4LGSB

Ricin a chain bound to camelid nanobody (vhh4)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
QVQLVESGGGLVQAGGSLSLSCAASGGDFSRNAMAWFRQAPGKEREFVASINWTGSGTYYLDSVKGRFTISRDNAKNALYLQMNNLKPEDTAVYYCARSTVFAEITGLAGYQSGSYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Ricin Toxin's Enzymatic Subunit (RTA) in Complex with Neutralizing and Non-Neutralizing Single-Chain Antibodies.
pubmed doi rcsb
source organism Ricinus communis
molecule tags Hydrolase/immune system
molecule keywords Ricin
total genus 34
structure length 129
sequence length 129
ec nomenclature
pdb deposition date 2013-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lgsB00
3MACL 1FL6B 2VITB 4R2GD 4XB7A 4X4XB 1ZE3C 2GUOB 4QXUL 3TVMA 2OTUA 4PJ5A 3RAJH 4JKLA 3PWPB 1A1MA 3ARYA 5JW4N 3D48R 1D6VH 2OBGA 5IMLB 4IS6A 1LO5B 1FGNL 1HQ4A 2EH7L 3VFWB 2BVPB 4FQHB 1SM3L 2DLEA 4NQDB 4RGOL 1ADQA 1PGRB 1DQJB 3HAEB 3OX8A 1YEGH 3VXQA 1C5DB 1QBMH 3D9AL 4D8PA 1AD9B 1OAYL 3GSXA 2HA1A 1KIRB 4L9LA 3U4EB 3KGRA 5FGBA 3T0EA 1P7QB 1OAZH 5F6HI 2F5AH 4ISVA 3B5TA 35C8L 2APFA 5BMFL 3PWPA 4EN3B 2Q8AH 4YDLC 1P2CA 2EDKA 3PGCA 3LS5H 4LOUC 4RFEA 4UV7H 2J4WL 3MJ9A 4WI6A 4F8TA 2J8UE 3C5SA 5KAQF 3FN0L 3LIZL 5HDOA 3ARWA 4GG6F 3VDCA 1MCWW 2OX5A 3G6JE 3BDYH 4PJHA 1VACA 1UXSA 2YR3A 4XCEA 3VE0A 1A64A 3NBNA 5I1HL 3OXSB 3ZE0F 1DDHB 2PNDA 3KAAA 3NN8A 3DV4A 3QUXB 1FN4B 5DMGD 4LPXA 3RI5K 2W9DL 1JUFA 3QXWA 3ZKXB 2DQDH 2X4RB 5DS8A 1S9VA 1JGDB 2JJSC 5L2JA 2XI9A 4JO2L 3KYNA 4WY7L 1UVQB 2HWZL 5I19L 4ETYA 4F37K 4NZUH 1KCSH 2NY2C 4OZGB 4QTHA 1UXSB 1OAUL 3W39B 5GRYA 4MAUH 1MCPL 4JM4H 1CICB 3QUXA 1IT9L 4PJXA 2AJSL 4F57L 4HXBL 2FX7L 1P7HL 4LASL 3I75A 2ENSA 3U6RB 1DVFD 5T3ZL 1VSCA 1ZT4A 1I3RA 4WCYH 3EFDL 2VL5A 2G5RA 4V1DB 1KT2A 1KXTB 3C9NA 5I2IA 3IXAA 4AMKL 4YXLL 3L3KB 1QLFB 3REVB 4AT6B 5ESAA 4Y5XC 2EZ0D 1R5WB 4F7EA 4XXDB 2CIIA 2F54D 4UQ2A 1H3GA 4XTRD 1VB9A 3SHSA 2VYRE 3ARGB 4KTEL 1KB5A 1QD0A 1PBYA 4ZOEA 3VGBA 4OD1L 1ZV5A 4JRYE 3RWCB 5I1LA 3VXUD 4LCIL 4V1DA 4HKJB 1RZIB 1D3CA 1JPGB 1AXSA 2VERN 5C0IB 3P30L 3TO4C 3HI6H 4G8EB 1WBXA 2E8ZA 3T65B 2A9ML 4JFXA 4R4NC 2ICWI 4Z7WE 3UTQA 1EUUA 1VDGA 3CFBA 2CRYA 1M7DA 4HIEA 2F74B 4WU7A 2D9CA 3HI5L 3OKOA 4XP5L 4LKCB 2YPLD 2FDBP 5F9OL 5BO1H 1D5XA 3C08H 3RTQB 2BNQA 3IAPA 3UTTB 1ODAA 2WQRA 3WYRA 3SE3A 3U2SB 1FNHA 3FT2B 2FATL 2ORBL 5JW3L 5I1LB 2HN7A 4G6MH 1BAFH 4AM0A 3D2UD 3T0XA 3AUVA 2R1XB 3LKOA 3BZ4A 4TUJB 1AFVL 2P1YA 3UBXA 4DUVA 1I9RL 2J8UA 3VRIB 1FO0A 2R1WA 1M7DB 4V2CB 1YEHL 1CWVA 4PGDB 3UJTL 4GG6E 4JPKL 4NN5B 3WIFB 1IARB 4APQD 1T7WA 3CFDA 4LSVL 5IFHH 3WNKA 5E8PB 4WEBH 3VGAC 3BD5A 3RZCD 1Q9OA 3PQYA 3MOBH 3VG9C 4GBXC 1CXHA 1L0YA 3TO2A 4YDIH 4TUJA 2IBGA 3FN3A 4XMPL 3BEWA 1FGVL 3NH7H 5DEFA 5EORH 3AMKA 5FA3B 4NN6B 3TNMA 1IEBA 4PGDA 4NQXA 1IGYA 4K2UH 1KC5L 1T22B 4R26L 2H3NA 1VERA 5D2LB 4YPGB 5CCKH 4FFYL 3D1MC 4OCXL 5CZXC 4MB3A 4MQ7B 2FX8H 4JJHA 1AGFA 1NLDH 1CGYA 2QSTA 3O6FD 1Q9OB 4OZGF 3MJGX 3KPTA 5FDWB 2PXYC 4MD0B 1SYSA 1DSFH 4OUUA 1RUQL 2VXSH 1LP9B 3R4DA 1HH9B 2B4CL 4PB9H 5BW7A 4TTGA 1SY6L 3NFPA 2JB5L 3IDGA 2DLGA 4PJDA 4XX1E 3MJ7A 2ED8A 2Y23A 1HDMB 2VLJE 4IBLT 4P9HL 3ARED 4EEEA 3P9MA 5EZIL 1CL7L 3VWJA 4DZ8B 1WFTA 43CAB 3ARFC 1CGXA 5A2LH 1BVKB 4AIOA 3KJ4C 5KZCB 2P5EA 5E94B 4Y8DC 5KG9A 2CUIA 4MNQA 2IFGA 3KYMA 1IILE 3OJMB 1AE6L 1R3JA 3ARDA 4JREC 3UTTD 1C08A 3H0TB 4B5EA 1KENL 1J1OL 3BH8A 5DRXB 3FB7B 4JFDA 4MAYC 3QO1A 3ARXA 1AC0A 4Q2ZB 4ODVL 1IKNA 1HDMA 2VLRD 2W07A 3MODH 2Z31C 5EOTB 3SPVA 3WFHB 4EKXA 4LHQB 1H3UA 4M1GL 4OLWL 4K71C 4XWOD 4DZ8A 1GHFL 1HIML 1YEDB 5C0CA 1BEYH 2JJTC 1CDUA 4NJ9L 1X3DA 4OAWA 5KG9B 3SDXA 1EEZB 1RK0B 4Y4KD 1KBGH 4LCUB 4FQIH 4I0KA 1TJGH 2BFVH 1KPVA 2V5SA 3MFFB 1C08B 3PWPD 1QSFD 4FQXC 3VXUA 2IQ9H 3W0WE 2X4SB 1JHLL 3R06B 1U92B 4XBPB 4XRCB 5F96L 3GM8A 3GFUA 1C7SA 4LASH 4Y5XB 5IQ7H 1NCCL 5T1MA 5GZOD 2R23A 3LMJH 2BY1A 3QWRD 5BRZE 3LV3B 4YBQC 3EFFB 5TF1L 1UQSA 3LQAL 5INCB 4HLJA 3KYOB 3C60D 4TTDC 4I48B 3V4UH 3PQYE 4GXVH 1M05B 1T21A 1CICC 2ERJB 1KJ2H 2OSLA 4N0RA 4R4FL 5MEND 1CFQA 1U3HC 5D93C 3BP4A 4Z6AT 1DFBL 1A4JA 3HZMA 1KJ2B 3KPSA 2F54A 5DMKB 4KGJA 2FR4A 5INCA 1NDGA 1WV7T 3SGJC 5GS1C 5EU7C 2A9MH 1T66C 1OQOA 2VDPL 4P46A 1YNLL 2ARJB 3QQ3A 4M8QB 4LCYB 3GMMA 1ZS8B 1T6VN 5MI0C 1ACZA 4LL9A 1NCNA 1KB5L 1T21B 2A0LD 2H1PH 2IAMB 3MV11 3BMVA 4BZ2H 2IBZX 5HPOA 5LBSH 4PRHA 4PR5B 5E8NB 1INQB 4Y7MA 2VZSA 1MHCA 1A14L 3NCCB 1TZHA 5CJXA 2HH0H 5DMIH 1IQDA 1NGXB 1YEFL 4EI6A 2RAMA 3SE4A 3L1OL 4JDZB 5FM8A 2BCKB 5DJYA 4H8WC 1XR9A 4WI2A 2QADC 2NLJA 5CUSL 3RL2A 2HVKB 4G9FA 1KG0B 1JK8B 2P5EE 1EO5A 5HBBA 2MHAB 2WBJA 5DZOA 4OZIF 1NCDL 5JDSA 2AJSH 4F57H 4XC3L 3CUPA 3IDUA 2IMMA 2LU3A 2BC4B 2XTJE 3ZE1E 5LG1A 4OZFA 1KTRL 3MXVH 3ZTJG 5E6YA 3VXRA 5BRZD 3S4SA 5BQ7A 5C09E 3JTSB 4U1NB 1AXIB 2FO4A 2F8OA 5ESQB 4MVBD 4IRJC 5C9KA 1U8PA 1KFAL 3ZYZA 1R0AH 1NPUA 3HMXL 3MRFA 4PGJA 2C7UA 1RAMA 3QDAA 1KC5H 4Y1AA 3MRNB 1ZVYA 3QG6A 3FONA 4OB5H 3QR2A 2C5DC 4HJGA 5FK9A 4KZEL 1FGVH 1QBLL 1RVFH 2NQCA 4OD1H 1KIQB 3MLXH 4HS3A 4R90H 1JFQH 1F3JB 4XVTL 4NNYA 5BQ7B 2VRAA 3OPZH 4LU5H 4XI5D 4QWWC 4PJ7A 4XWOC 1NC2D 4FFZL 2IANA 2WK2A 1RZFL 1I1AB 3T0DA 5D71L 3N1GC 2C7UB 2BNUB 4Z77A 1NAMB 1QSFA 1CE6B 1DANU 2QSCL 3HLAB 4I18C 4WW1A 5GRZA 3F7RA 2UY7A 3DHMA 5BZWA 3RZCC 5J1TC 1EO8L 4V1DE 5ISZE 4IRJA 1HZHL 2DLHA 3O45A 3ZKMC 4DEPC 1EO7A 5IVZA 1T1XB 3MXWL 5KSAD 5LWYL 3H3PH 2JCCE 4Z7OF 1YQ2A 4HXAL 5KBNC 2XXCB 3BQUA 2ADFH 2HFFA 2R4RH 3KPSE 5F1SA 1KSRA 2WWKT 3CSYB 2YRPA 2D03H 4MQXD 4UNTA 1DUYB 3WFCH 5DJZA 1NGQH 5E2WL 5B39A 1U2HA 2M1KA 3R1GL 1FPTL 1T1WB 4D0BB 4MQXC 1HIMH 2BVQB 5EU4B 3C60C 4TTDD 1NGWA 1JGLL 4K3GA 5D7SH 3ARFB 1KUMA 5J11B 1KBGL 5D2NB 2BOBA 2BFVL 4YDIL 4I2XB 4K9EC 1DBMH 4Y19B 2XZZA 4DJMA 3AMLA 1OGAE 1BEYL 4JZNA 3D85B 5JIKA 4K2UL 1LK2A 4ELKB 4Z7NE 4XCCL 4FQIL 5ENWA 2XWBB 5E1HB 1HSBA 3SDAB 1EIBA 5I8EB 1I7TB 1GGYA 2RFXA 4ODTL 1QFUL 1VFMA 4I3GA 1DUZA 1W8NA 3SGJA 4HCRA 1QFOA 3DXAB 4WUKH 3BD4A 5IVXB 4HHAA 3FCTB 1ROWA 2AJYL 2Q8BL 5HDBF 2AP2A 1WAAF 3ARBC 4WW2C 1ORSB 4OI9A 2EIZB 1FNEB 2HTLD 3BGFB 3FQTA 5K9QG 2VXUH 4GXUM 1U8IA 1QBAA 2GTWA 5EU5A 3ZKND 3TFKC 4Y2DA 1BZ9A 1RJCA 2W65B 3JV4B 4RGOH 3GJFB 4Y4FD 4G7VH 2HT3D 3NZ8A 3CDFA 1YEGL 1YPZE 2EIBA 2CK0L 1MIMH 3NIDF 3B83A 2G5BB 3G9VA 2AJZB 3MCKB 4Z95L 1OTUC 3QH3A 2NY0B 4GRMB 3MNZA 1NC4B 4I3RL 1T7XA 4X6FA 2LAAA 1BLNB 2EDNA 4P9ML 4WWKA 3RKPA 3NCJH 4DKFH 4I5BA 4G6JL 3K8LA 4MS8C 3UZVB 2FJFA 3VXNA 4OSUH 2CDGB 4Y2DB 2QLVB 1T0NB 4ZPTB 1XT5A 3LQZB 5ICXB 2PW1A 4LDOB 5D9SB 4PG9A 4FXGB 1ACYL 4KFZC 1WAAE 2DWEA 4U6TA 3RWDA 4WI9A 3JVGA 3QH3B 3NA4A 1KF9B 5MENA 4FQXB 2J3SA 2VB5A 5I1CL 3SE3C 1JV5A 1S7UA 4X7EC 1GJIA 1EHNA 1P1ZA 1S78D 1U3HD 3BJLA 1XF1A 5MI0B 4JM2B 2FJFB 2YXMA 5F88B 1NKOA 2VQTA 4BSWB 4TQEL 1RJLA 4RAVA 1FIEA 5D9SA 4Y4HB 4TRPL 2DD8L 3CVIL 1TZGL 2VQUA 1NQBA 3NZHL 4R9HA 2QR0B 3N1PC 2D2OA 3OJVC 3QHZH 2ZOLB 3VXUE 4F7TB 43C9B 5C2BL 4YXKH 4TPRL 4OI8A 4M3KB 3JBG7 1B0GA 5J56B 1XGQB 4KJQD 4HEME 2OTUB 3WO4C 1OSPL 3WIHL 1S7UB 4WCYL 4EBQH 3QWQB 3U79A 4EOWH 5F88A 1NANI 5J13C 1NL0L 1QBLH 1RVFL 1QZ1A 2PO6B 1JGVL 4XHQA 2UZXB 1F4HA 2JJVA 3SE9H 1JTOA 2J6EL 2BZDA 3EBAA 3WHXB 1TTGA 2MOVA 1H3PL 5DUBA 3IFNL 1XGQA 1PQZB 2Z8WC 4F80A 1UG9A 4OQTL 3TBSA 3V0VA 4RFEB 3IDYB 4LCIH 4XP1L 1AI1L 5DT1L 1SJHA 1XCTA 4PBVC 2CPCA 3OR6B 2A83B 3SDCB 3DROB 1GGBL 1S7XA 2A73A 5SX5K 3QIWD 4RIRA 3QJHA 2YZ8A 1A7RH 5FKAB 1JRHI 5IFJA 4ELME 3ALWA 4OZGE 3TZVD 4M6NH 4PRBA 3OF6D 4FTVE 5I1AA 1UM5L 3MRRB 1RFDL 1BZQK 1XGRB 5F7LB 2FEEL 2V7HB 4PV8B 4LSSL 1BFSA 5JW3H 1N7MH 5JORB 1SJHB 2DMKA 4ZG1A 2OR8A 4Y8AA 4I18B 1RZJL 3KLSA 1H3TA 1LGVA 3RWEB 2FIRT 3JUYA 5FO8A 2OZ4L 3EYSL 1MVUA 2ICEB 2GITB 4UT7L 1NFDE 2HLFD 2W1NA 4U1SA 1OP5H 4KU1A 1G0YR 5ACLA 5CEXB 3I75B 3U6RA 5HYSG 4HBQA 3OQ3B 2KQMA 5DD1H 4QXTB 4OB5L 4WTZG 1YYML 4OKVA 3SKMA 4L4VB 1OTUD 1J0IA 5JORA 3C6LA 4YHML 2QJDA 5IP4A 5CIPB 5KSBB 5IR1A 4N1CA 4I18A 4OJFL 6FABL 3F58H 5FF6B 2VABA 3QHFL 5ALBH 1MREH 4ENEC 1CU4L 1R5WA 4F7EB 4XXDA 2D3VA 2K1MA 4YXHL 3MRPA 4U1LA 1PG7H 1EMTL 1IGCL 3DUUA 4RISH 5J12B 1T2JA 4HX1B 3TVMD 5IBTH 3S37X 2AXGB 3ARGA 1BWWA 1K2DA 1E6OL 4J1UB 2H6PB 4KKBC 5BV7C 5FB8B 3HCVB 3RDTA 5C70A 3BSZH 1C5CL 1MLBB 2E6PA 4XNYH 3A6OA 5FF6A 3RU8L 4Z78B 2WQ8A 2D7TL 4L8DB 1XGUA 3MRKA 4P23D 4U1LB 3GMLB 1P6AB 2B2XH 1QSFE 4X8XA 4UIKH 3VCLA 2R2HB 2D7NA 3PABB 4NIKB 4XCFH 4P5TC 5I75C 1QR1A 1JWSB 2VISA 4QOKE 3MREB 5T1DL 4J1UA 5TE4L 2H6PA 1J8HB 1FG2B 4MJ6A 4PJ8B 3CX5K 4YDJB 3EHBD 1HOCA 3V6FB 4PREB 4RA0C 4HIIA 5A40E 5F7MC 1YY8A 5KS9A 4QNPF 2NZIA 2J12B 4WWKD 5LXGH 4DN4L 2EXWC 1KEGH 4K8RD 4P2QE 3K80A 2EDRA 2N4IA 2ATKA 4PJFF 3WL9A 3RNKA 4LQFL 2MSPA 4QRTB 1BQHA 2CR6A 4X99A 4NJ9H 5DYOA 4XAWH 1X5KA 2HT4C 3BT2L 3V6OE 2F53E 2GCYB 5HPMA 3X3FH 5GGRY 4NRYA 3F7VA 5TQ2L 4PJIF 4G43A 5E99L 4Y4HC 2A9NL 5IWLC 1FZMA 2YPVL 5EBLB 1VEMA 4U6VH 1I85A 2DQCL 2JELH 5HHXH 4Y4HD 3Q5TA 5EOCJ 1YY8B 4NC1E 5IB4A 4P2RB 1DBAH 3HUJB 2ICCA 3MJ8B 1KYOK 4KI5E 3QDME 4DVRL 3S88L 1J5OH 4UAOB 2B4CC 1AHWB 2XY1A 5FECA 3K1DA 1GRWA 1MY5A 4LRNH 4D9RE 3IDJB 1PAMA 5SV4A 3ULUL 3BAEH 3V6ZB 3WBDA 3ULVL 5FUOH 2NXZC 5T1KB 1HH9A 3KPLA 5D1QB 4BZYA 2ZCLH 5IOPB 1UKQA 1CDCA 4NGHL 1MCBA 4NQSA 2VLKB 2BNRD 4HUNB 1JPFB 4P2RA 4RBPH 5K93A 2CRZA 4BH8B 1LO0H 3ETBF 1G7JA 4APQA 1P4IL 1QSVA 1BBDH 5IEHA 5K9KA 1V3LA 3W0WD 4XP1H 5FYJH 3ELAT 5FYLE 3IU3B 3IDJA 2EICA 2V9TA 4J7RA 4U0RB 5IHLB 4XC1H 4NT6A 5ESVB 3TN0A 4WFHE 5C9JB 5T1KA 2XTJB 4PP2B 1B0RB 1OB1B 5CHNA 4HC1A 1U36A 1X44A 2LVEA 3VXSB 4PLOB 3S36X 1KIPB 2JE8A 3D3VB 4N1HB 3TO4D 4NFBA 5C0CB 1LD9A 5DK2B 1K6QL 1MEXL 1ADQH 1J0YA 2AJUL 4RMWA 2ITDB 3G6DH 1DN0A 1EEQA 1JWUA 3F6IA 1Y6NR 2Z91B 3VMOA 3SY0B 1F6AB 5C3LD 1EFXB 3BP6A 3NZHH 4YHYB 4ONOA 1FFNB 1U8NA 1ZT7B 2VDMH 3VXMB 4PP2A 4NUGL 3QISA 2OR9L 3WLWD 1W8OA 4M5YH 4R2GC 1KGCD 1MCOH 1X4ZA 2AABL 4QHUA 4FTVD 1FRGL 1N0XL 3T0AA 5EB9A 4PRDB 1KTKE 3PE9A 4JO1L 1MF2L 3STBA 2EE6A 4MA1C 3DYOA 4WI3A 3GIVB 4L8CB 5T1MB 1M6OB 4PS4H 5C08B 5C0BE 3QFDA 4OCYL 3TEUA 3RUGF 5BVJA 1JWUB 3EJYD 4ZFGL 4JG0L 1TIUA 4RMSA 3KHOA 5E9DD 3QHFH 5ALBL 1FFNA 1O0VA 1U8NB 5EBGA 4TVPD 1JF1A 1ZHNA 2HP4A 5CSGA 4WRLA 3FTGA 3QJFA 4L9DA 5DEGA 3PDGA 4UNVA 4ZO7A 5SV3A 2LQRA 3GIVA 5DJ6A 5DT1H 4L3EA 4GRLA 3PIQA 4NQEA 3S4SG 2X09A 5IMLA 2FR4B 2VLJD 4IS6B 5A3IC 1IAIL 2NXYB 3CPLA 4H0IA 3GHEL 3KWWB 5F97E 3ZTJH 4LBEA 3UJJH 1QRNA 3ZTNL 5JPMB 5GGRB 4GQPH 2VLRE 4LHUD 2Q6WA 1F3RB 2HKFH 1IM9D 1I1FA 1TETH 3FFCB 1IAOA 2WBJD 2ZG3A 5T5FH 4JKMA 2ZCHH 4F15B 5C07E 3QJFB 1C5CH 4XNYL 3L5HA 1MCWM 2X9WA 3BUYB 1WC7B 1A4KB 4CU6A 4BQ8A 3VFTA 2BMKB 1N7ML 3MRDA 4X0KA 1INQA 3QQ4A 1C5BL 4QRPB 3HR5B 4WV1C 1YEEH 2ADFL 2R4RL 5HI3C 2R39A 2C1PA 2X4QA 3HTLX 5GRUH 1JHTA 1GGUA 5I6XB 1I1FB 5JDJA 4XCEB 3VFGH 2KZ1B 5MEOB 3U4BL 1ZA6A 2CJUH 2WBJB 5DJ0B 2AJ3A 3CNKA 3TJEL 1S3KH 1D5MA 4Y2OA 1WBYA 5I9QC 1RMFL 3ES6B 5GPRA 1YEKL 1TTFA 4N90E 4L8SB 2DQUH 4YHIA 3VFSA 4NCC2 1KB9J 5DUPL 4LEOB 4LGSB 3VJ6B 2V7NA 4YO0A 2XA8H 1H5BB 2FX9L 3KPPA 4XH2B 1SMOA 4YBLC 3X3FL 1J0HA 4KK6D 2RIKA 1YN6B 4FN0A 5E8EA 4D0DA 2L7JA 2NX5D 5I1HH 4JFYB 3HC3L 4PP1C 2AJVL 4MNGE 1IE5A 4XCYA 2YUXA 5ADPL 4ESKA 1MREL 4LLUA 3NFNB 5JOFA 4GUPA 1UWGH 1NUDA 3MV8D 3PGDB 3PDOA 4N0UE 2VZOA 1FQ9C 3TCXA 2Z8VC 5HGDA 5JW5B 1KEML 2EDWA 3WO3B 3VJ6A 1FSKB 5F9WC 5KN5B 2IPKB 1X5IA 4Y5VC 4R97C 5HD8D 2VL5B 4D0DB 4UU9A 3ZKMD 1J5OL 2EKSA 1QA9B 1EVUA 5KSAC 4YC2B 2ZCLL 5C0BA 2AK4E 3U0PB 3I3DA 5B4MD 1I1AA 1A7QL 3SCMD 1G7HA 1FNGB 3BAEL 1EZVX 4JHZA 4NQVB 4MJIA 4N8CL 4I9WD 4NP4L 1AXTH 4NKQB 7FABL 1P4BL 3MRCB 5I76A 1CDBA 1IRAY 4X5XA 5C7XL 3CU1A 1KB5B 2EDXA 2PTUA 3VI3E 4PJBA 5FHAL 3EOYG 4C56D 1A1OB 4UU9B 2HKHL 5F44A 1ED3B 5I1EH 1ND0B 2DDQH 4U0RC 3TPUB 2NY3C 4FS0A 3GRWA 1N64L 1URLA 1WBXB 3O4OB 3CSYA 4JFXB 4MMXC 3D0VA 3OAZK 4NQCA 1WSST 1I7ZB 2DI7A 4WU7B 1AGCB 3PP4H 4PJEE 2GJJA 2W92A 4PRPA 1ZGLA 2RGSA 1WCBB 4XAWL 1I8IB 4JRXB 2VO5A 3MO1B 1WISA 1K85A 3P4MA 4U6HB 3KPRB 3DTXB 3KPRD 4ZQKB 3O6FA 4NYLB 2VMFA 5D2NA 5FV1L 4CVXA 3KR3L 2R56H 5KS9E 5LVEA 3CDGA 4JB9H 4KJWD 1DR9A 3JV5A 3BGAA 2XQYG 4OF5A 5IROA 4XPGL 1DE4A 3AREB 4MD4A 1FRGH 2YA1A 3IETA 3QULB 4JFFE 2X10A 5BOPA 3U9PL 3QIBD 1HSBB 5BS0B 3QPXL 4HMCA 5IVXF 3VA2C 2OR9H 1J0KA 4GG8A 4FNLH 5GISH 1REIA 5C0JA 2AABH 3QXUA 1ZAGA 4QY8A 2BSTB 4C56B 2WUBH 3WFDH 5CSZB 5J9PA 4K3JH 5FOBA 3UC0L 3U7WH 2P47B 4XNQA 5T3XE 1N5YL 5AZ2L 4DK3A 1QSED 3CDGB 5F70A 3M17B 4HDIB 4A6YL 5J6GA 2Q76A 1FNEA 1L0QA 5J1AB 2O61B 4QHMB 2IH3A 3FZUC 5EU7E 2FRGP 5FA3A 3TNMB 3TO4A 1O5DT 5AEAA 4NQXB 5EORL 1CD0A 3BPNC 1E0OB 3GSUA 4KKAD 4HPOH 4HMDA 3V6BR 3HG1A 4MS8D 4ORZC 5D2LA 4YPGA 3FFDB 3FJTA 4R0LC 3WDJA 5DRNB 2CKBA 5EBWB 3QBTB 3LN4A 3O9WB 3UTSD 4ORGA 1N0LA 4Q9BA 4N0UB 4YFDB 4P2RE 3SKOB 3E8UL 4CADB 1K8DA 2CLZA 2FJGA 2QQNH 2PO6C 3M17A 4HDIA 5EPMB 3KPOB 4KHXL 4RWYH 2MJWA 4BQCA 1NMAH 3MJ7B 1MHPL 2Q3AA 3TP4A 5DJAA 4JFOB 5I74C 1JYVA 4XCNB 4A6YA 4OZHB 1C5BH 1D9KC 2MCPH 3TT3H 1OL0A 5J6HB 4MJID 4QF1B 3L3IB 1R3HA 4L29B 3MC0A 2EDQA 1W0WB 1RUML 2X05A 2EEAA 3T4AB 1NBZB 1I9JH 5I73C 3W2DL 3DWTA 5EZIH 2EYRB 3MLWL 4WO4D 2VDLH 5AYQA 4XGZB 4GMTL 4J3TA 1QSEA 4G8GB 5JHLH 5DJAB 4P2CG 4ODHH 5DF0A 2NY1C 5ILTH 4L8BA 2ZP0T 4Y4HA 2Q7NA 3SOBL 4HIHB 1P5VA 1RU9H 4NKOB 4ONGH 2BY3A 1WBZB 4F7TA 4NQDE 1EEZA 2YPKA 4EDWL 4DAGH 1PZUB 1FYHB 1RD6A 5FEBA 4ZUVB 3O6MH 2E5EA 4M1GH 4OLWH 3TA3B 5HHNB 2DQTH 4N90D 5LCVH 5JPNA 3ZLQC 4LSQH 4ODSL 1PDKA 4NCC1 1WWAX 3P11L 5DUMH 1S7WA 5FOJA 4HS6A 2DQEL 2O5XL 4CVZB 3VWJC 4JGUA 1AJ7H 1TCMA 5I74B 1I7UA 3QUYC 2OS7A 1I4FA 3BX7C 3TNNA 1QR4A 4Y16C 1N6QH 3EO9H 5DFVC 2CLRB 5HXMA 1HNGA 2OTPA 2AEQL 5ID0A 1GIGH 1JGEB 1UZ8B 4AEIH 1NCBL 1YJDC 3UEZA 5D7LD 3VD7A 5DFWH 3BRGC 1RZ7L 4XVSH 1X7QA 3QWOB 1DZBA 1FNAA 4NQEE 4O2EA 1AO7E 2Z4QA 1A4JB 1TCRA 4JREB 1S7XB 3ARBB 4WW2B 3HZMB 3RDTC 1L7TH 1I7UB 2DS4A 2GTZB 4KI5D 1WTGT 2Z92A 4CUCA 5MEPB 3WO4B 2CLRA 4MNHB 1P4BH 3VGDA 4GXVL 5I1KL 5TQ0H 2Z31B 4FQ1H 3ARGC 4ODWA 4L4TA 3CMOL 4HWEH 4YHZL 2VZ3A 2P24B 4S1DD 2EDYA 4LCYA 3TJHC 2OYPA 1TVBB 5CZXD 3ARGD 3S96A 1FL6A 4O2CB 1W0VA 5FYLH 2IALB 5LQBL 1HHKA 5TPWL 3TJHD 2BNQD 3QWOA 3DGGA 5C0DB 4GW4A 1RJZA 5L2KB 4LLQB 1JZ7A 1LDPL 5GGTA 1G6RL 1MVFA 2DTML 5EUOF 3LB6D 5FGRA 1LO5A 4BUGA 4CAGA 4YGAB 4FQHA 3BRDA 1YNLH 2XYCA 5A43C 4UDUA 4NC2B 3RWEA 1UA6L 5KSVB 2EE2A 2GJZA 5IB1B 5J13B 3B43A 4BZ2L 4G6AD 1AY1H 1AD9A 3C5ZC 3P4LA 2HVKA 4G9FB 3SE8L 1IC5H 1IBGH 4U1KB 4OGYL 3D69B 3IF1B 4L4VA 4HT1H 4U6YB 3FRPA 4KKLC 1R3IH 3DGGB 5K9JH 2NW2A 2NX5A 4BZ1L 4LLQA 2XZAL 1TJHL 5M7QA 4MNGA 5IR1B 1WZMA 3HC0B 4HH9B 5SWZE 5CUSH 4UAOC 1D5BA 1T80A 2G2RA 1RY7B 1QKZH 1QSZA 4RA3A 1MHHB 2FHFA 3GSNA 4P5TD 5HDLA 5JUEL 1A6TB 1F90H 4LRNL 2WWMC 3IDXH 5FM5M 3LH2L 2Z9TA 3UTTE 1G0XA 1OARL 4LSPH 4P4RB 3MV7E 4F7CA 4IRSC 3UYOD 5JQ6H 3IFPA 1X5ZA 3D3VE 2IFFL 4KRMB 3KPMA 4NN5C 4Y5YA 3X13B 1N64H 4Q9CA 4JY6B 1T1YA 3H7BA 3QUMA 2OL3H 3RGVC 3VCLB 1A6TA 1KCKA 5I71B 4QTIH 5JR1H 1VGEH 3G04A 5E9DB 5CD3A 4Z77B 3MREA 2JIXB 3EO1B 5CILL 1P7QD 3T09A 4LLYB 4XPHL 4KRPD 3VXPA 4IRJB 5BOZG 5KOMC 5I2IB 3B9EA 3A6BH 1IGFL 3I3EA 4K94H 1AO7A 1N4XH 4JN2A 2GK0A 5JZ7D 3JVGC 4AT6A 5ESAB 4C59B 2F15A 3L3OA 2ATKB 2H45A 3QUMB 3QHTC 3WL9B 4CDGC 4RGNE 1QBML 2EDFA 3D9AH 4XWGL 3D0LA 1T3FA 1PEZA 3IDNB 4G42A 4GW1A 4JY4A 4ODUA 5B39B 4NRYB 2F5AL 5SWSD 2PYED 4DKEL 5D6DA 3V8OA 1CFSB 3GBML 1WUNT 4HKJA 2WLZA 2AGJH 4JRWA 5E8DL 3S36H 2L7UA 3RWHB 4J6RL 4PJIB 2FGWH 3QUKB 3X12B 2VDRH 3IFOA 4JZNB 3D85A 1WIUA 2ZUYA 4PGCA 4X8JA 1YMME 3P11H 2V9QA 5DUML 2HJFA 2A6IA 4YDLB 1J0JA 1XGYL 2NY5H 4IHOA 3CD4A 4ZMAT 3K4AA 5I1JL 1JF6A 5J06A 5LCVL 1RUAH 5IMMA 3UAJD 3LKOB 3E8UH 4NQSB 5IVXA 5ICZA 1R5IB 3KLAB 3VFRA 1OW0C 2FHBA 4ZXBD 3C2AH 4KRPB 5HDQH 1ORSA 2EIZA 4LIQE 3DVGB 2XA3A 2WM0A 4E42B 2ESVB 1IL1B 5TDNB 1SHMA 3U1SH 3IU3A 2A6IB 3MV9E 3NCEB 4ENED 1NEUA 4ZAKA 4KY1L 3R0MA 3P2TA 1BQLH 1QVOB 1KPRB 5T3ZH 2OI9B 4O02H 2NZ9C 3SDDC 2QHLA 4X4MA 4XVSL 3L5XH 5FYKL 3KNBA 1QFWM 3ULVF 4KXZH 3W2DH 1SEQH 1R5IA 3H2WA 4KKLD 4YXLH 4AMKH 3CCHB 3X14B 4WV1B 5EO0B 1BD2E 2XWTB 4I3RH 1MCNA 2J8UF 3MV8E 4X6CA 3EYQD 4XBGA 4PJXF 1H0DB 1NBVH 5SWQB 1PFCA 4KZDL 3E3QC 3A67H 1FVDA 3GSWB 3BUTA 4K7FA 4MQ7A 4PRID 3RWGB 4JFHE 5D7JA 1I8KB 1U8QB 4XT1C 3BVNB 3DO3A 4NKMA 1FL5B 4OUUB 5CMAA 4MA8L 1ZT1B 1V05A 4U1IB 3ULVD 2YD1A 3B9KA 1U6AH 3WIIH 1BF2A 4PJDB 2XWTA 4PJ5B 3CFEB 2OQJA 5I6XC 3GMQA 4BSJA 4QRRE 1PLGL 2D0GA 3CVHA 4LVEA 5K9JL 2NY4D 2AJVH 4FQQB 1R3KB 2XPGB 4WWKC 3PXHA 3HKFA 3EJZD 2X70B 3EOBB 1AQDA 4XP6H 3B3IA 4RFOL 2IAMC 5C08E 1DQJA 1U8QA 3UYRL 3OKKB 5KW9L 1T7YA 4G3YL 1EHLL 4OZFH 3GSXB 43C9A 3LRSA 3LN5B 4JY5L 4LNRB 4KKCD 4UDTA 1WT5C 3ZDYE 2GJ6E 2ZG2A 3EFDH 4ZUUB 5EOTA 4K3EH 3CFEA 4QRSB 3T8XB 4M62H 5C0RL 4WNQB 5DO2C 2QADB 1TZGH 2D7PA 3UDWA 3KHQA 2DQHL 3H42L 3DJ9A 2VN7A 3GBNL 2DM2A 1L7TL 1JL8A 4RSVA 4F3FB 4BFIB 1F90L 1I1RA 3LEYL 1V3MA 4DN3L 5CKGA 3P4OB 2GT9A 3VE0B 1CR9H 5ISZB 1FFPA 4IRJD 4X9IA 3WIHH 4GLRH 5D5MB 5HYIA 4YHYC 2IF7A 2C4FT 2G75A 3LN5A 4DKDC 1F97A 4P23A 3ARSA 4UDTB 3TIDA 4I3SL 3AFLA 1JUFB 1UJ3B 1RJYA 4XI5C 3F5WA 2Y72A 2NTFA 1J10A 2PR4L 3ZKNC 3KYNB 2OK0H 4NO3A 3MRLA 2FL5A 4EUPG 4HK0B 2EZ0C 1M71A 1ZHKA 4RIRB 1XF5B 3A6BL 3SBWA 4D9QE 4GAYA 5C09B 3RVXC 1ZTXL 4JDTL 2DYPA 3MNWA 3ES6A 2OM5A 1H3XA 1YQVL 4JZJC 2Z8RA 3C60A 2H9GA 2V7NB 2ZPKH 3S35L 5CSBA 1DQLL 3BZFB 4P9HH 4M02A 4GAJH 5DD3L 1KCRL 5F93C 4M61A 1WZLA 3PWLB 3NTCH 4JFYA 2BRRH 1T1ZB 2M2DA 3DARA 3IXAB 1WFOA 4M6AA 4LMQE 2W0KA 2N7AA 3W9DB 1CN4A 5HGAB 4X9FA 5D7JC 4LCCC 4OLEA 1CGWA 2HFGH 3GBMH 3VMPA 4YIQB 1WGOA 5HVWA 5EIVA 2IAMA 1QFHA 2QL1A 2H32B 3O81A 5DDHB 4RGND 4KK5D 2OP4H 1RK1A 3TIEA 4DVBB 1S5IL 5E5UB 3QUZD 4F15C 4LSPL 2NY3D 5DFTA 3OR7A 4U1MB 1FH5H 4NBYB 4JFPA 5DJCB 3QUZC 2AV7B 2Y6SC 5KSBA 5C0IA 1FG9C 1S5HB 3QFJD 3BZEB 3T65A 3K4DA 3BP5B 1MJ7L 4OGZA 1RZKL 1VESA 1ZWIB 3QDMD 3PF2A 2PW2A 3MUGA 4MDJB 2H32H 1FNGA 3OKOB 4MJIB 4XPTH 5DD6A 3UTTA 4YDKH 5DC9B 1RUAL 1NLDL 2O5YH 3ZT5A 2X1QA 4WGWB 4IRZL 1AD0A 1CFBA 5IW1B 5T3ZD 2IPUK 5ETUA 3OR7B 1X5YA 4ONFH 3MLPA 3EOAA 2PXYA 2P49B 1CU4H 4P3CL 4C55A 3DMMD 2BXYA 1Q0XH 4K3DH 3BZEA 5J12C 5F9DC 4PBXA 3HZYA 5A2IH 3H8NA 2RBLA 4G8IA 3RQ3A 3GMPA 4MDJA 3VI3F 1UH2A 4D9LH 3LS4H 3L5WB 4RZCA 1UADC 3V4UL 1WCBA 2X6MA 3VXTA 3PABA 1XCQA 2BVOB 4R4FH 5GHWH 1YNKL 3L95B 2D31B 4OTXH 3CFIC 5T1LD 4MAYA 2FH8A 2NY2B 3JWNC 1E6JH 4HIIB 2VNCA 1PJ9A 2CMRL 3T3MF 3ULUC 4KXZI 3RVTC 4U33A 2DLIA 1DBBL 5E8OA 3UJIH 2IANB 1X9QA 1SMAA 3HE7C 2V2WB 3PGFH 1DP0A 1MIEL 1T7ZA 5DD5L 5BVPL 3VRLE 1A0QH 3B9KC 4JPVL 4QRTA 5C0JB 1CQYA 1P53A 1F45A 3L95A 2KKQA 1EGJA 4MD0A 5CSZA 4L8SC 4IOIA 3C8HA 4J3SA 2H8PB 4NNXB 3NCFB 2LV4A 1KEGL 2IGFL 1BGXL 4Q0XL 3T0BA 3V9FA 3V5KB 2AQ3A 3BQUB 3JV6B 4ETQA 5DRZB 5IB4B 3HUJA 5I18L 4OQ1A 1ZSDA 1NCAL 2UWEA 3E2HB 3ECBA 2O26U 3HG1B 1DLFL 2P46B 5ACZB 5IM7A 3WLBA 4ZO9A 5LAXA 3IGAA 1FAKT 5CJQH 3ARFA 4YZFE 2Y1VA 4OZ4A 5EPMA 1MAKA 3OAYK 3JV6A 4JM2C 4MJ2A 1NUFA 1GSMA 3KXFB 3BP7B 3MLSL 1MNUL 1RZKC 1U8OA 5I0DA 1CR9L 4M3JA 2FIKA 4KVNH 4KROD 4NO5A 1EJOL 4DW2H 6CGTA 5J6HA 4XPBH 5F71A 4DOHB 1I1YB 2EDDA 4BKLB 3M8OL 2HTKD 1RK0A 1IAMA 2I9LA 3LKPB 1DUZB 3VD5A 3X11A 2EC9T 4S0SD 4OLVL 2BRQA 3WDHA 4D3CL 2H1PL 4F9PC 5GQBA 1QBBA 3IKKA 2OK0L 1A6AB 3C87A 5DMGC 3BIKB 1YQVH 4TSBL 3KXFA 4O4YL 3REWA 2R1YB 3QEUA 2COQA 1FBIH 2ZPKL 3G6JA 3HI6L 5FHBL 4HUKB 4M7KL 1FYTD 1G7MB 3LKNA 4XC1L 5EU5B 4NO5B 4L8BB 5EZOH 4J3XA 3QUYA 3TYFB 1KN4H 2WIIB 4CNIA 1UA6H 4H5SB 4BKLA 4JPIB 1AO7D 4ZFOL 1EAJA 3CLEL 5DGRA 3FN9A 1ZT7A 2B1AL 2WUCH 3TBYB 5DJXB 5JPNB 3UO1H 2WP3T 5MEQA 1BAFL 4K3EL 3NA9H 1AFVH 5C71A 1N0XH 5F21B 1KJ2A 3RVUD 1MF2H 1LE5A 5C08A 2HFGL 5BV7L 3V95A 1J1XL 1R24A 3CH1A 2N56A 4NBXB 2AEIT 1E4XI 4BFBD 2OJEB 2OR7A 4QXGL 1CS6A 1HSAA 4P46B 4LDLB 1RZJC 2ZNXA 1DJSA 3GMMB 3WJLA 4QOKD 1A02N 4MA1B 2R0ZH 3RX8A 1Z5LA 2R8SL 2AJXL 2GSGB 4KDTC 4UTAH 4KVCH 3GZKA 1M7XA 3GO1H 3CXDL 4Z7WB 2AK1H 5E24E 1GC1H 3T1FA 4GKNB 2BVPA 4OGAC 3FO2A 4J3UA 5IF0A 3HUJE 4AYFA 3LHPH 2HJLB 3B2UD 3B9VA 4XPTL 4YDKL 1WWWX 1OVZA 4NDMB 1K5NA 2XKSA 4HG4J 3T0ED 2PYEB 3O6KL 4JRYA 2QHRL 4M48L 3O8XD 1NANH 1HKLH 1Q8MA 3WFBH 3TF7C 5GGQH 4YDVB 2OMBA 3HNTH 4NJAH 1KJ3L 1A4KA 2K7PA 3ZL4L 4Z7WA 3VFTB 4PPTA 2BMKA 3MRDB 2JCCF 4X0KB 1BECA 1NCWL 4Z7OE 1MPAL 2MTPA 2DM4A 1DTUA 2Z31D 4LSUH 3R8QA 1EVTC 2F53B 3IKCA 1K5NB 5CP7B 3SGDI 1BIIA 5HHMD 5DQ9B 5I73B 3VFGL 5E95B 4B7LA 4XVJH 1UCBL 3U46B 4JVPA 1E4XL 4U6YA 1IZKA 2Y07L 3QG6B 1MWAA 3TBSB 1V7ML 3GBLA 4X9HA 4M43L 2DB8A 4XH2A 1A3QA 3PJSB 1YA5A 4QHLB 4NNYB 5E8EB 3T0VA 3U7AA 2R2CA 5JIHA 1CG9A 4EN3C 5IB3B 1CDGA 2HJKA 2YD5A 4U1GC 4Q0XH 4WDIB 5CP7A 2IMNA 4EXPX 1PY4A 5I1AB 5EO1A 1FFOB 3PGDA 4F33B 1T5XA 4NM8H 2BNUA 4Z7VA 2HTKC 1T2XA 1XIWB 3ILPA 1Q38A 2HFEA 5H37G 2P7TA 3C6SA 3O6FC 1CFTB 1RIVL 4I0PA 3T77A 3WMSA 5JHDE 2A77H 4PRHD 1RQ5A 4LCWA 2NR6D 3DUHA 1UWGL 5JHDD 1CG9B 1F11A 3PHSA 15C8H 3ZE1F 3QP3A 5L9DH 1NGZB 5C2BH 4KKAC 1CTNA 4F37F 5ITBH 1JRHL 1YPZF 4JEGB 1T1WA 4D0BA 4E0RA 1NBQA 4H1LG 4QXTA 4EBQL 5ECJE 5E9DE 3O4LD 4M1DH 4EQ2A 1RZIA 3RWFA 3O4LE 2VZUA 1SEQL 2A0LC 2FEEI 1MNUH 4XP9H 5A3ID 4LCWB 2GK0B 3NCMA 3S3JA 4J4PC 2VH5L 2ITCB 2PCPA 1A9BA 3EIFA 4K9EH 4KC3B 4P0DA 2NY6D 1T3FB 3IDNA 1GGIH 1Q1JL 3C8KB 3X3GH 2LVCA 4UV4H 4AY0A 5JOPD 2XWBA 4X7CC 3KPRE 1CK0H 4Y4KB 2CDFB 1K8IA 5GGVY 1KN4L 2FB4L 5C6PB 5EWIL 4OT1L 2R1XA 4UT9H 3MR9A 1FORL 3O2DA 5JXED 5GGVL 3EYVB 5I1DB 1A7RL 5C0CE 2XY2A 1OPGL 2ITCA 3BE1H 3IFOB 4HJJH 5T33H 5B3JF 5I18H 2VLKE 1FV1B 3O0RL 3LKQA 1EGJL 5E2VH 5E2TL 4ERSL 5DSCA 2JB6A 1A6UH 1QTYT 3QFJA 4L5FH 3FHQA 5E8PA 1F8TH 5L88H 1JGUH 1K8IB 4KUZL 2RR3A 4NHCL 4F8QA 1F4XH 1MUJB 4JHBA 3TO2B 4MJ6B 4CU8A 3L3JA 4XC3H 4GRMA 1CE1L 3LD8B 3IB4A 3EYVA 3U7WL 4GFTB 3MOAL 3WUWB 4QHMA 2AJXH 3J7HA 5TDNA 5IBUG 1D9KD 4KVCL 1I3UA 4ZFZB 2YEZB 2JB6B 2WUBL 4OF7A 5JXEA 4X99B 3QEQD 1MFAL 1BBJA 1TZIA 2HG5A 3KJ6H 4OLXH 4Z8FL 5CWSB 3Q5YA 2ICES 1YECH 4QHKJ 5EUKA 2E27H 2FSEA 3FFDA 4DEPB 3QI9A 3FB5A 4QHNB 1OGTA 4XHJC 5C0EA 5I8OH 1P69B 3EDEA 2XZQH 2FLBT 2B1HL 4Q6IC 3MACH 1KLUA 5H35A 1JV5B 5I15L 25C8H 3PL6C 4PJ5E 5F8RC 1BREA 4E5XB 4OF3A 5SWQA 1IKFL 2GKIA 1GGBH 2YEZA 3GSWA 5IBTL 1NMAL 5JHDB 5EZOL 5C8JB 5IEKB 1AGDA 1UENA 2BVEA 1NAKH 1OLZA 3BISA 4HKXB 1BM3H 5EUKB 3EKCA 1PG7X 4B41A 2Q1EA 1R3JB 1WT5A 1EJ6A 2GAZA 2R4SH 5C0EB 1T0PB 1IQWL 3K2UH 1FLRH 1A9EB 2HRLA 4XBEL 1MHPH 3T0EE 5D72H 1KLUB 4P57A 3QRGH 4BFEA 2I25N 5MP6L 4ZFOA 2F5BL 4Z76B 3ARZA 5AYUH 4GKSA 4GMTH 4BM7A 5MHSD 3B3IB 5BV7H 4UZGA 4ODHL 2KQNA 4TNVF 1I9JL 3K3QA 5D2NC 5AG9A 2Y06L 4HK3N 4G7YL 4GLRI 5HI4D 2FWOB 2VL4A 4PJCA 1Z2KA 1QFPA 3WUWG 4KK6C 5GGUA 4ZD3L 5HHMB 1LVEA 5IMKA 4HIJB 4OM0L 4OCSH 4OLUH 5IMOB 1KIPA 4UTBL 1MJUH 3N85H 1U58A 3F65A 3B9AA 1RSFA 5H2BA 3E3QE 2VXQL 3F7YB 1T4KA 3P4NB 4CVZA 3VRLF 5D7KE 1EX0A 3S35X 2Z91A 4NZUL 2O5XH 2F19H 1AJ7L 5C0FA 4S2SB 4L3ED 4IJ3B 1W72H 1Z6JT 1E28B 2YPLA 5B38B 3L3GB 1A21A 4U2ZA 4M48H 4IRZH 4AEIL 1Z9LA 5HHPB 2ZUSA 3GRWL 1HXYB 4PRNA 4CGTA 4U0QB 3RP1A 1U58B 1XAUA 3KPSB 1N6QL 2XKUA 1OF2A 2J5LB 1T0MA 5F7DB 4Q9QL 4M6OH 5FO9B 3SCMC 1ZHKB 2IANE 1D7FA 4ZXBC 3FOLB 4EI5C 3ULUH 3B4NA 3V4PH 2FX7H 3PWJB 1FVEA 5HI5C 1OW0A 1MQKH 4MNHA 2N1KA 1GAFL 1LEGA 5EU6B 3ULVH 4JAMB 3MGAA 1MELA 5A2FA 4YNYA 4M1DL 4U1SB 3O8XC 1OAZL 1ZXQA 4GXUN 1UCBH 1ZLUK 1IGTB 3LZFH 2DKMA 3ZDXE 1G6VK 4HPYH 1U41A 4OTXL 5I75B 3GIZH 1FVCB 5D1ZC 4X6EA 3NCYS 3PWLA 3MLRH 4NKDB 3EYUH 4JDVA 3VGHA 5ISZD 3W9DA 1HHJB 3DLQR 1F4WH 1XGPB 1IGJA 4JG1L 1KG0A 4HSQA 1Z9SA 3BE1L 3QPQD 3G5YB 1F5WA 4BA8A 1T66D 4F7PA 4HWZA 1NGPL 2AXGA 5DVNA 2WP3O 3D69A 2YD7A 1WC7A 1D5ZB 3H6JA 4N68A 5FYLD 1FVCA 2UUDK 4YE4L 3QQ4B 4OIBA 1OGAA 1RZGB 1TQBC 3EGSA 2IGFH 4MHHG 4K7PY 3HC0A 1MLBA 4HH9A 2GJ6B 4X6BB 1L0XA 1ZWIA 5CEYB 3P0YH 5ESQA 2Q20A 1DEDA 1XGUB 3MRKB 1IGJB 5L6YL 5D7IE 1M7IA 4JFFB 4RFNC 1ZA6B 3BEVB 1SBSL 3N1MC 5EO9A 3QHZL 1JZ2A 3VFSB 2ERJC 3WUZA 3FHAA 4YXKL 4NQDD 4HZLB 4HKBB 1P6FA 5CBEA 4MHHI 5KOVC 3LQAC 2E27L 1F3JA 3D39B 3MGOB 3D18B 1RZGA 5FYJD 4PREA 2D9QB 5I8OL 5L0QC 5IQ9B 3RKDC 5B8CC 5KS9B 4Y5YB 3X13A 3F7QA 3EYFB 3JWDH 3KXFD 4RX4D 3UTPE 4JCMA 2Y5TA 1EJOH 4DW2L 3PDOB 3LY6A 1QLEH 2VSDA 1CE6A 3MA9H 1DQDH 1QPXA 2BVOA 3MMEB 4P9HC 2YPLE 4Z0BH 3HMWL 3ZDZF 1J1PH 3F7VB 4HZLA 2LFGA 3IFNH 5IVZB 2VDNH 5FYJU 5D70L 4FTVA 5DZNA 4S1QL 3VGAB 4OQTH 2GY7B 5GGVH 4ZAKC 4J4PD 4G6FB 4O4YH 1ZVHA 5D8JH 5D72L 4HJJL 1BZ7A 4M7KH 3O0RH 1BVLA 4HGKC 1JCKA 1AHWA 5FECB 2A2QT 3U9UA 4GW5A 1CZ8H 2E7CA 5D96C 2ZUUA 1OP9A 5CBAA 2BVQA 1K4CB 1T89C 2X89D 5MENE 5DLMH 1LEIA 1MHEB 4PJ7F 4W6XB 2P44B 5KJRH 4AJ0A 1CGSL 5K59F 2BNRB 4M5YL 1CL7H 2SEBA 1UYWH 1JZ5A 4CMHB 5F7WC 3FRUB 2I07A 2C3VA 3TPUA 2NXYD 1YEEL 4ETQB 2VLKA 2BSRB 3MOAH 4NRXA 5IHUL 2PN5A 1L4IA 1BZ7B 4OM0H 4P5TA 2DMCA 2IBZY 1BVLB 2HFTA 3QFJE 5EC2B 2WINB 3S5LG 3HS0A 3U82B 2J8OA 5HHOE 3SDAA 3MOQA 4JN1L 1IKNC 2HJFB 1CDYA 1KXVC 1GOHA 1MHEA 2VKXA 2AGJL 4NT6B 5IBLD 2LU7A 1JZ8A 3P4MB 4U6HA 4P2RD 4PJDF 1KLGA 1LK3H 1FHGA 5TFSL 5C3TA 2VIRA 4NWTL 1XMWA 3QXAB 3V0WL 1NH6A 2M8XA 4ZXBB 3MLVL 4YUEL 1HYSD 4NRXB 5C08D 3FQTB 4LSTH 4G9DB 4Q97A 1A6ZB 1G7LA 4L1HA 4K8RL 4AIZB 4P5TB 4EUPA 4J4PA 4ODXB 4J3WA 1JBJA 5DA4A 3HS0B 2JJWA 3CX2A 4E42A 2W65A 2ATPA 4G8GE 4YXHH 1GXEA 3P0GB 4U3CA 4P23C 1B4RA 5TDOA 5MERA 2BHYA 4LIQH 2ADGB 3AB0C 5DFVD 3SKNB 2P43B 2BERA 3VXMA 4TVPL 3GHBL 1MRDL 3WXWH 3C2AL 3O6LH 4OBSA 1DN2A 3HN3A 1B4JL 4KDTA 4L1DA 3TBVB 1KJ2L 5CJ8A 3SO5A 4EUPB 4L8CA 1P5UA 3QUYB 1H0DA 4KQ4H 4OZIB 3TYFA 3OWEA 3ULUF 3MTRA 4N8CH 4NP4H 1FVDB 4Z7QF 4CJ0A 2AXFB 2PXYD 5F7FA 4RBPK 3GJFH 1BWMA 1I8KA 1NAML 1AE6H 4XNUL 3VG0L 2AV1B 2MPAL 1QO3B 2RHEA 1TPXB 5E4EB 5JNYA 1HQRB 5L8JB 4LVOC 4I1NB 4XVJL 1MCCA 4GRWH 5DJXA 4CBPA 3D5OF 1E4XH 3ZDZE 4OD3L 3FTGB 5F6HJ 2IQAA 1V7MH 1OP3H 5IHBA 3MNVA 3A67L 1T04A 1F4WL 4RFNB 4HLZH 1YUHB 4WIQA 1HHIA 3JWOC 3STLB 2B8OT 3CVHB 2ZUQB 4ZPVA 2Q7YA 4R3SB 3CPLB 2XPGA 5JZ7C 5EU3B 1PLGH 4OGAD 5EIIA 3RFZC 4EI5D 3MLUH 4GSDL 5LBSL 3ARFD 4GJTB 4RFOH 4X4YB 4Z7UA 4NRZB 2VAAA 3KLHD 4CN4A 3LRSB 1A14H 5CP3A 2AKRA 5E99H 4LK4A 5HY9B 5DURD 4PRIE 1A2YA 2I60L 3ARUA 4XP6L 2JLLA 4MJ5B 3LOWA 4N9OB 3FO1A 4U7MA 2V17H 1KXQE 1KPUA 3ALXA 5GGSB 4KI5F 1WBZA 4OM1L 3P4OA 1JHTB 4GMSH 5F89B 4C83B 4K3JL 2A6KB 2M26A 4MA3A 5HHOB 1D5MB 2XKNA 5C7XH 1PQZA 1YMMD 4O58L 3TM6A 1XR8A 4E41E 2DQHH 3H42H 3V79C 4LEOA 3OKYA 4HPYL 2WANA 2VUYA 1S7WB 5TE7L 5GRJL 1S9WA 5FYJE 2B0SH 1PX3A 1I4FB 1M71B 3RHWK 3QCVL 1XF5A 1BIIB 5FUCE 4IIQA 2VXVH 5JO5B 1PKOA 4GS7C 5DQ9A 2P5WB 3AVEA 3U46A 1A3LH 4WO4B 1KB5H 4QRUB 4WEMB 2V7HA 4PV8A 3VXME 2W60B 1FDLH 1YY9C 1T6WA 3MRIB 3BIAX 2Y6SD 5DJ8B 3ARTA 2EDOA 3P30H 4FXKB 4JANB 1ZTXH 4JDTH 4KQ3H 1U91A 5D71H 3GMNB 1B6DA 2R0LL 1S9WB 2ZSWB 4PLKD 5C0BB 4WDIA 1RHFA 5DLML 5C6WH 3QRFM 3EO0B 4GAGH 2NNAB 4LGRB 4OCRH 3HE7A 3QEGL 5CEZH 3T2OA 3AU1A 5DJDB 4QRUA 4UUJB 2VN4A 4LVNC 4O2CA 4X5XB 4GQ9H 3SKJH 2H32A 2QQKL 4OV5B 4HXAH 4CW1B 3WFDL 2EH8H 4I0PB 5DC0A 1KJVA 2OP4L 3RTQC 2P8LA 3VXRE 4PRIB 3SDAC 1ND0A 3QDMA 1I9RH 5ILTL 2Z0BA 1YEHH 3W5MA 1LE9B 1F11B 1OT1A 3UTZB 4OV6F 1HHHA 1T83A 2CGRH 4PJAF 1A6PA 3B5GA 4EDXA 4EJ1C 5IVNA 3FQUA 1MJ7H 4FQJL 1I7ZA 5TF0A 2EE3A 3QQNA 3DO7B 3MRJB 4YLQT 2KBGA 2XOTA 1A5FH 5L7XL 2E7HA 4ZO6A 2IAMD 3H3KA 4KMTL 3QDJB 4FP8L 1H8OA 3NPSB 3QI9D 4MXVE 1QFUH 2P8LB 4PRIA 1BOYA 1H3VA 5AD0B 4HBCL 4Z78A 1MRFH 4TVPH 3MA7A 2RB8A 1D9KA 4HV8B 2D0FA 2G2RB 2ESVE 3GMOA 1BJ8A 3GMLA 1FL3B 5L8LB 4XXCC 5HYJB 4WFGE 3JZ7A 2EIDA 2MCPL 3QIUA 5I8KL 5TH2A 3V0AC 3SDDB 4Y5VA 4TYUA 4PB0H 1GGTA 3VXTB 3QDJA 5E2UH 2FH6A 1WJ3A 5HHME 1FG2A 4F7CB 4PJ8A 2W9LA 1MFBH 3MR9B 5J9PB 3FFCE 3TZVB 1MCSA 1MFCH 3BKJL 4PP1D 4HUVA 1NAMH 4XNQB 2WV3A 4HKZB 4XNUH 3MLWH 4ZAKD 3VG0H 2ZUWA 1BQHG 4LSRH 5D7IF 4G7VL 4UNUA 3AGVA 3GK8L 4ELMF 3MRQA 5K9QI 2D03L 4KK9C 4AH2A 3W9EB 3QSKB 3HHRB 5F9JB 4Y5VB 1JNHB 1KTDA 1OD7A 3ILQD 3PG2A 4P2OA 4LLYA 3PWPE 2F9BT 4O2FB 4G7YH 4ORGB 2DQGH 1FZMB 1IC4L 2YOCA 1OAQL 4UINL 4N0UA 2W9DH 3MBEB 1SJXA 3FO0H 4IOFD 2CLZB 3SO3B 3DXAD 3PUCA 3DX8B 1IAKB 1G1CA 3GKZA 4HQQL 5DRZA 1BGXH 3HC3H 1Y6MR 1UWEL 3QXTA 4YBHA 3DX7B 4A6YB 3BW9A 2HVJB 2W0LA 5AWNL 4YBLB 4P2OB 3LPWA 3L5JA 3OKMB 2UZIH 3EJZC 1VKXB 3WLBB 4X5WA 4MCZB 4HK3J 3LVEA 3WXWL 4S1SH 5IOPA 2VDKH 4ZODA 4OZ4B 2EYRA 2X4OB 5ID1A 3RRQA 5IIEA 1Q9WA 4KKCC 4PJIA 1QSEB 3OB8A 4G8GA 1CLCA 1MLCB 2V2TA 3CFKA 5K9KB 3ZKSD 5GS1A 4IMKA 1BHGA 5HYJD 3PQYD 4TPRH 4FZ8H 5HYJE 2DQJH 2XFXB 5I1KH 5GRJH 3VXRD 1PSKL 4HUXB 4FFWD 4XPBL 1SVCP 3G9AB 4AQ1B 1OB1A 2LTQC 5IMMB 2IFFH 1ORQB 5D4QA 2OXGA 4IMLB 4UOJA 1J18A 3GIZL 3VRJA 3OMZA 2YBRB 1AIFA 4M6ML 3OGCB 3KYAA 1MLCA 3QIBC 3NCBB 2ESVA 1FNSH 4HS6B 1L6ZA 3ZSTA 4BK5A 1G7MA 1VPOH 3SCMA 5ADOH 1JI2A 4CVWA 2FHCA 2MNUA 2HTLC 3SY0A 2VLLB 1YN7A 4C58B 5BO1L 3TFKD 4KPHH 4UILL 4ELMA 4HUXA 1CXLA 1J12A 4Y4KC 4O51A 1SYVB 3S8WA 4YR6A 2P8PA 1WVZA 5IMKB 1FP5A 3I02B 3SEPA 1MI5D 3OHXB 1R3IL 4X83A 3WNPA 2P8MB 4YE4H 4G6KH 1TMCB 2AXJA 3OGCA 4TOYH 8CGTA 4D0CA 3HFMH 3O9WC 4FOMA 1Y0LB 4WENB 4AQOA 1CGTA 4BK4A 1TVHB 5FO7A 3D25A 2BJMH 5DK3A 5C0GB 2FNBA 5E56A 3DIFA 3A6CL 5D7JB 4F7MA 4NZRH 2UYLB 3CH1B 4ELMB 1NMBL 5I17A 1HINH 3BVNA 3VXOB 1RIUH 2CGRL 5LGHL 2YD6A 4G8FA 3DI2B 4OFVA 5HHPA 2CXKA 1OSPH 2BY0A 3KYKL 4CMMA 3MXVL 3TWCH 3NOIA 4KTDH 1JNLL 2FCBA 1P2CB 2VDRL 3PGCB 5A1AA 3GMQB 1OHQA 5FO9A 1Y0LA 3I6GB 1D6EA 4PRAA 3T1FB 4LBEB 4YX2H 3FB8B 2XWJA 1FVEB 3PWJA 1QACA 4NFCA 4F7MB 2ZNWA 4M7LL 1LILA 1KCLA 5KVMC 5CCKL 3OXSA 3GKWL 1DDHA 4CL7A 1HEZA 3BHBB 2VQ1B 4RISL 2PYEA 5I71C 4LNRA 3F58L 3INUH 4XPHH 3QEHB 4PJAB 3OXRA 5IW3A 3CX5J 1JFQL 4M8VA 4QRSA 5BXFB 1N6UA 1S7TB 5DQJB 1PG7L 3TN0D 3WFBL 1MI5A 3I6GA 1YJDL 4NQCE 4M9PA 4MA7L 3HNTL 1UVQA 5A16A 3C09B 4LHJB 5IT2L 5HJ3A 2QQQA 2X4QB 5A2JH 5JOPE 1UJTA 4JHAH 4WTWA 5GZND 3L9RA 2HT4D 2W91A 3WS6A 3WXVH 4DOHE 2VQ1A 4HWZB 3OG4B 1CZ8L 4OLZH 2YUVA 4KRPC 3QXDB 1UXWA 4JFDD 4PJXB 2O5ZL 4PJAA 1D5ZA 4PUBL 1HWGB 4TSAL 4P4RA 3QT2A 5T1DH 1I3RB 1J1OH 5TE4H 3F5WB 2ADJB 3GJEA 1TITA 5E8DH 3S36L 1AC6A 3DSNA 4M43H 4Y16D 4XCYB 2DICA 5HJ3B 3UROR 5DVKA 5IHUH 4HFWB 2ENYA 3LRHA 2YRLA 2OZ4H 4UT7H 3DUSB 3O3DB 3BWAB 4RNRA 5EZJB 4DUWA 4W4NA 2OJZH 1INDL 1EXUB 3U0TA 5HGDB 4BUHA 5JW5A 1T5XB 1FN4A 1A5FL 4XMLH 3V52H 5HGBB 2JIXA 4HKBA 4NNPH 1IAIM 1S8DA 2VLJB 1IC7H 3I9GL 2ADJA 1FSKC 5F9WB 2WWKO 3MBED 3TH2T 5FGCE 1P4LA 5HHXL 4S1SL 1AO7B 4HFWA 3U0PA 3UTQB 2DQEH 3UYRH 5D1ZA 1EMTH 1IGCH 2JF1A 4XCCH 5D2LE 3DUSA 3O3DA 3D0LB 5GXBB 4LKCA 2DBLL 3WJJA 1D5XB 2O93L 1RIVH 1CICA 3O8XA 4HJ0C 5EH1A 5CZKA 1VEPA 4K7PX 5KVDL 3PNWB 4Q6IA 1JYWA 3O6LL 1RHHB 5E5MB 3IVKB 1VA9A 3VI4E 3S34L 4GBXA 5C0NC 35C8H 4HWBL 3PL6D 4NQCB 3DVFA 1NBVL 4I2XE 3V5HB 3VRIA 2I9TB 3X12A 2PCPB 4KZDH 4F2MA 3U9UB 5E6IA 4K9EL 1K4CA 3O8XB 1WLHA 4FQ1L 2CK0H 3HPLA 1EAPB 2R69H 1HH6A 5ADOL 3BH9B 1AD0B 3PNWA 2PYEE 2VR5A 3NAAL 5ETUB 3TCLA 4A2LA 3DNKA 3RWCA 3GI9H 2Z8SA 1NFDB 4Z18A 3EOAB 4P49A 3FT4A 1F6FB 3G6AA 2ZSVA 1QG3A 1UWXH 5CIPH 4MB4A 4YK4B 3BEWB 4MXQC 4K7PH 3VWKD 2E6QA 5DK0A 5J7CC 2IPTH 3MRMA 5BS0A 3L5WA 3RTQA 2QKIB 4ZAKB 5IB2A 3P73B 3S35H 2X42A 3U2SA 2UZIL 2BJML 1ETZA 4QRQB 1SBBA 5CEZD 4MZ3A 1ES0A 2DQCH 2JELL 2AERT 4G8GD 4TOYL 1FNFA 3G6AB 1E27B 5J6GB 5DI8A 1UZ6E 3D87B 4F9LA 4LARH 4FABH 4TULH 4G9FE 3TT1H 3MGTB 4ZFZA 3LCYA 3AS0A 3QCTH 1ETZB 3PQYB 4YX2L 2CRMA 3GMRA 3OKNB 4JO1H 3ARDB 3SKOA 4J8RB 1ZT1A 3LH2H 4ZUSA 2IBBA 5IK3A 3IXTA 4X7SH 3CZJA 1X6LA 3BH8B 3BFOA 5DRXA 3O4OC 4MCYB 4HW6A 3MRBB 3JV0A 3OV6A 4XPAH 4OFPA 4U1JA 4Y5YC 3RL1B 1G0DA 1OY3B 4BFGA 3LKRA 1EK3A 1A3RL 3AREC 3Q0HA 4LHUG 1FE8L 1AQDB 4ZTPH 2NPLX 4N0YL 3S9DB 3VWKA 2AV1A 3CSPA 2FX8L 3OKNA 3RX7A 4PV9B 4S1RL 3IGAB 4LCUA 3CH8A 4DGYL 4G6AC 4JHAL 5F7UA 2GAZB 3O11B 5F9OH 1MCFA 4P3CH 4Z7WF 3VXUB 4YFLF 4ZS6D 4AENB 1OWRM 5H94B 2Z93B 3IDGB 2CXGA 3R06A 4XBPA 2Q86B 3GHEH 4OD2A 5F6IC 2BX5A 4P57B 3MRBA 1T04B 4G6KL 4H8WL 1J86A 4H1LB 3OG6B 3RWIA 3AS3A 1BM3L 1U8OB 3Q48A 1JWMB 2QEJA 4R3SA 4PJ8D 2R0LH 3LKRB 3ZHLA 1GZPB 3WXVL 5JLZA 3W82A 4OLZL 4X6DE 5GRXG 5KVFL 1BVKA 1IZJA 2RQ8A 5HHOD 5AZEH 1CXFA 4LDEB 5IFAL 1ZA3A 3R1GH 2IWGA 3TH3T 8FABB 1F4YL 2FEDD 2B7DT 3X11B 5E08H 1BFTA 2IADA 5DHVB 4HUUB 4V1DD 3H0TA 1I8MA 3O3EA 5JMRA 1RMFH 2DJ4A 2FD6L 1INDH 1EEYA 4OD2B 4HIJA 1VADA 5GZOC 2OSLB 5DUPH 2DMBA 1JNLH 3BP4B 1J05B 2V5RA 3FO1B 4OCWH 3V2AR 1A1NB 3UYPA 4I4WB 3DV6B 2EXYD 1KYOJ 4XPFL 5F7KC 4LKXA 2Y06H 3OGOE 2DIJA 2OJZL 1BPVA 4PGEA 1IGIH 3SDDD 4M7LH 1NLBH 3WNOA 2A6JB 2X4TB 1TXKA 5DHVA 1YMMB 1ZHLA 2XT1B 4ODTH 3MV9A 1DQML 5MHSE 1SEBA 4FMKA 3AB0B 4Y5XA 1DSFL 3KG5A 4M61B 2VLME 5HYQA 1LE5B 2GTZA 2ARWA 1J7VR 3BZDA 4HEPG 4W4OC 3RKDD 4PGEB 4M6OL 4NKIH 4X7FC 5GSVB 4X6CE 2CO6B 5I8KH 1MAJA 2EC9U 2P5WA 4ZS7H 1LEGB 3TESA 1FAIL 1TVBA 3GSOB 1W0VB 5JDSB 2VR4A 2IALA 1NMCC 4G5ZH 3HC4L 1NDMB 4O9HL 4GW4B 3QNZB 4LOUD 4OZFB 4U1MA 4JANA 4X6EB 4P5MB 5FHAH 5DJCA 1A7QH 5HYQB 1IAII 1QYGH 2MMXA 1S5HA 1R5VA 3MLRL 2DDQL 5DC4B 2B2XL 2CLVA 1WFNA 2R69L 1XGPA 3MUGB 3LZFL 1GH7A 4HAGA 2NCMA 5BVPH 4ACPA 2YUWA 4PJAE 3HNVH 4F7PB 4PRPE 3MRNA 1EHAA 2X5PA 4YDVA 4HJGB 3QIWB 4YQXH 2EDJA 3QDGA 1EBAA 2BXZA 1RURL 4R7DB 4H20H 2R56L 5E00A 1WTLA 4NWUH 5KSUB 1HHHB 1KELH 2GJ6A 5DHYB 4ZFFA 4LRIC 2BCKA 4N0FB 4YHPA 1WAAA 3BQUC 4XAKE 1LO4H 3ROLB 5EUOA 4MD5B 5D6CA 4FXLA 2WUCL 4GS7B 4XP4L 5T3ZE 3S5LA 3CZFB 3IFPB 4PJHF 2R0WH 4FQLH 1A6WL 5IBUB 4DTGH 2NY5C 4JFEA 3EZ8A 3EYQC 1ZOXA 2Y25A 3U36A 3I84A 4AG4H 2UV3A 3GMOB 1GYAA 1MFNA 2FO4B 3QNXA 4WHTA 1T1YB 1AP2B 4W4OA 1N8ZB 3EYFA 2G9HA 3FFCD 2CDEB 4IDJL 3ROLA 4RDQG 1CD9B 5EO1B 1AXTL 5D6CB 5DWUL 4CDHA 5D1QD 5FGSA 1QFWI 1UJ3C 3FL7A 3WE6B 3BPCA 3FONB 1XIWA 5FUOL 5FK9B 4PJ9B 5D7LE 1FE8H 2EO9A 3HB3D 3L3DB 3NAAH 2DQIH 3HPJA 4HS3B 4G6FD 3K1KC 3JWDC 4OLYL 3T77B 3RUGE 4JM2D 4OFYA 4XPAL 4JQXA 3UTSA 3MBXL 4XMKL 3EHBC 3MYJB 4LP4A 3FB6B 3RBGA 3LDBC 4UOW1 5F7EL 5EC1B 5E5RB 5I30H 3ARQA 1IGMH 1AP2A 1NJ9A 1XF4A 3IFLH 3OPZL 2KPNA 1KN2L 1ZSDB 1NC2A 3C6LC 2C26A 4N5UA 3RY6A 1ITCA 4PJEA 2EYSB 5DMYA 2F8VA 2QQNL 3MSPA 3HLAA 4WW1B 3L1OH 4OI7A 1U3JA 1LEIB 5LAXB 3L3DA 3P0VH 3LSOA 1T1XA 1KV3A 1UB5B 3MYJA 3DX8A 4X7TA 3IDIA 4TNVK 4HF5H 3O3BB 3I3BA 3BGMB 3D39D 3QUKA 2J1KA 2BSRA 1M4KA 5GS0L 1QSEE 5L8KB 3TZVC 2XNAB 5EC2A 4XNXL 1R6VA 4R2GB 4UQ3B 5F3BB 2Q8AL 5I8CA 3UC0H 4K07A 4HUWB 4WUUE 5AZ2H 4LFHG 3MQIA 3ARVA 2EC8A 2CK2A 4OCWL 3QXAA 4X7SL 4ZS6C 3KLAA 5I1DA 3TWCL 4TNWK 2A6DA 2VSCA 3QDGE 2NY4B 3BIKA 4UIMA 3V0WH 4N9GB 4JN1H 3REWB 4NO0B 3CFKB 3V7MA 2EXWD 1IGIL 1DL7L 3LKQB 1LK2B 2E9IA 4ELKA 3CVHH 4X4ZA 1QFWH 4KJWC 1LMKA 2XFXA 1NEZG 4Q9RH 4PJ9D 3OJDA 5F1NB 2AXHA 4JPIA 3QO0A 3RWDB 4JO2H 2HT3C 4R7NA 4FFZH 4HUWA 3DXAA 3KNBB 1RZFH 2HWZH 5E6IC 2DAVA 4HHAB 5IHZB 5I66B 3M07A 5DEZA 2VLKD 2PYFB 4ONFL 3ULUD 2YBRA 4LLAA 4N9GA 5MEQB 3WV0A 1P1ZB 1QRKA 3HC4H 15C8L 2VOTA 3KDMB 5AUMB 9CGTA 1U8IB 4MA7H 4KH2A 1F00I 5T5NF 2DF3A 2IAND 4BSWA 5IT2H 4ZS7L 3B2VH 5DD0L 1OOAA 4P2YA 1TZIB 2HG5B 5EU6E 1YYLH 1R24B 1A7BA 1JPSH 2H2PC 3QI9B 4U4BA 3U83A 4M93C 3WHE1 4AL8H 2EIEA 3BN9D 4PJEF 3WFCL 3MNZB 5GHWL 2AEPH 4ISVB 1Z5LB 1TFHA 2P8MA 3PXJA 2GSGA 2JTDA 2IG2H 3UTSE 3QEQE 4OD3H 1GCFA 4GKNA 5DA0B 3D25B 4OZHE 4YHZH 1YUHA 1ITBB 4P5KA 2MPAH 2JCCB 1P84J 1CDHA 5ICXA 2NYYD 2Q7YB 5LGKA 2FEDC 2C3XA 5DD5H 3TJEH 3F62A 3B8SA 5MENB 2EKJA 2XICA 3DV4B 2VITA 4CMMB 2H41A 1JN6B 1H5BC 1IBGL 2YPVH 3ZHDA 3UMTA 4N8PA 2X4RA 4WUUB 5DS8B 1C8PA 2VZTA 4HT1L 4TUKH 2H2SC 2UY6A 1NEZB 4L3AA 4KROC 2VZ1A 2RCSH 2VC2L 2A83A 3OR6A 5J3HC 4NQDA 1RJLB 1PVHA 5ADPH 1DANT 4AG4L 2GT9B 1B90A 2QR0A 1RI8A 4U1GB 1KTLA 5TE6H 4DGVH 1P7QA 4XVUD 3N9GL 5CEZE 1CLYL 3U7YH 3IDXL 4WUUA 1GPOL 3ARDD 3RY4A 5AAWA 5ERWA 5H2BB 5A16B 3T2PA 4LSVH 5IB3A 1GGIL 5C0FB 1E4KA 2GK2A 3TA3D 2MQCA 5LJYH 1P84K 4UV4L 7FABH 4I0CC 1MVUB 2ICEA 1MRCH 4B53A 4G80A 1N3NA 2H9GB 3VH8A 4U31A 4MSWB 5TE7H 4OIAA 1K9TA 5JOEA 3VD9A 4IDLA 2C4XA 3V0VB 1G7PA 3STZB 4UBDC 3FQXA 5JXAL 1YEIL 4HLZG 1OF2B 4PY8J 2YD2A 4FFYH 4OCXH 2DQFB 3VMNA 1OPGH 2VABB 1Q9LB 3VW3H 5CILH 1EGJH 3E6FB 3LPFA 1FNLA 3G6DL 5LGJB 5EU6A 3DUUB 4JAMA 4ZOCA 3K2UL 3SE8H 4M6NL 5GS0H 3MRRA 1T20A 2A74B 3O2DL 4YIQA 1Z0MA 5HGBA 4MSWA 1RK1B 4XP4H 1ZT4B 3ROOA 3ULVE 2B1AH 3FQXB 3HB3C 2XRAL 3GSRA 1Q0YL 4CN6A 3O3AB 4JDVB 1G7IB 2WBKA 3BZ4B 5ELIA 4YJZL 3MUHL 3BD3A 3UBXB 3S97C 3BP5A 3M1BA 3HAEH 4YHLH 4P46C 3K2MC 4UT6L 5FUZH 3IAGC 2X44D 4QEGA 1A9BB 5T3XH 4F58H 1U8JA 3SDXF 4DKEH 2DI8A 5LGJA 4ZFGH 2NY1D 1J1XH 3BYTA 4WEBL 3KJ6L 3VGGA 4H26A 2EDLA 3CVHL 4CMHC 4FQJH 4KGLA 1PKQB 5IW1A 3SQOL 3FMGL 3ROOB 4ZO8A 5JQ6L 2R0ZL 3U30C 4JRXE 2PXYB 4FQPA 1C7TA 1JPGA 5FKPA 1HI6B 1DL7H 4Y4FB 4UTAL 4GBXB 5EBMB 1JE6A 3HZYB 2FBOJ 1D9KB 4HV8A 3UPCA 3C09C 12E8H 4APQC 4EI5A 5L2KD 4HIXL 2FO1A 3IYLW 3MRPB 1IGYB 3WD5L 3N06B 3VGEA 3CK0L 4U3HA 2BNQB 4J23A 5GJSL 4JHWH 5CFHA 1WITA 2H3NB 4NZTH 3VWJD 1VGEL 4Z7NF 3QIUB 5TH2B 2P42B 3QIUD 1JHLH 1F4AA 3WSQH 2FYYB 1K2DB 2X7LA 1RUQH 1BQLL 1IQWH 3EDFA 3P9WB 4WFEE 4RAHA 1TPXC 4YEFA 4IOFC 1GVIA 1HKLL 4L3EE 2R9HD 4IMKC 4Y4FA 3W81A 3LKSB 4HF5L 4HGWB 4H8WH 3ARBD 3B2VL 3NMEA 5DD0H 3WUWA 4P3DA 1B2WL 3TV3L 2Y5TB 3GK8H 3WIFA 4YHOL 4AH2B 4D9RD 1IMHC 3W9EA 1ZVSB 1PW3A 4JQIL 1FYTE 2BP3A 4PJHE 5C07A 3HR6A 1P7KB 1MFCL 3K4ZA 2C9AA 2FSEB 5TJWK 2V2XA 3N50A 4MXWH 4P4KB 1J8HA 4FZEH 3EYSH 2WSKA 3K8MA 3GSVA 1I9IL 5A2KH 1MJJA 2ICWB 4ODBD 1FCGA 4UV7L 2L4OA 2C3GA 5H35B 4BH8A 1F2XK 4P3DB 1LO2H 1QNZH 2I27N 1EUTA 1G7JB 4APQB 3MUZ1 1T22A 1TDQA 3RX5A 4YEEA 1LEKB 5BS0D 4CU7A 2J88H 5CBAB 3B2UC 5C07B 1KCVH 3ZE0E 2HVJA 4HKXA 1EA9C 3E2HC 3G5XA 3GB7B 3TA3C 3TN0B 5C9JA 4X5WB 4J8RA 5JW4M 1PKQE 1CBVL 1IM3B 2D7OA 5KW9H 4L9LC 2HH0L 5CHNB 5HVGB 2I07B 2VTFA 2WMPA 1U92A 1AGBA 2A77L 3U7YL 4NHUA 1LNUB 4Q9QH 1LP9F 4ZFOB 4Z76A 2V2TB 3ZKQD 1YC7A 1LD9B 3EFFA 1FO0H 2ITDA 3VWKB 1YYLL 4NKIL 1U8LA 2KH2B 1QP1A 3KYMB 2FBJH 5HSFA 1QEWB 5C2UB 4HUMB 4I77L 1IFHH 3FO9A 5D1QA 4DGIH 2DI9A 4H88L 4QHUB 4ZXBA 1AGBB 1DFBH 3BI9X 4XNMA 3VDAA 1BD2A 3KS0H 4IMLA 3SPVB 4DN3H 2XG4A 1JPST 2DKUA 1AIFB 2F54B 1YEDA 5DMKA 5B4MC 3SCMB 4POYA 3UZQA 2V5TA 3C5JA 3IS0X 5TQ0L 2EEDA 1VPOL 5ESVA 5TDOB 2AVGA 5GJTH 1KPVB 5DXWA 1QEWA 1G9NC 1BJMA 1II4E 1WK0A 4WFGD 5D5ME 1ZLUH 1LP9E 2DRUA 4X6DF 1DCLA 3T2QA 4LU5L 3I02A 3O41B 4P2OC 1OCWH 3KR3H 1JF5A 2JIXD 1BVZA 4PG2C 1MFDL 1CICD 2ZG1A 1Z9OA 4K55A 2R23B 4GAJL 2GJ6D 4GRLB 3JSSA 4OF8A 2CO7B 3VFUA 3CSGA 1TVHA 4QKXB 5FO7B 3CXHK 4X7DC 5D7KD 5JPMA 2R2EB 1EFXA 1OSZB 2XTJC 3RL2B 3AXLA 1CGSH 3OB0K 4KK9D 2PF6A 3K0WA 4U2YA 3DYMA 5GS2H 4UMGA 1M05A 4JY5H 1IAOB 4QO1A 1RUKH 3QNYB 5ACMA 5FXCH 1NSNH 3WNLA 1F3DJ 1JMXA 3E1F1 1CFQB 4PRDA 2DTSA 1G9NH 3QUXD 1JI1A 4LCWE 1N5AB 5DMJB 3O2WH 1OM3H 2EYTA 4OBRA 1R3LA 4NKDA 1M6OA 3OF6A 2X9XA 4PIRF 4QRPA 3STLA 4XXCA 3BKCH 3HR5A 1D6EB 3IT8D 3VFUB 4A2MA 4HC1H 1BQUA 1O7SA 4OGXH 1EH9A 3H7LA 1MFEH 2DBJA 1UH3A 3UX9B 2UZYB 4M7JL 3G5VB 2DM7A 1LK3L 2IPUG 4OLXL 4Z8FH 3S98A 2F8XC 5TFSH 3MRFB 1FZJA 5DJ0A 5B8CB 4TNWF 3CK0H 3MLZH 5HY9A 4PRHB 3QNZA 2DQIL 3OXRB 3I2CL 1OAKL 5FA4B 1DEEB 2YMXH 32C2B 3PIQB 1TZHB 1S7TA 5DQJA 4JQXC 3Q5OA 3G08A 4HD9A 5B22A 2KL6A 4R26H 4ZUWA 2OL3A 1M7IB 3OJ2C 3ZTNH 4QRRB 4ZOBA 2BVYA 5GRVK 5JOFB 2LABA 1FZJB 4X80L 3LS4L 1MRDH 5SX4H 2MWCA 1NAMA 1QSFB 4RMUA 1YJDH 5BZWB 4JQIH 1EFXD 3P0VL 4CVUA 5CBEB 5GS3A 1L6XA 3QQ9C 5BMFH 1Q9KA 5FCSH 4WFED 1B2WH 3TV3H 1F3DH 2NW3A 2HFFB 3LIZH 3P77B 2HJKB 4MLSA 1LQSR 3Q3GA 1E6JL 3NGBB 3MLTA 4JRYD 3FOMB 5C6TL 1BIHA 2VXTH 2HT2D 5GRUL 5B21A 4F33A 3CLFH 4PY7B 3UCRA 1NKRA 4JVWA 4L8SA 4RMVA 5EU4A 2DIBA 1INEL 4P9MH 3C5ZA 2QSVA 5DVOA 3OSKA 3DURB 4IM8A 2CMRH 3T3PE 4PJBB 5DJ8A 1YN6A 3RIFF 2FX9H 4Q58C 3W0WA 3VGFA 3BDBA 4Y19A 1VCAA 5J4MA 1YNTA 3UBXG 2Y7QB 3MLTB 2H26B 3D6GA 3QUML 1TLKA 2EXYC 3PV7A 4Z7UF 2NNAA 1V7NL 2ADIA 3EO9L 1JP5A 1DQQA 3SBWC 3TYGH 2XN9E 4O5LH 3AC0A 5I1CH 4PRPB 1IAIH 5F7HA 1GIGL 5I16B 3CC5A 3MUY1 4P48A 3VXSD 5SX5H 1MJ8H 4KK8D 5HHVL 4R97B 3K74B 3GUTB 5KVDH 2AJYH 2K3TA 2Q8BH 4BH7B 1ZLVK 2DLTA 3QAZB 4RGNC 4LFHD 4JJ5A 3QDJD 1QRND 2J2ZA 3VWKC 3UPRB 1DLFH 1DBKL 1FIGH 2DBLH 5T1LB 4KMQA 5IKCA 1DE4B 3AREA 4MD4B 4EDXB 5DO2D 4X5LA 3C8KA 2WINA 3AM8A 4F2MB 1MCDA 4NN7C 2C1OB 4C57C 1RUPH 1UM4H 1MIML 2CDFA 5I16A 4RX4A 1F58H 1NGWB 3HE6D 2AJZA 1TQBB 3TCLB 1UACL 3MLSH 5TPWH 3MA7B 2DQUL 1HHGB 2UVFA 3DMMB 3BGMA 2DWDB 5I1EL 1U8HA 4WWKB 1AR2A 2OI9C 3QCVH 5AAMA 3M8OH 1QNZL 1DBBH 4I5BB 4ODXA 5DK0B 3Q2CA 4L4TE 5IB5A 1MIEH 1RIHH 3MRMB 3UZEA 4NO0D 4EVNB 1ZGLP 3OZ9L 3LQZA 3AY4A 3QCUL 4M4PA 2F58L 5I8EA 2AEWA 3Q1SL 1OP3K 4C56E 3MO1A 5EBWA 3HNSL 4UOW0 3IJYB 1ZLSL 3KPNA 5EIQA 1CT8A 1G9ML 2YD9A 3HI1A 4R4BB 4LLVB 1NBYB 4DWHA 1KEMH 2DWDA 5DI8B 3ESVF 2P5WD 3QWRA 3VD4A 3FT3B 3HE7D 1NCAH 1W72A 3NA9L 2UWEE 5K59E 5FM4A 4LARL 3P0YL 3T08A 4WI8A 4QGTA 1OM3L 5BJTB 1BBJB 5F9JA 5CWSA 1ZEAH 2AXFA 3HZKB 4H1LH 3FB5B 5FGBC 4QY8B 1NSNL 1SBSH 5D7IB 2G5BA 2EH8L 2ZOLA 4QHNA 4L29A 1QO3A 1T89A 4KHTH 3KPNB 1JZ4A 4BELD 3MOBL 4DGVL 1N26A 3IDMA 4YWGL 1RZJH 1B0GB 2XQBL 5IK3B 2PYFA 1IC1A 3MV9D 2IH1B 1N5YH 3DRTA 2HRPL 2J8HA 2VDQH 3HAEG 4XGZA 3TO4B 5EZLA 1T0NA 5C8JA 2PO6A 3JWDL 4ZPVB 5KVGL 2YN5A 2OZ4A 5EU3A 4C4KO 5IJKA 3HZKA 2CKBB 4L4VD 2R8SH 4OFKA 2R29H 3LN4B 4YHMH 3HG1D 1DLHB 1IEAA 4KJQC 4OLVH 1KGCE 3MZTA 3BN3B 5CJOH 1WICA 2R0KH 1NUGA 1JYNA 1K8DB 2FJGB 5CINL 2WLYA 2AKRB 3LD8C 4X80H 4Y1AD 4P3WA 1SY6H 3MROA 1CLZH 3V8CA 1N2RB 4W81A 4PJGF 4WO4C 1MAML 3SDCA 4LPWA 2JCCA 4XCNA 5C0AA 1XF3A 1KPUB 4ALAH 5E2UL 1E6OH 3L3IA 4GAGL 1YPZB 3TT3L 1KJMA 3BPLB 1IEAB 1MFBL 2FWOA 2LE9A 5ID0B 3O2DH 2KUTA 2L0DA 4I8DA 1CD1A 4HGMA 3O2VL 5GRVL 2I5YH 3RVVC 3OB0H 3MYZA 2YA0A