1G7JA

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92h)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFHSTPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase inhibitor/hydrolase
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7jA00
5FA4B 2NTSP 3P4MB 1U95A 2VDLH 4WUUA 1FYTA 4Y4FB 3H9YA 4XCFH 1K4CB 2IADB 2D9CA 3OX8A 3QPXL 3TYFA 5T3XH 3FN0H 4JCLA 3DMMC 1CE6A 3HE7C 3NCMA 2BSRA 1NL0H 1ZWIA 5C6TH 5KVEL 5DQ9B 2KH2B 3GUTB 1NFIA 1JN6B 3O6KL 2Z4QB 3M17A 5FYJE 3WNPA 2ORBH 2XKUA 4D3CH 3QQ9D 3ARGD 3LQZB 5TJWK 4HULB 4N9OB 2GFBB 5JW4N 3BRDA 3VXUA 4GLRI 2R1XA 4K23L 3RVVC 2CK0L 3SDCD 3U4BL 3C8KB 2A77H 3HE7A 3MRLB 1HIMH 1WVZA 3HI5H 3N50A 3JUZA 3QNYB 4P23C 4K7FA 1E6OL 3BP6B 5K9OA 4ZS7H 2HVJA 4MA1B 4XBPA 5GGUB 4CADB 2DLGA 3WFCH 1WC7B 1GZQB 3AU1A 4YAQB 1G9MC 3TBWB 4P5MA 4I0PD 3IFNH 4OGZA 2R23B 4YBLB 5IBUG 3QFJE 5FYKU 4P23A 4L4TD 1NLBL 5FUOH 3FOMA 5E08H 3VXMD 5HYJD 3RP1A 3W0WB 1BD2A 1UENA 3WFZA 1T0NB 1RZKH 3VMOA 3VXPB 1S3KL 3WLWD 4R4BB 4PB9H 3L1OH 3PWVA 1X6NA 3B4NA 4YX2L 3VJ6B 1OCWL 3WSQH 4M43H 1X5JA 3JTSB 4X6DB 1R6VA 3KLDA 3EHBD 5CIPH 2M2DA 1HILB 4TUKL 3OSKA 1XF2A 5D4QA 1WAAF 5F70A 1EMTL 1CN4A 5F9WB 1AGEA 2FHFA 2MQ0A 5A2KH 3L3HB 1MREL 4L5FL 2DLFH 2R0ZL 1FV1B 4R96B 4B5EA 3RRQA 3M1BB 1G0XA 5EORH 4OBSA 3CCHA 4KK6D 1CL7I 3QNXA 4G8GB 3QQNA 5HHQA 4KUZL 4JCMA 3SKJL 2HWZH 2UUDH 1T21A 1AQKH 2NY1C 1T2XA 3LB6D 4QNPE 3IKCB 5C0RH 1I8KB 5J1AA 1QLEH 4ELKA 1AFVH 3VD5A 2Q7YB 4FFWC 4EDWL 1G9EA 1P4IH 4PTUB 4XP1H 3MUHL 3ZYJA 5K9JH 3FFCD 1VFMA 2X9XA 1AIFA 4GAYA 1KIPB 5DI8B 2CRYA 1CD8A 1LNUB 1BFSA 2BC4B 5HHPB 5CZVH 5BZDB 4IOSD 3IFLH 1IM3A 2FR4A 4MA8H 3JWNC 4PD4J 1XGRB 2DQHL 3OAUH 4KQ3H 2RAMA 1GAFH 2APVA 1WBYB 3BGMB 4LRIC 4X6DE 3RVWC 4NNYB 5LGKA 4M7KH 2XZAL 1Z5LB 5ALCH 4GQPH 1TCRA 2BY3A 3QCVH 1ZHNB 2RJMA 3ARQA 1X4ZA 5I19H 3P11H 3MRDB 4Z0BL 3EW3B 4QXUH 5IMOB 1TQCC 3STLA 3CUPB 1UZ6F 4LRIA 3H2WA 4LVOC 4M93B 3O6FB 3S88L 2DQTL 1B3JA 4M9OA 1U3ZA 4G8GE 2YPLD 1CWVA 2W91A 4RISL 2NPLX 2A9NL 1RZ7H 1J9CT 3WIHA 1R3HA 1QRND 1KB9J 4LHUG 4GW5A 1INQB 1Z2KA 1P2CA 3SCMB 1SEQH 5HJ3B 1I8LC 3IJSB 4X6CF 1NCUA 3ZTNH 5CP3H 2ZCHL 2AJSH 2V17L 4NGHL 4MD5A 3G5ZB 5E99H 2XWJB 3QG6A 2VZSA 1DR9A 5GRXG 3QQ3B 4R9HA 5CSZB 1L7IL 4PJHA 1CF8H 4CW1A 3I6GA 1I8LA 2EIBA 1DQQB 2OI9B 1AP2A 3MRHB 3X12B 5A3ID 1A22B 3MCKA 5JUEL 1SMOA 4QEGA 4R97C 2HT3C 4HPOL 4YIQB 1C5BH 3CLFH 4E42B 1YN6A 3HZVB 4XAKE 4S1DC 2YD6A 1WV7T 2PR4H 3AGVA 1D9KC 1VDGA 3NMEA 3GRWH 3E8UH 1MNUL 3DNKA 3AROA 1FNEA 1GZPA 1T7ZA 5I8OH 1VKXB 3C5ZD 5IG7B 4PLJD 5FECB 1FGNH 5HYEA 1CU4H 5D7SL 1B4JL 4NN5C 2VZUA 1D9KA 2R0KH 1CICC 1UT9A 5F97E 4IHOA 4L3EA 5DJDB 3U0WL 1KENL 4AM0B 5BV7H 2NCMA 4MLIA 2XTJB 1HXYA 3RU8L 4W4NA 4U1GB 4WFGD 5HVFB 2R4SL 4JVUA 4AIZB 3O41B 4MAUL 1NGPL 3TC9A 3I75B 3M8OH 2ITCB 4Y1AB 3K4DA 1A6TA 5GZNC 4NBZB 3K46A 2Z8RA 1P7HL 2OTUA 3HFML 4RBPK 4I77L 3V4VL 4KHTL 5LGHH 4CU6A 1A1MA 5J13C 3SDDC 1DP0A 1WCQA 4TPRL 1G7LB 2DTMH 3OKEA 3T65B 3BW9A 1MCOH 4DAGH 5DRXA 4CN6A 5B39A 5JQ6H 4JPVL 2ZJSH 1MFEH 1J0ZA 2E9JA 4PGBB 5EZIH 3UROR 3WHE0 1FZOA 4N5EC 1NSNH 5IMMA 2GJ6A 1DQJA 5ENWB 3SDDA 3SQBA 3MODH 3DV6B 3AC0A 3FZUD 4RGNB 1RJLA 2O61A 3IDJB 5JDSB 4KUCF 3IDNA 4GAFB 2Y07L 2O26U 5JIPA 5CUSL 4IRSD 3CDFA 2EDYA 3P4OA 2XTJE 2P8MA 1BJ8A 3GHBL 1F00I 1EH9A 1A14L 3ECBA 4N8CH 1HOCB 3CSGA 1WZMA 3GNMH 1HH9B 4Y1AE 2R39A 2FEEI 3C8DA 5D1ZC 5DD5H 3ARZA 3GHEH 1AR1D 3HS0A 5BMFL 3ARFD 3IU4L 3BAEL 4LASH 4I0KA 4UTBL 3MGOA 4WFHE 3BWAA 1CDIA 1CR9L 5D1ZA 5C0CE 1FZJB 1CFSA 2ADFL 2D03L 3TBYA 3CH1A 4X7SL 2MWCA 2WWMC 3CC5A 3GMNA 1E4XL 3TO4B 4HIHA 2HRPH 1G9NL 2IANB 3ARGB 3CD4A 4AIXA 3SDAB 5T5FH 1IAIH 5IT2L 4PG2C 5EUKA 5JW3H 3H9SA 5JA8B 3MRMB 1T3FA 3L3JA 3TP4A 4WW1A 4CJ1A 4M7LL 2DDQH 3VFWB 2BY1A 1YY9D 5JOPD 5HGAA 3RY4A 5A16B 3ISWA 2R2EA 3QPQD 1JPFB 1A6UH 1MJJA 2OR9L 2ED8A 4QRTA 1YPZA 3G6DH 5I15H 3OV6A 5I1DA 3IETA 2VDLL 4TUJA 1EBPA 4C57C 4PG2A 4XBGB 4HS8H 4O2CA 1ETZA 4U3CA 3BH8A 3B9KC 4XCFL 3AXLA 3JXAA 4PRPE 3ARVA 3EO0A 3WS6A 5KOMC 1MH5B 1NMCC 2XN9D 1YEEH 3PWNA 1YEKH 4M7JH 5T3XL 3FN0L 1NL0L 1T7YA 1T5XA 5A40E 2VLME 5C6TL 2V7NB 4K7PY 1BIHA 4ODSL 2I07B 5KSUB 3ARYA 2DQIH 3B9KA 2ORBL 2W59A 4D3CL 1RD6A 1BQHG 1ZSDB 5DJ8A 5HXMA 1XIWB 1ORQB 3C60D 4FXGA 2A77L 1ZVHA 4HWZB 1G7PB 1HIML 3HI5L 5E4IA 1IJ9A 2D4FA 4AEIH 3GSOA 3BT2H 1OGTB 4JY4B 1XF5A 3U46A 5HYSG 3QHFH 3MYJA 2QHRH 4ZS7L 2IANE 5DJAA 2VXVH 2OLDA 4P57A 3OGOE 4N1HB 4HMDA 3WFCL 4OLZH 3V8OA 5A2JH 5JO5A 3IFNL 4Z7NF 1K2DB 1WAAE 4DVBA 4WFED 4R0LC 2AJXH 4KKLC 1P6AB 4W70A 4ZAKD 3CDCA 2YD8A 5IB3B 1H3GA 3EJZD 5FUOL 4M8QB 4HWEH 4XRCA 5E08L 4HZLB 4BH7B 2YD9A 4Q2ZB 1F4HA 1QPXA 1RZKL 2F8OA 2YPKB 5KN5A 4PB9L 4R0LA 3L1OL 4L4TE 1DDHB 2AV7A 4KMTH 1FFPA 5JW4M 1QRKA 3WSQL 4M43L 2Z31D 2EIEA 3IRPX 5CINH 1R3JA 1H3PH 4Z0XB 3D3VA 1Q94B 2P42B 4I4WB 4JRWA 4EXPX 3O2VH 4X6CB 4NKOA 2AAVA 4P4KA 4HIIA 3BD4A 3MOAH 5GPRA 4UUJA 3NPSB 4DEPC 1MCPH 3BZ4B 1YMMD 2EYRB 3ABZA 1NEZA 1V7NH 2DLFL 4H8WC 4JFFA 3U0PB 1NUDA 2VZOA 4XP9H 4EXKA 1WZ1H 3O0RH 5ETUA 3TLRA 4I3SH 5EORL 4XHQA 5L8LB 3IFOA 2P5WD 2IWGA 3CFEB 2ZCKH 2GTZA 1MLBB 5LJYH 2LTQC 4HDIB 2HWZL 1VGKA 1AQKL 5C0RL 3QUKB 1GSMA 4OIAA 2Y7QB 5IEHA 3QIBC 1AFVL 4F8TA 4P2CG 4PBXA 5D1XB 1P4IL 4XP1L 5K9JL 3DX8B 4WHYH 2IPUK 3LPGA 5HHXH 5CD5D 3KXFD 3SKNA 2AXFB 3MRBA 5DRNA 2A83A 2X09A 3CIQA 1U58B 3LEYH 5GGSB 1E4JA 5HDQH 5LKNA 5DK0B 1F6AB 3HC3H 3HPLA 5CZVL 4KAQH 2OR7A 3N1FC 3IFLL 4XPHH 1M7IB 4MAYB 4MA8L 3GBNH 4QLRA 3OAUL 4KQ3L 2FSEB 5F7HA 1GAFL 4DZ8A 5GS1C 1WZKA 4A6YB 1KEMH 1U95B 2VDMH 2AJ3A 4WUUB 1FYTB 4ELMA 3DYOA 4X6CE 5DDHB 4FFVD 5CLTA 4M7KL 4HIXH 5I2IB 3QCVL 4YHIA 4Q9QH 3C6SA 1CE6B 4EDXA 3P11L 4R2GC 5I19L 1U8JB 4UI2A 3C6LC 3BZDA 2DN7A 4QXUL 1ZWIB 2J6EA 5GS1A 5J1SC 3B9VA 1NFIB 3U30B 3MO1A 2YS4A 3M17B 3QUMB 4P5KA 1Q8MA 1YEDB 1C7SA 2NX5A 1RZ7L 3BESR 5JPMB 3GEWB 3C6LA 4O2EA 1QEWA 3QJFA 4R3SA 2VLRD 1SEQL 1HH6B 4K7FB 3ZTNL 5FFLA 2AJSL 3W5NA 5HI3D 3W39B 4XBPB 2Q86B 4LLUA 4MZ2A 5EU7E 4PJXF 3EFDH 1KJVA 3AU1B 1C08A 1QRNE 2CK2A 5E99L 3RI5K 4N68A 3IYLW 1LILA 2NZ9D 1CF8L 3WFHA 4P23B 3EFFA 3ARDD 2NZIA 2OQJA 3S37X 2J1KA 3D2UB 2XQYK 3E1F1 1ZLVK 1FYTE 3OB0H 3SGDI 5BVJA 3ZYIA 1JP5A 5I75C 1C5BL 1XGTA 3CLFL 4KKAC 4XTRC 5HGDB 1AD9B 3SKMA 1XGYH 4U1NA 2PR4L 4AENA 5MEND 4KKCD 7CGTA 3VRJA 1UXWA 2BVPB 1FORH 4PRAB 3GRWL 1BZ7A 3E8UL 1JTPA 2E5EA 5E9DA 1RV6X 5IVXF 4OZHA 5D7JB 5I8OL 5FKPB 1LP9A 1C5DA 5EZOH 1FGNL 3BRFA 5J1TC 1GGTA 2H2PD 1XF2B 4HKJB 5T1LA 2DMCA 1GGBH 1I4FB 4C56A 1AGEB 2R0KL 4X8JA 4X99B 3PP3K 2AI0H 1JNNH 5ID1A 2RQ8A 3WN5A 2NY2D 5INDB 4RMRA 5E6IA 5BV7L 3MLRH 4OJFH 3BPOC 1UH2A 4RMSA 5DHYA 2V5TA 4QRRA 2BNQD 1A3LH 3AREC 4M9PA 3CCHB 4NYLA 5CP7B 3QNXB 3M8OL 3MRQA 5HHQB 3N85H 3BVNA 4MJ6A 3FAXA 2GJJA 5DVLA 4U0QB 5J1AB 4X83A 2FD6H 5LGHL 3GMMB 2LVEA 1KTLB 3VXNA 3CX2A 4RGOH 3DX6A 2R15A 3AREA 1KSRA 2ICWJ 2DTML 4GAYB 1O7SA 2AEIT 4OUUA 5FCSH 1MCOL 5CMAB 1C7TA 3HA0A 4DAGL 5JQ6L 3QDGB 2ZJSL 1IL1A 4NHCH 4NWTH 3LS5H 4ZFZA 4GUPB 3AS2A 1BEYH 2FR4B 1NSNL 2ZUUA 2BZDA 4LEXH 1HNGA 5E2TH 3MODL 3OXSA 1JNHA 2VL4A 4GRWF 4W6XB 5CGYC 5FM5M 1AE6H 2OK0H 4TNWF 2WW8A 4LVEA 3TA3C 3I3EA 1MAJA 4AQ1B 1TCRB 2AGJH 3ILPA 3T2NH 2VAAA 2EE6A 4HJ0C 4HIJA 3U36B 4MNGB 1UM6L 4PRIA 4XCEA 2R1YA 3BI9X 3KYAA 3H0TB 4N8CL 1IGJB 1REIA 4PY8I 3F7PC 3GNML 5MI0B 4ZG1A 5I1GH 5DD5L 3GHEL 2R8SH 2EH8H 4G8IB 4PLKC 1NC4A 1TQCB 4KDWA 2VR4A 3V52H 2FZ3A 4ESKA 4LASL 4RGMB 1HSBA 2E6PA 4R4NC 4K71C 2XN9B 4MD5B 1Y18A 4PTTA 4IDJH 2MKLC 3ZYOA 2DI7A 1ND0B 3UBXB 2OXGA 3T8XB 1RHHA 1WCBA 3QDGE 4Y4KD 3JBG7 3QG6B 1QYGH 1P7QD 4ZPVA 4OT1H 2PXYD 2AKRB 2DQDH 3JV0A 4CW1B 3I6GB 4G8FA 4ZDHA 4QXWA 2EKJA 2HRPL 3BXNA 4LNRA 1M71B 3KPTA 3TNNA 2XY2A 2MCG1 1EGJA 1MWAA 1IFHH 5T5FL 1IAIL 5GXBB 2AABH 1AGCA 1ZLUK 5JW3L 3QXAA 4FQQA 1YN6B 1KLGA 3EOAA 1I7RB 2XKNA 2DDQL 3BDBA 2NYYC 2W38A 3U4EB 4CKVX 2F74B 1U9KA 4M6OH 4M4RA 2OM5A 4MNGE 1A6UL 1BGXH 2WM0A 5ICZA 1FNEB 1T1ZB 1GZPB 3G6DL 5I15L 2D7NA 1H8OA 4L8DB 5IQ7H 3PL6D 2EDJA 4Y2DB 1JZ8A 1PSKH 2R2HA 2VLJD 4ONFH 5DR5L 3Q48A 3UYOD 1YEEL 3GI9H 4XMLH 1FNLA 1YEKL 4M7JL 3MRKA 5DEGB 3BZEA 3KYKH 4Z7NE 3QWQB 1HXYB 4ENED 1EHLH 3BE1H 1OAUH 2AV1A 1NKOA 3WE6B 1JRHL 5FUCE 2XN9E 2VDNH 4KV5F 3G6JA 2DQIL 3QI9B 1A6ZA 4CMHC 1KIRA 1S8DA 4JFYA 1EERB 1ODAA 1CXFA 2Z31B 3LKOA 4LOUC 3MJ9H 4H1LG 4AEIL 1DN0B 3ULUH 3BT2L 4OZFB 4JN2A 1G7HB 3ALXA 5D96B 1Q9KB 1RI8A 3NCBB 2QHRL 4YHOH 2EEDA 2NNAB 1J05B 2VXVL 3LV3A 4YHPA 5I8EA 3OKEB 1OAKH 1L6XA 3FJTA 3BW9B 5ADOH 3U6RB 3JWDH 4OLZL 5DRXB 3TZVB 4EI5D 1DJSA 1F45A 5C09A 4JAMA 3P0YH 43C9B 4U31A 2XI9A 1WSST 2AJXL 2XWBB 4Z7VF 4OCXH 1JMXA 1OLZA 1IEHA 5JXAH 2QADC 1MI5D 3AUVA 4X4ZA 2O61B 4HWEL 4QRQA 5FO8A 2ZWLT 4XVUC 3W5MA 4BUGA 3IDNB 3GMPA 4WFEE 2QEJA 1RFDL 4M7LT 1I1FB 2DIAA 2MKWA 3Q5TA 4XPTH 3VCLA 5I73C 2X40A 4M03A 4KMTL 2L7JA 2P8MB 5CINL 3HPJA 1DVFB 1H3PL 3SE8H 3QHZH 4MB3A 5IK3A 3O2VL 3UX9B 4JPKH 2W65A 3NH7H 4JRYB 3G5VA 2G9HB 3MOAL 3EO1B 3WMSA 3VFTB 1MCPL 1YY8A 1QACA 4WTXA 1H15A 2QQQA 1UA6H 1V7NL 5T1MB 2I24N 4HKXA 1I9IH 5DD1H 1UEMA 4DOHB 3KJ6H 4XP9L 5ELIA 4PGCA 1WZ1L 2VLLB 3O0RL 2X4SA 1P1ZA 3MGOB 2Q1EA 4I3SL 3UJIH 2YUZA 2ZCKL 3L95A 1CTOA 2PTUA 1CFSB 3V4PH 4M1CC 3PGFH 3TBYB 1G7JB 4BELD 5KSBA 1IQWH 4YDLC 3CC5B 3LEVH 3MGTA 4N0FA 1NGWB 3FKUS 5J3HC 4HIHB 5T3XD 1NBQA 4M61A 5HHXL 3TESA 3HR6A 3TT1H 2P44B 1KB5H 5HDQL 3LEYL 1T3FB 4IS6A 4WW1B 3HC3L 4KAQL 2YEZB 1NMBH 3Q5YA 4KJPD 4XPHL 5HGAB 1YEJL 2XTLA 4XCCH 5E6ZA 2NXYB 3GBNL 1MJJB 2X1WL 1CFNA 1YPZB 5DMGC 9CGTA 1KEML 2VDML 1WFOA 4TUJB 3LN9A 5L88H 4HWUA 3BOVA 1MLCA 4BM7A 3VD3A 3HLAA 1NUNB 3AXLB 4JRYE 4HIEA 1QFUH 3QDJA 3EO0B 4HIXL 1S7TA 3TBTA 2G5BA 4PREB 1LWRA 4LQFH 4Q9QL 2V2XB 4LBEA 1EV2E 2A6DB 4LPCA 1FVEA 3BQUD 3KDMB 3MRRA 1XCTA 4JKWA 2MQCA 3T09A 5MEQA 5F96L 1HXMB 4YC2C 4E41D 4FMFA 2FJFB 1VACA 2FCBA 1NMCB 2UZXB 3S3SA 2VXSH 1A4KA 5DJ8B 4KI5D 4ZO8A 3DRTB 2OXHA 5I8CA 3BRGC 5FCUH 5JW4Q 1SVZA 2X42A 2WIMA 4X5XA 5BJTA 2V5YA 4BZ2H 2GSGB 3GSOB 4Q6IC 3KLAB 1OP3K 1AGDB 1KF9B 3EKCA 4YDVA 3RKPA 2PTTB 1U8KB 3MYJB 4OIIH 5C2BH 5IVXE 3DETD 5DJAB 3JWOH 4NKMB 4Z7OF 4JFEA 4FQLH 4GRWB 1D5MB 3SJVD 4K3HA 4YDKH 2FYYA 4EUPA 4KDVA 3MCLH 4U7SA 4U33A 1FZMB 3EYFA 2J8HA 4ZUSA 1YPZE 1TPXC 4HCRA 1YNTA 3F6LA 3PHOA 2YWYA 3RNKA 4XRCB 3BGAA 3UPRA 3JTTA 1RZJC 3EOYG 2OCFD 2ZG2A 5IB2A 1S7WA 4MNQB 3VWKD 1XGYL 2UWEF 2GK2A 3U48A 4YO0B 3L3OA 1FORL 1WZLA 2AQ1A 2AV7B 1XAUA 3D39D 4OLEA 1R3JB 2PYEA 3D3VB 5EZOL 2Q7NA 5HVWA 3OB8A 4U1IA 3PABA 4JRXA 4BSJA 4NKOB 4P4KB 3BEVA 12E8H 1GGBL 2QR0A 4UUJB 5E03A 3MNVB 1I1AD 4JFPB 1QQDB 1CLZH 2I5YH 2AI0L 3VFMA 1JRHI 1JNNL 4N5UA 4P3DB 3MLRL 4YHMH 4OJFL 4Y4HA 1KLFA 3NVQA 1SJXA 1LQSR 1A3LL 3WFDH 3BMWA 3IFOB 3N85L 4JM2F 4GRWE 3UYPA 2CO7B 4NQXB 2FD6L 5IEHB 2BNQE 2BSSA 2BSTA 1QFPA 35C8H 4RMUA 1CFQB 4RGOL 4CDGC 5D5MF 1NCNA 1BFOB 2BNRD 3KHQA 5DRNB 2A83B 3KPSD 4MNQE 1JIBA 1MUJA 4H88H 1T22A 4NHCL 3HPLB 4NWTL 3LS5L 4I2XB 3QIUC 1BEYL 2W60A 3HAEG 4LEXL 2FHBA 5E2TL 4DZ8B 4TSBH 5FYLE 3D3VE 1F13A 3UZEA 3D25B 1AE6L 4Y4KB 3VGAC 5DJYB 5LXGH 1P7QB 3O4LD 5FDYA 3FB6A 2PXYB 5F89B 1LEGB 2AGJL 2H32B 1XGPA 3I6LD 3VG0H 3QIUA 3T2NL 1MQ8A 2NY6D 3VXSD 5DHVA 5EO0B 3C6SB 4EDXB 2BRQA 2RFXA 2X4RB 4F9PC 3VE0A 4XH2A 5GS1B 4L4VA 4JO4H 2X44D 4J12A 3MO1B 2Z8WC 4ORGA 2FO1A 4NDMA 5DVKA 4P5KB 4ODUA 4HEME 5F44A 1S5HA 1HI6A 5GSRB 3V5HB 2DKSA 5I1GL 2H45A 4UQ2A 3HI6L 2DQFA 5K9QI 2R8SL 2EH8L 1U41A 4F9PA 1Y6NR 4O2EB 3S34H 1PYWA 4NC1C 3V52L 3RX8A 1IAMA 4HBCH 3SDYH 1N7MH 2VLJB 4DK6A 4IDJL 3S8WA 3ES6A 1KJVB 3BUTA 5D7KE 1YN7A 1ZLSH 1FYHB 4I2XE 1W8NA 4OT1L 1BFTA 1IAKA 4WDIA 5FYKE 3DVGB 2DQDL 4D0BA 4XPFH 1I85C 3WFHB 1IC5H 2C3GA 4IMLB 4Y7MA 5C7XH 3WNNA 3IDUA 3MRGA 1DBBH 3L5IA 3CPLA 1BZQK 2C1PA 2DKMA 3SGEI 2IBGA 1IFHL 2DM2A 4JZNB 1IGFH 2AABL 2R1WA 1A5FH 1KYOJ 3SKMB 3E6HA 2CR6A 4U1NB 4KV5E 1T0MB 4NN6C 4TTGA 1UXWB 2GK0B 2HT2D 2IH3B 1I85A 4XC3H 4OGAD 2UY7A 4M6OL 3G5YA 1BECA 4HW6A 5E9DB 1BGXL 3UTQB 5C9JA 5EO1B 4U1SA 3V6FA 4HK0A 2DQJH 4OGXH 1LP9B 4LCCC 5DJCA 5IQ7L 4LMQI 3HZKA 1MSPA 1MCKA 4LLDB 5E1AA 1PSKL 1QTYT 4NM4H 4ONFL 4YJZL 2RB8A 3A0OA 4C56B 1UJ3C 3GI9L 5KS9A 4XMLL 5ID1B 3WN5B 1B2WL 5E6IB 1ES0B 3KYKL 1K6QH 1EHLL 3BE1L 4TSAH 4U1MA 2X89A 4LCCA 4Z7VE 3DGGB 5DHYB 3VGGA 1OAUL 1KIQA 2VLJE 1J10A 2VDNL 4NYLB 3CSYA 3OF6A 4S2SB 1EEYB 3RVUC 3ZLQC 5M95B 4G3YH 3UAJD 5IBLC 4QGTA 1X3DA 2CSPA 3BVNB 1UJ3A 1OTUD 4MJ6B 1SM3H 4O02H 4PJAA 2HP4A 4M4PA 1EJ6A 4LU5H 1NFDA 1S7VA 1YUHA 5ICXA 3MJ9L 1IEBA 4RBPH 1B4RA 2X2YA 3ULUL 3NIDF 1RUMH 3DUSA 3B83A 4RRPG 3VXNB 3BKCH 4YHOL 4KJYA 4EBQH 4EN3C 3MLUH 2R69H 3RUGA 1OAKL 1JPGB 3NFPA 1U92A 2WUCH 3JWDL 3HNVH 4OF7A 3OXRA 1FNGA 1IL1B 3EYQD 4WTWA 1X4YA 2LVCA 4ZFZB 1DE4A 3P0YL 1NANH 4OCXL 5E9DE 5D7LD 3T0ED 3QNZB 1PZUB 3HZYA 5JXAL 4JG1H 4JQXC 4EN3A 3DI3B 3O3AB 1LP9E 5TDPB 5H8DA 5JORA 2VO5A 1W2KT 3GSUA 1NDMA 1U3YA 3HR5A 1P7KB 4J1UA 2UVFA 4FQIH 4C56E 5TDNB 1U8MB 5M7QA 3QFDA 3ILPB 4XPTL 3KR3H 5E0QA 2ED7A 2VAAB 3DVNB 4Y0GA 3NCYP 3DMMD 4PRIB 4XCEB 4JQXA 4K3DH 4PB0H 3SE8L 2D31B 3QHZL 4RX4D 3K8MA 1Z6JT 4TNVF 4JPKL 2OYPA 2FGZA 2I60H 5JIHA 3NH7L 3FCTB 2R4RH 3F65A 5HI4D 1GXEA 1MEXH 2AW2A 1NC4B 1UA6L 5IHZB 3ZHLA 1I9IL 5SWSA 5DD1L 2FZ3B 3KJ6L 4K8RH 1CIUA 1A7RH 3TWCH 3D85B 1HSBB 3UJIL 2HLFC 3FQNA 2BVOA 1Y18B 3MMEB 4PTTB 4JG0H 3A67H 3LKPB 1AO7A 4CUCA 4IEFB 1RHHB 3DUUA 1BD2D 1JGLH 2PW1B 5DC0A 3V4PL 1UQSA 4P48A 3PGFL 2BMKB 2VQTA 1IQWL 4PJ9C 4X7EC 1DBKH 1CXIA 3LEVL 1KELH 1QLRA 4K9EC 1EFXB 4JQIH 3OKOB 3BXNB 4P9HH 4LNRB 4MJID 3TNNB 3QO0A 3W81A 1VCAA 1AGCB 3ULVH 4FQQB 3TT1L 1KB5L 4UU9B 1L4IA 1UACH 3BN9C 1WWWX 1NMBL 4PJ9A 4Q58C 5T3XE 4PGZA 4XCCL 5D72H 3QG7H 3B43A 4L3AA 3EJJX 5ICZB 5D1QD 4KKNA 4JZJB 3DSNA 3GBLA 4WVRA 5CIPB 3SJVB 2DAVA 5L88L 1FH5H 3RIFK 3BPCA 4AEHH 2R2HB 1QFUL 1MVFA 4Z7OE 2DLHA 3S98A 5FAAA 4JM2B 4LQFL 3SOBH 5CAYB 3BZEB 7FABH 3OKMA 5H35B 1NAMH 1FSKC 4MQXC 4F7MA 4U3HA 2AV1B 2OTWB 1NCBH 1SYVA 3MV7A 4CMMA 4RFEB 5KVMC 5D5MB 5DURB 5EU6A 3K4ZA 4ZXBD 2VXSL 1P4BH 3S5LB 4I0CC 4JFYB 2P5EA 5EN2B 5EU4A 5FCUL 2NY1D 3X14A 6FABH 3LKOB 2UWEE 4BZ2L 1N59A 4X5WB 3EOBA 3P0VH 4FG6D 2ATKB 4OIIL 5C2BL 3TVMC 1QFWI 2AK4D 4HUWA 1HEZB 3OAZH 4YHPB 3JWOL 2R2CA 2WP3O 4FQLL 3ARRA 4IRZH 1W0WB 4U2ZA 4YDKL 5C09B 3QEQB 3MCLL 1LGVA 2PO6C 1PAMA 2CUIA 5C3LD 4JKMA 2NY7H 3BYYA 3TVMA 2JJUA 2JB6B 4MNHA 4K94H 2F54A 5HDBF 3SJVE 5A2FA 5T3ZH 3V7MA 5E2UH 4WEUD 3GMPB 2YXMA 2O5YH 4TNWK 3VCLB 2R56H 1OTTC 3EUUA 4LLWA 2PO6A 4NQDD 5ESAB 5HVHB 1UGNA 3PDGA 5IK3B 2YZ8A 4WI5A 3V9FA 5D5ME 5FDWA 3MC0A 4Y8AA 3WEXB 12E8L 4JR9H 4PRDA 3VA2C 4BFBD 3QR2A 4LLYA 4K7PX 4Z77A 5I73B 1CLZL 3MLTA 3T3MF 2I5YL 1YY8B 4Y5XC 2NY0C 1H15B 4PYGA 4YHML 1FAIH 4RAVA 2P47B 4PGCB 4XPAH 3NIFF 3RWHB 1P1ZB 3WFDL 1SYSB 4EJ1C 1ZVYA 5FO9A 4S0TD 4ONOA 2OBGA 3TEUA 3EBAA 2OS7A 1ITCA 2YD7A 1H0DA 4JANA 3MZTA 4Y5XA 3WUWA 1FFOA 5C09E 3BHBB 3QEQE 1YMHA 5EBLA 1TVBB 3MGTB 4MDJA 4N0FB 35C8L 5D7IA 5IR1A 2H8PA 3VH8A 1EO7A 2E7HA 2Y5TA 3RWDA 5A2IH 2HT3D 1B0RA 5I30H 5EBWA 1WT5C 2EKSB 2IFGA 2V9QA 1NFDF 2WBJB 4H88L 5L2KA 2F19H 4S1DD 4OLUH 2VISA 1D9KD 3HMXH 5I66A 4JDZA 5KANG 4L3ED 4PJBA 3UTTA 4GKSA 4TSBL 2YKLH 4L9LB 3O3BB 1RUQH 1ZMYA 4IRJC 1WBZB 4UT9H 1BPVA 1WT5A 5LXGL 3HLAB 4N0CC 2ADGB 4ZQKA 5F7EH 3KPRB 3VG0L 4KZDH 1CICD 3PWPD 2ICCA 2JJSC 1FVEB 1JWSA 4ZSOA 5MHSE 3MRRB 4JO4L 5FA3A 1LEKA 3O4LE 3G5XA 3JV6B 4IRJA 5MEQB 3MR9A 1G7IA 3P4NB 5KSAC 3I6LE 3RWJA 1J0IA 1VACB 3JVGA 5F1IB 3UJJL 4JY5H 3S36X 3T4YB 1A4KB 2EE9A 3BP4A 3K4AA 1NCTA 5GZND 3QUZC 2NY4B 5I8CB 3RDTA 3VXTB 3KYOA 2Q87A 4LSPH 4X5XB 4X98B 5BJTB 5LCVH 5CJXC 3S34L 2JJSA 5JHDA 1UB6B 5GRUH 2R2BA 4KC3B 4GRLC 2GJ6D 4HBCL 1N7ML 5E56A 3SDYL 3LY6A 5KSAA 3SDDD 1CGXA 1KLUA 4NCC1 4RMQA 5SV3A 2B5IC 5C07B 1N2RB 5GRVL 4QY8B 2QQNH 3QUZA 3QCTH 5HYSA 2FYYB 3GO1H 4JZOB 4EUPB 1LK2A 1ZLSL 4LVHB 4MXWH 2MPAH 1JWUB 4F7PA 4XPFL 3VXQA 1IC5L 4N5ED 5HBBA 3EYFB 4GRLA 5C7XL 4ZUSB 2DYPA 1QSVA 3DECA 2GYSA 3PHOB 1DBBL 3B3IB 3RNKB 3O8XB 3P73A 5BRZA 3JTTB 1ZLVH 1IGFL 1WK0A 5HHOA 5IB2B 5DK3A 5D93C 4MA7H 3KPRE 4X4ME 4HUUA 4NT6A 4V1DA 3L3OB 1JV5A 4XC3L 5JZ7C 5DSCB 2W92A 1TPXB 1KXTB 4L8CB 4KK5C 2DQJL 2PYEB 4OGXL 1CZ8H 1CI5A 3NIDE 2L0DA 1TIUA 3R0NA 3PABB 4U1IB 4YGVB 3V6ZA 4HT1H 1TZIB 2N56A 3BEVB 4NM4L 2QR0B 2HJFA 5L6YH 2PW2B 3E0GA 5D7LB 4OD2A 3GSVA 5EPMB 3T0EB 1K8DB 5IF0A 1MQKH 1CDHA 1JFQH 5F7WC 4Y4HB 1K6QL 1T83C 4TSAL 5E7BA 3MX0A 1DBMH 1INDH 5C07E 4CNIB 4G3YL 3RGVA 1KULA 4WJ5A 1DLHA 1SM3L 2BHZA 4O02L 2X7LB 4HXBH 5SX5K 4MX7B 4JHWH 4LU5L 2CKBH 4QHNA 1T83A 1AGBA 2WWMD 2BSTB 4Q7DA 4HMEA 4KPHH 4YXKH 2Z8VC 4PJ7A 3BKCL 2MTPA 1EDQA 1V3KA 4NN7C 3C5SA 4EBQL 4LAJH 2HTKD 3MLUL 1URLA 1BAFH 2R69L 5HVGB 5TQ0H 1F4XH 2PF6A 5CD3A 4URTB 1U8IA 2JKXA 1D5ZA 2WUCL 3HNVL 3QWRA 4N8PA 4QHKI 1FCGA 1SHMA 2LAAA 1JTOA 1UWGH 2ERJB 3HG1A 1W0VA 3JV4A 5FO7A 5DUBA 5MEOA 3EDFA 4HH9A 3IAPA 4FQIL 1I1YA 3B9KD 4NZJA 4P2RA 3G08A 4OAWA 4NJ9H 1XGPB 5D7LE 2E7LC 3KR3L 3T0EE 2X1XR 4JGMA 4I9WD 4YH6A 3VE0B 4XH2B 3KGRA 4K3DL 4PB0L 4L4VB 3O3EB 1NFKA 4P5TC 4D0DA 3VGDA 2I60L 4NDMB 1ZHLB 4ODUB 2DIBA 2CDGA 2OMBA 2P8LA 2E7LA 5C0AA 1MEXL 5D1QB 5SX4I 4WIQA 2Y1VA 5E2JA 3WHXA 2PTVA 2K7PA 5K9QG 2AXGA 4FZEL 4K8RL 1A7RL 5DUPH 3QDMA 4P5TA 1ZVSB 5HD8D 3GJFK 3O3UN 5DK2B 4JG0L 1FVCB 5DZLA 3OQ3B 3A67L 5AAMA 2FX8H 1O5DT 4C83A 5TDOB 1JGLL 4QF1B 3D48R 1YN7B 1PEWA 1U6AH 4WDIB 1WTGT 4D0BB 4AEFA 1DBKL 1KELL 4KQ4H 3RPKA 2ILLA 4JQIL 3SGJA 4GS7C 4BH8A 1QNZH 1X5YA 3NGBC 4P9HL 2IQAB 3UBXG 3QXTA 1H3UA 3CPLB 2IG2H 4N8VB 2WV3A 5AYUH 3MBEC 3QUXC 3ULVL 4JGJA 4G6FD 3E6HB 5J7CC 2IQ9H 3EJYC 4RFNB 4ERSH 3DX9A 1UACL 3ULSA 4I48A 4OV6F 3D9AH 2BJMH 3BUYA 2XRAL 5EU5A 5D72L 3IXTB 3QG7L 3E2HB 5C0BD 5C9JB 2RIKA 1F2XK 4NNPH 3V6FB 4XX1E 2L4OA 4HK0B 5FF6A 1CIDA 2XNAB 3KHOA 5GSVA 3HZKB 4WO4C 1FO0A 3MBEA 3QUXA 2D2OA 2B4CH 1RVFH 5HHMD 5E1AB 4JLRB 1EHAA 4AEHL 3LKSA 1I7ZA 1DFBH 4M6AA 4Y5YA 1J87A 5GRYA 3SOBL 1ZT7A 7FABL 1P5UA 2GY7B 4TVPH 1NAML 4QWWC 3HE6C 3J8F7 4U1MB 1WQVT 1YEIL 4WTZA 2HT4D 3SKOA 5DUMH 5H37H 4WO4A 1KIQB 1NCBL 2DM4A 1S9YB 5D9SA 4HUXB 5ICYA 2EZ0C 4MCZB 1HDMA 1IKFH 4LL9A 2JJTC 5HDBE 4PJAB 1P4BL 5B22A 5B8CC 1NGXA 4Y19D 4NQDB 1E28A 6FABL 4DVRH 4NRYB 1NFDB 1S7VB 2VJXA 3MV8B 3RTQB 4OF5A 4G42B 1F3DJ 3ZKSD 4XXDA 5CKGA 3QIBD 3PJSA 3P0VL 3QAZC 1YYMH 3DUSB 1MIEH 2QSVA 1MHHA 2HRLA 2OJEB 1F4WH 1EAJA 5JW5B 2JJTA 3EYSH 4IRZL 5E8EA 5DZNA 3NFPB 5L7XH 1U92B 5B8CA 4YHNA 4OZFG 3CZJA 3F12B 4ZFGH 5AAWA 3ULUF 1JHTA 3T0VA 2EIZB 1DE4B 1TDQA 3JZ7A 4BA8A 4QRUB 2AK4E 3T3ME 5DQDH 2NY7L 1JHKH 4PRHA 3AB0C 5B39G 4IJ3C 4K94L 5AWNH 5JORB 5T3ZL 1ZS8B 4OD3H 2OSLB 5E2UL 3NIFE 4M3JA 4YHLH 4J1UB 2O5YL 3V0VB 1ZT1A 4PV8A 1SJEA 2NX5D 2R56L 4XPGH 1G7MB 2IPKB 3DHMA 5K9KA 3OKKA 3KPNA 2E3VA 4R2GD 4JREC 1X5IA 3C6LD 4CN1A 3QIWD 4XVTH 3QXUA 3STBA 1U8PA 4QCIA 2FNBA 4JR9L 1S7SB 4PJAE 2UYLA 3FB8A 4NQDE 4AMKH 1KXVC 3L7EA 4KRPC 1NFDE 3MV8E 4WHTA 4X4XB 1U8NA 4G9FA 1FAIL 2X4QA 2D7TH 1T03H 5HGGS 4XPAL 2P7TA 2YZ1A 1CVRA 5DMKB 4P2OC 4ZOAA 3LKNA 3PWPB 1I3GH 4C4KO 3F7YA 5HGBA 1UQSB 3H7BA 3V6BR 5KJRH 4NQTA 2G60H 4PGDA 1U93A 3OJ2C 3KPPA 5F7UA 1QSFD 2VABA 1NMAL 4PS4H 5ISZB 3EDDA 2FECL 1KEGH 4JPWH 4F80A 4FXKB 3I85A 4P2OA 4Y16D 1UEYA 4PY7B 1JF1A 4YFLI 1AKJA 1VENA 3EDEA 1WBXA 3LN4A 1OQXA 5I30L 4W68A 3UC0H 3NZ8A 4K3EH 4U3XA 5HYQA 2F19L 1ADQA 4OLUL 5I8KH 1IAIM 2OJZH 4LHJB 3HMXL 2YA0A 5H94A 4UIMB 5E2WH 4Z5RB 5GS3A 1QKZH 5EOQH 2E9BA 2YKLL 1S9VA 3KPOB 4OCYH 5IKCB 1XR8A 4WFFD 1RUQL 4QRRD 4UT9L 3BPCB 4ODWB 4GW1B 5F7EL 4KZDL 2G75A 5DEFB 2JJWA 3OKMB 5IIEA 5DO2C 1KJMB 2IALB 4JJ5A 1UH3A 2OZ4H 4IM8A 4F7MB 1SYVB 3MV7B 4X9IA 4CMMB 1CLCA 4YFEA 4FP8H 3ARED 4NSKA 1VPOH 5EU6B 3CVHA 1MPAH 3PWPE 4JY5L 2I25N 3RWGA 5B3NA 5EU4B 3X14B 4LSPL 3GSWA 5LCVL 3FAWA 4WI6A 2XY1A 3EOBB 2BVEA 1Q1JH 5ISZE 5GRUL 4G80A 4U6XA 1WIUA 5EOTA 2Z35A 3UJTH 4XP5H 1GGIH 5T1KA 4NRZA 2ICWA 2QQNL 3V5KA 2NW3A 4EQ2A 3QCTL 3GO1L 3KPLB 4MXWL 2CRZA 2MPAL 4Q9BA 1ZT4B 3O45A 1MHPH 2X4PA 3QUYB 1K9TA 4J6RH 4OFYA 1HHGB 5CGYD 3IVKA 5CJQH 2EDFA 3QP3A 3TA3D 4EQ3A 1S7XA 4MA7L 2JIXA 5EC2A 5I71B 3ILQC 4MJ4A 4G9DB 1IM9B 2MHAA 4UDUA 4OV5A 1F11B 2CUMA 1NGQH 1DUYB 3B9DA 3VG9B 2X70A 1CZ8L 3MV7E 3WO4C 3QEUA 3X3GH 5EU6E 1DBJH 4HT1L 3IB4A 1K4DB 4GH7B 4PRDB 5EFIA 3PWJB 3TCLA 4LLYB 2XACC 5L6YL 4Z77B 1OTSD 3FRPA 3RHWK 4MGXA 2HYMA 1OSPH 2IMNA 1MQKL 2HJLA 1MHEA 3I6KA 5BXFA 4PLKD 5IFJB 4RAVB 4RDQF 3TPUA 4XCYA 1PG7H 2I27N 4APQC 4F7CA 3RJQB 2E7MA 4M02A 1DBML 1P9MC 1INDL 1PLGH 1M05A 1IGIH 1BOGB 1Z0MA 2VL5A 1H0DB 4GSDH 4JANB 3K2MC 1G6VK 4Y5XB 3WUWB 1FFOB 4JHWL 3WV0A 2CKBL 2D4DA 5EBLB 4MDJB 1J8HB 5ESVA 4N90D 1MELA 4U6YA 4KPHL 2K1MA 4YXKL 4APQA 5IR1B 1AGFA 1T04A 2Y5TB 1P9MA 1H5BB 2ARJQ 1JGEA 4Q6YA 5L9DL 4GLRH 3SO3C 2X4OB 4NRXA 3U4AA 1BAFL 5TQ0L 1FDLH 5EBWB 1TMCB 2W1NA 3CLEH 1F4YL 2VISB 3ZKNC 2JELH 3KYNB 1P4LA 4J8RA 3UTTB 1RK1A 1UWGL 3BP5A 4GKSB 3HB3C 1FLRH 5DJ6A 4YBQC 4H26A 4CAGA 2X1PA 1E4WH 1UKQA 2BFVH 2DD8H 4NJ9L 2YSSB 5CEXA 5FOBB 3QFJA 2JCCF 4JKLA 4CL7A 1CD0A 3O2DH 3WBDA 2PUQT 1OOAA 1JWSB 4ZSOB 1K5NB 1WLHA 3ZYZA 5LQBH 3P4MA 3GM8A 3LHPH 4L3CA 3RNQB 3UTSB 3DHJA 4HGKC 5E8DH 3V6OE 1KFAH 5DF0A 3A6CH 1K4CA 3BP4B 2EDDA 4YXHH 3S97C 2O5XL 3RDTB 3KYOB 4YXLH 1V8HA 4LOUD 1KNOB 3IRZA 3X11A 1A6VH 1J8HE 2R2BB 5DUPL 1XZ0B 4UV7H 1LEIB 1JN6A 2Z4QA 2X9WA 3AS1A 5DQJA 2KZ1B 3MPCA 4MA1C 3LQZA 2XA3A 1PZ5B 2GFBA 2LV4A 1LK2B 4LRNL 3FB7B 4XI5C 3T0DA 1U6AL 4N9GA 3MRLA 4TVSa 2W0LA 4Q9RH 3VXQB 4YBLC 1CL7H 4KQ4L 3WDHA 3UTTE 1QNZL 4LSSH 1RMFH 4TSCH 1JZ4A 2QADD 4QTHA 2A73B 3P73B 4FQXA 2IG2L 4Y19B 4YDIH 5J6HA 5AYUL 2EC8A 1YNKH 5GGUA 4CADA 5HHOB 3KPMA 2E6JA 2IQ9L 5E24E 1WC7A 1GZQA 4ERSL 4YAQA 3TBWA 4V1DB 4GG8A 2R9HC 2YMXH 3D9AL 2R23A 1JV5B 3RZWA 2BJML 3MNZA 1X5GA 3KPQB 4NNPL 4G6JL 4XMPH 5CFHA 2ICEB 3KLHC 3EOTH 4F9LC 5KVDH 4PJCF 1A7PH 3SQOH 2C3HA 3TN0D 2B4CL 1RVFL 3UTSE 1E4KC 1GH7A 4XCNB 1F8TL 2COQA 1T0NA 2HJFB 1HWHB 4U0RB 1DFBL 2CLZB 1ZANH 4OD2B 3GSVB 3PE9A 2CH8A 4R4BA 5F9WC 4BZ1H 1GYAA 4KDTC 5DRWB 3ULUE 3BYTA 4TVPL 3Q6GH 1A2YA 1U36A 5DUML 1EEZB 5IFHH 3JTSA 4JFHD 4X6DA 3UYRH 2NQCA 1TJGH 1H3VA 2EYTA 3RGVB 3P30H 1E6JH 5C0NC 1IKFL 4F2MA 3V0WH 3HRZB 3H8NA 4M1CD 3L3HA 4DVRL 4PFEA 1VFUA 3FRUA 1AGBB 3LRSB 4R96A 1YYML 1MIEL 4GBXB 4PJ7B 3LVEA 5GGRY 3KYMB 3HKFA 1F4WL 3M1BA 3U0TB 4Y19E 1W72H 3ZKMC 3EYSL 4G8GA 4UOW1 1U8IB 5L7XL 2V2WB 5HHOE 3VXRD 3KS0H 1OF2B 2VQ1A 3PF2A 3SN6N 4ZFGL 3DTXA 2UZYB 1KCUH 3HMXA 3IKCA 2UV3A 1I8KA 3VRIA 2VSCA 1TJHH 5DQDL 5DZOA 1NCDH 1U3HC 1JHKL 4PTUA 5DMGD 3ARSA 5DUBB 5AWNL 2E8YA 4HH9B 1KIPA 3HI1B 4OD3L 2PN5A 5DC9B 4K8RD 2D7PA 4YHLL 2IPTH 1CXKA 4EIGB 1I1YB 1LNUA 5GISH 1FIGH 5HHPA 3ZDYF 2KDGA 4XPGL 5JPNB 5H2BA 4Y16B 1U3HA 1XGRA 1SBBA 4D9LH 2NY3C 1KTDA 4XVTL 2Q20A 4M93C 3O6FC 1CDJA 2JF1A 5DGQA 2YUWA 4LLAA 4HGWB 4Z7QF 2Y5EA 4JFED 4A2MA 2Z91A 4AMKL 1ZHNA 4OIBA 1A64A 1ZGLB 1NC2D 3WHXB 3MRDA 1U8LA 2D7TL 5IMOA 4PJ7E 1T03L 1OAQH 3SCMC 5IB4B 2Y4SA 3O6FA 4IMKC 4JQVC 4OFVA 3VD4A 1BQSA 1I3GL 5F9AC 4C83B 2R0LH 2P43B 3FT2B 1CD1B 1NUGA 5KJRL 1NCCH 2G60L 1F02I 2P45B 3WO3B 1RURH 4PS4L 4O5LH 2DI9A 4MS8D 1KEGL 1QFWM 1A0QH 4JPWL 5HJ3A 5ACZA 4IMKA 3MLWH 4H1LH 4JQVA 2OI9C 5JOFA 2FB4H 5GRWA 1DLFH 2QJDA 2AS5M 4U6TA 4P49A 4K3EL 5LWYH 4WENB 4JHAH 3DX9B 4KTDH 5I8KL 1LE5A 1QSFE 2OJZL 2ED9A 2H26A 2XWJA 3L3GA 3GMQB 1OGAD 3DVIA 1BVKA 2X4TB 3JUYA 5E2WL 3NGBB 4PP2A 1QKZL 5EOQL 5FF6B 3IAQA 3MACH 3MRHA 3X12A 4OCYL 4WI8A 3ULVF 1CLOH 5D2LF 1FE8H 3W9EB 3QISA 4CU7A 3HZVA 4LAQH 1I7ZB 1S3KH 1JZ7A 1HSAA 3LQAH 1S7UB 2VN4A 4Y5YB 3EO9H 5KG9B 1OVZA 4R90H 1MAMH 3MOQA 2XTJC 3NZHH 4WV1C 1VKXA 5GZOC 3MA7A 5IG7A 4U1GC 1SEBA 3RZCD 2EIDA 5FECA 4FP8L 1VPOL 1MPAL 2DMKA 1HDMB 3V79C 1DL7H 1E28B 1L6ZA 3LRGA 4OCSH 3MROB 1KJ2H 5DJDA 4AK1A 2I9TB 3PJSB 4WV1A 1Q1JL 4NCC2 1VFAB 3TFKC 1MHHB 4BUHA 3S5LG 4XP5L 1JCKA 1QA9A 1GGIL 1TTFA 4AIZA 2EO9A 3O41A 5E8EB 4L4JA 5B8CB 4YHNB 4I3GA 4NO0D 3RBSA 5IMKB 1JHTB 5JW4R 2EICA 3C87A 1B0WA 2F53D 4KROB 1MHPL 3FFDB 3QEHB 4EDWH 2JCCB 1EZVX 1CGVA 4OI7A 1G7LA 5SV4A 2BDNL 5CJQL 3T65A 4UOJA 5C0CA 5CEZD 2H1PH 2QSTA 1SJEB 1GC1H 1HE7A 3MXWH 4PGBA 3AY4C 5GS0C 4DUVA 3OKKB 4G7VH 1AXSA 4JFQA 1NGQL 1ROWA 1EFQA 4LKCA 2YOCA 3DV6A 4IJ3B 2EDQA 3X3GL 5JDSA 1DBJL 1U8PB 4UBDD 4YHYB 4OZGF 2YWZA 2UYLB 1T0PB 3FB8B 4HXAL 3AY4A 2APTA 3L7EB 1OSPL 1BWWA 4U05A 1U8NB 3DURA 4JREB 2FJGA 2X4QB 3Q6FA 1IRAY 2P24B 2CPCA 1PG7L 5GGQH 2X5PA 1HOCA 4Z7WF 1PLGL 3MV9A 1F90H 1BIIB 1IGIL 3OGCA 4HQQH 3H6JA 5CZXC 2XPGB 1HH9A 4PRPA 4GSDL 3F7YB 4P46D 4UB0H 4KRPB 1LD9B 1PKQB 2YRLA 3H7BB 3SDXF 4PGDB 1JF6A 1YECH 3PWUA 1U93B 4JB9H 1O0VA 4LEOA 2ENSA 3Q2CA 1LMKA 2JCCE 3C5JB 5GGTA 5HI5D 5T33H 1ED3A 4V2BA 2W0FB 3ARGC 3SDAC 1WBXB 2EE3A 1FDLL 1FC1A 3CLEL 4PJCB 4HS6B 3LOWA 4GMTH 5H94B 1MCFA 2JELL 5EA0H 4ONHB 8FABB 4RWHA 3MLZH 3NCFB 4ZUVB 4D2NA 1MCWW 3KWWA 5HYFA 1FZKB 2X89D 1XR8B 2IANA 3ARGA 1FLRL 2FO4B 3UCRA 4HPOH 3SDCA 2M8XA 1J12A 3OF6D 1E4WL 4PJIF 4GJTB 1JPSL 2BFVL 2DD8L 1YJDH 3MRMA 5E00A 2PYFA 5LG1A 1WAAA 2JB5H 1GOFA 4HJJH 5E5MB 5J06A 4D9RE 1GHFH 3O2DL 4YHKH 4HKBB 1MCJA 2CIIB 3CMOH 5LQBL 1ONQA 1OSZB 1JYVA 4I8DA 3LHPL 3WYRA 3ARPA 4NSKB 3TH2T 4CVXA 3TJHC 2ZUSA 4I0PA 5E8DL 4CVUA 1B4JH 5IBLD 1KFAL 3UPAA 4C4KT 2YA1A 4YXHL 1PKQE 3DXAB 1B88A 4L4TA 4YXLL 1XIWC 5TFSH 4AG4H 4AY0A 5F88B 4MYWB 2P1YA 1A6VL 3T3PF 3V95A 5HYJA 3TN0B 1YDPA 3EHBC 4G80B 2Z92B 3DRQA 4GW4B 2BERA 4UV7L 5ACMA 2I07A 5KSUA 5T1KB 1S78C 4MAUH 4NRZB 3EIFA 1RULH 5IJVA 4OLVH 2WINA 3V5KB 2NW3B 1FL5B 4PJCE 3T4AA 4GRMB 2BSED 1VA9A 4XWGH 1XIWA 1ORQA 3V5DB 4HWZA 1DUZB 1G7PA 3MQIA 2A6JB 4X8XA 4Q9RL 2E27H 1CL7L 3PG2A 2X4PB 3GIVB 1OGTA 1SY6A 4LSSL 4JY4A 2IAMD 1RMFL 4TSCL 2V2TB 4KK6C 4TPRH 3NACH 4EUPG 4YDIL 3IDGB 4Y88A 4S1SH 1YNKL 3IVKB 3RI5F 1K3ZA 3CU1A 2XG5A 1CXHA 5ESQA 5F1SA 5EC2B 3MRJA 3WLBB 2X6MA 3DARA 4F3FB 1K2DA 4WW2F 2YMXL 2MHAB 5A1AA 1CGUA 3QZWA 3ROLB 3FO1B 3Q3GB 4XMPL 4PGEB 4FQPA 5SWSD 3ZT7A 5IB3A 3QEUB 5KVDL 1A7PL 3FHQA 3HAEH 3SQOL 4HZLA 4NO3B 3EYUH 1I3RB 4BH7A 4Q2ZA 3LKRA 4LHUD 3ARWA 4YPGB 43CAA 2Y07H 4WWID 2YPKA 1ZANL 4NPYB 1AO7D 4MMXC 4BZ1L 3NOIA 5F3BB 3DXAE 1OPGH 1J0KA 3FFCA 1DDHA 3Q6GL 4F7CB 4Z0XA 1Q94A 5IFHL 3UYRL 4I4WA 3FT3A 5KVGH 4MCYA 2B20A 4X6CA 5IMLB 1E6JL 1R3KA 1BWMA 4R7NA 5F7FA 5JLZB 3V0WL 1T7WA 3B5HA 2EYRA 2OL3H 4XZUB 4PJ9D 5ESVB 4JFHE 1Q9WA 4PJGF 4U6YB 3U0PA 2FX9H 4MHHG 3X13B 5D1XC 3GSQB 4M5ZH 1W72L 2YR3A 4B0MM 2B7DT 5D2LB 2VXUH 5EU7C 1WIPA 4HDIA 3P3YA 3QUKA 4Z7QE 1AI1H 1TJHL 4HJGB 1BX2B 1UZ8A 1P4LB 4MAYC 1RK1B 1NCDL 3MUJA 5D1XA 3DX8A 3SO3B 3VXRE 2ESVB 3MFFA 1WICA 4LVNB 4H26B 2IPTL 2AXFA 5L2JB 2DQEH 2VUOA 4X7CC 4U1JA 1U58A 1DQML 5GISL 3CX5J 1A6AA 1FIGL 1QRNA 5DK0A 2XXMB 1F6AA 2Z9TA 2X05A 3DO7B 5CEXB 1OAXH 1DEEB 1NGYB 4MAYA 3SGDH 1NAMB 3VU2A 5A3IC 2OZ4A 3MUY1 4D9LL 4I3RH 2VZVA 4NUGH 3VDAA 4MQXD 1DQLH 4A6YA 2IFFH 3U30C 2Y6SD 4L3CB 2VMFA 3ZE1F 3PV6B 1WFTA 5DDHA 1FL6B 1C5CH 5EG6C 5BCAA 5IBTH 5I2IA 4H0IA 4OFDA 1EJOH 2NY5C 4C55A 3X11B 1U8JA 3GSNH 3U2SA 5T1DH 4M00A 4PLJC 1OAQL 4ODSH 5INCB 4L8SC 1VESA 5DQJB 2F54D 3QUMA 3ULVE 3GJFH 2ITDB 5D2LE 1YEDA 2R0LL 1HWGB 1KXQE 1Q9OA 2W9EH 2ZUQB 5ACLA 3STZB 1NCCL 5JPMA 4N9GB 1FIEA 1EIBA 2Y06H 1FJ1A 2PO6D 3EZJB 3S35X 1RURL 4O5LL 4FTVB 1A0QL 1UXSA 1HH6A 3PGDB 3MLWL 4L8SA 4QTHB 4TVPD 2ESVE 2FB4L 4FQXB 2NTFB 1EO8H 5J6HB 1DLFL 4HFWB 3W39A 2Q86A 1IGYB 3KPMB 1FVDA 3BPLC 4MD4A 5LWYL 4JHAL 4KTDL 5CLWA 4GG8B 2X10A 4OZGB 2JK5A 3BKJH 4Q0XH 5LVEA 5C0FB 3MNZB 1PVHA 2VOTA 1KGCD 1JJUA 5D71H 3OWEA 1UG9A 4XNQA 4QXTA 5D7JC 3MACL 1CLOL 3D2UA 4M62H 4BKLA 1FE8L 3CFIC 1T66C 4Z7WB 5HGDA 1AD9A 4LAQL 1YA5A 1EA9C 2F53B 3LQAL 4NO5A 4S1QH 1RJCA 2BVPA 1TVHB 4OI9A 2NY0D 1S7RB 4PRAA 4YR6A 3EO9L 2HMIC 1FAKT 4R90L 3SDXB 1A2YB 1MAML 3FZUC 5D7JA 3NZHL 3T0XA 5FKPA 4MVBC 3VWJB 3CFCH 2Q3AA 2VDKH 2FH6A 2EYTB 4HKJA 5F6IB 4F2MB 3V7AE 2XZQH 1I4FA 3LN5A 1DL7L 5KAQF 4X99A 2VR9A 4OCSL 1KJ2L 5L2KD 1A7NH 2H3NB 5INDA 3FRUB 4MMZC 4HWBA 4FTVE 1OW0C 2FEEL 5T3ZE 1EEQA 2CRMA 2YBRB 5CP7A 2VQ1B 3UO1H 4NHUB 5ID0B 3DTXB 4WHYG 4LGSB 3ARFC 4OZGE 3VRIB 1NLDH 3GMMA 1G6RH 3Q1SH 1KTLA 4OKDA 1OW0A 3ALWA 1I8IB 3SE9H 5EIIB 1FFRA 4IRJD 4GQ9H 1RU9H 2HVKA 4Z7WE 5CMAA 4KGJA 4JFOA 4B53A 3O9WB 2H1PL 3QDGA 2F53E 5DMJB 3ARFA 1GC1L 3MXWL 2YD1A 3TYGH 2PNDA 1RHFA 2YC1A 4G7VL 4GUPA 3SY0B 5H2BB 3FQUA 1U3HB 5L0QC 3SDXE 5I1KH 2YPVH 4QOKB 1KTDB 5I1EH 5KSAD 5DWUH 5MI0C 1YY9C 2XWTB 2CIKB 2Z91B 2XT1B 2VDQH 4XP4H 2VDOH 4UTAH 3QUZD 3REVB 3UP1A 3U36A 5ALBH 4FRWA 3RKDC 1U8LB 1V7MH 4MNGA 1J1XH 2NY3B 4UV4H 2YXFA 3H0TA 5GGQL 5L8KB 4GRLD 4QHUB 3F7RA 4RGMC 1IGJA 2DYPD 5SWZD 3B5TA 2J88H 1F90L 4RIRA 4HQQL 5FUCC 5BRZD 3PQYB 4UB0L 1YECL 4PJIE 2ZCLH 4G8IA 4JB9L 5C6WH 4WW2B 3CXDH 1U91B 4PBWD 5ACZB 3CH8A 4PJFF 1KUMA 5JOFB 5T33L 4TTDD 5CSBA 2XN9A 5GRVK 3UZVB 3WIFB 2A6KA 4WGVB 1ND0A 3UBXA 1LE5B 1PBYA 3T8XA 2W9DH 3BPNC 2DTSA 3L3GB 2H26B 2C26A 4GMTL 3DBXA 2KZWA 4WWKD 1BVKB 2AKRA 5EA0L 1YQ2A 4OZIF 5JZ7D 1X5HA 1INEH 4LGRB 4PP2B 3MLZL 4QOKE 4KK5D 1M71A 3T3PE 2QLVB 1FNFA 3E3QE 4ZO6A 2JTDA 4Y2DC 3C60A 1UCTA 1I7RA 1YJDL 1HSAB 3L3KB 2JB5L 1IE5A 4HJJL 3U4EA 2F74A 3UXFA 1FCCA 3AAZA 1GHFL 1CTNA 4X5LA 5BS0B 1T1ZA 4YHKL 1MFCH 3CMOL 1F58H 2VWEE 2QL1A 3HUJA 3MA7B 5KZCB 1SEBB 4PJGB 4L8DA 4KK8C 4Y2DA 5IVNA 5DVOA 3V0AC 4EZMA 3QI9C 3PQYE 2VB5A 4G6KH 4ZAKA 2CKBB 5TFSL 4AG4L 5F1KC 2Z31C 3IS0X 5DEGA 3T77A 3CDGB 2DIJA 2HKHH 4WV1B 4U7MA 1JWMB 3BH9B 2G2RB 2VYRE 3DWTA 3HG1D 5D96C 3WE6A 1QA9B 4Z7UF 3QI9A 4PJ5D 1RULL 4QRPD 5C92A 4OLVL 1NBZB 4XWGL 4F7TB 3TZVC 2Z31A 2ICWI 2VERN 2BOBA 5J89A 2E27L 3TIEA 1DN0A 2VSDA 4OZFA 3ARBB 1KBGH 4HC1H 1G7HA 1Q9KA 4XAWH 1GCFA 2AVGA 3NACL 2NNAA 1J05A 2Z8SA 3MA9H 1JK8A 4S1SL 1BP3B 1QO3A 3U6RA 1YMMA 5D70H 4LCUB 5C0CB 3TZVA 4WU7A 2EDWA 4JFDD 5KSVB 1I1RA 3U79A 1UKTA 43C9A 2J12B 1XR9B 2OR8A 2XWBA 4DN4H 1AXSB 1RUAL 4JFQB 5C0GB 5BS0E 4LKCB 4X4YA 5CD5C 3ZE2F 1DVFC 4PJGE 2QQLH 4OM0H 3RWFB 5GJTH 3QDMD 4P5TD 3EYUL 4NQUA 1UFUA 2VLKD 4PR5B 5IP4A 1I1FA 2EDTA 5J9PA 5E5UB 3FO9A 3RFZC 1OPGL 2HG5B 3DURB 4FN0A 5GGRA 4D9QD 2BXZA 5CBAA 2FJGB 5HGHA 3Q6FB 3B2UD 1P6FA 1UM6H 2AQ3A 3Q5OA 2NW2B 4H20H 1DVFA 3KXFA 3C09C 1PG7W 4GXVH 3MV9B 5SWQA 4RMWA 4F7EB 5KVGL 2B39A 2ZOLB 4OQTL 3OGCB 5C08B 4JRYA 2G9HA 4PRPB 4W6YB 4G8EA 4P2QD 3EO1A 3VFTA 4PJ8B 3SE4C 4PJXA 2OL3L 3PWUB 3TBSB 3U9PH 5T1MA 5MEPB 4LEOB 3QQ4B 2ICES 3H42H 2FX9L 4DK3A 4N1EA 2VLLA 2F9BT 1ED3B 4M5ZL 3WUWG 2HLAB 1LO0H 3N0PB 3QUXD 1MCBA 3B8SA 3OKYA 4XBEH 5B38A 2IH1B 2VXUL 3ZE1E 3EJYD 4HBQA 3VH8G 3SE4A 4TYUA 1IT9L 1G7JA 1JZ6A 1AI1L 1AH1A 1NGWA 5CJBA 2NXYC 5C0DA 5HI3C 3KWWB 5IVXA 3NCEB 2BOCA 3J7HA 4WO4D 1MCWM 3NFNA 1VGEH 5IHBA 3C2SA 3SDCB 2DQEL 5AUMA 5E00B 2VLRA 3WS6C 2PYFB 1F6LL 2YEZA 1OAXL 3VGEA 3KG5A 1XH3B 2Q76A 3UTPE 4G43A 4QWWD 3HE6D 1HHJB 2J3SA 4I3RL 4NUGL 4LP4A 1ONQB 1DQLL 2VH5H 1IQDA 3MV9E 2IFFL 4CVXB 5C08E 4I0PB 1G9MH 4KKCC 5DR5H 3EZ8A 1C5CL 5IBTL 3MUGB 4PREA 1EJOL 4L4TB 3OTTA 4IOIA 3MTRA 3ARDA 3T1WA 3RIAK 2V2XA 2OP4H 3GSNL 1FHGA 2A6DA 3BJ91 3VXMB 3G6AA 1YDPB 2LE9A 5T1DL 5HYJB 2DF3A 4OZ4B 3KDMA 3DRQB 4NC2B 4PRHD 1HXMA 1QSED 1JRHH 1I9EA 1E27B 5IJVB 2FJFA 5DD3H 2BY2A 2WINB 5EZLA 3T4AB 2CGRL 2GSIA 3PNWA 2W9EL 3DRTA 3KNBB 4NQSA 4WI4A 4KMQA 3ZTJH 2Y06L 2IBZY 2GSGA 3INUH 3KLAA 1AGDA 3RA7H 2PTTA 1U8KA 3OAZK 2GEEA 4AT6A 1EO8L 4NKMA 4KJQD 3MBXL 5CGTA 1F3RB 1D5MA 4IIQB 5ESQB 3MRJB 4Z9KB 4JHZA 3BKJL 4Q0XL 3PV7A 3QZWB 2BNQA 2BRRH 1CGSL 1FZMA 1EVUA 1J1PH 4QHKJ 4G9FD 5D71L 4POYA 3M07A 2Y72A 4ZFOL 4NM8H 5CJ8A 3D0VB 4M62L 3CFDB 4Y8DC 5C0IB 3L3IB 2GUOB 4QXGH 3LKRB 2X4NA 3QSKB 4MNQA 3JSSA 4P4KC 43CAB 1RFDH 4LCWD 4S1QL 1DQDH 4YO0A 1HHHA 3IDYC 4X80H 4GOSA 1R3LB 3FFCB 5C71A 1MJUH 3VXME 5HYJE 2B1AH 3CFCL 1R5IA 1T7VA 2VDKL 3FT3B 4WI3A 4MCYB 4P2OD 1R3KB 4PJFB 1AKJD 2XZQL 4R7NB 3MNVA 4JFPA 1QQDA 1YNLH 1KACB 2C4FU 3FO2A 1ZHBB 3TO2A 1A7NL 1BQHB 4AZ8A 4J3VA 4P3DA 3VRLF 3FQTB 3HUJF 1Q9WB 4ZUWA 4XPBH 4XB8A 4OZIB 3VMNA 2YN5A 1VB9A 1Q9LB 4MD0B 3FB5A 1A1OB 3BX7C 1QVOA 4XNZB 1OLLA 2XIDA 3TCXA 2MSPA 3BGFB 1SBSH 3UO1L 3B9EA 3WIHH 5DVNA 4NQVB 4NQXA 1NLDL 1J11A 2CD0A 1G6RL 1UZ8B 3I84A 2VE6B 3Q1SL 4LSRH 1CFQA 4TUOB 4O9HH 2YPLB 4NUJB 3SE9L 3MFFB 3QRGL 1BFOA 1UZ6E 4GQ9L 4LKXB 1RU9L 5AEAA 2VRAA 4Y4KC 2GW5A 5E4EB 2ZPKL 4U1JB 2E9IA 4V2CB 1A6AB 4XGZB 1QRNB 2PXYC 3OHXB 5D2NB 1AHWC 3GJEA 3TYGL 3GBMH 4I2XA 2B0SH 3SGEH 1YEJH 4HF5L 3FFCE 3L3DB 1FL3A 5I1KL 3EDKA 4LSQH 2YPVL 5DO2D 3F8UB 4DFIA 2X1QA 5GGVY 4JE4B 2BNUB 5EO9B 1QBMH 4YUEL 3FHAA 5I1EL 3D25A 3RBGA 4Y4KA 5DWUL 5DJYA 4PJFE 1P7QA 2FBOJ 2PXYA 4UILH 3CK0H 5F89A 1LEGA 5J11B 1AHWA 2H2SC 2VDQL 2H32A 4XP4L 2VDOL 4UTAL 3LCYA 3BP7B 5JR1H 5EO0A 5ALBL 5BZWB 2X4RA 1V7ML 2ZKHL 1J1XL 1EVTC 3W9DB 3QEGH 4UV4L 5CCKH 3U2SB 3PL6C 4OZIE 4BYHA 3OG6B 5F96H 2CR3A 2J88L 1IILE 1OHQA 4OFYD 5F9JB 1A3RH 3DIFA 5GSRA 3V5HA 3LEXB 1Q9OB 2CLVB 5F3HA 2JIXD 2ZCLL 5SWZE 3C5ZB 1FJ1B 3DPBA 3PL6A 4Q9CA 3CXDL 4AL8L 1UXSB 4Z7VA 5IQ9A 4L8SB 2YPLE 2VLJA 4KXZI 8CGTA 3TF7C 2VKWA 1FVDB 4C59B 4MD4B 4OFIA 3VFVA 2W9DL 1EUUA 5D2NE 5C2UB 3ILQD 2DOCA 2JK5B 4HX1B 4EI6B 5JXED 2HTLD 3MOBH 3DVGA 2GI7A 1INEL 5GGVH 5IEKB 3FQXB 4IMLA 3NBNA 3MLYH 4XNQB 3FO0H 4QXTB 4XHJC 3U7YH 3K2UH 2GQHA 1RPQA 4BKLB 4NQCD 4JZNA 1CGYA 1FN4A 3OJMB 3P9MA 3BPLB 4GAGH 4Z7UE 1T0MA 4NO5B 4YEFA 1CQKA 2GK0A 4RDQG 2D0HA 2IH3A 4YR6B 2K9UA 5DJXB 3WN5C 2X9YA 3UTQA 5E6IC 5EO1A 1MFCL 1F58L 2KBGA 3RIFF 5I74B 3ZKQD 3DROA 4LLDA 2RCSH 3MGAA 3LN5B 3FONB 3ZSSA 4WTZG 4G6KL 5I0DA 4PJEF 2DL2A 2WQRA 2MNUA 1X5XA 5IHLB 1ES0A 2HKHL 1H8SA 3DGGA 3PHQB 1WF5A 4GMSH 1X9QA 1G9NC 4OSUL 3DSFH 4S2SA 1EEYA 1U8QA 3ZE2E 4Z8FH 2F8VA 3GGWA 4IRSB 1W8OA 3C8HA 3KJ4B 4WFGE 5CHNB 3QFJD 2SEBB 1KBGL 3CU7A 4HC1L 1CG9B 4PJ5E 2NXZD 1CCZA 4XAWL 1QG3A 1U0QA 2Y9RT 4P2QB 3S37H 3MA9L 3B8YA 1JPGA 2HVKB 4Y4FD 5D70L 2K7QA 1VERA 4JFOB 3RWCA 3ARFB 2YC1B 4K55A 4DN4L 1AXTH 1MRDH 3HNSH 3FQUB 4H5SA 2J5LC 5IV2B 3QNZA 5GHWH 4R6UA 2VAJA 3O3AA 5TDPA 2QQLL 3GZKA 4OM0L 5LBSH 5CJ5A 3BWUC 5GJTL 3HC4H 4Q97A 1P7KA 5TDNA 1U8MA 5ECJE 4ZFFB 3DVNA 5L0QB 5I16B 4RMTA 3K80A 4H20L 4CVWA 4AH2B 2D31A 2ADIA 3REWB 4GXVL 5DTFA 4RIRB 3HN3A 3FCTA 4D9QE 4BQCA 1PKOA 4JY6B 1AQDB 5DJ0B 3O4OB 3HI6H 5TE4H 3QXWA 4XI5D 3U9PL 5IHZA 2GITA 4ZNEE 1T89C 4LPTA 1I3UA 3H42L 5FB8B 3OKDA 4B7IA 3D85A 3OKNB 5HY9A 4J4PD 3S4SA 5I1AB 4P2QE 1LO0L 3MMEA 5EUOF 2V5MA 3LKPA 1GRWA 2R29H 3PHSA 2A6KB 4XBEL 5CSGA 1IGTB 4FFZH 3C9NA 1RZKC 4OTXH 3UTZA 3W0WD 2PW1A 1QFWH 4NWUH 2BMKA 3DBXB 1R5VB 2UWEA 1N5AA 1HHIB 1CDBA 1EFXA 1T89A 1QSEB 2FL5B 2I26N 2QKIB 4RAUB 3OKOA 4FNLH 4HSQA 4JZJC 3KLHD 4GT7A 1KT2B 3T2PA 1VGEL 3C60B 1KPRA 2EXWC 3ETBF 3QDHA 4UU9A 3BPNB 2YRZA 1AJ7H 1KCKA 4JM2C 3WUZA 3CNKA 2DL9A 3AAZB 4PIRF 4JZJA 1EK3A 3HUJB 2VH5L 3BZFA 5CIPA 3SJVA 2D0FA 3L5XH 1G9ML 3MRPA 5JOPE 3K8KA 2EEAA 4JM2A 4ZAKB 3T77B 3CFBA 1B2WH 2OP4L 2Z0BA 5FYLH 5H35A 2J7LA 4B41A 3AMLA 1BZ9B 3QO1A 2OTWA 3W11D 3LH2H 4MSWB 1W72B 4RFEA 5D5MA 3NA4A 1I1AC 3ZKMD 1TQBB 3TIDB 5DD3L 3FQWA 3DX7A 3S5LA 5AZEH 5I17B 1ZV5A 5EN2A 3PDOA 2BOBB 3TIEB 4X5WA 3QT2A 1KB9K 1QSEE 2FH8A 3INUL 4UNUA 4NKDA 2ATKA 2FJHB 3RA7L 1HEZA 3WCYA 1I1AA 1RZFH 2ZP0T 1JK8B 1QO3B 4XWOD 1YMMB 5E8NB 4CN4A 1W0WA 3EGSB 4NZDA 3ME0A 4WU7B 4XAKD 1IGCH 3QEQA 2BVUA 4H8WH 2VDRH 1AC6A 1RQ5A 2BRRL 1J1PL 1SVCP 5ITBH 3CFKB 4X4YB 1P5VA 2P5WB 3VRLE 4NM8L 3HUJE 2JB6A 3MRNB 1KJ3H 3KVQA 5HVHC 2HJKA 2J8OA 2CKNA 3O6FD 2J8UF 4QXGL 1NBYA 1FNSH 3IF1A 3QULB 3R06A 5B4MC 1AD0B 1DQDL 5J9PB 3C08H 3FO9B 5FYKH 3PXHA 4X80L 5F71A 5GGRB 2VITB 2WK2A 5CBAB 4O51B 5HGHB 1L0XA 4X6FA 1ZLWK 1J7VR 2WZPD 1MJUL 2DJUA 4DW2H 2B1AL 4U4BA 3KXFB 5ESAA 1TTGA 3FRPG 3SCMD 3MSPA 3VXOB 3P0GB 5SWQB 1ORSA 4OCRH 3WKMH 3WEXA 5FUZH 4G8EB 3ELAT 3N1QC 1W0YT 2GHWB 1YNLL 1JGDA 4PJXB 4DTGH 5EC1B 2H9GB 1WITA 2J6EH 2E6QA 4HV8A 5EU3A 1JVKA 4PJDF 4XPBL 4J2XA 5D8JH 3C09B 3R1GH 3BMVA 5CP3A 3O4LA 3K7UA 1F97A 2D7QA 3RWHA 1SYSA 2D7MA 3OL2A 3UTOA 4NKIH 1YMME 2LU7A 3T04D 3VXSA 5DLMH 5DD6B 5B38B 1SBSL 2ATPB 2WBJC 3IXAB 2WWKO 3WIHL 3BHBA 4YNYA 5LGJB 1TVBA 5CEYA 1VEOA 4LSRL 5C0DB 4ISVB 4O9HL 2P5WE 3WDJA 5IVXB 3PP4H 4YZFF 2BOCB 4L9LC 1UB5B 3NFNB 4OUOA 2V5RA 3S9DB 3ARUA 2EKSA 2WBJA 1JYXA 5AUMB 5KANI 2VLRB 3GBML 2B0SL 3GRWA 1C8PA 1J0YA 4JPIA 2Q76B 4GG6A 3LSOB 5BV7C 4G43B 4LSQL 4PJEB 3KXFE 2DBLH 5I6XB 2F5BH 1IQDB 1QBML 4L9LA 5GZOD 2G5RA 2QBWA 2ADJA 3ZKXB 2B1HH 3O3BA 3VFRA 1WBZA 3NAAL 5C3TA 2V7HB 4ZS6C 4UILL 5B3JF 3CK0L 2ADGA 5BVPH 3IU3A 4Y5VB 3WXVH 1FP5A 4Y1AD 5IGXH 3KPRA 4OGAC 4X4MA 5JR1L 1CE1H 1KJ2B 2DQGH 2FIKA 2NY4C 4IOIB 3ARDB 4PJXE 1Z9OA 1IZKA 3G6AB 3QEGL 4KHXH 5DFVC 5CCKL 3TFKD 2BVYA 3JV6A 3P4NA 5TF1H 4WEBH 5MENB 3DV4B 2IBBA 5E8OA 2Y23A 1A3RL 5F1IA 1UWXK 3T4YA 4LQ1A 4Y2OA 5EZLB 2GSIB 3PNWB 5TE6H 4NQSB 3VXTA 3DLQR 3FN3A 3CMGA 4LVHC 4X98A 3H9HB 4HC1A 1FG9C 1UB6A 3V7AG 1IVLA 2CXGA 1GOGA 4AT6B 4ZNCD 1NGZA 4NQED 3O8XC 4RGND 5C07A 1N2RA 1OTUC 4QY8A 2NY2B 2EE2A 5AYQA 2VLRE 4JZOA 5CKAA 5GS0D 3MOBL 1JWUA 2CO6B 2BNQB 1JL8A 4YK4B 5GGVL 5CS7A 1N5YH 1K8IB 4PJEE 3MLYL 4HHAA 3FO0L 3U7YL 3K2UL 4FQCH 3B3IA 3D69B 5ERWA 3O8XA 2YD4A 4JGUA 5D6CA 4MQSB 1N64H 4X9FA 4GAGL 1X5KA 3EDJA 2X4NB 3IT8D 1TNMA 3K1DA 4FZ8H 3GMRB 3NN8A 1HHHB 3T0EC 5DSCA 2AEQH 4NQCE 3RVXD 5C86A 4Y4HC 4UAOC 4L8CA 3BJLA 4KI5F 4LIQH 2VLMD 3EYOB 4PUBH 1R5IB 5CBEB 5MENE 4YGVA 4LPWA 2RCSL 1TZIA 3L5HA 5CZXD 1U2CA 1YEHH 4FABH 4LSTL 2PW2A 5EUOB 3IDYB 5D7LA 3RX5A 5EPMA 3T0EA 3FO2B 3TO2B 1K8DA 4OCMC 2OX5A 3TH4T 5E6YA 2DRUA 3D18B 4U1HA 4ZUWB 5CZKA 3TO4D 2VXQH 2NR6C 4GMSL 3DSFL 5SX4H 2GKIA 4CNIA 2IAND 4LK4A 4WU5A 3MJ6A 5HI4C 3SDAD 3FB5B 3NIGF 1QVOB 5DVMA 4Z8FL 3DMMA 2X7LA 4MX7A 3O11B 4CVZA 4HUNB 2H6PA 2IPUG 2ID5A 4RX4A 3V8CA 1A4JB 3VFNA 3TNMA 4EVNA 3LKQB 2ERJC 1X7QA 1F2QA 3S37L 2GJZB 4U6HB 4RCAA 3O2WH 5F21B 1BVLB 3GJEB 4S0SD 4WI2A 4LPUA 5FIEA 1EBAA 4K07A 2FATH 1AXTL 1MRDL 3HNSL 3KLSA 1FL3B 1N8ZB 5EB9A 3ZT5A 5GHWL 5IB5B 4MDIB 1EGJH 1MWAH 1T6WA 5LBSL 4G5ZL 3B2VH 3DYMA 3L5WB 3ARTA 1A6PA 5TF0A 3TJHD 3HC4L 2QSQA 1AHWB 5EUOE 4AIOA 5D1QC 1XIWD 4MJIA 2GTWB 1MFBH 2W07A 3O3EA 4POZC 1OWWA 1S78D 3FTGB 1PY9A 2EDLA 1ZHLA 3UJJH 3DIFB 3MXVH 1FLTX 5TE4L 4JO3H 5F3HB 5D1QA 3QXDA 2AXHA 4F37F 3PL6B 4LFHG 4X0KA 4Z7VB 1FRGH 5IQ9B 3BKYH 3GB7A 4ZXBC 3ZHKA 1ZVSA 5DK2A 1FVCA 3MJ7B 2R29L 4FFZL 5TDOA 1OP9A 4OTXL 3VFVB 2J8UB 1WUNT 5I76B 4QF1A 2C4FT 4RFNC 1WIOA 4NZUL 2EDKA 1QFWL 4NWUL 4LARH 2XQYG 2EDHA 4FG6C 1B6UA 4LLMB 3UBXI 2Z93B 3E2HC 1FQ9C 4ZXBA 2IQAA 4FNLL 3D5OF 4HAGA 3HAEB 3W0WE 1FN4B 4N8VA 4B7LA 1QBLH 3P9MB 4RZCB 1I7UB 2C3VA 5J12C 1BJ1H 3RJDA 3CZFA 1KN4H 1AJ7L 5FK9B 1C16A 1A7OH 1GL4B 4XXCC 2AK4A 3IXTA 1OY3B 4G6AD 4LLVB 2FGWL 3MREB 1R5WB 2XNAA 4PJDB 2GY5A 3L5XL 3DROB 4EI5B 4WEMB 4JLRA 4I18B 4YGAB 4YLQT 4YHZH 4I1NB 5HSFA 4GG6F 2OL3B 4XXCA 1MI5B 3MLPA 3RTQC 3R4DA 3BEWA 4DUXA 5FYLL 1HKLH 4MB5A 4JJHA 4OCWH 5BQ7B 5D1XD 1S9YA 3LH2L 4MB4A 1BQUA 2A38A 3ZHDA 4HUXA 1U8QB 5TPWL 1ZKAA 4MCZA 5JMOC 4BSVA 4JEGB 3DI2B 3BIBX 3GGWB 5HPMA 2J8UE 4NQDA 5AZEL 4OLWH 5FEBA 1Q72H 4KRLB 4NRYA 5C0EB 5TH2A 3MV8A 3RTQA 1VADA 3CFJA 4G42A 4MAYD 2AEWA 2OJEA 2N7BA 1RZFL 5JW5A 4WUUD 1FYTD 1I75A 4Z18A 5TGBA 4N0RA 5F93C 3F12A 3RWCB 4WHDA 1QFOA 2ZUXA 1IGCL 4HKZB 2EIZA 1YC8A 4H8WL 4UMGA 1FC2D 2VDRL 5CWSB 4P59H 4H5SB 4QRUA 3MRIA 4KVNH 5ITBL 1VEMA 3GSXA 4KZEH 2FEDC 2LQRA 3PWLB 1U8OA 4PJDE 1KJ3L 5JHLH 1ZS8A 5IM7B 1S7QB 2OSLA 3TV3H 4M6MH 1KCSH 1FNSL 4E0RB 5FKAB 4BSWB 3V0VA 3C08L 5FYKL 1G7MA 2IPKA 3VXUD 2DWEA 2J5LB 4I5BA 1MI5E 3GSNB 4X6EB 3HE7D 4DW2L 2ARJB 5T5NF 2ADIB 1A9BB 5DTFB 4OCRL 3WKML 3GJFB 1XT5A 1ZXQA 1J5OH 5FUZL 3RHWF 1S7SA 4WRLA 4YZFE 1FPTH 3P77A 4KUCD 3RVVD 4X4XA 4DTGL 2GITB 2J6EL 5D8JL 4FZEH 3VGBA 3R1GL 3OKDB 4P23D 1MF2H 3S4SB 5HY9B 2MQ3A 5F9DC 3B6SA 5DMKA 4DUWA 3D2UD 3VA6A 1CICA 4LPXA 3PWPA 3D0LA 4NKIL 3WL9B 5DLML 3UTZB 3C9NB 5E95B 4XNXH 1FG2B 3FL7A 3BQUB 5B3JE 2UWEB 1N5AB 4E41B 5ISZA 5ANMA 4ZFOB 4FXKA 1X5LA 5D7JD 5F7DA 3PP4L 3PIQA 5MERB 4PY7A 1N6VA 1T66D 1KPRB 3GKWH 5EZJB 3QBTB 1KCRH 4EUPH 1T5WA 5I9QB 2Q6WA 4UIMA 2XRAH 1M6OB 1QD0A 4Z5RA 2HMID 3IJHB 4LSDA 4HCRH 2EDXA 4AEEA 4NQEB 4NZRH 2DBLL 3OKLA 2F5BL 4XVJH 3KPOA 3BZFB 5IKCA 4MVBD 4P0DA 2B1HL 1HHKB 2W0PA 5FGCB 3MRPB 4ODWA 5KAQG 4GW1A 1ERNA 5BVPL 3WXVL 5IGXL 2EH7H 5DS8A 5H37G 1CE1L 1IARB 2DQGL 5DEFA 4Z76B 3S96B 2GCYB 3CFBB 5HHNB 4LLQB 4DKEH 4KHXL 1KJMA 1T1YA 2IALA 1YEIH 1RZJH 5JQHC 3QO1B 4MJ2A 5C6PB 3VWKB 5TF1L 4WEBL 2B2XL 3GKZA 1XCQA 3SE3C 5FV2A 3FQWB 4P9MH 1JBJA 3DX7B 2D0GA 3GMLB 5TE6L 1QLFB 3D39B 4HLZH 3PDOB 3QDGD 1BBDH 2APBA 5DMIH 5GJSH 1G6RB 3NFSH 3PXJA 4E41E 3ARXA 3L9RB 1V3JA 4NKDB 3H3BC 1LO3L 4FFWD 3QUYC 5DJZB 1I1AB 1LDSA 3IDMA 3SE3A 4KI5E 4QRSB 1U3JA 1OD9A 4ALAL 3QWOB 2GAZB 3KPLA 1NQBA 1N3NA 1AR2A 5I71C 3RL2A 4HG4K 1ZT4A 3O3DB 3BO8B 1N5YL 4F33B 3QUYA 4NQEE 4RGNE 5E8PB 2HTKC 1X4XA 3VFPA 4FQCL 3VG9C 1HHGA 5ABDE 5KS9F 2HJKB 4NC0B 1N64L 3RVWD 2DJ4A 5FGCE 3QZWG 4FZ8L 1NBYB 3IF1B 3R06B 2KUTA 5GS2D 3OJDB 4ETQA 1NH6A 4G9DA 1IM9A 3NIGE 5I18H 5DRZB 1WFNA 3F7VA 3GMOB 1F11A 2X41A 3UZQA 4X6FB 2AEQL 3RKDD 1XGUA 4D8PB 1DUYA 2BNRB 4DKFH 4LIQL 1HKFA 1N4XH 4PUBL 4ZO9A 3KPSB 4JM4H 1ORSB 5EOCH 1VFBA 1K4DA