The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
YVLTQPPSVSVAPGQTASITCSGDKLGDKYVSWYQQRPGQSPVLVLYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSALVFGGGTKLTVL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound to the broadly neutralizing antibody HC26AM
rcsb |
| molecule tags |
Immune system
|
| source organism |
Homo sapiens
|
| molecule keywords |
Antibody HC26AM light chain variable domain
|
| total genus |
23
|
| structure length |
105
|
| sequence length |
105
|
| ec nomenclature | |
| pdb deposition date | 2015-03-26 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
