1G7JA

Crystal structure of hen egg white lysozyme (hel) complexed with the mutant anti-hel monoclonal antibody d1.3 (vlw92h)
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
107
structure length
107
Chain Sequence
DIVLTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPSRFSGSGSGTQYSLKINSLQPEDFGSYYCQHFHSTPRTFGGGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor/hydrolase
molecule keywords ANTI-HEN EGG WHITE LYSOZYME MONOCLONAL ANTIBODY D1.3
publication title Estimation of the hydrophobic effect in an antigen-antibody protein-protein interface.
pubmed doi rcsb
source organism Mus musculus
total genus 29
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2000-11-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1g7jA00
4JGUA 3DMMC 4P3WA 4WY7H 2G5BA 4FFVC 4YFLF 2Y36H 4PGEA 2HN7A 3LQAH 1BZ7B 4OLZL 1RJZA 2Y07L 5IWLC 2F8VA 3IJYB 3DI2B 3T3ME 2AJYH 4WUKH 1BZQK 1YECH 3U4AA 4RFOH 1DQQB 2NY3D 4OFPA 1CFSA 4OM0L 3BP6B 4XH2B 2LAGB 4WFEE 2ICWA 1CWVA 2L7UA 3G08B 4MZ3A 4WGVB 3NIGF 3PL6B 4HGWA 5DEZA 1D5ZB 3QHZH 1DBMH 1NAKH 3B2UC 4ODSH 3RWFA 3HG1D 1G9NL 4HJGB 4M6ML 4LK4A 1CT8A 1PDKA 4WU5B 4WU7B 5J1AA 4W6XB 3VFMB 1S7TA 1MFBL 3O41A 2R56H 2W38A 1Q0YH 4OCXL 3LPWA 2H6PA 3QEGL 1D5BA 4LRNH 1MNUL 3LEVH 3PQYB 1BIHA 4NBZB 2HTLC 5ALBH 3T0EA 4G43A 5ENWB 2WLYA 2A9NL 3KNBB 5GGUA 1QRNE 5I75C 4DW2H 3AAZB 2R0ZH 1U8QB 3MLYL 2M8XA 5KSAD 3V6OE 1UZ6F 5HHVH 4JQIL 2ENYA 2B4CC 2R2BB 3BH9A 3DWTA 4CDHA 1FO0A 4RQQA 4H0HB 2F5AL 5D71H 1NC2A 5DYOA 5JQ6L 2XWBB 4GG6B 1RZJC 3JTTB 3RNKA 1CFQA 1YEKL 2X4PA 3OR6B 1IBGL 1MI5A 5E00A 3ZLQC 2RIKA 4R26H 1AD9A 4PJHA 4TN9A 1ZT1B 3L9RB 1GGCH 4OAWA 2A83B 3UXFA 4W6YB 2PUQT 1EFXB 2MOVA 2OTUB 1GZPB 1UCBL 2GFBA 3H9HB 2QV2A 3Q6GH 1Q9OA 3G6AB 3WS3B 1CTOA 1Z3GH 2EICA 4MB3A 5GPRA 1WEJH 4NNPH 1AJ7H 1ORSB 4HIXL 1KNOB 2IPUG 2Z8WC 4DGYL 1LEIB 5EWIH 3C6LD 4X7SL 3EW3B 5EG6C 1T1YB 4YNYB 5FUCC 2A6IA 4G9FA 2QR0B 1OLZA 1N4XL 2WINA 2EH7L 1IT9L 1J05B 4JY6B 5DWUL 5I71C 4PLNC 5JTWA 3CFBB 3LDBB 4ONFH 1GGIH 4A6YA 1D6VL 5D2NE 4G9DA 1WIOA 5JOPD 3AU1B 1RI8A 1RD6A 3LEXA 4WHTB 4QRRD 1RVFH 4BQBA 5JOEA 2KQMA 5CBEA 2YKLL 2XPGA 1FBIH 3B4NA 4JRXE 4M7KH 2OJZH 4WWKD 3CFKA 2VZSA 1YQVL 1BF8A 1OTSC 3KYOB 4FQ2H 1BM3H 4GRLD 3NN8B 2NY4B 1R3IH 5EBGA 2CLVB 1MH5A 2YUZA 3B9VA 1CXLA 4HX1A 4LIQL 1EX0A 3RPKA 5CJBA 5J1TC 2EDLA 3PHOA 1O7VA 5CEZD 3G9VA 4YBLC 1T2XA 1XCTB 2H32A 5T1LD 5B3JE 1LO3L 5ADOH 2KZ1B 3H0TB 4JHBA 4NQCD 4P23C 2XQYK 5J7CC 1B4JH 1IC4H 1ZKAA 2ZKHH 3UTZA 3E2HB 3H9SE 4HUKB 4ODUB 1V3KA 4KJYA 1LP9A 2FBJH 4QCIB 3KHQA 3JWOL 2R4SH 4ZYKA 2XTLA 2ZZUT 1MPAL 1KIPA 1TCRB 4OLVL 3EKCA 4LARH 2PXYC 2QHLA 2XXCB 1E4XI 2PYEB 2WW8A 25C8L 1G7QA 4RFNB 3QEHA 2C1OA 4JZJB 3T09A 4KQ3L 3DO7A 2DQHH 3MOAH 3VMPA 1OP5H 2YD6A 2R1XA 5H37H 4TQEH 3CU7A 2CQVA 4L9DA 1PJ9A 3L5XH 5BVPH 4I9WE 3PWLB 1UXWB 4FMFA 4DAGH 1B0GA 3FN0H 5D96B 3S34H 2BC4B 5DGQA 3L7EB 2ED9A 1C7TA 5DJ6A 2PW2B 4WO4D 1QR1B 1JV5A 1B0WA 1E6OH 4JM2F 5AUMB 1VFMA 3MSPA 5ERWB 1I8MB 5IVXB 2OI9C 2W07A 4U49A 1CIDA 4PJ7A 3QXDA 3QO1B 3SPVB 1F4YH 3FONB 2R39A 5IM7A 3FB7A 5F21B 3BAEL 3IRZA 2AK4E 3GBML 3HZYB 4TRPH 4KVCH 5I74C 2D7PA 4W6WB 1CE1L 4Z77A 4MS8C 1JTPA 4XCFL 5JLZB 3KYNB 2Y9RT 3FRPG 3X14A 4MD0B 4OGAD 3JXAA 4M1CC 1CDUA 2P47B 2O26U 2UWEB 3AS2A 1DSFL 3MR9B 1BBDH 3JWNC 5CBAA 4MD5B 5D7JC 1IM3B 5I76B 2DM7A 4L9LA 2NXYD 5ISZD 3WHXB 1HSAA 4QEGA 3UPAA 1U42A 2NYYC 4HSQA 3WIHL 2IADA 1R0AL 3I6LE 4I77L 5E8DH 5BRZE 2OQJA 4N0UB 4Z76A 1U8LB 1FH5H 3DGCR 4ELMA 3LB6D 3ISWA 4N90D 1WFUA 2CLRA 1KJ2B 1FFRA 4DGVH 2OCFD 4YC2C 2IANB 3L3JB 5I0DA 1VFOA 5I1DA 4PUBL 1W8NA 1CE6A 4HMEA 4M1DH 1U8IB 4EDWH 4EQ2A 3REVB 3QDMA 5BMFH 1AY1H 4Y4KA 1FO0H 3KPNB 3EYOB 4Y2OA 3TBWA 5E6ID 1QR4A 3D2UA 3IRPX 5J9PB 4HHAB 1BFOA 1II4E 5I1JL 5HYSB 3MOBH 1LD9A 4Z8FL 4QNPF 3C9NB 3WHE1 5I1IH 1MCBA 1P6FA 1QO3B 4LLUA 1F90L 4HIHA 1IL1B 1N8ZA 4HKJB 4HKBB 3DX8B 1T20A 2FATH 1S9XA 2CMRL 4XMLH 5IJKA 5D1XC 1R3HA 2Q20A 4QTHA 2CUMA 5IHZB 1YEEH 4TUKH 1Q8MA 1RZKC 4Y2DB 3CD4A 1T3FB 3IFPA 1T0NA 3AS0A 3QUZA 4KJPC 1IGFH 2KL6A 4LEXL 5HI3D 2WUCL 3HTLX 2HFFA 3SJVA 1NBZA 2WBWB 4HT1H 3QEQA 4PY7B 1Y18A 4S0SD 1B2WL 2HJLA 2BXYA 1MCRA 5K9KA 2A2QT 2DM4A 4A6YH 4XVJL 4IOFC 2O61A 1HZHH 3RVXC 5D7KE 2D03L 4X80L 3SCMB 4JCMA 3S98A 1GPOH 3OV6A 1MWAA 3S3SA 1FAIH 4AK1A 5JOFB 5D7IA 1N6VA 2XG4A 4OGYH 1L4IA 5SWSA 2AAVA 2N4IA 1J8HE 1EGJA 5A1AA 4L4VB 5CWSB 3ES6A 5I18L 4ISVB 3GGWA 1N2RB 5C08E 1I1RA 3DXAE 5JPMA 1CG9B 2XZQH 4FMKA 2WIIA 1CD9B 1MRCH 1S7RA 1G7JB 4N8CL 3ZKSD 3BW9A 1NAMA 3FO0L 2YSSB 3LS4H 5TDPA 2H32H 5EZLA 3QIBD 2D7TH 3VFGL 3OGCA 3IYLW 4CAGA 5C09B 2VDQH 3BDXA 4HKZB 5E8OB 5KVFL 5B3NA 4HEPG 4YBQD 2E3VA 3HMWL 5HHME 2ZCHL 5DVLA 2DQDL 4WTWA 4ODVH 3BRDA 3FAWA 4Z7VE 4FQXB 3O2DA 3ELAT 4JKKA 5T5NF 3QWRA 4P59L 5L8KB 3LOWA 3A6CH 1CBVH 3S88L 3BGFC 1MRDL 1Q94A 1A3QA 1HH6B 1SYSB 4P4KB 3CH1B 2HRPH 5GGVY 1YMME 4IRJD 2LTQC 5KSBE 3QR2A 1R5VA 4PRDB 4UV4H 2HFGL 2A38A 4U6YB 1ZHLB 2NLJB 2NY3B 1OTTD 3UPRA 4Y4HA 3R0NA 4R7NB 4MAUH 3P0YL 5T5FL 3BYYA 2CIKA 3BZEA 1QLEH 4QKXB 2OJEA 2XY1A 1MHHA 3V5DA 4PLOB 1ED3B 1E27B 3CXHK 1DANT 3GMRA 3ARYA 3HG1B 1CGSL 5DFTA 4HUWB 4KK6D 4AQ1B 5DFWH 5D8JH 3IB4A 3T65A 4BUHA 3LKNA 1ZS8B 1MEXL 3T4YA 2ZOKB 3KJ6L 5JW3L 2YD3A 2VXQL 5F7WC 1QPXA 1XGPB 1KB9J 1UH4A 2FSEB 4GXVL 5IVNA 1JK8B 3D3VD 5E8EB 1I9RL 3DV4B 4M5ZL 3VRJA 2UUDK 1RUPL 4J3XA 4QHUB 4AIXA 3NVQA 5EORL 5IMKB 5HPMB 5KSAB 3OKOB 5DD0H 3TIEA 3C08L 1KYOK 2QSCH 3TZVD 3IF1B 2WQRA 5KANI 5FF6B 5D5MF 5DEFB 3EYQC 1MFAL 2XWTA 5I1EL 4PRPA 2VN7A 3H9YA 5C0DA 4XCEA 1RUAL 1JGLL 1QQDB 4M4PA 3IDGA 2VLLB 2W0FA 4XGZA 4Z7WB 1ZVYA 2ZG3A 1CQYA 1N59B 2H2PD 2V2XA 5DEGA 2HT2C 3MRFA 4EJ1C 3OAUL 4M48H 2VL5B 5C0EA 4Q0XL 1MCKA 3NIDF 3CFEB 4Y5VB 1XIWA 4U1KA 1X9QA 2FZ3B 3C6LB 2Z31C 1P6AB 5L7XL 4GBXA 2V5YA 1EEUA 3MRJB 4U1SA 5BS0A 3V6ZA 4DUVA 4PRID 1UWEL 4ZFOA 4ZSOB 1IFHL 1Q72L 1WFTA 1HE7A 3OX8A 4J4PC 2BVPB 3G6JF 4QRRB 4KHXL 2ARWA 2IAMC 1CYGA 4DJMA 4EBQH 1AKJD 1A3LL 3ETBF 4O4YH 4EIZC 4XNMA 1NGYB 4WWKB 3BT2H 3DLQR 4NN7C 4X7CC 4GRLB 3X3FL 4G6JH 5TPWH 3ZYJA 4LQ1A 4XBGA 3F7PC 2OL3B 4XNZC 1XFPA 5FO8B 2K7QA 1V5JA 4D8PA 3U1SL 2VISA 5T1LB 3S6CA 3MCKB 5ICYA 5EO9A 4OCWH 5EA0L 2Q8AL 1IJ9A 4NQCB 3ARFA 1NGZA 4UUJB 4WUUE 5HYSG 2VXVH 1ZHNA 2BSTA 4EEEA 1LE5A 3MJ7A 5E6YA 5F6IC 4C58B 5C7XL 1FPTH 5KVEH 5IHBA 4JN1L 1RZFH 3MRMB 4U1NB 5AZ2L 4DOHE 3U9UB 1PY4A 5LGKA 1MWAH 4YFDB 1NSNL 4HG4K 4GFTB 5GS0C 3O6KL 5CD3B 4JPWH 1D5XA 4P9MH 3KS0J 1INDH 3T0ED 3AY4C 3U0PB 3MUGA 2I07A 1LE9A 2GQHA 2O5XH 2O5YH 3QWOA 4Y19E 3GZKA 4RIRA 5GIRB 3CMOL 1GGBH 2Z93B 4UTAH 1NAMH 1HILB 3CVHL 1LWRA 1QRNA 3PIQA 5IQ7H 4LQFL 3K4DA 5H35B 1N64H 1MREL 3V6OA 1NC2D 2P5EE 3Q1SH 1AQDB 2LE9A 3ULUH 1C1EH 4UQ2B 4YHPA 1YNTA 4BUGA 5CJQL 1CVRA 1JNLL 2YPVL 3VCLB 1MI5D 3BPOC 1BQLL 2I25N 3IFOA 4U6XB 4WO4B 3TYFA 3MGTB 4W68A 3OL2A 3AGVA 5IEKB 2I24N 1HKLH 2BK8A 2W9EH 3EOTL 1LO4H 3O2DH 4Z78B 1UACL 5DRZB 2ZPKH 1WICA 1BFSA 4GAJL 4XAKE 3I2CL 5EC1A 4MJ2A 2V5SA 1YEJH 1YEGH 4PJDB 1TZIB 5IFAH 1KIQB 3MLXH 4G9FD 1AH1A 1WLHA 4QF1B 1I8IA 1T04B 5E2UH 4P46C 4G6FD 1U8HB 3G5XB 2NY5H 4XX1E 2X44D 5A16A 3OKNB 3W39A 3C5JB 2GK2A 3MLPA 4JGMA 5EN2A 1RSFA 4K23L 1TENA 3B3IB 2IPTL 4BZYA 5TE7L 2NXYB 3T2QA 3MJ8B 5ISZB 5D2NA 3WFEH 5A3IC 1OD7A 2V9TA 1TQBB 3CU1A 1KG0B 1ZMYA 2FEDD 1QPPA 2A9MH 4D0DA 3IFNL 1P2CA 1N6QL 2G9HA 1BEYH 4JRXA 4EDXB 5E9DD 3SDDA 3K1KC 3DX9A 2P48B 3E0GA 4XPBH 5CEYB 3STLA 4UDUB 2FIKA 1X5HA 4TOYH 1HWGB 1RUQH 4KI5D 3CDGA 3I02B 4XP6L 1FZMB 5BV7B 1YEIH 5IMOA 5E8PA 1UB6B 4PD4J 2X09A 5DSCB 1NBYB 3KDMA 4WFHE 5JPNA 4YE4L 2AJ3B 5AD0B 4JO4L 3W11D 3QXAB 3JTSB 4UTBH 3WN5A 5E6IB 1KLFA 3LH2L 3HR6A 1R6VA 2X70A 3IS1X 5EU6E 1EUUA 3H9SA 4U0RB 1M6OB 3QNZB 3ZDXF 2P8LA 3ILQD 2NY4C 1M7IA 3TWCH 3N85L 5KJRH 4Z0XA 5E1HB 3M8OL 2NPLX 5AWNH 1PW3A 5EUKB 5HY9B 2HJFA 4LSDA 3SEPA 4ZTOL 4BH8A 1N7ML 3RTQC 3VE0A 5CS7A 5LWYH 3O4OB 4JM4H 2WWMD 3RX5A 3SGEH 3HZKA 3WIIL 4WDIB 5JUEL 4KY1H 1LK2B 2RJMA 3MBXH 2YUXA 4X8XA 3BD4A 4JKWA 2W60A 1IGTB 2BVYA 4PGCB 5KTEH 3WKNA 3FOMB 3MREB 2CIIB 2DWDB 2FJHA 3T2OA 2BVTA 5JW4R 2VZOA 1PFCA 2W0PA 1KEGL 1RIHH 4LPCA 5E2VL 1UT9A 5F9WC 2HKFH 3VFVA 4RFNC 4JZJC 3PJSA 4IBLT 2XZCL 5EU7E 5KAQF 4Z6AT 1NEZB 4KV5F 4LSPH 4KK8C 3TCLA 3LEYL 3SE4C 1P5VA 1WT5C 4X4XB 3RVWD 4B53A 5B39B 4CMMA 3NZ8B 4YFEA 3IJHB 2AK4A 5D96C 3U0TB 4YR6A 1ZLUK 4OSUL 4U3CA 4WCYH 4PJ9A 5SWZD 1I9JH 1GOGA 2EE2A 4MDJB 3FT4A 2XWJB 2YA1A 4N8VA 3RY6C 2OK0L 3QIBB 4X5WA 3CFDB 2BSRA 5F7UA 5C6TH 4JO3L 3L6FA 1HQRB 3LQMA 4XP5H 4KZDL 1XCQA 2EECA 3NAAL 4Z0BH 5I8OL 2DQEL 1FGVH 3ZKNC 5FECA 2AW2A 3CIQA 4R4FL 5IG7B 5A2JH 1ZT4B 4X7TB 4YZFE 1A9BB 5HI4C 2G2RA 1XH3B 4M93B 1FNGB 3I3BA 4K7FA 1CF8L 2NY1C 3V0VB 4XP9L 1A7OL 1ES0B 1MY7A 5BRZA 2MJWA 4YEEA 1B90A 5L6YH 3P9LA 3SOBH 4DUXA 3DJ9A 5I9QB 3UBXA 1AR2A 5DJ0B 4E41E 2OSLA 1IGYA 3QCUL 1E4WH 2AVGA 3QDMD 35C8L 4R7DB 3WXWH 1AE6L 4Y4KD 2NNAA 12E8H 1ND0B 1J1PH 1OGTB 1S7XB 4IRJB 1HOCA 4ZPTA 4CL7A 1LEKA 4JG1H 1VKXA 5KS9E 1WC7A 4EI6A 3D2UD 2C1PA 4MDIB 4U1MB 1VENA 4BFIA 4IIQB 5TF0A 2FO4B 3MRBA 4TVPL 2ADFH 2QSVA 3EGSA 2DI7A 3KPPA 4OT1L 1JBJA 3HZVB 2HG5A 1ZSDA 3CNKA 1DQDH 5ANMB 2ID5A 3O11B 2ZSVB 4JKPL 1EPFA 5CSBA 1FV1B 2N7BA 5JORB 3WL9A 3P4OB 1C12A 2YXFA 4OLXH 4Y4FD 3LKQB 3QUZD 1U8OA 5DC4B 2IH1A 3E6HA 3N50A 4NUGL 4O9HL 1UM6H 1X5IA 5GSRA 2O5ZH 3SJVD 4R0LA 1J12A 2BMKA 2PNDA 3D3VB 2A1WL 5FYKL 5HHQB 3TH4T 3QEQD 1HHIB 2JF1A 1BOGA 4N9GB 4WEUD 1ROWA 4PRNB 3LD8B 3HLAA 3DYOA 1GZQA 1MLCB 2HVJA 3RL2A 3FFDB 3WD5H 3RKDC 4X6BA 3U6RB 5GGSA 3DBXB 3TZVB 4LCYA 2MWCA 4ZUTB 1GAFH 5DJDA 4FP8L 5CINH 1KPUA 1BF2A 3V5HB 1WAAA 4EOWH 5SWSD 4NO0A 1FGNH 4I18A 3WS6C 2DQTH 1UZ8B 4Y2DC 3QT2A 3GIVB 1A7RH 2DMCA 2AABH 3DUUA 1Q1JL 3EZJB 4LLQA 3WKMH 1SBSH 3H2WA 4RMSA 3R06A 5CIPA 1J8HA 1P7HL 4LAQH 1G9MH 1T0MA 3CXDH 5DA0B 5TFSL 5C08A 3DXAA 4WI7A 5GXBB 2YWZA 2PF6A 3LY6A 4JKMA 4PJIB 1NLBL 1H5BA 4HD9A 2FLRT 3VFOB 3VG9C 1BWWA 2EC9U 1QSZA 3K7UA 4OUUB 5EOCH 5F3BB 1MIML 4CU6A 2IEPA 3WFHB 5HVWA 4NRXB 4X99A 1BPVA 2XZAL 2VWEC 1HCFX 4FQIL 4PRIB 2XA3A 5JXAH 3H7BB 1BX2B 4UILL 1ADQL 4KMTL 3D25A 2HJKA 4MD4A 4JFEE 1ACYL 3FO9B 3QWRD 1OGAE 4U1GB 5E1AA 1EO8L 2JKXA 5D2LF 3W5NA 4Z7VA 1AKJB 4K94H 4LNVA 3INUH 5KSUA 1MJ7H 4NM4H 3TT3L 3F12B 4WFGD 5T3ZL 4NWUL 3QIWC 2MCPH 2G5BB 4PGEB 4KUZL 2HN7B 1U92A 1GGUA 3IFLL 3G5VA 1RJZB 3N1FC 2MQ3A 3FO2B 4HQQH 2OS7A 1KLGA 4XMKL 3BHBA 4ORGA 1CFSB 1P9MC 5GRUH 1YMMA 4UU9A 3AVEA 4IMLA 5CZXD 2ICWB 4Y4HD 5KSBA 4FQXC 4OZGF 4HGWB 4POYA 1UWXH 1BVZA 2APXA 4WI6A 3RWFB 3QUXC 2VDNL 5GJSH 1CT8B 1NUNB 3SDYH 5I19L 4E9LA 1J5OH 3B2VH 3O41B 2R0WH 5JHLL 1D5BB 5FYJE 4YHZH 4NFBA 4N5ED 3T0EB 4G43B 4YDLB 5IK3A 2H26B 3X12A 5LKNA 3ZE2F 4OLZH 4R6UA 2JCCE 2Y07H 3BH9B 1JRHI 1MF2L 3EHBD 4RQQB 3BEWA 3RVUD 4OM0H 1NC2B 5DYOB 4QY8A 4RGOL 3M07A 3IXAA 5ITBL 3EOAA 3RNKB 1CFQB 2X4PB 3IXTA 4JZOA 1MI5B 5E00B 1GYAA 1RMFH 2KDGA 4EI5A 3WIHA 2IPKA 2AXFA 1AD9B 4PJHB 1FZJA 4XMPH 4M6MH 4ZXBC 3F6IA 2PYFA 1Q9OB 3JWDC 4R4BB 1RU9H 1NEZG 1J87A 4FFZL 3MNWB 3F58L 5B21A 1HEZA 1XIWD 5FGCE 2A9NH 5HDQH 3MUY1 4GBXD 3VFNA 2A6IB 4G9FB 3GIZL 2WINB 2EIDA 5BS0D 4ZO8A 3OTTA 2XXMB 4G6FB 1NFIA 3I6GA 3ZZ1A 4A6YB 2CDEA 3K0WA 3BISA 4G9DB 3DVFA 2IF7A 1HYSD 2AV1A 3LEXB 1PG7L 2QSQA 3P4NA 4RRPG 4X9BA 2NW3A 4DKDC 5CEXA 3WNPA 4H8WH 2NY7L 3BGMA 1NPUA 32C2A 5CBEB 5K9QG 2XPGB 5DURD 3CFKB 5I6XB 4Y5VC 3OR7A 3PDDA 1ZLSL 1JYWA 2BY2A 3HR5A 5FYKE 1MH5B 3AM8C 5E9DB 3HI1A 4NHCL 1H3VA 4HX1B 5AEAA 4Q74A 3ZE0F 4HIXH 1BFVL 1JZ6A 3MUZ1 3ULVH 1T03L 4DGYH 4HUMB 2NZ9D 4X7SH 4RGMC 4HWZA 1QFOA 2H32B 3WHE0 4HUVA 3EFDL 5CILH 1TNNA 3VXTB 3AREA 1JGEB 2XTJE 2DMKA 5GRXG 1IT9H 2F58H 3WO3B 5DWUH 4G7VL 1OOAA 1BVLA 4P49A 2FLBT 3Q2CA 1D6VH 4KJYB 1W0YT 1UC6A 4PJAE 2EO9A 3C60A 1LP9B 1MOEA 3NCBB 3QPXL 4ZYKB 4WWKC 2B1AL 4WUUA 2YA2A 4HPOH 1KIPB 1J0YA 1NDGB 4K9EH 2YKLH 5TQ0L 1XGYH 5DK3A 3OWEA 2OP4H 1T83A 1YQVH 3NIDE 2BNRE 1G7QB 3MRQA 3QEHB 2C1OB 5CIPH 1HIML 4BQ8A 4HCRA 5H2BA 4YXKL 2M1KA 1M7XA 1U3HC 2VR5A 5DK0A 2R1XB 3RPIA 3S3JA 1Q9WA 4BK5A 1QRND 4Y19A 4MA3B 3MNVA 1QLFA 5E8NA 3VD4A 3BN3B 4K8RL 3OAYH 1KCVH 3KPOA 1B0GB 4WI5A 4RMQA 3MGAA 3SDCA 4XNXH 1KIRA 3G6JE 3WXVL 4PJ8A 5DJ6B 2P5EA 1FZKA 1JV5B 2YZ1A 4PBWD 4MSWA 3MQIA 4ZS6D 4PB0H 3J7HA 1MPAH 4PJ7B 4OLVH 3QXDB 3N9GL 3FQRB 5IM7B 3FB7B 1KENH 1UYWL 4M3KB 1JHLH 1A7QL 2EDDA 4JFYA 5BOPA 5H37G 3BD3A 3TVMC 4Z77B 2YD9A 2OR9H 4JFXA 4JQVA 3X14B 4DTGL 3QAZB 4YDIL 4X6FA 5SWZB 1OP5K 4NRYA 5CBAB 3VFWA 1DL7L 1F6AB 2YD7A 3EO1A 4L9LB 1HSAB 2BVUA 5EUOF 1AGFA 5BO1L 4BKLA 3RZCD 4P3DB 1S7UA 3HMXL 2D7QA 4F7EA 2GJ6E 2IADB 4YO0A 4WW2A 2R69H 4X6CA 3OB8A 3QZWA 2OQJB 3NFNA 1QLRA 4JRXD 3QG6B 4H0IA 4Z76B 3BIKA 4KGJA 4ELMB 4O00A 1A1NA 5KOVC 4KROD 1F3DH 2CLRB 3GSXA 2E6QA 3ESUF 4X4ME 5FDWA 1CE1H 4XCFH 1RIVL 3HCVA 2D3VA 3RUGF 1CE6B 2ZUQB 4WV1C 3MRLB 5CUSL 3QDMB 3QB7C 4LLVB 1D9KA 4Y4KB 2Y7QA 3G5ZA 1KXVC 3L3OB 3WFCH 3TBWB 1F4WL 4ACPA 3D2UB 1TQBC 1BFOB 3DV6A 2VDRH 1LD9B 1FDLL 2EIZA 4U3HA 3LQZA 2VLJE 4LRIC 3WIHH 5F1IA 4LLUB 1YEDA 4NCC2 4HIHB 5EU6A 2GTZA 1N8ZB 2HWZL 2X1PA 1T20B 1S9XB 4XPFL 1BJ1J 4UB0H 1IQWL 3F7YA 5DQ9A 4QTHB 1P4LA 5BV7C 5I1HH 1YY9D 4YWGL 1OTUD 4Y4FB 4Q97A 3QUZB 3IFPB 1T0NB 4NCDA 1VADA 4ZFZA 4QWWC 2EDXA 2HFFB 3SJVB 1NBZB 3VGDA 2ZUTA 1CXKA 3QEQB 1BREA 4QRSA 5DHVA 1RFDL 5E6IC 3QUML 1Y18B 4J3UA 3H42H 4OCSL 3MRDA 2HJLB 3VD7A 1G9NC 3IDIA 5K9KB 2JELL 2J1KA 4GRMA 2VL4A 2O61B 1A6UL 5I1JH 4NBXB 4Z8FH 3HAEB 3HA0A 5D7IB 1F90H 1X6LA 5SWSB 1MUJA 1GIGH 4K3JL 2WAHA 2EDYA 2HFEB 2P24A 3S3PA 1MQKL 3VD3A 2QJDA 3GGWB 3ZKXB 5JPMB 4FFYL 1I1FA 4U0QB 1IVLA 2WIIB 2NTFA 1PAMA 4KDTA 1I85C 3K80A 1S7RB 4MNHA 4DK6A 3S5LA 1I1AC 3BW9B 1NAMB 5LBSL 4P5KA 4PJ9D 2D7NA 4LEXH 3EO9H 2WUCH 3HE7A 4HIJB 5TDPB 2QLVB 4XVSH 5EZLB 4DGIL 3OGCB 1SJEA 1RAMA 2H45A 3BESR 1CL7H 5C0AE 3SDXF 4P2RE 1KEMH 2ZUYA 2CXKA 2R4RL 4XVJH 1T7WA 5TE6L 5TH2A 5C0IA 4X80H 4DN3L 4JB9L 3TBYA 4I48A 4PRBA 3ZO0A 3I6LD 1QFWH 3IKCA 3OKDA 4JO2L 4G6AC 4ODHH 1T2QL 5BRZD 4NP4L 1Q94B 2EH8H 2BSSB 2VZ3A 5TQ2L 2MHAA 2WUBH 8CGTA 4U7MA 5GJTL 2DIBA 4JPIA 2EYSA 1OAQL 4HCRH 3LAFA 2EYRA 4J2XA 2ENSA 5EBWA 1A5FH 3FO0H 4N0CC 4F15B 4E41A 1RJYA 3UDWC 1Q0XH 2QBWA 2AJXL 4Y5XA 1DVFC 4X7EC 3L5JA 4YHYB 3QIUA 3EOBB 4JAMA 3CLFL 1C5DA 4Y4HB 5KS9A 1LVEA 1UJ3C 2CIKB 2FX7L 4XZUB 2CK0L 5I1KH 5CJ5A 1MHHB 3V5DB 3VI3F 3GMRB 9CGTA 3HI5H 4V1DE 4KRLB 4P59H 3T65B 5JZ7C 3LKNB 4C57C 1UM5L 1NMCB 1CLYH 4PLKD 4ALAL 1YPZE 1NFDF 3T4YB 1VFAA 4M7LH 5BJTA 2C4FT 3LIZH 3ULVD 1KB5L 4K71C 2DQJL 3GMLA 1M1SA 5T33H 4IRJC 5I1GL 1WK0A 2X5PA 3VRJB 3EYVA 1KCKA 2WBJA 5BXFA 3WLWD 4KUCD 2FL5A 3TIEB 4LGSB 3RY5A 1NMBL 4UNTA 2DLIA 3BE1L 3JWOC 2HFGH 2DRUA 4NFDA 2XWTB 3OGOE 5C0DB 4XCEB 3P0YH 4O2FB 5D7KD 3UZVB 5F1NA 4NO0D 3IDGB 5SX5H 4E42A 5JIIA 4M7JH 2W0FB 5EB9A 1CZ8L 3ALXA 4XGZB 3CK0L 1URLA 5DEGB 4ZAKD 1DDHA 1ZTXL 1XAUA 1CLOL 3MRFB 1NQBA 1J0HA 1J8HD 4PJBF 2HKHL 3KJ6H 1C7SA 2B4CL 3LN9A 4JDVA 3SKMA 2CH8A 3CZJA 5JW3H 5C0EB 2VXQH 4PRAA 1P84J 3DXAD 2Y25A 4GXVH 3LD8C 1XIWB 4U1KB 1ITCA 5F3HA 5DJYA 4TNWF 1U93A 1RK1A 1RUPH 2WZPD 1QOKA 1RZJL 1PQZA 1Z5LA 3K4ZA 4PJCF 3TZVC 4GBXB 3DIFA 4RISL 3C08H 1KJMA 4U1SB 5BS0B 3V6ZB 4RAUA 4LP4A 2VDML 2E7BA 4CGTA 5DT1L 4ZFOB 3HC0A 3OX8B 2N1KA 5HHMD 1JGLH 1S7WA 5DUPL 2H2PC 2R0KL 3MROA 5F89A 3FQTA 1JF1B 2VDPL 1UM4L 4O02H 3ZHKA 4BSJA 4JFEA 5DURB 4XNMB 1OGAA 3GRWL 3MJ6A 4U1IB 4LCIL 4XPGL 3N1GC 4XBGB 2VXSL 1N5YL 1AQKL 5ITFA 4WTZG 4LSSH 4D8PB 4JE4B 2BCKA 3O6FA 2PCPB 1OW0A 4ZQKA 3LZFL 1K2DA 2Q7YA 2VISB 5L7XH 5FOBA 2K3TA 1YMMD 2EDQA 5EO9B 5ICYB 4PV9A 5DHVH 3EDDA 3GBLA 4AEEA 2GI7A 4RWYL 4Q6IA 7FABH 1NGZB 3MRHA 1NCBL 5HYFA 4U1GC 2VRAA 1ZHNB 2BSTB 2AXGA 4DUWA 1LE5B 1EJOL 5KG9A 3MJ7B 4P99A 4AEHL 1Z0NA 4PP1C 4OLUL 4LDOB 4M5YL 4LSQH 2OLDA 4JHAL 1ZVSA 4XXCA 1D5XB 1IC5L 5CJXA 3O0RH 4C4KO 2FX9L 3X3FH 3MUGB 2I07B 2ICWI 3NFPA 1LE9B 3QWOB 4HW6A 4E0RA 4RIRB 2XA8L 4WHCA 1RZGA 2ADJA 3UAJC 2APVA 4PGJA 4M1GL 3ARRA 4KTDL 3A6OA 3U1SH 1QRNB 5BCAA 3PIQB 4UAOB 2Z0BA 4FQ1H 4MA8L 2CPCA 4JLRA 3NFSH 2JCCA 1D5IL 1ZWIA 4FZEL 4YHPB 1YNTB 3RNQA 3GI8L 5IMMA 1HHGA 5EO1A 4OCYL 4XC1L 1AXIB 1LNUB 2LABA 4LPUA 4EI5D 4NN5B 3VMNA 3IFOB 3QULA 5EO0A 4UOW1 4XNYH 5T1DH 4URTB 4Y88A 3TYFB 4AZ8A 3QDJE 4C4KT 2HT4C 3IT8D 4EIGB 3HAEG 5D2LE 1R3JA 5IP4A 3SO5A 4G8IA 3FO1A 4JN1H 4HS6A 2GCYB 2VLME 1E4XL 1W72A 2BVEA 4LVEA 4YDLC 3RA7L 3O6KH 1TETL 1OAUH 5EC1B 5C0ND 1VCAA 4QO1A 4I3GA 1LGVA 1QFWM 4HFUL 1F4XL 1SJHA 1QD0A 5DO2D 3WLBA 1NLDL 5DXWA 5KSVA 5GGQL 3FFCE 3MRPA 3MBEC 4KXZH 1I8IB 4HULB 3IDUA 4PG2A 3UTQA 1MREH 2D9CA 3QI9A 5A16B 4JEGB 5T3XE 1RULL 3W39B 4ZTPL 1DBKL 3C8KB 2MPAL 1E4KA 1JNLH 1TCMA 3M45A 4NNXA 4YAQA 1F58L 5D2NB 3ZYZA 2R8SL 1K6QH 1CGWA 1F4HA 1KF9B 3EOTH 1UACH 3MV8D 3VXRE 1P2CB 4GAJH 3FB6A 2G9HB 4JRXB 3I2CH 4GG6F 3DX9B 2PO6C 2QQLH 1IM9D 2FIKB 3RIAK 3STLB 1F6FB 4M4RA 4KROB 5IV2B 1MLBA 4G6ML 3U0WH 3CDGB 1FFPA 1L7TH 3VXMD 2EE6A 4QRUA 4OD3L 5F9OH 5IMOB 5E8PB 5KBNC 3BKYH 5DZNA 5SWQA 1J11A 5BZDA 5CGMA 5C2BH 4Z7UE 3KDMB 3K1DA 5JPNB 2F74A 5IUSA 3ZMRA 4NYLB 3C60D 2VZVA 3ESVF 2LV4A 1BVKA 4L29A 1IZKA 1QSFE 5TE7H 2WWKO 4WUUD 1SJVA 4U7KA 2P8LB 3ORJA 1FLRL 2BDNL 4PJAA 4RAVA 3BKJL 1M7IB 2RGSA 2G60L 2DB8A 4XVUD 4XCNA 3IFNH 2Q76A 3BH8B 4Z0XB 1LDPH 1N6QH 3H3BC 4YHOH 1S3KL 3TO4A 2CRYA 5FYLH 5F7NC 5GRVL 3S4SA 2HJFB 5IESL 4Y19D 4CVWA 5BQ7A 2BNRA 5D7SL 4BH8B 2L0DA 3D0VA 3VE0B 3L3DA 4XP6H 5HVGB 4RZCA 4GAGL 3HZKB 4F33B 1B3JA 2WWKT 1AP2A 1HH9A 3SDCD 3TM6A 3VW3H 1N0LA 2VN4A 4PJ8D 5C0JA 1A6AA 3ZTNL 4P2OD 2FJHB 3ILQC 4X0KA 4R2GC 1NMAL 5J3HD 3HNTL 2Y4SA 3G6JA 1EXUA 4UZGA 2ADGA 3TH2T 2YA0A 5FUCE 5GGTL 1RZKL 3SO3B 3VFVB 2GT9A 1KCRL 3JV5A 5HGGS 4I0PA 3U30B 3BWAA 3PHSA 3OXRA 3TCLB 2X89A 3MA9L 4XAKD 2DYPA 3MLTA 5DF0A 4U1LA 4LMQE 4ZFFA 5D1ZC 2VE6B 2BOCA 2WWMC 1LMKA 3PDOA 4CMMB 1KN4H 5DRNA 5TGBA 4HMCA 4ZTOH 5MEOA 2R1YA 3ARGA 4YR6B 4PJ9B 2HTKC 3WIIH 1OAXL 1INQA 3FT4B 4N8VB 2EZ0C 4JN2A 4NGHL 1OAKL 4X5WB 2BSRB 4B7LA 5J57B 5FK9A 3THML 3L6FB 2YN3A 3HKFA 1XCQB 2DLFL 3KLAA 4HJJL 3VWKC 1VERA 4OCNC 5DJCB 2QEJA 5FECB 1OQXA 2WBKA 3TBSA 2LVEA 4BZ1L 5T5NG 1L7IH 3B9KC 3H3PH 5JQHC 4GS7C 2G2RB 2GJ6A 1P4IH 4K7FB 2XZCH 2Z91A 1KELH 5BRZB 1F4AA 3TPUA 5IT2H 4XAWL 4QHNA 3P9LB 1CICC 3UBXB 4HWBL 2OSLB 5IVXF 5FYJH 4UI2A 3U79A 3ZYIA 4U6TA 1D9KD 3VFSA 3LVEA 2NNAB 4X4MA 3ROLA 3TBVA 5I15L 3UO1L 3K8MA 1HOCB 4ZPTB 3GNML 1VKXB 2VAJA 2VLKE 3HI6L 3QUYA 1WC7B 4EI6B 4F2MA 2I60H 2C1PB 4WFHD 1KCSH 1TXKA 2L7JA 1CK0L 2EO1A 4JKLA 4KZDH 3HPJA 3NAAH 3QXUA 4BFIB 5I8OH 2DQEH 4AM0B 1MIEL 1YEHL 3MRBB 5EU6D 3RY4A 5BW7A 1OLLA 2P8PA 1SY6L 2PR4L 3EGSB 3K81A 3KPPB 5SX4H 2ESVE 1U6AH 2HG5B 5HHPA 1ZSDB 4R4FH 3CC5A 5CHNA 2UWEF 2VLJA 3CSBA 1DLFH 4NN6B 1W72H 4LNRA 1CF8H 1A7OH 3WL9B 4JR9H 5CSZA 1C12B 4XTRD 3DX6A 2ED7A 1U8OB 5BVJA 1RJCA 5DD6A 1INEL 2IH1B 3E6HB 1T5WA 5ELIA 5F8RC 1DE4A 4Y4KC 1H3GA 4HLJA 4R0LB 4P0DA 3WEXA 3A6BL 3QCUH 3SGJA 2J8HA 1BOGB 35C8H 1H8NA 3HLAB 1AE6H 2FH8A 1GZQB 5SV3A 3RL1A 4O51A 2HVJB 4M6AA 3RL2B 4LCWE 2YUVA 4X6BB 5GGSB 3I50H 2ZSWA 4LCYB 2LU3A 1UG9A 4KTEH 5F7FA 4XT1C 1GSMA 5GGVL 2WSKA 3LCYA 5DJDB 1L9NA 2FEEI 5I30H 5DI8A 3O8XA 3P9WB 4NO0B 2DDQH 3EZ8A 1DTUA 4F57L 4Y4FC 3PDGA 1OARL 3QUZC 4OF3A 3S36L 4ZAKB 3DUUB 2VC2L 4NJ9L 2ZCLL 4OZFA 4LLQB 3R06B 5CIPB 1J8HB 1DUZB 1T0MB 4M02A 4NUGH 1CDJA 3DXAB 3HE7D 5FYKH 2A1WH 3WE6A 3O9WA 4YK4C 2MKLC 1W2KT 4JM2C 1SVZA 2E7LC 4X99B 4ZOEA 1XMWA 1J8KA 1FZOA 4FQPA 5C0AA 1K4CB 3J8F7 4P2RA 3D25B 2JK5A 1RZIA 2X2YA 2HJKB 5EZIH 5EIIA 5HHMB 1YN7A 5HHNA 1NGQL 1YC8A 2EDJA 5E1AB 3S37X 3UYPA 2IFGA 1KUMA 4I3SL 4Z7VB 4H0GA 4Y5YA 1Q1JH 5KSUB 4JFZL 1OCWL 3D85A 1FVCA 4FZ8H 5L2KD 2BJML 1F3JA 1I1YA 3NH7H 1KTKE 4OZHE 4QT5A 5TFSH 3G5VB 2XKUA 4ORZC 3QFDA 4E41D 3TV3H 3VGFA 4NZDA 1KCUL 3KXFE 3M1BA 3QIUD 2QL1A 3BHBB 3HRZA 4ORGB 1YMMB 5EU3A 4MQTB 4UU9B 1JGUH 4IMLB 1S78C 3VXSE 1IAIH 5KSBB 1MCNA 3BQUC 1SBBA 5FA3A 4FQIH 5DRWA 4GKOA 2RQ8A 3GI9L 1CN4A 3JV0A 2VSCA 5DD3L 4KK5D 1ACYH 3CJJA 4HS3A 5LXGL 4RGNC 1IKFL 1EO8H 5EIVA 2XICA 1N26A 4V1DA 3RWDA 4RCAA 4CNIA 1H3TA 1T6WA 4OLYL 3TT3H 2XFXA 1YPZA 4XB8A 1MCLA 4NWUH 4F15C 5IK3B 5MP6L 4YDKH 3X12B 2WBJD 4NKIH 1CLCA 1ZEAL 3V7MA 3GJEA 4NM8L 4J1UB 4CMHC 4Y4HC 2YEZA 3BEWB 4XMKH 2VITA 3N1PC 3BPNB 3C2AL 3H8NA 3IXAB 3WFDL 4EVNB 3EOAB 4ZFGL 5GS0L 4JZOB 3IXTB 3Q6FA 2HLAA 4EI5B 3DVGA 1JGDA 2AXFB 1FZJB 2VDNH 2ICWJ 5EBLB 4PG9A 3BWUC 4O58H 5DMGD 2KBGA 4NQEE 1JHKL 1WF5A 4N5EC 5FYLD 1RY7B 4RMVA 3KPMA 4G8GD 5JHLH 1WCQA 3FHQA 1FL3A 4C54A 1WVZA 1HEZB 3IU3A 4F9LA 3AC0A 3VI4F 5KVDH 3RVTC 4LVHC 4RBPH 3DX7A 3VFNB 3RVUC 4LVNB 2DM3A 1U8NA 2B1HH 2F8XC 2CSPA 2AQ3A 2AGJL 3EJYD 2SEBA 1K3IA 5FCUL 1JVKA 1NFIB 1MFNA 3NBNA 4TNVF 2CDEB 4RGOH 4PV8A 5DHYA 5FHAL 2AV1B 3P4NB 3SQBA 1RPQA 1YYMH 4PYGA 2NW3B 1QFUL 4M6OL 5CEXB 3JBG7 4NO5A 3BGMB 1ONQA 32C2B 3SGEI 1DZBA 1O0VA 2FECI 4JFED 1GHFH 4S1DD 4YXLL 1OGAD 1L9MA 4L5FH 4X5LA 4M43L 3EJZC 3OR7B 3MGOA 1WGOA 4GW5B 3MV8B 3K8KA 1Z9LA 4OD2A 1NUDA 4FFZH 3NTCH 4ZUUA 4KRMB 3HR5B 3IDMA 3A67H 3O3EA 3C09C 4S1QL 3STBA 1JWSB 1T1WA 1X5LA 4TSBL 1SMAA 3O6FD 1EH9A 1IM9B 3MLUL 4HWZB 4HUVB 4Z7WF 3VXMB 2EXYC 3AMLA 1PVHA 2J8UF 1ZT7A 5J6HA 2OZ4L 2VUOA 1TJGL 4ERSH 4GMSL 3IJSA 3QUKB 3L3KB 3HZMA 1CLZL 4OF6A 1BVLB 4M00A 4I0CC 3VA2C 3JVGC 2YRLA 3QRGL 3TN0A 3CX5J 2P7TA 3JSSA 3C60B 4M62H 1PG7H 1QYGL 1FNEB 4ZO6A 2OTWA 1FE8L 5AG8A 2NY7H 4WUUB 2UVEA 3HN3A 1EHAA 1A22B 4NNYA 2YPKA 1F8TH 4MGXA 2ICCA 1IKNA 4EUPA 1A7PL 2NZ9C 3MRQB 4OZFH 3TA3C 5FYJD 4PJCE 4NHCH 5H2BB 4FQHA 5DQJA 5DK0B 3QDGE 3RPIB 3V79C 4G3YH 1PY9A 4Y19B 4MHHI 3MNVB 1QLFB 4X6EA 5E8NB 5F96H 1T89A 4JHZA 2D31A 1I8LA 3U7AA 4UIKL 2PW1B 2UUDH 1NL0L 3KPOB 5CZKA 4PJXE 1QKZL 5CP7A 1HDMB 3DGGB 3SDCB 1KIRB 1U8JA 4PJ8B 3BKCL 1A6ZA 1FFNA 1UXSA 2NCMA 4YDJB 1FZKB 1FJ1A 4P2OB 4FS0A 4MSWB 3QPXH 2EIBA 1VPOL 5I8CA 3OZ9L 4LSTL 3PP4H 4ODTL 2Q7NA 5TQ0H 3QDJA 3KPLA 2AJVH 5KAQG 3MXVH 5L88L 5HGAA 1GC1L 3SE3C 3V6FB 1FN4A 4PJEA 3VGAB 3GKWL 2XV6B 3MV7E 1VDGA 1FSKC 4XPHL 1K3ZA 4CBPA 4UAOC 1A2YA 3NABL 5DFVD 1LDSA 4YXKH 4CUCA 4HBCH 3GHBL 1A6PA 2Z4QA 4JFXB 5DLMH 4KK9D 1MAKA 4P5TC 3QI9D 4Z18A 4DEPB 4X6FB 3MFFB 2AV7A 6CGTA 1HQ4B 5EOQH 3S96A 4LLDA 4NRYB 3FFCA 3VFWB 1NCUA 1NCCL 1TVHA 3EO1B 4A2LA 2XKNA 3P30L 3Q5TA 4GRWE 1JIBA 4LHUG 4HUXA 1AGFB 4ZS6C 4BKLB 1J10A 3VXOA 1S7UB 4P4RA 4F7EB 4I0KA 2ZUSA 2W65A 4WW2B 4YO0B 2PTVA 3QQNA 5EZOL 1OPGL 4OZ4A 1IAIM 4X6CB 3QZWB 4OLWL 3NFNB 1QLRB 1QBLL 3BIKB 3N9GH 5IWLA 3VFUA 4UT9L 1A1NB 4O2CA 4QHLA 1A7QH 3VXRA 5FYKD 3ZTJH 4G5ZL 3VH8G 2V5TA 3GSXB 5KVGL 5EBMA 5FDWB 2AEPL 1VFUA 2GTWA 1P69B 3HCVB 4UBDC 4MJ4A 4MNGA 4DZBA 1A1OA 2VXTH 4ZNEE 1O7SA 4YDIH 3EAKA 1IGIL 1D9KB 2XTJD 2Y7QB 3DVNB 1KXQE 3G5ZB 1SHMA 3BN9D 1XZ0A 1DL7H 3RZCC 4NKMA 3MJ9A 4Z7OF 4PJDF 1JZ4A 3DV6B 4LAJH 4Z7UA 5BO1H 5IFHL 1DQML 2EDKA 2EIZB 3LQZB 5F1IB 1M71A 5ESAA 3ZDYE 3RGHA 1YEDB 3H9ZA 5EU6B 1QSFA 2GTZB 3BIAX 4IJ3B 4LVOB 3KG5A 2QQKL 3MV11 1G0XA 3F7YB 1DN0A 3TO4D 2R0LL 4MWFA 5DQ9B 1P4LB 2E9IA 4DFIA 4AEFA 2BNRD 4S1SH 4JG0H 3BZ4A 5GSVA 4RAHA 1NJ9A 1V7NL 1VADB 3GSOA 4F80A 1RIVH 3K2UL 4JVWA 3K4AA 3D6GA 2DS4A 2EDEA 4XPAL 5DHVB 4QRSB 4HIIA 1OVZA 3V5KA 3DETD 3MRDB 3TF7C 4DKEL 2WV3A 3IDIB 4LSUL 1DCLA 4LASL 4GRMB 5EFIA 2ZOLA 1KJ2L 1YQ2A 2OBGA 1FDLH 4ZMAT 5IMLA 4WHYH 3KLHD 5CAYB 4I0PD 1SEQH 3B6SA 4YXHH 2HWZH 1MUJB 1YY9C 2P24B 4JHWH 3GRWA 3N1QC 4S2SA 2DYPD 4RDQF 2X1QA 4XPFH 4IS6A 1IQWH 3KR3L 1I1FB 1DJSA 4AIZA 4XVTH 3MMEA 1DQLL 2ILLA 3ARGD 4MNHB 2LU7A 3S5LB 1X6NA 1A1MA 4OZIE 3BDBA 2Q87A 3HE7B 4X9GA 3GSVB 4WNQA 4Y16C 1SJEB 1RFDH 4JDZB 1QNZH 4X4YB 5ESVB 4NZJA 4PJGE 1UA6H 2JELH 4M6NH 4B50A 3FCTA 3SO3C 1Q9LA 1OSZB 5TH2B 4OB5L 1M7DB 1IRAY 1TVBA 2OXGA 4S1RH 3U30C 5L9DL 3IVKB 5DQDL 5LQBL 3TBYB 4I48B 2A77L 1OSPL 2GJ6D 4PRBB 5DJZA 3IKCB 3OKDB 1YY8A 1N5AA 2H1PL 1MQKH 3FB5A 2MHAB 4N1HB 3WNKA 4XP4H 4EUPH 4I8DA 5C0FA 1QBML 4JPIB 2EYSB 1QA9A 2ZCKH 4KWUA 5I1CL 5K93A 2EYRB 4ZS7L 5L2KB 4LLYA 2YS4A 5LBSH 4S11A 5CJOH 1T7ZA 4ZUSA 3WO4B 3HC3L 1RJYB 2VH5H 4PTTB 4E41B 3QUYD 3VRLF 3KPTA 4Y5XB 1V3MA 3QIUB 2V7NA 3HC4H 4L1HA 4ZDHA 1C5DB 1WJ3A 3D0LA 5KS9B 1DFBH 5TE6H 3UBXI 5IHUL 3S35H 4DN3H 1N0XH 3U9PH 3WJJC 4NZRH 5C07E 2VLJD 1H8OA 4YX2L 4JO2H 3RZWA 2VDLL 4P2CG 1T2QH 5DDHB 2ESVA 4NP4H 3AXLA 1VFAB 5BJTB 1I9IH 2DI9A 2ED8A 1CGXA 2JJSC 5EU4A 4LU5H 1MQ8A 3OB0H 4L8DA 3CMGA 3SE9L 5ADPL 4J6RL 4G8EA 5MHSE 3EYVB 2WBJB 4IRSC 5BXFB 2F53E 1PKQE 2FL5B 3O3UN 3PABA 2AJXH 2X4QA 2IQAA 5GGSY 2ICES 5ILTH 4LCWA 3MLWL 2VXUL 1TNMA 1NBVL 1JNHA 5T3XH 2APFA 3O8XD 2AQ2A 3T3PF 3WIFA 2CK0H 4E42B 4PLKC 4KKLC 1ITBB 2HVKA 5ECJE 3ULVC 1DDHB 5ID0A 1AIFA 3V0WL 1BIIA 4YIQA 4TPRL 4YHLL 4JDVB 4K8RC 3SKMB 4G8GB 4B5EA 4PRAB 2AK1H 3P4MB 1WBYA 4U33A 5F3HB 5D7JA 5DJYB 5FV2A 2CO6B 2Y5TA 1U93B 5I1GH 1RK1B 2Y6SD 3O9WD 4HF5L 4ZUVA 1Z5LB 1PQZB 3OHXA 3MODL 4GXUN 3O2WL 2YD5A 1JRHL 2HAZA 5D4QA 4KGLA 3CDYA 2WANA 1KJMB 1NMBH 5DD1H 5FEBA 4HZLA 3DUSA 4RAUB 2ZJSH 4K9EC 1KTLB 5C0AD 4XX1G 3MJ9H 3LKSA 4LDLB 4P2RD 3HC0B 3JWDL 3MYJA 2ORBL 4U1JA 4CVUA 3DO3A 4P9HH 4ZAKC 2DTML 2X10A 5FB8A 3MROB 5F89B 3FQTB 1MHEA 4AT6B 4P2YA 4P57B 4ODXA 3KAAA 3OXSA 2V17L 4JFEB 1ZTXH 1OGAB 1U91B 5SX5K 3D85D 2LQRA 2HKHH 2JJTC 1KJ3H 5ITFB 2IMNA 4YHML 1YNLL 2V7HA 3LV3B 2BCKB 3O6FB 3TNMB 4JVUA 2I9TA 4ZQKB 1RZJH 2XNAA 1K2DB 2Q7YB 1TIUA 1S9YA 1YMHA 4OZHA 4BSWA 2LFGA 5FOBB 3KWWA 3IAQA 4PV9B 4RISH 4IDLA 1MHPH 2IANE 2DKSA 4WJ5A 4DQOL 4Q6IB 3LHPL 5E99L 3KXFA 3MFGB 3MRHB 1H3PL 2JLLA 5DT1H 2AXGB 5D1XA 3U7YL 5KG9B 4FQJL 3FTGA 4F3FA 5B38G 3HRPA 1T2JA 4PJIF 5DUPH 4HGMA 3MV9D 5IJVA 2VDPH 1EVTC 1UM4H 4OIBA 4MX7A 3T2NL 4V1DD 3UJIL 4OQTL 2Y06H 1ZVSB 1SJXA 2X9YA 3GRWH 4KRNA 3LN4A 4LCIH 3NFPB 4H20L 4KAQH 4NC1C 4UINH 2VXSH 4E0RB 1Q9KA 2NMSA 1N5YH 1HSBA 5ABDE 1RZGB 3E8UH 1A14L 1QP1A 2ADJB 4UNVA 2P43B 3HFML 2D0FA 3LZFH 4IDJL 5DMYA 4JLRB 2M2DA 2JCCB 3WFBL 2W9LA 3RNQB 5IMMB 4NQUA 1HHGB 5EO1B 2JIXA 1AXSA 3EFFB 3QULB 4OTXL 1A6VH 4M61B 5CEZL 4HPYH 5C0RH 4G8IB 4LSVH 5E0QA 4HS6B 1O5DT 4OLUH 1U95A 4Z95L 1W72B 4K7PX 3NIFF 3BO8A 5IBLD 2CDGA 4G6KL 4JHAH 4GQ9H 2VWEE 4NQEA 4M7ZC 4ONHA 4NQTA 1S5HB 3LKOA 5C0GA 4HWBA 1AGBA 2NXZD 2XA8H 3O3AA 4L4VE 1SJHB 3RHWF 2ZUWA 5FGCB 3WLBB 5KSVB 4M1GH 3MRNA 1PEWA 1Q38A 1XGUA 1DUYA 1XGRA 4MA8H 3QI9B 1MVFA 5J12C 1D5IH 4NWTL 1ZXQA 2YR3A 4FQQA 4JDTH 1AI1H 4NNXB 1MJUL 1YUHA 1EZVY 3W9EA 5C09E 4ZG1A 5J13C 5IVOA 5LVEA 1A8JH 5K9OA 5C0NC 1FYTE 3FB6B 3RA7H 2ATPA 2PN5A 3UYRH 4HAFA 2EYTA 5C92A 4XNQA 1C5CH 5K59F 4U6VH 4X6DA 1MLBB 4QRTA 4PJHF 1F4XH 1FFPB 3U4BH 2XYCA 4QRUB 1NLDH 1ULVA 2EKJA 5GGQH 3NA9L 5SWQB 4APQC 3R8BB 5BZDB 4GSDH 2F74B 3MJGX 1RULH 2Q86A 3TN0D 2XTJB 1ZLVH 2DQCL 3V9FA 1BWMA 2MPAH 5I2IA 4LCCB 1BVKB 2ATKA 5IB2A 3QP3A 4YHKL 5I1LA 3CLEL 1GCFA 1IEBB 4PJAB 4RAVB 2R8SH 3D39D 2E7HA 1C16A 4J3VA 1AGEA 4PY8J 3LKRA 2FNBA 4L4TE 4YQXL 1PGRB 4XCNB 1CL7I 2JJWA 3RVVC 4AMKL 1FFQA 2Q76B 3VI4E 3KJ4B 2C3VA 3TO4B 5ETUA 3S4SB 5BQ7B 5MERB 2BNRB 4G6MH 4OKVA 3W2DL 4ELKA 3GSQA 2BVQA 3D0VB 3L3DB 4PJCA 3P0GB 4RZCB 4OD3H 2CXGA 1QFWI 3FZUC 4BQ9A 3LPFA 3QDGA 4MQXD 1WZ1H 1AP2B 3VGEA 4G80A 1HH9B 4CVZA 1RZ7L 1VFBA 5C0JB 1KFAL 2R9HC 1CDYA 4PJXA 1R24A 4RX4D 2D9QB 3EIFA 5DD5H 4XVUC 1EXUB 3BPCA 2ADGB 4I5BA 4KI5F 5BV7L 4HXAH 1HHJA 4KPHL 2BDNH 3QDJD 4XNUH 3BKJH 2GT9B 4P48A 5JW4Q 2G60H 4I0PB 2GHWB 2BP3A 3BWAB 4OV5A 3OXRB 5F7EH 4F8QA 2VLMD 3BPLB 2Z31A 4N68A 2IGFL 2DYPB 3MLTB 4U1LB 3RDTC 4ZFFB 2BOCB 1LP9F 3OG6B 4AL8H 3MV7A 5IESH 5DRNB 3TYGL 1MCDA 4HBQA 5FFLA 5MEOB 2R1YB 1K4DA 1WWCA 3ARGB 4LSRL 4PJ5A 3VFTA 3MO1A 1MFDL 4J4PA 3FFCD 4X8JA 4JN2B 1G1YA 4P2OC 3TT1H 3KLSA 2IAMA 5E56A 1S8DA 4AIOA 5J3HC 3K3QA 2J5LB 5FK9B 5T3XD 1WWWX 2Y36L 4Y8AA 3KLAB 2RCSH 3R0MA 1K8DA 1NMAH 4YFLI 4L1DA 5D1QA 1AC6A 3FRPA 4NZTH 5C3TA 3TBSB 4FFVD 1N3NB 4HWEH 4Z7NF 1KCRH 1YZZA 4N0FB 1CR9H 1U58A 15C8H 2GJ6B 2E6PA 3EO0A 1EFQA 1MCOL 4OKDA 2Z91B 2XT1B 3TPUB 3VXRD 3P77A 2QADD 2CKBA 4QHNB 1DBML 1NAKL 4ODSL 4DEPC 5E08H 1B88A 4C83A 4LDEB 1ZA3A 2W9DL 2J6EL 1CFTA 4PJ7F 5ACZA 3VFSB 3ROLB 1UQSB 1MCWW 1HHHA 4LRNL 3QUYB 4NGHH 4F2MB 5FUOH 1NGPH 5ALBL 4ZNEA 4GKSB 4HS8H 1IGMH 3THMH 4QLRA 4DW2L 2K1MA 5IW1A 2R0ZL 3HPJB 3FN9A 4J7RA 3AY4A 3NCYP 5ACMA 2D4DA 1QSFD 2F54E 2P8PB 4Q7DA 3MLVH 3WDIA 3OPZH 4BZ1H 2FX8H 5HHPB 3T0DA 3CC5B 5AZEL 5CHNB 2X1XR 2VLJB 5D71L 2BHZA 3ZKQD 4XH2A 1RUMH 3O6ML 2IFFH 4LNRB 4CW1A 5CSZB 3ET9F 2DN7A 4NQDE 1ETZA 3DX6B 4KKBC 5DJXA 5BVJB 5DD6B 4WI9A 4R26L 1J1XL 1DE4B 2X4NA 4HWBH 3RQ3A 3WEXB 5HHOD 1IAKA 4GXUM 3BKML 4O5LL 3QWQB 5I15H 1Z3GL 3QSKB 1K85A 3UO1H 3RL1B 4O51B 2AJUH 4ELMF 1G6VK 1WEJL 3C5ZA 4NNPL 1MAMH 2XQYG 1AJ7L 2ZSWB 3RWJA 3OJ2C 5ENWA 1ZOXA 3I75B 3CFCL 1R5WA 5J8OA 4LVOC 1JGVH 5E70A 3HUJE 1MIEH 1VB9A 3LKPA 4HWNA 1SY6H 3O8XB 5B8CC 4K3DH 3BMWA 3MCG1 4HIEA 1E6JH 2EKSA 4BFEA 1YEFL 3GO1L 2P8MA 4ONFL 1GGIL 3IDJA 3ZSTA 4OZFB 5LGJA 2J7LA 3JTTA 4P46A 2FJGB 3LSOA 1RVFL 5FO7A 3QJHA 1INEH 4NPYA 1BJ8A 2QSTA 3PNWA 1KPVA 1FBIL 4M7KL 4K07A 3PWPE 1EFXA 3WE6B 3O9WB 2HMID 1JPFA 2PTTA 1BM3L 5KANG 2P5WE 4OZIA 4OFYA 1R3IL 3LRHA 4U6HA 4PS4H 1OTSD 2ERJC 1WWAX 3TNNA 3GBNL 3ARBA 1OAZH 2FHFA 1FZOB 2CJUH 1KULA 5C0AB 4PJGA 1J0ZA 3RBSA 5GGVH 4P2RB 3SDAC 2JK5B 5ADOL 1RZIB 5EIIB 1WV7T 1YN7B 2Z92A 5HHNB 1B4JL 3BP4A 1IC4L 4JY6A 4QHMA 2ZKHL 3DNKA 1EEYA 5I66A 1FCCA 4Y5YB 5DJ2B 3RKPA 3RWEA 1T1XA 2YWYA 3VJ6A 2FDBP 3D85B 5CD5C 2H3NB 2R4SL 1F3JB 4QT5B 2E27H 2DKMA 5D7IF 4LARL 3QFDB 2H2SD 1GL4B 2F19H 1BQHA 5GS2H 3RIFK 3M1BB 3FT2A 4KQ4H 3CFJA 3HRZB 5EU3B 2X42A 4FA8A 2OR7A 3L7FA 2DQHL 1RJLA 2W91A 3MOAL 2A74A 4U3XA 4IRZH 3EDEA 5DRWB 2EIEA 4H88H 3TPKA 4WEBH 4TQEL 3VWJA 1LK3H 2OM5A 4EQ3A 5BVPL 4KXZI 4XRCB 5B4MC 1YDPA 4HS3B 3MV9B 3ULUF 2ESVD 3FN0L 1T5XA 3S34L 1K9TA 1P1ZA 3RTQA 4ZNCD 3MLSH 4I3SH 5C07A 1TJIH 5EPMA 1CXHA 5DRXA 4V1DB 3RWDB 3OJMB 4CNIB 1OCWH 1E6OL 2XFXB 1YPZB 3S4SG 1PEZA 2HFTA 2BJMH 2VKXA 4D3CL 3QHFH 3P3YA 3CVIL 3GJEB 3QIUC 3RIAF 1Y6MR 5EU5A 3I9GL 5FGBC 4QYOA 2YEZB 2F53A 2VITB 1PKQA 1YNKL 3GB7A 2QQNL 4CN4A 4LCWD 4KVCL 4KK5C 3Q6FB 3QCTH 2HLAB 1CGYA 3DVGB 1JGDB 4FABH 3SE4A 5HVHB 1ZHKA 3O6LL 4P5MA 4GRWH 1U2CA 4PG9B 5DGRA 1IKFH 4ZO7A 2BC4A 2J88L 3HE6D 4M1CD 1JI1A 4FQLL 5D7LD 3KPMB 1FL3B 3IU3B 3RY6A 5D7JD 4OLYH 4XCCL 5GRJH 2CKBH 2YD4A 2FB4L 3G6DL 2NXZB 3DX7B 2NYYD 2IBZY 1F3DJ 1H15A 1XF2A 1U8NB 1U3YA 1TPXC 1MJJA 4LOUD 3VDCA 7CGTA 1FH5L 1HXYA 2SEBB 4L8SC 3O2VH 3LMJH 3QQ9C 1XEDA 4WTXA 4DGVL 4PV8B 3F7VA 5DHYB 2JJUA 4OM1H 5GS0H 3ZDZE 4MCYA 4MJ5A 4NO5B 1REIA 1ONQB 1X4YA 1A7NL 1AY1L 1F13A 2A6KA 1RK0A 4MD5A 1FIGH 2XIDA 3MGOB 2VOTA 3V6BR 4YGVA 5I76A 4OD2B 5FGSA 4OCLC 3IDMB 3MOBL 3O3EB 4NO3A 1T1WB 5FA4A 1I7UA 5I1IL 2E9WA 2P49B 3V0AC 4JREB 4LIQE 4XBEL 2FATL 1ZT7B 3UJTH 4OF7A 5J6HB 4DZ8B 4U7SA 4U4BA 3IJSB 4RBPK 1JF5A 1YEEL 3HZMB 3KXFD 4TSCH 2NX5E 4TUKL 3TH3T 2AEQH 3T3PE 5IB3B 1KJ2A 5D1XD 3TN0B 2P7TB 3CUPA 3FQUA 4JFPA 2MCG1 1IGFL 1RQ5A 1U2HA 3FMGH 2OTWB 4HT1L 5JXEA 1I75A 4QOKE 1YYLH 4QRPE 5DZLA 4KVNH 4YXLH 4NNYB 2YPKB 3D39B 2X1WL 4LCUA 4M43H 3SE8L 4A6YL 5E2WH 4HHAA 4EUPB 2D0GA 2P45B 5HYSA 5EOTA 4HLZG 1D6EA 4QHKJ 5FHBH 3TJHC 4FQHB 4TSBH 5DQJB 4IOFD 5IHLB 3RVXD 2YD2A 1J88A 3MLUH 1PBYA 4OI7A 4ZOCA 1IL1A 1AXTH 4X6EB 4Q6IC 2D31B 4HKJA 4XHJC 4LPXA 1NCWH 2YD1A 1TJGH 2YUWA 3PP3H 5CP7B 5KW9H 2JB5H 5INDA 2JIXD 3WS6A 1U8JB 5F7MC 1YC7A 1A6ZB 1FFNB 1UXSB 4UDTA 1MRCL 3QRGH 1T66C 1Z9MA 1KTDA 1FJ1B 3C6SB 4OQ1A 1QYGH 3LS4L 3WUWB 5IGXL 1FE8H 5I8CB 5CJXC 3PHQA 3QDJB 4H5SB 1MFCH 2VDQL 3KPLB 3GJFA 3WV0A 3T3MF 5HGAB 4NQED 5IVZA 1FN4B 4PJEB 4OZFG 1KT2A 8FABA 1A7PH 5HBBA 5DR5H 1A2YB 4MXQD 4ODVL 2Z4QB 5C9KA 1DBBH 2XN9E 5SX4I 1FNSH 1T80A 3A6CL 3O45A 4JPVL 4ZD3L 1DQJA 4L4VA 4LPYA 2AV7B 4UIKH 1NL0H 3S96B 4LLDB 3FFCB 4NJAH 1TVHB 4ODWA 3TLRA 2XKNB 1E0OB 5IB5A 1WTGT 4HDIA 4HUXB 4OCRH 3VXOB 4P4RB 5JMOC 2W65B 4FFWC 3BGAA 4D9RE 3QIWA 4OZ4B 4LSTH 1DBAH 4ODTH 1KC5H 2DL9A 4KRPD 3CCHA 4UV4L 3ZSSA 3S8WA 1HNGA 3VFUB 5JMRA 4TTGA 5DFVC 4O2CB 4MAUL 1NCTA 1UENA 3VXQA 4QHLB 1FYTA 4XPHH 4TUJA 3VXRB 1P9MA 2QADB 1WSST 3NABH 1QLEL 4PG2C 5EBMB 2DQGL 1G7PA 4NBYB 4OI9A 5D8JL 4MNGB 4DZBB 3D9AH 2B0SH 2J8UB 1I8KB 3V7AE 3QUXA 3ARDC 1XZ0B 4NKMB 1WIUA 3P30H 1SYSA 3PUCA 4Z7UB 3CZFA 3SBWC 1UEYA 4K7PH 1MCPL 1M71B 5ESAB 2QSCL 1QSFB 3FAXA 5EZOH 2QKIA 1HKFA 5I75B 3D5OF 3RWHA 1A47A 4OLWH 1C8PA 1DN0B 4MWFB 4L4TA 1G7LB 2HLFC 1FFOA 3CX2A 5A2KH 4JO1H 5JW5A 5HYIA 3NMEA 3F8UB 5KVGH 3BZ4B 5GSVB 1SVCP 1NJ9B 1OAYL 3GSOB 5GS2D 5F6HI 3QDGD 5E24E 5HHOB 4I13B 4HIIB 2J4WL 3V5KB 4LCCC 4GW4A 2ZOKA 2HT2D 4TTDD 4ZXBA 2NY0C 3AMKA 1LO0L 5GQBA 2ZOLB 1EO5A 4NOFA 1I7ZB 5HD8C 5IFHH 1DQMH 5IMLB 3KJ4C 5E94A 4Z7QF 2AKRB 3SKJL 2QQKH 2Z31D 5B3JF 1R3KA 5K59E 1MI5E 2GJZA 4S2SB 1U3JA 3KPQB 1F02I 1G6RA 4IS6B 1IAII 2R0LH 5JIPA 3REWB 4TSAH 3QG7H 3ZKMC 4AIZB 3MV7D 3MMEB 4PJ5D 2NY6C 4PJFB 1BJ1H 2R29H 4GO6B 3DETC 1B4RA 4J4PD 4EBQL 4WNQB 4LP5A 4MXVF 3BT2L 3P40A 2IAMD 3AFLA 5TPWL 1IGJA 2YZ8A 4DKEH 1J18A 1JZ3A 5DUBA 3QRFM 3FCTB 4LASH 5F88A 1Q9LB 4MQ7A 5D1QD 1KJ2H 4K2UL 4WHYG 1TVBB 3AM8A 4K3EH 5DJZB 3PL6C 4OCWL 1KXTB 4YBLB 3GHEL 4P2QE 1JPTL 1CFBA 3SKNA 1YY8B 5GRWA 1CU4H 1N5AB 3LN5B 3CPLA 3HS0A 4FQCH 5FKPA 3FB5B 3ARGC 3MCLL 2ZG2A 4ODBD 3RWIA 2GITA 1QA9B 5J1SC 1FPTL 1DQLH 1RZFL 4LLYB 1BHGA 1G7MA 2VABA 1OF2B 3QPQC 1JNNH 4N0YL 3X11A 5E9DE 4F9PC 1EGJL 1P7KA 4JPWL 4P9ML 4POZD 1INDL 1LHZA 1CIUA 2V7NB 4ZDHB 1A0QL 3UEZA 3D0LB 1BZ9A 2W92A 2NW2B 4UTAL 4OB5H 5IQ7L 2GK0A 4A2MA 4D0BA 1WBXA 5LQBH 2DQIH 2KPNA 4Q6YA 5FV1L 1VGKB 3EDJA 3MCKA 1EHLL 1U3HA 3NIGE 2DIJA 4L8CA 3F62A 2F54A 1C1EL 2ESVB 1KV3A 3AXLB 3GJFH 3L3GA 1MY5A 4KJWD 4MVBD 4UUJA 3ZYOA 1V7MH 3NCJH 4XWOC 3ULSA 5EU4B 3BSZH 3OKLA 1QBMH 2EDTA 5C9JA 4G8EB 4NQDA 5F7HA 2C7UA 1FC2D 4ZS7H 3QUYC 1LO4L 1PSKH 5HDLA 2ZPKL 1EZVX 1EBAA 3F7RA 1FNFA 3HC3H 3C5ZD 5CD3A 4V2BA 3PABB 2VQTA 3JV6A 2E9BA 5CMAA 1YEJL 1YEGL 2X4QB 1UZ6E 4RA0C 2YC1A 2IQAB 5IFAL 4LCWB 1L0YA 4Z7NE 1JNHB 3WUWG 5IHUH 3LDBC 3WIFB 5E2UL 1BGXL 4AQOA 5I74B 2HVKB 5C6PB 3DRTA 4YX2H 3TVMA 3HUJA 2DLGA 4D9LH 4JQXC 2QTEA 4UT6H 1AIFB 4P46D 4JFFE 3QH3A 4YIQB 2I9LA 1FRGH 3HE6B 5D7LB 4MA7L 3PGDA 3WFEL 4DKFH 1WBYB 3AB0B 1CCZA 5D7JB 2MSPA 2Y5TB 4NQSA 4ZO9A 4XP1H 4ZUVB 4BQ6A 4OFYD 3OB0K 3RAJH 1FLTX 5FYJU 3PWPA 1JZ7A 3ARBD 3DUSB 3OSKA 1NANH 1X44A 2P5WA 3ULVF 1YJDH 2OTPA 3NOIA 3LKSB 1UB5A 4TOYL 1RUQL 1TMCB 3MLWH 3MYJB 4U1JB 1NBVH 1GC1C 3E2HC 5SWZE 5FB8B 1S5IH 4AG4H 1MHEB 4I2XE 4HH8A 4YC2B 1F42A 1K5NB 4KUCF 4ODXB 3OXSB 1LO2L 4WV1A 2VB5A 4TPRH 4RWHA 3O9WC 2MNUA 4QXGH 1RV6X 3GK8L 5E95B 1WAAF 1IC7H 2I9TB 3BRFA 4HC1A 4HF5H 2XNAB 3TWCL 1YMHB 4KI1A 4OZHB 4QXUL 4BSWB 1ZLWH 1Z9OA 3KWWB 5KJRL 1OP9A 3E3QC 4LRIA 4L8BB 4R3SA 5CZVL 2KH2B 4WJ5B 1C08A 3KXFB 5GZNC 3VWJD 4JY5H 1KB9K 5F72S 1JMZA 1IE5A 5D1XB 3JWDH 3NPSB 2ORBH 5AAMA 5LWYL 5IBTH 3FTGB 4F3FB 3TO2A 3C5SA 5IJVB 4KY1L 5EIQA 3RTQD 4NZUL 4X9IA 3ZE1F 5C07D 3WDJA 4MX7B 3VD5A 3BD5A 5AD0A 3MA7A 3WMSA 1TJHH 3LN4B 1G6RH 3QQ3A 3MX0A 3GMNA 4ZFOL 1RIHL 4YBHA 1Q9KB 2RFXA 4F7PA 1HSBB 1G0YR 3ZL4H 1YNLH 5IR1A 1H0DA 3HNVL 4DVBA 1CD1A 1CFNA 5MHSD 3U48A 1OHQA 1Y0LA 1DP0A 1BBJA 2F53D 4LSPL 4Z7VF 5E2TL 5FYKU 2X6MA 1QBAA 4R97B 3BJLA 4KK8D 5EUKA 2YN5A 3LHPH 2JIXB 5E99H 5HY9A 4LEOA 4G7YL 4YDVA 3U7YH 1DEDA 2EE3A 1I9JL 1I85A 1WITA 4XHQA 2AS5M 5CGYC 2XQBL 1I1AA 4FG6D 2CRIA 4POUB 2Z8RA 4KKAD 3BO8B 3T2NH 3PWUA 2ITDA 5KSBF 3JUYA 4NQEB 4Z0BL 2AJSL 1PYWB 4ONHB 5IROA 2A0LD 3LKOB 1S7QA 3MUJA 5C0GB 1AGBB 3FT3B 1FCGA 3JUZA 3O3AB 4HV8A 4EZMA 4IHOA 1SM3H 4XC3H 2J6EA 2DAVA 3MRNB 3H3KA 3HFMH 2R1WB 3D69A 4NUJA 1XGUB 3QDHA 1DUYB 1XGRB 1NEZA 2RAMA 5HVHC 1BD2E 2YK1L 5L6YL 4J3SA 2NY1D 3DARA 2R23A 1ZANL 4FQQB 4JVPA 5HI5D 1WFOA 3V52H 1MCQA 4NKDA 1ZHBB 3NZ8A 5GGRA 3IJHA 1E4WL 1YUHB 3U0TA 3W9EB 12E8L 1J1PL 4JRYE 4WFFE 4PTUB 3MZGB 4JG1L 1IAOA 1JFQH 4NKQB 5K9OB 3GMOA 1EK3A 4KRPB 3P11H 2ATPB 2EYTB 2LTQB 1HQRA 4XNQB 3FQNB 4F7TA 3BJ91 4RRPA 3BEVA 3UDWA 3GMPA 1A3RH 1DVFA 4X6DB 3DRQB 1JWUA 1I3UA 4JFHE 1A9BA 5DMJB 3GSNL 4NT6A 4AEIH 1UJ3A 3V0VA 4RGNE 2NR6C 4OLXL 2ZUUA 2DLEA 2Q86B 1VGEH 4NWTH 2BNUA 4GAYA 2BRRL 5I2IB 2O5ZL 5IB2B 2NX5A 5JXED 1ZVHA 3SGKC 5HGHA 5I1LB 4GKNA 1U8KA 4R7DA 3ULUD 4KZEH 1GOHA 3IKKA 1C16B 1AGEB 1NCDH 4GUPA 4QOKA 3SCMC 3U7WL 1S7VA 2IQ9L 4QRPA 3B43A 4QNPE 2C3VB 4N1EA 3IETB 4JREC 4ENED 2IJ0C 4I4WA 2FH6A 5ETUB 2JTDA 3L3HA 1VA9A 3MRRA 3MLRH 4OKVB 3UTPE 2KZWA 4MZ2A 3HZVA 3GSQB 4ELKB 1FL5A 2BVQB 2HH0L 3QCVH 5E6ZA 3Q3GB 4PRHE 4U2YA 3QDGB 3TN0C 2ZSVA 2AABL 4CVZB 1FV1A 1IEAA 3WKML 1VFBB 1TTFA 4LAQL 5F7DA 5IKCA 3CXDL 4PJXB 1R24B 3WSQH 2YOCA 3BPCB 2UZIL 4I5BB 2WNGA 1HHJB 3CLEH 1ZLVK 5HYQA 1L6ZA 4PRNA 1IKNC 2BY0A 1MLCA 1F11A 5MEPA 4KC3B 4OV5B 1NCAH 3IU4H 3UTSE 4RDQG 3TZVA 4HK0A 2Z31B 1W0WA 2BFVH 5JXAL 4IOIA 3QXWA 4KJQC 1X5GA 4ZUWA 1I8LC 43C9A 4OV6F 1VEOA 3MV7B 5D6CA 3MXWH 3V5HA 2X7LA 1T6VN 4UNUA 4PJ5B 3W2DH 3VFTB 3MO1B 1I3GH 3WUZA 2VQ1A 5J1AB 3BXNA 3FJTA 1S7TB 4HC1H 2BSED 4P4KC 4X8JB 4K94L 2HA1A 2XN9A 2H6PB 4MB4A 3RP1A 2DTSA 3INUL 2I27N 2IAMB 1RZ7H 1MJ7L 1S8DB 4NM4L 3L3IA 4O2EA 4Q9QH 2MCPL 3FN3A 5GGUB 1OY3B 1KFAH 3OBAA 4KDWA 4NN7B 2H8PA 1K8DB 5D1QB 3QIWD 4GRWB 1A6TA 2NY3C 1C5BL 1QBBA 1VSCA 4HQQL 4OUUA 1FO0B 1U58B 5I1AA 3EO0B 3BYTA 2IALA 4PD4K 4PRPD 2VSDA 1FYTD 5FUZL 3P77B 1NBQA 5C8JA 2EXWD 3H7BA 2CKBB 1F2QA 4OGXL 5F9JA 1F3RB 1MRFL 1G9NH 4OAWB 3TYGH 4C83B 1ZA3B 4H26A 4LSRH 5ACZB 1BJMA 1RUKL 3QUXD 1J5OL 2GFBB 2R0WL 5GRVK 1MFBH 5F6IB 5D9SA 1HHHB 4OCXH 3QEGH 4CN1A 3WJLC 1MNUH 3ARSA 1J0JA 5KSAC 5E7FA 5A2IH 2BNQE 5I17A 4WIQA 3BI9X 5B39G 5IW1B 3DECA 1HK6A 3PWVA 2N7AA 3MLYH 4MQSB 4JQIH 3FO2A 3ROOA 2JJVA 1XF5A 4OF0A 3U46A 2IBZX 2QADC 3GSUA 2F5AH 1MCOH 4L4TD 4QXWA 5JQ6H 4CW1B 4TVPE 1JTTA 1ETZB 2Z8SA 5DJXB 1DEEA 1YEKH 2ZUXA 1RMFL 1IBGH 4XMPL 2X4NB 4NDMA 1RURL 4WW2F 1IAKB 1KCLA 3BPOB 2W9DH 2VZUA 4X6CF 2J6EH 1UCBH 1RU9L 4RSVA 5FCSH 1FORL 1I7TA 4P9HC 2MQCA 4ZXBD 3C5ZB 3C6LC 4RFEA 1S7SA 3RWJB 2C9AA 2F9BT 3PHOB 1R5WB 4KMLB 5HDQL 1PX4A 2H26A 3V8CA 4ZODA 3ZT7A 2Y23A 4OGZA 3DHMA 3LKPB 2D4FA 5D5ME 3WYRA 1N4XH 2VLRE 3W9DA 4HIEB 2EH7H 2FJFA 5AZEH 3UTZB 2EKSB 2P8MB 3ARFD 5DTFA 3O6MH 3IDJB 3MBEA 5LGJB 4WFED 4P46B 3LSOB 2BY1A 3KGRA 5FO7B 3QJHB 4NPYB 4H8WL 3KLDA 1J1XH 3PNWB 1KPVB 4GRLC 2FCBA 1Z9SA 3BKMH 1X3DA 1JPFB 2PTTB 1I7RA 4O5LH 1DQTA 4R4BA 4OUOA 4OZIB 1SMOA 3NZHL 1MCFA 4U6HB 3RU8L 3MNWA 3DO7B 1CDIA 3TNNB 4LIQH 3ARBB 2DL2A 3ULVL 1DANU 3CFCH 3FB8A 4PJGB 4BJLA 2PO6A 5CILL 3T2PA 1LO3H 4LMQI 4OJFL 2Z92B 5D6DC 1S9KC 3BP4B 2F58L 4QHMB 2IPUK 1EEYB 5I66B 1YEFH 3GO1H 3RWEB 4MXWL 1T1XB 3PXJA 3VJ6B 4P2QA 3NA4A 3G5YA 3JWOH 3Q5YA 3CXHJ 3LRSA 2HMIC 4HPOL 4MCZA 3FKUS 4K9EL 3EJJX 1XGYL 4YGAB 1NDMA 1LEGA 2OP4L 3HB3D 5T3ZE 1BQHB 1EVUA 3FT2B 3CFJB 25C8H 1CXEA 5JA9A 3MZTA 3SQOL 5E9DA 4KQ3H 3L7FB 4PGBA 1RJLB 3GBNH 2A74B 4Z7QE 3BZFA 3VWJB 1NC4A 5JIKA 2FBOJ 3R4DA 1KYOJ 3VXTA 1U3HD 1KCVL 3UYOD 1JGEA 2D2OA 1YDPB 2F54D 3DURA 1UH2A 1T5XB 4WO4C 1P1ZB 3RTQB 4XNXL 3UTTE 5C07B 5EPMB 1EAJA 5DRXB 1UH3A 1B0RA 2YBRA 1OT2A 4NQDD 2J2ZA 2H2SC 2YD8A 4MXVE 4PB0L 1NDGA 2C3HA 5EU5B 4QYOB 3SDDD 3PXHA 5JNYA 1AFVL 1T0PB 2F53B 1KENL 4YZFF 1PKQB 4MJ6A 1JHLL 1UGNA 4TNWK 5F9WB 1FNLA 3BAEH 3GB7B 3GBMH 2MKWA 4OGAC 5DK2A 2OR9L 3PGCA 5I1DB 3GMQA 1ZHKB 4MA3A 3BVNA 5HTSA 4BH7A 4P5MB 5T1MA 5D1ZA 2FYYA 1EA9C 1IC1A 3TVMD 1X5YA 5IIEA 2NXYC 1DSFH 4IMKA 3H9SD 5KS9F 4LGRB 1J1OL 4JFFA 4M8VA 1R0AH 2R69L 4H25A 4D3CH 3CVIH 4I77H 3VWKA 3LB6C 1H15B 3I9GH 1XF2B 1GRWA 3PWPD 1MJJB 2DLTA 4MNQE 3FQRA 1HXYB 1R3HB 4YHIA 2EC9T 4AENA 2P5WD 3B9KA 1YNKH 2QQNH 3F7VB 2FR4A 2NY1B 1HWHB 4M3JA 4MCYB 4MJ5B 4PUBH 1JMXA 5F93C 3OJVC 3O6LH 1CICA 3DUHA 5A43C 3HE6C 2WQ8A 3GDBA 5A2FA 5AG9A 5SWZA 3FHAA 2A6KB 4I9WD 4U0RC 3SKUD 1RK0B 1F6AA 3AB0C 3WFCL 1JTOA 2J88H 4I2XA 4PGDA 4YGVB 5GISL 4FQLH 1XF4A 3VRIA 2VDRL 3OAZK 4NO3B 4E5XA 4P3DA 5DZOA 1EV2E 1I7UB 4XCCH 5FA4B 5KZCD 1UJTA 1MWAB 2FB4H 3G6DH 4LOUC 4HG4J 1T7VA 1EERB 2DJUA 1DLHA 3QG6A 3LQAC 2FIRT 3ES6B 2E7CA 4UB0L 2X05A 5H8DA 2CMRH 3B83A 3VFRA 5I1HL 5HI3C 3O4OC 5DUML 4I1NB 2AK4D 3CUPB 3FQUB 4JFPB 2BOBA 1EJ6A 4WTZA 2RB8A 3RI5K 3D87B 1BFTA 3MRLA 2N56A 4LFHD 4LLVA 3H42L 1A7NH 4QWWD 5D70L 3ARQA 1B2WH 3L3OA 4LCUB 3ZDXE 5EOTB 2YPLE 1D6EB 2D03H 4NKOA 4JJHA 3T4AA 3W0WE 4MAYA 4HKXA 1XR8A 1GIGL 3CFIC 4XBEH 3ULVE 4Z9KB 1JUFA 5I18H 1X4ZA 3NPSC 1JF6A 3DTXA 1SEBA 5INDB 4Y4FA 4UDTB 2Y1VA 1KTDB 2GEEA 3QIBC 4N8CH 3EO9L 3CVHA 4JFOA 4XVSL 5HXMA 1I1AD 1CXIA 3PHQB 3VFGH 4YBQC 1R5VB 3E6FA 3HNSL 1CL7L 3GJFB 4ZPVA 5IVZB 1KEML 2A73A 5KVFH 4N5UA 3SE8H 3UPRB 3VG9B 2V2TA 3MRIA 1KT2B 2FHCA 8FABB 1WAAE 3HMWH 4JM2A 4M93C 2E7LA 5F71A 3BZEB 2ZCHH 2DQDH 2FRGP 2OJEB 3HAEA 4KV5E 3ZT5A 4R4ND 1QFWL 4CU8A 4R97C 3O45B 4BK4A 4ODHL 5I9QC 1DQJB 2HFEA 4NFCA 1MELA 3S88H 2EH8L 3GUTA 2E7MA 1QSEE 1MRDH 2WUBL 3VGGA 1WZKA 4G6AD 4WENB 1OP3H 4ODWB 1F45A 2IMMA 5IB5B 4HDIB 4HCRL 1BD2A 3VFPA 4FXGA 3P73A 1FHGA 3PP3K 1A5FL 3ZE1E 4OI8A 5IGXH 4HIJA 1ZA6A 3QIWB 1OTTC 4D2NA 1Q0XL 3CCHB 4IIQC 4N0CD 2JCCF 5LG1A 4JRYA 4PRPB 4MXQC 5F1OB 2Q1EA 1DVFD 3VXQB 4C55A 1FYTB 4TUJB 5T5FH 4KK6C 1RZ8A 5I1KL 2R2EA 4KFZC 1G7PB 3HI5L 1CDGA 3BQUA 2CRZA 1CGSH 1PG7X 2V2XB 2OMBA 4JPVH 3QQ4A 1CLYL 1BQHG 4ZD3H 5M94B 1MEXH 3QUXB 4M7LL 1U3ZA 3C87A 2BSSA 3LIZL 5E4IA 3SKOA 5JZ7D 5DMKA 4PR5A 2FWOA 3B9EA 5C08D 2DM2A 5BOZG 3B5TA 2NX5D 4NC1E 5CJ8A 5T33L 1TZGL 1KGCE 3CZFB 1I9RH 4M5ZH 2VMFA 4KRPC 3T1WA 5EORH 2OMNA 2GUOA 3KPRE 3OF6A 4EN3A 2CUIA 4QOKD 2QKIB 3RWHB 5FKAA 4QRPD 1JYNA 4LLWA 5A2LH 3EOBA 3TCXA 3JV4A 1MFAH 5I1EH 4L4TB 1FFOB 1RUAH 5C6WH 4XZUA 5JW5B 4B41A 4L3CA 4M7JL 3L5WA 2DQGH 1TZHA 3MACL 2VDKL 2IWGA 4L3EE 5HGBA 2DBLL 4GW4B 2V5RA