1FE8H

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
210
structure length
210
Chain Sequence
DVKLVQSGPGLVAPSQSLSITCTVSGFSLTTYGVSWVRQPPGKGLEWLGVIWGDGNTTYHSALISRLSISKDNSRSQVFLKLNSLHTDDTATYYCAGNYYGMDYWGQGTSVTVSSAETTAPSVYKLEPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords VON WILLEBRAND FACTOR
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 210
sequence length 210
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8H02
5AYQA 5IT2L 2VDKL 4NOBA 1SEBA 4HIIA 1UWEL 1FL3B 4KRMB 3CMGA 1TTUA 4YH6A 1NC2A 3FL7A 4DOHE 5ERWB 3WS6A 4D9QD 4Q6IB 4NIKB 4TN9A 1MCIA 2YPLD 1EO8L 2O5ZH 3ZKNC 2BX5A 4APQC 1AR2A 2AEWA 1YUHA 2DQHL 3PABA 4OD3H 4G42A 2VITB 3UJJH 1DLFH 2L7UA 3DMMC 4PJEA 3P2TA 3W2DH 4M8QA 1NL0L 1SMOA 3NIGE 3S4SA 4OFVA 5CWSB 1U8IB 3ARGD 4AL8H 1BD2D 2BDNL 3H9HB 1E4XI 4PRBB 1T7YA 5C6TL 5ACLA 5IQ9B 3V4PL 3P9WB 4X80H 4CW1A 2NR6D 4P4KC 2NZIA 1U3HA 2CLRB 4UBDC 4WFFD 2YD4A 5CJOL 5F1IB 3C5ZD 2VXSH 2XXMB 4F80A 1X6LA 5KSVA 5T1KB 5IV2B 2A6KA 2VE6B 3U7YL 4ELMF 1HHIB 3RZCB 1D5BA 1WK0A 1IGJA 3PV6A 5C08B 1WV7T 3OHXA 4IRZL 5DLMH 2CDEA 2H2PC 2NNAA 3KPNB 3AM8C 3ARQA 3QPQC 5KW9L 4WUUA 4IOIA 5K93A 1T66C 2ADJA 1DQLH 2ESVA 3K8MA 5HVGB 3S7GA 3TA3B 3B9DA 2Z8SA 1PG7H 4OCYH 5SX5H 5HBBA 3QZWG 1LO2L 4LLUA 4YIQA 3O3AB 3L3JB 1OOAA 5C0DA 1MAMH 2XZAL 5FDYA 3PWPB 2WBWB 5F44A 4HS3A 3RWDB 4AEHH 4M6OL 2P8LB 5D7JB 3VFRB 1K2DB 3VXMD 1KUMA 4JN1H 3T0VA 5AYUH 3I6KB 1N6QH 2W60B 4MAYB 4R4FH 4PJCF 4YHOH 1PYWA 4Z78A 4XMPL 2G9HA 3QUMA 4WU7A 5GS0D 3EO0B 1S9YB 3O0RL 1HKLH 1FZOB 3GIZL 5GJSL 5F21B 1TJIH 5L7XL 4PJ9A 1NAKL 2OXHA 4JHWH 4LLWA 1U2HA 1IEBB 3HPJA 4LLMB 1UB5B 5IFJA 2R8SH 3QXUA 1EERB 3NIFF 1KJMB 1OTSC 1LO4L 4WU5B 5F7FA 1P5UA 1BZ9B 2H6PB 2YD8A 2AJVL 5IMMB 3Q6FB 5GS2H 4L3ED 1EO7A 4Y4HB 3OJ2C 5A2IH 4K7PX 4H8WC 4LRIA 1CZ8L 3NZ8A 2UV3A 4U7MA 4Z7VE 3CLEL 3D9AH 2A77L 5D7LD 5KVGH 4CMMA 4Z76A 1NMBL 4DEPB 4QF1B 4QTHB 3GSXA 5E00B 2BNQE 2YD1A 3UO1H 1TTFA 5LQBL 2EDDA 5L2KE 4OLZH 4WFEE 3BGFB 1Z9MA 1J7VR 5FOBB 4HUWB 3MRFB 1AHWC 1IC7H 1F3RB 4R4BB 2AV1B 2VLLB 3CZJA 4L9LA 4HMEA 4RCAA 4G6FB 3RUGF 3V0VA 4R6UA 4LHQB 2DLFL 1ES0B 4RGND 4APQA 2WIIB 3QEQE 3L9RB 5AZEH 12E8L 3CVHB 3SDYH 3VXOB 1MFDL 5FM5O 2HKHH 2X1XR 3DLQR 2YPKA 3MQIA 5FUCE 4TVPE 1YYLL 1VPOH 3H3BC 4XBEL 4LIQL 4DW2L 1BIHA 2D0HA 2NY1D 3ULSB 3MRPA 4RA3A 4P4KA 3TCXA 3MV9D 4OLUL 3CAFA 5IVOA 1JZ3A 2Y5EA 2YWYA 5CGYC 3TYGL 3VFOB 5M7QA 3OAZK 3QDMB 2CMRL 1RK1A 2HTLD 2Q8BL 3OJVC 4RX4D 1CN4A 4XC3L 4XNMB 4N1HB 3ROLB 1W0WB 4JFOA 3WIHH 4BSWB 4KI5C 4GW1A 1S7UB 1VADB 5FYKL 4O2CB 4Q97A 5KVDH 3AM8A 3CGTA 1JWMB 3PHQA 4D9QE 4NZJA 3VU2A 3DARA 2YPLE 4UQ3B 1KN2L 2QKIB 3GSQA 1P1ZB 4L4VB 1KGCD 5KSUA 3DXAB 2UZXB 5EU6D 3BE1L 2VABB 4ZFFB 4YFEA 4HBCL 1IBGH 1YEEH 4WTZA 1ITCA 1T1YB 1TETL 3P0VH 4Z7UE 1BD2E 1Y6MR 1CG9A 5HYQA 4QXGH 4FABL 4OLXL 3TWCH 2DDQL 2EO9A 4LEXH 4MXVE 4WFFE 3O81A 4FQJL 3KHQA 3IFLL 3IS1X 3DV4B 4JJ5A 1MRDL 2R23A 5DUBB 3DTXA 3BEVA 3QG7L 2Y9RT 2GCYB 4H88L 2B1AH 4P46D 5F7HA 3MRHB 1DP0A 3OKNA 3HE7B 3O3UN 3STZB 1NCCH 1AQDB 2GQHA 5I8EB 3QCTL 4R90L 4XP9L 5DMIL 5IROA 4BKLA 2HRPL 2Q76B 5ILTL 4HJ0C 2EDLA 4CDHA 3E1F1 4M3JA 5JXED 4UAOC 4YBLC 3L7EB 3DO7B 5EU3B 1ZSDA 4PY8I 4NO0B 1BBJA 3FT2A 2LE9A 1HXMB 1OAZH 1XF5B 2DYPD 4P4RB 4Y5XC 3SGKC 2WSKA 5T33H 2IPKA 2G60L 4U1JB 5L2JA 3OV6A 3MZTA 3SN6N 5LGKA 1KCUL 5BS0A 3VFSA 2OJZL 1KEML 4C83B 3SDAD 2CK0L 4JQIH 4JANA 3BKJL 1KCKA 4M4PA 3QULB 3VXME 4FNLL 4QHKI 1WTGT 4CNIA 4L9DA 4H8WH 4S1QH 3U9PL 3SO3B 4KQ4H 3VMNA 2DQJL 4ORGB 3L3OB 3SDCB 3TVMB 4Y1AB 4Y8AA 5DD0L 2BY1A 3MLTB 3SKUD 1NFDE 3IKCA 3EYFA 4L4TD 4UUJB 5KN5A 4OB5L 3KWWB 4FQIL 1ETZA 3NCJL 3JUYA 4OI7A 1KLUB 4JKLA 1MCOH 4DZ8B 1YJDL 5LKNA 4J1UB 4UILH 2XWTB 2YR3A 2YPVL 4XVUD 2IAND 3R06B 4Z18A 1P7QB 4JAMA 3MOAL 1OQOA 3DX7B 2X1QA 1UWXH 2R1YB 1KB5H 3QXVA 3S35X 2AXFA 2EDHA 1SEBB 4HIIB 1FVDA 2W9EL 4L3EE 2HMIC 4LKCB 4LDEB 3ZTJH 5D1XD 1F42A 1NC2B 2HFFA 1FZJA 4AEFA 2HLFC 3FT4A 5D7LE 5EDXA 1QRKA 4XNUH 1BMGA 1YUHB 2BXYA 3RJDA 3PABB 5IHBA 4G42B 4Z7QF 1PJ9A 5I1IL 1AE6H 3T0WA 1U8OA 4U6YA 4FQHA 3S4SB 4G6JH 4HXAL 5DUMH 1C16A 1CE6A 3VDBA 2XNAA 4G8IA 3MLUH 1K9TA 4MLSA 3WFZA 1TQBB 3ZYJA 2DTSA 1RZKC 5E5MA 5EORH 4CW1B 1U3HB 5FF6B 1MCFA 3UC0H 4Q9RH 5AZ2L 5IOPA 2JTDA 2R2EA 4O5LL 2DBLL 3RIFK 5KSVB 4JPKL 2A6KB 5E6ID 3T77A 1ZVYA 4RGNE 1D5BB 4V2BA 3MV7D 3PV6B 4OIIL 1B4RA 4LNVA 3RL1A 3OHXB 3R8QA 1FORL 1RUQH 2CDEB 4YHKL 1EHLH 2NNAB 4QTIH 4WUUB 5FDWA 3U9UA 4IOIB 2ADJB 1IAIL 2ESVB 3BSZH 1NCDH 2ZUQB 1NCBL 3MV9E 4PJFA 1AC6A 2VKXA 4LLUB 4YIQB 3VI4E 5ADOL 3LN5A 1IAKB 3AS1A 3KR3L 3EUUA 4OZHE 5C0DB 2KKQA 2ZCLH 5K9JL 4HS3B 2NTFA 3UYRH 2NY0D 5F70A 3MLWH 3ZTNL 2NXYC 2ADGA 1YMMB 3LAFA 4ALAL 2DJUA 2DL2A 2E6PA 1EIBA 1X5HA 4PB0L 3AMKA 4FFVC 4Z7VA 1PYWB 2XQYG 4DTGH 1JGLH 3LKOB 3QUMB 4WU7B 5ICXA 4CU8A 1PVHA 4MD4A 1I8LA 3SGJA 5EU6E 3QBTB 3A67H 5A16A 2BNQA 3ETBF 3JWOL 4ZXBD 1YC8A 2O5XL 5FUZL 4QHMA 5L2KA 4MAUL 3WLWD 2J88L 2YXFA 4PJ9B 1MRCH 4LLWB 2ZG1A 4TUOA 5TQ0H 3T0ED 3HPJB 1T7XA 3ULVL 5IFJB 4KK8D 1WFTA 4FMKA 1OAYL 1OM3L 5ICYA 1CFTA 3HNVL 5H2BA 4XCCL 1FE8H 3JXAA 3W81A 3H3PL 1NH6A 2AGJL 4H26A 1U8PA 1BOGA 3QEQA 3NZ8B 4U1KB 1A5FH 2X7LA 3QQ3A 4N8PA 4CMMB 4Z76B 4QGTA 3PGFL 2I24N 1WCBA 1FH5H 3GSXB 2EDKA 1R5IA 3B5HA 3EZJB 5DQDL 3WXVL 1LO0L 3PDDA 2LU3A 2XY2A 3RKDC 4FQCH 2N1KA 3DURA 4JM2B 3AC0A 3Q5OA 1MCBA 2FD6H 2VNCA 3WDHA 1BQHG 4P59H 3CH8A 3QAZC 3LHPL 4S1RL 3WNKA 3C60D 1CT8A 4ODBD 4MDIB 4L9LB 1G1YA 3V0VB 2H9GA 1BBDH 3BT2L 4APQB 2VR5A 8FABB 2ZSVA 5FIEA 1OLZA 1SVCP 1FBIH 4V1DD 4DUVA 1R5WA 1YY9D 2Q3ZA 4JKMA 1B4JL 1EA9C 4X99A 3NACL 1U8LA 4GXVL 4LSPL 3WO4C 5J11C 1YZZA 2AQ1A 4M1DH 1IM9A 5IGXH 3MZGB 4L4TE 3ARRA 5IJKC 3MRPB 5B39G 3O9WC 4LGRB 4P4KB 1MVUA 2B4CC 4NWTH 3DVNA 3ARGA 4JO3H 5T1LD 4Z7UA 1BD2A 4MZ2A 1K4DB 1I7RB 1RZKH 4S1DC 4M62L 2IANE 3MLSH 4M6NL 4S10A 5GXBB 2YEZB 1GHFH 1B0RA 5J6HA 4JFOB 4XPGL 1MCWW 2E9WA 1JMXA 1MFNA 4Y4KD 4GW1B 4GAYA 5F7EH 2J6EL 4K3EL 2QQLH 3PHQB 5EB9A 3K3QA 3GSRA 1PBYA 2F58H 3BFOA 3GSQB 3T65A 3RA7H 3P9LA 4ETYA 3D0LB 5TE4H 2AEPH 5KSUB 2ICES 4KVCH 5KVEL 3QI9D 4I3RL 3QRFM 1LEKA 4K8RL 1LD9A 1RSFA 2GFBA 1T1XA 2A73A 3TBSA 4P0DA 5EBLA 3BISA 4AEIL 4F7TB 3HUJE 1CG9B 2BNRD 5HYQB 4PRDA 3WIIH 1L9NA 3MLYH 4Y19D 4I13B 5D1QC 4R9HA 3U4AA 1A7PL 4JJ5B 4BELD 2R23B 3DTXB 5E7FA 3BEVB 2VWEE 5DD3H 1YQ2A 1CBVL 1IGCL 1DVFC 3VXMA 4JB9H 1YEKL 3K2UH 4BKLB 1MRFH 1X5LA 1YPZA 2R1XA 1J1PH 4UV4H 1KIPB 3O2WH 4HWBL 4RGOL 1NFDA 3W9DA 3TESA 5JQHC 1BBJB 3FT2B 2V7HA 3IJYA 1DL7H 4OGZA 3MA9H 2IQ9L 2IPKB 1S7TA 3G08A 5J56B 4OKDA 1MCNA 5L2JB 5JHDD 4YWGH 1MEXH 2CQVA 4NWUH 1QRNA 4D9RD 2WUCH 3VFSB 4F9PA 4Q7DA 2QJDA 2A38A 1CGYA 4JANB 3RAJH 3IJHA 1EMTL 4WEMB 4L29A 2DWEA 4ODWA 2K1MA 2ERJC 5KVMC 4TULL 4L3EA 4CNIB 3TJHD 1QFUH 3FQNB 3LKPA 1SHMA 1A3LH 4JG0L 4DJMA 1F5WA 5F6IB 1I9IH 5GS2D 3V4UH 1F4XL 3EYFB 3IKCB 3ZKXC 5GZOD 3DV6A 5KN5B 4ENEC 1TZIA 1ETZB 2Z0BA 3CX5J 4PUBH 4TUJA 4JGUA 3T0EE 3AXLA 3KLSA 4ODXA 5EZOH 4JAMB 1WWAX 3ARFC 4LDLB 3BJ91 3G5XA 2UZIH 1MHEA 3D18B 3MRNA 3QIUD 4HPYL 5E99L 5ISZD 4PJXE 1Q0YH 3DUUA 1N0XL 1FVDB 1YEJL 2ICEA 3G9VA 4XPHL 3UYPA 2VC2H 3T1WA 1TNNA 3RWEA 3ZE0E 1YN6A 5CD5D 2HFFB 3WBDA 3O6FD 3FT4B 4GG6E 3BXNA 4JM2F 3V52H 1BGXH 1WT5A 3QDGD 1K85A 2IPUG 3REVB 2AQ2A 2FYYA 1TJHL 5FO9A 1GVIA 2IH3A 3RWFA 1FFQA 1U8OB 4U6YB 4FQHB 5ALCL 3LEVL 4LSUL 1GIGH 3MV9A 2B4CH 5I1JH 4HMDA 1C16B 1CE6B 1MFBH 3BW9B 2XNAB 4OTXH 4UMGA 2VDNL 5C7XH 5E5MB 2VYRE 4OZHA 5IOPB 3ARDC 1KCRL 2R2EB 4RX4A 3F6IA 4NNXA 3VFNA 2NY5C 3T77B 5DHVA 4OFKA 5I66A 3BDYH 5E56A 3BN3B 5FCSH 3GO1L 4CN6A 4V1DE 3RL1B 4OKVA 3QUKA 1QBAA 1MQ8A 1HILA 4D3CH 2I26N 1OP5K 4M03A 4K7PH 5DRWA 3U9UB 2GT9A 3VWKC 5EU6A 1MPAH 5A43C 1ZE3C 4PJFB 2AK4A 3BKML 4LVHC 2W65A 3BN9D 3C08H 2EDNA 1ZT7A 3LN5B 1OAQL 1RMFH 2AAVA 2EYSB 1I3GL 4GG8A 5HHOD 3HAEA 4JO4H 2Y36H 3DX9A 4OF3A 1IGIL 4NZTH 5C07D 2NTFB 4JG1L 4FFWC 4LQFL 2OP4L 1NMCB 2QSQA 2ADGB 3SCMD 4P46A 4ODUA 5EC1A 1AGDA 1BQUA 4Z7VB 5CEZD 3Q6GH 4GS7B 1OP5H 5ICXB 4MD4B 2NY4B 5JXEA 4D9LH 5BVPH 2BNQB 5BOZG 4HH9A 4EN3D 5JIKA 2OR9H 4QHMB 5L2KB 1T6VN 2ZUUA 4NZRL 3DUSA 1I9RL 1HINH 1JNLL 3WEXA 2BNRE 3OQ3B 1NFKA 3R1GL 2X4NA 4YDJB 4Y19E 1OPGL 4OM1L 1ZS8A 2IAMD 3CFEA 3WLWC 3FOLA 5HI4C 3SDAA 1JZ7A 2ICWA 5ICYB 2XY1A 1CLYH 1CFTB 1YEGL 2NZ9D 2VDQH 4J12A 5H2BB 4Z5RA 5TE7H 5E9DD 4Z0XA 3BP6A 4H26B 4OQ1A 4DGVH 2PR4H 1BOGB 2FLBT 1KIQA 3QEQB 1NCWH 3PL6D 3QHZH 5EOCH 3ULUH 1KTDA 2X7LB 3M8OH 3QQ3B 4WJ5A 5GGVH 2IBZX 3NPSB 1WCBB 5GIRA 5LGHH 1R5IB 4XPBH 1X4ZA 1IAII 3QUYD 1X5YA 1Z0MA 4NJ9H 5HYSA 4FQXD 3MOBL 5DVNA 3ARFA 1IGFH 1UZ8B 3DURB 5JHDE 2RBLA 4WDIB 2DLGA 5ANME 2EIZA 4DQOH 5BRZD 3B8YA 4D9RE 3ZDXE 4PRID 4X7DC 1UEMA 3RBGA 1CT8B 2Q8AH 3F7YA 1DBJL 2B2XH 2E9IA 2H9GB 3QSKB 3QPXL 2DQFA 4U49A 5E8PA 2FATL 2VRAA 1YDPA 5A2LH 2ZSVB 3NIGF 25C8H 5D1XA 1TDQA 3MRBA 4CL7A 1R5WB 5FOJA 4EUPG 4Y2DC 2YPLB 1DQDH 4I1NB 4X99B 3TV3H 3S36L 3ARED 4G6KH 1J88A 4R8WH 2YRPA 3OKDA 4B41A 2Y06L 1CLOH 5M95B 3T04D 1A6ZA 1MVUB 1QG3A 3DVNB 2E5EA 2HYMA 1NLBL 3ARGB 4Z7UB 2CUMA 1BD2B 2MTPA 2ZKHH 4P3DA 5IBTL 4RWYH 5D70L 4PJDE 6FABH 4MXQC 1IGMH 1SY6H 1NBVH 3P4NA 4ZD3L 1B0RB 2NY5H 3B9EA 5J6HB 5IB2A 5E6IA 5CP3H 3V4VL 1JFQL 4QXUL 5ISZE 4HPOH 1ZEAL 4M7LL 3CDGA 4GAYB 5MI0B 1EJOL 4EXKA 1GC1H 2FB4H 3TT1H 3VWKA 3QNZA 4BYHA 4I18C 4P49A 3T65B 3P9LB 3L5XL 3O6LL 3QDGE 5T3XD 1FNFA 3LB6C 4XXCC 1AGCA 1T3FA 1A1NA 5F7MC 1LEKB 1LD9B 4NKMA 5GS3A 5FUOL 1BP3B 1T1XB 2XACC 2A73B 3TBSB 2Y6SD 3U4BH 4JO1L 1JYVA 5ESQA 4HFWA 3GJEA 3GNML 2NXYB 4JVPA 2JLLA 4KJQD 4K7FA 4LL9A 1NCNA 4IBLT 1FIGH 3HE6C 2FX8L 4PJHE 3VXMB 1KELL 2DKUA 4XXDA 1G6VK 3S35H 3KDMB 1VCAA 2GJJA 4K3JL 3X12A 2D7MA 3VXNB 1YEHH 1MVFA 2R1XB 5CLTA 4U33A 3O4LD 2Q7YA 2R4RH 1OTTD 5FYLL 1MLCB 4NQCD 1NFDB 3W9DB 2DQCH 3INUH 1UM5H 1TVHA 3C8DA 4UQ2B 4DN4H 2V7HB 4ZXBA 4KKBD 5J12C 1NLDL 3IJYB 4ONGL 3EZ8A 1EZVX 1WSST 1S7TB 3G08B 3ALXA 4V2CB 2J8UA 1T7WA 2CK2A 4KI1A 5HHOE 1ZV5A 5GRVL 5AG8A 5D7KD 5C07E 1CGSH 4M6ML 2JELH 2QSVA 3IDJA 3IDMA 5BVJA 3IJHB 2A0LC 3ZDYE 4L29B 2DWEB 4ODWB 4PJXA 4P9HC 3TP4A 3WV0A 1AXTH 4KXZH 4L3EB 2AK1H 3P4MA 2F5AL 4PBWD 5CUSL 5MP6H 3BH8B 5JW3L 4XH2A 2X4SA 3LKPB 1CDYA 1VDGA 3PP4H 5CEZE 4GG6A 4Y0GA 4GSDL 4Q0XH 3BRDA 1NKOA 2YN3A 4G3YL 4ZUUB 5KOVC 3DV6B 1EK3A 2VKWA 4PGDA 3QAZB 4K3GA 1G9NC 3EDEA 1TZIB 2AABH 5J13C 4X9BA 5GGSY 3VDCA 2W9LA 3SDXE 4Z0BH 5HPOA 4TUJB 3H9YA 3STBA 3AXLB 3QCVH 2YD5A 1A3QA 2DB8A 2NY3C 1A7BA 3GBNL 5GGRB 3C60A 3G5XB 2XQBL 3MNVB 4MA1C 1MHEB 3FJTA 3MRNB 4KGJA 3D39D 5HDBE 4Y2DA 5TF1L 4RGNB 1F4HA 4KKCC 2ICEB 1TXKA 5E9DE 3WO4B 5GS1C 1BZQK 3RWEB 4WRLA 1YN6B 1KYOK 4V1DA 5E4IA 4M1GL 3BXNB 3V5DA 5JXAH 1H3XA 4MQ7A 1FJ1A 4K3DH 2FYYB 4C55A 5FO9B 1JNJA 2NY1B 5D1ZC 1UACL 2OI9B 2IH3B 2QR0A 4XPAL 3RTQD 3RWFB 4UT6H 1TPXC 1Y18A 1B90A 1DQQB 2BXZA 3MV9B 5GSRA 3WNLA 2J5LC 3C6LD 5T1LA 3VXQA 4PTTA 5BRZE 4OZHB 4IEFB 1UQSA 3G5VB 4XP1L 1DBKH 4S1SH 5A2JH 2DM4A 2LQRA 4PRIE 3BWAA 4NNXB 5DHVB 3X3GL 2X40A 1O7SA 2NTSP 4I18A 4Y4KA 5I66B 3O8XC 2OTWB 1Q9LA 3I9GL 2Y25A 1J0KA 1R3IL 4OKVB 3QUKB 3CPLB 1HILB 1MNUL 3RWJA 3FAXA 5DRWB 4JPIA 4MXVF 2GT9B 5EU6B 4P9MH 5CBEA 3QI9A 3ZSTA 5C0BD 2IBBA 1ZTXL 3EHBD 5I73C 5CINH 3IDXL 3GRWH 4P99A 1NGYA 3PP3K 2NW2A 2W65B 2XTJD 3LH2H 4OF6A 1ZT7B 2ENSA 3SE9L 4OD1H 3V7MA 2BNRA 3HTLX 5I6XB 3HE6A 4GG8B 4L8DA 4Y19A 3MTRA 1RUPH 1AD0A 3HAEB 2DAVA 4KPHL 3S8WA 1TTGA 3DX9B 5E7BA 3FQWA 4LASL 1M4KA 1Q94A 5GRUL 5CS7A 3CK0L 4P46B 4N1EA 2ENYA 4ODUB 5EC1B 1FG2A 1AGDB 4HFUH 3RVTC 3L95A 4PRPD 4RAVA 5F1KC 1CTOA 4ZAKD 3KXFD 1A6AA 2P43B 2P1YA 4XB7A 5T3XE 2O5ZL 4OD3L 1CGVA 3UJJL 2P4AB 4HH9B 1DLFL 3CSYB 3MUY1 3W2DL 2DYPB 5DF0A 3DUSB 3WEXB 4TTDC 1QBMH 4PRNA 3LSOA 2X4NB 5ANMA 1ZS8B 3CFEB 2ERJB 3IKKA 1P4BH 4X80L 2IFFH 2H1PH 2V2XA 3FOLB 2CLZA 3SDAB 3WIFA 4LK4A 1ADQA 4KTDH 1NFDF 4P9HH 3NN8A 3JWDL 2QL1A 5DT1H 2FGZA 2PXYC 4NP4H 4Z0XB 2ITDA 3BP6B 1KIQB 3HMXA 2YUXA 4WJ5B 5I71C 4P23C 5EU7C 5GIRB 1VA9A 4TSCH 3SE4C 4NQCE 4HXBH 3NFPA 1JF5A 4L4TB 3DPBA 1DQLL 1G9NH 5HYSB 3G6JE 3ARFB 1PG7L 4NJAH 4G7YH 2EIZB 5DWUH 1EVTC 3RY6A 4PJDA 5D7KE 1T7VA 3EOYG 2Y7QA 3F7YB 5GS1A 1MAML 5CIPA 4FRWA 3E6HA 1CF8H 4HCRA 1A8JH 1GRWA 2DQFB 1ZLSH 1YDPB 4AEHL 1X6NA 3WJJC 5D1XB 3MRBB 2AI0H 4Z8FH 2W0KA 3O6FA 1IEAA 1W8OA 2C1PA 4JN1L 4P5TC 3VD4A 3P9MA 5AYUL 1N6QL 4YHOL 2DLIA 3HPLA 3OKDB 4N9GA 2PETA 3AROA 1A6ZB 3HS0A 1W72A 3HNSH 4NDMA 1HKLL 1C7TA 3U36A 1OCWL 1RU9L 3HUJB 4D0DA 1TJIL 4MYWB 2PO6C 4YDVA 3S37X 4OZFA 3DBXA 4JHWL 3PWVA 3MRQA 3P4NB 2R39A 1TCRA 5C6PB 2VXUH 2R8SL 4HJGB 4C4KT 5E6IB 3P0YH 2P46B 5IB2B 2IQAA 1FSKB 1JHLH 3D39E 3CDGB 1N8ZA 3E2HC 3VA6A 3O4OB 4JFDD 1JF6A 1HH6A 4Z95H 3WN5A 1A1OA 3VI4F 5DHYA 1G1CA 4LVHB 3D9AL 2FX7L 5KVGL 1AGCB 1T3FB 1A1NB 4NKMB 3IXAA 1XR9A 3PIQA 3CH1A 4ZUWA 3FQTA 2D7PA 4F57H 3UO1L 1RI8A 4PPTA 4YHZH 2V17L 1C1EH 3U0WH 5ESQB 4OLZL 4HFWB 4NCC1 5FK9A 5EIIA 2OJEA 3GJEB 2VDOL 5HHOA 1I3UA 3NH7H 3HRPA 2FJGA 4Y4FC 4Y88A 5C07A 4K7FB 1IC7L 4MCYA 2NY0B 3T0BA 2VO5A 4R4ND 1QFHA 3AS3A 4XXDB 5GISH 3W5NA 4JFYA 2Y23A 1QD0A 1MCEA 1MCQA 5AZEL 1S8DA 3SDYL 2HKHL 2Q7YB 2P5WD 1E6OH 2YUVA 2EEAA 5C0BE 1TVHB 4ZXBB 4EN3A 3G5YA 1J0YA 4S0SD 5FYJU 2XTJE 1JJUA 4NZUH 3SDXA 2BVQB 5KSAD 1YEIH 1LO5A 3T0EB 3P77A 1GOHA 1IT9H 4ZTOH 3SY0A 5A3ID 3EYSH 4WTXA 4XNYH 4MNGE 3IDJB 2PXYA 3IDMB 5BVJB 5C9KA 4RBPK 3MRGA 3MRIA 4PJXB 3BVNA 3WIHL 3P4MB 4KTEH 5E9DA 4JN2B 4EDXA 4XH2B 2X4SB 4NM8L 5BQ7A 5FM4A 3PL6A 1P6AB 1ZAGA 4PRPE 3UZEA 2O61A 2BVYA 4GG6B 4WI6A 3KXFE 5BZDA 4Z7NE 3ROOA 4RIRA 4LVEA 5F89A 2G5RA 3EYUH 4O2EA 4U1GB 4PGDB 5EULV 3QUYA 4FQXA 5D7IA 3G5ZA 4X4ZA 1IBGL 1YEEL 4XB8A 4HZLA 3S3JA 5BRZA 3CMOH 1P7HL 4C4KO 3TWCL 4PRIA 3C60B 1FNLA 4LEXL 1HQ4A 4KKAC 4X7FC 3CLFH 3KLHD 4RBPH 1U3ZA 5ALBH 3ZL4H 3W82A 2YK1H 3NPZB 4BQCA 4V1DB 4J3VA 3BZFA 1NCCL 4I3GA 2X9YA 3MUGA 3VWJC 3V5DB 2R2HA 5D6DC 4L8SC 3AREA 4MQ7B 1FJ1B 4RDQF 3BPCA 2QR0B 2PO6A 5F1OB 5B3JF 4YHPA 1Y18B 3BGMA 3L5WB 5CCKH 4MA7H 5I1KL 2ZCKH 5T1LB 1OAZL 3JV6B 4LKXA 4XX1G 4WV1C 5T33L 4PTTB 3TM6A 3WFHA 1UQSB 3MCKB 4CU6A 2IC2A 1J0ZA 1LILA 1WQVT 2FEEL 4A2LA 1T03H 1X4XA 2VZ3A 5E1AA 5DJZA 2OX5A 5IM7A 4I18B 4Y4KB 5HI5C 5DRNB 1DUZA 4JQIL 1PSKH 4N5UA 2BOBA 1Q9LB 1AY1H 1S9WA 4IMLA 1UM4H 1H5BC 4S1QL 4H8WL 3HUJF 4BM7A 3IGAA 4YDIL 3CDFA 4KQ4L 2GSIA 4JPIB 1VGKA 1I4FA 1MREL 1WICA 5CBEB 3KPQA 3QI9B 2C3GA 1OVZA 1NGYB 4GRWH 5EPMB 2NW2B 5E08H 4JDTH 2BNRB 1BJ8A 4QHUA 3B6SA 1KIRA 1JCKA 4ZO8A 3HE6B 4L8DB 4X6BA 1MCOL 4Y19B 1TZHA 1AD0B 1FPTL 1D9KC 2A83A 4HHAA 3O3BA 4LOUD 1I7UA 1VEMA 4UILL 2XTJC 1HYRC 4Q9BA 4NQXA 1Q94B 2ICCA 3O41A 4MJ5A 4PJAE 1JPTH 2OL3H 4WI2A 4YGVA 3OAUL 4JFDE 4J7RA 5DC9B 3A6BH 3L95B 4IM8A 2QHRH 5C0CD 3IDIA 2D7TL 1A6AB 2HKFH 3MGTA 2NXZD 2APVA 2O93L 5GZNC 2B5IB 4NQCA 4WWKD 3QB7C 4G43A 3GSVA 5BV7C 1JPFA 4I4WA 4GXUN 1T6WA 4M61A 3ARBC 3G6JA 4AIZA 4G6JL 5DUML 5JHDB 1FL5B 4R3SA 3STLA 3LSOB 5ANMB 3RVXD 2JJWA 3Q3GA 2IPTL 3WHE1 2W0PA 5EORL 2VL4A 2WW8A 2CLZB 5DHXB 3UC0L 3VMPA 5ABDE 4Q9RL 1XIWD 1DUYB 5MERA 3WIFB 3AU1A 3DYOA 3NN8B 4J8RA 5EU4A 2ITDB 2OZ4H 1BX2B 3GMOB 2AQ3A 3IT8D 4LCCA 5TE6H 4LMQE 4KROD 5I17B 2WV3A 1UYWH 2EDTA 3BQUD 4U7SA 1HCVA 2P5WE 5CSGA 2CRZA 3LDBC 4W4NA 5IVZB 4HUNB 4XGZA 1VB9A 4QTIL 5EUOE 3QUXC 2HJFA 4FP8L 3O6MH 1CDGA 5I74B 5DMGD 1NCDL 2NY3B 3T0AA 4JKKA 1S78D 1DFBL 5FCUL 5J3HD 6CGTA 1K8DA 4PJDB 2H2SD 3IFOA 1CFVH 2Y7QB 5GS1B 1BVZA 5IVNA 5CIPB 3EDFA 5ISZB 3UYRL 4CU7A 3D39A 1C5CH 4GBXC 4OCSH 3GSNA 1ZLWH 3VWJA 1ED3A 5AWNH 3MLWL 1L7IH 4L8SA 3U4EA 3O6FB 1IEAB 1X5IA 2C1PB 2PTTA 3P9MB 5HVHC 3GSNH 1Y6KR 2VDKH 3QDGB 3O2DA 4DTGL 2J5LB 2OQJA 3HPLB 3SGEI 4G5ZH 2FBOJ 3X14A 4N9GB 4BZ1H 2YMXL 2BVOA 5C0IA 3HS0B 1W72B 4NDMB 3U36B 3C6LA 1XGRA 3DX6B 4D0DB 5IP4A 2DD8H 4YDVB 5F9WC 4OZFB 5E2UL 3DBXB 3SHSA 4IMKA 4XMKH 3PWVB 5TQ0L 3MRQB 2JCCF 4NO3A 1TCRB 3EAKA 4K07A 2IQAB 3QFDA 5DVOA 2SEBB 1H5BA 1IZJA 3IDNA 1N8ZB 1S5IL 1QSVA 1KIUA 3QG6B 4YO0A 2D7QA 4ORZC 1FE8L 4ZO6A 1HH6B 2FHCA 4DCQA 3ARUA 4UB0L 3WN5B 4OF0A 1NAMH 5DHYB 5E24E 4GQ9L 1AGBA 3N1GC 4RMTA 3GMPA 3VD3A 4NHCH 5C0BA 3IXAB 1FH5L 1XR9B 3PIQB 3RZWA 4ZUWB 2R69H 3FQTB 4J3WA 3OX8A 3D48R 4MD0B 3EFFA 4LCYA 4CMHB 5FK9B 5EIIB 4HIJA 3ZSSA 5HHOB 2FJGB 3EBAA 5C07B 4MNGA 4ZS6C 4OJFH 4MCYB 3BI9X 1E4WL 4KZEH 1OWRM 4L8CA 4WW1A 4GUPA 1BBDL 1CQYA 4JFYB 5DO2C 3NZHH 2RCSL 4PRPA 4ZAKA 2XKNA 1S8DB 1EGJA 2M26A 5E2TL 3V0AC 4HMCA 3M45A 4M1DL 4NFBA 4EN3B 4KKNA 1T0PB 1DANU 3FO9A 4JPWH 4XMPH 1U41A 3B2UD 1W8NA 4HG4K 3SDXB 4NWTL 3S4SG 3ARSA 1LO5B 3O0RH 3P77B 4O9HL 4WI3A 5GJSH 3SY0B 1ZGLM 2Y5TB 1RZKL 1G7HA 3MLSL 5L7XH 3MRGB 1GHFL 3MRIB 3MRJA 2D0GA 3BVNB 5TFSL 5E9DB 5LAXA 1SQ2N 5F7EL 5BQ7B 3JV4A 1H8OA 2ZUSA 3PL6B 4O51A 2P8MA 4XHJD 4F9LC 2O61B 5C0CE 2E7LA 2HG5B 2QQLL 1JYNA 1N26A 5BZDB 2X1PA 2F58L 4OFDA 1LP9F 5T3ZD 3ROOB 5FA4B 4RIRB 5F89B 5JORA 3RA7L 1SJVA 2VMFA 1EDQA 1MHPL 5TE4L 4O2EB 3ZDXF 2AEPL 5EO9A 4LGPB 4KVCL 4O00A 3QUYB 2VXTL 4PP2A 4FQXB 3G5ZB 4HZLB 1I3VA 1GXEA 3E3QE 1I7ZB 5IQ7L 4KDTC 5BRZB 1FFPA 2WWMD 4GBXA 2IPUK 3KPOB 4XWGH 3WFBL 4PRIB 3WIIL 3S9DB 3MLYL 2CIIA 3MFFA 3TO4D 1HQ4B 2QSTA 3BRGC 1E4KA 5GSVA 1C7SA 4HC1H 2LAGB 5LWYL 1OT2A 2HVJA 5DD3L 3BZFB 3MUGB 1IZKA 4JB9L 3KAAA 5C2BH 3K2UL 2R2HB 3QXTA 5J9PA 2BSTA 1MRFL 2HT2D 3AREB 4KJPC 4XWOD 1F13A 1J1PL 3Q5YA 4PJDF 1LEIA 3BPCB 12E8H 3IU3A 3O2WL 2PO6B 2W38A 1S7SA 4YHPB 3BGMB 5CZXD 3P30H 5EFIA 1RV6X 4KZDH 1OSPH 3W0WD 3MJ9H 2KDGA 4LKXB 1DL7L 5GS0L 3MA9L 4K71B 1CI5A 1ZVHA 3WFHB 3O3DA 1X5AA 4YWGL 1RJZA 2OK0H 3CXHK 5E1AB 5DJZB 4NWUL 1MCCA 2WUCL 2M1KA 1T2QL 5IM7B 4RISH 4PJAA 1A7RH 4PGCA 1OSZA 1DUZB 1JZ2A 3RAJL 3WMSA 3QFJD 2AKRA 2Q8BH 3PWNA 2BOBB 4JFDA 4PV8A 4KK5D 5IFHH 1S9WB 4IMLB 3WKML 5D96C 5F9JA 1QFUL 2CXGA 3IGAB 2DOCA 1A3LL 4PJ8C 5FYKH 1PZUB 2UUDK 1ORQA 2GSIB 3L5IA 1I9IL 1VGKB 1I4FB 2CGRL 3F5WA 1MJ8H 2EKJA 4ONHA 1KN2H 3FO0H 3V4UL 1OP3H 3WS3A 4WO4C 1F4AA 1F4YL 1YQVH 4N0UE 4UINL 4PJHF 4FHBD 3B6SB 4QHUB 1G7MA 1KIRB 3TPKA 4F15C 4X6BB 1TZHB 4ZMAT 4PUBL 2A83B 2EC8A 5T5NG 1I7UB 4D94A 4NQXB 4HDIA 3K8LA 5EZOL 3D0VA 4MJ5B 3O41B 2DDQH 1U8HA 2UZIL 4N5EC 3BPOB 4YGVB 3UPCA 1Q0YL 5FGCE 3MO1A 1K4CA 2VC2L 3IDIB 3KPPA 4OGYH 2F15A 5HD8C 3CJJA 3DETC 3MGTB 4RMSA 3V52L 1BGXL 4NQCB 5I0ZA 5K9KA 5EUOA 4G43B 3GSVB 3DO3A 4PJIE 1OAKH 1JPFB 4I4WB 4M61B 3RVUD 3ZDYF 2OMBA 3G6JB 2YUWA 3R0MA 4PLKD 3U7WH 4AIZB 1GIGL 2B4CL 4ZUSA 4R3SB 3STLB 5I1JL 1EX0A 4LAJH 1MFBL 3LQZA 5F7UA 5KSAA 4YUEH 5C7XL 4HK3J 3Q3GB 5FGBA 4DFHA 2BRQA 1T20A 2FEEI 5GGTA 2G60H 3RIAK 4MB3A 5MERB 4Y16C 3IETB 4F9LA 4QY8A 4EBQL 3ULVC 4J8RB 5EU4B 3WSQH 1HDMA 4LCCB 2CK0H 4KK9D 1NBQA 1TVBA 5FYJD 4NC1E 3SDXF 5L8LB 2JB6A 3ET9F 4D3CL 4XGZB 2HJFB 4K7PL 3UROR 4U6TA 5HXMA 1MPAL 2I27N 5DMYA 1KTRL 5HDBF 2DRUA 2XYCA 4UDUA 3TNMB 4XP5L 1DBAH 4WTZG 2BSSA 4ELME 1K8DB 2V2TA 1RMFL 3IDGA 4OB5H 3IFOB 5FKPA 1CFNA 4JO4L 3P40A 3GSUA 2IH1A 2WANA 3D39B 3TCLA 4JM4L 3VWJB 1ED3B 3I75B 3OXSA 5HHVH 4KC3B 3U4EB 3ZT6A 2GUOA 1UC6A 1NSNL 3CFJA 2P5EA 5IBLC 4WI5A 3FQRA 3VRJA 1BZ7A 4G7VL 5T3ZE 4P5KB 1IMHC 5JW5A 3BIBX 3Q6GL 3F12A 2OQJB 5I0DA 3X14B 1QR4A 2B8OT 2BVOB 3LMJL 5C0IB 4D9LL 2XWBA 3AY4A 4EUPH 3DRQA 3C6LB 1XGRB 2OR9L 1Q0XL 4BA8A 3S88L 1OTUD 4RFEA 5FO8A 4HXAH 3CIQA 4DKFH 4NO3B 1BAFH 3IB4A 1AQKH 4N8CL 3QFDB 4Q6YA 1FLTX 4LVNC 2QHLA 1A14L 3U1SL 5AZ2H 1RHHA 4LLVA 1RZ7H 4PJ8A 1CLYL 1MCJA 2RR3A 4YO0B 3H9ZA 4F7PA 1IFHH 2VDQL 4O5LH 1XF1A 2YRLA 5TE7L 2IGFH 3G6AA 3KNBA 4JPKH 4DCQB 1X5KA 4DGVL 2PR4L 1NCWL 3QHZL 4G8FA 5EOCL 4HKBA 3V5HA 3M8OL 2DI8A 1I9JH 1QSFD 5GGVL 1DQJA 3QDJD 5HGBA 2XPGA 5C0BB 2WM0A 4O2FA 1OHQA 5LGHL 4R0LC 4XPBL 2IMMA 3OX8B 1W0VB 1GAFH 4EI6A 4WCYH 4J4PD 3EFFB 2XTJB 3OKEB 1A6TA 4LCYB 4NJ9L 3ALPA 3K1DA 4QRQA 1IGFL 3ESUF 4HIJB 1RZIA 1XGTA 1JF1A 4DQOL 2E8ZA 5IMOA 4MNGB 1QACA 2R4SH 5ADOH 4YHNA 3KR3H 5KBNC 5M94B 1HYSD 2B2XL 3MA7B 2VZTA 4L8CB 3QFJE 2PYFA 1FYTD 2BHYA 2HVKA 4GW5A 2NY6D 4PRPB 4ZAKB 2XKNB 5BV7B 3I3BA 2QQKH 3GM8A 1DQDL 4LSQH 3TV3L 3CFCH 4WWKA 4G6KL 4M5YH 4NC1C 4R8WL 3QEGH 3SKNA 4WW2A 3FO9B 1T5XA 4PB9L 4AIOA 2KUTA 2HN7A 4RNRA 2BVTA 3F6LA 3JWOH 1XF3A 4PRHA 4MAUH 4RWYL 5DEGA 1JTOA 1G7HB 6FABL 3NGBC 1IGML 1XIWA 1NBVL 3CU7A 4QOKD 1V05A 3BZDA 3MRJB 2NY5L 3ULVH 4HAFA 5LAXB 4HPOL 4YR6B 4Y5VC 1OAYH 4O51B 5A2KH 1OM3H 2P8MB 4P2RD 2BMKA 2KBGA 3HNVH 4XCCH 3BQUA 3TT1L 5K9OA 1IGTA 2EH8H 3H3PH 4U1SA 3B9KD 2DMCA 2OR8A 1A1MA 5EO9B 4NN5C 4FG6C 3RRQA 1PLGH 4PP2B 3MFGB 2ICWJ 4XVSH 1WCQA 2CKBH 5ACZA 4DUXA 3HR6A 3U4BL 3WXVH 1FFPB 4UV7H 1FVCA 2VLKD 1HHHA 2CIIB 3MFFB 2WWKT 1SMAA 3MLVL 2EDRA 5GSVB 2VLMD 4M7ZB 3P4OA 4S1RH 2W9DH 1FIGL 3HA0A 2HVJB 4MSWA 3LPFA 4F8TA 3KJ4C 5FYJE 1G7PA 2BCKA 3S35L 3SBWC 5J9PB 2BSTB 3PWLA 1YEHL 1LEIB 3AB0C 1OGAD 3MJ6A 3IU3B 5IEHA 1XFPA 4WEBH 1FCGA 1S7SB 5EFIB 2DQCL 3INUL 1UM5L 3NACH 4DN4L 5J1TC 4JE4B 4N0UA 3VGHA 4JFED 4GMSL 3O3DB 4W4OC 5JOPD 1RJZB 4CUCA 2ARJQ 4OFPA 4ZFOA 1K5NA 1CGSL 2JELL 4PJAB 1J8KA 4OV5A 1OSZB 4M62H 5D6CA 2XTLA 3QO1B 2AKRB 2Y07L 4M6NH 3PWNB 1ONQA 4JFDB 1AXTL 4PV8B 3OB0H 4N90D 2EDQA 5F9JB 5MP6L 1JNNL 4R0LA 4LARH 1ORQB 5JO5A 2LV4A 3F5WB 3LD8B 4ONHB 4Q0XL 4X5LA 4PJIA 1DR9A 2VL5A 1CD8A 1MWAA 1JGDA 2MKLC 5KVEH 1P7KB 4Z0BL 3O2VH 2FHBA 3QCVL 3RKPA 1KCLA 3D0VB 2BZDA 5DSCA 4YHYB 4M93B 1BVKA 3RHWK 1U8HB 3DIFA 4URTB 1BJ1J 3QUZD 4QKXB 3MO1B 1K4CB 4Z9KB 3KLAA 2EDWA 3ZE1E 1DJSA 3KPPB 4KMQA 4YHIB 1MFAH 2BNUA 5F96H 1CBVH 5ECJE 2P5WB 1QSFE 4MHHG 3QDJE 3PJSA 1YEKH 5JXAL 5K9KB 1SYVA 2D31A 5EUOB 43CAA 5H35A 1UJ3A 4K3DL 1J1OH 4XVTH 4JR9H 5DQ9A 1H3UA 1F3JA 4HWBH 4RGOH 2E6JA 4UT6L 5KSAB 3LQZB 5ESAA 2KPNA 4OCXH 1J0JA 4ELMA 2WWKO 4Q6IC 3ZLQC 2IQ9H 3P11H 1T20B 1FQ9C 4G9DB 4S1SL 4KUCD 4OLWH 2XWJA 3KPSD 4N68A 1IJ9A 4QY8B 3JZ7A 2C3VA 1A7OH 4K2UH 1HDMB 3C5JB 1TVBB 4U31A 1OQXA 2JB6B 3SKOA 3T3ME 5C0EA 3X3FL 1NUGA 1TJGH 5CEXA 5IESL 1NCUA 3MYJA 3BUYB 5L9DH 3LKNA 3PWJA 4UDUB 5CINL 3RZCC 1HWHB 2BSSB 4OCWH 2J7LA 2VB5A 3LH2L 1Z0NA 5HYJD 3REWB 2V2TB 3IDGB 2J3SA 5HVFB 5CJQL 3CNKA 5FKPB 1CFNB 1RUPL 4HH8A 3TO4A 4AH2A 3QQ9C 4PR5A 3GSUB 2IH1B 4MJ6A 4NKDA 4P2OD 4QOKE 1EEYA 4M9PA 3TCLB 3V5KA 1ZKAA 4A6YH 3OXSB 4WHYG 3TA3C 4OFYD 5HVWA 2IADB 2GUOB 2OXGA 3CFJB 4P2RE 4HFUL 1P2CA 3FQRB 3VRJB 1BZ7B 3OAYK 1YEJH 5EC2A 1AR1C 1BFTA 5JW5B 1EAPA 1N4XH 3F12B 3ZKSD 3MSPA 1CE1H 1M71A 1MQKH 4W4OA 4HX1A 2XWBB 4HT1H 3DRQB 5D7JC 1FZKA 5GGUA 3IDUA 5D93C 4TYUA 4I9WD 4RFEB 5ALCH 3LEVH 1FFOA 2G75A 4MAYC 2DI9A 2VLKE 5DFVD 3VFGL 3IAPA 1Q9OA 2EXWC 3GB7A 2VLME 1DTUA 2H1PL 2IFFL 5KS9F 1RHHB 4LLVB 2R56H 4P9HL 1JPSH 3RY4A 2EDOA 3TZVD 5JTWA 3G6AB 1UCTA 2JJTC 3O45A 3OL2A 4TTGA 4G8FB 3I50L 3OAYH 4B5EA 3I6LD 4NPYB 1ADQL 4HKBB 3V5HB 1JP5A 2LU7A 3VGEA 1OGAE 1DQJB 5HGBB 1FNGA 1R3HA 2XPGB 1RJYA 1KJ2A 1LK3H 1D5XB 3IRPX 4HGMA 4HXBL 1CD0A 2YKLH 1KYOJ 4EI6B 1X5ZA 5E5UB 5CP7A 5KJRH 4U1MA 1A6TB 5E6YA 1G9NL 4Y4HC 4QRQB 4JFEE 5CJXA 1L4IA 1XGTB 5JHLH 5JOPE 4YXLL 3KGRA 4NJAL 5DTFA 1JF1B 5IMOB 5DWUL 1KN4H 2E6QA 1VFMA 4DEPC 4YHNB 3H0TA 2YD9A 2P47B 2FNBA 5C0FA 1I3GH 3FKUS 1IGIH 1CF8L 2PYFB 1T1ZA 1UM6H 4GW5B 2HVKB 1ZLSL 1JI2A 4N90E 3BYYA 3BGFC 4YFLF 2AI0L 3GJFK 4Z8FL 5BW7A 2NXZB 1G6RA 3HZKA 4KMLB 5FXCH 4WWKB 4DAGH 3SKNB 4WW2B 1QSEA 4WY7H 1T5XB 1Q72H 2HN7B 5B21A 2RJMA 3HNSL 5HHQA 1U95A 5EO1A 1XF3B 1J0IA 3D3VD 3F7VA 1RY7B 2AXGA 3B5GA 3HI1A 5DEGB 4Z7OE 1M6OA 1W72L 4RMWA 5CWSA 1XIWB 1Z2KA 1UENA 5CMAA 3V6FA 1CGTA 1EV2E 1W2KT 2VXUL 3GJFA 5EUOF 3P0YL 1JHLL 5DURD 3UXFA 2VLRD 5EN2A 5F1IA 4KROB 4PP1D 4EI5D 2BMKB 1YEGH 5K9OB 3BQUB 3HB3C 5C2UB 5IV2A 4BSVA 1QPPA 1ZT4A 2ICWI 1IGTB 4GRMB 4U1SB 4FZEL 4JFQB 1A1MB 1HSAB 4PS4L 5I2IA 4XMLL 1CXFA 3GSOA 1KLGA 3BRFA 1O0VA 5EZIH 1XF4A 1I85C 2BSRA 2VISA 3KPNA 5ACZB 3HMWH 5E4EC 4YHZL 3U0WL 1C1EL 1WGOA 3EYOA 1MIML 1BFVH 3MUHL 1VHPA 1FVCB 1HHHB 2EE9A 3NH7L 4XNQB 4XBPA 3KPSE 2FL5A 3HAEG 4JFHE 3RGVD 1JTTA 3P4OB 1CK0H 3C6SA 3ULUF 1FO0A 4MSWB 3QO0A 1WFOA 3MRMA 3LPGA 3K0WA 1G7PB 2BCKB 3PWLB 1NGPH 2AXJA 1CICD 3GSWA 3WFEH 3NABL 3VFRA 1RIHL 1UG9A 5IEHB 1K2DA 3L6FA 4YE4H 1E6OL 3PHOA 5SV4A 1BVLA 2W60A 2Q87A 3S36H 4MAYA 3KS0J 4N0CC 1QBBA 3HE7C 4N0UB 5EOTA 3EO0A 3HNTH 5HYJE 4ZPVA 5I1EH 2XIDA 4DVRH 4X7EC 5TQ2L 1YEIL 3HC3H 3NFNA 4ZFOB 1PEZA 1IT9L 4ZTOL 3F58H 3ABZA 3EYSL 4IS6A 4KVNH 4XNYL 5IBTH 2J2ZA 3TEUA 3OGOE 2QADD 1ONQB 1IEBA 5FGCB 3ARPA 1KXTB 4KTEL 1KJMA 1JFQH 4QXUH 1B6UA 1ZEAH 1BWMA 3RNQA 3LPWA 1WIUA 4LP4A 4R0LB 2FRGP 2E3VA 4AQOA 5CBAA 5JO5B 1QSFA 1GPOH 2VLJD 3QDJA 1OGTA 3UP1A 3OG6B 4H25B 1FNHA 4PJIB 3EYUL 2EXYD 4W70A 4LAQH 2VL5B 1MWAB 1AGEA 1J11A 1JGDB 4R96B 3QHFH 4NQTA 3VGDA 2HTKC 5KAQF 4X6CF 4I9WE 4QTHA 5HYSG 2DM3A 5FUOH 4XI5C 4DKDC 2CDFB 3SDCC 3TVMC 5SV3A 4AT6A 4LIQE 4CVWA 3UAJD 5DSCB 1BVKB 3B3IA 3T09A 3GNMH 3CLFL 3VFVA 3DIFB 2W0FA 2E7CA 1OW0C 2HT4D 5ALBL 3ZL4L 2YK1L 3KLAB 4ZFGH 1QKZH 3TGXA 4K7PY 2BNUB 3I6LE 4NNPH 1X5JA 3CCHB 3QISA 3PJSB 1SYVB 2D31B 3ZHKA 5H35B 43CAB 2X9XA 4K3JH 1UJ3B 4YDKH 4GKZA 3MBED 4DVBA 4I2XE 4GKOA 5DQ9B 3CVHA 1SBBA 3WFCL 2MHAA 4YGAB 2AJYL 1F3JB 3MOQA 5FYLH 1HIML 5E70A 1KTLA 3LIZH 4IRJC 4MA7L 5D72H 2ZCKL 4BQBA 4ELMB 4M7KL 3CVHH 4YPGA 4HULB 1DANT 4X5WA 2EDYA 4XAWH 1JRHI 2XWJB 3UCRA 3EIFA 1U92B 4QOKA 3LEYH 4W6XB 2APBA 2C3VB 4HLZG 2HJLA 4MVBC 3BWUC 2MPAH 4F3FA 4WW2F 1N64H 1PSKL 1WZKA 2JK5A 3EO1A 2VXVH 3JTTB 5KZCD 1AY1L 4XNMA 4P2RA 1TQBC 1AI1H 1UM4L 3SKOB 5C0EB 1JI1A 1U3HC 1WZMA 3GM0A 1I85A 3B9KA 2LVEA 2D4FA 4LHUD 3ARYA 4O2CA 4TRPH 5CEXB 2FJHA 4U4BA 5JDSB 1P84J 2CRIA 4HQQL 3MYJB 4X8JA 2EZ0C 3LKNB 3PWJB 1YECH 1ORSA 5DQJA 4PG2A 4XPFH 1C08A 1OP9A 3SDDD 4IOFD 4JDTL 4FXKB 5ITBH 2L0DA 2VLKA 3O11A 1WFUA 3TO4B 4AH2B 3KJ4B 4PR5B 1ZHLB 4MJ6B 1EEYB 3T4AB 3QIBD 1RVFH 2E7MA 4KDWA 1JPTL 2ZUQC 2DWDA 3GBNH 4KJWD 2BOCB 2OL3L 2XQBH 2VLRE 1A7QH 4X0KA 3DV4A 1P2CB 1DLHA 3LKRA 5TF1H 3A6BL 5EC2B 2RFXA 2QHRL 1EAPB 4HEME 2HKFL 1OGAA 4OQTH 1LDPH 1M71B 4ODTH 2ED9A 4HX1B 1JIBA 5TF0A 3QNYA 1FZKB 4NSKA 1UACH 4JFEA 2JB5H 2YA1A 1FFOB 3OKKA 4F2MA 1KCVL 5H8DA 4KUZH 3RWIA 3UZQA 1Q9OB 1DDHA 3GB7B 4U1JA 4XP1H 3VXUD 1HHJB 3QFJB 4XNZB 1VESA 1GGBL 4Z77A 1E27A 2FH6A 5J6GA 2VQ1A 5B4MC 3LQMA 3RVWC 3O45B 2OZ4L 4KK6C 4UTAH 5TE6L 1WWBX 3WO3B 1UYWL 2O26U 1FNGB 1R3IH 1R3HB 3QULA 1RJYB 1WBYA 1KJ2B 5C6WH 2QSCL 4HAGA 1JGUH 3O6ML 5CP7B 4U1MB 3L3OA 3BKCH 3JUZA 4UNVA 5IMLB 4PJBF 4LRIC 1ZTXH 4OBSA 5DTFB 4X5XA 2XRAL 4NN6B 1OW0A 5D4QA 4UUJA 3BEWA 4Q9CA 3KWWA 3F7PC 3H0TB 1CFVL 2DJSA 3TBVA 5C0FB 2EE2A 4KPHH 1UH4A 4K8RD 1YNTA 1HE7A 3ZKMC 1TLKA 3QUZA 4G8GD 1C5CL 1AD9A 4NQSA 1P4LA 1T1ZB 4OCSL 4OT1H 4PJIF 5GRUH 1L7IL 2FJFA 3CK0H 4LPWA 2R9HC 5IW1B 4JM2C 1NGZA 2BC4A 3RDTD 2DLTA 1U36A 2K3TA 4I8DA 3GSNL 1BJMA 1G6RB 4CBPA 3HZKB 2D03H 4LKCA 4DN3L 4IRJA 4B0MM 1QSEB 4W6YB 5GRXG 4L9LC 4G5ZL 2XG5A 3N85H 4LCUB 4P2QE 5E03A 4BZ1L 3SGEH 5C70A 1RHFA 5HHQB 1E28A 1H8SA 1U95B 1U0QA 5EO1B 5E8DH 3F7VB 2AXGB 2DD8L 1K3ZA 3HI1B 1M6OB 3VGAB 4XMKL 1T83A 3KPSA 5CMAB 3V6FB 32C2B 3GJFB 2EYTB 5JIHA 2R0LH 2NYYC 5FF6A 2LTQC 1MCHA 5EN2B 1CGUA 3RWCB 4XCFH 3JWDH 4BSVB 5E2VH 1ZT4B 5ADPL 3H42L 2EDFA 3RHWF 1EBAA 1NAML 2BHUA 4PLJD 5I2IB 3I3EA 1U3JA 3GSOB 1KLGB 1IKFH 1DCLA 4NHCL 4D0BA 1XF4B 1LDSA 2BSRB 2VISB 2R69L 2X1OA 4JKPH 4LRNH 3CXDH 1QNZL 1VFUA 2AJUH 3U6RA 4RMVA 4XZUA 3QXAA 3EYOB 5HYJA 5F7WC 3NCCB 4F37K 4M7JH 3GHEH 7FABH 3FZUD 4XBPB 2FL5B 4OJFL 5DJ2A 4LEOA 1IAKA 3C6SB 1FO0B 3QO0B 4OFYA 3MRMB 4YK4B 2QQQA 3H9SD 4KZEL 1BPVA 2V5SA 2MKWA 43C9A 3EYQC 4R7DA 3NZHL 1Z5LA 5C1MB 1YMMA 3GSWB 3TFKC 5DK3A 3L6FB 5D93B 3PHOB 1BVLB 1A7NH 1ZWIA 4ZDHA 3DRTB 1FAKT 4TQEL 5BV7L 1T0MA 4JPWL 3LKOA 4TSAH 5EOTB 1JWSA 2X89A 1VEPA 4ZPVB 5IROC 2EKSB 3NFNB 4GW4A 4XCNA 2F8XC 1FGVH 1OCWH 1XMWA 3QIWD 1RU9H 3QUMH 2OS7A 5JLZA 4IS6B 1R0AH 2J12B 1ZK9A 3ILQD 3TN0D 2W59A 2C4XA 3AVEA 4FN0A 4P2CG 3TZVA 3I2CH 3W39A 3GMQA 4UTBH 3RNQB 3UPRA 4YQXH 4I77H 1H8NA 1UFUA 5LXGH 5CBAB 1MFEH 5JZ7D 2F19H 1QSFB 3QDJB 1RURH 1OGTB 3G6DH 2ATKA 3MV11 5EG6C 4I2XA 1V7MH 4U1KA 3OXRA 1AGEB 2EC9U 1RZJC 2FX7H 3H3KA 4E41E 1T5WA 1C8PA 2UY6A 1I8IB 2V5RA 4M1CD 3TNNA 4WFHD 3I3DA 4XTRD 3ZKQD 4NC0B 5F6IC 2C7UB 2V17H 4U3XA 4XWGL 4AT6B 4DZBA 4CKVX 3B3IB 2VDOH 3VFVB 3VXUE 2W0FB 4JM2A 5C0ND 5B8CA 3B83A 4YBQC 3VRIA 3RU8L 4HC1L 3AS0A 1F2XK 1U8KA 2KZWA 2MQ3A 4QRSA 4HIXL 4MDIA 2DIAA 3DOSA 3CFIC 5AEAA 1I1AD 2A6DA 4WIQA 5C2BL 1NDMA 1CDUA 8FABA 1JK8A 4WHTA 4GKZB 1MHHA 4DVBB 4EKXA 4NQDD 2MHAB 2UVEA 4K9EC 1RULH 5I9QC 3P30L 1KTLB 3E0GA 4KZDL 4NUGL 1OSPL 4GLRH 3MBEC 3MJ9L 4HUKB 4PYGA 1MHCA 4POZD 4OIAA 2FEDC 1IC1A 3FN0H 1IKNA 1YYMH 2X5PA 3N1MC 4YPGB 4KQ3H 2P24A 1OT1A 4OZFG 4X5WB 4X9HA 1RZGA 1MJUH 4OF7A 3L3IA 2OK0L 4QOKB 5FA3A 1KBGH 1JHKH 2HJLB 1K4DA 1I7RA 3C8HA 4HF5H 4YLQT 3F7QA 4RISL 1A7RL 4G8GE 4F3FB 2JK5B 2DQGL 4MQTB 3EO1B 2E8YA 5FEBA 3UTZA 2VLRA 5DRZA 3LQAC 4EI5A 2YEZA 4P2RB 4DGIH 1NDGA 5HTSA 5IFHL 4F33A 1OB1A 3B9KB 2V9RA 4NM8H 3PXHA 5E4EB 4OGAC 2FJHB 5FB8A 1T2XA 2D9QB 1MJ8L 1JN6A 4GMTH 3ILPB 4X8JB 2CH8A 3FO0L 1ORSB 2YRZA 1N6UA 3D0LA 5DQJB 3C5SB 1C08B 1HNFA 1YQVL 3UTTD 1UVQA 1IQDA 1A3RH 2VLKB 2VXQL 3O11B 4MS8C 1ZA6A 4KKLD 4F7TA 3RGVA 4HG4J 2I25N 2DWDB 1H3PH 3UEZA 2B39A 3OAZH 1MIEH 3RQ3A 5FV1L 1RD6A 3HC0A 4X0KB 1A9BA 1DLHB 3LKRB 1FP5A 2RFXB 4NC2B 4OD2A 4OGYL 2HLAB 5J4MA 1OGAB 4ZTPH 3OKLA 5IW6A 4KRNA 3BP4A 4BK4A 2DMKA 1NMCC 5IR1A 3QNYB 1QFOA 1URLA 1OAKL 4NSKB 1KF9B 3GHBH 4MA3A 4RFNB 1KIPA 2VQTA 4JFEB 1ZLVK 3H6JA 4XT1C 3U7WL 3C09B 3EJZD 3FRUA 3OKKB 4F2MB 4LQ1A 4RA0C 1IE5A 4LSSH 3RWIB 5I1KH 4YUEL 4GS7C 1DDHB 1I8LC 2NY4C 1P4IH 3SGJC 1CXKA 3VD7A 4F7CA 1JZ6A 4Z77B 4IJ3B 1E27B 3ZE2E 3H9SE 5J6GB 2VQ1B 3V6ZA 3WSQL 3OKYA 2EH7H 4KJYA 5GGTL 5GRJH 4OIBA 1F45A 3HR5A 5GGSA 1UB6A 5I8CA 2Z8VC 1WBYB 1YY8A 4G6AC 1TENA 3FQNA 4X6FA 3KPTA 4YDIH 2VDMH 3TLRA 3ZHDA 4P2QA 1F6LL 1RZJH 2Y4SA 4MNQD 1MREH 5HI3C 4OUUA 2HT3D 4XAKD 1YC7A 4FA8A 4FZ8H 1NGQH 2EEBA 4X5XB 3QJFB 1DBAL 2UWEE 4NO2A 1MELA 3ZE1F 5FUCC 3BEWB 3NPSC 1PX3A 3TBVB 1FPTH 1Q9WA 1YNTB 1QSZA 4ERSH 3QUZB 4RAHA 4NQSB 1AD9B 1P4LB 3VFMA 2WINA 2FJFB 5HHVL 3NCBB 2P7TA 1NGZB 2BC4B 3CXHJ 2FLRT 3D18A 3OAUH 1V7NH 2XKSA 3U7AA 2C1OA 1P9MA 4AZ8A 3IAQA 4IRJB 1F58H 2D7TH 3MBEA 5DJXA 4Y5YC 3B43A 2N7AA 4DK3A 3ISWA 4K9EH 5CFHA 1E28B 4HGWA 3REVA 4WFHE 4JRWA 5DJ6A 1NFIA 4KMTH 1LO3H 4JDVA 4DKFL 3T3MF 1SEQL 3KPSB 1BAFL 3BW9A 1AQKL 4PGZA 1ACYL 2IPTH 2E9JA 4ZS7H 3PDGA 3BYTA 4MB5A 1RZ7L 1L7TH 3ARGC 1IFHL 5I8KH 2IGFL 4M3KB 2WZPD 3U82B 4AY0A 3CUPA 2NR6C 1YN7A 4QWWD 3C5ZC 2R2CA 4LHUA 1JBJA 2JJSA 3W11D 3Q0HA 1I9JL 1Y0LA 4NQDE 2CO6B 4RFOH 4D0BB 1PDKA 4L1HA 5EA0H 5FECA 5MI0C 1GAFL 4FP8H 3U6RB 4WCYL 3SDDA 4XZUB 3QXAB 5HYJB 2I9TB 3P4LA 3L7FA 1CQKA 2Z31D 1JYWA 1DFBH 1SJXA 5FCUH 4P2OB 1UADC 2BHZA 2R2BA 2GSGA 2X4QA 5DJ2B 2R4SL 3QIBA 1JMZA 4LEOB 1N0LA 3BKYH 2PYED 2EYSA 2X09A 4U0RB 2VR4A 43C9B 4L4VD 1B0WA 4R7DB 1Z5LB 1MH5B 3T8XA 2IALA 3L3DA 3SE3A 2QQKL 1QVOA 1BQSA 4N0FA 4LSQL 4JRXD 4JDZA 3CFCL 1ZWIB 5BCAA 5JIIA 4ZDHB 4M5YL 3QEGL 4LVOB 1T0MB 4BZ2H 4E41A 1XT5A 1JWSB 1KGCE 3FQUA 3LKSA 2YMXH 4JREB 2GHWB 3UTTE 2DICA 2I60H 1JZ4A 1S5HA 3IYLW 4GW4B 4XCNB 5EU5A 5JW4M 5GS0C 5JLZB 1H3TA 5E2UH 4KRLB 5TJWK 4YDJA 2YWZA 2W1NA 3TZVB 2V5TA 3W39B 3VJ6A 3GMQB 1M7IA 5DFWH 1ODAA 3UPRB 1S5IH 1D5MA 2G5BA 5FV2A 5IIEB 4F9PC 2B1HH 2Z35A 2YA0A 3LRHA 2EH8L 2ATKB 4HGKC 3TBTA 4UB0H 2BY0A 4I2XB 4GRLD 5DUPH 4GQ9H 3OXRB 1BREA 1PLGL 2J6EA 3CFBA 1T5WB 3SGDI 4NZDA 4XVSL 2CKBL 3UTSD 4L3AA 3TNNB 4IRSD 3MRRB 5TGBA 2AJ3A 1R3LB 1KSRA 4UV7L 1NEZA 4DZBB 4TVPH 3N1QC 1UZ8A 4M9OA 4KRPD 5KG9A 1U8JB 5B8CB 4WDIA 3VRIB 4H20H 4G8GA 3NCYP 3V7AE 1U8KB 2W9DL 4XNXH 4Y1AD 1QR1A 1PG7X 1WEJH 4QRSB 1QLEH 1E4WH 4Y5YA 5D2LE 4L3CA 4I0PD 2A6DB 1NDMB 4X6EA 1JK8B 4WHTB 2RCSH 2YD7A 3D87B 4Z7OF 3GDBA 1B0GA 1MHHB 3VRLF 4WEBL 4MNQE 2YPLA 4RGNC 2DQEH 5E2TH 4XAKE 1VERA 4G9FD 4UT7L 2X4PA 1MCWM 1VKXA 1F90H 1MHCB 4MD5A 4OCRL 2GTZA 2P24B 2LTQB 2WBJD 1RZGB 1WT5C 3L3IB 1J05A 5FA3B 1KJ3H 2NY1C 4O9HH 2OI9C 2HA1A 5HDQH 1QTYT 1MFCH 5DURB 2G2RA 3UTZB 2VLRB 2MFNA 3C5ZA 4N1CA 5DRZB 5HYIA 1A6VH 4EI5B 5B3JE 2R0ZL 1NDGB 2ARWA 2BK8A 3RL2A 1UJTA 7CGTA 5TFSH 9CGTA 1QFWH 4F33B 1OB1B 4U05A 2F74A 4HKJA 2HTLC 4PD4K 4HD9A 4LARL 3IF1A 2PUQT 5FB8B 1MOEA 4KUCF 1JN6B 4MQSB 3VMOA 1MHPH 2Z93B 4QHLA 2Q3AA 3LKQA 4ZUVB 4G6MH 1UVQB 1IQDB 2ZP0T 2VXTH 3O2VL 5L8KB 1ZA6B 5IQ7H 2ZJSH 1MCPL 3RGVB 3WFBH 1WZ1H 1A4KB 4MXWH 2APTA 4DWHA 4X8XA 3H9SA 5A40E 3HC0B 3V6OE 1FNAA 1A9BB 4EZMA 1FDLH 1I3RA 4MGXA 5I6XC 5LWYH 1IGYA 4WWID 1CICB 1G7QA 4OD2B 2ZPKH 5DRXA 1MFAL 4WHCA 5F96L 4CJ0A 3OKLB 5IW6B 5CJBA 5CZVL 3RVVD 3MV7E 1YEFL 3BP4B 3MLXH 4WHYH 4MA8L 1GGCL 2H32A 2OBGA 3KDMA 2M8XA 3OKMA 3DVGA 3UYOD 5IR1B 3VXNA 1CDIA 1J1OL 4XVTL 4P46C 4JR9L 4F7MA 4MA3B 4L8BA 1MLCA 3FRUB 4LBEA 2UWEA 4U2YA 4UQ2A 1IQWH 1HHGA 4OCXL 1BF2A 3QIWA 5GS0H 2MCPH 3P11L 4N0RA 3SQBA 3QNXA 5JXEC 4F7CB 4OLWL 4JGMA 4YHLH 2QADB 2PYEE 3HKFA 2XZCL 4GAGH 3V6ZB 1A7OL 1G9MC 4F37F 1T2QH 4K2UL 4OM0L 4KJYB 1DEEB 1I1RA 1M7DA 1A64A 3HR5B 5FM8A 3JVGC 2F8VA 4TOYH 5GGSB 1UB6B 5I8CB 1YY8B 3BO8B 3WKMH 2XICA 5T1DH 4XP6H 4JRXE 3TIDB 3BH8A 3SDAC 4RSVA 4WEUD 4X6FB 4DOHB 1UKSA 4PJ9D 1TJGL 4P2QB 1N7MH 5ID1B 1ZXQA 5CJ5A 3NA9H 5B3NA 5D7LA 3NMEA 2CGRH 4OUUB 5AUMA 2DLEA 5L9DL 1AFVL 4M43H 3PWUA 2WLZA 4NO2B 4QNPF 4YNYA 2VDPH 3EKCA 4ZUUA 4OCWL 1F4YH 5E2WH 4UINH 2VZSA 3GIVA 3LN9A 3U46B 1Q9WB 5HYFA 3OWEA 4N0YH 4TNWF 3VFMB 5C92A 2NY2D 2WINB 4A6YL 5GGRA 2XFXB 4NKQB 2P7TB 4MQXD 3MNVA 5DA0B 3HCVA 4FQLH 5C0RH 4WENB 3EJYD 4JVWA 4XVUC 2XZZA 2C1OB 5I9QB 4YXKL 1N4XL 1V3MA 3MBEB 5DEZA 5DJXB 1BEYH 5GHWH 1CE1L 1NC4D 4NQDA 3BZEB 2NMSA 1MQKL 4XC1H 3S3PA 4HKXB 5TDPA 4HT1L 5D1XC 1LEGB 4HGWB 5DMKA 3UTSE 3MLZH 2UVFA 4TUKH 5DJ6B 5EO0B 1NFIB 5I30H 1DQQA 4JDVB 3NTCL 3ZKND 4APQD 5IJVA 3DMMD 5CHNA 3G5VA 2MQ0A 3WLBA 3N1FC 5KZCB 2R56L 1JPSL 2YZ1A 4EBQH 3RJQB 2AW2A 2VDRL 3CUPB 3ES6A 2ZWLT 1YN7B 5KTEH 4JLRB 4NQUA 4DK6A 4LHUB 2OTWA 4UBDD 1J10A 1Y0LB 2DI7A 5DHVH 5E6IC 1FSKC 3AAZA 3VD9A 2JCCE 1LK3L 3CPLA 2VWEC 5FECB 2YKLL 4G9FE 3O4OC 5JQ6L 5KJRL 3SDDB 5F7NC 3CX2A 4ZSOE 3UTTA 1KJ2L 3L7FB 5JHLL 3MRLB 1U8QA 4C57C 1TITA 2H2PD 2R2BB 4XP5H 2GSGB 2X4QB 3JBG7 1KN4L 3QIBB 3QPQD 4C59B 3NA4A 4P3WA 1T66D 2E7BA 1BF8A 1MUJA 1WIOA 2NPLX 1UM6L 4JM4H 2JJUA 4PJEE 3T8XB 4GOSA 3HAEH 2IALB 1B2WH 3L3DB 1QVOB 1NSNH 4N0FB 1YNKH 1X4YA 3WHE0 2NY0C 4JDZB 4G7VH 2YUZA 4DAGL 4XPTH 4WY7L 1IL1B 4E41B 1Q72L 3LKSB 3U2SA 3FQUB 3LMJH 3WJLC 3OMZA 1XGYH 5LCVH 1S5HB 4FFZH 3CSYA 5EU5B 5CGTA 1Q0XH 3S88H 2DYPA 3QR2A 3VXUB 3JVGA 4ZXBC 3VJ6B 1G9MH 4JFPB 1M7IB 4N8CH 1IRAY 3CU1A 3DSFH 1DBBH 1CFQA 1A14H 3U1SH 4H1LA 5D2LA 1D5MB 3T0EC 4HUUB 2G5BB 4KDVA 2Q86B 3V0WH 2Z35B 1KT2A 4KK8C 3AMLA 1DEDA 3TBTB 5I75C 3W9EA 4HWUA 1OTSD 3TPUA 3PXJA 2XZQH 3CFBB 4MNQA 3VH8A 5MEQA 5EZIL 3TT3L 5BS0D 3HMWL 5TGBB 4L4TA 4EVNA 2NW3A 2AJ3B 3N0PB 5D71L 4PG9A 3GI8H 1BFVL 1NEZB 1J12A 2ED7A 2X4TA 1MCDA 5KG9B 4U1GC 3AGVA 5MEOA 1LP9E 2WLYA 4G8GB 2IANA 1GL4B 1CK0L 5FM5M 1JZ8A 5JPNA 5EH1A 3MXWL 1QR1B 3VW3H 2C3XA 3RDTB 3KVQA 4Y5YB 1DZBA 4L3CB 1KTKE 5E95B 4X6EB 1NGPL 4OCNC 4BUGA 3C60C 1CGXA 5HHMD 1B0GB 1F97A 3BMVA 3WFEL 2ADIB 4YE4L 2CR3A 4I0PC 3KYNA 2X4PB 4KH2A 1VKXB 4MD5B 5F71A 4OUOA 1YY9C 4PB9H 3HNTL 5I1EL 1QA9A 2GTZB 3FB6A 4DVRL 3EDKA 1LK2B 1X5FA 1J05B 3HC3L 4NFCA 3HUJA 3F58L 4KVNL 1OD7A 1QFPA 5F8QC 1K6QH 2G2RB 1FIEA 3C5ZB 1ZANH 2XKUA 1KB9K 4D8PA 2VR9A 3RL2B 5KAQG 2RB8A 4HJGA 3L5JA 1VSCA 5CGYD 2F74B 4HKJB 2YOCA 2FGWL 5HGDA 4QGYA 3IF1B 4HLZH 3PNWA 3WNOA 3MV7A 3ZYZA 1GPOL 4PV9B 4Y4KC 4KI5D 3FCTA 4QHLB 2APXA 4LAQL 1WTLA 3LKQB 5JOFA 4QCIA 4XRCA 3QHFL 5BO1H 1N2RA 1RUKH 4YAQB 2Z31A 5C09D 1SBSL 3ULVF 3MGOB 1FAIH 4JKWA 1BJ1H 3QI9C 2PYEA 3FO1A 3H9SB 4OI8A 3RP1A 3GUTA 3MLVH 3VG9B 1CL7H 2NLJA 1S7XA 4J3UA 1NUDA 5BMFL 1I3RB 3EO9H 5CILH 4FOMA 1IGYB 4ZFGL 1QKZL 5FO7A 1EEUA 2A9NH 1G7QB 2BFVH 5DRXB 3RNKB 5F7DB 4NNPL 4JRXA 1C5BL 3WJLA 2H32B 1DN0B 3OKMB 3ZT7A 3DVGB 1S9KC 2Z92A 4YDKL 4F7MB 1VENA 2EDEA 2A6JA 4L8BB 3HN3A 5AG9A 1AXIB 4ESKA 3S97C 3A6OA 4LBEB 2OTPA 3LIZL 2UWEB 4NBXB 5D72L 3MACL 1HHGB 3CVHL 5JNYB 3QIWB 5DXWA 1EHNA 4HJ0D 4FTVD 2B5IC 3QNXB 4GMSH 4XAWL 2BVQA 3TN0B 3LEYL 3T0EA 2C26A 2DQUH 1F6AA 1JRHH 5JW4Q 1I9EA 4U6VH 2MPAL 1N64L 5JR1H 5IFAL 1M7DB 2EE3A 3WFDL 2VXVL 2Y07H 1U8NA 5IUSA 2HWZH 1AI1L 5HHPA 4PJ7F 3U30B 4JN2A 4TNVF 1JNNH 4UT9H 4GRLA 4TRPL 2EIDA 5D7LB 3D25A 3CC5A 1TFHA 1HOCB 4R7NB 5AUMB 1HSBA 4X7CC 3TJHC 1QLRB 1YECL 4LPVA 3PWUB 4FS0A 2CD0A 4YNYB 1ZLUK 4IRSA 4XPFL 4IHOA 1XCQA 4JQXA 5D5ME 1P5VA 4JCLA 1UCBH 5ITBL 3GIVB 1ZA3A 5IMKA 2EC9T 4E42A 2VAJA 1RJCA 3VXSD 5GZOC 3TH2T 1J18A 5I74C 2FO1A 4MLIA 1RVFL 2EIBA 1G0XA 2JJVA 1NBYA 1J5OL 4YFDB 3HCVB 2EICA 1D3CA 1A7QL 4QHKJ 3PUCA 1G7LA 3WDJA 4OZIF 4I0PA 1I1AB 3RY6C 4YXHL 5FKAA 1V3LA 2P44B 4NQDB 3QIUC 1MF2H 4OQTL 3EJYC 1LDPL 2JCCA 2VZ1A 4ODTL 5TDPB 1KEGH 4XP4H 5BS0E 5DMKB 2HMID 4HLJA 4U1LB 5CD5C 3O6FC 4ZSOA 1ZLUH 2WQRA 1MY7A 4ZUTB 2JB5L 5FAAA 2XA3A 2EIEA 3WCYA 2WBJA 2HLFD 3L5WA 4KUZL 3EOTL 5GGQH 5IJVB 2MQCA 4OBRA 3JV6A 1BECA 4B7LA 3ARWA 3VFPA 1NUNB 3IS0X 5CHNB 2NY7H 4X7SH 3MCKA 5EIVA 2VZOA 3WLBB 2AJZA 2EYRA 4NKIH 3EDDA 3MRDA 1IM9D 3ES6B 3HI6H 4LSDA 3MROA 4UTAL 5DRNA 2DMBA 4X9GA 2AERT 3V6BR 5HHME 2E9BA 5SX5K 4POUB 3THMH 3L3GA 1J1XH 3AAZB 5AAWA 4ONFL 1CD9B 1U9KA 1JGUL 3X3FH 5K9QI 5ID0A 3BKCL 3UTTB 5IESH 4C56D 3WN5C 5MEND 1U8QB 2DKSA 2Z4QA 4AIXA 1F3DJ 5T5FL 3TYFA 5EPMA 3DECA 3V95A 1VFAB 5CJQH 2C3HA 2BP3A 3MJGX 1MUJB 3BN9C 4XCEA 2V2WB 1FYHB 1CTNA 4OT1L 4CMHC 3M1BA 5IBUB 4PGJA 1S9VA 4JHZA 4P3CH 2VJXA 2D03L 4NBYB 3HI5L 1BM3H 1JVKA 1U91A 1MLBA 4KI5E 3SCMC 2CR6A 4JGJA 3N85L 2NXYD 3U2SB 4Q2ZA 4GKNA 3ZE2F 3DHMA 2V6HA 1BWWA 5E8DL 4FFVD 5C09E 1T80A 2ED8A 2R15A 3PP3H 3ORJA 2GAZA 3BPLB 4GAFB 2CDGA 1EUUA 5JHDA 1FL5A 4HK0A 1G7IB 1LP9A 4EN3C 4ACPA 1EVUA 3VFGH 1A02N 2R0LL 1CFQB 1MAKA 1WF5A 3VI3E 1QFWM 2R0KH 3FMGH 4H1LB 4UOW0 1DUYA 4CVZA 5D2LB 3HFMH 1JWUA 1T1WA 3WNMA 1UH3A 4XCFL 2IAMC 3MODH 5E2VL 2UWEF 4PJFE 4W68A 5K9QG 1KT2B 3TC9A 3W9EB 1BX2A 3GMOA 1A0QL 1BHGA 3KG5A 3I50H 3TPUB 1ADQH 5I17A 4TSBH 2NZ9C 3KPLA 4MNQB 1UKQA 3VH8B 1IKFL 3O4LE 5MEQB 1LGVA 1QRND 5IVZA 4FXGA 4JKPL 3PL6C 3HMXH 4LRNL 3CXDL 5D2NE 4NBZB 1JE6A 2AJUL 4EJ1C 2NW3B 4EVNB 2BY2A 1LHZA 4PG9B 1RIVH 1ZHKA 1Z9SA 4M7JL 3GHEL 7FABL 4FTVE 2X4TB 2F5BH 4I0CC 3N50A 3UJIH 4YXLH 1LNUA 1RUMH 5MEOB 4OF5A 4EEEA 3QUYC 2IANB 2IWGA 1ZMYA 1GZPA 4FQXC 5JPNB 3RKDD 3EGSA 4GT7A 3QIUA 5ISZA 4K3HA 4CN4A 2J1KA 2EDXA 5CIPH 1LVEA 1NC4A 4HCRH 1LE5A 3KS0H 1NQBA 1A7NL 3KYNB 4X4YA 1HKFA 2GK2A 3QDGA 1A22B 4MJ4A 4TSAL 1HZHH 1BOYA 1QA9B 3NIDE 3FB6B 1YMHA 3AREC 4NUJB 5C86A 4XCYA 2C5DC 1FGVL 2GJ6D 3E8UH 3NCFB 3KHOA 3QUML 3DX6A 5H94A 3FTGA 4LSVL 3VXSE 2DQDL 3K8KA 3DMMA 1EPFA 1W72H 1R0AL 3O9WD 4D8PB 4K71C 3I2CL 4QRRD 3CDCA 4UTBL 5GJTH 4OZFH 2SEBA 4HIHA 4JZNA 4OV6F 4E9LA 4I77L 4YQXL 4O02H 4S1DD 1U93A 5HGDB 5LXGL 3QG6A 1MFEL 3PNWB 4PJHA 3VXTB 3PGDA 2F19L 3QEUA 3MV7B 5HGAA 3RFZC 2YXMA 1RURL 4R97B 1SJEA 3G6DL 5IVXE 3WIHA 2FSEB 1HNGA 1V7ML 3FCTB 4FZEH 4PS4H 5JOFB 4XMLH 4QCIB 4XRCB 3B2VH 1N2RB 5E1HB 2Z31B 4Y7MA 2BVPA 4MD0A 2R29H 2DJ4A 1HN1A 2WQ8A 3IJSA 1MIMH 3ZZ1A 2DBJA 1D6VH 2PYEB 3FO1B 4FFYL 3WXWH 4AENA 3GUTB 2Y6SC 3CDYA 4RGMC 2NLJB 1S7XB 3BD4A 3QQNA 5DDHB 4UOJA 1CXLA 5FO7B 3I02A 1P53A 2D7OA 2P8PA 3SCMA 4KJQC 4HV8A 1P6FA 2AK4D 1P84K 5D1QD 2ZG3A 4HWEH 4JRXB 1H9VA 4UNTA 1RK0B 2Z92B 2QLVB 2Q6WA 5C3LD 3BPOC 3NABH 2A6JB 1RIHH 4JEGB 1RULL 1B6DA 1DVFD 1FG9C 1A6UH 4C56E 4W6WB 4S11A 4J3OC 5MENE 5CEZH 5BXFA 5D5MA 3FN0L 3PV7A 1YYML 1OTTC 1U6AH 1PEWA 4RQQA 4KQ3L 5F7YC 1MJUL 5TQ2H 3MXVH 5D2NC 3RX8A 1KBGL 4KKBC 1JHKL 1F6AB 2GY5A 4HF5L 2IAMA 1I1YA 2Y5TA 1QBLH 1CDHA 1IEHA 5I75B 1I8MA 1F4WH 1U8NB 4DGIL 4F7EA 5HHPB 4O4YH 4LPXA 1EBPA 4GRLB 1FVEA 1FFNA 2HG5A 2CKNA 3D25B 3CC5B 1HSBB 4PIRF 4GMTL 5FA4A 1MAJA 4X83A 3UTSB 4LCCC 3ZYIA 1UWXK 4IRSB 4IHOB 4AYFA 3ULUD 1XCQB 5D2LF 5HJ3A 1A3RL 3ARTA 1ZA3B 4E42B 5IMKB 4LPYA 4UZGA 4KRPB 2Q7NA 1N6VA 1I7ZA 5H37G 3FHQA 1YPZE 3KPOA 4ENED 1NBYB 1H3PL 1AKJD 5ITFA 1MIEL 3SOBH 3C2AH 5C0AD 1A2YA 5GRYA 1G7LB 4I0PB 2F8OA 5FKAB 1AHWA 3CVIL 1S9XA 1RFDH 4NRYA 4G80A 3ARFD 4ZTPL 4WI7A 3VDAA 1KB5A 2JCCB 4MZ3A 4Z7WE 4G9FB 5ICZA 1QRNE 4IDJH 4DFIA 3GHBL 4ZSOB 1DSFH 3WFCH 4TPRL 4C54A 1L0YA 2AJYH 5HY9A 3MLRH 1HIMH 2VUYA 2WBJB 5I1HL 4LSSL 4U1HA 4BK5A 4JY4A 4M7KH 2BRRL 4NOFA 3KPMA 3RTQC 3VFPB 1P4IL 3VD5A 2AJZB 2EYRB 2AP2A 3C6LC 4NHUA 1Q1JH 3MRDB 5IW3A 5GRJL 2EH7L 4PJEB 4OLVH 3R8BB 4M8QB 3MROB 4IMKC 3OB8A 2HJKA 4JFFD 3L3GB 3ARDD 2OM5A 3J7HA 5DZLA 2A1WL 4MMXC 5E5RB 1RJLA 2VDML 5I1CH 5ID0B 1RZJL 2CLVA 2CRMA 3FN3A 2X9WA 5KS9E 3U0PA 5I1LA 4CAGA 4HQQH 1G0YR 4FZ8L 2Z4QB 2ZSWA 1KC5L 1NGQL 5C09A 3TYFB 2GJ6E 3DYMA 5T3XH 5SX4I 1IGJB 3MREA 3BPNB 3VWKD 3EHBC 1IAOA 4LFHD 4HIEA 4HWNA 4ERSL 4XCEB 4QRRE 3M1BB 3G9AB 4RRPA 3LVEA 3IDYB 1OWWA 1S9VB 1V7NL 4N9OB 1QQDA 1F58L 1U91B 1MLBB 4FFWD 4G8EA 1I8KA 1DQML 3O4LA 4K9EL 4Q2ZB 3LS4L 4GKNB 5TH2A 2V9QA 1CFSA 1CDCA 3GMMA 5D2NA 4ODSL 4ZAKC 2XT1B 4MNHA 4B50A 2GAZB 1CR9H 4FTVA 3WE6A 5J8OA 3QJHA 4KMTL 2CDGB 1LO3L 4HK0B 2FECL 1KCVH 1LP9B 1F2QA 2GW5A 4Z78B 1EEQA 2G9HB 1PY4A 4ZS7L 4ZOAA 1EFQA 4Y5XA 3H7BA 3SGKA 1QP1A 1MCKA 3OR7A 1L7TL 4CVZB 3LQAL 1JWUB 4S0TD 1GGBH 3IETA 1INDL 1T1WB 5I8KL 2X2YA 3RI5K 2AK4E 4NN7B 3A6CL 1R24A 4JHBA