2GG1A

Nmr solution structure of domain iii of the e-protein of tick-borne langat flavivirus (includes rdc restraints)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
TYTVCDKTKFTWKRAPTDSGHDTVVMEVGFSGTRPCRIPVRAVAHGVPEVNVAMLITPNPTMENNGGGFIEMQLPPGDNIIYVGDLNHQWFQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Genome polyprotein
publication title NMR solution structure and backbone dynamics of domain III of the E protein of tick-borne Langat flavivirus suggests a potential site for molecular recognition.
pubmed doi rcsb
source organism Langat virus
molecule tags Viral protein
total genus 14
structure length 93
sequence length 93
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2006-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2gg1A00
2V33A 2R69A 4AM0Q 4UT6A 1URZA 4ALAC 1PJWA 5IREA 4FFZA 1Z3RA 1UZGA 3N40F 2HG0A 4AL8C 4UT9A 1Z66A 3UAJA 4UTBA 3N42F 4X42A 5AAWC 2R29A 4L5FE 2H0PA 5AAMC 3J2PA 5B1CA 3J27A 1TG8A 4BZ1A 5GZNA 3VTTA 2GG1A 4UTAA 2ALAA 2JV6A 2JSFA 3P54A 4GSXA 3N44F 4BZ2A 4UTCA 5KVDE 1ZTXE 3C6EA 5KVEE 3IRCA 2JQMA 5JHLA 2P5PA 3MUUA 3N41F 5KVGE 4FFYA 1OKEA 1S6NA 3UYPB 5GZOA 1RERA 3G7TA 1OK8A 3WE1A 1SVBA 4FG0A 4GT0A 5JHMA 5LBSA 5KVFE 3N43F 1OANA 5LCVA 3UZQB 5IZ7A 3UZVA 5LBVA 3C5XA 2I69A 3UZEC 5H37A
chains in the Genus database with same CATH superfamily
3DJRA 3NZ8A 3QVAA 3DX2A 4ZUSA 1U8CB 3LHPL 2H8PB 2KQMA 3IBEA 4H2AA 2OYKA 5EU6D 4N0YH 3B1TA 3ZRFC 3DHJA 1WDAA 4O2FB 2H5UA 3NACH 3HAEH 3LPGA 5E4EB 5CEYB 3CK0L 3ARUA 2M83A 4H13C 2H3NB 4YBLC 5DJCB 4BSWA 4DGWC 4HSCX 5C92A 3WKQA 2HSIA 3ILDA 5SWZD 2UYLB 4W4OC 4NGHL 5FUZH 4ELMB 4AG4L 1OD9A 3V0GA 4AM0A 1QW8A 2QVIA 2MKLC 4KRPC 2ZWZA 1GC1L 2WHVA 4OGAC 4MZRA 5AAPA 3IDGB 5IHZB 3UTSB 2VAJA 5DQDH 1LD9B 5ECJE 2IWGA 2AV1B 4UIMB 2X4SA 2YAQA 3C2AH 4PJFA 1LK3L 4JRYE 5C0CD 3OF6A 1KY6A 2R9HC 3NCJH 2WZPA 5AAMC 4J3SA 3TJPA 5A2FA 3GM0A 5FM8A 5GS1A 3QDMB 1CGSH 3QW9A 1K5WA 4JGNA 2DF3A 1I3GL 2JQAA 2D7TH 2FR4B 1FSKB 3BSZL 2ZWSA 2R2BB 4UNUA 3UC2A 2QEJA 5SV4A 1BZ9A 2I5YL 2RMNA 3TN0B 4OI8A 3BD3A 3GJEB 3U25A 2G75B 1OGAE 1NCOA 4TKWA 4R7DA 3WFEH 3KL3A 3GGWB 4AJ0A 4BHUA 4OT1H 3A67L 2F8VA 5HGBB 2VITB 1S7WB 3V4PA 1DQML 1OAZL 3RGBA 1XMEB 4ZUWB 5T3ZD 2XCMC 3DV6B 3PIQB 5I18L 1OSZA 2HWZH 5TQ2H 2J72A 5EU5A 4GRWF 3MODL 3U9PL 1XZWA 2NQDA 1JZJA 2P3YA 1NEPA 3DXAA 5KYYA 2PKDA 4FJ6A 4MCYB 2OQJA 3C6LC 1MNUL 5GGRY 4Y2OA 3T6XA 4N1EA 5IMLA 4FQLL 4PBDA 2A99A 5TF1H 3BYYA 3K74B 3KNBB 4MNQE 1CG9A 4UYQA 1DBML 1Z9OA 4P46B 3BJLA 2AABH 2GTQA 1MRCH 5ADPL 3Q0HA 4YZFE 1L0PA 5IFAH 3QO0A 1TFHA 5GRJL 2YSTA 2V9QA 4FQJL 2R27A 2VLKD 3VFPA 1SJMA 2Q8BL 2ZOWA 4I1NB 4KNTA 3STZA 1E3FA 2FUTA 4KK5C 3MJ9L 3H9SD 4FQXC 2YGVA 4ONGL 1RZKL 4Z7WA 1S3KH 32C2A 2BVEA 3GSUA 4P05A 1N5AB 4MD0A 4AQ8A 2F8OA 3BPNB 2VLJB 1HESA 3N5AA 2CCVA 2MCMA 3KYKL 35C8L 1IGYB 4IIZA 5KVEL 4Z7NE 1NUDA 3DOSB 2EIBA 1QQDB 3BLPX 3ML9A 3ARFC 2BY2A 3L08A 4AYFB 4U1KB 5HYEA 4JE4B 3V0AC 3NCXA 1JPGB 5ESQA 3L4TA 2YD8A 4L4VB 1L9MA 4ODUB 5DT1H 1MFVA 4N8UA 3DO4A 3LEYH 3GS0A 4HUWB 1KPUB 1AIFB 3OAUH 4CSTA 4K3HA 2X4PA 1HYSD 1KIUB 5CZRA 1GZHA 5AYUL 3HG1A 3U2SA 1FH5L 3SJVD 5FWQA 4XVUC 3IF1A 5GS2H 1VZIA 3TJHC 3FTGA 4XO9A 1GJWA 4H0IA 3OAZK 3TVMD 1IEBA 1THCA 5IFHH 4QTIH 1EH9A 5HHMB 3DETC 3ZO9A 4YFLI 3QZMA 2ZF9A 5EDSA 1MF2L 5EA0H 1HHKB 2ARJQ 3DNKA 3KCPB 3H56A 3FRPB 2QELA 5ABDE 1IO4C 5C0CB 3KM2A 4PR5A 5HVHB 4OLWH 2Y7OA 4TM9A 1SJVA 5B8CB 1NGYA 2ZAGA 1NMCB 4GKSA 4FLHA 4FL4B 4AXWB 1MCWM 1JWMA 3JSSA 4JPWH 4Y1AA 3QIWD 5ISZE 1X6NA 1Y1DA 1QA9B 2Y2YA 4HIPA 1G7QB 3TCTA 1ZJAA 2ROXA 1VRSA 2G3XA 6PAZA 3J8F7 5L0QB 1FNAA 4YNYB 3S3CB 1JNJA 3BP7A 1TQWA 4IOSA 4W68A 1NUFA 4NO3A 4V11A 3S35L 4WTWA 1NMBH 5C2UB 1L7TL 4M7ZC 1JHKH 2VZTA 5FCSH 2XBTA 1F4AA 4Z3JA 1MCEA 2EDWA 4G9FE 1SYVB 4Y8AA 4ACTA 4AQOA 4EMZA 3HHSA 1YMMD 4FCAA 3FFDA 1R5VA 4HFUL 4P0DA 3EJZC 3KLSA 3V52H 4HG4J 3CIQA 1XCTB 1TVBA 3H3PL 4IRZA 4R26L 2HFFA 1EHNA 4PJCE 5DJXB 5JHDB 4WV1B 1OTSD 2OJEB 1B2WL 1DFBH 2YA1A 1DDHB 4HIEA 2QZQA 3T3PB 3TTYA 2CDFA 2OMNA 4DVRH 4U3CA 4FULA 4FC3E 3HZVB 2WVVA 1R3KA 1FGNL 3QNYB 4P3CL 1IGJB 1F4YH 1I8MB 1COBA 1N18A 5HI3C 1WT5A 4LL1A 4DO4A 3TT1L 1EUUA 1MI5E 8FABB 2ICEC 3FQXA 2BY1A 4NO0A 3LV3B 4NHUA 2F1AA 4H26A 3PWUA 5AOZA 4XH2B 3VB9A 2F61A 4QXTB 2ITFA 2IMMA 5CGYC 3O11B 2OL3L 4WK4B 4K3JH 3T08A 4N2KA 1T89C 4JO4L 4F58H 3K6IA 1KG0A 4W9FC 1ID2A 3BRGC 2YKLH 4KQ3L 4GKNA 3M45A 4ZO6A 4YAQA 4CMMA 1UJ3A 5ECGA 3RVTD 3H9SB 4NDMA 1ACXA 1N70A 5GGSY 4ENED 1IKOP 2H1XA 3DMMD 3Q2VA 1IIIA 3CZUB 5FKAB 2R4SL 4KHXL 1XSIA 3FQUA 4CGUB 1JZDC 3L7FA 1K2DB 1R17A 3KPRE 4HALA 5JHAA 2KLRA 2RD0A 3QPQC 3MNMA 5I17A 3LN5B 3QDJD 1TT6A 3U4EA 2P48B 3BVTA 2PNDA 4WI3A 4RWYL 4NM8L 1YUKB 2ZXEB 3NSFA 1V5JA 2VR7A 3MXVH 4N8VB 3BP4A 4JFDB 4C54A 1X5YA 4YXKH 1KLUA 5CR1A 1U30A 4K3DH 5HGGS 3L4CA 4KWUA 4KZEL 5DD3L 3GPSA 3AFLA 1F00I 3C09C 3FYEB 2CCLA 5DR5H 3U36A 1JZ8A 3RHWF 4PRDB 4J2QA 3E38A 3TFKD 1IM3A 2LVEA 1MFMA 1CMOA 5DHMC 1VF5C 5EZPA 3TVMB 4JO3H 4GW1A 2B1HL 3EO1B 3SYPA 3D50A 1QLEL 2G60H 4K23L 1BEXA 1XGYL 2DIAA 1ET8A 4HK3N 3KVQA 2UY6B 2HJLA 4O2EA 4F37F 2YC1A 4G80A 4LCCB 5H35A 4Y0GA 3Q3GA 1MLCB 4HKZA 2PWEA 3SDDA 4G8EB 1ZHLB 3VFSB 1TO4A 2HTLD 3KWTA 1L5GA 3QGVA 4FERA 2H3XC 2OA9A 3MV8D 1HSAB 4JG1H 4KXAA 5EZLA 5INCB 4NBYB 1TPXC 1VGEL 2DY2A 1MCNA 1AQDA 3LRGA 3BJ91 4XP9H 3U30C 5C0FB 1NCCL 3BPLC 3QUYC 1AJ7L 5IBUB 3GYRA 2R1WB 3W0WE 4RZCB 1KJVB 3G04A 1SVBA 3VNYA 4XHQA 5DFTA 4U1GB 5DUMH 4KXCA 1TENA 4NC1C 2OW6A 1SBSL 5IHUL 3JV5A 4K4KA 2YFOA 3U7WH 4KZCA 1T83C 3HHRB 5M95B 4APQA 1J1XH 4J3VA 3ARGA 4JHWH 1L0XA 5JUEL 4CC0A 4LSQH 1PSKL 3IJ7A 3PAVA 4Q14A 2YD3A 4OI7A 1BVLB 3EGSA 4IKLA 3ARQA 3IS0X 3RKDD 2L04A 4U1HB 4BIKA 2CR0A 3BUQA 3SO3C 4E9WA 5K9KB 2DBLH 3FK3A 3EUUA 4P48A 2QSQA 2ADYA 3STLB 4MYWB 4DW2H 1HQRB 3VD1A 4OLZL 4ZRGA 1DFXA 3HI6H 1RUAL 1AQHA 3DDFA 3BKYH 1QI3A 5FUCE 3EF7A 3GSVA 2O5ZH 4CADA 4NQDA 3ASWA 4LNVA 2Y1YA 1WAAE 2YRLA 4JM2B 1I1RA 2WQRA 2H6OA 2XKNA 4N2IA 5I9QB 1J8RA 4PMEA 5J13B 4H8HA 4OB5L 3SZKC 4HX1A 5AAWC 4F9LC 4KQ4H 4LEEA 2MPAL 3MRMB 4HXBL 4PD4K 3AY4C 1VEMA 4KKAC 2UV3A 4LB8A 5BS0A 7TAAA 2XWBB 5C9KA 2B2XH 4NWTH 5EG6C 5JLZA 2DQJL 3JWDC 1U2CA 3CFEA 4Y9CA 3NZUA 1ZV5A 3G5ZA 3O6FB 3PFQA 2YXWA 4LPYA 2WBXA 3FT4A 2H6UA 3CXDL 4BZ1A 4F8OA 4ZFZA 2MOQA 3U1PA 3I3EA 4C4KT 4Z0XB 3QI9D 4RDBA 1IQDB 3GSQA 3U2JA 3KYAA 1BJ8A 2W5PA 3CCHB 3CZNA 2ZSVA 3FH8A 1AZNA 1T5XA 4AV4A 3VFVA 3CK0H 3WLBB 2RGSA 2QV2A 1WWCA 4M5SA 4E2OA 1VACB 3VXTB 3BW9A 2LAGB 4XCFL 1JNHA 3CDYA 1HAUA 4UAHA 4DKTA 1NC4B 3VI4A 7FABL 2Y7LA 4EIBA 1CXIA 1WO2A 3SBRA 1D5IL 3OMAB 1VCAA 4X6EA 1RJCA 3DX9B 2C1OB 3BWAA 3HZYA 3HC0B 1H9VA 1SOKA 3PNWA 4F2EA 3RWGB 3CLEH 4XXWC 3GRWL 1PZ2A 2Y9RT 4PTUB 1LO2L 5DC4B 1MAML 4FE9A 4OJYA 1YUHB 5GRWA 3SPVA 1SUHA 4NAQA 5I6NA 5DJ0A 3IAGC 4HOXA 5FYJD 1YEJL 3MV8B 4MA8L 3AT0A 4XBMA 4MBOA 1MCFA 3KXFD 2R56H 1Z1WA 3CN3A 2Y7MA 1GOGA 3NP3A 2I5YH 4NS0A 1ZTXL 1BWWA 2D0FA 2Q0ZX 4QHLB 5DRWB 1C5BL 5ERWA 3VSTA 1ASOA 1UD3A 4FMVA 1YCSA 2Z8SA 3ESUF 4WI0B 2YARA 4D9LH 5A2AA 1IBFA 3A67H 4BM7A 4Q6IB 3QRBA 3QK0A 3PWPA 3GK8H 1RSYA 4LLVA 4AYGA 1OF2B 2GBAA 1BQ5A 3C08L 4ODVL 3KR3L 5I23A 1TJXA 4PY7B 2OMVB 4LQ1A 5LGHH 3VXME 3NH7H 2ADFL 4TSAL 2GK0B 4RSVA 2J57A 2G2RB 3G5WA 4OBSA 2WBJA 4A2FA 1OSPH 2W0FA 3F6IA 4ELDA 2EKSB 4WKZB 2LU4A 1HZHH 1M05B 4LCWA 2GITB 1MVUA 3GXNA 1U8PB 2C3VA 4Q6YA 2CLVB 2OTWB 4Q7DA 2QKIA 3UBXG 5I1AA 4EUPB 5I1CL 4DEWA 1G9NC 2VDLH 2YBGA 1MFCH 1E9QA 1I7ZA 1N8ZA 1UASA 5E6IB 2W81C 1X7QA 5GS0D 2Y69B 3FQWB 3TP4A 5ADPH 2PWHA 3VXOA 3TEXA 5D7JC 3CSBA 4CBPA 3EH2A 4GQRA 4NQED 4HCRA 2Y22A 4ZAKB 2VABB 4DQAA 3MNWB 4YHPB 3F85A 2Q8BH 4FAAB 3PPSA 2HKHH 4WNQB 2FO1A 2VDPL 5GZNC 1G4RA 4QOKA 4Y1SA 3WEXB 2ZOOA 4UDUA 2NX5E 3COOA 3HNTL 3OHXC 4ERSL 5ABZA 3DVIA 5I73B 2NR6A 1KB5L 2KQNA 3AMKA 3UADA 4BQ8A 5ICZB 3ECVA 3GI8L 4LPTA 2QVKA 3L6FB 3KYKH 4ELMF 3KPQA 3SYCA 3QHTC 4PJGF 4MAYD 5HD8D 3REWA 2OMWB 2ITDA 3OKMB 2WCGA 4MS6A 4OCYH 5C2BH 2AXWA 3ELAT 4JREB 1U36A 2AJVH 4XCEA 1WA0X 3H4FA 4JFXA 3QPXL 1KJ3H 3W82A 1THAA 3AXIA 1T0PB 3SDCB 3RE0A 1EVUA 3VXSB 3DO7B 2NY5L 4BFKA 3SPJA 2BVUA 3FQRB 1D5ZA 3BUIA 3MCKB 5C0IA 5TE4L 2GPZA 2TAAA 4OZHA 1ZOXA 3ZTDC 1RPUA 2BCKA 3LTVA 2WK2A 1BQUA 3LNIA 4Z7UE 1H3PH 4S0TD 4UOW0 1F6LL 1MF2H 1KTRL 4Z5RB 2WLZA 4R0LA 3MN8A 1JBJA 2ZX9A 1OWRM 1KCRL 1MH5A 3ISRA 3MVSA 1JK8B 2OZ4L 4KU1A 4LLWB 2J12B 1VKXA 4WO4A 3WE6A 2FTAA 5JHLH 3MNZB 1Q38A 3GJFH 4L3EB 5C0GA 4JDVA 5J3HD 2ZOKB 2RJMA 2WKOA 5KSBB 1KDIA 4WGVB 1LE9A 5ITBL 1VSCA 5AB0A 3ILEA 4ANUA 1JZ4A 1XF2A 5CBAA 4BFJA 4QCIB 4N90E 4WUUD 2O5YL 3S35H 1A4AA 1QPPA 5DF0A 3NZ8B 4IJTA 4NSKB 3D85B 5IW3A 4GRLA 4IJ3B 4ZS6C 2OYMA 4NBZB 3T1FA 1QLRA 3FU7A 3SPIA 3GLZA 2QTEA 2BZDA 1KEML 4PJBF 4BFOA 8PAZA 2B0SL 2N4IA 3AS3A 5D72H 2JCWA 3S37X 4BSWB 3NEXA 1P5UA 1KB9J 5I6OA 1AZBA 2D3JA 1CDBA 1B2WH 1EFXA 3FULA 1P7BA 3SDAD 3AM8C 3O4LA 5B38B 3CAFA 5F1OB 4PJAF 4XC1L 1HU8A 1BVOA 1RLBA 4IOIB 2P7TA 2JI3A 3IJSA 3QQNA 2DQEH 4Y4KC 3HG2A 3J07A 4IRJA 4RBPK 3TT1H 4W9EC 3AACA 1FCGA 1P4LA 3WO4C 1ZVNA 4TSCH 3T2QA 1H3GA 4XP6L 1S9KC 2A6JB 5D2NB 3TWCL 4JGUA 3G5VA 1F90L 3KYMA 4K8RL 2VMJA 5EIIG 2Y5QA 5GS1B 5E6RB 3MCLH 5I1IH 1F3DJ 1QSEA 3QZWA 1CL7H 2QPUA 4JQIA 2ATPB 3TBVA 1BOYA 1VZGA 1BZ9B 2HFGH 4PIRF 2F8XC 4TOYL 3FONA 4POYA 2YMTA 1N19A 5AQ0A 5MHSE 4R7DB 2MJWA 2FJFA 1F02I 4HDIA 2FEDD 3RGHA 5FLVA 3DTDA 5DD6B 1QSFA 1KT2A 3D87B 3D25B 1JYWA 5T1LB 5J11B 4N2GA 3V4PB 3TEYA 3KLHC 1JGEA 2J6EH 1OSZB 2XVGA 3FHAA 3FQTA 4P4KD 4QRPA 5E8NB 1Q0YL 5EU5B 5CU9A 1G5GA 4Z3TA 3SE3A 1JVOA 3DXAB 3ARED 4AV5A 5IJVA 4NN5B 1QRNE 1E8XA 4P5TD 5KYYB 3T0DA 1E5CA 1K8IA 4P23C 2NXZD 5D93B 2OQJB 2VTFA 4DK3A 4P5KA 3CLFH 4Y2OB 4C47A 2NY2C 5F9JB 2FSEA 5JW4M 1BQHG 1M71A 1QBLL 4HEMA 5IMLB 2B1HH 5GSRA 5F7LB 4JY6A 1A6AA 4PW4A 1QLEH 2HKAA 1CG9B 4I4WA 4K23H 5HI5D 3KLQA 4DP7X 1DVTA 4EKJA 5CEXA 4UQ2B 5BRQA 1JD9A 3QO0B 1A4CA 1QX1A 4FQ1H 2YIHA 4FKKA 4ZDHA 5HGHB 1S7QA 4G8AC 3KE0A 4JFPA 3ULUC 3GNML 5J6HA 1JUFA 4XVSH 3KS0H 1T7XA 3IDJA 4OUUA 5F9WB 3STZB 1W8OA 3H6JA 2RR3A 1PU0A 4BKSC 2OJ1A 5AWNL 4U3HA 4YLBA 1G7LA 1IKNC 3HE7C 4R7NA 3DYOA 3R0MA 5EUOB 4WHDA 3ZKQD 1MWAL 4G8GD 5I8OH 2XWRA 3A6CL 5F89A 1VGEH 2AQ3A 1NCCH 2VCOA 4J3BA 4I87A 1HL8A 1YPZF 3DO3A 3CFDA 4O9HH 1J0JA 3KEHA 1TTBA 1R46A 4L9LA 3KL5A 3IJYA 1UWGL 3A6BH 3UAFA 3BCFA 4K15A 3QJFA 5IHUH 1NCJA 4CVXA 1KPRA 3GKWL 4XHJC 4YDLC 5DJ6B 1UT1A 4MCMA 3GZKA 3HVNA 4XO4A 1ETB1 4PP2A 4I2XE 4KK9C 4DGVL 1KZYA 3HG1B 2VMFA 3RI5K 3UH8A 3U2SB 1TJIL 4PJFE 1RUPH 1ASQA 3FTGB 5TFSH 4C4KO 1IEBB 3UAEA 3BH4A 3OZ9H 4PJ5D 4XBPB 3QWNA 5EZJB 4AX3A 2E7LA 1PLGH 2HTKC 3D51A 5GGQL 4FXKC 2B5IB 4HAGA 1OL0A 4HK0B 1LO4H 4YO0A 1XSKA 1EERB 3DRQA 2ICCA 4LNRA 4Z7AA 4P2YA 2PPFA 5MENE 1I4FA 4ONHA 2ZP9A 4KMLB 4JFFA 1NGYB 2WXPA 2DD8L 5IMOB 2LVCA 3K2UH 1CYWA 4HWBA 1JWMB 4IIQC 4Y1AB 3U0TA 3BC9A 3MLYH 2ICWI 4OB5H 4OCXL 1MFEH 3DK0A 1L6ZA 4H1LA 1RHHA 3F62A 4Y5YA 4UQ9A 3LPWA 3P2DA 3X1NA 5E6UB 4JANA 2BSDA 4NUPA 3HA0A 4NO3B 4YSTA 5FHBH 3VXPA 5EU6A 3OX8A 3W11C 2WWMC 4UINL 3OAZH 1JE6A 1BQLH 2YWZA 3LZLA 1M7DB 5KUKA 4S1RH 1USZA 5D1XC 3HHSB 2VSCA 1JFQL 4LAJH 3FFDB 5EOQL 2CALA 4TN9A 2OULB 2R2CA 2P8PA 4YR6B 1JDCA 1UOKA 4Z7QE 1G4MA 1TVBB 2CGZA 5SWZA 2HFFB 3VH8A 4EZJA 1B4TA 2A77L 4HIEB 3TPKA 3V2AR 5A43C 2CDFB 1RULL 4WWPA 3FMGL 1MIEH 1R3KB 2WVVB 3N9GH 2XJLA 2DKSA 5D71L 2X41A 3G6JA 3P3TA 5C6PB 4MXQD 3GIZL 3K46A 3IMUA 1J48A 4PJIE 4O5LH 5C0BA 3LRSA 2CKBL 3BAJA 2UX7A 5PCYA 2BDNH 3D2UD 1BSIA 2AJSL 3P69A 4F7KA 1XMWA 4L0PB 4OKDA 5TE7H 3FQYA 4PJEA 5DHVA 4FLQA 3GUFA 3EAKA 1U8KB 3CMOL 2YD1A 5DMIH 4GKNB 4FQ2H 3HS8A 4TNFA 1LO2H 4YAQB 3TF7C 2EINB 1UJ3B 4TVPE 2XWZA 3FH5A 4M5YL 2H2SD 5DA0B 1YEJH 4MA8H 3F84A 5BZZA 3N40P 3ZE1B 4ES9A 3AAZA 1B90A 3FQUB 3KS0J 5IROA 2LLLA 4N9OB 4XNAA 3GBML 1NOLA 3L7FB 1DHKA 2WXQA 1TNMA 1O5PA 3CZEA 1QAWA 1DBKL 4NZRL 4TVSa 3M7OA 3U4EB 2BVQA 5I17B 2J1XA 2ZPKL 1C5BH 3GXPA 1EZVY 1N10A 4KI5C 4YVUA 3L3HA 4XMPH 15C8L 3O9WC 3BP4B 1RKRA 4Z7IA 1E5YA 1KLUB 4P2QD 4HGMA 3R18A 2NTFA 3K81A 1S5IL 2YA2A 4ODWA 2AJXH 2NXYC 3NFSL 3U0PA 1PL3A 1P4BH 1T2XA 3UJTH 4NJ9L 2EVIA 1M3IA 4IMKC 3U36B 3UGUA 4ODVH 4ZODA 2PO6A 3KR3H 3V0JA 5GGTA 1IM3B 2ADFH 1V3JA 4WHCA 3MKKA 5K9OB 2AZUA 3ULAB 1V27A 1ZVHA 5CP3A 5BZDB 3WY3A 1Q9LA 2Y72A 3S8FB 5SWSA 2A9ML 3IMWA 4X8GA 1G9NH 3QIUC 4WEBH 3MYZA 2DLHA 1AOZA 3B34A 4EI5C 4MJID 3F6JA 1RU9L 5TD4A 1JPSL 1G7PA 3B37A 4QNPF 4O2EB 3GFUA 5I1CH 2YC1B 3FUJA 3CDCA 4Z1PA 4ATTA 2XV6B 2E6JA 1FLTX 2Z92A 5J5EA 2WQ8A 3FO9A 4O02B 5FDYA 1QI5A 1KLFB 3CSFA 3Q3GB 2OMTA 2DQIL 4HKZB 4PU2A 5D1ZA 1A22B 3FAXA 1G6RB 3SDDB 5E2WH 2AXJA 2NW2A 4XBEL 1ZVYA 3QQ9D 1WH0A 4B27A 1SEBB 5GS2D 4HS3A 1L5GB 4XAKD 5EZLB 3JTSA 3FW6A 2BW5A 4X4YA 1P53A 3DTXA 2E8ZA 5DS8A 3S35X 2DDQH 3KCWA 1QW9A 1LP9B 2H2PD 3G04B 3ARDA 3HNTH 4JEGB 2YPVA 1KB5H 1PTZA 5IB2A 3VGHA 4KKZA 1RIVH 4P5SA 2YK1H 5FF6A 2CUAA 1XF4A 5D7HA 4BFBD 2LU3A 4APQB 1MUJA 4GRWE 4M7LH 4FZEH 3UERA 3C8KA 3WDIA 1HXKA 1BM3L 3B4NA 2B1AL 3HI1A 1N6QL 2JKRM 2Y1VA 5DZJA 1GW6A 4PI2A 1Y18A 3LNDA 2WO2B 4QT5B 1OP4A 4QXWA 2X2HA 2QPSA 2V37A 5C7XL 4MMXA 3U4KA 3O2DH 3UP6A 3GEFA 4I0PA 2VMDA 5IBTL 4M7JL 3CMGA 3NT0A 1F13A 3EYUH 5CNHA 5IREA 2NY5H 4RMVA 3VW3L 5HYJA 4AQEB 5TQ0L 1FIGL 3MV9A 1BDYA 2EVFA 5CD5D 3FYIB 1BVZA 2VR5A 3GSVB 3S88H 4CADB 3NTCH 4N5EC 5J0BA 4NQDB 4HEPA 1S46A 2CLZB 2XKNB 4WI8A 3FB5A 4JDZB 1BPLB 4B9YA 2OZ4H 2ZUXA 1LDPL 1NICA 2V9TA 3HC3L 4CILA 3MPCA 4PBXA 5BS0B 4QKXB 1A7NH 3LZNA 2DMKA 1UZ8A 1UFUA 3RB7A 3K6SA 3HS0C 3WXWH 5E2VH 5JLZB 2CJUH 1RZ7H 2QQNL 3BH8A 3UTZA 5D96C 5HYSA 3PWJA 2DIBA 3CFEB 3VG9B 3Q8AA 4MJ6A 3G5ZB 1IQWH 2YBRB 4AVHA 1G9HA 3UPCA 3FT4B 5F0MB 2DB8A 2Z35A 1WTLA 2OM5A 3LEVH 4K0OA 2PPAA 4GAAA 4NKOA 3IPFA 4NWUH 3Q2WA 4HPOH 4G6KL 3GSQB 4YDZA 4G6FD 1KEGL 1A7RH 3I6KB 1ZT4A 4LLYA 2ZSVB 1T5XB 3NEEA 2X4QB 2B0SH 1JNLL 1IBGH 4UTCA 4YSRA 3VFVB 3TYFA 1NDMA 2RIKA 4ZXBD 3RRQA 3IFOA 4N8CH 2Q1EA 5TGBA 4M93B 3BW9B 4UM9D 4HSQA 3WNOA 1JNHB 1N0XH 2EXYD 3F7QA 3VI4B 4MNGA 1A7QH 4G43A 2J2ZB 4KGLA 1OTTD 4I3RL 1T83A 2R69L 1MHHA 2OXGB 1I1FA 4U3XA 1AMXA 4X6EB 2AQNA 1JNNH 3BWAB 3HZYB 5GJSL 1AAJA 5IVOA 3PNWB 4XR8C 4OLVL 1RZFH 1KWGA 3G7TA 5D7SL 1FJ1B 3ZRCC 1NCBH 2IBBA 2NYYC 3N3EA 5KYUA 1JV2A 3Q13A 4KVCL 4U49A 5DGQA 4K8RH 4DO5A 3MRNA 3GDCA 1MAKA 5GRXG 3U9WA 5FK9B 5IY5B 2QQLH 4Y4HD 3SE6A 3S5LA 4OLUL 1SF3A 1FP5A 3M6DA 4JO1L 1QHOA 3BVDB 1ODUA 2XFGB 2I7SA 1G0YR 4X6CF 4E42A 2VXQA 2E46A 2DV6A 3HW7A 4TOYH 1DTUA 1EEYA 5DI8B 2AMUA 1U8OB 5I71B 4LBEA 2HX8A 2BWDA 5F0JB 3PAYA 4J6RH 3QAZB 2IQ9H 1S9VA 1X9QA 4J3OC 3T8MA 1WAEA 1AHWA 4J28A 2UWEF 3FN0H 3PWPB 5E1HB 5H37G 2YXVA 4LLVB 2Z64C 1AO7A 3K80A 1URZA 3NZSA 3CSTA 2GAZA 4U2ZA 1KXQA 4ICXA 2I27N 5HYFA 4E41A 4OGXH 3PV6A 1M42A 3C9NA 3K5RA 2WBJB 1ORSA 1N59A 2ESVE 2W0FB 1NDTA 2FSDA 5T1KD 2XG4A 3N50A 4LCWB 5AVVB 1G1CA 3ZIYA 2C3VB 1A3LL 2E7MA 3F3HA 2PN5A 3PJNA 2QKIB 5I1AB 1QBLH 4L8SC 1QRKA 1JVKA 2EEXA 1I7ZB 1N8ZB 4P59H 1X7QB 1RZJL 2DQHH 2FYVA 3AS2A 4BH8A 3ULUH 1RFDL 2AI0L 5JYMA 3AS1A 4KFZC 3VXOB 2EE3A 4X98A 4JY4A 3V0DA 5I0XA 5D7IF 2UY7B 3ZDXF 4HOMA 3EYOA 3B2UD 1WVZA 3LXBA 1DP0A 5IBLC 4QOKB 1D5MB 5L7XL 4LP4A 4A1RA 4UDUB 4Y9FA 2DM2A 3PRZA 1V8HA 2R23A 2EDRA 4U31A 1MWAH 2F5AL 2GCYA 2IDSA 3D48R 3EYQD 1CDHA 4D9QE 1NINA 2ZE0A 1CTOA 1XVSA 1BLIA 1U91A 1E27B 4PJ9C 3SDXA 4O58H 3MLSH 3VSUA 1L9RA 4EDWL 5EEWA 1ZLWK 3IMRA 4R5VA 4RRPG 4XCEB 5E6YA 3STBA 4ZMYA 1ES0A 4JFXB 1A3QA 4KGJA 4M1GH 4JZJA 1H6UA 1QNIA 2YEQA 3CFTA 4ZS7L 5C0DA 1MCOH 3VM5A 5A2CA 2XTLA 3JTTB 3BWSA 2G5UA 4FNUA 5CP7A 3RVXC 2M2DA 1D5ZB 1UHVA 2PF6A 2V7HA 3WENA 4OZHB 2ENPA 2IFFH 2N0KA 4NI6A 1EXGA 1UWEL 2BCKB 1N8OE 1KCSL 4MASA 2E9BA 1PPIA 4GAJH 2ZKMX 2XWCA 1ANUA 2NY6C 2EXTA 1MH5B 3CVIL 4AUJA 1JYXA 2Y24A 4ODSH 1TCRB 2HT2D 5D4QA 1C5CL 1ULVA 1VKXB 4QXGL 4WO4B 43C9A 3V6OA 1YEDA 2G2PA 1MJ8L 5EOCJ 3P77B 4MWFA 4N2MA 4OGAD 4PB9H 5C0GB 3L1EA 1SHWA 4JDVB 4G8FB 1GIGH 2FGWH 2VDKB 4HWEL 5JW3H 4PLOB 1MJUL 4YUEH 2XN9D 4FNSA 3FUNA 4M8QA 4XP4H 4JCLA 4DQOL 1XF2B 4ZSOE 5JZ7C 5CBAB 3EBAA 3NZHL 5CCGE 1KXVC 1E6JL 3QI9A 3ZR5A 3F5WA 1A6VH 4KVPA 4GRLB 2V3DA 4GKLA 4X6CA 1Z3RA 3T1FB 1QLRB 1I7UA 1OPGL 2R15A 3K91A 4F24A 3H3KA 5AUMA 5EOQH 5IESH 1WE5A 2X9XA 1K5NA 3THML 3LZOA 4DT2A 2CDEB 1W0YT 4JRLA 1P5UB 2P28B 1OHZA 4QRTA 1SLVA 1A2YA 2WLKA 4FXGA 4X0NA 4UV7H 2DH2A 1AD9A 1IAOA 5AKTA 1KCLA 2P7TB 3IJSB 1GHFH 3GIZH 4IRJB 1BXUA 2D7PA 2IAMA 4NQCB 4RFOL 1P4LB 1UVQA 5BZWB 3L9BA 1IC7L 2WKLA 4IDJH 4E0RA 1SQ2N 3DDGA 3G5VB 3ABLB 3WD5H 3WI9A 1OSEA 3C6LD 1GYUA 4WWOA 1MCPL 3W3BA 3CMOH 4PYGA 4NT6A 1QSEB 3QEQA 4NFDA 2GUYA 2G9HB 1R24A 5EU3A 4A6YA 4I1RA 4AYEC 2CZNA 3D4YA 3FONB 1MJJA 3BPOB 4KXZI 3ZVVA 4WHTA 2F53D 2XTJC 1OZTG 4X4ZA 4HDIB 2P5PA 3IDMA 1U33A 3NOIA 3DHMA 1KT2B 4RBPH 5JORA 2AHIA 2D4FA 3MV7A 4S1QH 4KKLD 4NZRH 4QHKI 1U41A 4YEFA 1KJ2L 1CYGA 1JGEB 1A8ZA 15C8H 1HINH 4FQXD 5D7LA 1UQSA 3FQTB 4QRPB 5JHMA 5ALCH 2WYTA 3QJQB 1RERA 3QUXB 3LXUX 5IJVB 3NFSH 5IVZA 1H6TA 5IOPA 4JGMA 5IQLA 1X5FA 4I7ZC 4LOFA 4ZX4A 4P5KB 2VL5A 1A4KB 4GOSA 1DQQB 1H8OA 1GC1C 1NEUA 2FSEB 4PG2A 2K8MA 1M71B 4YHZL 3ARFD 5GSRB 5FV2A 3IJ8A 4JY6B 3OSVA 4XMUA 1J87A 4I4WB 1XB8A 1YAIA 4JRXA 4PY8I 4ZFGH 5CEXB 4E9QA 1JPSH 1WTGT 4NQXA 4YBLB 5E99L 3VRIB 4A2GA 4ZDHB 4ES8A 1S7QB 3BH9A 4UQDA 2VDRL 2VZOA 3QDGD 4JFPB 3PL6C 1BV8A 5J6HB 1UC6A 1JUFB 4OUUB 3IDJB 3TJHD 4JQXA 1GPOL 4KRPB 2DQIH 3BAEH 1JCVA 1EEZA 1TMCB 1QFWL 3P30L 3LPOA 5E8PA 5ICYA 2G2NA 3DETD 3MX0A 3HRZA 2X3BA 5EN3A 1A6WL 1I3UA 4MJ5B 4R7NB 3OMZA 5CIPH 5EN2A 3QNZA 3LX9A 4LP5A 4AUUA 1GJIA 5F89B 4EI0A 4E9VA 2Q2LA 3P3UA 2GVYA 1E2VA 3NCMA 4FG6D 4KJWC 4XWOC 2AXGA 4ZQKA 5KS9B 4R2GD 5IVNA 4NAJA 1UOVA 4L9LB 3FU0A 4RWHA 1KBBA 3MAWA 4AVJA 2ZYSA 5E24E 3IJYB 5C0AA 1FORL 1JPEA 3BZ5A 3UG3A 3QISA 3QJFB 1K6QL 3O4LE 4PRBA 4PVBA 3ROOA 1YNTF 5DEZA 1GKOA 2VLME 3WCYA 3WJMB 1U8LA 4B9JA 4PP2B 3ZTJG 5F6HJ 2P4AB 4G1MA 4JDTH 4PV8B 4XI5D 3I6SA 4YK4C 5I30L 2WY3B 4POZC 3V9FA 4IU2A 2ADIB 3LAFA 1QHQA 3G9VA 1V55B 3EJZD 2BHFA 3MOQA 3Q8BA 2E9WA 4TVPL 1FIGH 6CGTA 3BEVA 2W65A 1PYWA 4YHIA 1U92A 3GMMA 4ONHB 3V4UL 5LXGL 1XL4A 1H3TA 1JRHL 1JGUL 3GSNA 3DPDA 4P23A 1B4LA 3MLUH 5JW4N 3U0TB 4KKCC 2FWSA 5BV7L 4D8PA 1ACCA 3BLBA 4HS6B 3K2IA 3BKMH 2I26N 4H1LB 1QSFE 1RHHB 1RZKC 3WBDA 3HC3H 3I9GL 2D2OA 2ZCHL 4JANB 1PZCA 3D0LB 5GPRA 5CGYD 3VXPB 3TYGH 1PVHA 2XA8H 3OX8B 5C08A 4RGND 2G30A 5H8DA 1JXDA 1T20B 4PN6A 4ELME 5E5RB 5IT2L 4FD0A 2QQNH 4PJGE 2X4NA 4QEGA 2Q86A 4OLXH 5FO7B 3EG9B 3M17A 3C60A 1ZV2A 5F7YC 4NQUA 1JDAA 4U7MA 2YPLE 2LQRA 4LDCA 4YHML 1PKQE 2FLMA 1AGEA 3SDAA 3TO4D 3VH8B 4EN3C 4ZMTA 5C09E 4WAFA 3IGKA 1AC6A 2YZ1A 3D18A 5SV3A 2E47A 3PNRB 1CGVA 1JWUB 2PTVA 3LZPA 4Y2DC 3S5YA 3QPQD 2RAMA 4ETQA 4JQVA 3G6JB 1FL3A 4P2RA 3ISYA 5F3BA 5CKAA 5I1KH 1G7HA 2ZOLB 3ARFB 4YSEA 1CZ8L 4QIRA 4KKRA 3LRSB 4OFPA 4MQXD 4K71C 1R19A 2BSRB 3IXAA 1D6VL 1E50A 5E5MB 2MCG1 4LSUH 3B9VA 2NLJA 3C75A 4PJEB 5DHVB 4WVRA 5EEVA 4RAUA 3KPOA 2PP9A 1LP9F 4XN9A 4JFQA 5BO1H 1OCWH 4K94C 4GW4B 4KTDH 1BVNT 1RVFL 2EICA 4YLCA 1KN4L 3ZZQA 1KCKA 5D8JL 2BERA 3D39D 5EU7C 2MH4A 4JO1H 1XR8A 3O6KL 4BZYA 3PFUA 3PWNA 5EF0A 5DXWA 2QQKL 3LKPA 4AEHL 4IDLA 1NBYA 4JE0A 4Y2NA 2BVQB 1NBCA 3Q6GL 3L3HB 1RY7B 5JDJA 3AREA 1EO8L 3UTQA 4PJBE 2F7IA 2Q10A 4A7SA 1OCZB 4GXVH 4GIAA 4XX5A 3SO5A 4ZTOL 2NTFB 4ODWB 3U0PB 3RWFA 3SYOA 2B7DT 3VTTA 3IJEA 3QUYD 3WN6A 5L9DH 3E9TA 4J2XA 2PO6B 4LCYA 3UAAA 3U4BL 4PJAE 2CCWA 2MNUA 2PW1A 3QQXA 5IK3A 3OLGA 1KYOK 4OZFG 3RA7H 4L0ZA 2NQ3A 3DRTB 1Q9LB 5GIRB 4JFFE 5HHNA 5SWSB 2A38A 4B0MM 1MIMH 1AD0B 2J8UF 4FLOA 3TA3A 2Z0UA 4N8VG 5F72S 3B2MA 2E4FA 4M8VA 4TQHA 4Y19D 1AACA 4LZKA 4LEBA 3MLXH 4AWJC 5CINL 4LIQE 5FO2A 4KDTC 1WZKA 4JRFA 1TZHA 5LHDA 1KTJA 4KRLB 1TQBB 2OMTB 1CXEA 5D1ZB 4J3XA 4NYLA 3QARA 5EU6E 4XPBL 2B4CC 2VIRB 2G3MA 1I8UA 3NIDB 1MN4A 3ASNB 1CB4A 2JMRA 3JTSB 5E0FA 2WUCL 1DQDL 3B9KC 4HA1A 4AGQA 1BAFL 3DTXB 5DS8B 3NIFB 4V1DD 5BRZD 3OXRA 5SWZE 4WWKD 4WKXA 5EFIB 5T1DL 2Z9TA 2GJZB 3WIHH 1K85A 2CO7A 2DQTH 3GXDA 3KBHE 4IU3A 3OWRA 1NCUA 5D1QD 3VGAC 5IB2B 5EBGA 3UYRL 1CDUA 5FF6B 1XF4B 4HT1L 1CXLA 4X8JB 1MUJB 4KKAD 3APMA 3Q9PA 1MFNA 1MWOA 2QDWA 2IH1A 5C0CE 4LSVL 4EDWH 5BJTA 3C6SA 1UH3A 3W5MA 5C0BE 4MS8C 1X44A 3FO0L 1Y18B 4MJJA 5IBUG 5AZ2L 2XG5B 2KZBA 4JR9L 2YMOA 2BJMH 5LUMA 3L54A 4PRPD 3ZUNC 4I0PB 1OAYH 3MBEA 4QGTA 3P73B 5F7KC 4B3VA 3HAEA 5TF0A 5HYJB 1TO5A 3MUJA 5LBSH 3MV9B 7PCYA 2K45A 3QC6X 3R19A 2YGNA 5F8RC 2FX8L 1L3WA 3TFBA 2VR8A 1V10A 4X4MA 3C09B 4Y89A 4Q9QL 3PP4H 5F2FA 4GAFB 1U93A 4DIXA 4Q9CA 2X2UA 2UX6A 4KFMA 4M7LT 1C5CH 4TSBL 2V5TA 5T3ZE 2PXYC 3SCMA 1Y6MR 4Q97A 1GOHA 2IDQA 3EXJA 4XNUH 3Q6FA 1WFIA 1UZ8B 5JPMC 4AEIL 1X9UA 2XYCA 3D39B 3FSWA 4DP9X 3K6SB 3ABGA 1QD0A 3HN3A 1I9RH 2HUHA 4Q52A 3BH8B 3UTZB 1YPZE 3R4DA 3X3FL 4KZ0A 2NY0B 3PWJB 5HYSB 4Z3IA 1G7JB 4G42A 4DQOH 4MJ6B 4DGIH 4MX7B 4OCLC 2IH8A 5KANI 2C5DC 3QA3B 3WHE0 2Z35B 4M6OL 4OF3A 2JV6A 4OZGA 4XP1L 3WSQH 4HUMB 3FTWA 3UPAA 1T0NB 3FCTA 5AZEL 4R4NC 2IXQA 2MCPH 4JUTA 5HDQL 1T1XB 1KGWA 1DCLA 4XPAH 3U30B 1BEYL 1X9RA 1ZT4B 2I60L 4J3TA 1R5IB 4LLYB 3BPLB 4PLKC 3MLVL 4JHAL 1O9WA 1EDYA 2HH0L 2VLKE 3TYFB 2ZUTA 1WZLA 1NDMB 1F1GA 3IFOB 4MLIA 5TGBB 1XZ0A 4QYOA 5A2BA 1CFTA 3H9SE 3K3QA 4G43B 2C4FU 2X5PA 4ORZC 4WW1A 1MHHB 5T8IA 2YRPA 6TAAA 3AWEA 4AYSA 3B7UX 3OR7A 1A8JH 1W16A 3F64A 4B9KC 2NPLX 1H3VA 4LAQH 3O8XA 5I75C 3MBXH 1IC7H 3RVUC 3SO3B 1JV2B 1TQVA 4X4KA 5DZAA 4AMKH 4UU9B 2DTMH 2AQSA 1YNLL 3QYNA 2XQYA 1CE1H 4GPVA 1MCPH 4Q9RL 3BT2L 4WJKB 4UCFA 3VRJA 4G3YH 3RX8A 4DEPC 5TE6L 3IWVA 2ALWA 2IPKA 3M8OL 2V6HA 2LABA 4E42B 3TT3H 4GXUM 4V1DB 2X89D 1EEYB 3SJVE 4LBEB 4TQPA 1UGNA 5GRYA 3L4WA 1LO5A 3D3VD 3HPJA 1S9VB 4QJ3B 2L0DA 4HH8A 5D7JD 2YRBA 2IG2H 3LKNA 3DUUA 1AHWB 2GT9B 3QSKB 1UEYA 1EZVX 1QMUA 1AO7B 5GZND 2AJ3A 5CJOL 2IPTL 3ZOAA 2N7AA 1KJ2H 1M9WA 2R4RH 3Q7JA 3N1GC 1P6AB 1DBAH 1L6PA 3QFGA 3U7AA 1AXSA 3NEOA 4U6HA 4E41B 3PV6B 2OK0L 4MJIA 4BZ2L 3C9NB 1ORSB 1N59B 5E5LA 4PRPB 3B8SA 1FYHB 2XG4B 4WFFD 4UDTA 4WSJA 5LN8A 3EFDL 3GS7A 3VGEA 4CBZA 1M3JA 2VXSL 1S7RA 5DJ2B 2FIRT 1T6WA 3CU1A 3EHBB 3N55A 2FECL 2PUQT 4KOBA 1DQJA 4DN3H 5MERA 1UWFA 2VJXA 4B53A 5BOJA 1KTLA 1YMME 1I9JL 3C5SA 5F1SA 4B96A 4BHUI 4JY4B 3GHEL 1PNDA 2VJ0A 2FLRT 4LKCA 4WWNA 3EYOB 2WD0A 1NCIA 5LG6A 3C5JA 1DQTA 5JOFA 2DM7A 3V0WL 1GPOH 1X5XA 5FX3A 3KZ8A 2B3RA 3MACL 1E28A 3P30H 2ALAA 3GBNL 3GHBL 1QFUL 5ESVA 2V8LA 2WIMA 2B15A 3OKDB 5TDOA 5H94A 3UABA 1J0HA 4GSRA 4HGWA 1Z9PA 3CQPA 5KW9H 1ZLVK 5DHYA 1U91B 3CBKB 3JWNC 3SDXB 3UPRA 2F5BL 2ZCLL 4R90L 2DL9A 2EDDA 2Z4TA 1RZ8A 2OSXA 1K6QH 4MNGE 2FBRA 4HHGA 1A7BA 3UTTB 5HPMB 2ZX7A 3ZXAC 1J8HD 1EO7A 5IHLB 3UBFA 1CFSA 5CP7B 1FQ9C 2VL4A 5I30H 1HWWA 1MG3C 3CVDA 3QORC 1IILE 4NENA 5KN5A 4M8UA 1O0VA 1R3LA 3SB3A 4IBZA 4O51B 4QNPE 1BZDA 4BKTC 6FABL 3T0EC 1ZHNB 2WZ6A 4DTGH 1TCMA 4NUMA 1UB6A 2TRHA 1U3JA 1XGQA 3DSNA 4XNQB 3UG4A 4N0UA 3QDJE 3OD3A 5G4MA 1HWHB 3V4UH 2ZXCA 3ECBA 1KTDA 43C9B 3SGKA 4HBCH 1CJYA 3QG6A 4MWFB 1ZLWH 2BM3A 4XXDB 4PJXA 2E59A 1FO0L 3CVHA 2J4WH 4ZX6A 2L7UA 3O41A 4Y4KD 2XZCH 3HE6C 3BRFA 3D9AH 3RBSA 3BKCH 3NJVA 1FZOA 1NOAA 4OLYL 1E7VA 1PZSA 2F15A 3P4NA 4ZW7A 2CNZA 2KC0A 2Q2EB 3KM1A 5F21B 2W80C 1KBPA 3S3SA 3F5WB 3HZKB 5CXPA 4PRHA 5IR1A 2CHWA 1M7IA 1WFOA 3BIAX 3DPBA 1I7UB 2Y06L 4S0HA 5AUMB 4E9RA 4AJWA 1TTCA 3IDIA 4EQ2A 2W9LA 4HPHA 2JE8A 4LOUD 1INDH 4YHMH 4OIIL 3OHXB 1KENL 2AQPA 4MYPA 4FXGB 1OY3B 5AG9A 4NNPL 1YEGH 3MV8E 4PJ9A 1PCXA 1CICC 4AQZA 5GGUA 1RK0A 3O2VH 1B3IA 1Y07A 3KLHD 3IGUA 1YNKL 1UM4H 3V6ZB 5I6XC 3U6XS 3FQNA 1UVQB 1E8ZA 2ADJA 3ZSTA 4E0RB 3K8KA 4Y4HA 5BOZG 3NPSC 2WXNA 4K94H 3V5KA 4JCMA 3CFUA 2KT6A 2NY2D 3TH3T 5B38G 4HLJA 3F7VA 3JTBA 4W81A 4NT6B 2UVEA 2UXTA 3BP6B 3GSRA 3QEQB 2VSKB 2WP3T 4A6YB 2DQDL 1CR9L 1RVFH 2YPKA 4HF5L 5HSFA 1RAMA 1PAZA 1MJJB 1P5VA 3OMNB 3WY1A 3ZE0B 3F7RA 5HGAB 2C9XA 1YZZA 3RFZA 3IDMB 4ZFOA 1NGPL 1UEMA 3CFCH 4JPKL 3ULUD 4WW2F 3I9IA 5JORB 5BQ7A 3MJ7A 2OV0A 3MV7B 3KLKA 3KH3A 2FDBP 4AEHH 4EBQL 1U0QA 4Z7VB 4Z7OB 2R8SL 2VO8A 1M4KA 2X6MA 3Q6GH 4LVNB 4XP5L 4FQQA 1FFOB 25C8H 4GBXA 5D7LB 1UQSB 4YMPA 3HE7D 2H3KA 1BQRA 2QMKA 5AW6B 1YEHH 1WBXB 5IOPB 1JL8A 2WCSA 2CQVA 2XZQH 5DMGC 4H8PA 3SKUD 3TZVC 4BUQA 1DQLL 2HKFH 3U4BH 1FIEA 5KVMC 3SKOA 1I8LA 1Z9NA 3BFWA 4LLDB 4U0RC 2DWXA 1T2QL 4P9HC 1HTYA 4A2EA 3V4VB 5DJAA 3GSWA 1AS7A 3QEGL 2ODHA 5IB5B 1KYFA 2HZHA 4JRXB 4RNRA 2JVUA 1GRWA 2O6DA 4KK9D 1RUMH 2ZJSH 2YD0A 3BH9B 3OB8A 5CINH 3VG0L 3JV0A 3QIBC 1XD0A 2B4CH 2E56A 3CWGA 3NSYA 4FYTA 4K73A 4I1PA 3OXSB 4P2AA 3NDZE 5E4EC 4AQ1C 1EEZB 5E8PB 4LFHD 2VDQL 2F1BA 4OV6F 4XPBH 3MX0B 5DFVC 5ICYB 3BVWA 2V5SA 3HRZB 2Q6WA 4X6CE 5EN2B 4X8XA 3QNZB 1FRGH 4B7IA 2PP8A 4B9ZA 2WUCH 4KVNH 4IKNA 1TZGL 3MMEA 1JHLL 4M8RA 3S3PA 2AXGB 4ZQKB 4P4RB 4JO2L 3PQYA 5L88H 1BD2D 4M1CC 3V8OA 1RZGA 5T1DH 3U7YL 1TJHL 2UWEE 3VD4A 2EP6A 4XNMB 3ETTA 1CE6B 4MZIA 2XPYA 1FYTD 4AJYV 1F3JA 3D09A 3QUZC 4PRBB 1JPST 3ROOB 1NIFA 3IXTA 1U8LB 2JJUA 4DEUA 4ZW8A 4D9RD 2F6AA 4G1MB 4G5ZL 3W11D 2WWMD 1FSKC 3HUJA 5I16A 2ZD0A 2Z8VC 1H3UA 12E8H 1DJHA 2PR4L 3IN2A 4JR9H 1BFOA 3QCVH 5EIQA 5D1XD 5FYJE 5JW4Q 4OBRA 1I9IL 3V6BR 2IMNA 3KXFE 2FB4L 3GMQA 4QTHA 5DMKA 2DYSB 1J5HA 3PGDA 2H47C 4FTVD 2AK4A 3RIAK 4H44C 3BEVB 3SPGA 1PYWB 4YHIB 1U92B 3GMMB 3MRBA 2QHLA 2VDNH 2AMGA 1P2CA 4P23B 3GSNB 1KGJA 4CVZA 1MCCA 5HDBF 5D7IE 3QFJD 5F7NC 2FVNA 3ZDXE 2A6KB 1NCHA 5I8KH 4D8PB 5T33L 3CZKA 1GCYA 4BYHA 2BNRD 2D31A 2NY7H 4H5SB 3DYMA 4NRZA 5BW7A 1HK6A 1I53A 5L8JB 4PJDF 3O45B 3MRPA 4OD1L 3CVCA 2QR0A 4FKEA 4YLQT 4FFZL 1ROCA 2DQUH 5C08B 1PLAA 5HHPA 4TLUA 1P69B 3VX0A 4KZDL 3NSJA 1IGCL 2F9BT 3ETBJ 3PL6A 3WE1A 2VE6A 4PJ8A 2X4NB 1NJ9A 4LPCA 1G9ML 2Q86B 4DOHE 3AMLA 3C60B 1X5HA 2D7QA 4PVLA 4LMQE 3L2LA 5AOIA 1G84A 3HB3D 4TS6A 1SY6L 4MAUH 4HSAC 3SSGA 1CI5A 4HWBL 3FUKA 3DX1A 4KX9A 2ZAHA 1SEQL 1WCBA 1BEYH 2VM9A 3D18B 2PYED 3UYPA 3WIAA 2EDLA 4NQEE 4LIQL 1PF3A 3CHQA 5AVRB 3OGOE 2K3TA 1FL3B 4P2RB 5F3BB 1K4CB 4ANWA 1OAXL 4OM1H 4B97A 2CH8A 4KI5D 4UB0L 4UIKL 3O9WD 5B1JA 4NZTL 3MDJA 3QJZA 2BIMA 4W93A 3CPLA 1OAUL 3UZEA 1MY7A 4MBRA 5FB8A 1E65A 3EYVA 1ZLSL 2NXYD 4RISH 3WYRA 4UTAL 4XN1A 3AQXA 1E2WA 4NPYA 4R5XA 1NKOA 3K1DA 4GT7A 3BWUC 1WS7A 2JLLA 3BX7C 2OMZB 1VZHA 4E5XG 2B8OT 4AL8H 5DJYA 2F53A 1CFBA 1RSFA 4FXKB 4QTFA 1BF5A 4WK2B 4QRFA 4DZBA 5C0AE 2BSEA 2W9EL 3VFOA 4Q9RH 1ORQA 2GEQA 2OMYA 2R51A 2DOCA 4UOJA 5LNGA 2EH7L 4U1MA 3LQAL 3NSDA 3MTXA 3PWNB 3WNLA 3WTTA 2BIPA 4C58B 2VXTH 1BD2B 1BVKA 1NBYB 2A1WH 5JA9A 5E9DD 2A9NL 2A9BA 3S96A 1NANH 1NGZA 5GZOD 2F74A 4H4NA 3ARXA 3MJ9A 5HVHC 2X4RB 1TG8A 2CJ3A 5FC9A 5F0PB 2QLVB 4WUKH 4FL4C 1DUZA 1U95A 2DMCA 2VSMB 3IJEB 4ALAL 3EOAA 5HHVH 2IPTH 3FDWA 4C57C 1VDGA 1QYGH 1DE4A 5F3HB 3UO1H 3N0AA 4XMTA 2UZXA 1PY0A 5HHNB 3IPBA 1E3ZA 3TA3B 4DVBA 2HLEB 5JO5B 4RX4D 3TV3H 4Q89A 5ILTL 3K1KC 1V05A 1A25A 5T3ZL 2AP2A 2H41A 4DO6A 4HW6A 4WUUE 4XVTL 5CSGA 1TZHB 3PDGA 4Y7OC 2COQA 4XNXH 4YSPA 1BREA 2C1PA 2X09A 3PXHA 4NYLB 4NJAL 4D0CA 4HPYL 3E9UA 4OM0L 1NBVH 4WV1C 4U4BA 5GGRA 2VLRD 1TJGL 3GHEH 3VDBA 5C8JA 1KV3A 5I5JA 1AGCA 1L9SA 3DLQR 3FJTA 2E9JA 3R8QA 3IM1A 4UF7C 3MACH 3KYNA 3OXRB 1CDYA 1NTDA 2JB5L 2FAUA 4UILL 4ZPVA 4PJDA 2CO7B 5ACLA 2WNKA 3CHXA 4W1TA 4IU3B 3L1FA 2NY4D 3W9DA 5FUOH 1EFQA 5IIEA 1XIWA 4HV8A 4D8OA 2VXVH 4XODA 1KXTA 2IH1B 4XMLL 3C6SB 5BJTB 4I9XA 2V33A 2V2WB 4J8RA 5CN1A 5FUCC 2DQCL 3RX5A 2Z4QA 4LSRH 1D6EA 4LGSB 5JNYA 1U6AL 4OCRL 4NZDA 1WWBX 1ZIBA 1AC0A 3MBEB 1BWMA 3O9WB 1A21A 3CSYA 1SUJA 1RMFL 3CN4A 4AK1A 2NXYB 1QABA 3L5XL 3ZZLA 3DJSA 1AGBB 2YPVL 1GZPA 1T1WA 1F58H 2WSDA 4MLSA 6FABH 1NCAH 3IGAA 4KROD 2BWIA 3G6DH 5B39A 1E4JA 1ZCRA 3T2NL 1U93B 3F8UB 4YBQC 4CRPA 2ICWJ 1IEAB 3L4ZA 4U1NB 1IZKA 5IW6A 4H25A 3SCMB 3QIUB 2XWTB 2Z1KA 3DI3B 4EI5B 2JB6A 4DKFL 1ECZA 3P4MA 1FGVH 2VDML 5HBBA 3EGDA 1B4JH 1I1AA 2OL3A 1Q9WA 1W0WB 3LH2H 4X5WA 2ZP8A 2Q7YA 3KL0A 3RBGA 3SYQA 5E9DB 1BFVL 2WP3O 1JPTL 1ROWA 2UZIH 2YQ3A 3GT6A 2XX0A 4OZGB 1UM5H 3N1MC 4KJQC 3QP3A 3FCTB 3SY0A 4LCCC 3QCTL 1SN2A 3W56A 4NB7A 4JJ5A 4KDVA 4B9GA 5I8CA 2G5RA 3WEAA 4PG9A 5BO0D 3WN5C 4MVBC 3FUHA 2V5RA 3PLYA 1ZEAH 4P8QA 4F8TA 1YG9A 3VVWA 1PX8A 1YQ2A 1XZ0B 1AS6A 2WYZA 5BXFA 4PSRA 4J3OD 4ZX5A 4L4TD 4PW9A 3I9AA 4NNPH 4WW1B 5HVGB 1P7QA 3L95A 1LE5A 5ENWA 4G8GE 1RUQL 1EJ8A 1M9SA 2PW2A 4JFED 3BD5A 3OR7B 4U1GC 5JDSA 4U1IA 3WXVL 3TJEL 1MQKL 1U8JA 2VRAA 2WTPA 3KDPB 2OR7A 3O8XB 4ZI8A 3OQRA 4F80A 5F88A 1H9DA 3PWVA 4HHAA 4UUJB 2V3FA 3MA9L 4Q2ZB 1S9WA 2JI1A 2X87A 3Q5YA 4XOCA 1QKZH 4X99A 4B7LA 4OCSL 4YHNA 3VRJB 4WU5A 1E6OH 2UUDK 4K7FA 2IPKB 3MLRL 1HQ4A 4Z3FA 2WQVA 4XCNA 2DQDH 4HF5H 1GMEA 1X5GA 2W95A 2WSKA 2Y7SA 2YEVB 3DECA 3E80A 2C7FA 2ZKWA 3HPJB 4MMZC 4PJ5E 5ADOH 2Y6SD 1HJBC 3BYTA 1NGPH 3DUUB 4WCYH 3MLWL 3PPEA 3ROLB 3ISWA 4ZJ9A 2FQEA 3OB0K 2FX7H 1KYOJ 2P5ED 4QJ5B 2AJ3B 3QBTB 5GGSA 4DP8X 3HS0B 4KRMB 1EV2E 4IHBA 4K9EH 2DEWX 4CN1A 4EKXA 4U6HB 5D96B 2DQGH 4F57L 4R96A 4JUSA 3KWXA 5EDXA 3TC9A 1A3RL 4HJGA 2JJVA 1Q1JH 5AW1B 4F27A 2BVPA 3CDZB 4NUGH 4UDTB 5BUGA 1DQLH 5F1IA 1YEIL 4XC3H 1CGXA 5CMAA 1S7RB 5AW5B 2MMXA 1A14L 1X5KA 1BAWA 1JOIA 3SOTA 4K2UH 3QEGH 2N3JA 4PCSA 1LP9E 5MERB 3MR9A 5CLXA 4RMQA 3ARBA 4Q56A 4NCDA 3C5SB 1QLFA 2ZYIA 2HJKA 1HWGB 1QNZH 1F8TL 4PWIA 4L1SA 4LKCB 4MD5A 5F7MC 5BRZA 1DQKA 5JOFB 1WS8A 4WWKA 5I15L 4M00A 5I24A 1NFDF 1E28B 3Q8FA 1V7NH 4GUPA 2NW3A 5D1QA 5ESVB 1CWVA 4TVUA 5LWYL 4X7CC 1YMHA 3S9DB 1NAML 1REIA 3I3DA 1NEZB 2I25N 1PG7L 2Q3ZA 4QRSA 5H94B 1CBVL 1J05A 3K72A 5CM1A 2ID5A 3MRLA 1A6UL 3UPRB 4JO2H 3QG7L 2FNBA 1JGLL 3U46A 5HHOD 4G7YH 4R5TA 4FEIA 1G0DA 1RZ8B 4GXUN 1NM4A 4YL4A 4QLWA 3S36L 5IM7A 1WBYA 2M1KA 3T2LA 1N6UA 1E5AA 1XAUA 5CZVL 2X6UA 4CSSA 4PJ7A 1CFSB 2DLFL 4ANKA 2OMUA 4AOFA 5AYQA 2XLLA 1RK1A 2J8UE 1NC2D 2VUKA 5KN5B 3ARPA 1AHMA 2CUHA 3BE1L 2JJSA 3TLRA 4LEXH 4ABWA 2B9BA 5CJBA 4KMTL 5HJ3A 4ZMNA 4S0SD 1MHEA 1UB6B 1XGQB 4G72B 3DSNB 3HNVH 1S7TA 1E5BA 4OCWL 2FJGA 1ZLVH 5HYQB 5LCVH 4XB3A 4Z3HA 4YH6A 2BP8A 4Q6IC 4XTRD 5JXEC 1W15A 4MNHA 3ECBB 1KTDB 2XZAL 1NAKL 1U42A 3QG6B 2R0WL 3MRDB 4P2QE 3T0WA 4DP0X 4PJXB 3WTVA 3CVHB 5LQBL 5T33H 3VFNB 4S10A 4JLRA 1FZOB 2WSPA 4MHHI 4YS4A 3P4NB 1NSNL 4GIPD 4ZYKA 2EDEA 3GRWA 4C59B 5T5FH 2CRMA 5E8DH 1RCYA 4U1SA 1BM7A 1PMYA 1WITA 4BK4A 4GIOA 4UBDC 1NCGA 2CAKA 4PRHB 2MQ3A 5IR1B 3L16A 2H32H 1M7IB 3IDXH 1J1PL 4MJIE 1NMAL 3OLEA 5E6IC 2P5EB 4ZFQA 3IU4H 5EOTA 3IDIB 3VDAA 4TNWK 4U1LA 4Q8BA 4CSZA 3GB7B 2VC2L 4MA7L 5KSUB 1SY6H 4GSUA 3B5GA 2XTJD 4ZAKC 1IAII 1A7PH 4GP8B 2AGJL 1FNSL 3UTOA 5TTRA 3FPYA 1U8NB 1ZXKA 4JDEA 3BMVA 5FYKU 4UT6H 5F70A 4XAKE 4PJ9B 2X3AA 1RK0B 5KEZA 4K7PY 2V0AA 3ZLQC 4UB0H 3I74A 1Q0XH 4YZFF 3QRFM 1S4IA 2WJ7A 3EADA 1Z9MA 3JBG7 4AI7A 3FQNB 2M26A 2GG1A 5HYIA 1B6UA 1G5AA 2ADJB 5KTEH 4PBVC 5I1HH 3T3MF 1R9FA 1GYVA 3A47A 1FFTB 1FVCA 4RAHA 3QH3A 2GW5A 2AVFA 4OFVA 1GKEA 3GSOA 1UD2A 2HFEB 5F7DA 4ZMQA 4GEIA 4KHTH 2G3ZA 2GJ6D 5GQBA 4OIAA 5G5DA 2YPKB 4P2OC 4WI5A 1JGVH 4F7EA 3SDCC 1P5VB 1TDQA 4YC2C 1MRDH 1ERNA 2NY6B 3CHSA 4OZIA 1LO3L 3CQQA 4ZFOB 4G8IA 4TQIA 5BQ7B 3G5YB 4HUNB 2XN1A 3JT2A 3EJCA 3ZBMA 4FQQB 5FYJL 4N2LA 1WC7A 5SX5K 1VFUA 2N1KA 1Y7VA 1S7VA 2WBKA 3ILPA 1F4WH 3N43B 3ZKSD 1KB5A 3QJVB 4XCCH 1MCWW 5E00A 3T4AC 4GP5B 1N67A 3ZT5A 5HDRA 3FFCD 4KJWD 2R1XA 4XWOD 4XT1C 4D2NA 4NPJA 1YDPB 1KDJA 1MELA 1OAJA 2XWJA 3SKOB 5HHQA 3TBBA 4E9SA 2BVOA 1NWPA 1RIUL 2F54B 1HXYB 1UZ6F 5DJAB 3GSWB 3LKRA 3SKMA 3T1WA 1FDLH 1CU4H 1EXUB 3CFNA 4LLQA 4K7PL 4LGRB 4RNRB 5HVWA 2J88L 4LOEA 4OF6A 5KAQF 5J9PA 3RTQD 2ARWA 2E7BA 2ZUSA 4XVTH 5FYJU 4KXZH 4JRYA 3ZZ1A 4POZD 3N6YA 4W9JC 4ZMVA 2P44B 1PJWA 5K1VA 3ULUF 5F7BA 4DGYH 4YBHA 1CICA 3KGTA 4F33B 5E7BA 2Q6WB 1VGKA 5BVJA 3PGCA 4ZPTA 1H8SA 2DWEA 3LHAA 3HVDA 2EILB 1T4KA 3E7JA 4XWGL 1U8QB 4ZMZA 3BUTA 2V5MA 3MMEB 3ZL1A 2VZ1A 5C0RH 4NHCL 2OZ4A 2IPUG 3IU3A 1OGAA 5GS0L 2VRKA 3PQYB 5H4YA 1U8MA 5ALBL 3WUWG 3OZLA 2WWNA 2CBQA 3VXUD 4PGJA 4KKCD 5K69A 4UILH 3GLEA 1J8HA 1F3JB 2A9CA 5EWIH 3WFBL 1QR1B 5KJRL 1J5IA 5GS1C 2AEWA 5ACMA 4DPAX 2Z7YA 1JF1B 3MROA 3HUJB 4QDGA 1E9PA 4LVEA 5FR3A 5I16B 2X1OA 5BMFL 4C8XA 1KCUH 5D1ZI 1BFOB 3W39B 3VGBA 4R4FH 4GQ9L 3D08A 2R29H 3GMQB 3LIUA 1CXHA 5DMKB 3PGDB 4XAWL 4EN3D 2C9UA 2YD2A 3NFPB 4PFEA 2JIXD 2BOCB 3MRGA 4MNQA 3KDMA 5J11C 2QVFB 2Z93A 1P2CB 5CS7A 1DVFA 4Y2DD 3BZFA 2ATKA 4DP6X 1AFVH 3FUFA 1ET7A 1FH2A 4N0CC 4TULH 3RNKB 3NAAH 1UOWA 1A9EB 1H3XA 2I7OA 3FO1B 4NKQB 5DC2A 4LCUA 4M9PA 2A73A 4EVNA 2D31B 4NRZB 1A7OL 1KBKA 3DIDA 1FNGA 3MRPB 4YXHL 2QR0B 4DKFH 4TQEL 1IX2A 1EANA 5HHPB 3UACA 3NQIA 4XMWA 4I77L 1SM3L 4K5PA 5E56A 3LN4A 4UT9L 3BDXA 3QIBA 1YC8A 3PL6B 4PJ8B 4DZ8A 4XOBA 1NJ9B 1W9XA 3GF8A 3OJMB 5D6DA 4K3GA 4XCYA 4AQ1A 3CDGA 4KKBD 1IC5L 1JPTH 4NO5A 4FXLA 1ZANH 4O2CA 3TBWB 4PLNC 4AY0A 2YAHA 1ED3A 3AC0A 4K07A 4IQHA 1ZDSA 4BA0A 1Q9KA 43CAA 5F9WC 3L17A 3ZIMA 1L4IA 3KD4A 2VLLA 4XPHL 4HG4K 1U8HA 1DL7H 1YN7A 5I5MA 1N5YL 3DIFB 2OYPA 2ILLA 3POCA 5DVMA 2EIMB 2HPOA 1RHFA 3FF8A 1C7SA 3Q1EA 4AQ8C 1IC0A 2R7EA 3QUML 3SKJH 1EZSA 4C83B 2V3EA 2EIDA 1FV1A 2GTWA 5FB8B 2VXUL 1CDGA 4G6AC 1H5BA 2YAEA 1T0OA 2ED7A 2F2HA 4NPYB 2BNQD 4YK4B 1HHHB 3O4OC 1GSKA 4OI9A 3PJSA 3U83A 3H1ZA 4MDRA 5F1KC 5BV7C 1BXAA 1GXEA 2HUEA 4RDQF 5DJYB 4PW3A 3GO1H 3KPPA 3QXDA 4Y88A 2BHYA 1H8LA 4Z3GA 1GZHC 4L29A 2QGDA 4DZBB 3LQZA 3VFOB 3PHOA 1ORQB 2XXMB 2OMYB 2F58L 2P8MA 3LIZL 1O9VA 1JAEA 4U1MB 4PGEB 1BF8A 1E2ZA 2YD5A 2EYTA 3S96B 3CXFA 1NGZB 4X9FA 4KI5F 2F74B 3U0WH 2VDOL 2YQGA 3RWJA 4DP4X 3IFLH 2HN7A 4Z76B 1MWAA 4Y1TA 5C6TL 1DUZB 5E8OB 5DQ9A 3LS5H 3EOAB 3TL5A 4PJCA 3GXFA 2JKIS 1SRDA 3MV11 3PY9A 2FWOA 1IM9A 3CH1A 1DE4B 4PS4L 5DRNA 3DC0A 2D03L 3MXWL 3EGXA 3GZPA 3NRQA 4F57H 5DRXA 2UZXB 2OCJA 4XPFH 4OLEA 2YJQA 3RVWC 4C56D 4DVBB 4MKTA 3I84A 2XN9E 3INOA 4I18A 5KVGH 1MI5A 2CXGA 4PY8J 4S1SL 5K39A 2WLYA 2VUOA 5IQ7H 1A14H 5CSBA 4MS8D 4N24A 5KS9E 4FFYH 2J71A 1HIML 3GZOA 3ZHLA 2CWRA 1IGTA 3NIGF 3ZDYB 3ZE2B 5CF3A 4D0CB 4OKVA 2E7HA 1KYDA 5GGRB 3CC5A 1WG3A 3BQUA 4NZUL 3FT2A 4HIJA 4JY5L 3AUVA 3DGDA 1R3IL 2CHDA 3KGUA 2YXMA 3CHPA 1KFGA 1WT5C 4AEFA 4KK6D 5IEKB 1QBAA 1DEDA 3BN9C 3EOBA 5DRZB 4AIXA 2OR8A 1L9PA 3KPRA 3ULVH 4KAQL 5ITFA 1PG7H 1YQVH 5IIEB 3X13B 1XIWB 5DURD 1A6UH 2PXYD 4HV8B 3FAWA 1ZLUK 2APTA 2Z31A 3ZW3A 3EO0A 4FNLL 5F44A 2FK9A 2BW4A 3PS6A 5IUSA 3RPIB 5F0LB 4J8RB 1HOCA 1UJ3C 2EC9T 2OSYA 1YECH 3Q8CA 2BSCA 4M1DL 4YSAA 2Z4QB 4MQSB 1D6EB 1S7UA 4OF5A 1FE8H 3R8BB 1R3HB 2B77A 2EVGA 1E4XI 2VN4A 2QPEB 2GHZA 1CQKA 2I85A 2WOYA 5ANME 2HJFA 2BFVL 3VXRD 1UADC 4DFHA 3CSYB 1Z66A 4HOWA 2AK1L 4R4ND 4YOKA 3RDTA 3MUGA 1K3ZA 2NSMA 4EI6B 3IDUA 4A68A 2F53E 4HMDA 2KH2B 1KC5L 1GZPB 4H0HB 1A4JB 3X11A 3LNFA 5DJ8B 3BD4A 3I6GA 1HKFA 4WU7A 1TR7A 4GG8A 4QR7A 1LK2B 4NKDA 3VFTB 3FO2B 2QADD 4H25B 4LLMA 1T2JA 1A9BB 1MEXL 1RUML 1KCVH 2CKBA 1E0OB 2JB6B 4G1EA 1SDDA 2DMHA 3J2PA 5B1CA 1VHPA 4HHWA 3UJJH 3EGDB 4X7SH 1I1AB 1MRFL 2OL3B 4N0YL 1KGYE 4LL4A 3W57A 4ACPA 4ELKB 3L2NA 4X5WB 3RI5F 2APVA 3NACL 2CO6A 1PY9A 4D0DA 3N44B 5ANHA 3RVUD 2RFXA 4I3GA 4O02L 3KAAA 2DICA 3LRHA 4LLUA 3E3QC 3WEMA 1AGFA 2FRGP 4WF7A 3SY0B 1DJWA 2G0KA 4G7VH 5FUZL 2VN5A 1X5AA 4JJ5B 1NMAH 5I8CB 2D7OA 2NCEA 3B9KB 2IAND 2ARJA 1KGUA 3SDDC 4EO5A 3RWIA 3QDGE 3N41F 1N7MH 5CSZB 5DQDL 3T5WA 4EXPX 4YFLF 2QVTA 5C70A 2UXFA 3A23A 3KLLA 3C2AL 2AGJH 4XXCA 3VGAB 4PQXA 3NCJL 3E6FA 4JG0H 2I9LA 3D06A 1P7QB 3L95B 4WI6A 2FD6H 5ENWB 5D4IA 5IMMA 2PW2B 1LWRA 5JDSB 2K4AA 4GQQA 4U1IB 4ZMXA 1URLA 2NZ9C 5HDBE 1PZAA 1U8JB 5SX4I 1T7YA 1WK0A 3OC5A 3BQVA 1Q90A 3GIVA 3PWVB 4HHAB 4APQC 1UB5A 3ARGC 4YHKH 2SODB 1S9WB 3WFEL 1EJOH 3NVQA 3FU9A 4L37A 4PJDE 3V7AG 4X99B 3D6GA 4OT1L 3CUPA 5L6YH 1HQ4B 2NZ1A 1B6DA 1AG6A 5LBVA 4LRNH 4XCNB 5JR1H 1DJYA 4BCZA 1FAIH 2I69A 3CZLA 3CU7A 3H0TA 5IW1A 5TQ2L 1UYWH 4RLDA 5F93C 2FH8A 1AQKL 1UT2A 4A37A 4J3OF 3T0AA 5CIPA 4P04A 4L2LA 2LU5A 3OKNA 3QJHA 4X6DB 4XN7A 4LASH 5LXVA 4HAKA 5G2NA 5JPMB 5GGSB 1ZRUA 1CLVA 3ZDZB 5TF1L 3HBQA 1OE3A 2GIXA 3VYNA 2X1XR 5E6ZA 3IDYC 1MDAA 2LTQC 2AABL 4HJGB 1MRCL 3DJZA 4F7TA 1NLBL 3B3IB 2IIJA 3N85H 2BVPB 5IFAL 3FPXA 4KQ0A 4S1DD 5F1IB 2VW7A 5DVNA 5LGJA 2ZONA 4LE8A 5L4FA 1OP3K 5JIQA 5GJTH 3K8LA 2WNXA 3VWJA 1ZSHA 4RGNE 5EO0A 4QY8B 1SQMA 1BBJA 3H85A 4UT7H 4RFNC 1KV7A 4TUKH 3MZTA 3FOLA 1TYEB 3ARBB 2XXCB 1S3KL 5CCHE 5I66A 4GSDH 3AWGA 1QLFB 3OB0H 2HJKB 2OCCB 4AYDC 3Q48A 4MD5B 3QORD 2FZ3B 4DP5X 1S8DA 1QZ1A 2CBPA 5KZCD 1DANT 3T0ED 4GUPB 2NW3B 2KDGA 4G9DA 4AIEA 3K8MA 3WFHA 4XO5A 4BCYA 5IMKA 3BDYH 4JFVA 2EC8A 5DT1L 5I75B 4OFKA 4PRIA 1OM3H 4QRSB 4X9BA 3LEYL 5A3IC 1TQUA 1F5WA 4KO5A 3OAUL 3MRLB 1UCBH 4LSSH 4L3FA 4J3UA 1IIKA 2FH6A 3FHQA 1XCXA 5ALBH 3U46B 1FF5A 1JHTA 3HE6D 4M43H 4AENA 5I0WA 4DEPB 4X9IA 2X6CA 5IM7B 5IFHL 4QTIL 1M2VA 2GUOA 3HN8A 2ZG2A 5EA0L 1ZHBA 1ZLEA 3VXMA 3GMRA 4PJ7B 3H6AA 4KUCD 1PEZA 4NAMA 1J1OH 1RK1B 1FFQA 1R34A 4LDEB 4OLWL 1ZPLA 2EEFA 3MLTA 5D2LF 4W6WB 1CQYA 5IGXH 5KVFH 1KIQA 1JFHA 1JN6A 3D39E 2IPUK 4JPWL 5HJ3B 2VRQA 1ZT1A 3MRHA 1S7TB 1B9KA 4L3CA 1FFRA 4XAWH 3RUGB 4A2HA 2HRPL 3WIIH 2BP8B 4YDNA 5I76A 3HKZA 3Q2LA 4CL7A 1TTUA 3VM7A 1JHKL 1Z5LA 4L8DA 1XR9A 2R69A 3S2CA 1U3HA 5IJBC 1TFPA 1U8IB 3TPUA 3FS9A 4JLRB 4GAYB 4J39A 1KLGA 3LKQA 3V52L 4I88A 1TZOA 3X1FA 4IS6B 5DHEA 4ZYKB 3U79A 5E2JA 4U1SB 2B16A 3OJVC 2QKIC 2NX5A 1DFBL 3NJHA 3MJ6A 4DVRL 1L9NA 1J9TA 3RILA 1MPAH 5EU4A 5KYXA 1F4YL 2F7PA 2H0JA 4Y19E 2AJYH 3OWEA 5EOTB 4TTDC 2PTUA 3AG2B 3RZCA 1AXTH 2GJRA 4U1LB 5E03A 4QRRD 4WGKA 2GHWB 5C0JA 2K9UA 3AW5A 1HH6B 1EHAA 1U4EA 3EOTL 4HZLA 4XPHH 1LMIA 4BK5A 1L9QA 4HUXA 1KB9K 2VM4A 4K3JL 2AQRA 3WGVB 3K4AA 3RWDA 4A63A 4L05A 4FEMA 2VERA 3MUZ1 1FZJA 2ORBH 1GZQA 2NR6C 2ZX8A 2GBVA 3KPSD 2BSSA 4KH9A 4XRCB 2YKLL 3SOBL 1QEXA 2LGNA 5C07D 5IG7A 2BH0A 5BRZE 3OBAA 3K2KA 5HY9A 1CVSC 1FL5A 2IDUA 3V0VA 1IBYA 3UGEA 3ME0A 2EO7A 2R0KH 2WXRA 5A7BA 3NGBC 4Z7UA 1TQCB 1FVCB 4LPVA 5D1QE 4OIFA 3QH3B 4PRAA 5DMGD 3RWEB 3TZVD 4IBQA 5KVDH 4RRPM 3BI9X 2VH5H 3GSOB 5F7DB 2FUQA 1HSBA 3C12A 3P2TA 5G5DB 4DP2X 3VFUA 4JW3A 4F7EB 4ODXA 2LLNA 1JI2A 4YXKL 2WCPA 1D5XA 3PXLA 3ECQA 3VI3F 4G8IB 1PG7X 4HKJA 5INDA 2DKUA 4F8PA 1YEFL 4JM4L 4R0LC 1EXHA 1KIPB 2VDPB 1VPOH 2PTTA 5GS3A 1MLBA 4JO3L 2W1NA 2VDOH 4IGBA 2DIEA 3P9MA 3QO1B 2G60L 4WO4C 3PP3K 1W2KT 1S7VB 3ILPB 3S36X 1LE5B 1KB5B 1GYWA 1ITCA 5C3TA 5IQMA 1YAZA 3APDA 1MW3A 2W94A 4DUXA 5DYOA 3UTSD 4D7BA 2XWJB 1JGDA 2EYSA 2D03H 4NP4H 2EEAA 3B83A 1ACYL 5ACZB 5JIDA 3LKRB 3SKMB 2PWGA 3CX2A 4FOMA 1QPKA 3CNKA 4OF0A 3RIKA 4GRLC 4ABQA 3A4FA 3QDMD 4JG1L 1J0IA 3IE4A 5DK2A 4S1SH 4QAMB 5J9PB 2QGBA 4WTQA 3JQOB 4H20H 4XP9L 4JRYB 1CD1A 3K6FA 2GY7B 3TN0D 5J1AA 1CICB 5SX5H 3UCRA 3MC0A 4ZUVA 1WF5A 1P5UC 5DUML 3UBXA 5I82A 3UAJA 5BVJB 3PABA 3QRGH 3PGCB 5ISZD 1DZBA 3N42F 5BZXA 4F15B 4NZUH 2DWEB 1T4KB 1IC4H 1XF3A 1FA4A 4J4PA 1HZLA 1R3IH 1J1XL 2X4TA 5HHOA 3WHE1 4JHWL 3NPSB 3IU3B 1OGAB 4LSQL 3GQFA 5DFAA 1U8MB 4IRJC 5B7FA 3IN0A 4IBTA 5JHBA 2UVFA 4OJCA 2WN3A 4G9FD 5I19L 3HC4H 4LHJB 3UYOD 5F6HI 1MG2C 3OGCB 4QRRB 4RVBA 4WJG3 3X12A 4EF3A 2BOBA 1NC2A 5IFJA 4DW2L 2FEEI 4EZKA 1JG9A 3ESOA 3HI6L 4AGNA 5D70H 3MROB 1E9PB 3BKYL 4NKMA 1E67A 2O5ZL 1QRNA 3QEUA 4X8CA 3L3JA 3R0NA 5IKCA 4GW5A 3WTSA 4P46D 3BPOC 2ZXGA 4JN1H 4XNZC 4HIHA 4CA4A 3Q2CA 2J56A 2BVTA 4MNQB 3KDMB 3M46A 1BFTA 2Z93B 4NEHB 4BQBA 3D3VE 1KC5H 1DVFB 4UQCA 3TASA 3BZFB 2ATKB 2B2XL 4NWTL 2VO5A 1DBBL 1GTNA 4D7PA 5DMYA 3WLWC 2NQCA 4BELD 3SE3C 1NFDE 1TZIA 1QVOB 1WIOA 1JZ7A 2A73B 1BQKA 4EVNB 1HT6A 2VLJD 1TEYA 4FFVD 1T22A 1C16A 1FNGB 5KSVA 1RK7A 2GSIA 4X80L 4NCC1 4PHXA 4XNYL 1M57B 1T03L 1MRFH 1J0KA 1CF8H 1JYNA 2K6WA 3QIBB 5SWQB 3A22A 4LOVA 4WFFE 4DZ8B 3EYSH 2XPGB 2EJ1A 4L4VD 1KFAH 4I3SH 4R8WL 4XCYB 4AQ1B 5DU7A 4Z7NB 3CDGB 4O02H 4NO5B 4GY4A 5CEZH 4UI2A 4O2CB 4GQZA 1MCHA 1G6RH 3G3LA 2NZIA 1ED3B 3RGVA 1Q9KB 2Z34A 3BCDA 2APBA 43CAB 4R97C 2VLLB 1DVYA 2C34A 1U8HB 1B0RA 5JQ6H 5KAQG 5L2JA 5HHMD 3ZQXA 4K3EH 4LLAA 4I2XA 5DD0L 2N01B 1TQSA 3CLEL 5MP6L 2R7EB 5CLZA 2X88A 5JOEA 1KJ2A 3L3IA 4MFHA 4FYRA 3QUZB 2IJ0C 4HWZA 1FV1B 2GTWB 3LZRA 1UD8A 3HEIB 4WGWB 3PDDA 1F1AA 4HJ0D 2OTUB 4K7PX 4A7QA 4L9LC 2CGRH 3T71A 1ETA1 2OMXA 4PVNA 5MENA 2R56L 3PJSB 4P9MH 4W9GC 1V54B 1IFRA 4M62H 1UT9A 4BBWA 2P8LA 4L29B 5ISZB 2HVKA 4D9LL 3PHOB 3ETBF 4OIBA 2P8MB 5ABAA 1J8HE 1UD4A 4C55A 4LSTH 1BGXL 3GK8L 3EDFA 4P99A 4OW6A 2E7LC 3SHSA 3V10A 2XWEA 2JCCB 2FX9H 1G9MC 4QAWA 3NH7L 5LGHL 2EYTB 1KGXA 1SXAA 5JHDD 2X38A 4G9FB 2CM5A 5JW5A 4LFHG 3RWJB 1AQKH 1OSPL 3LQMA 4MMYA 1HZHL 3KYOB 3ALXA 2CUIA 3RQ3A 3P54A 1ZWIA 1UXMA 2PCXA 5ID0B 3B43A 4PJCB 1HHIB 3AUWB 2AFNA 3ETSA 1IM9B 2VDLL 3CZFA 3TA4D 1MFCL 5JA8B 4Y5YC 5DRNB 3EGXB 5IV2A 5DRXB 1AVAA 4W9IC 3CTTA 1QWUA 4AW7A 3K71A 2ZQKA 1NLBH 1TQTA 2NNAA 2CK0H 3RTQA 1LO0H 3NK4A 4OFYD 4P49A 1MI5B 4HJTA 1OIOA 4PJIA 5E2TH 3T3ME 1A47A 1A1NA 1LHZA 5A2LH 1CS6A 2HKHL 3ORJA 1CDCA 4FZ8H 4OUOA 3UZVB 3F65A 1PAMA 4YDKH 3GBDA 4TQ8A 3U1SH 3MLPA 4M61A 3SGJA 1AHKA 5IVXF 4OKVB 1J0ZA 3ZO0A 4U0QB 5CCKL 1XH2A 4YE4H 1BQHA 5EORH 4HS8H 4JN2A 2YOAA 1WQVT 3CC5B 2P9RA 4KNSA 3BQUB 3DSFH 4HIJB 5DTFA 2CBMA 1PNCA 4NUJA 5FW6A 3ZR6A 4HUVA 2WMPA 3VXUA 3JZYA 3HI5H 4JFHE 2X6BA 3LQAC 1XGUA 4APXA 4CJ1A 5JPNA 4OCYL 5C2BL 3EOBB 5AB2A 1UJTA 4JFDD 2W0PA 2KL6A 4Z95H 2AJVL 3KPRB 2NY3B 1KJ3L 1EAJA 1AR1C 2V7NB 3V5HA 3DK2A 5DZOA 3DOHA 1U21A 5B22A 3EO0B 5HXMA 4ALAC 2JH2A 5F96H 3ZKNC 4PJHF 4DN4L 1SXCA 3LNGA 1S7UB 4MAZA 4H8QA 2ENQA 1H3PL 2L8AA 1WP6A 3MO1A 5B7EA 2XUWA 4S2SA 1UZ6E 3L7EA 3NQKA 4M3JA 2HJFB 1OTUD 3GS4A 4RDQG 5IROC 1UKTA 4KJQD 4L4JA 5TDPA 1UXSB 3RDTB 3QUKA 1A0QH 5JHLL 2OI9C 5AFAA 3RNQA 4FHJA 1E42A 1FLRL 2EIZB 3P0VH 4D0BA 4A38A 1KIRB 2ED6A 1FC2D 1AKJB 3H9YA 1MFBH 3ULUE 1VFAB 1XCQA 3X11B 4GMSH 3DX0A 5MEPA 4BV1A 3I6GB 5IWLA 4WU7B 3U2IA 2HRPH