2GG1A

Nmr solution structure of domain iii of the e-protein of tick-borne langat flavivirus (includes rdc restraints)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
TYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Genome polyprotein
publication title NMR solution structure and backbone dynamics of domain III of the E protein of tick-borne Langat flavivirus suggests a potential site for molecular recognition.
pubmed doi rcsb
source organism Langat virus
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2gg1A00
4GT0A 3G7TA 5JHLA 1OK8A 2V33A 2H0PA 1Z66A 5KVEE 1UZGA 1URZA 5KVFE 4UTBA 2P5PA 1TG8A 3C6EA 3C5XA 4UT6A 2HG0A 3N43F 4FG0A 3UZEC 1OANA 5JHMA 4UT9A 1ZTXE 3VTTA 4UTAA 4FFZA 2I69A 4GSXA 2GG1A 5B1CA 5IZ7A 3UAJA 5IREA 5GZNA 4L5FE 5AAWC 5LBVA 3UZQB 4FFYA 4AM0Q 3N42F 3N44F 4ALAC 3WE1A 1RERA 2ALAA 5KVGE 2R69A 3P54A 3IRCA 4BZ1A 3MUUA 1S6NA 5H37A 2JSFA 4BZ2A 5KVDE 3UYPB 5LCVA 5LBSA 1PJWA 3UZVA 3J2PA 1SVBA 5AAMC 4UTCA 1OKEA 4AL8C 3N41F 5GZOA 4X42A 3N40F 1Z3RA 2JQMA 2R29A 2JV6A 3J27A
chains in the Genus database with same CATH superfamily
1D6VH 1S78C 4GB9A 5I1GH 3OV6A 1HQ4A 4LQFL 3UC2A 4JAMA 4R7XA 4DAGL 2HRPH 1VAHA 3K0WA 4M6NH 4KNTA 1EQWA 3LQAH 4AE0A 3KS0J 5DD3L 3F00A 5E2UH 2MFNA 5EN2B 5EU6D 3G08A 5A16B 5T33H 4UQ3B 4E9VA 3MNWB 2VGLM 5H8DA 2G5UA 1WE5A 4KH2A 5GRUL 2Q76A 4MRCA 3C5XA 5HDQH 5D1XB 3G5VB 3JZ7A 1GY1A 4N4YB 3NCBB 4XPHH 3Q2CA 2VB5A 3MODH 5FDYA 4DW2H 3U9PL 3BAWA 1EJOL 4I5BB 1IBGL 2DYPD 1KIPB 3V4UL 1CK0H 4W9GC 5A3ID 3EH5B 2YBRB 3EH3B 3SDDC 1A1OA 2C3VA 1X4XA 1H15A 2UX7A 2ZCKL 3FCGA 1KCRL 3PRZA 1I8KA 4NRXA 4X6EB 4UM9A 3MYZA 4LSSL 3KPLA 5CCKH 4HWBL 4IU3A 4R7NB 1XGUB 1MFEL 2XZAH 3QIUB 1T80A 4Z0XA 4XC3L 3LMJL 4I0PB 3ET9F 3B9KC 1QZNA 1FYTB 3BZDA 4M7KH 4QHNA 5H4YA 3RAJL 4L5FE 2X4SB 4PJFF 4JFPA 1NDMA 3P30H 4JO5A 4Y2OB 5I6MA 3V4VH 4F91B 4HAFA 3HC4H 4FQLL 4YDJB 3HZYB 4LSDA 4P4KD 4Q9CA 1SM3H 4PJ8A 1T4WA 3MKKA 2QR0A 4OIFA 1IUZA 3QVAA 4KKZA 3RFZC 4DERA 4WHCA 4BK5A 4I85A 2MRYA 3LZLA 2F5AL 1OOAA 3OL2A 2ZYIA 1IM9A 1K5NA 2YIHA 1VPOL 4AYMC 4JFEB 1MCOH 1FH2A 4X80L 2LLLA 3FMGH 2ADIA 1G7PB 4PV9B 1AQHA 6FABH 4FYRA 2RAMA 4MJIB 1OGAA 1RFDH 1CFBA 3V0AC 4QYOB 3QXAA 5D1QE 5AYTA 5I28A 3D0AA 4U4IA 4NKOA 5G4NA 3TC9A 4N0FA 2OK0L 3MQIA 3IFLL 5E6YA 3AS3A 2R59A 1TENA 4PJAB 1R5WA 4IDLA 2IGTA 3FFCB 4RDBA 1TO5A 4Y2DD 4M1GH 3NSYA 4PMFA 2JQMA 3T6XA 5AKRA 4FA7B 1DQLL 4GYBA 4OF5A 2ARJQ 1Q0EA 3SKNA 2VNCA 1M71A 4JGMA 4OSUH 4PJEE 3VO0A 5E6ID 4MDJB 2ICEC 3CAFA 5GGVY 2O5XH 3ETSA 4HAKA 3VXRA 1KELH 1E9PA 1MJUL 1Q94B 1U8JB 2UY6A 2ZOWA 3TO2B 3C9NB 3QUKA 4FI8A 4ISVB 4K8RH 1E3ZA 1OAZL 2SODB 4JN2B 3RWHB 4DTGL 4G7VL 2AEWA 2F1BA 4MGXA 3RTQC 1GHFH 2OMUA 1AQDB 2FRGP 3ROOB 3DLQR 4N8VB 2YKKA 3MV7A 5J7CC 1P7KA 4A37A 4DEPC 4PBDA 4KAQH 1L5GB 4L0PB 5FECA 4QRAA 1D7CA 3MRBB 3BWAA 4O51A 1Q38A 2VDPL 3VXUB 2GC4C 2XG4B 1AAJA 5K5YA 5LXGH 2P8LB 1JPFA 4KKNA 1HSAB 1G1KA 3OAYK 1FFPA 5E2VL 1FSKC 3L3KA 2VDNB 4FG6D 5FYLE 3RNKB 4HZLA 2CZNA 3ZQWA 3FRUB 5HJDA 1ZK9A 4A6YL 1JGEA 3C6LB 5FA4A 2IXQA 2EVFA 4A66A 2R0WH 2OTPA 4PLOB 3VFGL 2EUZA 4CNIB 2AI0L 1M1SA 2Y5QA 1MCPL 2A2QT 1T03H 3STZA 3RGVB 4QJ4B 3FT1A 4K5OA 3GSUB 5JIQA 3IDNB 4WV1A 4EQ2A 4FJ6A 3QXUA 3S7GA 5FB8B 4PJIF 2ITCA 4ZUWA 5TQ2H 5D9SB 2F5BL 2W92A 4ATWA 3VVWA 5K9JL 3MDJA 3U7YH 4ALAH 5DEJA 3VWKA 1OE1A 1UUNA 4Y9CA 3K3QA 4C8XA 3C2AL 4XBMA 5EZLB 4UU9A 1XAUA 1S7VB 4QDGA 3VQLA 3HNSL 3MRPB 3H2WA 3GD1C 5I1IL 3OMIB 3TO4A 1UGKA 3WXWH 3EBIA 2CD0A 2R23A 3X1EA 3HMXA 4W9DC 1D5XA 1YC7A 3FRPB 2WTPA 3DXAD 5LO7A 4FC3E 1NM4A 1WWCA 3IE9A 1NCCH 1QYGH 5HHOD 3UJJH 4Z3GA 2UXTA 2Y7LA 5B4MD 3BEWB 1XEDA 5EO1B 3KPMB 4JDTL 5IB3B 2EYSB 4YSCA 5HHXL 2Y69B 5L2JA 3O6FD 2Q5BA 1IKFH 1VEOA 2UXFA 4GUCA 2I9LB 1KUMA 3BSGA 4XPGL 1EJFA 1YN7B 2OMVB 3SDXE 1HIML 1YEJH 4WO4D 4B9KC 1OGTA 2DN7A 3MREA 5GRWA 2AK4E 3R4DA 2XU9A 4YR6A 4BD4A 1A4BA 3Q8CA 3N1MC 4F7TB 5KG9B 4TSBH 3G6AA 4KQ4L 4KTEH 1E6OH 3EHBC 3KMDA 4XNBA 2J8OA 3RPIA 4D7PA 2DKUA 2YXMA 1CICB 1OAXL 4PJHE 3WLWC 1TKWB 4YHYB 5HYJA 4KZDH 4JHWH 3F6LA 5EMYA 4WWKA 2GY7B 4MZIA 3H9SA 4PS4L 1GZHA 2PYFA 3TOPA 5IKCB 2B0SH 2GVYA 5CEZL 1F45A 4LCUB 3DGDA 3MGOA 2A77L 4GRLC 1AD9A 1XF4A 4J12A 2CM5A 3HN3A 2BHFA 2EC9T 5D2NB 3BZFA 2AV1A 5KVEH 2DV6A 4PLNC 2IALA 4EDXB 3QHFH 1GJUA 4UILL 2BMKB 4DKAA 5C09B 1CU4H 2QGBA 4J2QA 1AXTL 1X9RA 4Z7UB 4AEIL 5DMJB 3WMSA 4J8QA 3QXWA 4U1IB 5DQ9B 4OGZA 4JKPL 3VI4E 1EEZB 3APMA 4HS3A 2XZCL 4DQOH 5I24A 4ZZKA 3GPEA 1XSKA 3EOYG 1U8PB 3TA4D 3L3DB 3KLAB 3VWJD 2YUVA 4FL4B 4UT6H 3V5KA 3F58H 5E9DE 2J25A 1RZKC 3UL4A 1UXMA 4N1EA 3GB7A 3FHAA 4EBQH 1FZOB 5C1MB 3Q2NA 3TEZA 1IGTB 2XPZA 4NI6A 4WJG3 2EIKB 2DOCA 2IBGA 4PV8B 2PO6C 3BZ4B 2IEPA 4YDLC 1FO0B 4FFZH 2PWFA 4JO2L 3AT9A 3CFNA 4PHZA 4DN4H 4XNQA 2EEAA 1EAOA 1M6OB 1MIMH 1JMXA 1RUKL 2WNXA 1BOYA 2C7UA 5EOCJ 3B6SA 3OR6B 3B5TA 3CDCA 1YEHH 4BHUA 4MNQA 3BVXA 4G6AD 3US0A 2CUAA 2ICWI 3CFBA 4RDQF 1LP9A 3BN9D 4HIIB 3F83A 2CG9X 3ZE0B 3OKMA 2CDGA 1LMIA 2CUIA 3O8XB 4X8GA 1JTPA 1K2DB 5HY9A 4AQEA 2NY0D 4ZFGL 1KT2A 1ZVNA 4L29B 3HE7D 3KPOB 3NCWA 1JWMB 1T04B 3OAUH 1NOFA 3WKPA 3VD3A 3LPWA 2C4XA 3SPGA 5E94A 1T89A 3JV4B 3V9FA 3MJ7B 3LB6D 2XDHA 4GP8B 25C8L 1CFSA 4PWFA 4Z7NF 3HRZC 2NYKA 3WNOA 3BFQG 3QUMA 1SMOA 4IRJD 5EPMA 3VRIB 4BIKA 4X6DB 3V6ZA 4L1SA 5JXED 3VTAA 5JQHC 4ONGH 4PJ7F 3HMWL 2J88H 4WEEA 4X7TA 1KOAA 3GM8A 2DJMA 3A22A 3GMNB 4ANKA 4K2UH 5HGHB 3NSCA 3LY6A 4ZMQA 4OZIB 2OJ1A 2L3BA 2NX5B 3P77B 3P9LA 4MD4A 2VRAA 4X7FC 3KBPA 1K4DB 1IFHL 2D31B 4OZIF 3U6XS 3PPSA 4B50A 2BWDA 3FU7A 3L7FB 1A2YB 3MRDA 5KANG 3OKLA 2NY3C 3GTTA 5BOJA 3S36L 1NTDA 4TS6A 2FYYB 2DICA 1FFQA 3JWNG 5B7FA 4FQCL 4KK8D 4R0LB 1KLGA 2WBJD 4KDWA 3P73A 4M1CC 4XR8C 3OB0H 3PREA 4FTVA 5DDHA 4K5MA 3BIKB 5DD5H 4YAQA 1PW3A 2RACA 4OM0H 1NFDB 2EDYA 4IKIA 5FUZH 1AQKH 4EOWH 1PG7L 4C4KO 2GTWA 3JT2A 4ADIA 3IVKA 1J1OH 5B3JE 4I1PA 3DX6B 4X6CB 2DDQL 2OBGA 3CN4A 2ICES 1IV8A 4X6CF 3VSVA 2YQ2A 1DANU 5L9DH 3FQTB 5LJYH 3QI9B 4YXLH 3KZ8A 4YE0A 4YSDA 4ZO7A 1FV1B 4QCIA 3VFUB 4PRNA 2W9DL 3PQYD 5K59E 4FHJA 3KPPA 4OKDA 3BKJL 4R5VA 5F96H 3B5HA 2R2CA 1IGMH 1FFTB 4AEHH 3QUZA 1ZVYA 2BP5M 2GIXA 3BRGC 3VFRA 3UFIA 1DN0B 1RZ7L 1RERA 4FGMA 3RZWA 5IQ9B 1T4KA 1W8EA 4RGMB 4DKFH 5BV7H 5CN1A 4G8FA 4PR5A 2WXQA 4OZGF 2XICA 3HRPA 1LILA 2X4PB 5KW9H 4KOCA 2GCYB 4NDMA 3O6ML 3QDHA 1QNZH 2QQKH 1UH4A 5KBNC 4KHTH 5KS9B 3IJHB 3FOMA 1UQSB 1VLXA 1SN5A 1A5FH 4HGKC 5KYXB 2HJKA 3GNML 1XF3A 3FB8A 2Z4QB 1RJYA 3D4CA 1NQBA 3DECA 3IGFA 3S48A 1CXFA 1G6RH 1L4IA 3FZUC 3IDJB 4WU7A 2IV9A 5F7BA 1MQKH 2MTPA 3N41B 4JFDA 5CINL 4F8PA 1YA5A 4ZS6D 2Z92B 3N41F 4TSCL 1NGYB 5SWQB 1O75A 1EPFA 3U1SH 3CVBA 4WW2A 2N7BA 2BSED 5FC9A 3SCMB 3AB0C 5DWUL 1F1AA 2B8OT 4BH8A 1FORH 3DVFA 4NJAH 3BWUF 3NH7H 1S3RA 3NZ8A 1A6WH 2YN5A 3UTOA 1ZS8A 3M07A 3LZRA 4XVTL 2IFFH 2GJPA 1G1OA 3BLKA 2H6UA 1UZ6F 4AT6B 3A6BL 4PGCB 4K9EC 1HCZA 1ZV2A 3KWWA 2A4EA 1KPUB 4PVNA 3BVWA 5JDJA 5AKVA 2GJRA 3D3VA 1IIIA 1OSEA 5F7DA 1ZLUK 4J3SA 3BRFA 5I1LB 2P5PA 5IF0A 3MLTA 3HC3H 4LIQE 4TTGA 2DI7A 4NWTL 4XO4A 3TNNA 3F01A 1HHGA 4LESA 3LSOB 4Z8FH 3C8KA 5KYYA 4JVWA 4HKXA 4UNUA 3WTYA 1RAMA 4Z95L 2YAOA 2Z8VC 3DRQA 1J1PL 4V2CB 3AXIA 5I30L 2X4TB 2XV3A 4KJQD 1W0VA 4OTXL 5JLZB 4M4RB 2JTYA 4QRUA 1IQWL 2YOCA 1KDIA 1SBSH 2AGJH 2B7DT 5J3HD 1QUPA 4ENED 3V0EA 5D7IF 2PWGA 2YPVA 4AGLA 3C08H 4K94L 2WZ0A 1KTCA 4JPKH 3GEWB 4LOEA 1BG9A 2BVQA 4B6ZA 1FNGB 2VAJA 2YEZB 2FEDC 1AE6L 4MA8L 1UM6L 2UWEF 1MVUA 1KEML 1ED3A 2YMOA 1YDPB 1KCVL 1Z9MA 2IQ9L 3CCHB 4HS6A 5DRZB 3V6OE 2A5UA 4X9HA 4AV4A 4Y7OC 1RJCA 3K7UA 1AIFB 2X1PA 1A3RH 5D6CB 5DS8B 1H5BC 3RDJA 3SJVD 2YXWA 1F0LA 2HTLD 2IPTH 4OLXH 4OJYA 2CBQA 3QCVH 2J8UB 1P2CB 2A6JB 3FO9A 3GMRB 4LLUB 2OULB 2FATL 1RURH 4NQXB 4KNQA 4IOSA 3IU4L 4HEPA 4WHTB 1BZ8A 3OLEA 2B15A 4PFEA 3IJSB 4G8GA 4QHKJ 3FB6A 1DQML 4BSWB 2VDOH 2ETWA 4U05A 2JCCF 3EG9B 4PP2A 4S1SL 5CBEB 3Q01A 3MNVA 3VXSB 4XNAA 4HCIA 4LQFH 3L4WA 5KYUA 2VQ4A 4FQ2H 1Z9NA 2PLTA 3ARBC 43C9A 2AJXH 2EKSA 2P5WB 1QABA 2H1PL 1H0DB 3EFDH 4AH2A 1V5JA 2E5EA 1QO3B 1SOSA 3DV6B 3GXPA 1Q9WB 4PGBB 1SPDA 4MJHA 4PJFE 3ARWA 4WGKA 2FX7H 5IQ7L 5DJYB 1CF1A 4HWZB 1BQUA 1HQRB 2CE6A 1HE7A 2H26B 5JORB 2JQZA 3MJWA 4JDZA 3WUWG 5A2FA 4DKEH 1TQTA 2EADA 2W0FB 2QZ5A 2QGEA 3U9PH 1EJOH 5D70L 3WELA 1X7SA 1J5CA 2V33A 3V4UH 3HE6A 4I1RA 1D5ZB 3UAAA 3B37A 3QR2A 5FO9B 1J12A 3ATAA 3THMH 1J05A 3DTXB 1KCRH 3U0WH 4CDHA 4LSSH 3ZT6A 1PKQB 1Z1WA 4HWBH 4GUOA 3GXTA 3R8QA 3TCLB 1YY9D 4PREA 3MXWH 5HVWA 2APBA 3KEHA 4E2OA 4TQPA 2CALA 4JQXC 4MDIB 4XC3H 4J5VA 3D39D 3SE8L 1MHCA 1NBVL 5HD8C 1MG3C 4PG9A 3VM5A 4RIRB 3W9DA 4UQDA 4JFSA 2F2HA 4LEBA 4LL4A 4J3OF 3VH8B 3O3EB 1MY7A 2FJFB 1IM9D 2IPUG 4QRRB 1RZGB 3TONA 1VESA 3IJYB 2UZPA 4NQEA 3LTVA 1ZLSH 5EIIB 1GS7A 1OIOA 4DVRL 3QIWA 2F0CA 4OI9A 1LD9B 3DHPA 4QRFA 3WLBA 3BH8B 4Y19B 5G4MA 5K9KA 4LEEA 3UTPD 3MBEA 1BJ1H 1EDQA 5AVZB 1I9EA 1CCZA 4XX5A 1NCGA 4MKTA 3FU3A 3K4ZA 1FJ1A 4BE6A 5KUKA 2NY2C 2VWEE 5EOQL 3K2KA 3F5WA 3V0JA 4ORGA 2X6UA 5TF1L 4MCNA 5D5MB 4LB8A 3ZHLA 2HJFB 1MI5A 2NOYA 4ZMXA 1SY6A 1OT4A 1DQTA 5C86A 4PRPB 4HDIA 5KBPA 5I8KL 4FQ1L 3CU7A 2CLZA 4PJGF 2F7OA 2X42A 3INUL 3VXRD 4DGUA 3G6DH 5BUAA 4ZMOA 3QUGA 3IFLH 1F90L 4ZSOB 1F97A 2ZX7A 4TNWK 4PG2A 5C70A 3W81A 5DUJA 1E5CA 3LIZL 2DWEA 3TBSA 3ULSB 1A66A 1DQLH 4OCXL 5L8LB 2AANA 2ZCZA 3QUXB 5F3BB 3FT2A 3T4AB 3RX5A 2YD0A 3V5HA 4Y4HB 3QSKB 3JYCA 3VG0L 1BIIA 3V6FA 1PFOA 1IZKA 1OAZH 3DETC 4UQAA 2XJKA 3VFVB 1S9VB 3Q8EA 4G7VH 1N2RA 1TLKA 1QHQA 4NC2B 1KXVA 4NKDB 4YHOL 5DFWH 2MPAH 5IB1A 2R8SH 2BVEA 2IG2H 2CHNA 3FUHA 4P9HH 4PJIE 1I8LC 5DS1A 3BJLA 2APWA 4K5PA 3FB5A 5C0CE 1UCTA 1ZWIB 5K9QI 3IBOA 1XTLA 3QA3A 3QXVA 3VXQB 1DVZA 1HZHL 1M9SA 4I2XE 4ZDHB 4S10A 4NN5C 4X5WA 1QW8A 4OCMC 5E2VH 1SJEA 5HYQB 4AWJC 1OHQA 2OM5A 2HA1A 2QBWA 5ESQB 5JHLA 1NC2D 5IBTH 3BZEB 1U2CA 4ODUA 5E6UB 3VFGH 3QUYC 4FP8H 4CVZA 1CF8L 1KTJA 2AI0H 5C6PB 1SOXA 5LG1A 2Y5TA 3LQAC 3AREC 3MRNA 1DFXA 3NIDB 1P1VA 3HS0C 4MXWL 4H7VA 3U6RA 3NIDF 4LARH 3VWKD 3PYCA 4G59C 3SPVA 4ZPTA 5KSAC 5MENB 2ZAIA 3V9EA 2FHBA 1IGJA 1WRFA 2EJ1A 3MGTA 4OGXL 3TO4D 4K3JL 2F5BH 4R2GB 1MAKA 3L7EB 2YD6A 2NY4B 3FTSA 3WY1A 1QSVA 3VNZA 5DJXA 4AYFB 1NZRA 1S9WB 5BQDA 1CGTA 3QIBB 2FJGB 1MCNA 3A4FA 4W4OA 2APTA 3C2AH 2VLKB 3CC5A 3KCPB 4QOKA 3T0VA 3R19A 4MCZA 4NNXB 1QX1A 4AQ1B 1A9BA 4HPOL 5I1IH 4ZW7A 2MNWA 2HLEB 2H32A 2PXYD 4DPBX 3NA4A 2XPYA 5A2LH 1IC5H 2QSCL 1BF2A 1YQVL 3MNZA 5C07E 1IEBB 3HKFA 1SLUA 1EO8L 2YPLB 3GSQA 3RWIA 3MV8A 1QBLL 4XMPH 2G5BB 3WDIA 1OPGL 3VXMA 2X6CA 1YEIL 1UEMA 4XOAA 1CLYL 3VI3B 4R3SB 4CN4A 4OU3A 4A7SA 2ZUUA 4RRPG 2EKJA 5DHDA 5HHXH 1IEAA 4PTUB 1KPVB 2BS9A 4EUPG 2A1WL 3CVHA 3CVDA 1M6UA 1HIMH 1JNLL 2QTEA 2P80A 4NO3A 4QKXB 3NEEA 5JHDD 1HOCA 1M7IA 1SDYA 4S0TD 1JGLH 1EFXB 3CMGA 4BH7B 4KQ4H 4W1TA 1VZHA 1JHTB 3P2DA 1RULL 4U3SB 4MQSB 5AAMC 3SDAA 3FCTA 1NA8A 1DBAH 1YPZF 4BELD 2VABA 5FYJU 3WUWA 4U6XB 2X4UA 3QFJA 3NFSL 3DX7A 1IBYA 2BZ7A 4QO1A 5KTEL 4JM4L 4XRCA 3A47A 5CIPB 3WMPA 5JOEA 5CEZH 3MRRB 3TBYB 7TAAA 4MDRA 4N2MA 1ZTXL 2YGPA 1KZQA 2V37A 3P2BA 5I1JH 3UAFA 4NFDA 1O7DE 2R0ZH 3SDDB 1AHMA 4NM8H 1OTUC 3V0DA 5HPMA 2D9CA 4KROC 4DPCX 4PCYA 4UILH 1DQDL 5EEUA 3LRSA 3N50A 4EN3D 4X4KA 2W9LA 4F8OA 2ZCLH 4AEIH 1N6VA 1AXTH 2CAKA 4KY1L 5ALBL 1GZPB 2FJHB 4J27A 1QSEB 3B9KB 4KGLA 1GSKA 3VD5A 5E4AA 1MRDL 3LX9A 4JKPH 3AU1A 1MWAB 4K8RC 3UMTA 4WUUB 1J9TA 5ITBH 1AD0B 3KL5A 3TJPA 5INCA 3QORC 2QKSA 3FT3B 1FAIL 3NESA 1HHJA 3IMRA 4MX7B 3VA2C 4HMDA 2H47C 3UG4A 1D5MA 2EDKA 4MAYA 3WAKA 2ITFA 2VSDA 3RFZB 4M4PA 2GSIB 4GO9A 5AAWA 4NUJA 2GUYA 1BAFL 2OL3L 2OSXA 4RAUB 5IK3B 4C59B 1KSRA 2YAQA 4JZOB 3EO9H 4A2MA 5B1KA 1G7MA 3EGDA 4JO2H 3RQ3A 3SBWA 1LE9A 3G5ZB 1A7RH 4PCKA 5IVZA 4Z7NE 3Q6FA 5JHBA 5MEPB 5HYFA 2V5MA 1JGDB 4IRSD 4JFWA 3MX0B 5HI4D 2MJWA 4GFXA 2BSDA 4NXKA 4V11A 4AIZA 2HUEA 3MROA 2OMBA 3HC2A 4ZMNA 4PJ7E 4ELME 4UNVA 1EJ6A 1HX0A 5IMOB 4DNLA 4PTTA 4NQCD 3KLHD 1V7ML 1FGVL 1TZOA 3HIZA 2GITB 3ULUF 1XXFC 2J2ZA 3BXNA 1S8DA 4PVLA 1J8RA 4BKLB 1IBBA 1OTSC 3WUZA 4H8VA 4YK4C 4ALAC 4TLTA 3NT0A 3H7BB 5DK0A 3QDJB 2JKNA 3GJFA 2ZXAA 3UJTL 1ZXQA 3JTSA 2C4FU 4FA8A 4UOJA 5BPPA 2ICEB 1MW0A 5IJCC 1TCRB 2BLFA 4FI7A 3PIQB 2J43A 3NRPA 4G8IA 1F3JA 25C8H 2JIXB 3VE0B 4K15A 5C3TA 3CFIC 3QEQA 2JK5A 5L4MA 3RTQB 3CSTA 5IM7A 4AQAB 1XWVA 1LO5A 4IEFB 4IGBC 5HHQA 4NFBA 5F21B 2X2IA 3A4EA 3HMWH 2LU3A 2F54B 2CNYA 4N8UA 5DJZA 2VW4A 4KI5C 4UTBL 4UTCA 3TS8A 3OMZA 2AXFA 1S7UB 1CXLA 2ZXBA 1FSKB 3F7VA 3T0WA 3GXIA 1LO2L 1IFHH 4CKQA 2IANB 1AHWA 3ENEA 2WLLB 4OZHF 5DJ8A 1UJ3C 1AACA 2VYRE 3X2QB 5ISZD 4KVCL 1OXYA 3IPEA 2WUCL 4HGWA 5DMGC 1IAIL 3O0LA 4FQCH 2R1WA 3P4MA 2IH1A 1YRKA 4YNYA 2KZKA 4U2ZA 3EH1A 4X83A 3KXFE 2FR4B 2WTRB 5C0BB 1FIEA 1CGVA 2LVCA 4OZGE 1PZ3A 5EIVA 2OZ4A 1IJ9A 4PRDB 4FABL 1U93B 1WC7A 1PG7H 3WJLA 2V2WB 4GI6A 5DA0B 5E8DL 1H19A 5IMLB 1JYVA 3MV9D 4WFEE 3PGDB 5HHNB 5T3XE 2DDQH 5CGYD 1WTLA 5K1NA 2Y7OA 3KPNA 5LDSA 4JK0D 1GC1L 2VJ8A 3KH4A 3CHXA 2AABL 2ADYA 1NJ9A 1JK8A 2Z31A 3EJJX 5J13C 3BKJH 3T5WA 1R3JA 4ZFFA 1CBVH 4Z6AT 3OKEB 5CILL 2RD0A 5EV7A 4EZKA 3WG7B 1EBPA 3BGMA 5HJGA 1N6UA 1OF2A 5ENWB 2BSSB 4E9LA 3O6MH 5BW7A 3LRGA 2EILB 4JFDD 5GGVL 4JRYB 2KUTA 4RRPA 4UUJB 1H8LA 2UV3A 1J5IA 1UZ6E 1SFDA 3GNMH 5HGAB 4OJEH 3C87A 1FA4A 2AC0A 1P4UA 4NN7C 4UTAH 2O4EA 2W0KA 4LVNC 5JW3L 1JMZA 2DKMA 3SGKC 2V5SA 2R2EA 5E56A 3C5SB 2ZOKB 1VKXB 1U58A 1V3MA 2I27N 4Y88A 2DW5A 3FFDB 2KYIA 3EHBB 2UZYB 2Y7QA 4HX1B 5HGGS 3VX0A 2IIJA 3AAZB 5DUBA 1WIOA 1DCEA 1WA2X 1I7UB 5I5MA 2CDFB 2WOBA 2YHGA 3ARGC 5T1LB 3DSNB 2VDRB 2WBKA 4RVBA 1TQBC 3RVXC 2G9KA 1IGCL 1PNCA 5D1QA 3MRGB 1NAMA 2CR3A 4XVTH 4J6RH 2WZAA 1WFMA 1V7NL 2Q86A 5IJVB 3RNQA 4FQQA 5CEYB 1YN6A 5D7IE 3A6BH 3TIDA 3NACH 3MRMA 4LGPB 3HR6A 2H6PB 5EHFA 3WKYA 3HZVA 3R18A 2ZE0A 2KZWA 4KDTA 2WYHA 4TUKL 3ZKND 4PJEA 2UWEE 4LOUD 4NWTH 4NERA 2CNZA 3SBPA 3ES6A 2OYPA 1PLCA 4YHNA 3CC1A 1IGFL 3CZFA 1KEGL 1AYOA 4UM8A 1IC0A 2MOGA 1X5MA 2GBUA 2V2XB 2ZP9A 3M17A 2H8PB 5DLMH 3TWYA 2IH9A 2P5EB 2PW2B 2QPUA 3MXVL 4GUPB 2JH2A 1HHIB 1W72L 4TVPH 1ZGLB 3TFBA 1XCTB 4OTXH 2OR8A 2CPUA 1IQWH 2GYSA 4GMTH 4Z7QE 3RWCB 2JCCE 2PO6B 4K94H 4YDLB 2XTJE 1N7MH 1SLXA 4ODWA 1ECYA 3T8XA 1J86A 3WJJC 4ZTOH 2D3VA 4P23C 3L9EA 3OGCA 1RQ5A 3MTXA 3CFDB 2WWOA 5KSBF 1ZA6B 4TLKA 2DQEH 4Y0GA 2D7PA 3RVWD 1GTNA 1UKSA 4G8GD 3MCLL 1E67A 1KYOJ 3GHBL 2BCKA 2NTSP 4MXQD 2UZXA 1VJSA 3IDXL 4B9CA 1JWUB 5LBSL 2HFFA 3DROA 3PNRB 1N0XL 5IZ7A 4I18C 3B8SA 5F7AA 2XWXA 3IU4H 3MBWB 3VDCA 5JW4M 5L7XL 4ERSL 1Q0YL 2HRLA 5EZJB 4JFXB 5CGTA 4CN6A 3LKSA 4OZ4B 5I8EA 1IL1B 1PCXA 1RI8A 3GLZA 4U6HB 2ICWJ 2LR4A 3HRZB 3WE6B 3N44F 1NCBH 5FYJE 3UH8A 2BC4A 5IT2L 3RIAK 4DK3A 3DRTB 2YLHA 1VFBB 2VERN 4JQVC 2H1PH 1KFAL 2JCWA 1BEXA 4WFGD 5DD0L 1FNLA 4U3HA 2NTFB 1CD1A 2ZAGA 3UZQA 4N9OB 5ECGA 1SQMA 1IAII 5BV7C 1Z6JT 1RLWA 2XN9E 1F11A 4QHMB 4TUOB 1CLOL 1KJVA 4M6ML 2EZ0C 1RJLB 4F9PA 2VIRA 3QJFB 2WANA 5HYEA 4WK2B 3MMEB 1U42A 4B5EA 1R9FA 5D70H 2VC2L 3GMMB 4DO5A 5JPMC 1W15A 5T1MA 4AMWA 5CJXA 1A1MA 3L95B 1N70A 2NY3B 1OKEA 3SDXA 2X28A 3ILPB 5TK2A 3EJQA 4X5XA 2AK4A 4CW1B 2KDYA 5DK2A 4KRPD 4JM2D 4XN1A 3I75B 4GI8A 5TE4H 4NQED 3V7MA 4J6IA 3E3QE 5E8OB 4GRWF 4F3FB 5FV2A 2BWQA 2EYRA 2LU5A 4J23A 4PJHA 3SE8H 1NBVH 1XSJA 1BF5A 3MBED 3CHPA 1UWGL 4F2FA 1RK0B 1YECL 4GP5B 1KULA 3PPEA 3QDGB 2XVLA 3L3GB 4PJGE 5AENA 3Q5YA 4JFZL 4AENB 4H20L 1NCDL 2E7HA 2ENQA 4K71C 2BSCA 2HZHA 3EJPA 3C60C 5E4IA 5CWSB 5EU5B 4LVOC 3J7HA 4CMHC 3LKOA 4TKWA 5BQ7A 1KB5A 1CD0A 3OKNB 4P57B 1X5XA 4LKCA 4MMXC 4BUQA 2AS5M 2C3GA 4PJCB 4DKTA 3BYYA 4YGVA 5EOQH 1SHWA 4PJBB 3VI4A 4HQQL 4PBVC 5TF1H 1X44A 1DBBL 3FS9A 6PAZA 5AWNH 1DZBA 4YLBA 2XNAA 1NBQA 1UA3A 4F57L 5E9DA 1JV2B 4TSAL 3OKOB 4LSRH 4WI5A 1PY9A 2Y07L 1MELA 4EI0A 3GMOB 1FZJA 4G6FB 5EH1A 5B1CA 2WIIA 3TV8A 1F90H 2BXZA 1LHZA 5IEHA 1FDLL 2R2HA 5F3FA 3WO3B 1C5DB 1TIUA 2K8MA 5GSVB 5JZ7D 3UTQB 3RI5K 1XH3B 3AB0B 5L88L 1NGXB 4XBEH 1QQDA 1LE5A 1I9JL 12E8L 1UEYA 2WIMA 2OX5B 3IJ7A 3UC0L 3HI6L 3T65A 4NLHA 3RE0A 1GPOL 1QRND 3H4HA 4I4WB 5CO1A 4YHOH 2V9TA 1AP2A 4PWKA 3VFNA 4RFEA 4YH6A 2J5WA 2XWBB 1M3JA 3ZMRA 1S46A 4GRLA 3CN3A 5I1KL 5DWPA 3LZFH 3QJZA 4JZNA 4CILA 4HHAB 1T21B 2A6IB 2OTWA 4K7PX 4OGYL 1HZHH 3RP1A 2VUYA 3KPSD 5CP7A 2F8IA 43CAA 1W80A 3JWOH 7FABL 4KO7A 1NBCA 2I07A 5T5FA 5HI5D 3T0XA 4AVJA 3TZVD 5AVUB 1JUFA 5AVVB 5HHMD 2ZKWA 3L48A 1FE8L 3LZQA 1CF8H 2XY2A 3F6JA 5C8JB 1I7TB 4M61A 2VLJD 3LKPB 4PJDB 1A4CA 2HN7A 4NP4L 2YPLE 3MFFB 2GJ6E 5AYUL 4PBWD 5A2JH 4YSQA 1ZLUH 4LPVA 2AFNA 4LASL 4HETA 2FQGA 2XQYK 4M8QB 4AL8L 3ULVD 1Y1DA 2NSMA 2QKIC 3PAUA 5EULV 1C7SA 5C2UB 4Q14A 1S7TB 5E8EA 2X6AA 4UV4L 3RY5A 2AXGB 5FLVA 4H0GA 4GBXD 1EERB 2NR6D 2OYMA 1OT2A 1UOLA 4M8VA 3V8OA 3OM3B 4JJ5B 3MRQA 3EDJA 1BVNP 4UQ2A 3WMQA 3TESA 5FGBC 2VDLL 3GKZA 2E6JA 3DV4B 3L08A 4KJYA 3UOAB 5GGSA 4CADB 1PGRB 4NP9A 1ETZA 1H5BB 2QSCH 1JZ3A 3FH5A 5IBUG 1EO8H 1NINA 1YPZE 1D9KA 1EAPA 2ZUQC 1RK1B 3EFFA 1OPGH 4NENB 2EVIA 1YEIH 2WAQA 1GZQA 4B7LA 3TBVB 2BNRB 2AJZB 3WTXA 2F19L 4X6BB 3M7FB 3AS2A 4A7TA 3GUFA 2YQBA 3WENA 1J1XL 4TVUA 1N4XH 2O6CA 5GS1C 4PD4K 4X4YA 3ARBB 3CFEA 3P3RA 4DP9X 1YHPA 3CN0A 2EDFA 3TBTB 3G5YB 3RVVD 2X88A 4H25B 5K9OB 1Y0LA 2DQDL 2FLBT 4WKZA 3TJHC 4Y4FC 1P9MA 1KG0B 3D87B 4XCNB 2Y36H 2ITEA 1RMFL 1MCCA 3P3UA 4MS8C 1NUFA 2J56A 4MJ5A 4RA3A 4JE4B 3IFOA 1IAOB 1VGKA 1TZIA 1VDGA 1YUHB 3EGSA 5KTEH 4N9GA 4JM4H 4ONHA 1UACL 1Y18B 2VUKA 2PCFA 2NUPB 2IADB 3ISWA 4Y8DC 3PCYA 4RAVA 1ZTXH 4U7MA 3UYPB 4YWGL 4QRQA 3K1DA 4PW4A 3SDCC 1UXSA 3CLFH 3ATDA 2NW2A 2MOQA 4BHUI 1DQDH 5F1IA 1JN6B 1ZHLB 5EEYA 5DR5L 1R3HB 4F7PB 2O61A 3KGRA 4L3EE 3QO0B 5IHUH 2R1YB 4M8UA 5ALBH 2Y2YA 4AC2A 5I73C 3KVPA 2D7NA 1MRDH 2HXAA 1SOQA 3RKDC 2ZSVB 1WV7T 1MJJB 4R7LA 3FCUB 2H3KA 2GBTA 3ECWA 4P9HC 5M95B 2AERT 2ED8A 4FMFA 4WI0B 3M8OL 3TNMA 3ULUE 1O6VA 1IC7L 1V54B 2PP8A 3OQ3B 3MYJB 3Q5TA 2OL3H 2Z35B 3QULB 1CVRA 3FQWB 3B7SA 3FCSB 5F9AC 3K0YA 1KIQB 1XDTT 1T2QH 2NQ3A 2BSRA 4D8PB 4X5QA 1AR1D 1F4YH 5GS0D 4MZ2A 4XGZB 2WQAA 1BPLB 3EOAA 2AEQH 2NY2B 2JKIS 2JB6A 2Q8AL 2JKSA 4IJ3C 1XO8A 1JK9B 1KTLA 4LDLB 3O2DA 3MOAL 4B9JA 5C08B 4U1KA 3ZZSA 3GMPA 4BINA 1YMME 3IU3A 4CC1A 5K1JA 3NYKA 4HU2A 2ICCA 5CKAA 1CDYA 4M56A 5IB2B 3B2MA 5ETUB 3HFML 3RJDA 1EEYA 1QFWL 1V7MH 1BBJA 1DEEA 4FXLA 1DJSA 5ESVA 3QNXB 3WS3B 2C9SA 3HOGA 1HFUA 3WKQA 3TIEA 1ADQA 4U1NA 1QFHA 4KZ0A 4UOW0 2EUVA 3M1OA 3VW3L 4OZHE 2ZXDA 1JV5A 1NL0H 2EXWC 5DXWA 4ZBJA 4CC0A 2AAVA 3X1BA 3UJTH 7CGTA 2VR8A 1YY8B 2IC2A 1LQSR 2D0HA 3LZOA 5TDOB 2ODHA 4K3EH 4ES8A 1MIEL 3V6OA 3OXRB 3SE9L 3WBDA 3ZDZB 4XBPB 1VEMA 1C16B 4HH8A 2K6WA 1QLFB 4Z7WB 1IMHC 1JJUA 1O6SA 2VLRD 5A2IH 3B1UA 3WFZA 2GI7A 4FFYA 1WH0A 1XZ0B 5GGUB 4UB0L 1BD2B 2FSEB 2B2XL 1KJ2B 3BEVB 4AG4L 1K8DA 3P11H 2CWRA 4PJ5E 2WO4A 3K81A 4NN5B 5I0VA 1BZOA 4PW3A 1I1AC 4EO5A 3LCYA 3MJGX 3JVFC 3U9UB 2R4SH 3CMOL 3BQVA 2DMKA 1U8QA 4BZ2A 3EJYD 2X38A 1SXCA 4KVCH 4QY8B 3L9RA 4LAQL 3QUYB 2WUCH 1M7XA 1IAIH 4KKBC 3SE3C 1FL3A 1LQBC 5F7MC 1U8MA 3ARFD 5BUPA 5IW6A 2JNZA 3AREB 1ZPUA 2ZXCA 1U3ZA 3AM8C 3QIUA 2HPTA 4ZMWA 4FYSA 5CJBA 3OZKA 5E1QA 1C5CL 4JRLA 3HG2A 3GUTA 3B9EA 4PJFA 2JJTA 5D2LB 1J7VR 3M86A 4FABH 2BP3A 5FOJA 3FUEA 5IFJA 4NZUL 5E8DH 2VL5A 4BGDA 4HUWA 2V3EA 3GJFK 5CN3A 3FT4B 3LQZB 4P06A 1A8ZA 3GJEB 2PF6A 2WO3B 1UTDA 1FH5H 4Z7IA 1P5VB 3ZMEA 1H3GA 1N5AB 1R75A 2QSQA 2AABH 3LNEA 4FZ8H 3NZUA 4A7GF 3FUKA 3PHQB 1RZ8B 1TMCB 2JQAA 3PGCB 2KQNA 3OKKB 4R7DA 4EDWL 4G9FD 4HH9A 2WQ8A 5CILH 5IROA 5EIQA 3U2SB 5J9PA 3WL9B 4O58L 3KPRB 4HWUA 4I9WE 1O9VA 2EDBA 1UYWL 3SPHA 5J0BA 1N8ZA 5D7LB 3EZJB 3FW6A 1IGYB 3ETBJ 4RZCA 4CMMA 4BKSC 3V4VB 5IOKA 2YPKB 2JELH 3N5AA 1ES0B 1SJHA 3STBA 2X89D 4XMKL 4BFRA 4P2RB 3N91A 1MCFA 3GM0A 1KCKA 3GMQA 5J1AB 4WEBL 3M88A 5FWQA 5SWZE 3VFWA 3CX5K 5D1QD 1PZ5A 4Z77B 1BQHG 5I16B 3EYFB 2XQBL 4LHUA 4MQ7B 3BP5B 5HJ3B 5CU5A 2YRBA 1CPUA 5GGTA 1SYSB 3HNTL 3PUCA 1ET5A 4JN2A 2X2HA 2WLMA 3IYLW 2YJLA 3RRQA 1RPKA 1KGCE 1DVFD 2QGDA 1A3LL 3F7YA 1CFTA 5J1SC 2FIKA 4JGJA 5JR1L 4P2OC 5KSVA 3OXSB 5LAXA 5DHVH 4MHHI 3EGXA 1E43A 1QLEB 1DJHA 2GFBB 4FQXA 3C5ZA 1K8IB 3I9PA 3KM1A 4NHUB 5E2JA 1IAKB 4KROB 2L7EA 1X7TA 2RMNA 3ZGHA 2IOOA 5F9OL 4E41B 2OCCB 3NDZE 4XVOA 4HJEA 3F7RA 5KSBE 1WG3A 1AKJA 5F1OB 2F58H 3UPRA 1WZMA 2BOBB 1P7HL 5C71A 1IGFH 4Z7VF 3PS6A 5HHPB 1KEGH 2ESVD 1VEPA 3EO0B 5JW5A 3L5WA 3QORB 1WBZB 3JT0A 4WQOA 1FFOA 5KVDH 3MXVH 4P3DB 4PJIA 3OX8B 2ARJA 2R2BA 4JFUA 4L05A 1ECZA 5JA8B 5C0CA 2K78A 4JQIL 3ULVL 3D0LB 2V8LA 4A7UA 3HMXH 5FUCC 1ZVSB 3KYNA 4I2XA 5BRZB 5H35A 1K5WA 4GSRA 4Q9QH 4BFEA 5AVSB 1XBRA 4Y8AA 4QNPF 1SQ2N 2CRZA 3AUWB 4QF1A 3FO2B 4HJTA 5A3IC 1GKOA 1QFWI 4BDVA 1GS6X 2XCMC 5EUOF 1S7VA 2FZ3B 2DJUA 3GDBA 1J5OH 4LCVA 3SPJA 5I75C 1KNOB 4CBZA 1F3DJ 3BVTA 3OPZH 3OC8A 4JY4B 5ID1B 4XNUH 1X5ZA 4DVBA 2XXGA 4F9LC 4DUWA 2G4EA 4JHAL 2XV6B 4JDVA 2EIBA 3MCLH 4L3AA 1QVOB 2WYZA 3B9VA 3CVHL 2PR4H 3RZCD 1CDJA 2M1KA 1TTUA 3NN8B 1HU8A 1D7BA 3IDXH 4H5SB 3T0AA 4JG0H 1TJXA 5KANI 2ED6A 3B43A 3IM1A 3MNMA 4P4KC 2EDLA 3PP4H 4IBUA 4YK4B 4L3CA 5L7XH 1Q0YH 1BWWA 3WIAA 3AROA 3NAAL 1RVFL 1NSNL 2FT7A 3UBFA 3ZE1B 4BV1A 3G5WA 4JEGB 4V33A 1AGEA 4YFDB 5EU6E 4PS8A 1J0JA 3IXAB 4I7ZC 2AJVH 5C0IB 4LCCB 4BFIA 5IT2H 2WP3O 1FVCB 5KG9A 4GRWE 1KFAH 1GJIA 3O9WD 5C07A 5DD0H 4IGBB 2VZSA 5LWYL 2CJ3A 4ABUA 2H1XA 2V4LA 2G0KA 4Q6IA 2HT2C 2WVVB 4Y4KA 5D7SL 1ZLWH 1JZIA 3MUGB 1WHOA 1CLVA 4DGIL 2AK4D 4M6MH 1JDDA 3FQUB 1BLNA 4JO3L 3LRHA 4GQRA 3UTTE 4ETQA 4E9XA 1L0XA 5DRWA 3TA3C 1KBKA 2VC2H 4IMKC 1CXKA 1UJ3B 4UZGA 5C0NC 2SEBB 1E9QB 4KXCA 4AZ8B 1Q9OA 1JPST 5J11C 4NO0B 3CH1A 5E6IC 5I23A 1DBJL 4GPVA 2EDJA 3E7JA 4UIMA 5HPOA 1TJHL 1RHHB 4XZ4A 5EU3A 4YQXL 5JDSA 5C0GB 1EEZA 5FDWA 4QUOA 3SB3A 3ZXAC 2VLLB 3LPOA 1UWGH 4FKHA 4GKSB 4NCDA 2AAAA 4U1HA 1KIRB 4UIKL 4X2UA 1V05A 5DS2A 3KYMA 1X9QA 5C9JB 4JFZH 3QQ3A 4H20H 2Q7YA 1NCDH 4FG6C 1YO4A 3HG1B 1B4JH 2GUOB 3UDWA 5I5JA 5GS0L 3GMLA 5J13B 1ZT4A 4DO6A 1YMHB 3H4FA 5INDA 5CM1A 3VVVA 1UD6A 4WK0B 5KBMA 3DJZA 1WQVT 2ZX8A 4RFNC 3MZTA 4DZBA 1MFUA 1G9HA 3U25A 2A74A 3UZEA 5AG9A 1S7XA 4XCFH 2DMHA 1ZANL 5A40E 3MPCA 2X9WA 4G42B 1M56B 3AGWA 4HQQH 4BCZA 3W82A 2UUDK 2OSLB 4F57H 4KITB 2K9FB 4ZZFA 2XG5B 1RU9L 4TSAH 3MRIB 1QAWA 3IDIB 3N2JA 3PHSA 3QUMH 3BAJA 4EVNB 3E8UL 3ATBA 5L6YH 1A9EA 4NN7B 3ZRFC 2N1KA 4LVNB 4HUUA 3QK0A 5ICXA 5F7KC 4KI1A 5K93A 4F7CA 4NT6A 4Z76B 4M8RA 5D7KD 1KY7A 1BQHA 1XB8A 1G0XA 2CSPA 4APXA 5BS0D 3O41B 5LQBL 4H0LC 1NM9A 3H0TA 2B5IC 4NHCL 3IKCA 1AGDB 1RUAL 3IXTA 5L88H 1I9JH 12E8H 1MNNA 1WIPA 1KYFA 1U8OB 3ARGB 5G5DB 4GQZA 3UC0H 3O0RL 1GPOH 1TQBB 3BWZA 2ZXWB 2IWGA 4I3SL 4PJ7A 5AKSA 4ELMA 1U2HA 3AS0A 4ICXA 5CLYA 5T1KB 5MEQB 3FONA 4LBEB 1KLFA 32C2A 1O7SA 1NGQL 3QQ4A 1UD2A 3CQFA 1UOVA 2CIKB 3MJ9L 4H1LB 4OGYH 4QRPD 4W9ZA 2BY2A 1CIUA 1Z9SA 3QJHB 1AGFB 1S7RB 3BRDA 4DP8X 3N55A 3O81A 7FABH 3BW9A 4D0BB 3EUDA 4I8DA 1HL8A 3BC9A 1HH6B 4N22A 2QADC 2FEEL 1O6TA 3DIFA 1RIHL 4B9IA 2FYYA 5F93C 3S35L 3WU1A 4FHKA 1FE8H 5AOMA 4J4PD 4AV5A 1AC0A 1N67A 2F74A 2G75A 4AGQA 3RL1B 3KGTA 4AVIA 4JZJB 4I48B 3BP7B 3AY4C 1U8IB 2X1WL 5BO0D 1EX0A 1MZZA 3QEGH 5MP6H 1QWHA 4ZO8A 3VI3F 5J6GA 4ZOCA 5EF3A 4J3OG 4WJ5A 4ZPVA 3VH8G 4P9ML 1EA9C 4AL8H 1OSPL 1EH9A 4YFLF 4BYHA 5IQOA 1NC4B 4N2IA 3SE4A 5IHZB 2L0DA 4JG9A 4UV4H 4L5FL 4APQC 4UOQA 4XPAL 5CEXA 4P23B 4ZOEA 3JYBA 3VGEA 3HPJA 2PCPB 4QT5B 1D9KD 2WXMA 5EBWA 3DSFH 4MVBD 5IUSA 3CFKA 2PNDA 3DXAE 3ATEA 3N40F 1E4XL 4KUZL 4URTB 4YSPA 4OIAA 1FNEB 3EH2A 4N8CL 3KXFA 5CZXD 5HHOE 4D7BA 4UOZA 5B7MA 5ICZA 5BJTB 2ZG2A 1P1ZA 4OZGA 4JJHA 5IOPB 2WNGA 2ED9A 3FQRB 3V4LA 1KTBA 1EANA 2B1AL 5IVXB 4RX4A 1SXBA 4JPIA 4I18B 1I8IB 2J6EA 1L7TH 1Z66A 1HSBB 2DWTA 1R0AL 3IJEB 5EBMB 2CJTA 4EKJA 3S5LG 4OI7A 2F19H 2VXSL 4NAJA 2QQNL 4XCYA 4AZUA 3F04A 2A9CA 2LTQB 1TYJA 2DMBA 3BH9B 4Y5VA 3WTSA 3KL0A 1KCSH 1J1XH 1K6QL 3OKDA 1IC4H 1DJWA 4HLZG 1G7IA 5FK9B 3CIAA 4XOBA 4HJJL 4Z3JA 3EAKA 1SVCP 4RNRA 3VFMA 1XV8A 1MCSA 4EE2A 2N59A 2WW8A 2DQDH 4TQHA 2LU4A 1ZGLM 4YDMA 5EBLA 2Q6WB 1K72A 4C56E 5BV7B 5DURB 4P4RA 1MFAL 1RMFH 4ZUSB 2JJUA 2WVUA 3S3DB 2PYEE 5I74C 3MCKB 3TP4A 4PY7A 1UACH 3EDEA 5JPMB 3S96B 4DGVL 2EUXA 4TPRL 4R4BA 1REIA 3BD3A 4YHIB 3P4OA 1KIUB 5D4JA 4YWGH 4ESKA 1CQYA 4YLQT 1G6RB 3U4EB 2W80C 4RSVA 1R5VA 4OV5B 4IU2B 3IPFA 3ZPDA 3LNDA 3LB6C 3VX1A 5DR5H 2YRZA 3FU9A 3LSOA 2PPAA 5K33A 1SHXA 2Z8RA 4IRJC 4HK0B 3RUGE 4AEEA 4PJXB 2GK2A 2X44D 5LNEA 5JXEC 1D7DA 1CFVH 4M48H 1E8YA 5DI8A 3NIGB 3PGFL 4HCRL 4NN6C 5I6KA 4X6FB 1XF5A 3O2VL 2B14A 1ZLVK 3W57A 1FIGL 3UZVA 5D7IA 3ZOAA 4NQDD 1IC7H 3AXLA 4K71B 2A6KB 3WCYA 5ESAA 4F7EB 1A6VL 3C60B 3M46A 4K73A 3DBXB 2AXJA 3JWOC 1JTOA 4LVOB 4CMHB 4WFHD 2UWEA 4B9YA 1ZSHA 3AW5A 5FYKE 2GEEA 3ALPA 3FF8A 1F2QA 1RZFL 2Q8AH 1I4FA 2YFNA 3LV3B 4X42A 4XZUA 1B4LA 2BPBA 3RDTA 3L17A 4QHUB 4MSWB 4Z3IA 1EVUA 5DCCA 3HZMA 3WJMA 3MLZL 2X1OA 1PG7W 3P69A 4MB1A 2DM7A 2OXGA 3VFPA 3HFMH 4O5LH 5JHAA 4OD2A 1QFWH 1JWSB 1XCQB 4AJWA 3MR9B 1W0WA 3MLRL 1BAWA 4OQ1A 2BIHA 4YHPA 2JCCA 2JLPA 4W4NA 4G82A 3JUZA 1F86A 2FWSA 5EC2A 1OAQH 8FABB 5F9JA 5DFTA 1YZZA 1WTGT 2QHRL 2G3ZA 1T5WA 5F6HJ 2F53E 1MIEH 1EXHA 1HEZB 1U2YA 3JTTA 2D2CC 4X99A 1OD9A 2V3DA 1XIWA 2OTUB 2FEEI 1QO3A 2FTAA 4PCTA 1HXMA 3JWNH 4C58B 3Q44A 4UT9A 2C1PA 2XPGA 3GLEA 4UB0H 3CH8A 3OJDA 4IKLA 5JORA 3D85B 1TYEB 2B2XH 4XVUC 2PWDA 1BOGA 4KXAA 1NUDA 4C57C 4X0KB 4YO0B 5F9WB 4GSXA 5EZPA 2LLNA 3QIUD 3H85A 4GW4A 4PRIE 4WWOA 5LCVL 1XFPA 4I0PD 1VADB 1XXDC 2D3LA 2Z91B 3CMOH 4JFOB 1M7DA 1U8NA 1D5ZA 1T1YA 4LAQH 4ZFOB 1T7YA 3IPBA 3MGAA 2B08A 1EXUB 4K3DL 5AOKA 5PAZA 5I8CA 1HHHB 3A4AA 3QS3A 3O4OC 3ZDYB 5JW4Q 4FAAB 1CDBA 3S5YA 3O3DB 4YDVA 3SKOA 2H7WA 1EBAA 4TVSa 4OAWA 1MHEA 3GSNB 1C5CH 4P05A 4NUGL 5B8CC 2VAAA 1BIHA 1Q9KB 1LK2B 2XN9A 1E4XI 4GH7B 4LSTL 3WS6C 4G43B 1S6NA 1RSFA 2Z7YA 3IJYA 4C55A 4YMPA 5F88A 2QKIB 1XR9B 4JFED 1AGCA 2HSIA 3VMOA 1M1XB 1U8CA 5IROD 2XZZA 3PQYE 4X9BA 5LGJA 4BQ8A 5F97E 1I82A 1SY6H 4NZFA 4MJID 2ATKA 4HPYL 1IKNC 1CFQA 4IMLA 4M5YL 3SPIA 2I7SA 3K72A 4WVRA 3A3YB 2WLKA 4JMXA 4EDWH 2C1OB 2YSSB 2QTVA 2YAFA 3WFDL 3EYOB 4WFFD 2FEJA 5I2IB 2BDNH 2V8MA 2COVD 4L9LA 1UENA 2N4IA 2ZUQB 3FFCD 5JIKA 1UD3A 1UYWH 1DN2A 2JF1A 4KJQC 5LXVA 2E59A 4YGAB 1HHKB 3S5LA 1JI2A 3A5VA 4PJGA 1DDHA 2HKAA 4G7SB 4NOFA 5JPNC 5J3HC 4LNRB 4XMKH 3N1PC 3VQ2C 4NQVB 4YUEL 3O3UN 3LEYH 1JGVL 1IB5A 3ARTA 3KH3A 4EZLA 4GG8A 5IB5A 4HXAH 2E4FA 5GS1B 2J1KA 3VFSB 5ERWA 5I1DB 1AXSA 1X9LA 1OARL 3PWPE 4UAHA 4WEBH 1KV7A 4WSKA 5DYFA 1QSFB 1WFTA 2YXVA 1AC6A 4XNMB 3UADA 1XAKA 4U1JA 2XQBH 1N19A 3TJEL 4Z7VE 3VXUD 4Y4FB 3MRJB 3HNTH 4FQXD 5ADPL 2FNWA 2VERA 5L2KB 4FFVD 4Z3FA 5JHLH 4P5TC 4R4ND 1GGBH 2OMZB 2ZD0A 4HKBA 5AOJA 4MNGB 3C6LD 1O5DT 4MA3B 1HE8A 5JR1H 2HT3C 3I9GL 5FO8A 1U8KB 4BE5A 1CG9B 4HUMB 1ZTXE 4D0CA 2NDGA 4Z3HA 5GZND 4QNPE 3K6SB 4GAFB 3SDCB 2EXYD 2UX6A 2WSKA 3TEYA 5ANMB 4XCEA 4XH2A 2C3HA 4DT2A 1R3LB 5E9AA 1WPCA 5EUOE 2ZXQA 1YC8A 5DFAA 3BZEA 4Q56A 1XD0A 1YEKL 1W16A 1BEYL 5F9OH 3D9AL 2ICWB 4HSQA 3U2IA 2P44B 3ILDA 3EOTL 5I73B 3HCVB 3MN8A 5CLXA 2NLJA 2DL2A 3BP6B 1GW6A 4YHLL 1NFIA 5C0FB 2B4CL 2HFEB 4HJGA 3B3BA 4AITA 3HA0A 2EXTA 1NOLA 1Z9OA 3L13A 2VR4A 5DEZA 5LGHH 4EAEA 4K3HA 3U0TA 2WXPA 2BSBA 3F84A 5B1JA 2H32H 4K7FA 3RIAF 5ILTH 1CE6B 5C0EB 7PAZA 1I53A 3I2CL 2X70B 1PLGH 3EJZC 4GKLA 5JQIB 3REWA 3ISYA 4NIKB 4UDTA 1I8AA 2R0KH 2R56L 3PAVA 3S2AA 3T6ZA 1R3IL 4D9QE 1HH9A 1E4HA 4B60A 3HR5B 2QL1A 3ZYZA 4LO9A 2O6FA 2P24B 3KDMA 3SJVE 4E42B 4BK4A 2ZWLT 3WY2A 4PJ8C 4UOW1 2VDKL 3IEAA 3L3IB 3K46A 4ETYA 4JHAH 5DQDL 3TBWB 3CVHH 2YPLA 2GJ6A 2P4AB 3X14A 3Q05A 5CHNB 3T04D 5HI3D 3ARQA 1JD7A 3PJNA 4ZFZB 2VMEA 2FO4A 5I26A 1TVBA 2FX8H 1WZKA 3HFFA 2G5RA 3LHAA 1PDKA 4PB9L 1AO7E 4ZQKA 3ZJAA 4O4YH 2K70A 3KNBA 3NAAH 1RVFH 4XPTL 1CICD 3PV7A 3G5XA 4IQHA 3AMLA 1SLWA 2VDML 3OAWA 1SYVB 4S2SA 3VDAA 3EJCA 5FKAA 2ENJA 1X6NA 5DJCA 1NMAH 1RY7B 2FT6A 2A9ML 1URZA 5DJAA 3B2UD 2HG5A 1DVUA 3RWDB 5LWYH 3FTYA 1YPZA 3ZR6A 1PZCA 4HHWA 4NYLA 5D7SH 2OJZH 3O4LB 4DP0X 5EZIH 1I85A 2CPCA 4DGIH 4FFWD 1I1AB 2O5YL 5I18H 1JF5A 4IBYA 1HYRC 4P59L 1KTDA 4L4VB 4LLYA 4P48A 1HEHC 4BZ1L 3K71B 2RBLA 4YHZL 3GIVA 1DLHA 4U6YB 2KERA 4XMWA 4CVXB 3DTDA 4NQUA 4CU7A 1CE1L 1BP3B 3D39E 1CR9L 1CZ8L 1L9SA 2WNKA 2E75C 3B2VH 4OQTL 1L0QA 4E9YA 2AJ3B 5KYWA 4YQXH 3BT2L 3IE4A 1GJWA 2BSTA 5CR8A 4XX1E 3FQ4A 3GRWL 1MHHB 1EGJA 3DHJA 2A6DB 3UTSB 5DRXA 3RI5F 5AYQA 1VACA 2WHVA 4UIKH 4D0DA 5HDBB 3GI9L 1N0LA 3NFNB 5HP5A 2E6PA 3QNYA 1WWWX 2YD7A 3UTPE 2ALAA 3QDME 3FNKA 1CO1A 3I02B 4KXZI 5MEOB 2D4FA 4MMZA 3FJTA 2FUQA 4ORZC 4JM2F 3WIFB 2CCLA 4WV1C 1QTSA 4N0UB 1VCBC 2ZF8A 4L3EA 2APFA 3O8XD 3J2PA 2GK0B 4OT1L 2WBXA 4IOFD 5AVQB 4H88H 3MA7B 4RBPH 4DH2A 1JVOA 5CLTA 1JPTH 3H53A 3VWKC 2OMYA 4Q89A 2BFGA 4UMSA 3GJFH 3C09C 3HC0B 5GGQL 4ZXBA 1ONQB 3POHA 5GZOA 2TSAA 4KVPA 1AGBB 3TO4C 3I50H 2G9HA 4GW1A 4JKMA 4KK6D 4F8NA 2MKLC 4PRAB 1PLAA 4R90H 1H3UA 3C2SA 2B77A 5BZWB 2W5PA 1S9YA 1FLRL 1Z7JA 2B9AA 5AW9B 4YHKL 1PY4A 4PIBA 3CPUA 5FGCB 2GJZA 2I60L 1T7WA 2XTLA 4OGAC 4Y1AB 1K85A 3V0VA 4ZNCD 3EO1A 1IM3A 1FG2B 3BP4A 4RAHA 1JXKA 2WAHA 3ISRA 5E2WH 5M7QA 3IF1A 3S8FB 4NXSA 4LCWB 4LPCA 5B38G 5EA0H 4JKNA 1NGWB 2JXMB 1YMMA 3O0RH 4PJ9A 5CF3A 4NC1E 3QQDA 4KO5A 3UG5A 4N2FA 2E9IA 4P2OB 4ELDA 3VI3E 1OL0A 5SV3A 3GSRB 1NGQH 3DVGB 1A22B 1XGTB 3QEUB 1J8HB 2P46B 3BVVA 4KTDH 1AXIB 4PWJA 3TH2T 2IQAB 1F41A 3QQ9C 4OZHA 2YC1B 2OZ4H 3QBTB 3MI6A 4Q6YA 1FL6B 4BBWA 4RLDA 5BOPA 4MRBA 1HDMB 4TXVB 5EC1B 1RIHH 1D3CA 4WWKC 3ECBB 3S35H 2BVTA 3EDDA 5IMMB 4OCSH 1GZHC 4HUVB 2IBZY 4UV7L 1WK0A 5DVLA 2ERJC 2K45A 5E8PA 3VGDA 3V0IA 2N1TE 1BVKA 4KKAD 3K80A 3QI9D 1INQB 1MF2L 3JWDH 4JHBA 3WHE1 5L4JA 2NPLX 2GIMA 4PJ5A 1ZY9A 4X98B 3L45A 4NM4H 2AQRA 1SGKA 1VGEH 1F2XK 1OSPH 3U48A 5H2BA 2F7RA 2N3JA 4A6YA 3AQYA 5EORL 3GIZL 1QR4A 4L5FH 4XPAH 5CSBA 4WTQA 5KVGE 4TN9A 1H3TA 1P4BL 5CJQL 5I75B 1NCWL 1KBGL 1NBYB 2WWNA 5GXBB 3UBXI 2G2NA 2J12B 1E4XH 5CCGE 1YEDB 5DJ2A 2CGRL 4FXTA 4WFED 3LVEA 1GCYA 5I5IA 4N2AA 4EUPH 1SEQL 1G84A 3FC8A 1Z0NA 3LN9A 3PJLA 1FZKB 4JFFB 2BSSA 5BO1L 1IVTA 3ULVF 4BXVA 4P4KB 3IFNL 5TQ0L 1AANA 1R0AH 1HEJC 4XB3A 4XWGL 3SCMD 1YEGL 2VXSH 1QKZL 1U95A 4PSPA 2G2RA 2QQNH 2Y6TE 4MLSA 5EU4B 3ZKQD 4IOIA 4U0RC 5JHDE 5C0JA 3MLWL 4ODHH 3NGBC 5ITFB 3B83A 1UZ8B 4HJJH 3AWFA 3DVNB 4AIOA 5H94B 4V1DB 3DO7A 4IBVA 1CGYA 3VRJA 2DBLL 2BNUB 1OK8A 2Q8BL 3ZZLA 4DP4X 1MFAH 1IE4A 1FN4B 3DPBB 4NZRL 1E28B 1UURA 1YEFL 1T89C 2IH3B 3PNWA 4R4FL 3VGAC 1RZPA 5EOTA 4DOHE 2M8XA 5EU7E 3AVEA 3TA3B 2Y24A 4JY6B 4DGVH 2ZKHL 4HA1A 5SX5K 4F80A 1SN2A 1XMWA 1Y1UA 5EBGA 4ZS7L 5J11B 3JZYA 4X4XB 3MOBL 3L3HB 5SWZA 5E6IB 1MEXL 4ANUA 2X9ZA 3HI1B 4PS7A 3I85A 4NKIL 4HV8A 2CLRB 5E1AA 4CKVX 3ZMNA 4HAGA 2IWKA 4FTDA 1FVEA 3H9HB 2R4RH 3NZHL 1QR1B 4PGEA 1JZJA 4XWOC 4MS6A 3X11A 1NEUA 2AVFA 3ZTJG 3V5DB 4TNEA 3PGFH 4J1UA 1DANT 2MKWA 1IIKA 3O2VH 3ILEA 4FCAA 1FIGH 3QAZC 3CSPA 1RL1A 1V27A 3ZZQA 2E3VA 3S5ZA 3CQQA 3V10A 1MRFL 4ZX3A 1P84J 3S98A 2EXSA 3BHBA 4XAWL 1L6PA 1PYWB 5JUEH 1FZMA 4L1BA 3PUUA 5KSBA 4RFNB 3NRQA 4OFDA 3WDJA 1JP5A 3PL6A 3T1FB 5K9QG 3TH3T 4NQCE 4OJCA 3TVMA 3FUNA 4G3YH 2YARA 4LLVB 1HCFX 1P0SE 4A2FA 3Q5OA 5E03A 2LABA 5DD6A 3MLZH 1PL3A 1UD8A 2ZICA 1FNAA 2VM3A 2A73B 3VXSD 5IUCA 3RKPA 5JW4N 4XNXH 1T1ZB 1L9QA 4NZTL 2M83A 4RGNC 3QUZC 3NCCB 4NO5A 4AXWB 4JL2A 5KOVC 2H41A 5CGYC 4AL8C 1C8QA 5K39A 4M7LL 5CR1A 4K5NA 1ML0A 2EDDA 2DWXA 4P2QB 5IESL 1NBZA 3DUSA 2B5IB 2EDNA 4LDCA 3QXDB 3N1FC 4PH8A 4TQ8A 4E9WA 2NUTB 2EACA 5B38A 35C8L 2QQQA 3DGCR 1BQ5A 4QXTA 5SWSE 2QVMA 4P99A 2LVEA 4HP5A 2E9WA 2O5ZL 1U4FA 1AMXA 3IAQA 5CS7A 4I77L 5DVMA 3P3SA 2A4ZA 1IE5A 1UZGA 2GABA 1BQRA 4WW2C 5I66B 5ISZE 1JF1B 5C2BH 2UY7A 5IR1B 3L8QA 2DEYX 1HCVA 4N2LA 5LCVH 1AI1L 4UT7L 1N5YL 2FBJL 1DUYA 2CJSA 2YD5A 4GAYB 1YCSA 3OQRA 2LAAA 1H6EA 2QLYA 3BSZA 2QADB 3L5IA 5DZAA 2WJ7A 2CJUL 3I6KB 4J3OD 5EU6A 1MUJB 2NT1A 2CLVA 2VDQL 5GIRA 4FNTA 4Q74A 2AP2A 4NO2B 4QRRD 2GSGA 3RL2A 4K3DH 1O9ZA 2Q7NA 4LPYA 2R1XB 1YLBB 1CD8A 4F3FA 2FUTA 3NA9L 1ZVHA 1AYRA 4GSUA 5JXAH 1FO0L 2OXHB 1TU2A 3FTXA 5IY5B 3QNZA 3MV9E 4Y19D 5KSUB 1S5HA 3ABZA 2QVKA 4G71B 2DYPA 1KB5H 2CUHA 4LSTH 1OP5K 4GW5A 4W9FC 3GSXA 4XXWA 3UTTA 1G94A 2VUOA 3EYUL 3TPUA 3Q9QA 3H42H 4FXGA 4KTYA 4J3WA 4FJZA 4APQB 2QV4A 1MJ7H 5HDWA 5CMAA 2BCMA 5DHXB 1HOEA 1ZK5A 3FHEA 4ZUVB 2H2PC 1QA9A 3L3JA 1ZV5A 2K3TA 1I9IH 1MFDL 4M5YH 3BUYB 5EEZA 1X9UA 2AQ3A 4XHJD 3LRKA 3CSYA 2EH7H 1FFRA 4AGMA 1KGYE 4FQHA 3WFDH 1BZ7A 3SKMB 2R29L 4JCLA 2DB8A 3REVB 3JV6A 4ZYKA 3BCDA 4KXZH 1E8WA 1BBDH 1DSFH 4GKOA 2D0GA 4LLQA 3MV01 3OC5A 1AS6A 1KLUB 3QARA 4JANB 1WZLA 1VFMA 1LNUA 4J3TA 1BZDA 4YUEH 1UB5B 2DH3A 2BHUA 3TWCH 2V2TB 3L81A 4L8DA 3X12B 3BSHA 3GGWB 1OARH 4GXFA 4KZCA 3VGGA 2J7LA 4MA1C 3QPXL 1S7WA 3PABA 3HHSA 4PP1C 2NXYD 5DVKA 1FRGH 2FWOB 2YMTA 3TJEH 2G60L 5K69A 4HG4J 3GQFA 4N6RB 2VN5A 2OMWB 1SJXA 4MXQC 5HGDA 1U21A 5I74B 1J0KA 3ECVA 3VJ6B 4WLCA 1DQQB 1H3VA 1F1DA 4HBQA 1T22A 4Y2DA 3I9GH 1MH5B 1T21A 2L7UA 4GMSL 3JXAA 3WSQL 5TFSL 2FHFA 2HH0L 2YD8A 4YPGB 3P3TA 3PWNA 1E6JL 4JPWL 3L5XL 4S1QL 2XWTB 2Y1YA 1UB6A 5MEND 2HVKB 4GG6F 1JDCA 1RJZB 3DOHA 3D9AH 1XF2A 3ZDWA 3FB7A 4M3JA 4R2GD 3L4CA 1QACA 2H9GB 4JO8A 4OVVA 2NY4D 4EI5B 1USZA 1KGJA 3QIBD 4NN6B 3MFFA 3ROLA 3HE6C 3UAJD 3U9WA 3P0YL 4AK1A 1T1WA 1CI3M 4F7MB 1CFNA 3JWNC 5DSCB 1U8HB 2WXFA 5E4EC 4FXKA 1N3NB 2XWZA 5E6ZA 2OI9C 2PN5A 3I2CH 4G80B 2ZKYA 3D18A 1F6AA 3GXDA 4QTIL 1UXWB 1HINL 1I8MB 4HFUL 1B2WL 2CM6A 1UOKA 2YPLD 3VD4A 1A1NA 2R56H 1SEBA 5JNYB 3ESNA 4JKLA 1R3IH 4KQ3L 4YOKA 4KRPC 4HVBA 1T83A 1FUNA 5GGRY 2XTSA 5GGRA 3N9GL 1FL5A 1UOWA 3QIWC 4CSPA 3MV11 1F42A 2W38A 1UM4L 4BUGA 2P8PA 2YGVA 2XY1A 4PLJC 3KAAA 4OCYL 3MBEC 5F3HA 4NI3A 4A2GA 1FFNB 3R4RA 1DZ0A 3SYPA 1QZ1A 1U92B 4P04A 2JE8A 4U1LA 2Y06L 4GAAA 4PRBB 2TSBA 3BGAA 1NDGB 1LEKB 4NRYB 5ICYB 2UYLB 4NSKB 4DCQB 5IV2B 4JFQB 1QWNA 3N42B 4WFGE 2VDMH 1OSZB 2ADGA 1T7ZA 1UASA 3DXAA 4PEEA 3RWGA 1OAYL 3TBTA 5CCHE 5HHOA 1A0QH 4BFBD 3T3PF 2BW5A 2ZYRA 3PFUA 2WINB 5AOIA 2GSMB 1RK7A 2Q2LA 5B39B 3P9MA 4PG2C 1JYNA 1FC2D 2EVJA 4WW1A 1AIZA 4NPYB 2HJLB 5I1AB 4XVJL 1P4LA 3O6FA 3O11A 1YUHA 2XKNB 3Q2LA 3IDMA 1MJ8H 2NW3A 1Y18A 1WZ1L 2O5YH 1G7LA 4M3HA 4HIHA 4KJWC 4WO4A 5DJ0A 3D4YA 1LO4L 4P59H 5CUSH 3B9KD 4EXPX 2EVGA 4Q0XL 2ZF9A 3BKCL 5DRNA 4TRPL 4YHZH 4N2GA 1KXVC 2FL5B 3HLAA 4QXGL 4WUUD 3DX2A 4HD5A 5JZ7C 3UTZA 4YN3A 3WXVL 5FV1L 5DJDB 1HILB 1CR9H 1CZ8H 3QO0A 3RTLA 5HSFA 2RFXB 3QH3B 3STLB 5B8CB 1CXHA 4AYDC 2XV2A 4MBOA 4M62L 4C56A 4JLRB 1UVQA 3BT2H 1I3GL 2PUQT 2VISB 3N43F 1Q0XL 4HJUA 3U46A 4LIQH 1QPXA 1KXTB 3BUTA 4FNLL 3INOA 3ME0A 2PYEA 2VW7A 2JI2A 3Q6GH 4FEIA 2JKWA 1NLDH 2OR7A 4L3ED 2A3TA 3GI9H 1JFQL 2P26A 3O2DH 2BIMA 1KTKE 4KRNA 1XVSA 2B59A 3IRPX 3KLDA 4M1DH 4WNJA 5EEWA 3KLKA 3COOA 1VFAB 5FCSH 2QDVA 3RWJA 3T6VA 5HI5C 3FCSA 2GT9B 4ZXBD 1A21A 2ITDA 3H1ZA 1TR7A 2ADJA 5FFLA 5AB0A 1G9NH 1FG9C 2VSMB 2YZ8A 5TGBB 5GZOD 5E5UB 2A9AA 3ULUD 1ZHBB 5C0RH 2ISDA 3W0WB 4OT1H 2X7LB 1JK9A 3VWJA 2AK1L 4AVHA 3RUGA 4Z3EA 3SZ6A 2DYRB 5BVJA 1BXXA 4JPVH 3FQ1A 1TZGL 1D5BA 4NQSB 5GGQH 4W4OC 3DX3A 3R1GL 3QDJD 4NBYB 5AVTB 2A83B 5GRVK 3I74A 5GJSH 2EYTB 2AKRB 5IW1B 4WDIA 5JPNB 1UJTA 4OF0A 5KVMC 2NY6D 2JIXD 1WWBX 3QZLA 4HC1L 5LAPA 3DX9A 4LRNH 1TQSA 2Y1ZA 2VW6A 1FLRH 4PJ9D 1YMMD 2JJVA 2OL3B 4KXDA 1ZMYA 4YHKH 4FFYH 3RTQD 2HMIC 4NKQB 4FG2A 4EIUA 1E4WL 2I60H 4XB7A 4ZMYA 5IIEB 1O0VA 4E5XA 1FPTL 4RRPM 4KBPA 1QRNE 2YZ1A 1TSRA 2X1QA 1HZLA 1GGTA 1XSIA 2HKHL 4FKEA 1C16A 2BY3A 4I1NB 4UBDD 3WFHB 2BW4A 2DJSA 4L4TE 3GSWB 2DQIL 4P5TB 4UYQA 2Z9TA 3UO1L 4B5ZA 4RMTA 4BZ2H 1HQ4B 2CRMA 2X4RA 1Q90A 3NSDA 5BZZA 2YRLA 3QG7L 3CVIL 4JAMB 5TDNA 3KPSE 3HE7A 1QHOA 2PP9A 1KJ2A 1Y7VA 4HBCL 4Q7DA 3SIKA 4LXFA 3NMEA 4D9RD 4AQ8A 2FQEA 3QZWA 1H3XA 3JSSA 3G08B 1YYLL 3RIFK 3LIZA 2FBOJ 1WBXB 3UACA 5C0BD 2D7MA 5HHME 4HKJA 3SDAC 4PJ6A 4OI8A 4TQEH 4W9KC 3IFPA 4LHQB 5DGQA 4IRJA 1G87A 1KBVA 5DHEA 1RPQA 1TZHA 2VLJE 5E9NA 5EDXA 2F53A 1G4RA 5JXEA 5DVOA 3RA7L 2ZWKA 3RVVC 3D5OF 4B9PA 4UV7H 1P7QA 5I17A 1R6VA 2WXHA 1WITA 1OOWA 4PB0L 1A1OB 3ULVE 1H15B 1MF2H 4NRXB 4UM9B 4ZAKA 1L3NA 2PPDA 3KPLB 4IU3B 1JXDA 1MPAL 3ASOB 5F1SA 4DK6A 1QWUA 2B16A 4PRIA 2O30A 4A2HA 4P5MA 1N18A 3ZRCC 5C0RL 1A6ZA 3GIZH 4QHNB 2WBJA 1I3VA 1NDMB 3BQUA 4JFPB 3SSGA 1JZ4A 1P4BH 3PJSA 1RZ8A 3PGCA 3ALXA 4PJ8B 2UVEA 1JI1A 2NY1C 4MAYC 2QR0B 4Z5RA 1QEWB 2YXFA 5I8OL 4OZFG 1X5FA 4D94A 5AAWC 4E0RA 1SEQH 2H2SD 5J89A 2VMFA 1J0IA 4OFKA 1M2VA 1JGIA 5EN3A 4U1MA 3QAQA 1IM9B 1G0DA 1HI6A 1K5NB 3OSKA 4N2NA 4U7SA 4XX1G 1T6VN 3SBWC 2YD4A 1OAKL 1T20A 2ADIB 2IDFA 5GGTH 5T1JA 2R69A 3PQYA 4XWGH 5AW6B 1JYXA 3RX9A 2C4FT 4CSSA 2P8MA 3PHOB 1SLVA 3WLWD 1OGAB 3FSOA 2ZX6A 4ZTPL 3PFQA 3QXAB 3B1TA 1AR1C 4HZAA 3PV6A 1ZDQA 4F2ME 4NKOB 1MAML 4N0FB 3TXAA 2W9EL 3BP5A 1WEJH 1R5WB 1XGRA 2D7TL 2Q8BH 3U0PA 2MQCA 2EIDA 1U8LA 2IAMA 2WPGA 4K23L 5D4IA 4LLAA 3SKNB 4NZRH 4ZX5A 3FSWA 1M71B 5SWZD 1CWVA 1YEFH 4G8AC 4R4FH 2QELA 3VXRB 3V0WL 1E9PB 1IBHA 1Z3RA 2UY6B 3SGEI 1X5LA 4X7EC 1W6WA 3QUKB 1A4KA 2ZKHH 2NXZC 4H1LG 5LLIC 1A47A 5AW5B 1G7HA 3MUJA 2OMUB 4HIEA 4OCLC 2BSEA 3TEXA 1NPJA 4ZS7H 3PWPA 3MV7B 1P7KB 2P5ED 2YD9A 1MCKA 2NZIA 3MOBH 4JVPA 4XCCH 3QRFM 1MEXH 5FECB 3CXHK 2DQCL 4A38A 3BWAB 4O51B 4NKIH 2A9DA 1QEXA 2HYMA 1YJDL 1JPFB 3SBRA 4Z7VA 3DPDA 1FFPB 2H3NA 3L3KB 1B4RA 4HZLB 3AZUA 2RALA 5AUMA 1X5IA 2PO6D 1AHWC 3NZHH 3OTTA 4FE9A 4MCYA 1JGEB 1FVDA 2IXQB 5FA4B 4HLEA 4B41A 4RMBA 3ZQXA 4TOYL 2ARWA 4C4KT 4X9YA 3KPQA 2XN0A 1IKNA 4LSPH 3PDDA 4OCRL 3GBML 1MG2C 3IRZA 4WV1B 3EJYC 4N0RA 2DQHL 4MAUL 5EUOA 3WHXA 1IKOP 4GSQA 4XAWH 5AG8A 2ZOLA 2ITCB 4ZUWB 3L4VA 3WJLC 1ZRUA 2K9UA 2YJQA 1A7OL 3ARFC 3MO1A 3VXOA 1RZJH 4KWUA 5F7LB 3VWKB 1UCBL 3NCYP 4KUCD 3CSFA 2QVFB 5DC2A 4X8CA 3C09B 5EG6C 3CFCH 4UU9B 5TJWK 1U6AL 4Z7AA 3K2UL 1HNFA 5AVWB 3TO4B 1N26A 4HK3J 2Z31C 2MEJB 3JWDC 1B9ZA 3QRBA 2R23B 4NZTH 1D5XB 5AZEL 3QWOA 4CL7A 1OP4A 2XZQL 1CBVL 4XTRC 3MTRA 4ODTL 4TL4A 5T3ZD 1T5KA 5C3IA 3B34A 3ZL4L 1XR8A 5BW7C 5IWLA 4QJ5B 3U4BH 3EIFA 2VLRE 5GRVL 3SJVA 4LCCA 4H44C 35C8H 4JG1L 3MRKA 2KLSA 5L2JB 1MLBA 1E50A 2MNJB 3D4ZA 3BE1H 2NY3D 2NQCA 3MREB 4YR6B 4TM9A 5DJ6A 2WKOF 4XXCA 2BVUA 1MFBL 3ZHKA 3G6AB 1F56A 1AO7A 2VXQA 1TNNA 4M1CD 3RPIB 3L9YA 5GS2H 1MWAL 1Q1PA 4JO4L 4MJJA 1AI1H 2QFRA 4UT7H 5A6LA 5HYJB 5CD5C 1COBA 4N86A 1EGJL 2CJUH 2DQJL 1ETJA 3GT6A 4WWKB 3H9SB 5D1QC 2PYFB 2VDQH 6CGTA 3MJ8A 3PWUA 3GZOA 3ZE2B 2E7DA 2P45B 2OSYA 2DEWX 2ERJB 3UTTD 3MGOB 4WAFA 3AMKA 3ZE2F 1AD9B 1CYWA 1XF4B 1AMYA 1FHNA 3BZFB 2AV1B 4DESA 5F89A 4N6QA 3WIHL 1NKOA 2IALB 4UTBA 3LXBA 2X9XA 3BZ5A 2VLLA 3BWSA 4QXVA 2WSPA 1JRHL 3GRBA 4KDTC 5D8JL 3DDGA 3QFGA 1WS7A 2AQQA 4JUTA 1BMWA 4JY5L 2JB5H 2DL9A 5KBLA 3MRLA 4N28A 1XGQA 4OLYL 4HS3B 3QRGL 4FCHA 1T0MA 4PN6A 3W9EA 5AW1B 4G9FE 4OM1L 1R5IA 1MFDH 2RR3A 3ULUL 3ETTA 1O7VA 3D39A 2VZ3A 3GB7B 3NK4A 4OZFA 5C7ZA 1ND0A 4O2EA 3IGKA 2R29H 3FZUD 4G42A 4WI3A 3BPOC 1FBIL 2GTZA 5E2TL 2VR6A 2NDFA 4XNQB 2V9UA 4QTFA 2CHDA 3ZY7A 2C7UB 3B6SB 4EVNA 3OLDA 1Q9LA 3QDMA 3AACA 1EJ8A 1URIA 2ZX9A 3BDYL 4MNQB 5IVNA 5E1GA 4U0RB 1H3WM 1BM3L 1DJYA 3NGBB 5J4MA 3CFBB 3O45A 1ZSDA 1LP9B 1ZGLP 1Y6MR 4XMZA 3CDYA 3L1FA 3UROR 4GG6E 3MRHA 3IMBA 3OKMB 2BFVL 2CDGB 3LN5A 3QPXH 5HY9B 1BMZA 2ENSA 2XFXA 2ZWYA 4AQEB 5FOBA 5F7EL 2A0LD 4PJAF 3APDA 4G6MH 4OLEA 2FDBP 3EADA 1HXYA 2TRHA 3NABL 3RZCC 4BKTC 1M42A 3UERA 3GXNA 5E94B 1OM3L 3VGAB 3GXMA 5DZNA 1F5WA 1JNNL 3LEVL 1CFSB 1USQA 4BXSV 5DVPA 3QUMB 3UG3A 1C5BL 4H1LA 5EPMB 3KYAA 3WSQH 4I0KA 5TFSH 3CX2A 2OSWA 2HH0H 3IDGA 3EYSH 4GAJL 1LLAA 3DYOA 4QRSA 2Q87A 1E6JH 3ORJA 4JPWH 4HOMA 2P7TA 1AOZA 4S1QH 4X7TB 3UMNA 3S37H 2H0EA 3IWUA 2ESVE 1ANUA 1G6VK 1ZT1B 2P43B 3PHAA 4XN2A 2VITA 4AGNA 4BWWA 4F9PC 3QZMA 4QAMB 1B0WA 2AV7A 3PXJA 3P9LB 4MD4B 4N85A 5IGXL 1DUZA 2NNFA 3FU7B 4R8WH 3MRDB 5CJXC 3OKLB 4YZFF 2BVPB 2FEDD 5DHVA 3PWLA 4WU5A 5SX5H 3VI3A 3P0YH 4KMQA 3H9ZA 1V55B 4HS8H 4KJPD 5D1ZA 2HT4C 1BVNT 1KLGB 5I19H 3QAZB 5B3NA 2VM9A 2BXYA 3P73B 2J73A 1KB3A 2MQ0A 4JPQA 1NC2A 5AW7B 5DDHB 4FTVB 1J11A 5T5NF 3T71A 4KU1A 4J3BA 4YAQB 2IDCA 1BFSA 2XLLA 3FYIB 4AYGA 3LPGA 4DK5A 4HFUH 1B2WH 3K4DA 3HG0A 3MLVH 1MY5A 3GO1L 2J6EH 2C9PA 2DQFA 3GI8L 2GTWB 5M94B 2W0LA 4HUKB 1I9RH 1SF5A 3IVKB 5T3XH 1A25A 5CNHA 3T3PE 2ZYHA 4GAGL 5CFHA 3QQXA 4UAOC 5AL0A 1MREH 4UQEA 1W72A 1ZHKA 2FVNA 4QCIB 4PRNB 4IBQA 3KPPB 1I7RA 2BVOA 4OCYH 3E9TA 1A3QA 4Y2NA 2EIJB 2FQDA 3QUZB 4RGNB 2QT6A 3IJEA 3VFRB 2E4TA 3RILA 2COQA 5CSZA 4G8FB 4PR5B 3SE6A 5GRYA 4WIQA 4NWUL 2AVGA 4NDMB 2PXYA 1LGVA 3FPXA 2EECA 2DTML 3UEZA 2E27L 2EDEA 3FOMB 4EEEA 4FLHA 1M3IA 3F3HA 2HJKB 3GZKA 3FB8B 3P54A 4WNSA 1RJYB 3VUAA 4XO3A 1OB1A 3HVDA 4KMLB 1WZAA 4WU7B 4KFMA 2ZG1A 3KJ6L 4GLRI 1HCYA 4IS6A 5LBSA 4WO0A 4JFDB 2HKFL 4XVJH 1T0NA 3GKWH 2C9RA 3EBHA 3FOLA 5DLLA 4WW2B 3VD9A 3L4XA 1QFUL 1DVSA 4BH8B 5E00A 3N0PB 1HKLH 2QDWA 3G04A 4ZUTA 1LO4H 4NFCA 5HD8D 5JHDA 1BQLL 3NZ8B 4C56D 1YNLL 3BKCH 5FHAL 3NIFB 4L3FA 4L37A 4TRPH 2BY0A 1OP3K 1WFUA 4QXGH 1ZS8B 5KUMA 3DJRA 1M7UA 1RZKL 2OJEA 4FNRA 2LFEA 1W9XA 1ZA3A 1MN4A 4OV5A 1SOKA 2IAAC 2PYED 3WXVH 2AHIA 4L9DA 1UG9A 4H0IA 4M5TA 1MLCA 1A14L 3KWWB 4RGOL 4XI5D 4M62H 2WB1A 4NGHH 3SGEH 3D3VB 5F7DB 1Q0XH 4LU5H 5IF0B 3NCJH 3MLTB 4M5ZL 4Z7UF 1E2VA 3G6JB 3HEIB 3ASNB 3ELQA 1HHGB 3G6JF 2KL6A 3WKML 1P6WA 1N6QL 3C8KB 2O93L 1XSOA 1CL7H 2NY2D 4HKXB 5KYYB 1M2OA 3WD5H 1CD9B 5DFVC 4IRZA 3DRQB 3NJMA 2A6KA 1CGSL 3K8LA 3HTLX 3QZOA 4JO1L 4EN3A 5EB9A 5C08D 1A6PA 2RQ8A 5DEFA 3ZRSA 2HWZL