3BEWA 4BFEA 4KKBC 1IGML 4X4ZA 4C58B 2CDGB 5GGTH 3C60D 4L8DA 2FL5A 4M00A 1KB5H 2YZ1A 1E4JA 5C07E 2P45B 3QQ9D 2BSTA 1CU4L 3TCXA 2JB5H 2W91A 4NO3B 4NQCA 3BD5A 5J12C 2WZPD 1KCVH 5I1CH 4YEFA 1QOKA 3BP5A 3GI8H 3B83A 4GLRI 4KHXH 3M1BA 3L7EB 1VGEL 2ZOKB 1T04B 3G6AA 4GKSA 5L88H 1AGFB 4FMKA 5C0JB 3KPOB 4XB8A 4RIRB 5SWZA 5F3BB 5T3ZH 5B22A 1NL0H 2P1YA 1YMMA 1AR1C 1X6NA 2AGJH 2VDPL 4P4KA 1MHPL 3F7YB 4KK8D 2AJUH 2JCCE 3G5ZA 3MJ6A 3MRNA 3X11A 4XVJL 4G6MH 3U4BL 3LEXA 4IRZL 4J3UA 3WKMH 4PGEA 4UTAH 4XH2B 2NLJA 2QSVA 4FQCH 3TA3B 4GRLA 1NBYA 4ZPTB 2NY3C 3CVHL 3OL2A 1YECH 3CAFA 3D1MC 4OZHA 1UZ6E 1BQLH 4QT5A 1LO5B 1NGQH 3GMPB 3B9VA 4N1EA 4BSVB 1JJUA 1KPRA 2XACC 3TA3D 2WIIB 4L29B 1MUJB 1MFAH 4FRWA 4IRSD 1QSFB 4J4PD 1OPGH 3GHBH 3HPJB 5IW6B 3REVA 3L3IB 4H1LH 4HPYL 3QZWA 4ZAKC 3ZYZA 1EK3A 2YRZA 3OR6A 3SHSA 2Y07L 4Z7VB 1EJOH 1Q0YL 4PJBE 3S3PA 5E5UB 2KZ1B 3VA6A 1Z9MA 1KLUA 3SDXB 3C08H 3SKMB 4HG4J 5C08B 4ZD3H 4MAYA 4PJAB 2J5LB 1XGQB 4HLZH 5I76A 4S1DD 1I9EA 4OF0A 2XNAB 5DR5H 3U7WH 4OI8A 1ZT7A 3DGGA 5FYLD 1OAXH 3WE6B 5C08D 5LBSL 4PR5A 1GZPB 3K7UA 5I2IB 4I48B 3QULA 5AD0B 3UPRB 1J1OH 5DMGC 2QV2A 2IANB 5E5MA 2OL3H 5CZKA 2G5BB 5EU6B 2R1WA 4M62H 2NY2C 4AIZA 4WFED 1CGSH 3KXFD 4I18B 2BVQB 2V9RA 1EXUA 5FO7A 3UBXA 4LLVA 4PJXE 3ZDYF 1WLHA 5D7KE 3H7LA 5IHZB 2X4NB 5DJ2A 1JGLH 1YEDB 2IAND 4M8QA 4MX7B 5EU6D 3FO2A 3CSYB 1M71A 3SDAC 3MV9A 1A6PA 4JFZL 1I1YB 1CFVL 5TDOB 1QD0A 4R2GD 4KY1H 4LASL 4RFEB 4LCIL 2J8UF 5A16B 3L5XH 5FK9B 1KJVB 5F7NC 3VXRE 1I7TB 3RU8H 4XB7A 3SKUD 4EUPH 1AXTL 4JY4A 3NFNA 3D5OF 4LARL 2X4SB 4YFLF 2R1XB 2VAJA 1LVEA 2CUMA 1CFNB 4XGZB 3QG6B 3QEUB 1KB9K 4QF1B 4PRAB 1A1MA 5CWSA 1RUPH 1TZHB 4V1DB 3U79A 1IZJA 1PKQE 2AKRA 4XCFH 4KFZC 1XAUA 3AB0C 1ZSDB 1DFBH 4JAMA 2GUOA 4K3EL 3V6FB 3KYNB 1NFDA 2OQJA 3MLUL 4PTTB 5MI0B 1WZMA 4F7TB 5JW5B 1PLGL 4V1DD 3EOAA 3QNZA 3H9SE 4OLZL 1FLTX 4M61A 2X9XA 4NUGH 3WNNA 1TTUA 2V2XA 4G6KL 1U8OB 3OSKA 1FNFA 4M6NL 3GUTA 2XFXB 2FR4A 4JFDA 2UWEB 3V4VH 5D5MA 5GGUB 3GJEB 1IAOA 4HJJH 1EEZA 1P9MC 1NCWH 3QIWC 2ADIA 1DBAL 3LOWA 3T0EE 4RQQA 2XWBB 4X8XA 1UM6H 1ZHKB 1GGUA 2PNDA 4G8IB 2EH8H 4PJ5E 2XKSA 2ZPKL 4HMDA 3C8KB 1AD9B 1ED3B 1ONQB 1NEZA 1DBJL 3KPSA 1DLHA 3IXTA 4O2FA 4MA8H 1MJUL 3GSVB 3CLFH 4D9LH 4ZS6D 4B5EA 3VE0A 3LMJH 4K7PY 3I6KA 3OXSB 4HD9A 2VLKA 1A7OH 3RL1A 4FXGA 4GMTH 3I02B 1X6LA 4U1LA 4ZYKB 2DBJA 5D7IE 1GH7A 4JKKA 3B2VH 1VENA 3LRGA 5DDHB 2DMKA 2GYSA 3M45A 3T65A 3GSQA 4GMSH 1ZS8B 2DAVA 5CLTA 4EJ1C 4NJ9H 3CVIL 1YC7A 5E6ZA 1IAMA 5CJQL 1CT8A 4K2UH 1K8IB 3HUJE 5BVJB 3ARFC 1CVRA 2V7NB 3V6BR 4UIMB 4MDJB 3MLYH 3FB5B 2E6JA 1NKRA 1KCSH 2D3VA 3WBDA 5IEKA 1YY9D 1CFTB 4XX1E 2HTLC 5IIEB 4DCQA 5EDXA 4YC2B 1GZQB 2Z31B 1XR8B 5I30L 2GJ6E 1HK6A 3QSKB 3IT8D 3AM8A 4J12A 4LPXA 5C1MB 4AEIH 1IAKB 5GGVH 2YR3A 5BS0A 3S97C 2DLTA 4XVUD 3NTCH 5IR1B 4O51B 1XGYH 1T2QH 4TVSa 2FO1A 1UM5H 1JF1B 2Z31D 4Z7UF 1YDPA 4A6YH 3NZ8A 4G8FB 5DVKA 4JRXE 2R2HB 2BNQE 5EPMA 3OJDB 2B7DT 2BRQA 3O81A 3KPPA 2XZCL 1CE6A 4WV1C 1HH6B 3ZSSA 4ZNCD 1Y18B 3WXWH 3OGCB 3IF1B 4LLDB 1T66D 4CVXB 1X4ZA 3K0WA 5GJTL 3DRQA 2P8LB 1GC1H 4MXQC 3SKNB 1NFKA 3MODH 3VXMB 5E7FA 4LCCB 1JUFB 5IT2H 4Q9RH 3P0GB 3L95A 1A7RH 5I66A 2HJLB 3NCJL 3P9LA 2P48B 2YOCA 1JF5A 5L9DH 2Y9RT 1ZLWH 1T1WB 1YY8B 5IK3A 4LLYA 5BRZA 1QR4A 3BW9A 3VXMD 4U1JB 5HVWA 2QADB 1A6AB 2VIRB 2ZCHH 1G7QB 1XFPA 5DGRA 3FT2B 1X5AA 2DKMA 1T1ZA 4URTB 5BQ7A 5E8EA 1X5KA 1ORQA 3S37L 5IBTH 4FQJH 2BXYA 2R29H 3LSOB 4X5WA 3MNVB 3JWDL 1T6VN 4L3EB 2QADD 4YIQB 3QUMB 5CZXC 2JJTC 5HDLA 5IVZB 3S35L 2EYTB 4WWKD 4M5ZL 1MCRA 4RAUB 4P57A 2Z8SA 3JBG7 4IOFD 3OKKB 3HZYA 1JRHL 5CD3A 4L3ED 8CGTA 4UDTB 4OD2A 5GS2D 1J5OL 3QB7C 4J6RL 1F11B 2F58L 4JFHE 5TF1H 1DUZA 4GS7B 5EUOA 4YBQC 2D03H 2R8SH 3D48R 1U8NB 3WXVH 1ZHNB 1K2DA 1VADA 3BKYH 1K6QL 2J8UA 3MZTA 1V8HA 3NGBB 4ODSH 5DD6A 5FOBA 5F6IC 1DLFH 2AQ1A 3M8OH 4H0GA 4WHTA 1ETZB 1T2JA 5JORA 4YHLH 3BN3B 4YHOH 4LMQI 3QPXH 4XPAH 3OG6B 3HNSL 5D1XA 2YMXH 1HH9A 4DOHE 4OFDA 3ULSB 2Z35A 2E7LA 3FOLA 4L3CB 4CADB 5K9JL 1JHKH 3AREC 4XBEH 3WDIA 4KMLB 1OAKL 1FV1B 3FQTB 3HG1B 3CX5J 3K8LA 1A1NA 1Z5LB 1H3WM 1OL0A 4L5FL 4Z18A 3QUXA 2A74B 2VZTA 3IDIB 4WI6A 5FM8A 5HHQB 4NO0A 4XC3H 1NGPH 1HSBA 4XNQB 3CU1A 4U1SA 5JQHC 4Q9QL 2IG2L 1KPUA 4JPKL 3N50A 2J88L 1MCEA 3HG1D 5IQ7L 4OLXL 4P5TC 1DE4A 2Z8VC 4G9DB 5ETUA 5GGTL 3X13A 3ZT5A 1KB5L 1MAKA 2DWEB 3DI3B 1MI5E 4LDOB 3JWOH 4WU7B 3FQXB 1UQSB 5I1CL 2AXJA 4QRRE 1A8JH 3VGDA 3V5HB 1EFXA 2ORBH 1AGCB 3BN9D 2D9CA 5T3ZL 4LSUH 5F9OH 1BZ7A 3EOYG 1AY1L 3CPLA 4NKOA 4ONHA 1BOGA 1MY7A 3D25A 5FFLA 3VD7A 3EJYD 3HB3D 3IFLH 4LHUB 4G6ML 5HYIA 4EI5A 1SYVB 1Q38A 4UTAL 1F4HA 3PUCA 4FQCL 4X6CE 3K2UH 4P2OC 4KTEH 1L9NA 4D2NA 1U93B 4FTVE 5F8QC 1YECL 2H32B 1N8ZB 2CR6A 1BQLL 1DCLA 4LLUA 4X99B 4PRNA 1JNHA 1MFAL 3WV0A 4UB0H 3MREB 3BPLC 3IVKA 4RDQG 2Z93B 1KCRH 2LU4A 2XXMB 2R23B 4ODBD 1J11A 4X9IA 1CDIA 3VXSB 3B9KA 1EJOL 1AHWB 1UC6A 3U46B 2XY2A 4DQOH 5IWLA 4AENA 2G2RB 5C07B 4ZFZB 1D6VH 1MAJA 5HHOE 1IGIL 5DUBA 1EUTA 1Q9WB 3QDMA 4U6TA 3VXSD 5C6WH 4NFDA 3FRPG 1A6UL 1U8JB 2Q7YA 3LQAC 4PJ7F 4Z7UA 1FNGA 5DR5L 4AT6A 5J89A 1OAXL 4PJ9A 1KIRA 3BHBB 2HWZH 4GAFB 3RHWK 3LKOB 1J1OL 4EDWH 2EIDA 3OKOB 4P3DA 2AABH 4PRBB 2OL3L 4HUXB 4M62L 1OAZL 5D6DC 1CGSL 1G6VK 2Y06L 5CP3H 1SEBA 3WEXA 1HI6B 5EZJA 5FCSH 1YEHH 5GRXG 3G6JE 2VKXA 1X9QA 4U6HB 5JQ6H 1UH3A 2DLEA 3CH1B 1JGLL 2FDBP 1CLCA 3HI5H 3L5IA 1T83C 2XY1A 4NGHL 3QDJA 2ATKB 1RJLA 2BOBA 2LV4A 5FIEA 4JO3H 4KY1L 3HZMA 2IBZY 4NZTL 4CNIA 1WT5A 3L5XL 3D39E 2LAAA 2DQTH 1VESA 4LBEB 1VGKB 3O3EA 4I9WD 3OAYK 3NA9L 1EZVX 1PG7W 5F7FA 2EECA 3UJIH 1LWRA 3VXQA 1A22B 2LU3A 3MR9A 1RUPL 4BJLA 3BXNB 2AXHA 3UYPA 2WWMD 4Z77A 3QHTC 3RWIA 1ZE3C 5E8PA 1FO0B 2BOCB 5C0RH 5EH1A 3P4NB 1DFBL 2MPAH 1A1OB 4MNGE 4JPVH 4KPHL 5DVMA 1AO7E 3H8NA 3F58H 2D7PA 1FL5A 4UILH 3B43A 5DJDA 1FLRH 4DGIH 1WWBX 4GW5B 4R7DA 5B4MC 3INUH 3D2UA 4S11A 3LD8B 4NBZB 3QNYB 5F7UA 2IPTH 3RAJH 3CFIC 4YHPB 1XCQB 4ZS7H 4BQ9A 5D93C 3QUYB 3GEWB 4YBLB 1SHMA 2YBRB 3TIDA 32C2A 4JN2A 3V4VL 5TDPA 2F53E 3IU3B 2PR4H 3G6DH 4HJJL 3IDYB 4N68A 1NCWL 2LTQB 1F90H 2VC2H 2XZAH 3BKCH 1S9VA 4H25A 2OZ4A 4NHUA 2GITB 5JIHA 1UM6L 5D8JH 3VFRB 5J13B 3QUYD 4L8BA 1C12A 2H45A 5JLZB 4JB9L 5KAQG 2NW3B 4NO5B 1RJCA 1A9BB 5DVOA 2XKNB 1S3KH 1GGYA 1I7ZB 1OF2A 3MRPB 4IS6B 5I71C 3WL9B 4P9HL 2W0FB 3W2DH 3RPIB 3CLFL 4D9LL 4EQ3A 5DMIH 3LMJL 2BP3A 4I0PC 5FECA 5HGDB 3PQYA 4LKCB 4M03A 1A7OL 3L5JA 2BK8A 4R8WH 3QEQA 4KXZI 5DQDL 5EWIH 3B2VL 1IE5A 2CDFA 4PJGB 1JV5A 5DK0B 1CIUA 4JFXB 4GAYA 1RJZB 1RHHA 2W9LA 4NRYB 1UWXH 1T0PB 4POZC 2I9LA 4PJHE 3HE7A 3I6GB 4FABL 4YWGH 4GMSL 2ERJC 2R2BA 2DKSA 1V3LA 4S1RH 4MXVE 3WFEL 4F58H 4NJ9L 4UDUB 1G0XA 3BPCA 2YC1A 3DARA 3KLAB 1MQKL 5M94B 5FYJE 2ADGB 1UZ6F 4YGVB 3MLYL 1RUMH 1FL6B 1KCSL 4JZOB 4PD4K 4PJFE 1A0QH 4RISH 5CEZD 2CRMA 1I4FB 1L4IA 1T0NB 1IFHH 5D2NA 1FVCB 5C71A 3C60C 4YR6A 4ZFOB 4M3JA 2GK0A 4JDVA 1UEMA 4X7TB 4MZ3A 2Q8AH 3EDFA 1JYWA 3KJ4B 3K2MC 4MCZA 3BEWB 4PJBF 3CXHJ 2NY0D 5GGVL 3MV7E 3RFZC 4KVNH 4L8DB 2FL5B 4HHAA 4JDZA 4NQDE 1XGYL 3DLQR 4Y4KB 5FGCB 5C9KA 3SE4A 1MJJA 4NQCB 5IB1B 1J88A 2AJYH 3T3PE 4XRCA 4KK8C 1TFHA 3M1BB 2W9DH 1DP0A 4GKSB 3G6AB 4LCWE 4J2XA 3IETA 2GK2A 5SWZB 4H88L 3WXWL 4L8CA 3RDTB 4NDMA 4NQCD 1N2RA 5KOMC 3ARBB 3G5ZB 3MRNB 1GC1L 1VEMA 3MODL 2OR8A 3LEXB 5SWZD 4PGEB 5IT2L 2VN4A 4P0DA 3RDTD 4Q9RL 1QHOA 2NLJB 1A7RL 4B0MM 1YMHA 1NBYB 4P4KD 4RMUA 5L9DL 4NQEA 4X0KA 3ILQD 2H2SC 2WQ8A 5TPWH 5HYQA 1CFSA 1NCUA 2ZCHL 2D7OA 1KN2L 2EZ0C 3PGFH 3WUZA 5D7LA 3AY4C 4MJ5B 4RRPG 1KPRB 2NNAB 3IKCA 4N0CC 3SQOH 4N0FA 4UQ2A 5T1DH 4J1UA 3UZVB 5IBTL 1JNLH 4FQJL 2R29L 4PJ7A 3BP4A 5HHXL 3IDNA 3VI3F 4S1DC 1SJXA 3WFZA 4PBXA 1JI1A 2COQA 4NOBA 1MIEH 4A2MA 2MHAA 2O61A 1CE1L 4U6VH 1YJDC 3O2DH 2M26A 2D31A 1QYGH 4Y2OA 4MAYB 5GRJL 4NM4L 3NIGE 2BNQB 5I76B 1AP2B 1V7NL 1MEXL 5A3IC 2HJFB 1WFTA 1S78D 5DFVC 2CSPA 3LKQB 5TF1L 2GAZA 1ZT7B 4WEUD 4MAYD 4PR5B 2BNQD 3U7YL 2D03L 2R8SL 4JM2F 3S7GA 3QULB 3RNQB 3BKYL 5E5MB 4ODSL 3QWQB 2R1WB 4ZTPH 5DJCA 3B5GA 1DLFL 3WNOA 3M8OL 4AIZB 2Q7NA 4I18C 1UXSA 2YXFA 4K8RH 1AQDA 1EXUB 3UBXB 4YHLL 3T08A 4YHOL 4OM1L 4RMQA 1U8PB 3QPXL 4XPAL 1JPTH 2N4IA 4GKNA 5DJ2B 4Y0GA 2YMXL 1EMTL 3FO2B 1M71B 2GEEA 3MPCA 3MV9B 2XIDA 4G80A 5ESVA 1NH6A 5GISH 5IROC 2AEPL 5JMOC 1SJVA 3OKMA 2X4TA 4ODVH 3IU4H 3CFJA 2X1PA 4Z0XA 3O41A 1JZ8A 5ISZA 1S9YA 1JHKL 5B39A 3D0VA 2X2YA 5CILH 3U7AA 1BVKA 3MV9D 1DTUA 4JY4B 4UV4H 2BNRA 1NGPL 3STZA 2YA1A 1HYRC 2D0GA 5ELIA 5CWSB 1A1MB 4OGZA 4Z7OE 3OJ2C 3IDJA 1E4WH 1J1XL 2AKRB 1TJGH 2GSGB 4OLUH 3DX8A 4QXGL 1BGXL 1NFDB 3SE3C 3IFOA 3L6FA 3JWOL 3GSWA 3RTQA 3T1FA 1NBQA 2VLMD 1JMZA 4M61B 1KPVA 5I1DB 5GS0D 2NX5E 2PXYB 4KV5E 4Y2DC 3BE1H 3RNKB 4XTRC 3GUTB 4F8QA 3VD5A 4JFDB 4LSUL 5F9OL 1IAOB 1EEZB 5HHVH 4YO0B 4OGXL 2ADIB 3NABH 3HMWH 2BVPB 1PGRB 3IFLL 2B5IB 4ZS6C 5HI5C 5TQ0L 4JFDD 4LLMA 2A0LD 4WFHD 1RHFA 4BH8A 2YD6A 2HH0H 3EW3B 2QKIA 5I8EB 4PJEF 1NEZB 3KPSB 1DLHB 3IXTB 4O2FB 1BWWA 4Z78A 2E6QA 4DFHA 1EBPA 3VE0B 1BLNB 3I6KB 2VB5A 3W39A 2VLKB 3SN6N 3BDYL 2JB6B 3RL1B 3PWJB 4FXGB 5IF0B 3X12A 2H9GA 4LDLB 3KPSD 3I6LD 4UB0L 2DI9A 2VWEC 4WUUE 3MROA 5HI3D 2O5XH 5I1GH 4Z7QE 2VDOH 4YH6A 1JYXA 1CGXA 3U6RA 2VLKD 1WGOA 5IBLD 3T65B 3VI4F 1KEMH 5F7DA 3DXAE 4DQOL 5DD5H 1D6VL 4PJBA 1CT8B 1BX2A 3IAQA 1WWCA 5F8RC 1QA9A 3SGKC 1LK2A 4PRIA 4HG4K 2BVUA 5IEKB 2I60H 4U2ZA 5LAXA 3OZ9L 4DCQB 1ZHLA 3I84A 1R3JB 1Y0LA 4EDWL 4TULH 1ZXQA 4YFEA 1WIPA 4DVBA 2EDKA 4PJIF 5C09E 5CGYD 3CU7A 4YQXH 2C1OA 4NP4H 3RVWC 4QHMB 5ID0A 1OTTD 4WTWA 4LCUA 3NCFB 1OAQH 1YEHL 3MX0A 3VGEA 5FYKL 3QCTH 3BH9B 4LRIA 5JQ6L 1UWGH 5E6IC 3HI5L 1INDH 5EPMB 1NDMA 1P2CB 1T66C 3MRJA 3WLBB 3H42H 4TUJA 3KPPB 4MQXD 1UJ3B 4QNPE 1FVDA 1CE6B 2P5WA 1A7QH 4JPIA 1U95A 1VACA 4N5ED 4PJ8B 4U1KB 3F6LA 5CJXC 5JDSA 3VXPB 1RULL 2IPUK 1XIWA 4RGMB 3EUUA 2ED9A 5CJ8A 5CCKH 3DRQB 5L2KA 3EZJB 3VXRA 4OZ4A 4HDIA 4PJ8D 4QTHA 1UZ8B 3UJIL 3B9AA 3MRBA 3IDXH 4ZUVA 4CMHC 3GKWL 2NY4C 4JCLA 4L4VB 5HHOB 5I66B 3P9LB 2OK0H 1HHGB 1VCAA 5GRYA 2ZCLH 4LEOA 4N8VG 4F15C 5BRZB 5C0NC 2MPAL 5IB3A 3BW9B 1AQKH 1NANH 3LKNA 4JPVL 2QADC 5ENWA 3BSZH 4HIJA 3RKPA 6FABH 1EERB 4UILL 5FYLH 1FLRL 1T1ZB 4HH9A 4L4VD 4Q0XH 5C0BE 4XXCA 4DKEH 5E8EB 1ORQB 1U41A 3INUL 1JYVA 4U6YB 1FIEA 2IPTL 5BRZD 2VQ1B 5TE4H 5K59E 4ZS7L 1J8KA 2PCPA 2X42A 5JHLL 4XMPH 5I17A 4JM2A 2PR4L 2J3SA 1F90L 2VC2L 5FAAA 2DYPB 2XZAL 3BKCL 5JW3L 4P57B 3FO9B 5D8JL 3RVVD 3HZYB 5KVMC 1RV6X 4OD2B 5EIQA 4FA8A 3DO7B 3AFLA 3ARGC 2DYPD 2OTWA 1I3UA 3S4SB 1DUZB 1P1ZA 1KB5A 4GS7C 5AYQA 5EUOB 5D72H 5DMIL 4R4FH 4M7KH 3UXFA 3V8OA 5JUEH 3QA3B 4L9LA 3LIZH 4LPWA 5TE6H 1S5IH 2O5YH 1K2DB 4R8WL 1VADB 1MWAH 2J8UB 3ZKMD 4OV6F 5DD6B 2BVTA 5D1ZB 4WHYH 3F7VB 3BZDA 3HFMH 1OP3H 1PQZA 5JORB 4RWYH 3BIKB 5DSCA 1WSST 5D1XB 1HH9B 4YWGL 4QWWC 4UAOC 4MNGB 2YD1A 4S1RL 1S7RA 4X6CF 4XNYH 3FOLB 3LEYH 5JPNA 1ZA3A 2FX7H 4JJ5A 4FHBD 1P7QB 5E24E 5IUSA 3S5LA 5L6YH 5D1XD 1JGUH 1RUML 5E2UH 2G9HB 5DFWH 5KANI 1UJTA 2VO5A 1A1NB 5EZIH 3IXAA 1A0QL 3QUXB 5EUKA 4G8EB 1IEAA 4NO0B 1P4LB 4HWBH 1HSBB 1F4XL 1P7QD 1R5IA 2W9EH 3CFKB 4U1SB 1MF2H 5MENE 3PDGA 4TN9A 1KPUB 2Q8AL 3WFCL 4OV5A 4E0RB 3GIVA 2DQCL 2B4CC 3WJLA 1GGCL 3SJVE 1F6LL 1U3HC 2VR4A 1V7ML 3QUXD 4MDIA 5F9WC 4TPRH 1JE6A 4NO0D 4KVNL 5ETUB 4G6AC 3MOAL 4KROC 2Y25A 5F89A 1J8HE 1FN4B 2W60A 1MOEA 2Q1EA 4IBLT 5IMLA 4NC0B 2AEQH 2AJYL 4XWOC 3RP1A 4PJEA 2W9DL 2EXYD 1EFXB 3KJ6H 1A4JB 2PETA 3SKJH 4UBDD 4LU5H 2X09A 1BZ7B 3AC0A 3GMNA 4NKOB 3BP6B 15C8H 1OAUH 1QSVA 1MVUA 1U6AH 2MQ3A 4PJHB 3C5ZC 1EFXD 4O58H 2G60L 1VFBA 3P9MA 5C0FA 4EI5B 2QSCL 1NUFA 2AJVH 2UY7A 4OZFG 1SJHA 3VGBA 1TQBC 5HHME 3RI5K 3WN5C 1B90A 4Z5RB 3IFPA 4FFVC 3S96A 3DX6A 5A2LH 1QBAA 4EI5D 2MCG1 5CGTA 4LLUB 1CK0L 4PRNB 3EYOA 2PO6A 3PGFL 1HINH 4UTBH 3SQOL 4OUUA 5T1DL 1G9MH 1JNLL 1Y6NR 3Q48A 3U48A 2BRRH 1RUKH 1L6XA 3IVKB 4L8SC 3NIFF 4M93C 1UWXK 4B41A 1MIEL 5I0ZA 4EUPA 3B9KB 3W9DA 1EA9C 1AHWC 3H0TA 4MA1B 4JG1H 4U6VL 2RCSH 3EJZD 3TBVA 4YPGA 4AENB 1N3NB 4WW2F 1NAMA 1QYGL 4PJIA 2CIKA 4Y4FA 3ULVH 2F19L 1QFWI 5DUBB 3ZTJH 4GXUM 1FNAA 3QDMB 3B9KD 4FOMA 4LCWB 2Q7YB 4Z7UB 4AT6B 3WDHA 1FNGB 4P46A 2VLLA 4RFOH 4PJ9B 1KIRB 1WZ1H 4LRNH 1FHGA 3QDMD 3RZWA 2YHGA 5KVGH 3QCUH 4P3DB 3EO9H 4D9RE 2XTJD 1F3DJ 4JQXA 1ND0A 1B3JA 3T77A 3VRLE 4Y4HB 5DUMH 4YZFE 4PJ9D 3WEXB 4K8RL 5DMJB 5M95B 4GRWB 4KK5C 1FIGL 4I0CC 5EZJB 1JPTL 1H3PH 1VB9A 5EO0A 3O4OC 3FONB 3QJFB 2BFVH 2YN3A 3S98A 1OW0A 3ZDXE 3QDJB 4Y4HD 4JFPB 4O02H 3WD5H 4EVNA 3OX8A 1RJLB 2EO9A 4ODVL 1WC7A 3IU4L 2BOBB 5KS9B 4B53A 1JTTA 4MNHA 4CNIB 4NO2A 2CR3A 1I1AA 3DOSA 3TO4A 5CILL 2A6JB 3K8KA 1JZ4A 1DVFA 3JV4A 3O3EB 3QDJD 2WWMC 3MFGB 4GUPA 4UV4L 2NR6D 3CDGA 4FZ8H 4LIQL 4PREA 5DYOA 4F8TA 5EU7E 2ZOLA 1NC2B 2QR0A 3VXQB 1KIQA 1VFAA 4PS4L 4MGXA 3MR9B 3CX5K 1JFQH 4RMTA 1U8KA 4BYHA 1E4WL 4Z77B 5F44A 1ZK9A 2OJEA 3RWIB 1DUYA 1EBAA 5E8PB 1N7MH 4OLUL 3VXUE 1ZA6A 5FA4A 1NC2D 4DK6A 4QRSB 1D5XA 4V2BA 1QBLH 3L5WA 1WAAF 4RNRA 5DRNA 1FL5B 1MCFA 4OCYH 2XWJB 5JHDE 3MBEA 4R7DB 2P8PA 3D2UB 3LD8C 4MB5A 2C3GA 3UPAA 1AIFA 3BE1L 4QRRA 5TQ2H 3QUYC 1OWRM 4WI3A 5C70A 3TIDB 4JN2B 2VDKH 5TDPB 2HP4A 1DBKH 1EAPA 3FB6A 3CSBA 4OCRL 3IDYC 4QOKE 1QFHA 1MCKA 4KDWA 3WO4B 3D2UD 1S9VB 3DWTA 5DEGB 4NHUB 1FYHB 3HMWL 3PWPA 4APQA 4KAQH 5HDBE 1X5FA 2LVCA 4BZ1H 1TNMA 5J13C 4L8BB 4MQ7A 1C12B 5CSGA 5D7JB 1TXKA 3JWNC 2WK2A 5EN2A 4TQEH 4K3DL 1OF2B 1EO8H 3QXTA 5DK2A 3T3PF 3Q0HA 3PXHA 5FECB 3PQYB 3STBA 4FTVA 4D8PA 1T5WB 3QEQB 3ULUH 4ZFGH 2CDFB 3QIBA 5DRZB 4LSDA 3AUVA 2VDOL 4GAYB 3O6MH 3PQYD 1RHHB 2I9LB 4WFGE 2VAAA 3HE7B 3ISWA 3QEQD 2IMMA 4ZUTA 2XZQH 2P24A 2R2BB 2XV6B 5DD5L 5I1EL 2YC1B 1G7HB 2VDRH 35C8H 2VITA 4UI2A 1KTDA 1OGTA 5FB8A 2VH5H 1C5BH 4OFIA 4N8PA 4HAFA 2C1PB 2DQDH 3HE7D 3UJTH 1NKOA 3QIUA 3CVHB 2H8PA 5JIIA 4U6XA 2I60L 4HIXH 4B7LA 1GOHA 5ANME 1WFOA 3G5XA 3ZKXB 4YR6B 5HJ3A 2GK0B 4QRPE 2VLJE 2VDMH 3N06B 4TULL 4MCZB 3PWNA 1SVZA 5GGSY 4YQXL 5KSAC 4NP4L 2IH3A 3HZKA 1HQ4B 1FSKC 5I1HH 3FN0L 4JDZB 2XICA 4Y4KC 3QCTL 3NIGF 1UWGL 5BO1H 3U9PL 1MJJB 2EDDA 3EOTL 3RZCA 5I1IL 1HHKB 1INDL 3UAJC 1NLDH 3H3BC 3MOBH 4XRCB 1CDYA 5EBWB 4P2QE 3QUZB 2C3XA 5E1AA 4MS8C 2PW2A 3ECBA 4L1HA 4ERSH 1JTOA 2WLZA 3REWA 4L8CB 5FUZH 2ED8A 1C08A 3HC0B 3RDTC 5I74B 5JPMA 4EXKA 1N2RB 1Q1JH 3QUZD 2DM7A 2NXYB 3ARBC 5JZ7D 4KUCF 3DSFH 3DXAB 4XWGL 3IDXL 2DLHA 1DQLH 1MJ7H 3WCYA 5DD3H 2OK0L 1YMHB 4YHMH 2ZCLL 2NXYD 5CINH 1QG3A 4NQEB 4X0KB 3R0NA 5MHSE 4WW2A 1AQKL 3TWCL 1CFSB 3BSZL 1RZKL 5ACZA 1MHEA 6FABL 3CSPA 2HMID 4TVPD 5D7LB 3IKCB 1DJSA 4N0FB 4UQ2B 2ITDA 5DZLA 3O8XB 3MUGA 1AO7A 3FMGH 4NQED 4UT6H 4PJ7B 1T7WA 3BP4B 4NQSB 5TE4L 4RCAA 1HSAB 4OZIF 5HD8D 4XPTH 4FP8H 5D7LD 4DZBA 2O61B 3O8XD 1CWVA 4K7FA 5F7LB 2D31B 1I8LC 3TV3H 3L1OH 4X4YA 5C86A 2M8XA 3I3BA 5L0QB 3ARZA 2B20A 5D72L 3QEHA 3BIBX 3O3BB 4R4FL 2Z91A 1G7LA 5JUEL 3ARRA 3LIZL 2FHCA 1MLBB 3WS6A 4N5UA 1S5IL 4KV5F 5TE6L 2CXGA 3RQ3A 1MWAL 1PX3A 2IPKA 5DJCB 3GMMA 1DN0B 3HFML 3P11H 3SDCA 1I1CA 1AQDB 4RWYL 4KI5E 5GRVL 4Y89A 2ATPB 1ZWIA 3KPRE 4XNYL 5ESVB 3LEYL 1KC5H 1A7BA 2FX7L 3ZKNC 3OKMB 2X4TB 3KYKL 3MUY1 3CFJB 1OP5H 3NMEA 1CG9A 1ACYL 3BKML 3O41B 2MKWA 3PL6B 5ISZB 2ZKHH 3L3HA 5L6YL 5B39B 1JGUL 2I24N 3D0VB 4RDQF 5E2UL 1Q8MA 5EOTA 5GGVY 4POYA 4WTZG 1BVKB 4DTGH 3DVNB 5EBMA 4DWHA 1WAAA 5J9PA 4BM7A 1UENA 2BNRB 4F33A 5GQBA 3TC9A 2NZ9D 2W9EL 3STZB 4JEGB 1WCBA 2Y23A 3PL6D 4JQIH 5T1LA 5ISZD 3BMVA 3HMXH 1AFVL 4QGTA 4MSWA 3GFUA 5C3TA 2BNRD 4TPRL 1IGYA 3VGHA 5GS0C 2VZOA 1F4AA 3DX8B 3FFCE 2FEDD 1OB1A 3IFOB 3L6FB 2HN7A 1G84A 3MV7A 1TCRB 3GSWB 4X83A 5IJVA 3IDUA 2AEQL 3T1FB 3CXHK 3QAZB 2W65A 1KPVB 4AG4H 3KJ6L 2PXYC 4JG0H 3SKJL 2HRPH 4LU5L 4LOUC 3GIZH 3C2AH 2EYRB 3MRHA 5KTEL 4I2XA 2KKQA 3CFBB 4HFWA 4RGNE 1U6AL 2B39A 1T20A 5BV7H 4QCIB 2K7QA 1FFOA 4LP4A 4Y5YB 3MRIB 2B5IC 3EFFB 2AJVL 2EC8A 4LLMB 4QHLA 8FABB 5J57B 3MTRA 4BH8B 3NH7H 4BH7A 4JFFA 2QKIB 1S7SA 2X1XR 1QFWL 4Z78B 3SDDA 3P4MB 3AS3A 4KJQC 2W07A 1U91A 3W39B 4OFPA 1HINL 4UTBL 1P4BH 5JTWA 4F9LC 2QL1A 4WDIA 3ZHLA 5CEZH 3X12B 2H9GB 1G9ML 1OP3K 2BRRL 1UB5A 2RBLA 2VOTA 3MROB 3IB4A 1ZVYA 2DIAA 3AXLA 2A6IA 1FGNH 2F8VA 5DC9B 4JG1L 2RCSL 5F7DB 4LSVH 3RUGB 2CGRH 3BP7A 5K33A 1J8HB 1S7TA 4RFNC 5JR1H 1R0AL 1JVKA 3TBWA 3O2VH 3ULVL 5C2BH 2N7AA 3MLXH 3KPQB 3K1KC 3M17A 3R8QA 4OF3A 5IW3A 1QA9B 3MRQA 1LK2B 4PRIB 2SEBB 2IMNA 4OSUH 3MUZ1 2GTWA 4RFOL 5EA0H 1EPFA 5LAXB 4Y88A 1VDGA 4Z7WE 1WZ1L 4LRNL 3DURA 3UX9B 1ZHLB 1W0WA 1MFNA 1Y0LB 5K59F 4OFKA 5KVGL 3QCUL 4OF6A 3EO9L 4JANA 3LS5H 4DVBB 4PRID 3BUYA 1BJ1H 1TZIA 2C1OB 4Q6IA 4QHKI 1HKLH 1KUMA 4LCUB 2JF1A 3RWDA 1N4XL 1H3PL 3B5HA 3NFPA 2BFVL 1LO0H 3WIIH 1JNNH 4ZXBC 1QVOA 2EDHA 3MRJB 4X9BA 4O02L 3WD5L 4TUJB 4JFYB 1UJ3C 1FVDB 2P5WB 1U95B 1ZGLB 4PJ8C 4PV9B 1QSEA 3ZKQD 2WUBH 1U36A 4X6FA 4XP5H 2YSSA 4XHJC 4P3CH 1XIWB 3V0VA 4RGMC 5JO5A 3LB6C 4NN5B 5I6XC 2E9IA 4FZ8L 4PJDE 5L2KB 2R4RH 2P5WD 2P5EA 5C0CE 4OZ4B 4HDIB 2X4OB 4QTHB 3O6KL 1G9NL 3PHQA 4GBXA 3MRBB 4ZUVB 3V6OC 2YWYA 2C9AA 1P69B 1QPXA 4OZIA 1JFQL 4XCEB 2DTMH 1XIWD 4NQVB 1ZT1A 2A38A 1X5JA 4LEOB 5L2KD 5JXEA 1N7ML 1CXLA 2RIKA 4P49A 4NFCA 5BJTA 2DM3A 3LKNB 4HZAA 1ODAA 5ENWB 3Q5OA 1QFUH 4HIJB 4JKPH 2BC4A 1QBLL 3DMMA 2IFGA 3HAEG 5J3HD 4FFWD 4HH9B 2E9BA 4OCYL 4WCYH 4MAUL 4PRDA 3VGFA 1RZJH 3RKDC 4TUOB 3KGRA 1DL7H 2E27H 5E2WH 5TQ2L 4LL9A 4NCDA 4KHTH 1HOCA 1DBKL 2JJWA 3RWHA 4PRPB 3P30H 1ROWA 4TSBH 2YEZB 1BIIA 1KV3A 3ZSTA 2X1WL 5GRUL 4KAQL 4D9RD 2XKUA 1NSNH 4GOSA 2D7TH 2GT9A 3BOVA 2ESVA 4JM2D 3ROOB 2P7TA 1MRDH 1MSPA 4PRPD 2WWKT 4CGTA 1JZ2A 1EO8L 2PTUA 1P1ZB 1KB5B 3QQ3A 1LMKA 4L9LB 3HTLX 3U2SA 4ZOCA 4F2MA 3ULUL 4ZFGL 2P46B 5F7HA 4OFVA 3MNZA 2P8MA 5D1ZC 1CD8A 1PQZB 1JHTB 1W0VA 5DSCB 1KN4H 2GY5A 5BOZG 4Q6YA 3RGVA 2OI9C 1KCLA 1S7RB 4LGPB 3HKFA 3QPQD 1ZA3B 4RMVA 4JJ5B 2ZJSH 3VWKC 35C8L 5DTFA 3FRPA 5T3ZD 2WUCH 4H20H 1SYSA 2VH5L 2IAMA 2MWCA 3S5LB 1MFCH 2DQDL 5HY9A 2E8ZA 5CJOH 1N5AA 2EEDA 5MEOA 2WBKA 2GI7A 5EUKB 2I9TA 3ZYOA 4HIXL 2ITCA 1IEAB 3MLRL 1WFNA 1R5IB 4D9QE 2VDML 4OV5B 3GIVB 2V5RA 2V5YA 3O6LH 5J0BA 5TFSH 1RJYB 4FXLA 4H1LB 3VFMA 1WISA 2Z8WC 2APBA 4LNRA 1YEJH 3AMLA 5F89B 3JTSB 4UBDC 2VKWA 5BO1L 3TIEA 1IRAY 2W60B 4PGDA 1QO3A 3MOBL 5ALCH 4Y7MA 4OI7A 4ERSL 3PWLA 3MJ7A 3NCYP 1QRNA 3BUTA 1JZ5A 5FUZL 1IGFL 2NXZB 3GMNB 4Y16A 5F7KC 4M4RA 5L8KB 4KKAC 1MVUB 1Q1JL 1M7DA 2ICCA 4W6XB 4HJ0C 3DSFL 1VFBB 3P9MB 1SJEA 5GJSL 4HGMA 5C0FB 3OKEB 3HR5A 1DQLL 5IB5A 1SJHB 1ULVA 2OL3B 1MJ7L 5HYJB 3GRWL 4P4RA 4X4MA 5MEPA 1CXKA 1EH9A 4M43L 1MLCB 5DD3L 3A6CH 3E8UH 3S34L 4NRZA 4C4KT 3IFPB 2CLZB 4JY5L 3ZDXF 1IC5H 1NCDL 4IRJC 3O45A 1FH5L 3ESVF 4FQQB 1KTRL 4X6DF 3DX6B 3S96B 4WFFD 3NZHH 2DQIH 5IM7A 2FX8H 4M6MH 4UU9A 1IVLA 3EYOB 5HYJD 4LFHD 5INDA 2QJDA 3N1MC 4OUUB 1AC0A 3HE6C 3GHEH 5GGSB 3FMGL 5CBAB 1FC1A 1KG0A 4MJIE 3MXWH 4CMMB 4XPTL 2E7MA 3QI9A 5F1IA 3IFNH 1F4YH 4EUPB 1IKNC 3W9DB 1ZGLM 3H0TB 1ADQL 3TBVB 5B38B 5B21A 4OKVA 3N1GC 1T7VA 1NAMB 2HFGH 1CFBA 4IOIA 3HRZB 4TSCH 4PJIB 5FDWB 4HIHB 2CIKB 3A6BL 4Y4FB 3BJ91 3TV3L 2VXQH 1OTSD 3MYJA 2DMCA 1OARH 3L1OL 1C16A 4E9LA 2NYYC 1LEKB 5FKAB 2OSLB 2JIXB 2Y5TA 1QFPA 4P46B 2VLLB 4ELMF 4Y4FD 3HC4L 1JWUB 2XQYG 3IJSB 3CFCH 5TDNA 4MD0A 4WO4C 3LKPB 2X10A 3C87A 3LDBC 1SBSH 2W0KA 4Y4HC 4AJ0A 4NQXA 4P46D 3TPKA 3MRGB 3HI1A 3JV0A 1PD6A 3ARDB 5EO0B 4JO4H 2MQ0A 4LLWA 3RVUC 1KC5L 4EVNB 2HYMA 3OX8B 5DO2C 2H3NB 1WC7B 2MMXA 2WBWB 3WLWC 3TN0A 5I75B 2EEBA 1DBMH 4UV7H 3ARDD 4MNHB 2CDEA 1I1AB 3TO4B 4L3AA 3E3QE 4M3KB 5IEHA 1DVFB 3JV4B 5AAMA 2Y6SD 4GUPB 4K3JH 5HSFA 5D71H 5CAYB 4PREB 1DEEB 2MJWA 4M9PA 5IB2A 2C26A 2ZOLB 3TZVC 4JQIL 3OR7A 1KIQB 1MPAH 1VFAB 1I1AD 3TO4D 4IDJH 3ET9F 4R0LC 3QUKA 1RIUH 5F88B 2Y7QA 4QXTB 1U8KB 5ITFA 1FFPA 1DVFD 2ICWI 4GRMA 5IBUG 2OJEB 3D3VE 1DUYB 3PDDA 3VFGL 2X4PA 4H8WC 4M7LH 1GGIH 1ZA6B 5FA4B 1G6RA 4U7KA 1OHQA 3L5WB 4IHOA 3UDWA 4RNRB 2PW1A 4CW1A 1NUNB 2FD6H 3HHRB 3MBEB 1N5YL 2DJUA 1E0OB 3VMPA 4AG4L 3L7FA 3GIZL 1EAPB 3C2AL 2I07A 4XXDA 1YN6A 2HLFC 3MBED 4XCNA 1YA5A 3WO4C 1AE6H 1T22B 5BV7L 5I9QC 4OM0H 1KOAA 1X44A 3AS2A 4PFEA 4Q2ZA 4MA7L 5FOJA 2IFFL 1X7QA 4TNWK 4HKZA 5D7JC 3GSXA 4KTYA 2YD4A 4M7JH 3NH7L 5CZVH 3GSOB 4AM0A 4XAKD 1YNLL 3R06A 4P23C 5I16A 2QQLL 3PWPD 4LCYA 5DK2B 3BPNC 3V4UL 2FJFA 2IEPA 2IQAA 4RRPA 3SCMC 4OD3H 1E27B 3V7AG 3A0OA 4K7PX 5IFAH 5IB4A 5IKCA 4D8PB 5CEZL 3SGDI 3VXNA 1JL8A 2DRUA 4NT6B 3C6LA 2GW5A 3QIBB 4TTDC 3C8DA 5FO8A 3P2TA 2VAAB 5DJ6A 2JJUA 4ZUTB 5D2LE 3QRFM 4OLYL 2CGRL 4ZFOL 5JR1L 1OP5K 1UYWH 3O2VL 4ORGB 2M1KA 2GTZA 3QIBD 4BKLA 2VITB 1KTDB 1OGTB 3MLXL 3QWOB 5AWNH 5FB8B 3LKSA 3HNVH 4EI6A 2RFXA 2UZXB 1M7IB 1U8HA 1FNSH 3ZE0E 1BQHG 3BD4A 2H8PB 4OSUL 4U6XB 4HKXA 5EA0L 4TUKH 3G5XB 3WJJC 5HJ3B 1RVFH 5J6GA 3O11A 5KSBF 1XR9A 1YJDH 1MJ8H 1GOGA 3PWNB 3F62A 2IH3B 3HZKB 1HKLL 3VW3H 3OB8A 2APVA 3ARVA 4XNXL 1LO0L 4XVTH 2OJZH 3RZCB 2BXZA 4HS8L 2KL6A 1MCWM 3LHPH 5DQJB 3QUZC 1R5VA 4Y5VA 2PW2B 3ECBB 3KPLA 5F1NB 4OZGF 4X6DA 1A02N 3AROA 3HR6A 4XP1H 3REWB 2WUBL 5TJWK 5JW4N 1C08B 2UZYB 4P3CL 4F7PA 4OF7A 1G7MB 3RZCD 5JPMB 1K8DA 3BJLA 4MJ4A 3NVQA 5H37H 2R4RL 5I1KH 1GGTA 1U8QB 1X3DA 4DGYH 3LZFH 5ALBH 1QTYT 2R2EB 4N9GB 4KK9C 4BELD 3CXDH 2IWGA 2AXFA 4IIQA 2VN7A 3KLHD 3SOBH 5LVEA 2DWDB 1FAKT 2BJMH 3LN9A 3R1GH 4WY7H 5F9JB 1BFSA 1QFUL 4JKPL 5ACZB 1HZHH 4Z7WB 3QR2A 4X8JB 4WCYL 4YK4C 5CBEA 4F9PC 1IEBA 2ITDB 2NY1C 3O8XC 3MUGB 3E0GA 4OI9A 3HI6H 1MRCL 1DL7L 2E27L 5E2WL 3T2QA 1Q9KA 1NCNA 4ELMA 5LQBH 3FQNA 2FH8A 4OLVH 4DZ8B 2V2TA 2EE3A 1TVDA 4DZBB 4HGKC 1D5MA 2WAHA 3P30L 3KYOB 2C3VA 1VEPA 1R3KA 4TSBL 4MD5A 5LWYL 3BAEH 4K7FB 3U1SH 1P84J 1NSNL 3O6FB 4KDVA 4KKLC 4X4YB 3RA7H 1MRDL 9CGTA 5FHAH 3OHXB 4X80H 5L0QC 1MHCB 1NGZA 3TCLB 3QEHB 2Z91B 1G7LB 3O6FD 3SE8L 4Z7NE 1H3GA 3PNWA 5CKGA 3SPVA 1NBZA 4LQ1A 2A6KA 5IESH 3GMMB 2OR9H 4M1CD 4GO6B 1MIML 2YD5A 1TQCB 1K4DA 4NUJA 4LPTA 3SGJA 4YXHH 1FBIH 5FEBA 4MWFA 1ZWIB 5FHBH 4HIIA 5I18L 1CN4A 3C2SA 2FHFA 4ONGH 1EEQA 2ZJSL 1OTUC 2WUCL 3KWWA 3PL6C 3L3HB 1MFCL 5ESAA 2GKIA 4WU5A 3ZL4H 2A6DA 5EOTB 5CJOL 5EBMB 2YK1H 3RVTD 5J9PB 4LDEB 1BD2E 5C9JB 4F33B 2YPLA 4OLWL 3QFJA 1WCBB 4KZDH 5GXBB 2FEDC 5HI4C 3RWFA 1BAFH 3O6LL 2R9HD 5TFSL 1MVFA 4MSWB 4QRPA 4NCC1 4JM4H 4LHUG 3TBYA 2H26B 1IGYB 5EOQH 3V4PH 1YEJL 1OSPH 1FYTA 1RUAH 1OB1B 5EO1A 5T1LD 4F3FA 1Q9OA 5F7MC 2OZ4H 2VL4A 3WFHA 5IJVB 1CL7H 4XPBL 5ALCL 3QAZC 4F7CA 4HWUA 2W0PA 2EC9T 3MYZA 1IGMH 3NACH 2VXSH 4PB9H 3A67H 4P2QA 3VG9C 1U8MA 2QHRL 1I1RA 4PTUA 3MRHB 4KQ3H 4HFWB 3SDXE 3OKDA 4KJPC 5FYLE 3RL2A 1CU4H 5C08E 4PJAE 1GSMA 1FFOB 1HIMH 3HN3A 5KVEH 4Y5YC 1LD9A 3SO3C 1MCOL 5L8LB 2NW2B 4N8VA 3A6CL 3FT3A 4BH7B 2AXGB 3GBNH 4JFFB 1ZTXH 4UIKL 1S7SB 3KXFE 4WFEE 1IC5L 3TVMA 1ZEAL 2ID5A 2PYFB 4ZUSB 2FX8L 4M6ML 5GGQL 1U91B 1CR9H 4K71B 2IANE 4WDIB 5EU6E 3UEZA 4JFFD 5IHUH 3GHEL 2AJZB 4G9FA 1UB5B 3QISA 3MXWL 4J3OC 5FYKD 4PLKD 3AXLB 2A6IB 3C5JA 2CH8A 3S3JA 5GZOC 4HUKB 3IFNL 3UO1L 1F4YL 3MV11 4U1HA 3VFVB 5KSBA 3BP7B 1S7TB 2HFGL 5EO9A 2IALA 4JFQA 2CLRA 2EDFA 4NKIH 5C0EA 2VXQL 1OARL 4PGJA 1BFOA 3M17B 2EH7H 1AD0A 3PHSA 1H8OA 3VGGA 1J0IA 3PABB 2Y07H 1YEFL 5K9QG 1FPTH 2GTWB 5H2BA 4ZUWA 3DURB 1VEOA 4HK0B 5BZWA 3CFCL 1W0WB 1H3UA 5BMFL 4LP5A 1XMWA 5FO9B 4OZGA 4V1DE 1SBSL 5IOPA 5I15H 3JWDC 4PG2A 1AKJA 3BUYB 1TZIB 4G3YH 4Q6IB 5EIIA 3RWDB 3RVXD 5LBSH 3HLAA 3ZLQC 3NFPB 3EHBC 4JO4L 5J6HA 4NYLA 1K5NA 4ODHL 4JFEA 5CP7A 3RIFF 1LO3H 1TNNA 1A3LH 2CK2A 1V3JA 4E41E 4MNQE 4NZUH 4TVPH 4Q9CA 2LAGB 4KUCD 4HUNB 1DBML 4UV7L 4WI8A 1QSEB 2IBZX 4X6FB 2YSSB 4U0RB 4QRUA 1IZKA 2O26U 3IS0X 4NKQB 4NN5C 1BF8A 4W70A 5D71L 1TCMA 4JY6A 2P5EB 1JGVH 3TH4T 3GO1H 3K80A 5ESQA 3PHQB 4GBXB 4KVCH 3S6CA 3DI2B 1MPAL 2BSSB 1QSED 4IDJL 1RIUL 3OQ3B 1EFQA 4OZIB 2QBWA 1UH2A 3BGMA 4LASH 3TBSA 4LCIH 1ZT1B 2F54A 5IVXF 4F57H 4HXBL 1NMCC 3MV01 2P5ED 1FZOA 4M7LL 1GGIL 5BJTB 4GBXD 5DK3A 2BC4B 2FSEA 1UCTA 3DMMB 2Z8RA 5CHNA 1WV7T 3QDHA 1RZGA 1O0VA 4K94C 2HVJA 2FD6L 3SQBA 1UXWA 4IMKC 3BZEA 1RZIA 3BWAA 4NSKB 4YDVB 2W59A 5JXED 5EU4B 1OM3H 5HYEA 4QTIH 2HT2D 4P2RE 1UB6A 3DMMD 5T33H 2F8OA 3RWHB 4K3EH 3UYRH 4ZAKA 3MLUH 1AE6L 2H6PA 4WWID 4OM0L 4OZFA 3D18A 5E8NB 3KYMB 1PLGH 1XF2B 4XAWH 3MXVL 4OLZH 2C7UA 2ESVB 4M7JL 2P7TB 4M6NH 2X44D 5CZVL 4NFBA 4GXVL 5JDJA 2VDLH 1S9WA 1F00I 4JKLA 3O3DA 1CLOL 4OD3L 5GS1C 5SX4H 2P47B 2ESVD 4HUWB 3U2SB 3ULVE 4DUVA 3CZFA 1G7PA 5EU7C 1QRKA 1X5LA 5DFTA 3MNZB 3UTQB 4ZNEE 5DI8B 2WBJC 2HKFH 2H1PH 3BGFC 2FX9H 1DBJH 3OKNA 1W0VB 3MMEA 3CDYA 3VXTA 4FFZH 4BUHA 1JWSB 43C9A 2R69H 3Q2CA 3WIFA 4MXWL 3AS1A 3D87B 3C8HA 2GCYB 4XMKH 4HWNA 5DTFB 3SDAA 1ZLUK 3PV6A 3GRWA 3PIQB 1QLFB 2DS4A 5AWNL 1SYSB 2JJVA 2IAMB 1YYML 2IADB 1WK0A 5HY9B 1FNSL 1NGXA 1N5AB 1U58B 5MEOB 2XPGB 4TUKL 3FQUB 1RVFL 3VXME 3CVIH 5B3JF 2IAMD 4AEEA 4DJMA 5EZOL 3E6HA 4OCMC 1YJDL 1MJ8L 3MRRA 1XCTB 3VFMB 4BSJA 3VW3L 1QPPA 3CC5B 4G43B 4LNRB 1B0GA 2AVGA 1YPZF 1ADQA 3TIEB 3FAWA 4PGDB 4BFBD 3ZDZE 3EYQD 1GRWA 3LHPL 1IBGH 2VZ3A 4L3EE 3H9HA 4PJCA 1SEQH 3PWLB 4XX1G 3SBWC 5KN5A 1QRNB 4XP1L 5ADPH 3FO0H 4I1NB 4CRPA 4PY7A 2NXZC 2Q87A 4XCYA 4Y16B 4HS6B 4M6OL 1P9MA 5D2LB 3QIWA 1LK3L 3MCKA 1AH1A 5I1KL 3FTGA 4DGYL 3WSQH 1QRND 3HR5B 1T21A 4PLJD 5ACMA 3CXDL 5MEPB 4Y16D 2DQJH 4NRZB 3OWEA 1EV2E 4JN1H 5GRZA 2A77L 2ZNWA 3R1GL 1S9XA 1RU9L 4WY7L 1DDHA 4K55A 1CD1B 4WIQA 3GBLA 5IM7B 1UM4H 1ERNA 1HZHL 5INDB 4PRHA 5E03A 1KBGH 4CJ0A 1I85C 1EHXA 4K8RD 3ETBF 3T0VA 2F74A 2AV1A 1KG0B 4EBQH 3KG5A 1T1XA 4WI4A 1KJ2L 2XN9A 2Y4SA 2Q20A 5LQBL 5F1KC 5D4QA 1H9VA 5BW7C 2CJUL 1TVBA 4L4TA 1TPXB 3BAEL 3UBXG 3U1SL 4IOIB 1LE9A 5K9QI 4M7LT 2P49B 3MYJB 1CTOA 1C16B 3QI9D 3RA7L 3HG1E 3TNMA 2BMKB 4P2CG 3ARFA 5FHAL 4GKZB 3ZMRA 4P9ML 1XH3A 3OB0H 4KH2A 3OPZL 3S35H 1OVZA 4X80L 1CXIA 1FP5A 3PWVA 4KDTC 3GMOA 1NCBH 5BXFB 5J11C 3AU1B 4PG9A 5TDNB 5FYJU 1XGUA 1ZT4A 3ARTA 3IGAB 1W72L 4R4ND 1BVLA 1T5XB 1BBDH 1A6ZA 4KJWC 4NQXB 3DYMA 5DA4A 2EXWD 3P4OA 2ZWLT 1F3JA 3KS0J 3F65A 1PY9A 4PB0H 4LSPH 2WIMA 1IM9A 1FBIL 2A83A 3ARDC 4LLWB 4ONGL 2VQTA 2FECL 1K6QH 5IVXA 3I3EA 4UUJB 2KZWA 1AGEA 5DC0A 3TN0B 3K4DA 1CDJA 3ZL4L 4WV1A 2CDEB 4HC1L 5HGGS 5F21B 3QCVL 2PTVA 5IEHB 2ED7A 3HNSH 1JBJA 4ETQA 5F6HI 4ONFH 1S5HA 3FQRA 3TN0D 3MRFA 5IB2B 1E6JH 3S8WA 1BAFL 3OR7B 2OS7A 3QUKB 1I8KA 2Y7QB 3OKLB 4M5YH 3RY4A 5K9JH 1FFPB 2JLLA 3H3PL 4EOWH 4GRMB 4JM4L 5EOQL 3V4PL 4L5FH 4C59B 1OSPL 1RUAL 2OZ4L 5IVNA 1NEZG 2PW1B 4Q9QH 4CW1B 5FYKU 2IG2H 4JPKH 3MBEC 2J88H 1YC8A 3ZE0F 4KZEH 3FN3A 5IQ7H 3MGOA 1CGUA 1T03H 3NACL 2VXSL 2H2PC 4PB9L 4GG6A 3A67L 3VXSE 4EDXA 3L7FB 4ENED 2KBGA 4KI5C 4KQ3L 4XCNB 2JJTA 3GM0A 4F37F 1IEHA 4TNVK 1W8NA 1HIML 5KVEL 1T6WA 3ILPA 1X7QB 1V05A 4G42A 4WENB 4HKZB 4YDLB 3QHFH 3RX8A 3PP4H 2AQ2A 2V5SA 1IGJA 3GBNL 3WS3B 1ZTXL 3R06B 5I16B 1AY1H 4LCYB 4S10A 3L5HA 2XRAH 1T1YA 4PLOB 2IQAB 4I8DA 1BD2B 1CR9L 2ARWA 5IKCB 1D7FA 4DKAA 5IHUL 1FVEA 5F70A 3VXNB 3UROR 3C6LB 4BSWA 4HS3B 4Z76A 1C1EH 4LAJH 3RJQB 4IRSB 5IFHL 1BD2D 2VZUA 5GZND 4OJFH 4HF5L 3IDGA 5KOVC 1ZMYA 4B7IA 3ZKSD 4I9WE 2FGZA 1GC1C 3C6LD 5FGBC 3KPMA 5AZ2H 2FATH 2GTZB 4NKIL 4M7ZB 4BKLB 1N59A 4A2LA 1CXHA 3LKSB 1R5WA 2EH7L 2I26N 1C8PA 3LVEA 4DGVH 4EI6B 4IM8A 4Z95L 3EYFA 1FNHA 1YPZA 2WANA 1U8HB 4ZSOB 2YUWA 2NY6B 3AREA 1J10A 1FPTL 1LQSR 1LGVA 3GSRB 4RGNC 5J6GB 5E8OA 4WGVB 3U36A 2VZVA 3S36H 3TPUB 1XR9B 4X9GA 1IGIH 3E6FA 4XP4L 5I15L 5E1HB 1PVHA 2NY6D 3GDBA 3QH3A 3QQNA 5I8KH 4G3YL 3EOBB 1A6UH 4P5TA 2GSIA 4S2SA 3KXFB 5KVDH 4HUMB 4ZMAT 1KIPA 5LGJA 1IT9H 2AS5M 4OCLC 3OMZA 1W0YT 4ELKA 1LO3L 4NM8H 4U1GB 1GCFA 3JV6A 3DBXA 5AEAA 1A3LL 1R5VB 5HDOA 4Y5VB 4NZUL 4TVPL 2IH1A 1OAZH 3KPLB 1HKFA 4WTZA 2Y06H 4N8CH 4J3SA 4X6DB 5FGSA 4K07A 1A47A 4Z7NF 4R2GB 3RY6C 4GSDH 4F7PB 1NJ9B 2BSRA 3K46A 2LQRA 3W0WA 2R56H 5E95B 3R8BB 1HXYA 5ID1A 1JGVL 3GO1L 4NGHH 4CVUA 7FABH 4KVCL 1MWAB 3MRDA 1I8MA 1L0XA 1KYOJ 3UC0L 3CSGA 3O4LA 4PBWD 2AXFB 4F57L 4NZTH 4IIQB 1OP9A 4N0UA 1HXMA 4P2OA 4LVOC 3NA9H 3SGEH 2WINA 1NAMH 3S4SG 4HLJA 1IEBB 1QR1A 1YN7A 1GL4B 1X5ZA 4PPTA 4PJGE 5CSZA 2APXA 1BVZA 1OLZA 2N7BA 2YPVL 3GMRA 2UUDK 1OM3L 1EO5A 1Q9KB 4QTIL 2IBGA 1KXVC 3STLB 3FQNB 5T33L 4GAGL 1D9KC 3UYRL 1RI8A 1D5MB 4KPHH 3I2CH 25C8L 2EYSA 1R3KB 4MD5B 5F71A 5CEZE 5J1TC 4PBVC 4XAWL 3FO1B 1QEWB 2Q86A 4YXLH 3WIHA 3O6FC 5HHPA 3TYFA 5CKAA 1HWHB 4E41B 4MNQB 3SGEI 1NC4A 5EU3A 5D9SB 3DETD 5EOCL 4HQQL 1DSFL 4NKDA 5E2VH 2VDLL 1NGZB 1GGBH 1XF4A 1NCTA 2EDBA 4M1CC 1CBVH 3EBAA 3QXAA 1DR9A 2QSTA 4G8GA 2X70A 3SPVB 4E41D 3E2HB 5IQ9A 4MNQD 4AQOA 1KELL 4MJ6A 2FBJH 2ZUQB 4Z7VF 4JB9H 2A6KB 3Q6FA 4KK6D 4W6YB 2W0LA 2HKFL 2H1PL 3C09B 4FQXC 2FX9L 5ECJE 4ISVB 3N9GL 4CJ1A 4PJAF 3G5YA 1K4DB 2VISB 4NUJB 4YEEA 5D6DA 5T1MA 4OKDA 5FGCE 4EN3B 4P9HH 3VWJA 4KMQA 4FFZL 1HCVA 3IJHA 2A2QT 2DL9A 4MWFB 2R69L 4NQCE 3SO5A 4HIIB 3VFWB 3MUJA 4XI5D 2YD9A 2IGFH 3DHMA 1H0DA 4NNYB 3GJFH 1V3MA 2ZUUA 4Q97A 2BHZA 4XMKL 5E4EC 1BIHA 1T83A 5H94B 2BHUA 3KWWB 5DQDH 1X4XA 4EN3D 3LS4H 1Y6MR 2VTFA 5SWZE 4WU5B 3GKZA 1YMME 4P2RB 4P5MB 4FABH 4LSQH 5GSVA 1F3RB 3WFEH 3PG2A 3QFJB 2FJGB 4XNZC 3F12B 3EDKA 3RWFB 3CMGA 5KSUA 1MQKH 4DKDC 4D3CH 4P2RD 1JPFA 4JRWA 4HWEL 4OAWA 5GSRA 2YPLD 2UV3A 1UKQA 3QFJD 3SKOA 5IG7A 2DJ4A 1INEH 3R4DA 5IP4A 2W1NA 5HHNA 4PP1C 4YBHA 1Q9OB 2MOVA 5J8OA 1DBBH 1R3HA 4F7CB 2JJSC 1IBGL 3KS0H 1SEQL 3B9DA 5SV3A 5ADPL 3FO0L 1GHFH 1U8MB 2VL5B 2VSDA 3TYGH 5J7CC 4RAVA 4N9OB 2N1KA 2VJXA 3ULVD 5FV1L 1J1PH 1IQWL 5H35A 3RL2B 4HAGA 1I8IA 1OSZA 4JQVA 1INQA 5ICXB 1LD9B 3WSQL 5LGHH 3BIAX 2AK4A 3B2UD 2DQJL 3N85H 3FT3B 3S37X 4JN1L 4H88H 5TH2B 2X9YA 3KHOA 1WZLA 2FO4A 2MCPH 3L3OB 3TVMB 3HAEA 4PLKC 1MHHB 1RURH 2ICWA 1UM4L 2BZDA 3S35X 3FKUS 3MRMB 1IC7L 5B8CC 3QDGA 2CUHA 4K71C 2UWEF 1KBGL 3H9YA 5INCA 2D7QA 4XBGA 4U33A 3TVMD 4G9FB 4EBQL 1ZVSA 2B2XH 3P0VH 4WGWB 3OXRB 1U3JA 1FZKA 1AR2A 4HCRL 1KJ3H 4WI5A 3MV9E 4LGSB 5KSBB 1KN2H 3CD4A 3GNMH 4G9FD 2Y72A 3BPOB 4WWKB 2IALB 1FAIH 3MRCB 4JFQB 1WITA 4O2EA 1BFOB 5KVFL 4NWUH 1AD0B 5HHXH 3N1PC 2XG4A 4F7MB 5I1AA 3TJHD 1J0KA 1P84K 5H2BB 1CE1H 1NCBL 4ZUWB 4CDHA 4KRPC 1GOFA 2HJKA 5K9OA 4DKFH 3RVXC 5BZWB 4WTXA 5GRJH 3MV8B 4NM4H 4OZGB 1V7NH 1CDCA 1R3LB 2VLME 5IJKC 5EU5A 1MEXH 1AKJB 1BBDL 2AP2A 3MO1A 4XMLH 5EIIB 1TENA 4I77H 1NFDE 3RIAF 4PB0L 4LSPL 3HLAB 3MV8D 3U7YH 2PN5A 5J6HB 4NYLB 1K5NB 2BCKB 5CP7B 1AKJD 1BZ9A 4P5KA 4XNUH 2J8HA 2IJ0C 3SY0A 3QXDA 4U31A 5J12B 5HDQL 4UT9L 3FT4A 2YUZA 4KKBD 5F96H 4JFDE 4YHIA 5D96B 4JPWH 4WFHE 2ZOKA 5D1QC 5I1LA 2P42B 2BY3A 3H6JA 4OM1H 4XCCH 4QRUB 4X7FC 3KPOA 4JFED 1URLA 5J1AB 5F3BA 2RAMA 3CK0L 4ONFL 1VFMA 1EMTH 1NFIA 4JY6B 1MH5B 1CGVA 1RFDH 3ES6A 3F7YA 1E6JL 5ESQB 2AEPH 5C0GA 5L2JA 4R7NA 3B3IB 3BGMB 4M5YL 1I3GL 3TBSB 3KPSE 2ZZUT 2VRAA 3I6LE 4EOWL 1M7XA 1F6AA 4XH2A 2JELL 3VH8B 1XGPA 4ZPTA 3U4AA 1LP9B 2VLKE 4I5BA 3ULUD 2FSEB 1H5BA 1RZGB 2HVJB 2HFEA 1HEZB 1D3CA 3FCTB 1LO5A 5E6YA 3DYOA 3BZEB 1RZIB 3BWAB 4BSVA 3AY4A 4KZEL 5C0AA 4L29A 1WJ3A 1J1XH 3MLVL 1MREH 1T03L 1QSFA 3ZE1F 5K93A 4LVHB 4QXGH 2BVOA 5JXAH 1BGXH 3I3DA 1BM3L 3QNXB 4XHQA 4P59H 4OZFB 3C9NA 1HWGB 3D18B 3IRPX 3DPBA 3VFPA 4Z7VA 5E9DB 2MKLC 3TH2T 4BFIA 1S7VB 3EDJA 3QHFL 3L3JA 1XGQA 3OB0K 3PP4L 4ZAKD 4U1IB 2DI7A 1CZ8H 2HT3C 4NN6C 3CGTA 1UA6L 5E9DD 2XRAL 3E3QC 3ZDZF 4OGXH 3O3DB 2ARJA 4W4OC 5C6TL 2FH6A 2DB8A 3KYAA 1G7PB 5I2IA 3RBGA 5BZDA 5TQ0H 5AD0A 1C1EL 4UNUA 2V5TA 3QQ4A 4TOYH 1FFRA 5DVNA 4I18A 2BVQA 4X7SL 3MMEB 1KEGH 5FYJH 3VXTB 4OJFL 4WI2A 3ABZA 3WIFB 1KJMA 1MRFL 3BDYH 5HGHB 5DMGD 5AZ2L 1YEDA 2FATL 4MX7A 3LCYA 3MQIA 5IROA 3PV6B 4AY0A 5MP6L 1I1YA 3DJ9A 2VSCA 5TDOA 4DGVL 2JK5A 2WP3O 1BFTA 3FHAA 1NGXB 1G9EA 4HK3N 1SM3L 1RIHL 1HNFA 3TO2A 1A5FH 1KJVA 2Q6WA 2VUOA 3SDAD 1FZMA 3QHZH 4NPYB 3V6OE 5T5NF 3E6HB 3S36L 3O9WC 4L4VE 3MRRB 4R6UA 3QEUA 5I8KL 2A9NH 1KJ2A 5BRZE 1B0GB 4YDIL 4JZJC 5KVDL 3OZ9H 2XG5A 3AB0B 3CFEB 1ZSDA 1Z6JT 1IT9L 3SE3A 3LV3B 2GJZA 4NM8L 3O2WH 2KQNA 3BYTA 3AVEA 1TDQA 3X14A 2XWTA 4OCXH 4PJCB 2DIBA 4N8CL 5KN5B 5DJ0A 3UTTB 5HYSG 4PLJC 1U8OA 4QYOA 1AXSA 4GSDL 4Y2DA 3GSNA 2B1AH 4XCYB 3G08B 5FYKH 5TE7L 2UWEA 2R56L 2C5DC 3VFUA 3QIWB 3MCKB 3BX7C 7FABL 1W72A 3FTGB 3UTTD 2XWBA 3ZDYE 3H7BA 1DQMH 3LPFA 4MVBC