4Z0XA

Structure of hepatitis c virus envelope glycoprotein e2 antigenic region 434-446 bound to the broadly neutralizing antibody hc26am
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
105
structure length
105
Chain Sequence
YVLTQPPSVSVAPGQTASITCSGDKLGDKYVSWYQQRPGQSPVLVLYQDSKRPSGIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSALVFGGGTKLTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody HC26AM light chain variable domain
publication title Structure of Hepatitis C Virus Envelope glycoprotein E2 antigenic region 434-446 bound to the broadly neutralizing antibody HC26AM
rcsb
source organism Homo sapiens
total genus 23
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2015-03-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4z0xA00
4V1DA 5GGTL 1XIWB 3QIWB 5LWYL 2VDNH 5GGQL 2BOBB 2ZP0T 5J9PA 2X4PB 3CVHL 4JY6A 4OZHE 1KIRB 1AJ7H 1FIGH 4LCWA 3SPVB 2HKHH 2EIZA 4KKAD 2MCPH 3WFCL 1T1YA 2HT4D 5HYJA 1GGCL 3P9LA 4YHLH 2YA1A 5T1KD 1XGPB 3PQYA 3HE7D 2BCKA 5D1QD 5J12B 2PW2A 4OLVH 3G6JF 4WI2A 1OAQL 1T0MB 3N1QC 4XRCA 4RMQA 3T3PF 3NZHH 2IH1B 3GSWA 3MUGA 4GW5B 1RZGA 3V0AC 1I1AB 1ZT1A 2CDFA 4G42B 3MOAH 2QADD 3ZE0F 3MRCA 2R0LH 1X3DA 3I02B 4XAWH 3GHEL 4POZC 4NQDE 3CZJA 3HN3A 2EDJA 1NJ9B 3QEUA 3QNZA 2VE6A 3U36A 1TVDA 5D7LE 3A6BL 5HVHC 4OTXH 2DI9A 3IETB 4FOMA 4KKNA 4XHJD 4YUEH 4P4KA 2PO6A 5ACZB 3EO9H 2BDNL 3OXSA 2J8UF 4RAVA 5BS0E 2VZUA 3KPNA 3P4LA 5C0IB 2V9RA 1EEYB 2WSKA 4YH6A 4U2YA 4YDVB 3L5WA 4I9WE 3RJQB 9CGTA 5CZVH 3K1DA 3C8KB 1CXFA 1ZE3C 2J6EH 2WM0A 3BGMA 1HQRA 1AXSB 5I19L 4HS6A 4EI6A 1CDIA 2ATPA 3UPCA 3JV5A 4HIEA 1UGNA 4PTUA 3WFBH 1QO3B 5SWSB 5FYKU 3VGAB 3Q1SL 1NCBL 2ZG3A 2FO4B 5KVFL 4P2RE 5SX5H 2ATKB 2NNAA 1TITA 1MCJA 3ABZA 2VABA 3LKPA 5D1XC 3FB8B 5EO9B 3BPCA 3ROLB 2CDGA 4FMFA 3DBXA 4PJAE 1TVBB 4NT6B 4FQ2L 1I7UB 3MJ9A 4FQXA 2NZ9D 4ZD3L 2NQCA 3IDUA 1DBBH 4XMKL 3MA9H 5D1ZC 3VWJA 2XNAB 1EK3A 4U6YA 1O7VA 4TULL 3VXSE 3P2TA 4L8BA 5B3JF 1FLRL 3QIWD 2CKNA 4X4ZA 1KB9K 2AS5M 4RFEB 2DJUA 2V5YA 1MFBH 3TN0C 4FFVC 3S3JA 1ZMYA 5D8JL 1BFOB 1JPST 3KYKL 4MWFB 4PRNB 5DJ8A 1T83C 1L0YA 1J87A 3G5ZB 4OAWA 1KTDA 2XWJB 5HGAB 3EDJA 1U3ZA 4DFHA 4JO2H 1X4XA 5C92A 5DJ0B 1UWGL 4DOHB 5BMFH 4NKQB 3FQUB 2DBLL 1I1AD 1EGJH 2K3TA 4BQBA 2EDLA 4EQ2A 3KPOA 4JAMB 1QHOA 3RL1A 3KPPA 5KANI 5FYJU 4OI9A 1TZGH 3CFBB 2H32B 1LHZA 4U1LB 5TDOB 5ICZA 1S7RA 1F3RB 1MJUL 4BQ8A 1Q94A 4U7MA 5MP6L 2C1OB 3LHPL 4O9HH 5SWQA 2PTTA 4ODTL 1IAOB 3VFOA 2ITCB 3QUZB 2CDEA 4UILH 1K6QL 5LG1A 2D4FA 4F7EA 2R8SH 3OBAA 1U3JA 3MGAA 2ZPKH 2F15A 3WSQL 5IEHA 4XPGH 3O11A 5JHDB 5GRXG 2XQBL 4MNGE 3PWVB 5FDWA 4FP8H 2HKFL 5CP3H 4PJXF 1DBJH 4R96B 3VW3H 2X6MA 3NFSH 4M4RA 2R23B 1U8OA 4JHZA 1QBML 1TLKA 2YN3A 3MFGB 3LKQA 4DCQB 5L9DL 3RKPA 4HS8L 1QNZL 1MQKH 5ERWB 4K94L 4ZFOB 2X89A 5J7CC 4MAYB 1CXLA 4DEPB 4L8DA 3IGAB 4JY5L 2DWDB 1KB9J 4S1QH 1EFQA 4S10A 4FZ8L 4S1DD 3OPZH 2Q3AA 3LIZL 3W9EB 4S1RL 1JK8A 1I9RH 4NKIL 4XNXL 4P5MA 3B3IA 4JRYB 4WIQA 4WUKL 5CMAB 3C08L 3UTSE 3OMZA 4K9EH 4XP5L 2GY7B 4MJIE 5IMOB 3ETBF 1MPAH 3UX9B 2X4OA 4X4YA 3QZWG 1SYVB 1OOAA 4LDEB 4J3VA 2AJUH 5B4MC 3DI2B 5FKAA 1I75A 5IWLC 4KI5C 3BH9A 3NTCL 2VC2H 3CH1B 4U6XA 1LE9B 4MYWB 3GK8L 5HDOA 3FCTA 4OJFL 4MQ7A 4QF1A 1A7QL 3CK0L 4YDJA 3LSOA 2OSLB 3RUGB 5C0FA 1Q9LA 5IHBA 4K71C 4EI5B 2DQGL 3FFCB 5F3BB 3MJ8B 1FHGA 3KHQA 3GSUB 1T0PB 1VESA 4O5LH 1WCBB 4H5SB 1B0GB 3MV7D 5D1XA 4N0CD 2WIIA 1GZPB 4UBDD 1NL0H 1OLZA 4ELME 5FECA 5MEOB 3QEQE 4N8PA 2R4SH 1VFBA 3GKWL 3ULVC 3ULSB 2AKRA 4AZ8A 4JRXE 4X6EB 4L5FL 1VA9A 2CQVA 2X7LB 4GS7B 2EH7H 5IVZA 4H26B 2BZDA 3IXTA 3IAPA 3QUZD 4FMKA 4YQXL 3ILPB 3CFJA 1JPSH 1M71B 4CKVX 4LEOB 3P4NA 1FO0H 5FUCE 1K4CA 4UINH 3H7LA 1JV5B 4DW2L 5TE7L 1KXQE 2VKWA 2DTML 4JLRA 2NY5L 2OQJA 4KAQH 5BW7C 3TWCH 2GIYA 3O6KH 4RBPK 3EGSB 5I8OH 1MCEA 3SN6N 1MOEA 1AQDA 5AUMB 5MERA 3GSNA 1QYGL 2QKIA 3KYMB 4Z95L 4MAYD 3QPQC 3MRMB 4RA0C 5F71A 3HI1B 5JPNA 4OQ1A 4JR9H 1Q72L 4ERSL 4OUOA 1N0LA 4N1CA 1G9MH 2DJ4A 3HC3H 1IC5L 4FFYH 4ZO9A 4OGZA 2VAAA 2F54A 4JRYD 3O3DB 3HC0A 1LP9F 3UTOA 4HAGA 2GJZB 4RWYL 4U49A 2IQ9L 3O6LH 1BQHB 3QXTA 2P49B 1GSMA 3MLRL 4I8DA 4GKZA 4RISL 4JB9L 1Q9KB 4NGHL 4M02A 4OZFG 3BZFA 4Q9QH 1WAAA 3TIDB 3RWFB 5AG9A 2W1NA 5CJQL 3RTQB 1M7DB 1MFEL 3UYRL 3HMXH 3MRPA 5DD3L 3U4BL 5J1SC 4EI5D 5HYEA 3FFCD 2WAHA 3G6AB 2XTJB 4DZBB 1ZSDB 2GEEA 1YPZB 3CZFB 3VGEA 1CK0H 1I8IA 4LK4A 4HQQL 5CEYA 5FK9A 3MRHB 1FDLL 4Y5XC 1CXEA 4JJ5B 1T7ZA 3D85B 1IC7L 2APXA 5DD0H 4HKBA 4PJCB 4R7NA 3VGHA 4WU5B 5E6ZA 4NFBA 3U7WL 2CKBA 5HD8D 4LOUD 3UJJL 4HV8A 4H8WL 4LLVB 2UWEA 1U6AH 1VFUA 1X5ZA 5AZEL 3FO1A 4ZTPL 1G7LA 4WTWA 1HN1A 2EXWD 4XNZC 2GITB 3G6DH 5JA9A 1UZ8B 5T1LB 2Y7QA 4XMLL 2P8MB 3VDBA 2DWEA 2EDWA 1NUNB 2AJZB 3H9SE 3VFSB 4X8XA 4XZUA 3RI5K 3V4UH 4C4KO 2ID5A 1AE6H 3BDXA 4WTZA 2JJTC 3AS1A 5IWLA 3LS4L 3PWUB 2CLVA 3ESUF 3BP4A 2NYYD 2XPGA 1JP5A 5HHNB 4OLEA 3LPGA 2MWCA 4HCRL 3T08A 4PJ5E 3UXFA 2NLJA 4LLYB 4FQJH 3MJ7A 1CF8H 2PYEA 3L5XH 4ODUA 2EEAA 2DQCL 3S36L 2ZG2A 3NGBC 2R1YB 4JG0L 1AI1H 4C83A 3L3GA 2XFXA 4PLJD 1FCGA 1VDGA 2ADFL 1BOYA 4ZQKA 5H94A 4X6DA 1AP2B 5I66B 5I17B 1EIBA 1T20A 4EN3C 2VISA 4NKOB 3SGEI 5DEGB 5DUMH 1UA6L 4PUBH 5FO7A 4IRSC 3T1WA 1G0XA 4NNPL 2KDGA 5BV7B 5J56B 2GCYA 4NQSA 1ZWIA 1OP3K 1ZA3A 4CADA 2MQCA 3NCJH 2VWEC 3KDMA 1X9QA 2F58L 2WWKO 1WCQA 4IIQB 4XVJH 4Q58C 4X0KB 4Z7QF 5EN2A 1A7OL 1VGKA 3W5NA 2R2EB 1RUAL 2WK2A 3VFGH 1NLBH 3GI9H 3BVNA 4JN2B 3QR2A 1ADQA 3MLSL 4G43A 1BD2A 5F6IB 3L3HA 5LXGH 5BW7A 1QEWA 1WFNA 3BH8A 1HIML 1K2DB 2PF6A 2F5BL 4LKCB 4LQ1A 2G5BA 3HLAB 5HY9B 4PJDE 4YIQB 4ODHL 2XTJD 4RIRA 1MH5A 3SKNB 1TJGL 1EUTA 4G8GB 2BRRL 3BO8A 5J3HD 2G75B 3FB5B 1NH6A 5CJOH 2VSCA 3GMQB 3GSXA 1CLZL 4HF5H 5DJZA 3CFEA 1CGWA 3FONA 3OJDB 2GJ6E 1J1PH 3BKJL 4JFQA 4TTGA 1INQA 4Y5YA 4N0UA 5JOPE 1TXKA 3P73B 1CDUA 4NM8L 1U2HA 1T4KB 4FXKB 1Q9WB 2CO6B 1NGQH 4PLNC 2R2BA 1A6UL 5T1LD 2XACC 4HJ0D 4PGDA 1ZHKA 3QO0B 4R97B 2ZUVA 2ZKHL 2BHYA 1GAFL 1IEAA 1MCFA 1H3VA 4Z7VF 4KJPD 2CLZB 5C0EA 5IB3A 1OY3B 1EFXB 4MXWL 4UIMB 3QPXL 4TVPE 4DWHA 2Q6WB 1A2YA 3PWJB 3QEHA 3TA3C 3ECBA 4U1JA 4KJWC 1FNAA 4M7LL 4MA7H 4PJ7F 2AV7B 5FV1L 5C0RL 1KIQA 2O5YH 4Y5XA 2B7DT 1KLUA 3P0VH 3MLWH 4JHBA 1OW0C 3A67H 2ENSA 4Z8FH 5C09A 1YMHB 3U0WL 4U0QB 3MV8A 4ONHB 3U0TB 3VXNB 5LQBH 2PYFB 1RMFH 1YQVL 5F1IA 5L8KB 3UMTA 3SDDB 2W59A 4PJHF 2J8OA 3QQ3A 5DMIH 5TF0A 1IGYA 5EUOA 4CBPA 1FN4B 2HFTA 4HWBA 2NY2D 3O3BB 1V3KA 1SEBB 3D2UB 2E9JA 1U8LB 3OZ9H 4KXZH 1OQOA 1R3JA 4FNLL 3P4OA 4LVOC 5F7MC 2HFGH 4HIJB 2AQ3A 4I3GA 4NQVA 1ETZB 4GBXC 4LSSH 2YPKA 5BRZA 1DLFH 3LY6A 3WLWD 4EVNA 5D7IF 4UTAL 4JQIL 4U4BA 4TNWF 3P0GB 5CBAB 1PYWA 3KGRA 1IAIM 5IKCB 3C09B 3FQNB 4G8GD 4EDWH 4LLMA 3UJIL 4KMQA 2UV3A 1V3JA 1JN6A 2AJSH 2PXYC 5TGBB 3PL6B 3ZL4H 4NZJA 4EN3A 1DBAH 4HG4K 5TQ2H 5JPMA 2AJVH 2Y6SD 1DP0A 4XX1G 2N4IA 4PJ8B 3BWAA 1H5BA 1E4XL 2DM7A 2EDYA 3FQWB 5J1AA 4BFGA 5F89A 4PD4K 3S3PA 4EEEA 1FYHB 5C6TH 5KVDH 2VLJB 2AJ3A 3QUXA 1P2CB 4PFEA 4U1NA 2BNRE 3A6CH 5MEPB 5K9QG 1EFXD 2VDPH 3T0EC 5CKAA 1UWXK 3DUSA 1WBZA 4KV5F 3V4PL 1I7ZA 1Q1JH 4NQDB 5E2TL 3QDGA 4JHWL 3CJJA 3BZ4B 2FYYA 3MYZA 5E4EB 4ETQA 3QEGL 2FX9L 3DUUA 1RZJL 5C0CE 4KJYB 4QXTB 4MCYA 5DA0B 43CAB 4E41A 1YY8A 4KHXL 4P2OB 5BS0B 4K3DH 4LVNC 3HZMA 3MFFA 1SY6L 3NCCB 5FO8A 2VKXA 5KG9A 2EYRB 5B39B 1OVZA 1JTPA 5ISZE 4NN5C 3SDDD 4ZO6A 4MX7B 1LO2L 5DGRA 3QBTB 1RJLB 3HZKB 2XY2A 4G8FA 1MLBB 1JZ2A 2X42A 1U0QA 4WWKC 5HHME 3QWOB 1ZLVH 3DVFA 3GHBL 4QXUH 5EZOL 1JGLH 4XC3L 2DRUA 3TBSA 2HLAB 4YFLI 1N5AA 3TA3A 1QSED 1QG3A 2D9QB 3VMNA 4WI9A 3IJHA 3VH8B 4HC1H 1FC1A 5IR1B 2P45B 2I07B 3NA9H 5T3XE 1MVUB 2MQ0A 1HEZA 5EZJB 5DK2B 4KTYA 5EU4A 1JGUH 2FJHB 1ND0A 1U3HC 2DLIA 4MMZC 4WW1B 3CUPB 4Y4HC 1CQYA 1TTUA 4YDIH 4PJ8D 1S78D 4F15B 3V4VL 2M8XA 3P77B 3DWTA 4FQCL 4XPFL 5DEZA 4QT5B 3GBLA 3KPSA 1HQ4A 1QACA 2JCCA 5C0BE 2DQHL 3DVIA 2P7TB 1BZ7A 5DJ2B 5DRZB 2VLJD 4Z78A 1N0XL 4MD5A 4NO0B 2Y25A 2IPTL 2WBKA 4P9MH 2VDOH 4XB7A 3RNKA 4PLKD 4X7DC 2ADIA 4M1DL 3FRPA 2HAZA 1JHLL 4JKKA 1JWMA 1AH1A 3V6OA 1KG0B 2DDQL 1FVCA 1JVKA 3DXAA 4NQDD 5FM4A 4DFIA 2A9NH 2RHEA 4OGXL 4L29B 2A6JB 5BO1H 5D7LD 4KJQC 2GTWA 3QIUD 1BMGA 1HYSD 1JZ7A 2VDLH 3QQ4B 2NX5E 5D5MF 3N85L 4P2OD 5BS0D 5JOFA 2PXYA 1HE7A 1A6VH 1JWSB 3HI5L 4LLAA 2IGFH 5F9OH 1A64A 3C6SA 3ARUA 4I9WD 2HN7A 4PP1C 5ID1B 5F97E 1KJVA 3GZKA 1CTOA 5EU7C 4MNGB 3D5OF 1ED3A 1T22A 5JXEC 3RVUD 4HIHB 3AM8C 4PJEB 1OAUH 1S5IL 5IMLA 4FTVA 1S9XA 1RZKC 3IFOA 2A9MH 3GDBA 2LTQB 2WZPD 3RQ3A 2DM3A 1A0QL 2JJVA 4J6RH 5KW9L 1S7WB 2EO9A 1B4JH 4L4TA 2Q8AL 4HBCH 4D9LL 2QHRH 5IJVB 4DZ8A 5EZIL 4MDIA 4C4KT 2WUCH 3LD8B 3GM0A 1MJJA 4G9DA 2X1XR 1SVCP 4TQEL 3BZDA 2G2RA 3O2DL 1T03L 3ROOA 3UTSB 5FHAH 2H32H 1WICA 3L3OA 4U3HA 3VXSD 1Y0LB 3JTTA 4YR6A 2M2DA 1YNLH 1AD9A 1CFNA 4LPXA 3KPRB 1L7TL 5L7XH 4LLQB 2GY5A 3FMGH 3QIBB 4LSQH 4FZEH 2OTUB 3L5JA 2NY6C 1OD9A 3QJHA 3T04D 4MSWA 2QEJA 3C5JB 3OXRB 4WWKA 3JZ7A 3MUY1 4TUKH 5J06A 2FX7H 2WWKT 2ICEB 5GS1A 4BELD 3NOIA 3W9DA 1RUKH 3GGWA 3WKMH 4IRJC 1A7NH 3B5TA 5FYKL 5ID0A 5IVXE 4OCMC 4JFPA 3QEQB 5F9AC 3CPLA 4Y4KB 2A74B 3HI6L 1J0ZA 4JRXB 2YD8A 4GKNA 4UNTA 3PWPE 4ZFGL 2W0PA 4XC1L 3IS1X 2VAJA 4PG9A 4LSVH 1BEYL 1OGAE 5GS0C 4BUGA 2OK0L 5HI3D 1U3HA 4Y4HA 2PNDA 1HH6A 5DVNA 1EMTL 1U91B 1G7HA 1S7XA 4KZEL 5E2VL 2EDDA 3MRFA 3QFJB 5I1JH 5I1CL 3BP6A 3QJFA 3VXQB 4MA1B 5D9SB 3QHTC 4OLXL 1YEKH 4RMSA 3SHSA 4Y8AA 3ARDC 5FGCB 1EAPB 3FB7A 2FRGP 5F7HA 5C0JA 4GAJH 2X4NA 3EFFA 1AGDB 2O5ZL 3TVMC 3LH2H 5DR5H 5L88L 5IFAL 2EE2A 1RZ8B 3WXWL 1CT8B 4OCXH 1JNNH 1MRCL 4ZXBB 3V5DA 5BXFB 4DGIL 1E28B 2Q76B 3UTSD 4G9FB 3BEWA 3D0VA 4IMKA 1S7QB 4P23A 2JLLA 4GXUN 4D9QE 1X4YA 1J1XH 4KKLD 3QDJA 5HI5D 5KOVC 1TZIB 5GGRY 1DEDA 4J3UA 3M45A 4UDUA 1FZJB 1S7SB 1QRNB 4N1EA 5CBEB 3LZFH 1FSKC 4MVBD 1TQCC 4PJXA 3QIBD 4JCMA 2SEBA 3PGCB 5ECJE 4ODBD 1R24B 1FG2A 2BMKA 1KPVB 1NUFA 2WWMC 4AM0B 4UQ2B 1VFAA 4Z0BL 2P8LA 1FFPA 5IMKB 1T04A 4Z5RB 2VXSH 4XMPL 4ZAKC 5D7JC 4CN1A 3GBMH 2L7UA 3KWWA 1T1ZB 1URLA 1JL8A 2UVFA 1RVFL 1DN0B 4HUUA 1AHWA 4YHML 1LK3L 1J5OH 4Z7UF 1RZIB 1B2WH 3EYOA 3QEQD 4N8CH 5KSUB 4Y4KD 1RIVL 4BUHA 1ZKAA 1MELA 2PW1B 4XAKE 1W0VB 2CUIA 4JRXD 4LSDA 5BVPL 2A83A 2W9DH 3QUMB 3UZVB 1ZT4B 5I0ZA 1LO5A 3BKYL 2GQHA 2Q3ZA 4K8RL 1HILA 3X13A 4GKSB 1CDYA 1OTTD 2JK5B 4NPYB 4RGNE 4Z0XB 3H9SB 5DFVC 5H8DA 1XGQB 1GGUA 1U92A 3RP1A 4L3EE 4ZYKB 1FJ1B 2YUVA 4G3YL 1F58L 1JPGA 3VFUB 4AJ0A 1J7VR 1FYTE 5KSAD 3DGGB 3T0WA 2KH2B 3WS3A 4OLYH 5DJXB 3QFJD 3FOMB 4PRBA 3BPOB 3NPZB 4OM1L 1RUML 1MSPA 1IM3A 4XWGH 3ARPA 4X8JB 4E42A 4IRJA 4RCAA 4MNQA 2YPLE 3MBEB 4XPAH 2JELL 5GZNC 2ZJSL 1J18A 3PWNB 4M43L 2XZQL 5FM5O 4ZXBD 4YHYB 3LMJL 1P5UA 3R0MA 4I18B 5IBTL 2JB6A 4LHJB 2J5LB 1P1ZB 1UB5A 4GG6F 3QDAA 1J0YA 2FBJL 1CTNA 4JQXC 4NHCL 4FABH 1MWAA 3CFCH 5SWZA 3JWDC 2B1AH 5EU5A 1ZOXA 1OL0A 3D39E 4NRYB 2H8PA 3RKDD 4UQ3A 3V52H 1Q9OA 3ZHLA 1UZ6F 2I60L 3H0TB 4ZS7L 3ES6A 4QHMB 3F62A 3VG0H 4BQ6A 1T7VA 1WZ1H 5IF0B 4XPTL 1HXMB 5FUZH 3C6LB 2R69H 3DX7B 4I3SL 2DQFA 4DGYL 1P4IH 4HGKC 3OKLB 4OZ4B 4PJDB 1OQXA 2VXUH 4ODXB 5D7SH 1YN6A 1J0KA 3ARDA 2AK1H 2FCBA 3JV4B 4AIZA 3BKMH 4Q6IA 3TVMA 3MRJB 1YJDC 2PUQT 2GJ6B 3A6OA 4LAQL 2UZIH 4TOYH 5L0QB 3DROA 5DXWA 4HXAH 3CVIL 4MA8H 1IGJA 1DBMH 3QSKB 4JO3L 3FO0H 1N6QH 2DIAA 5E2WH 2XZZA 4OCLC 5JQ6H 3ZYZA 3O2WH 3V5HA 4YXLL 5BV7H 2C3WA 4HGMA 1FL3B 3H9SD 4UDTB 4GOSA 3NFNA 3VRJA 3UZEA 1LEIA 2F74A 2LU7A 3D69B 1HCFX 2DIJA 1P4LA 1B4RA 4FXGA 1D7FA 4PJ5D 1U95A 3RY6C 4HWUA 2XKSA 3VI4F 4BH7A 3H7BB 1BJ8A 2YMXH 4KK5D 4Y1AA 1TDQA 3GSQA 1W72A 5E70A 3RGHA 3L6FA 3QRFM 4M7LT 4OBSA 4D2NA 5CSBA 3SDYL 3GMLA 5FGRA 3K2UH 4ZAKA 5D7JA 4ZOBA 4QWWD 1XR9A 3SDCA 5DZLA 4YJZL 1R3LA 3WHXB 3MBED 4FN0A 4NYLA 2JE8A 2HTLC 3RI5F 3T0XA 4P4RA 3U46B 1HHGB 4G80A 1D5BB 5D70H 1MREH 2HJFB 3ZYIA 5HHVH 1JTTA 4LARL 3OKOA 5FO9B 4F7PB 5H37H 4J4PC 2LE9A 3X3FL 1OP9A 4W6WB 3MYJB 3SKOA 3OKMA 4PR5B 4R4BA 3NCYP 4KROC 3ZT6A 4HWNA 1UG9A 2NY1D 5CUSL 4AT6A 1ITCA 4NZRH 3VXTA 2VLKA 3ZT5A 4H1LA 5IQ7H 3HMWL 1VPOL 5HVGB 4G5ZH 1C12A 3MRRA 4K8RD 1FH5H 3QYCA 2A73B 1NUDA 2Y72A 4HJGB 1KNOB 4MLSA 3DECA 1HKLL 4Y19A 3RX8A 3I6LE 2GJ6D 5JZ7D 3ZT7A 1IMHC 4R4FH 3O3EA 4XTRD 1CE1H 5FKPB 5A2LH 3MOBL 3EJZC 5JOPD 2B0SH 4K7PY 5EC1B 4NRXB 4DKFH 5JXAH 4XCCH 1IKNC 3O8XB 3FO2A 3IDIB 5IVNA 5T3XL 4YHKL 4M5YH 4XI5C 2NTFA 2NY3B 1RZKH 1XEDA 5D2NE 2BSRA 4HWZB 2MKWA 3IJSB 4P5TB 2X1WL 4GMSL 5F96L 2BNRB 1T0NA 4F7TA 4HEME 2FEEL 1B9ZA 1A4JA 1JFQH 1VHPA 2HT3D 4TVPD 3AMLA 3BQUB 1PKQE 3U6RA 2AEPL 1D9KC 2V17L 4N0YH 3ARVA 5EBMA 1CL7L 5IW1A 4J8RB 1PLGH 5I1GH 3EOTH 2WINB 4YBQD 3PGFL 2F53E 4F3FB 4XNUH 1V3LA 4GXVH 5C0CB 5DYOA 2B2XL 3N1MC 5IBLD 1QQDA 5F7KC 1BOGB 2QBWA 3NIGF 3Q48A 5D1QC 4LLDB 1C1EH 2NY4B 1BFTA 1BZQK 1R5WA 2HTKC 4UV7H 5DD1L 4YZFF 5ISZB 1KUMA 4X7SL 2W9LA 4OD2B 5A16B 1UM6L 4PJ9D 4N8VB 5FB8B 2X4TB 4DKDC 3KPQA 5B38G 5ACMA 4ONFH 1YYMH 2FD6H 5DEFA 3BYYA 3M07A 5HHOB 1QD0A 2Z8WC 2CR6A 4G8IB 35C8H 2IBZY 2OTWA 1I7RA 1HSAA 2CK0L 2YS4A 5TQ0H 2V2WB 2ZOLB 2G5RA 5FYLE 5EBLB 4Z7OF 2X4SB 1K8IA 5DS8B 3RY6A 4PJGF 4WVRA 4PJ7A 5F72S 1NAML 3IFNL 4PRIA 1VSCA 2MPAL 1NMCC 3P11L 5MHSD 4M5ZL 4TSAL 1UCBL 4D8PA 3ARBB 1QSFB 2EE3A 3IJYA 1X7QA 1LNUA 3T8XB 4O4YL 3BSZH 8FABA 3HFMH 3UYPA 3TV3H 1G9NC 1IFHH 1QHPA 1TNNA 4WFED 4EUPB 5K9QI 1IAII 1LWRA 4FQQB 2B5IC 5F9JA 2O93L 3STLB 3B9AA 1U8JA 5J6HA 5KVMC 1NFKA 2QSCH 3I3BA 5HYSB 3OTTA 15C8H 3T4YA 3IU4H 4J4PA 3F8UB 5C0BB 3PNWB 5E2JA 2P24A 1DE4A 1F42A 3LN9A 4K7PX 4OCRL 3ZE2E 1F2XK 1ZT7A 3LQMA 4P5TD 5CZXD 3V7AG 5DRXA 2BNRD 3HNTH 1MIMH 3BESR 5BZWB 5IGXH 1GH7A 3HG1B 4UT9H 2F19L 2EYTB 4LMQI 5IK3B 4KFZC 1NGYA 3FZUD 4XBEH 5DQJA 4IHOB 3V79C 1NCNA 3IXAB 1ORQA 3SY0A 1YUHA 4HUMB 3FRPG 4YDKH 2NX5B 5C0CD 2AXJA 5T33L 2EC9U 1XCTA 4Y16B 2G9HB 2BC4A 1YNKL 2C4XA 3ZTNL 2NY4D 3T65A 4BKLA 4R4ND 4UB0L 3WIFA 3HRZB 4KDTC 5FA3B 1TJHL 4XNYH 5IOPA 1SJEA 5ISZD 4QHNA 5F7EH 1F4YL 1PFCA 4RDQF 3E8UL 2PR4H 3DV6B 1IKNA 3X3GL 4DN3L 3V6ZB 1GGYA 4L4JA 3M8OL 5C6WH 5HHOD 5HHMD 3BISA 5HHPB 1UT9A 4JANB 4JKPH 3QRGH 1FV1A 5FGSA 3DETC 3CFDA 3ARZA 3ZKNC 1UXWB 4ZOEA 5TE6L 2VR5A 2VDKL 3OKKB 1CFTA 1D9KA 3WMSA 4F80A 3S35L 1B6DA 4BA8A 1S3KL 4ZPTB 5ITBL 3LB6D 2D03H 2GKIA 1TPXC 3F7PC 2V7NA 3ARBD 1QSFD 1QLEH 4ZDHA 1FE8L 1KIUA 5T3XD 4WUUA 5T1KA 1INDH 5J4MA 5C07A 1I3GH 5EU3A 5D1QA 1N59A 4MQXD 1R3KA 4OQTH 1RK1B 5HYQB 2DL9A 4K3EL 1MEXH 4PP2B 4QRPE 2VZVA 4HFUL 5FUOL 1DQMH 3M17A 3WDHA 3BIAX 1UFUA 1CIDA 3WFDL 3OAUL 2C3GA 4FQHB 1MCWW 5C0BD 2PTUA 5A3ID 3BKCH 4PJAF 4KKBD 4S1DC 4P2YA 3NAAH 2ORBL 4KTEH 5F6HI 2JIXB 3U9UA 3FKUS 3ZKMD 5LGHL 3LKNA 3G5VA 5EOQH 1FZOB 4NRZA 3QUKB 1JNHB 3RY5A 4CDHA 2DQUL 4HK0B 5D2LF 3CLEL 2P46B 4OD1L 3GSRA 4ONGL 5FHBL 3QCVL 1FGVH 2DLEA 2NX5D 3W39B 3WIIH 4WO4C 5E8DL 2CO7B 3W81A 1J8HE 5C9JA 1YA5A 2AEQH 1IVLA 1U36A 4Y16D 2DKUA 3QXAA 5CEZD 3L3JB 1G1CA 3R1GH 4LEXL 2CPCA 4XPHH 4CNIB 1KB5A 1UKTA 3JWDH 3UTTE 1AIFB 4DTGH 4OIIH 4W4NA 2Y36H 2YK1H 2VN7A 1I7TA 1HXYA 1Z9OA 5JNYA 2V2XA 4ZUSA 4R3SA 5GSVB 4QHUA 1J11A 2WW8A 2BVTA 1CICB 2IPKA 5T3ZE 5E94A 1YN7B 4X6BA 1A5FL 2BFVL 4LQFH 1WBXA 1FBIH 1S8DA 1BVLA 2HJKB 3QNXA 4PJBB 4LF3A 4HPYH 3ULUL 2CIIB 1IM9B 1A1NB 3VD9A 3DVNA 1BM3H 1A7PL 1MAJA 1YY9D 5I8EB 1NC4A 3LQAL 5E7FA 2EEBA 3EJJX 3QIWA 1FGNH 2BOBA 3I75B 5CLTA 5TPWH 2NXYB 3PHOA 1QVOB 5EORH 4H88L 3SPVA 1BF8A 3GSNL 4X6CE 4Q7DA 1LEKB 5D5MA 3R06A 4G6JH 4QY8B 3HR6A 1A3RH 3RZCC 4W4OC 2GUOB 1XGTB 4JFXB 5IB1B 5JW5B 3VXRE 3HHRB 1OAKL 1QFHA 4KDTA 1T0MA 2ESVB 1KTLB 2I27N 1S9WB 3F7QA 4JFEE 3LVEA 4HBQA 4KQ4H 3PGDB 3KJ4C 3BW9B 4GW5A 3KLDA 1JF5A 2IMMA 1I1AA 2OM5A 4YHOL 5DJAA 3SJVB 1AY1L 5ELIA 3SDAB 4N9GB 5L6YH 5DHXB 1N2RB 3FT4A 1BQLL 3WDJA 2KQMA 4P9HL 4X5WB 2BNQB 2IEPA 3IETA 4DGVL 2AI0L 5ACZA 3AXLA 3AB0C 3MPCA 1IGFL 1FNEB 2NY0B 3EYQD 2VDQH 4HH9A 1G1YA 1N64H 2R9HC 5C0IA 1EEYA 5I73B 5CGTA 4YDVA 4G7YH 1AGCB 1Z3GH 1UM4L 3RA7H 3C8KA 2NMSA 3PWPD 3EJYC 3TIEA 1BVKB 2GAZB 5F9WC 4JE4B 3PABB 1OP5H 4F57L 2HA1A 1EO8L 3MLXL 3O41B 5JHLH 4JO1H 3RHWK 4L3EB 5AD0B 3BN3B 2FO4A 4TSBL 2Z31C 2ATKA 1GCFA 5HHQA 3FB8A 4U1SB 5EO9A 2MJWA 1NFDE 2NR6D 5GGTA 5E00B 3NIFE 2IAMD 4OZGE 4KZDH 4NT6A 3CVHA 4HIXL 5HD8C 5D71L 5DHVA 4OT1L 4XHQA 5JDSB 1JGEA 3WE6B 3BJ91 4RMUA 5T5FL 2VITB 5CHNB 1IM9D 2XNAA 4JREB 1HK6A 1DVFC 5EOCH 4CVXB 1MFCH 2YPLB 5IHZB 3TF7C 1A9BB 3MNZB 4GQ9L 2KL6A 2D7OA 3CCHB 3MZGB 4AYFA 4X5LA 5FGBC 4WW2B 3J8F7 4K94C 5EIIB 1EV2E 2AK4B 5I15L 1BFOA 2FGZA 4BZ2L 1I4FB 2I9TB 4EIZC 2CLRB 4UT6H 4NUGH 4MWFA 3OKEB 4D9QD 3TH3T 2WIMA 1RY7B 1TNMA 4NWTL 3EYSL 4QRQB 3D39B 4PGZA 3B9KB 4JZJC 3G5ZA 4PRHE 2XWJA 3QUMH 1Z5LB 2OL3L 1GOFA 2ESVD 1J0HA 3VGDA 1UXSB 3FQTA 1KN4L 3AS0A 4R2GB 1J05A 4PLJC 5DJ0A 3HZVB 4JZNB 2C7UB 2GK0B 1CGVA 1XAUA 3MV7A 3SJVD 1PVHA 3MV9E 5I6XC 4JAMA 1RUQH 1UM5L 2B39A 3SDAD 4JVUA 5TDOA 5GGSA 1UQSB 4A6YB 4QHLB 2VXVL 4JM4H 2QL1A 1A6AB 2BY1A 2WQ8A 3MNVB 4UV4L 4N1HB 2LFGA 1IAOA 5E8OB 2ITCA 3QUZA 1YDPA 5C0ND 2NY0D 3GI8H 5I18H 1OGTA 1TZHB 5AWNL 4LHUD 4XAKD 4WEBL 3BXNB 3C9NA 4FFZH 3MNWB 5A43C 1IKFH 2V6HA 3EOAB 3PWVA 1HH9A 4W6YB 1BHGA 4AG4H 4R96A 2JF1A 4RGND 1ERNA 3PP4L 1FL6A 4X7TB 2R23A 5DD5L 1HOCB 2UUDH 4L3ED 4DCQA 3LCYA 1YEIL 5J3HC 1ZHBB 4QTHA 2YR3A 5ERWA 5AZ2L 4QRRE 3VD7A 5ESQB 3IGAA 4MGXA 2D31B 1U42A 1LDPL 4HHAB 3MRKB 4LLUB 3G08B 3W9EA 3SE4C 2NY5C 1GHFH 3X12A 4JRYA 3SO3B 3VFNA 2OR8A 5CMAA 3R8BB 3WL9B 1B3JA 2YPLD 4HJ0C 3ZDYF 1G9NH 4Z7UA 5IB2B 5IMOA 4JZOA 5J6GB 1K4DB 3I84A 3OKNA 4JPKL 4RNRB 1F00I 3MUJA 3G9VA 4KJPC 1JPFB 1SYVA 3IKCB 4PRPE 5HDQL 1FCCA 4HD9A 3CH1A 1K3IA 1LE9A 3OGCA 5F1SA 2MHAB 4P46B 3TBVA 2APFA 3MRQB 3O4OB 3T77B 4HPOL 3RUGA 2OSLA 5GGRB 3D39D 4LSTH 3QHFL 3B9KD 4EI5A 4UI2A 1MY5A 1ZHNB 4YLQT 5I9QC 3ZLQC 4W68A 4R2GD 3GSUA 1KN2H 3S5LA 1GZQB 4HS3B 3PJSB 4DKEH 2Z31A 1B0GA 3DLQR 4QRSA 2L0DA 3DMMB 2DKMA 1LILA 3EDEA 2G60L 4HWBL 5MEQB 4CGTA 5ADPH 4ZNEA 2H1PL 1KJ2B 3SOBL 3WFEL 2R1WA 4YBHA 1J0JA 1ZLWK 1FZMB 1Q0XH 4OGYL 3TNMA 4QOKA 2NY2C 4H1LG 2P44B 4O02H 3UEZA 3F7VA 3MA7B 1JV5A 1OARH 5FGBA 4GG6A 3TYGH 4Z77B 1CLYH 1PZUB 2VIRA 2WQRA 2X70B 3AC0A 4M6MH 3TGXA 3RAJH 4QRUB 5TF1H 4JKMA 4H8WC 4JZJA 1TIUA 4YO0B 3IVKB 5D2LB 3VDAA 2HWZH 3QWQB 1E0OB 2P5WE 5F7FA 4DVRL 3VD4A 4XP1H 2BSSA 3MROB 1IILE 3ARFC 1PKQB 2OR9H 5I1DB 4LCWE 1G7JB 1T2QL 1A14H 1M7IB 2HG5B 4L3CB 1KCSL 5E1AB 5IW6B 4L8CB 2Y6SC 5CKGA 4HLZG 4QCIA 2J2ZA 1KULA 1FFOB 5MI0C 1ZGLB 1OCWL 3MXVH 2D4DA 2W65B 3FQXB 3K2MC 3NFPB 1D5MB 3CC5B 4QXGH 3MXWL 4TUOA 5EOTA 1A7BA 3BIKB 3K4ZA 4PREB 5EB9A 5EDXA 1Q9KA 4EBQL 1NKOA 4JFFE 3HPJB 1FORL 4D0BB 3TIDA 3RWFA 1ZA6B 2RCSH 4HJJL 1KXTB 3DJ9A 2WLZA 4NKDB 1M7DA 4P46D 2IQAB 4FQPA 3TZVC 4ZUVA 1QFPA 2Z93B 5ANMA 5GGQH 3SCMB 1YEHH 3SKJH 2FR4A 5HYIA 4WGWB 1ACZA 5HGBB 3KS0J 1G6VK 4L9LB 3Q5YA 4DZBA 5T1DL 3CZFA 5J11C 2YKLL 5CGYD 3WFCH 4MNHA 4Z7WF 1IGCL 3TT3L 3ORJA 1RIUL 1TQBC 2Y5EA 4JJ5A 4ZTOL 4PBVC 4GRWF 4PJCA 3DMMD 4JDVA 3WNMA 2FDBP 4AEHH 3PUCA 3OGOE 3O6FC 4LLVA 2XICA 5IHUH 1YEDA 2DMBA 4JHAH 5EA0L 1PG7H 3SE4A 5IESH 3FB6B 1E4KA 5DFTA 4JM2F 2WUBL 4NQCB 1UZ8A 5T1LA 2P8MA 5DLML 2AJZA 5KJRH 3RVXD 4JDTL 2IG2L 5MENB 4PJIB 5E5MA 1J12A 1KENL 1U8IA 3PWUA 5DGQA 4ZS6D 4LNRB 3HC4H 1SBSL 4UOW1 2BDNH 3BN9D 1ZVSB 4OV5B 3B2UD 2Z35B 4LLYA 5CEXB 3HAEA 3O4LB 4YX2L 1HHHA 1MRDH 2UVEA 1FFRA 1UACL 5GJTH 3UTZA 3B2VL 5KVEH 3IDMA 2IPUK 5EZLA 1MUJB 4MS8D 1HHJB 4NKOA 5DEGA 1CD8A 3JWNC 1CR9H 32C2A 1T5WB 3KJ6L 2R0WH 4MB4A 1NCBH 2XG4A 1FRGH 1QLFB 4CMHC 1EXUB 1NMAH 3BI9X 1CD0A 3ET9F 4KRPB 3C60B 3OB0H 4FQLH 1BFVL 5DC9B 4X9IA 4IIQA 4X0KA 2B8OT 1NCTA 4JFOA 2LVCA 4JN1L 5CP7B 3RWDB 4BYHA 3IDYB 3HB3D 1QFWH 2ZSVA 1R0AL 4XMKH 3OAZH 4JN2A 1FL5B 2DQTH 2HMID 4NQTA 1KJMB 2XKNA 3VXUB 1T1XB 1E6OL 5BVJB 5IFHL 1K2DA 4BQ9A 4G7VL 1KCLA 3BT2H 2YD4A 5HY9A 4KVCL 3QIUC 3SKNA 2OLDA 3TBWA 4G8GA 2HVJB 3FB5A 5I75B 5FYLD 5TFSL 3D3VA 3QUYC 3EYVB 1HSBA 3OJDA 4IJ3C 5T3ZL 2QTEA 2HFEA 4HKJB 1AGEB 3G5XB 1VEOA 3P73A 1T4KA 1Q9WA 2DBLH 4GW1A 1REIA 3DRTB 4GG8A 1ACYH 3FOLB 4HCRA 3U30C 3MLZL 2Y23A 4IMLB 1NEUA 3MODH 5CIPB 4U2ZA 4JPVH 3MACH 1CGSH 3V9FA 2F8XC 3KLHD 2AJXL 5FCSH 3WUWG 3IKKA 1YNTB 4ODTH 2LQRA 5IIEB 5CEZH 4UIMA 3QZWB 2H6PB 1RJZB 1XF3A 3LEYL 3LS5L 4WHTB 4QNPE 4APQC 4OLZL 3T1FA 4BH8A 1F5WA 3PWLA 2PCPA 3ZDZF 2ICES 1FZKB 3RU8L 1FAKT 4GUPA 1U41A 1XR8A 5B8CB 1XFPA 3D18B 4CRPA 4OF0A 4AEIL 1T6VN 4F8QA 5KSVB 3GMMA 3S7GA 1HI6A 4ONHA 4KK8D 3VD3A 3VXNA 3UC0L 2X05A 5L9DH 2XN9A 1IQWH 4HS8H 2VDNL 4JO4H 4KRPD 4K94H 1H8NA 2HH0H 5I71C 3C60D 3LAFA 3JTSB 2A0LC 4CMMA 2XV6B 1RK0B 1AJ7L 1FIGL 1XGRB 2HKHL 2JJUA 5DHYB 3WN5B 2MCPL 3KXFB 4U3CA 4LLWB 1FN4A 1CE6A 5C0DA 1UEMA 2ZSWA 1RZJC 1UJ3C 3DV4B 5D96C 1YYLH 4OLVL 4ODWA 1IBGH 4WEMB 1ETZA 3E3QC 2GT9A 4LIQE 3VXUD 3H9HA 1QSEA 3NZHL 4XWOD 4Y2DB 5CBAA 3MOAL 5GPRA 2R0LL 5I1KL 3DOSA 4XAWL 3OKYA 2NY7H 4C56E 5K59E 3FQNA 3AS3A 2FH6A 3GK8H 4IOFD 5I1IH 3V0WH 3OB8A 4OJFH 1ES0B 1F13A 3EDDA 1A7QH 3CK0H 3RWIB 4OTXL 1ZS8B 4YUEL 4XB8A 2W0FB 4LKXB 4R0LB 3EO9L 4OZHA 5CSZB 5K33A 3NPSC 4F9PC 4PJ8A 1IC4H 3RVTD 3FQWA 5HJ3A 2FEDC 3BP7B 5F1KC 3ZMRA 5CZVL 3PF2A 3CFKB 2J6EL 5ESAB 4R8WH 3VXRB 5GRUH 1M4KA 4IOIB 3HKFA 4RFNC 5KS9E 4JFEB 4QRPD 1P2CA 1OAYH 4L5FH 1A21A 5MEPA 5CWSB 4YQXH 4OZFB 5F1NB 5J8OA 3EHBD 2F8VA 4OF3A 4LCYA 4C59B 4NQDA 3EIFA 1YECH 1NBYB 3EW3B 1I9JH 1MJ7H 5D7LA 4DW2H 4XXCC 3QIUA 8CGTA 1V3MA 2DTMH 4I5BB 2IJ0C 2DKSA 4NWUH 43CAA 2WLYA 3RDTC 5BS0A 1DBBL 3MA9L 4KC3B 4M6OH 2WBJC 1XGUB 2JB5H 1WF5A 2ZWLT 3W0WE 5HI5C 4R7DB 5EU6B 3E6FA 1GPOH 2EYRA 3BGAA 1QYGH 4JY4B 1BJMA 4UT7H 4MVBC 5C0AE 2FWOA 1A1MB 1J8HD 3N1FC 1NDGB 3HZKA 3BFOA 2QLVB 4X4XB 1IEBA 1MFBL 4XVUC 3V0VB 2ED7A 1MLBA 2C1PA 4I2XE 3LN4B 3UDWC 4F7MB 3UTTD 4YDLB 3RVWC 3QWOA 2RIKA 2V2TB 3OR7B 4P2RA 5E6IB 2EXYD 1UKQA 2DYPD 4IS6A 5IMMB 2YEZA 5DSCB 3QISA 4JO2L 2IQ9H 3DX6B 4PJAA 5H35A 5IVXF 5BMFL 3PG2A 4Y2DD 3OX8A 3FAXA 3HE6B 1EGJL 1DR9A 1X5KA 2VZSA 4NGHH 3RIAK 1U8KB 4UNUA 3TJEH 4TTDC 1TZGL 3VH8A 1OP3H 2VQUA 4QRTB 3SGEH 1KFAH 5IR1A 3MREB 2VL5A 1MVUA 3KPMB 5EZJA 3UYRH 3VXSA 5J13B 5DK2A 3GSVA 4K7FB 4Z76B 1L6ZA 1TCRB 4UILL 5F7YC 4WW1A 3WNLA 2R8SL 4HQQH 5LBSH 2ZPKL 3BDYH 5FF6B 5KSAC 3P77A 4XPGL 4I0PB 4MD4A 4YFEA 4QT5A 5SX5K 5FYJD 2ADGA 3VXRD 1NCDH 3ARSA 4FP8L 4PRHB 2P7TA 2J12B 3BIBX 4X6DE 1DBJL 5DRZA 2LV4A 3VW3L 4JFED 3LQZB 3NFSL 2NW3B 3QG7H 2EZ0D 1B6UA 3VXMB 2VLLB 2MCG1 3WNOA 3ULVE 2W38A 3BHBB 1SY6A 1JYVA 1KG0A 1MWAL 3L3DB 5HHXH 1NPUA 4MCZB 4S1QL 2H3NB 3EO1A 4JQVA 2EKJA 5KVGH 4OUUB 3QQ4A 1RIHH 3CSYA 3OPZL 2OI9C 5I8CB 1QFWM 1I9RL 4JEGB 1JWSA 3B6SB 3NABH 2F5AH 1CWVA 1XH3A 4K9EL 5EU6D 4YK4B 2VLRB 2DQCH 5ID1A 3VWKB 3T4AB 4MNGA 1J9CT 3E2HC 1MPAL 1Z9MA 4OCSL 1Q38A 1D5XA 4P49A 1G7PB 2AJUL 3VGFA 2VC2L 3HS0B 4QKXB 2ARJQ 3TM6A 3IDNB 4FG6D 3P0YH 5SWSE 3BZEB 1QR1A 4NO3A 2E7LA 4NUJB 1WWBX 5ETUB 5E6ID 3VE0B 3WJLA 1M05B 5EO1B 4D0DB 3SKUD 3C5SA 5CAYB 1G7QB 5CD5C 5I8KH 2HT2D 4O5LL 2ENYA 2FHCA 3AREB 4YAQB 2EYSA 1NL0L 4JPIA 5FCUH 3UTSA 1IJ9A 2R4SL 4JFDE 1FLTX 4MJIA 4JJHA 4A6YH 1DQJA 1Y0LA 4XP6H 4DVBB 2DOCA 2WBJA 2EH7L 1LVEA 3K74B 3RHWF 4O2FA 5GISL 1JPSL 3QAZC 4Z7NF 3O45B 1FO0L 3ULUF 4MZ3A 4NDMA 1X5XA 4UINL 3ZSTA 3QIBA 5KSBE 4I0PD 1CLZH 4U1HB 1MIEL 2OTUA 4GH7B 3BKJH 4PRHD 3C5JA 3OXRA 4KAQL 1PBYA 3UAJD 1NAKH 2XXCB 5C08E 3GM8A 1A1OB 3TWCL 3O6KL 4IDLA 1Y6NR 4DOHE 3VXMD 1WTGT 5EIVA 1YEJH 2Y5TB 3DIFB 2XWTB 2EH8H 1I3VA 2ZKHH 1GAFH 1S7VA 4ELMA 5E56A 2YZ1A 3TPUB 3QEQA 2AXFB 1MHHA 3C5ZB 1A47A 3S5LG 3IFPA 4JRXA 4JR9L 5E24E 3IFLL 4ODSH 3JBG7 1G9ML 4FFYL 3HC3L 2DQDH 3TO4B 3LRSA 4KK9C 4HKXA 3LDBC 2VLRD 1WIPA 3VWKD 1CXKA 5JHDE 1MCWM 3O6LL 4EOWH 4KTDL 1ODAA 1WAAF 2NY1C 3AU1B 1RPQA 4AEFA 1U91A 5KSAA 3F12A 1G0YR 1BF2A 4NN7B 4Q9QL 1X5LA 4NBZB 4Q97A 1IGTB 4PJFE 3VFWA 2DI8A 3VXQA 1JF1A 1X4ZA 3O2DA 3V6BR 4V1DB 1FNHA 1DCLA 3AUVA 4HIIB 4K8RC 5J9PB 1F02I 1PY9A 4JY6B 4Y4FB 3BGFC 1K85A 4X80H 4LCWB 5KOMC 1CK0L 4ZO8A 5HYJB 3WHE1 3P9LB 4XTRC 3G5YB 1RV6X 1RZ8A 4UTBH 4P5KA 5DD0L 4URTB 5BXFA 1FO0B 5JUEH 5GHWH 4G6KH 5DQDH 4M1CD 3SDXE 1RZGB 4YBLB 3RIFK 1A8JH 3G6DL 1KJ2H 1TZIA 4GRLB 3MRCB 4PRPD 3AFLA 1NGPH 4MAUH 5CBEA 2AABH 2P43B 3JWOC 5CILL 3V4UL 1J1OH 3VFRB 3X14B 2UZYB 2PO6B 3OXSB 3FFCE 4RAVB 4AM0A 4UQ2A 1VADB 1SQ2N 5IMKA 4OZIE 4FQJL 4Z5RA 3L5WB 1T1ZA 5GSRB 5FA4A 4CW1A 1RZIA 5KBNC 3OR6A 4EI6B 3C5ZD 1BJ1H 3QCUH 4PTUB 1W0VA 4PUBL 4PJ9C 1ZT4A 3QDME 4G6AD 4JM2C 5DF0A 5HXMA 4GKSA 3TO4D 5GZOD 2VABB 5E2TH 3NCJL 1G7MB 1D5IH 3EDKA 3H9SA 2OZ4H 1VGEH 3BPCB 4JHWH 1TFHA 2CDGB 1KC5H 3DBXB 1W0WA 4GW4A 1FJ1A 2EO1A 4XVJL 3VFUA 2FX9H 3ARGC 3U7AA 4FQXB 5DRNB 5EPMB 5FFLA 3GRWH 3VFGL 1NLBL 3GI9L 1RHFA 3VWJB 4J3SA 4PJ5A 5DJXA 3B5GA 4K07A 5EFIB 3FOMA 3IDGB 1DSFH 3TNNA 4L8BB 5LXGL 1RUPH 3U1SH 2P5WD 1C5BH 4G8EA 4Y4FD 3S9DB 1KF9B 4X8JA 5C8JA 1U8PA 2H2SC 4LCWD 3WLBB 1RI8A 4TRPL 5HYJD 5CJOL 3HAEG 2EDRA 4CN4A 3B4NA 3HUJE 5DJ8B 4HF5L 3KNBA 3B9VA 1J1PL 4OAWB 1TTGA 4I18A 2RAMA 2X1QA 3DSFH 4ORGB 4NQXB 1NGQL 3EOBB 3E6HA 4GRLD 5DT1L 3RL1B 3KPPB 4K3HA 1GOHA 5IT2H 3H0TA 2XIDA 5ICZB 1U2CA 2ZCKH 4LRNH 3RWHA 5I76A 1Q94B 3MV01 5IF0A 2YOCA 1HXMA 3UP1A 2AGJH 5DJDB 4J23A 2PTTB 5SWQB 5K9KB 2QR0A 2PO6D 2R15A 3FZUC 4IDJH 5EC2B 5JIKA 1FQ9C 3VFOB 2CDEB 5JW4Q 2P47B 4GAGH 2R2CA 3OKLA 4PJDA 3WFZA 1DQLH 2XTJE 4F7EB 1YPZE 5GRJL 4ODXA 3TC9A 4OCNC 2Z9TA 4MA7L 3JV4A 4FQCH 4XPFH 3NACH 5BJTA 2EC8A 5FDWB 3BD5A 2GJ6A 1JNLH 2B4CH 3P0VL 3W5MA 3MLWL 4U0RC 1N0XH 1MHEA 1J88A 3A67L 2VDMH 3WFHB 4Z8FL 3OJVC 4RQQB 2ARJA 3G6JE 5LQBL 1QPPA 3QQ9C 3GIVB 3E0GA 4KGJA 3T0EE 4L8DB 1BBJB 5DMIL 2L7JA 3WD5L 1DBKH 4N0FA 4MQTB 1EHXA 1QP1A 4V2CB 3D69A 3GMOA 3OZ9L 3THML 5GGVH 4P5MB 3B3IB 3MRLA 1FG9C 4JDZB 2J8UE 3H7BA 4LSSL 1DLFL 1A6PA 2IFFH 2XXMB 3LB6C 2D0HA 3KG5A 3IU3B 5CFHA 4X4YB 3LRHA 4OD3L 2BVOA 4I1NB 2ED8A 4I48A 3BH9B 4EDWL 2J1KA 4X6FA 5IBUG 4BSWA 3WHXA 1JRHI 3B43A 1P4BL 4MQ7B 2YD9A 5IQ9A 2AJSL 1JUFB 1CGXA 3LSOB 1Q9LB 1HHGA 1MNUH 1D5BA 1DBAL 4P0DA 5TQ2L 2X9YA 4PJ9A 4D9LH 4JM2A 4U1GC 5FO9A 3HPLA 1FAIL 5T1MB 3PDGA 5D1XB 2BOCA 3J7HA 2D2OA 2WIIB 3ZE2F 2BSTB 2YZ8A 1T03H 4PR5A 5FECB 3ZKMC 3S98A 3ESVF 5KVDL 1VFBB 5CIPH 2AKRB 5D1ZB 4NC0B 3A6CL 4K7PH 4CDGC 1KV3A 3HNSL 3IXTB 3BUYB 2VDPL 4NN6C 3CFJB 4E0RA 5B3JE 1KCUH 4C56B 4B5EA 1Q1JL 3QI9D 1XF2B 4P4KC 5E9DE 1DQQA 1F90L 2QSTA 4HJGA 1KNOA 2FIRT 1QSZA 3TN0B 3ILQC 3K8LA 2NW2B 5ACLA 4YHPA 3T0VA 2W9EH 3RX7A 2BJMH 5FKPA 4K3DL 1KEMH 3D25B 4KKCC 1LGVA 2FJGA 3FTGA 5HSFA 1F11A 2J88L 3IDIA 5EWIH 5FYKH 3A0OA 3S37X 2X89D 4NCC2 2RR3A 3VGBA 6CGTA 5KS9B 4P5TA 3FRUA 1CVSC 2BNRA 3BE1H 3BD3A 4C54A 5JDJA 1AKJB 5E08H 4RGOH 2VAAB 4QXUL 1IQDA 1BBDH 2FL5B 3S4SA 5DJCB 1CFSB 4KMTH 1HHKB 4RDQG 2I9LA 3KLAB 1VKXA 3M1BA 5C0CA 3DRQA 4LP4A 3W2DH 2GFBB 3BZFB 3WIHH 5F1OB 3STZA 5EU7E 4HC1L 3W0WB 1V05A 3PV7A 2QQKH 4LGSB 2VXQH 3NA9L 4M6NH 4OLXH 4K3JH 5ISZA 3MRPB 4OD2A 1JGUL 2BY3A 3UZQA 5C0AB 2ZUQC 4N8VA 4XBPA 2O5ZH 4WV1B 4YDIL 1I8IB 1RURH 1H3TA 5CEYB 2YSSB 1LK2B 5FK9B 3B8SA 3AGVA 1KLGB 2OJZH 5D1XD 3H8NA 2JCCF 2FSEB 4PB9H 4HKBB 1X5YA 4R7NB 4G8IA 3ARWA 2CKBB 1KCKA 4WEUD 2AXGA 4HV8B 5FYJH 2UWEB 2ZOLA 4P57A 4R90H 5EBLA 3FO1B 1G7LB 1NANH 4P9ML 5D1ZD 1EZVY 2VDOL 1P9MC 5E1HB 1NLDH 5DRWA 3NZ8B 4U05A 2Y7QB 4J2XA 4C56D 4OZFH 3ARBA 2A9NL 1P69B 1KCRH 3UPAA 5BO1L 1OTUC 1AD0A 3TN0D 2YBRA 2CLVB 4EUPA 5FOBA 3BP4B 4OFDA 2VDLL 4W81A 4FQQA 4MXQD 5FV2A 1A6VL 3VH8G 5D93C 4K71B 2OX5A 5F9OL 4XMPH 1ZLVK 4C83B 2XFXB 1D5ZA 1RVFH 2IAMC 2VSDA 5C0BA 1IGMH 2CRYA 4ZQKB 3DHMA 3Q6FB 4X6DB 1OAUL 4PGEB 2VLJE 1T20B 1WVZA 4F9LC 2VISB 3UROR 2A9ML 4HUKB 4X99B 5FO7B 1EHAA 1CDHA 1AKJD 2NXZC 3BOVA 4J6RL 2XZCH 2WP3O 1BGXH 2GCYB 3ZZ1A 1B4JL 3F5WA 4NM4H 4WRLA 3CGTA 3SO5A 4HBCL 3P30H 3KDMB 4JPWH 2E8YA 4O58H 3CXHK 3ARTA 4IHOA 5GIRA 2WUCL 4FHBD 3IXAA 5EN2B 1VGKB 2K7PA 2NX5A 4EXPX 1RULH 5CGMA 1YEFH 3BVNB 25C8H 4UAOC 3T2NH 4Y16A 1W0YT 2G9HA 3W0WD 3L3HB 4OM1H 3BH8B 2EE9A 3ZHDA 4MXVF 2CR3A 2GJJA 2IANE 5C0AD 4RX4D 4OV6F 1MH5B 3DV6A 3JWOH 3V6ZA 1T80A 3BO8B 5L7XL 4EQ3A 1MLCB 3FMGL 1NAMA 3I9GH 4LSQL 4FZEL 5DJZB 5HHPA 3CFEB 4JANA 3WO4C 2N7BA 1WEJH 5INDB 3I6GA 3LMJH 4JFQB 3K1KC 2I25N 5EO0B 5C3LD 1INQB 5GS2D 4TUKL 2FX7L 1QLRB 4RRPA 2R56L 1LP9E 3BPLC 1RUKL 3PXHA 3WKML 4ZPTA 4PGDB 2HRLA 3U83A 2FHFA 5C0GA 3UPRB 4ZS7H 1IEAB 1Y6MR 5HBBA 4ODVH 1EZVX 4X7CC 1IAKA 2EDNA 4JFDB 1NEZG 4ZFOL 4I3SH 1KELL 4KI5D 1XIWD 4RGNC 3VXPA 2CSPA 3I6KA 3K4DA 3ECBB 1RK1A 1JHKH 4U1JB 2FJFB 3ULUC 5KSBB 3LQAC 1Y18A 1KIQB 1NFDF 5IEKA 3CXHJ 3HZYB 3ME0A 3NIFF 4Y5XB 1KLUB 4DJMA 4OZGF 5IHLB 3CVIH 3RIAF 2Q87A 3C8HA 1BZ9B 3Q3GA 5C08B 1J8KA 3PHSA 2EDXA 4LCUB 1UVQB 4B7LA 5I1JL 4DQOH 4MD0A 1YEKL 1JHTA 3ULVD 5F1IB 4N5EC 4P3DA 5IVXA 4PV8A 4GAJL 4XNZB 1P9MA 2R0ZH 1I8KB 1IGYB 3LH2L 5EUOB 43C9B 3PWPA 4KUCF 2I5YH 3VA6A 4OCXL 1JNNL 4RMVA 1CDBA 4U1KA 4NQVB 4U6TA 1OGAA 3RNQA 12E8H 3L3JA 4CNIA 2YPKB 5BRZB 4P9HC 1R5VA 4NJ9H 4ZFFA 5I0DA 3MRNB 1PYWB 5JLZA 1QFWI 2J4WH 3NGBB 4PJEE 1QPXA 4LLMB 3RWJB 3MR9B 2N1KA 4XCFL 4PJFB 2IAMA 3LZFL 4TSCH 5FM5M 5SWSD 3QPQD 1YN7A 2EDKA 4J3XA 4F9LA 4EN3B 5DK0B 4B50A 2HJKA 5JPMB 4IRSB 2CIIA 1A1NA 4PGCA 1WZKA 5J1AB 1A7RL 5F89B 2DD8H 2VXSL 3UBXA 4F33A 4PY7B 3TO2A 3I75A 1QVOA 4IRZH 3RWGA 4Z7QE 2NCMA 5GGUB 1B2WL 4K55A 4JFDD 4N8CL 4XVTH 3SDXB 3DYMA 3SE8H 2W9DL 3RX5A 4ENEC 2GUOA 5IB1A 5JW5A 1WBZB 2DF3A 2A1WH 3F6IA 3D87B 3MX0A 5JR1H 1S9WA 3KPRE 1UWEH 4Y7MA 1DANU 4JGJA 3RVVC 3BW9A 5E0QA 3DYOA 2IBGA 5CSGA 2FYYB 4ETQB 1DUZB 1I9IH 2E27H 5J1TC 1KJ3H 3DUUB 4U1MB 3UYOD 3SDAA 5JORB 4E41B 3I50H 1YY8B 3O9WB 5B38B 3HZMB 3MFFB 1MCRA 1N2RA 2HP4A 5C08D 3UJTL 4OLYL 1EBAA 4OZIB 4X5WA 4O2CB 5KG9B 1NBVH 1VENA 1FNEA 1LO3H 4XWGL 4M48H 4G8FB 4LHUA 2R0KH 1WWCA 5F96H 1TMCB 4XPAL 5DZNA 1ZTXH 1DUYA 1CXHA 2VZOA 4MDJA 4XP9H 4Z7VE 5E99L 1KIPB 3QDMB 3QB7C 4PB0H 1F3JB 5BZDA 2IBBA 2GAZA 3GEWB 1IAIH 1MCBA 5DO2C 2A77H 5LGKA 4LSRH 4Y89A 3F7YA 1HWHB 3O41A 2LVEA 1N5AB 3TA3B 4L3EA 3VFPB 4FABL 5JHDD 5AD0A 1CFVH 2B1AL 5TH2A 3DO7A 2B1HH 2B2XH 5IP4A 1FYTA 1MF2H 4LDLB 3V52L 4U1SA 2VRAA 3IJHB 4XT1C 1SMAA 5E00A 1ZXQA 3L3IA 2PETA 3VG0L 1WZ1L 2P8PA 3QFJE 1U93A 5FUZL 3DX9B 1VEMA 2R69L 3OWEA 4CJ0A 1P4IL 3H3PH 5EULV 4BSJA 1ND0B 4IRSD 5FGCE 1NUGA 1MQ8A 1SM3H 2VXUL 3C2AH 4PJHE 5D7SL 2YPLA 2ICWI 4M4PA 5IHZA 2AK1L 3PHQB 1A9BA 2MTPA 1OM3H 3U82B 3HUJB 3FAWA 3BKML 3CCHA 4Y5YC 4MJ5A 4PTTA 1YMME 1BZ7B 2UZIL 4M3KB 4PBXA 2XTLA 2CK0H 4TOYL 4ZS6C 5EIIA 2R29H 4HXAL 3IB4A 4G9FE 4MA8L 4MD5B 1DBML 2CLRA 4LVOB 3EZ8A 3OKEA 3FO0L 2ADIB 1N6QL 5D2NC 1X5GA 4GBXB 5JQ6L 3O2WL 1JWMB 5D7IE 2OR7A 4B0MM 4TSAH 5BV7L 1UXSA 1QRNE 3HZVA 1XCQA 2E5EA 2C7UA 1BP3B 2GK0A 2XRAL 1CGYA 4MS8C 3NVQA 4FQ1H 4NZUH 4QTIH 2Q1EA 3O9WD 5JOFB 2PXYB 3MJ9H 5EUKA 1Q8MA 4O2EA 3TJHC 5KTEH 1OTSC 4K2UH 1A6AA 2YMXL 2HN7B 2ERJC 1KJVB 4LSPH 1WC7B 4GXUM 1I8MB 2AEIT 2NTSP 5HDLA 3X17A 1R5IB 1F6FB 3RIFF 3K2UL 1GIGH 4FTVB 3IFOB 3QXUA 3BXNA 3O3AB 3G6JB 4X7EC 3S88H 1PX4A 3QDMD 2RFXA 3EOAA 1CGUA 3LPFA 5IFJA 1F97A 4L4TB 4YE4H 5D70L 4Q9RH 4H0IA 2IALA 3T0EB 1F4WH 5HHVL 4KV5E 3BEVA 4X7FC 4DZ8B 4M7KH 4MDIB 1S7UB 2HVKB 2Y06H 4F8TA 1ZHBA 4KJWD 4PY8J 3IDJA 1I1YA 2G2RB 1Z0NA 4XP4H 1DQDH 3OQ3B 4PV9A 5C6PB 2J8UB 4HHAA 3MRKA 4WUUE 4LLUA 5D72H 3JTTB 4LVNB 1OB1A 1T66C 4YR6B 2IF7A 3G08A 3O81A 5IQ7L 4K23H 1AD9B 1DJSA 4G5ZL 2Y07H 4NN5B 3WL9A 4YHIB 2WV3A 5IB2A 1FH5L 5J6GA 1K4DA 2CMRH 4LCIH 2OL3A 3K0WA 2Z91A 3KLHC 1H5BC 1JPFA 2Y1VA 3IKCA 2WP3T 4R4FL 4WWKB 1CE1L 4ACPA 1OAZH 1V8HA 4PYHA 2FGWH 2X1OA 4P3WA 5GGSY 5L2JB 1U8QB 2MHAA 1JF6A 3T77A 3W9DB 4DKFL 1S3KH 5GGRA 5JXAL 4GBXD 3QUXC 5ID0B 1H15A 2LAGB 5ICXB 4M5YL 4JFPB 1X44A 4HS3A 3PJSA 4S2SA 1EHNA 3FHQA 3RTQD 2X4RB 4GKNB 1EEUA 4JFZL 1JFQL 3NA4A 4KK8C 2CD0A 5A2KH 3F58H 4QXWA 4X9HA 1C16A 4M61B 1P6AB 4N0YL 1VACB 5E9DB 2ZZUT 1U3HB 1PLGL 5I1GL 3EOTL 4OCYH 4Y4HB 1KTKE 2GHWB 3D85D 3NCBB 4XNUL 1RZFH 4PGJA 4GXVL 5B22A 4JVPA 1VERA 1G7HB 4ZMAT 3RJDA 1S7XB 4FTVD 2ORBH 1AC6A 1HINH 2FB4L 4NQEE 3MRFB 3NCFB 1H0DA 1B88A 1C1EL 3MRBA 3QJFB 2GSIA 4UV7L 4EZMA 4NKMA 5ALBH 4UUJA 2X70A 2IADA 4XWOC 3T0ED 1X5FA 3DTXA 5D2NA 4DKAA 4FFWC 4YO0A 4ONFL 1J0IA 1YYML 4ONGH 1CCZA 2FD6L 2R1XB 4MA3B 7FABH 3QNYB 3BAEH 4IOFC 3V5DB 5DQ9A 1PKQA 35C8L 4LBEA 3ZO0A 4OFIA 2HG5A 3MLTB 2GW5A 5TQ0L 3BEWB 3D0VB 3B9DA 2F53A 3RVTC 3QDJB 4LIQH 1ZGLA 1FFQA 1UYWL 4M9PA 4KVNH 2W65A 4HW6A 4EDXA 3GBNH 1CD1B 4PJXB 3BIKA 3BSZL 3HFML 2SEBB 3S4SG 3TV3L 3WYRA 1IFHL 2AQ2A 3QT2A 4OF8A 1FG2B 3L95A 1MI5E 3U0PB 4QEGA 1ZA6A 4YPGA 1VFAB 2P8LB 1T04B 3TT1H 3EHBC 2QSCL 3HNVH 2Z93A 4QNPF 3KWWB 15C8L 1WWWX 3F6LA 3IU4L 4HUUB 2A6KB 3GSNH 4ISVB 4N8VG 1ZVYA 3HTLX 5INCA 3WDIA 3SGKA 5KANG 3V6OC 3HNTL 4KUZH 1MIML 1LO5B 5IUSA 5IGXL 2FNBA 3N0PB 1HILB 3I3DA 3X13B 1KSRA 4UT9L 4KU1A 1I1FB 5MHSE 4NO5B 4LVHC 4XBEL 4P2CG 5E9DD 4O51A 1U92B 1U3HD 4Y4HD 2EDHA 5F44A 4WFEE 5AAWA 4YDKL 4PG2A 1JZ4A 1IZJA 2YWZA 2E6QA 3WS3B 1CXIA 3O0RH 4M7ZC 4OLWH 2ZCLH 2V7HB 2NY6B 1J10A 2BNUB 5HI4C 1OHQA 4PRBB 5E7BA 2J7LA 3V6FB 4XNYL 1Y6KR 2ZUTA 5F7EL 1ZVSA 1AGFA 3VMOA 2QV2A 2Z35A 4YXHH 5CEXA 1XF4A 2PR4L 4IRJB 4MNQB 2HFFA 1UM4H 4Q0XH 2GSGB 1N5YL 5K59F 4JKPL 1WFTA 3QRGL 4NNXB 5D6DC 4JVWA 3MRGB 4X9BA 3K4AA 3BP5B 1HHJA 1UB5B 4HZLA 5GJSH 1O0VA 2CKBH 1M1SA 5GS2H 1QLFA 2OBGA 4LSUH 5EU5B 2BK8A 1KACB 1S7TA 1EXUA 1II4E 2H8PB 5DFWH 4PP1D 3D9AH 3C60A 5CD3A 2WNGA 2Q7YA 4E5XB 2IC2A 2D03L 3ES6B 4LDOB 4C57C 1QLEL 3QHZH 5A2IH 5JXED 2IMNA 1GXEA 3MGOA 1CYGA 3V95A 1INDL 1S9YA 1DL7H 4HGWA 1NSNH 2DQFB 1CS6A 4XCYA 2IANB 1FL5A 2DM4A 2EZ0C 1MCQA 2V5RA 3AVEA 1MEXL 5CCKH 1MRFH 4XVSH 5FDYA 3ARDB 4UU9B 1DQML 2YPVH 2A6IA 4GQ9H 5HHOE 5BVJA 1JZ6A 3D2UD 4XNMB 3TVMB 1KPRB 2VO5A 1G6RB 5DWUH 5GS1C 3BKCL 4GQPH 4HX1A 5I15H 1N4XH 2AXHA 1E4XI 2HVJA 1IGJB 3HRPA 4KTEL 3RGVC 4HUWA 4F2MA 1H3WM 4NWTH 1LP9B 5EOQL 1AR1C 1DLHB 4LRIC 4M9OA 2HRPH 3G5XA 3ULVH 1QSFE 5GRZA 2X5PA 4BM7A 3NFNB 3VRJB 4KK6C 4WENB 1TJIH 2EIDA 4U6VL 3DRTA 4OFYD 1AO7A 3FOLA 1FGVL 1UM5H 3PL6D 2X4QA 3VFMB 1GGIH 1JYNA 1QBLH 1RJYB 1FSKB 3LN5A 1TQCB 3WIIL 3X11B 3SKMA 3LEXB 4FXGB 4H25A 2AEQL 2MFNA 4QRPA 4BH7B 3K8MA 3R1GL 2NY6D 4XPHL 1YNTA 3KR3H 1S9KC 3JWDL 1ADQH 2M26A 3Q6GH 4Y1AB 3LPWA 4DTGL 3GSQB 1W72B 1XZ0A 2H6PA 2Y36L 2YK1L 4WHCA 3LEVH 3ZSSA 2HT2C 3GMLB 1KEGH 4ZAKB 5D7JB 5AWNH 4NFCA 4IRJD 4MNQD 1C5DA 1R3LB 4NYLB 1FZKA 4BSVB 4D3CH 4LQFL 4NNYB 1T3FA 1FBIL 3HG1E 1LO4H 4LCCC 4HPYL 1A9EB 1BM3L 4Y5VC 5GS0D 4RFOH 2R2HB 4AENA 1F4HA 1YEIH 1FGNL 5BQ7B 1MCOH 3SKOB 5TPWL 4MHHG 1E4WH 1V7ML 3OKMB 1J8HA 4IMKC 4P23C 2CRMA 1NDMB 5EORL 1RK0A 4ZOAA 1XGRA 2FLRT 3BMWA 3WN5A 5CEZE 1BVZA 4LLWA 3SGDH 5HGHB 3UTTA 3VXTB 2VLKB 4G6JL 4QGTA 2AJYH 3FN0H 1S9VB 4GO6B 5I1LB 3DV4A 4H1LB 2IAND 1FPTL 4WCYH 3INUH 1C12B 3IS0X 1FNLA 1A6TA 4GSDH 2DYPA 2WANA 4KQ4L 3ARDD 4HXBH 4AH2B 4RMRA 1D6EA 4Y2DA 4Y19B 3TVMD 5E2UH 4QOKE 5HYFA 2Z8RA 2VDRH 5L6YL 3O3EB 1W8NA 4I13B 2UYLB 5LJYH 5D6DA 1A6ZA 1AHWC 1OSPH 4HPOH 4KMLB 5DK3A 1ULVA 5TDPB 5LAXB 2NTFB 3DVGA 2VDQL 1N64L 1QOKA 4X6CA 1PZ5B 1Z6JT 3VI3F 4UIKL 4G7YL 1UZ6E 1Z3GL 3VJ6B 4F7TB 3RA7L 4U1IB 4NOFA 1PKOA 3RWCB 3UBXG 5ESAA 3MCKB 3VXRA 3U6RB 2O26U 4JFEA 1RHHA 1XT5A 3Q5TA 2YD7A 3SOBH 5IW1B 2WWMD 5JHLL 4JO1L 2E8ZA 1LD9B 4U6HA 5IG7B 4OZFA 3LKSB 5F1NA 1L0XA 2OMBA 5D7JD 2FZ3B 1JZ8A 5IJKC 3B83A 2AQ1A 2V5TA 1VB9A 4NO0D 2W92A 4CUCA 1R5WB 4KZDL 2O5XH 4ALAH 3RGVA 3S96B 3S34H 1XGUA 3KPQB 5EOCL 4LASH 3OJMB 4LRIA 1MFCL 3MRDA 5I16B 1CZ8H 3CH8A 4F7CB 4V2BA 4Z7VB 4L8SC 1SEQH 1A1MA 2OTWB 2H26A 4X4XA 4JG1H 4X98A 3V0VA 1HSAB 1EJ6A 4ORZC 1P6FA 4F7MA 3GJFB 4LHUG 1BX2B 2VLKD 5C2BH 4UT6L 4NUGL 1K8IB 4NJAH 2V2TA 4HK3J 4L1DA 1LEGA 1IGIH 4PJ7B 3TYFA 2ZUWA 1OCWH 5E6IA 3H9ZA 4PRIB 2AERT 3QUML 1KLFA 4U33A 1NFDA 2VR4A 3MLYH 5IMMA 3IJYB 3VFTB 4K9EC 4OZGA 1QBAA 3DX8B 3MV11 3TBYA 2O61A 1RUQL 4RGMC 3AS2A 3WXVH 5GZND 1P7HL 2ADJB 3G04A 4PJBE 3ZKXC 3VG9C 4G6AC 1OAXL 1PSKL 4Q6IC 4PJHB 4JM4L 1U8JB 3TO4C 3MREA 2Y9RT 2J6EA 4LCCA 4ZFZA 4OI7A 1TCRA 2JJSC 4Y5VA 1OP5K 4HUXB 3T2PA 3GI8L 5T1DH 5I18L 3S36X 4DAGH 1GJIA 1YMMB 1NKRA 2P24B 4CVUA 4N90E 1ZT7B 5LGJA 4I0PA 3OL2A 1RAMA 4HWEH 4KROB 1CN4A 1IKFL 1INEL 2XKUA 3NBNA 3KYOA 4PRHA 5IB5A 1ZANH 4AG4L 5D7IB 2ESVE 1RU9H 1T5XB 1WIUA 2CGRH 3KPRD 2XZAH 3LQZA 1N6UA 2OP4H 2NW3A 1NC2A 1RD6A 3SJVE 2VLLA 3MV9A 3SY0B 4GT7A 3BHBA 3EO0B 3T3MF 4NC1C 1YEEH 1R3IL 1XCTB 4EXKA 2BC4B 5AG8A 3VRLF 1ZLUH 2H3NA 2QHLA 3T65B 4BKLB 2BNQE 3WIFB 2H45A 4OUUA 1SJEB 3SDCC 1KGCD 1OT1A 5I8CA 1GHFL 2DS4A 3B6SA 2QQNH 4GRMB 4EKXA 3I85A 1EO7A 3GMPA 4Q6YA 1G9NL 3VWKA 2W0KA 2YUXA 4Q9BA 1FV1B 2HJLB 1F6LL 1NGZA 3CFDB 1AR2A 4MJ6A 3L3KB 1EGJA 3IDNA 3RUGF 1CFTB 1D9KB 5F8QC 1BIIA 1B0RB 2YXMA 1SVZA 2YRPA 1GL4B 1G9MC 4LSTL 4NUJA 1M05A 5EO1A 4QRRA 3N50A 3WUWB 2BY0A 4M93C 1KN2L 1G7QA 4DKEL 4HDIB 4ZPVB 4ZDHB 4WU7B 1OPGH 4WUUB 4X4ME 1NANI 5T1KB 3NIGE 5IJKA 4WTZG 3KPLB 5C07B 1F4XH 5EU3B 5D1QB 5FIEA 4HSQA 1N59B 4UMGA 5E8EA 1R3KB 4NO2B 2Q8BH 4YZFE 4RSVA 5ADPL 1UH4A 3GMRB 4TVPL 4YNYB 1E6JH 5ENWB 4WDIA 4DVBA 3M17B 5CP3A 4NBYB 1ZLSH 1Q0XL 4PRPA 4J4PD 1AQKH 3W11C 1H8OA 4PBWD 1YMMD 5KN5B 3O45A 2AK4E 4L8SA 4O02L 4G9FD 2UUDK 1D6VH 5TFSH 2ZG1A 1OARL 5EOCJ 3V5KA 3LKNB 3G5VB 3TYGL 1AGBB 4Z7OE 1CLYL 1QA9A 5AEAA 1K8DB 3MCLH 3U9PH 4M6ML 4PJGE 3RAJL 1QRND 5TF1L 3BWUC 1PDKA 4POYA 3GIZL 2HWZL 1NMCB 3MO1A 3WV0A 3DIFA 2XWTA 4XP1L 1NGXB 5C9JB 4WFFE 3TPUA 2OR9L 2AXFA 1BQSA 5EBWB 3WEXA 5LCVL 2X40A 1KB5B 4CVZA 4KPHH 4UOJA 5DZOA 2DLFH 2B5IB 3EJZD 4AMKH 3EFDH 3LS5H 4ZOCA 3TO4A 2EE6A 1I7TB 1HXYB 4AK1A 3MXVL 2V2XB 1L7IL 3QWRA 4ZUSB 4DUWA 3NH7L 2JJSA 4IM8A 4NQEB 1N3NA 2IPKB 4XI5D 4POUB 1IE5A 1WK0A 4X6BB 3O6MH 1FC2D 1WBXB 4HKZA 3I2CH 1BVLB 1W2KT 3D0LA 3QNXB 2EDFA 3DURA 4LF3B 4X9GA 2FATL 3MBXH 3DVNB 1JWUA 1NC4B 2K7QA 3DARA 3GO1H 3QI9C 2P5WA 3CMOL 1LMKA 1YPZF 3ZHKA 4HIIA 2QSVA 1YEHL 3PHOB 3SKJL 4BFEA 4Y4FA 1PAMA 1KPUB 2E7CA 4TNVK 5D5MB 3R06B 4PJCF 5F88B 1XGYH 3G5YA 3REVB 4WUUD 2BVUA 3H42L 5C07D 4BJLA 4XXDA 3TCLB 5I74C 1FO0A 4AEHL 2FLBT 2HTKD 4GLRH 5IHUL 4JHAL 1PG7L 4PRAB 2BVYA 3IF1B 4HMDA 3AMKA 5IESL 3NN8B 5CINH 4AIOA 5DJAB 4JGUA 5GGVY 4GRLA 2VH5L 5I1KH 4JFFA 1MI5B 4WY7L 1G7IA 4J7RA 5KJRL 3FT4B 3VFRA 1MFAH 5ESVA 3QQNA 1C5CH 3X14A 3BD4A 1PQZB 3HC4L 3AXLB 5ITFB 1VADA 1HDMA 1DTUA 1T21A 4HH9B 4BFIA 5DVKA 3RY4A 1J86A 1MRDL 3C6LD 1TPXB 5GJTL 3BJLA 3TIEB 5GSRA 5FEBA 4HULB 5KVEL 5CJBA 4OFVA 4A2LA 1CR9L 3DO3A 2R0WL 1V5JA 1FRGL 3UTQA 1A4KB 1JPTH 1NMAL 5HHQB 4EIGB 3T0DA 3F65A 1G7MA 5ICYB 4FQLL 3CXDH 3HMXA 5JW4N 3BPNC 4NQED 1SYSA 1YC8A 4QYOA 3CVHB 4YC2C 5DHVB 4M62H 2ZUXA 5DRNA 5EPMA 4Y2OA 1U8HA 5L2KE 2UZXB 1QFWL 1WBYB 4AQOA 1JGEB 3QFDB 4R9HA 2DQTL 3RPIB 1UKSA 1M6OA 3MZTA 5EFIA 1NC4D 3IDGA 5D2LE 3HR5A 1BAFH 4MZ2A 4XPBH 3BT2L 1NMBH 1FVEA 3VXOA 5FM8A 1RZ7H 3WLBA 4JFYB 3EAKA 4WO4B 2DQEH 2CXGA 2PTVA 4MXQC 4KKAC 5K9OB 3CLFH 2HT4C 3QA3A 2IPUG 4HT1L 1U9KA 1A3LH 5K9JH 3FQTB 1BLNA 1FIEA 4J1UA 1J05B 3HE7C 1ORSA 4ORGA 4NQXA 3EOBA 1CIUA 3MV7B 2M1KA 2XWBA 1ACYL 1TVHA 2J3SA 3E3QE 4I4WB 1T1WA 4ZUUA 3TBTB 1I3UA 1MI5D 2W0LA 3MODL 5GGSB 4JPVL 1YZZA 3MACL 2BVPB 1CGSL 5JW4R 2QADC 3S37H 5DJDA 3DETD 3ZKND 5K9KA 5E8PA 5EC2A 4AL8H 2ARWA 5CEZL 1YDPB 5DVMA 1OGTB 3QI9A 1UB6A 4XHJC 5DA4A 3UO1H 1PX3A 4XCEA 2XY1A 3O2VH 5F7DA 3C9NB 6FABH 2FX8L 4WJ5A 2J8HA 5I30H 1HH9B 5GRYA 1L6XA 3OB0K 1EJOH 1I9EA 1I85C 1W8OA 1YEGH 2ZOKB 3RZCB 5JW3L 3WFHA 1FL6B 1K5NA 4L4VE 4RQQA 1NCAL 2ILLA 4WV1C 2FEEI 4NQCE 1IQWL 3OAZK 3KJ4B 4WFGD 3WO3B 3GIVA 3CDGB 4QTHB 1MWAH 2W60B 5HGDB 4JO4L 5GS0H 2P5EE 2HH0L 2CK2A 5DDHB 1BBJA 1WV7T 2VUOA 1CL7I 5MENE 4PJIE 4YGVA 4KHTL 3QXDA 1OWRM 1QZ1A 2X4UA 4U7SA 3O8XD 5TDNB 3X12B 1FNGA 1YYLL 3VFNB 2NY3D 2XT1B 4JDZA 2VYRE 1IBGL 4OF6A 1MJ8H 2FO1A 3AB0B 3O4LE 1KBGH 2NZ9C 4Z7UB 4JZOB 5SX4I 3OKNB 4OB5H 3IU3A 1IL1B 4OCSH 1U8NB 3BQUD 2D3VA 2NY7L 2VQ1B 5I1AB 1XIWC 3QIWC 4WTXA 1G6RH 4WO4D 3OGCB 5GQBA 5I1IL 3H9YA 5F9WB 3U2SA 3V0WL 5F7UA 1JUFA 3TBVB 1KCVH 4OZHF 4XH2A 1P7KA 3MLVH 3MC0A 5KAQF 3S5LB 1MHPH 1IC4L 2Z31B 4XGZA 4HZAA 5J12C 1DFBH 5T1MA 4QRSB 4YGAB 4HH8A 3CX5K 2BSTA 3IRPX 1GC1C 2DI7A 3NMEA 4R8WL 5GRUL 1CG9B 1I1AC 3VXUE 2R4RH 5D1ZA 1OAYL 2R1WB 3BUYA 3OKDB 1DVFB 2V9QA 1FNSL 5GISH 3OHXB 4QOKB 3TNMB 1W72H 4C56A 1XF2A 2EKSB 1TETH 1YECL 5GRVL 5JIIA 3F7VB 1T89C 1I9JL 1MJ7L 3LKOB 3QULB 1MIEH 4GG6B 3TN0A 2NW2A 3CMGA 3VFVA 3OF6D 4NWUL 2BVQB 2VIRB 5K93A 1T83A 3RZCD 3D25A 2VR9A 4M6OL 3PIQB 5DMJB 2JB5L 3QO1A 4JZJB 4Q2ZB 4WHYG 1EX0A 4N5UA 1JZ5A 3GUTA 1CI5A 1GPOL 4RAHA 5CLWA 1ITBB 3HE7A 4BZ1H 2BSSB 4UT7L 1HZHH 1QKZH 4NBXB 2Z92B 3VGAC 2Q86B 5I6XB 5KS9A 5DC4B 4L3AA 3GB7A 4Z9KB 1RSFA 2FH8A 3IFLH 5DTFB 4QCIB 1C08B 1AKJA 4NZTH 3FJTA 4M8QB 2ICWB 3REWB 1CBVH 4MHHI 4H1LH 4ZO7A 2FL5A 2CXKA 5DJCA 1CFSA 4OKVB 5EOTB 4TUOB 1HHKA 4KTDH 3NIDE 3KLAA 2R9HD 2YC1B 3OAYK 2V5SA 1WFUA 4FQIH 4P3CH 2X1PA 3TJEL 2CJUH 3HG1D 2BRQA 2GFBA 5DC0A 4WFHE 3CX5J 1MHCB 3EJYD 5IM7B 3CDFA 1C8PA 3W0WA 1KFAL 2X9XA 4NHUB 5FYKE 1I85A 5JO5A 2Z4QA 4ZUVB 3RL2B 5ANMB 1S5HA 2FR4B 5C0AA 1NQBA 1OLLA 4RAUB 4RX4A 4WV1A 4LFHG 2VN4A 2Z31D 4MNHB 2DQIH 4YWGL 4I2XA 5LBSL 3KXFE 4OLUH 2YSSA 3BDYL 1LK2A 1KLGA 2YD5A 1QFUH 5LKNA 4M7JH 2FSEA 4DN4H 2RJMA 4JDVB 4HLZH 4OM0L 4QO1A 4NCDA 1NFIA 4PRDA 1NCDL 1GGBL 5GRVK 1YEDB 4N0CC 4W6XB 4UBDC 3QG7L 3AAZB 1DVFD 3JV6B 3ZDYE 3NZ8A 1G0DA 1KXVC 3GKZA 1RFDL 4QOKD 4DK3A 2ZUYA 3UBXI 5DUBB 5HHXL 2ZCHH 5CILH 3QUZC 5E5MB 3ZE1E 5FAAA 1A6WH 2CRZA 4I3RH 2KQNA 1U8IB 5KVGL 1XIWA 1YJDH 1GYAA 1BIHA 1RIHL 1A3QA 3SE9H 2X4PA 1KIRA 4D9RE 1EDQA 3NABL 2F5AL 3HAEB 4YEEA 4OSUH 4RZCB 1HHHB 2EICA 5I9QB 4S1SH 2ICWJ 1EEZB 2BHUA 1XGPA 1HYRC 1UH2A 3L1OH 4PJEF 5FYJE 3UTZB 3Q6FA 3IDMB 3TFKD 5F8RC 4PGEA 5EZLB 1H3PL 4X99A 2EIBA 32C2B 2IH1A 3P0YL 4XCNB 5F3HB 4MAYC 2KUTA 2VUYA 4DEPC 3GJFH 4G42A 4HC1A