1FE8H

Crystal structure of the von willebrand factor a3 domain in complex with a fab fragment of igg ru5 that inhibits collagen binding
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
210
structure length
210
Chain Sequence
DVKLVQSGPGLVAPSQSLSITCTVSGFSLTTYGVSWVRQPPGKGLEWLGVIWGDGNTTYHSALISRLSISKDNSRSQVFLKLNSLHTDDTATYYCAGNYYGMDYWGQGTSVTVSSAETTAPSVYKLEPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of the collagen-binding site of the von Willebrand factor A3-domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords VON WILLEBRAND FACTOR
total genus 45
structure length 210
sequence length 210
chains with identical sequence I, J
ec nomenclature
pdb deposition date 2000-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1fe8H02
1MFBL 2G5RA 5GGTA 1MI5D 3RDTD 2BCKA 3INUL 4HWEH 1N5YL 3GRWH 4XNUH 3VFVB 3VXUE 4LP5A 4KK8C 4LKCA 3C8KB 3LZFH 4G6KL 5C7XL 2XPGB 3O41A 1U8OA 1D6VL 4P9ML 2HFFB 4MSWB 3C5SB 1W72H 5DR5L 1IC4H 1E6JH 1MHCB 3CCHA 3TIDA 3DRQB 1YEKL 1MHCA 4PUBH 2YPVL 4Z7NE 5D1XC 4G9FA 1I85C 1FNEB 3EO9H 2VLRB 3VWKD 3OAZK 3IFNL 5D7IE 2BVTA 4ONHA 3N1QC 4U3HA 4ERSL 1KYOJ 4A6YB 4UNTA 4JAMB 5MERB 4HMDA 1WFTA 3ULUF 5D7LE 1BJ8A 3U2SA 2D31B 3B9AA 1F5WA 5FYKU 1GZQA 2NZIA 4MWFA 3QDJE 1JMZA 1HZHL 2JJVA 3BAEL 3RGHA 2FR4B 2VR4A 3QNZA 4UT7H 3V0WL 4AEIL 1DANU 1KXQE 4IIQC 4UT6H 3CFIC 1RIHL 3D39B 5J89A 1HHIB 3EGSB 1A6VH 2R2HB 2EDBA 5AD0A 1IC5L 2R69H 3FB6B 1VESA 3HR6A 3DSFL 1I4FB 4PJBB 4J3XA 5CCKH 4WWID 2NY5H 3MYJA 1JV5A 2NXYC 3OG6B 5C0AB 5IMOB 5B38A 1UQSB 2HFGH 4HMCA 1PEZA 1RZ8A 4OF8A 1FNEA 1EXUA 5E5MB 3V7MA 3OBAA 3P30L 5DD5H 5JMRA 4XXCC 4FABH 1AJ7L 2H3NA 4PJ8C 2LQRA 5GGQL 4E5XA 3V6FA 1MHEB 1FN4B 3MXVL 5D7KD 5CJXA 1T6VN 1GZPB 5F89B 5J56B 3SDCB 1RJZA 4HJJL 4KROC 2FD6L 1NFIB 5IT2L 4EQ2A 3QEHB 3DMMB 4PJEF 1MCEA 4P2QB 5DQJB 2YKLH 3I9GL 4M4PA 3T1FA 4P0DA 4JLRA 1EGJA 1BQSA 5KANG 2WIIB 3BEWB 1UEMA 3HI1A 3MV7D 4N0CD 4M00A 1TQCB 3HS0A 5GSVB 5HHOE 3MRLA 2IANA 5CWSA 2VDRH 3WFHA 4BKLB 4W6XB 4H0GA 5BS0E 4IOFC 4IRJB 3HAEH 1NANH 2IWGA 4L4JA 2V9TA 1E0OB 2BHZA 2YSSB 3F58H 4KAQH 1DQTA 3TJEH 1ZHNB 4KK6C 4GXVH 4NN5B 4AIXA 5TE6H 1VENA 2OXHA 4GKNA 2X6MA 2X4UB 1R5IA 4Z5RA 2EECA 4WFHE 2UVEA 5CZVH 4PP2B 1TVBB 3RWCB 2F53A 1DVFA 4ZAKA 3MA7A 3C08H 3CU7A 1I1RA 4MMXC 4Y2DD 3EYSH 4HBCH 5EBWA 3QFDB 3LV3B 5KSVB 2XA8H 1DVFC 5J1SC 2DJSA 4HC1L 3H9YA 1KJMB 2O5YH 5BV7H 4EBQH 2DQEL 2OS7A 5D6CA 4LPXA 5SWZB 3PDGA 3N06B 4HEPG 2HJFA 3G08A 2HFGL 4OM1H 4MAYD 3PGFL 2P24A 4Y19B 1S9YA 5GS1A 5HYIA 4NPYA 2CRYA 5JW4Q 5B3JF 3LVEA 4DTGL 2BSTB 3DMMD 1LO0L 4KTYA 1NCBH 4FFYH 3QPXL 1AO7E 3LOWA 5DMGD 1AIFA 5T1LA 1YYML 1N59A 1FNGB 3D39E 3FQNB 4KGLA 4N90E 4BSVA 4ZPTB 1KPUA 4YBLB 1OL0A 3F7VA 1T03L 4Z7QF 1KTDB 5IFJA 1MNUH 4H26A 1JIBA 1WWWX 3QDJB 4P57B 1A0QL 1HKFA 2XQBL 5J7CC 1BVZA 1YY8B 5AZEL 4IRSD 1XFPA 3AVEA 3MACH 1KTKE 1Z9OA 5D72H 3KNBA 3ARFD 5HHMB 1OD7A 3K1KC 5AEAA 5KSAC 5CD5D 4IOIA 3RNQB 1QEWB 1TMCB 1I9IL 4P46A 5L2KE 2FATH 3ZT7A 4FQ2L 5EH1A 4MA1B 5D1XB 4I0PA 3PWPE 2ATPA 1W72A 3I6LD 4KQ3L 4NT6A 3RIAF 2W07A 1G6RL 5HTSA 2VLKB 4PJCE 4YUEH 3H7BB 1G7LB 1BOGB 4L4VB 1MVUB 3VRIA 5DK2B 4GBXB 4XRCA 2NMSA 2ED8A 2BNRD 1F02I 5SV3A 1U8MB 4O2EA 1U3ZA 5IUSA 4P5MB 1YNKL 1MJ7H 3VWKB 5E2VL 4HJGB 1I3UA 3ZE0F 1PG7W 5FA4A 3ULVH 3KPTA 4ELME 3KG5A 4ZUVB 4AYFA 1SEQH 4JO3L 3NH7H 2CO6B 3QCTH 1RJCA 4XWGL 1Q9LA 5EWIL 5F93C 5BS0B 2H32A 1JFQL 2IPTH 4P2RB 2NZ9C 1L7TH 2LTQB 3DXAE 3H7LA 1MSPA 2FRGP 3P0VH 1F6LL 3MRRB 5H37G 2EO1A 3VFNB 2B1HH 3OB8A 4PG9A 2NY3D 3QIWB 1DLFL 1H5BB 5A2IH 4MZ2A 3MRBB 4NSKB 1HXMB 3G6JE 3NFSL 2NCMA 2FEDD 1ROWA 4WDIA 3MODL 1KJVB 3X17A 3V4UH 4X6CE 4ZO7A 3RVVC 3GKZA 5ADPH 1D6EB 4M7JH 3AMKA 3UTSE 4R9HA 1T4KA 5IESH 3B9KC 5CP3A 3RDTC 4FA8A 1CGTA 4G8EA 4HX1A 3KPRA 2OZ4L 3HE7C 1ZANL 5FOBB 2Q76B 3TN0C 1L9MA 3ARBC 3CMGA 2D4FA 1JI2A 1FNSL 2ATKA 2P42B 5F96L 3TT3H 4RWHA 2AQ2A 4YHOH 4Q9CA 3WJJA 4GUPB 4RCAA 3T1WA 1MQ8A 3WJLA 4GS7C 4F9LC 5JQ6L 4BZ2L 3NGBB 43CAB 5HHQB 4ZDHA 3JV6A 3OKDA 4EN3D 5SX5H 4PTUB 1OARL 4GRLC 4XCCH 3QHZL 5E2TH 5I1JL 3ECBA 4QTHA 2VB5A 4M1DL 5J3HC 1I8IA 4XPHL 5IF0A 4WWKC 3MRGA 5E4IA 4XAKD 2G9HA 4M03A 4O51B 4QHUA 4AH2A 5E8EB 1XF2B 5CJ5A 4HT1H 4MCYA 2NY4D 2DDQH 4XXDB 3IFLH 2NY6C 4PJGE 4P4RB 4PYGA 2R29H 4LHUD 2JCCB 2IBZY 4F7TB 3UYPA 4R2GD 1NDGB 1ZVSB 3S5LB 4R7NA 1F6AB 3IVKB 4LK4A 4EDWH 3S96B 1A7QH 3MQIA 4YHZH 5JXAL 2P5WB 4NWTH 3OJMB 4UT9L 4DZBB 1UEYA 3HUJA 4PV8B 4BUHA 2CK2A 4EOWH 4C56D 1MELA 3BFOA 1FCGA 1BVLB 1XCQB 4LGRB 1FGVH 1NGXA 1I7TB 1JNLH 3QUXD 4XNQA 4MD4B 3V8CA 2EDLA 3O2DL 4GRLB 4L8SC 1R3HA 1S5HB 1M71B 1ORQB 1OAKH 1BFSA 1T5WA 4DOHB 2AJVH 4IRSA 5D2LE 1K5NB 4EDXA 1DDHB 3JUYA 4YHPB 1G7JA 1P69B 2X4TB 2DQTH 2D7OA 4TUOB 3U46A 1ZEAL 5ISZE 1P53A 4FQJL 2RIKA 4FXLA 5EOTA 2R2BB 3VXTA 4KKNA 3LDBC 1JF6A 1NUFA 2EDKA 3MRIA 3GMQB 5DA4A 2G2RA 3H9HA 3ULVL 2P7TB 4IMKA 1ZWIA 1I9RH 3UO1H 4PGCA 2WSKA 3FHAA 5GRUH 4NUGL 2FO4A 5L9DL 5AWNL 4YH6A 4WWKD 5ENWA 4WFFD 4Z8FH 2A6IB 1FVEB 1CR9H 1ZA3B 2UWEE 5EU5A 4MJ6B 4L1DA 3N50A 1IRAY 2E9IA 4NO3A 1GXEA 3PHQA 5C0CE 3RVTC 4S1DC 5I1EH 3LEXB 1F8TL 4P3CL 2GUOB 3U4EB 2ZSVB 3GSNL 1C1EL 2ZJSH 4ESKA 4XP6H 3C9NB 3HKFA 1U8LB 3IKCA 3QRGH 5C07B 1V3KA 3HB3D 1QRND 3L9RA 5AZ2L 5F9JA 1I1AD 2ICWJ 1FIGH 1HDMB 2YMXH 4NHUB 4QKXB 4D0DB 4JFEB 4YDLC 3PXHA 4M8QA 5CBEA 2R23A 4NNYA 1P4IL 4RBPH 4JPIA 4K3JL 1A9BB 3O8XD 2HFTA 3T0EB 1EBPA 4HV8A 3CVIH 5F71A 3IRZA 5BMFL 5I1HL 5HI4C 2NY3C 3QI9D 5GXBB 4FQIH 2ITDB 4V2BA 1TQCC 2XTJD 5L2JA 3DVIA 2GQHA 3DYOA 3B6SB 1FQ9C 3KGRA 4X0KA 4NZTH 3BYYA 1IQDB 1U8IB 4NC0B 4QHNA 4RAVB 1ZSDB 1Z6JT 1QRNE 1VACA 4JRYD 4NQEA 3DO7B 3RWEA 1RZGA 1Q9OA 1OSPH 1CT8A 3LMJL 4HK3N 5CZKA 5KSAB 4ODTL 5B21A 1JZ5A 4LEOA 5D8JL 3LKSA 3UTPE 4KWUA 2ED7A 4Y5VA 5C0IB 5J13C 2M8XA 3ZKMC 5IB2B 4HS8H 1GOGA 1MCJA 3S7GA 1WT5C 3F7YB 1AE6L 4PJAE 1FVDA 2X2YA 4B50A 4DGYL 1JYNA 1N0XL 5DD6A 1PKQE 3MLSL 3T3PF 5C6PB 3C5ZD 4PS4L 3FT4B 3RWGA 3T0XA 2PO6B 2D9QB 3TZVC 4R4BA 3TBSA 1JMXA 2CSPA 2Z31B 4A2MA 4PBVC 1CFSA 1IC4L 1RZJH 1NBVL 2GJ6D 5FUZL 5KSBB 4H5SA 2ZSWB 4ZFZB 5C08A 5IB5A 1BHGA 1MCCA 3QFJB 3C60A 5D2NB 5HJ3A 3L3JA 1ZV5A 3AU1B 1EGJL 3ZKNC 3UDWC 3GSNH 4OQTH 4RIRB 3FQUB 1A1OB 1T66C 2VAJA 3JV0A 3EDDA 3VGAB 1IAKA 1CXIA 4TULL 3RNKA 4NRXA 2X4PA 3ULUE 2JELL 4N0YH 4MXWH 4XC1L 5GGTL 4YBQC 5TGBB 2XZAH 4L9LA 2DWEB 1OW0C 4HW6A 3KPSA 5D96C 1MIMH 5DD0H 1T0MA 2FX9H 2CUIA 1N0LA 1OQXA 2I9TB 2HKFH 1JNHB 3DUUA 4NBZB 1NGYA 4BJLA 4N8VG 4Z7VF 2UWEB 5JO5B 2AXGB 2IPKA 4EUPH 3QFJE 3AY4A 3MLZL 3QUZD 3HAEB 1GOHA 3DYPA 1JWSA 2GSGA 1ZXQA 3O4OB 4MXQC 2NYYC 1TXKA 3T0WA 1S9XA 4ODUB 4JFFA 1H8NA 2BERA 2VLLB 5KZCD 3HHRB 1GGCH 4GW5A 4YC2C 4EXPX 5ID1A 1RAMA 5D1ZA 1KC5H 3HI5L 4WI2A 3TIEA 3HCVB 4HIJB 4N8CH 2OR9L 4ORZC 4DKDC 3UYRH 3NAAH 1UZ6F 3QIUC 2X41A 4CW1B 1QSFB 2VSDA 3WCYA 1NGQL 3CJJA 3OAUL 4K71B 3RX8A 3OF6D 3ARPA 4WW1B 5EBMB 2QSCH 4WW2C 5TE4H 1CF8L 4X9FA 2WINA 1EHAA 1DCLA 1NBYA 5KAQG 2GY7B 2NX5E 1FZOB 4MA8H 2OP4H 5DVMA 5FO7B 2YPLA 4GKSB 4LVOC 1FE8H 3D9AL 2P5WE 3EJZC 5K9OA 1BJMA 1GIGL 3DJ9A 1RY7B 3U36A 4LRIC 5KVEL 1XR9A 4BSWA 2SEBB 1CBVH 2I26N 3GMNA 4JGUA 2C5DC 1YA5A 2WINB 3JWOC 2MCG1 1HN1A 4JFOA 1G84A 5DJZB 1OF2A 1DLHB 3G5VB 5IMLB 2DS4A 1JNNH 4YHNB 1GCFA 1SM3H 5E8NA 4QTIH 3EFFA 1T1ZB 3BW9B 3MLTA 4APQC 2GIYA 4TPRH 4NJ9H 2HJLA 1KB5L 5ESAB 1MJJA 2YOCA 2IGFL 3DVNA 5C0BA 4GAGL 5KS9E 4N1HB 4XNXH 1PSKH 3QUMA 3KDMA 1T1YB 1DBBL 4XPFH 2ID5A 4K8RL 3GJFA 3VI4F 1FFNA 5D7LD 2EE6A 3HC3L 4U1JB 4NRZB 1DLHA 3G5VA 3WNOA 2CIKB 5BCAA 4KHTH 5J1AA 1I8MA 4U3XA 1TZGL 1UWGH 4HZLA 3GIZL 3IFOB 2NYYD 3KXFD 2JB5L 5DWUH 3DUUB 5C0DB 1M05B 3UDWA 4P3WA 2I9TA 4OD2A 1QFWM 3T04D 5HDLA 3O2WL 3O6FC 2HT3D 3E2HC 5K9OB 2VDQH 5DLML 5DD1H 1P4BL 4D2NA 4NRXB 5GZOD 3MRFB 4FZEH 3ZKMD 3C08L 4HUMB 3AROA 5SWSE 1OLZA 4PRHD 2W9EH 2J8UA 2R0WH 4PJXA 2CDFB 4X6DE 3QEQE 4H1LB 4GG8B 3H2WA 3T3MF 5EFIB 1DBKH 4TQEH 3WMSA 5DI8A 2ZSWA 4ZFZA 1A3RH 3TBYB 1UKSA 3CFKB 3DMMC 5HGAA 2I60H 2J88L 1QSFA 3ZKND 2HJKA 5F88A 4PG2C 1PKQA 2B0SL 2VDOL 2Z31A 4HKJB 3S98A 1CIDA 4UV7H 3MROA 4F7EB 3OMZA 5CEXB 1V3LA 3TNNB 4P5TD 5EIQA 1V8HA 5BOPA 4R8WL 4OGXH 3TO2A 3MV8B 3G6DL 3MSPA 1CE1L 1CU4L 3HNVL 1P9MC 2RCSH 4GXUN 5EU6D 4RBPK 1S9XB 3BX7C 3OQ3B 3LH2H 2HT4D 1N6UA 3I9GH 4W6YB 4HZAA 3V4VL 5ICYB 5MENB 5D96B 5EC2A 2DKMA 4XAWH 1RZFH 3WKML 4XGZA 3SKNB 5LAXA 2C3GA 4WI4A 2VZ1A 1YY9D 4PB0L 5ITBH 3KPSB 4BH8B 3FQWA 3NTCL 1RUQL 1WAAA 4GG8A 4H1LA 4CU7A 4M7ZB 1UWGL 2X4PB 4K2UL 2O93L 3VW3L 3QNXB 5ICXA 4B41A 3SY0B 4GSDH 4PRAB 4Y5YA 5J8OA 3B2VL 3NCFB 3DETD 5BXFB 1FYTA 2A9MH 1CFTB 2Y36L 3CFBB 4WHCA 4R26L 5DUML 4DTGH 4Q2ZB 1M05A 1H0DA 2IJ0C 4H5SB 5L6YL 1C5DB 3I6GB 3MBEA 4J4PD 5F9JB 4Z7UB 1WV7T 4P4KA 5MENA 2OJEB 3BH8B 3SPVB 1DE4A 4HLJA 1GGIH 3B8SA 3CFJB 4U1JA 2BX5A 1RQ5A 3GKWL 5J11B 4KJPC 4MDJB 4IRSC 1YNTA 1IC7L 3FO1B 3SDDD 2Y06H 3F7YA 4HMEA 1BM3H 3P73A 4IDLA 4PJCA 5GGRY 1MRFH 3IJSA 1GHFL 2YA0A 3M17A 4KZEL 3LIZH 3S35L 3PGDB 4LLQA 5DJ2A 4DEPB 3GIVA 4PRID 4RFEA 2C7UB 1EAJA 3TBVA 4BFIB 5EUOF 2IPUK 4MXVE 2R2EB 1RU9H 4OTXH 1FC2D 3RWEB 3H9SE 4GT7A 3LPFA 3G5ZB 3FB8A 4G8IA 4J3OC 4TUKH 2XZZA 4G42B 1IQDA 3GMNB 2G2RB 4BSWB 4ZSOE 5E00A 4OF5A 1M7DB 3NIFF 5FHBH 5IHUL 2W1NA 1HNGA 2J8UB 3UTTE 2JE8A 3MV9D 2ZZUT 4IBLT 2J5LB 5FYLH 1N7ML 2BY3A 2D03L 2X9YA 5FK9A 5GGUB 1BEYL 3IGAA 5DJAA 4YHOL 4YHPA 4LCCC 2H6PB 1T0NA 1KT2A 3VDCA 5FECA 4QOKD 4IHOB 5ALCH 2R1WB 5HHOB 4NWTL 2NY0D 1XF5B 1X5GA 4ZTOH 2ZOKB 4MDIA 5I1GL 4LNRA 4I48A 5B39A 1K6QH 2A9NL 3MOAL 4WUUB 4N5ED 3AB0C 4M7LT 2YXFA 4YLQT 4KK6D 2IQ9H 4P2QE 3Q1SH 4XX1G 4U1LA 2CJUH 2DJUA 3E8UL 2HTLC 5JHDD 5TPWL 1X7QA 3QCVH 1CK0H 1GC1L 1SEBA 5ID1B 4FFVC 4OD3L 2GSIB 4NO3B 4LSRL 1ZT1A 3U79A 1GGBH 1MREL 1S5IH 5ID0B 3K81A 1MCQA 4GKZB 4AQ1B 4JO3H 2P44B 2X89D 1KELL 5I15L 4PLKD 4MAYA 2WANA 4F7PA 3QXAB 3VXNA 4JDZB 2P7TA 3TVMB 5BQ7B 4ZXBC 1CDUA 5EC1A 1YZZA 3TBTA 1T0MB 2DQEH 4C56E 3OKDB 43CAA 2NW2A 2QQLH 1INDL 4PJ8D 1RJLB 5IT2H 1TVHB 1IAKB 2X1WL 4LNVA 2HLFC 5T1KB 5JZ7D 3RZCD 1HZHH 1FZOA 4UOJA 5FHAL 2VDMH 4XPBL 1WWAX 4KXZH 2I07B 4Y89A 3ZT5A 3N1GC 1FDLL 2FBJL 5I1LB 1D5XB 1DL7H 4JG0H 4WFHD 5L88H 1YJDL 3HC4H 3TT1L 3UTZA 2HVKB 4HULB 4MXQD 3GGWB 4WDIB 1HXMA 4IIQB 3B3IB 3L5HA 2FJFB 5D1ZB 1BZ9A 3OKOA 3VFUB 1A64A 4NQCD 5E8DL 3S5LA 1XMWA 1PD6A 1K9TA 1KCUL 2CGRH 4K7FA 3K8LA 1DBAH 4LVHC 3ZE0E 4C54A 5IWLC 4H88L 3W0WA 5GS3A 3SDDB 3FONA 1ZLWH 2DQIH 1CG9B 4TUKL 4G6ML 3OHXB 1FYHB 3V0VB 2XKNA 5IMKB 5JUEH 1Q9OB 4YUEL 4TRPL 1YEJH 4HJGA 3GMRA 4LVNC 4OCNC 1LVEA 4Z18A 3QH3B 4FFVD 5FUOH 5ITFA 3U6RB 4JO1L 4OSUH 1DL7L 1P7HL 1U8IA 5D5ME 3JV6B 5TGBA 2AK1H 2R0WL 3ARWA 5JIKA 1CFVH 5A3IC 1A9EA 3TT1H 4PGEB 4ZOCA 4LSUL 2ITDA 5HI4D 1A1OA 1I9RL 1DP0A 1G7QB 2UYLA 2APWA 2WBJB 3JWDC 5T5FL 1RHFA 4N8VA 5I1GH 4OBRA 1KFAL 2VWEC 4Y4FC 5IW1A 1UWEH 1SVCP 3VG9C 5HYJA 4JY4B 2KZWA 2G60L 5FM4A 1LQSR 3O9WA 1KLUB 3A6CH 4RX4A 3UZVB 3PWPD 3RWGB 5INDB 3FT4A 1IGJB 1RUMH 1TIUA 1YY8A 3EJJX 4QRPD 3J7HA 4XB7A 3KYMB 1RK1A 4LHUG 5DD6B 5IHBA 2GJJA 3M8OH 2ZSVA 3QIWA 4CVZA 2GUOA 4PYHA 1RV6X 3K2MC 3A6BL 4M02A 5BRZD 4HIEA 3L5XH 4OLUL 3T08A 4YE4L 4QRPB 2O61A 1J0JA 2RJMA 1AIFB 4JKWA 1KELH 2CDEB 4ENED 3LD8C 1LE5B 2JJWA 2N56A 2P8PA 2CLVB 5I1KH 2AK4A 2NXYB 3S35H 1AD0A 5ITBL 4OFDA 4APQD 5GRVL 4AEEA 1N26A 5HGBA 4AQOA 1FNFA 5K93A 3I2CH 2WAHA 4O5LH 3RAJH 5SWQA 4ZXBA 4Q6IC 3T3ME 1QBML 2XT1B 1XAUA 1MHPL 5FUZH 1VERA 3AS1A 1BFVH 2QQLL 5GRJL 2K7QA 3L3IA 3CMOL 1CXFA 1BOGA 2ZUQB 4KTEH 2Y6SC 5L7XH 3GSWB 1NJ9B 1ERNA 1NC4B 2BMKB 2NY2D 3MLRH 3T8XB 1F45A 5IVXF 4HS6A 4YDVB 4DFHA 1VSCA 2VO5A 5TE6L 4JFXA 1N7MH 4EDXB 1U58B 4HGWA 4HHAB 3HUJE 3BP5A 2CLZA 1LNUB 4PJGB 2IG2H 4ZUTB 4F37K 5JR1L 2DTMH 2F5AL 4G6KH 2VLJB 3T0BA 2ZUYA 5HHNB 5IJVA 3I6LE 1U93A 1MQKH 2X05A 4PJ7F 1AGBA 4FG6D 4XBPA 3U4EA 2JIXB 1FYTE 2P1YA 3OXRB 3NCYP 4JCMA 1P2CA 1BFVL 3JTTB 5ISZA 3KYNA 4E41B 1MIEH 5C09B 4ELMA 5EIVA 4M43H 5IFHL 2CIIA 4XP9H 3SGDI 1CN4A 4JZNA 2AVGA 3EO9L 4NKDA 5ENWB 3QDMB 1D9KA 1QYGH 3OX8A 4PV9B 2V9RA 3RUGA 4ZFOB 4BH7B 4BUGA 1S9YB 3DOSA 2VZUA 3LPGA 4F15C 5DQJA 1AR1C 1T03H 3DMMA 3DX9B 4PGCB 3C8HA 3N9GH 4QY8B 1JWUB 4PJ9A 5C0GA 2D4DA 2JJTC 5F89A 3MRIB 5D6CB 1JHLL 3MV11 1F6FB 1PY9A 4KDWA 4XWGH 3O2VH 3V6FB 5DJ8A 3IU3B 5CJXC 4ZDHB 5GS0H 2H2PC 3RGVB 3BXNA 4M1GH 1YQVL 3RVXD 3MRCB 3OJDA 4KJWD 3U0PB 1WT5A 1N6QL 3GSUA 4CJ1A 4NUJB 5EDXA 4I2XE 4URTB 4RRPG 3ZO0A 3ARSA 3CXHK 3HE6D 4NQDD 3TVMD 4WU5A 4LVHB 1ZKAA 5I66B 3V5KA 3KPRB 1NGXB 1GAFL 3FRPA 4QGYA 5HYJE 5IOPB 3JWOH 1F4WH 1ZHBA 3B9KD 1LO5B 3CUPA 1AXTL 4LLMB 3HUJB 3GI9L 1D6EA 4F57H 5CLTA 1NEUA 2FR4A 3PJSA 1NC2D 2OJZH 5IW6A 5DO2C 2Z9TA 2GFBB 4PG9B 3G6AB 2OM5A 1NFDE 3MRLB 5CWSB 4Y5YC 5MERA 1BIIB 3NZ8B 4G9FE 3RTQB 4F7TA 1AY1H 1KACB 3VJ6B 1T1XB 4TVPE 5HY9B 5D5MA 3BMVA 1LK3L 3DV6A 4WV1B 4M6MH 2EIBA 5IROA 5E8PB 1NBQA 4ZFOL 2E8YA 3G6DH 3OKNA 4KJWC 4K9EC 2Q87A 3V2AR 2DLHA 4IEFB 1JGLH 4HH9B 2HMIC 2OI9C 2DN7A 4E5XB 2DQDH 3CC5A 4UQ3B 1QFWI 4YGVA 3T0EC 2WBJD 4DAGH 3KPMB 4FP8L 3OZ9H 1G7LA 1HHKB 3TO4B 3VD9A 1AQDA 3MNZB 5E6YA 1IGYA 5EIIA 3V7AG 4DVRH 1IT9H 4L29B 1UM4L 1CK0L 4FFWD 1PGRB 4LHJB 3DGGB 4Z76B 5L88L 1K3IA 3BQUB 5EIIB 3OV6A 4PJEA 3TNMB 3U0TB 1AQDB 3MNZA 4KV5F 3EBAA 2X7LB 2FYYA 4G8EB 1QA9B 2YD2A 3CU1A 2DD8L 3QXTA 3MLZH 3BPLB 4WW2A 3CC5B 3I3DA 1S7RB 3QPQD 1FE8L 2FB4L 1UH2A 2Q1EA 3L5WA 4ZTPH 2J8HA 4QLRA 2YC1B 1I8KB 4BZ1H 1GZQB 2X1PA 2J7LA 3QHZH 5E2TL 1S7VA 3WUZA 3MGTA 4FQXA 3VFNA 1U8QB 1LHZA 4ZPTA 5H94B 1WBYA 2VDPH 1G7PB 1YN7A 3L7FA 3FQXB 2H32B 4TSBL 5I75C 3MC0A 1A4JA 4FQXC 3RUGE 5DEFB 4X7SH 4MLSA 5L2KA 1NAKH 4M8VA 4H8WC 4HSQA 3O6LH 1A3LH 3VU2A 3QSKB 5HGHB 2R39A 5I71B 2P24B 5CGMA 5FFLA 3MNVB 3Q6FA 3RL1B 1T2QL 4P5MA 3MRNA 4PJ7E 2R9HC 3W2DL 1CDGA 1KV3A 1O7SA 4OI7A 4U7KA 2FX7H 1DQQB 1A7PH 2ZPKH 3MRHB 2Z92B 1J0IA 4X5WB 4JO4L 1W2KT 4OGZA 5E8OA 3QT2A 1BM3L 3FTGA 2VDLL 5JOFA 1R5WB 5LGKA 2CKBA 1GHFH 3E6FB 4KZEH 5J57B 1F3JA 4JFDD 3QXWA 4ZAKB 1JYVA 1P84K 1F4WL 4WJ5B 5IQ9A 2WUBL 1S7SA 1TZHA 5TFSH 2YRZA 1HI6B 3ILQC 2EE2A 1X3DA 3GHBH 3U0WL 4JFED 4P23D 3P3YA 4RA3A 3T2NH 4KRNA 4Z95L 5ELIA 5C07D 3H42L 5F7HA 1OTSD 2F9BT 1DTUA 1FL5B 2JJSC 3MV8D 3O6FA 4O02L 5C86A 3KPNB 4XPFL 1VEPA 1ADQH 3HZKB 4NKDB 2DIBA 4H20L 4MS8D 2FZ3B 1YPZE 4PGDB 3LS4H 5I8KL 4RGMC 5GRXG 3HMWL 4KHXH 4ONFH 1KLGB 3RY6C 5C1MB 4NP4L 4OM0H 4YHKL 1CZ8L 1ODAA 3FOMA 2WIIA 2Y72A 1XCTB 4MNQA 3TN0A 3JTTA 1I85A 4WTXA 3N1MC 2MOVA 3OXRA 2VE6A 1VFMA 4GQPH 3C2AL 3GMOB 5F6IC 3OGOE 1BZQK 1JPTH 4ORGA 3VGHA 1EEQA 4PFEA 1RIUL 5CUSH 2A9NH 4HAFA 5BVJB 4MJ2A 3BIBX 1FN4A 2DIAA 4PRHB 1CBVL 1MHEA 5JHLH 3QEGH 1A02N 4LLYA 2FO1A 2VLJA 3IAPA 2BVPA 3ZL4H 3RHWF 4ZUTA 1N4XH 4XH2B 1M7XA 4K3DL 4YFEA 3WL9A 8FABB 1A1MA 4DN4L 4OZHF 2BNRE 4ZQKA 3V95A 4AEIH 1BEYH 1P7KB 2ICEA 1GC1C 4TSCL 2KQMA 5D1QB 2X5PA 4RAHA 4NZTL 4LDLB 2BMKA 2XACC 3D25A 3QDMD 1DBBH 2AV1B 3P11H 4R4FL 3BO8A 4BYHA 4QXTA 3TYFB 1U8NB 1ZHNA 5D7SH 4X4YA 2NX5D 1D7FA 2R2HA 1UC6A 5ETUA 1HHIA 3VMPA 3FFDB 3V4PH 3ZKSD 1HI6A 2R29L 1B0GA 5I30L 1MOEA 35C8L 3SKOA 4ELKA 3QEUA 3FO2A 1INEL 4NIKB 3EUUA 2X4NB 4XHQA 1S9KC 3CLEH 1OCWH 4K7PX 1AE6H 4HWZB 1BOYA 1JUFB 2QTEA 5IJKA 1A3LL 2ITCA 3GFUA 3WIHH 1D5MA 2VDQL 5DLMH 4YR6A 5INCB 1QZ1A 3SDYH 1UZ8A 1JWMA 4CVZB 3QEHA 1FGVL 3W0WE 5JOPE 1NFIA 2YUWA 3IDIB 3Q6FB 4XMPH 1A8JH 3NIDF 1TCRA 3DRQA 3MCKB 3RVTD 1KLUA 4UT9H 1QHOA 5L2KB 2EICA 1TZIA 2JLLA 4XPAH 3N85L 4U7MA 4OLWH 2IQAA 7FABH 4ZXBD 5D93B 3L1OH 3B2VH 4KK9C 5I1DB 4TOYH 1JV5B 5DJYB 3CLEL 2GTWA 3FJTA 3UYRL 5I75B 3QIWC 4Y88A 5F7NC 1G1YA 1PLGH 1QBBA 3EFDH 5AD0B 1ORSA 2GK0B 2OTUB 5I8CB 5KG9A 3T65A 4Z0XA 4KPHH 2XY2A 2FHCA 3I02B 4LSDA 3RTQD 3FHQA 4V1DE 5MEQB 2EYRA 2FYYB 3JV5A 1BX2A 3KYOB 1XGPB 1I7RB 5KJRL 4OZFH 4POZD 3BE1L 5KZCB 1T2JA 5AUMA 3MRDB 1QFHA 3ULVC 3SDDA 1UYWL 3ALPA 3NIGE 4U0QB 3IXAA 4NKMA 4NKIH 1Q94A 2Y07H 4MB5A 4LCCA 3CSYB 4LLAA 1EAPA 4OV6F 5D6DA 3BQUC 1BF2A 1S7WB 4OFIA 1A7OL 3DV4B 3TA3A 2NNAB 3HG1D 3RL2A 3WYRA 1PY4A 1WC7B 2NTSP 4IIQA 2Y36H 3D5OF 3TWCH 3WLBA 2OLDA 3BIKA 3VXSA 1LDPL 1LK2A 1QFWH 3FQTA 1W0WB 1IEHA 4X6CB 4JQXC 2X4QA 1B2WH 3P9LA 3QZWG 1QO3A 4G9DB 4HBCL 1A7PL 4XCNA 1E4XH 2YK1H 4RDQG 2YD5A 5D72L 4HKZB 3P77A 1FPTL 3DX8A 3BN9D 1B0RB 4D8PA 3BHBA 1MPAH 2XICA 4G8FB 4FMKA 4XVJL 2BVQA 1VFBB 1KIQA 3PJSB 3OSKA 3VFRA 3SE3C 2V7HB 1QVOB 2AJSL 4OT1L 2E27H 4PLJC 2HWZH 5CBAA 2H32H 5KVDL 4JB9L 4TOYL 1GPOL 3NFPA 4RISH 3IS0X 4HG4J 4Y2DA 4B7IA 1DZBA 1Z3GL 4PTTB 3OKEA 4NM8L 5KS9F 3OR7B 2HH0L 5CJQL 4NKOB 3IETB 4PR5A 1F11A 5HYQB 2P47B 4UNUA 4E41D 4XP6L 5I66A 3CNKA 3UTTA 5JPMB 5I9QB 4WU5B 5E5UB 1S8DB 4W70A 4QNPF 1DJSA 3RI5F 2MCPH 2UZYB 4XCFH 4R96A 4GKZA 3VXMA 2QQKH 2B1AH 3GB7B 4OLVH 3PNWB 2E6PA 1DBMH 2HT4C 4NJ9L 5C6TH 4KMLB 1U8HB 1JYXA 4OKDA 2L0DA 1G7HB 1QLRA 1YYLH 3BE1H 4GS7B 3RZCB 8CGTA 5E99H 5FCUH 3QUZC 3ARVA 1WQVT 3VDBA 2VOTA 4FXKB 5C0GB 4DKFL 4GSDL 4QY8A 1JPGA 5DMJB 2PYFB 3VMNA 2RBLA 5CEYB 5EULV 1PJ9A 4JO4H 3L3DA 3TFKC 1DQMH 5E4EC 1JRHH 1OB1A 4WFED 2XTJB 1G9NC 3VD5A 3FOLB 4YK4C 4LNRB 3CIQA 3PQYB 1VGKB 3NCJH 4RRPA 2X9XA 4IHOA 5C09A 4PJHF 5C0NC 5M94B 1UFUA 3S3JA 2A73A 5GS2H 4WI9A 4FNLH 5CFHA 1RVFL 3IDNB 3STZA 5ADOL 4BZYA 1TJGH 4XBPB 4U05A 3VD3A 4APQB 1JHLH 1JRHI 2DM3A 4X99B 3VH8A 1YEHL 4UAOB 1I1CA 3MA9H 2XFXA 3N9GL 1YC7A 4OAWA 1UB6B 5D7IB 4C83A 4G8IB 3FB8B 4G3YH 5JIPA 1T0PB 3WNLA 5B8CB 3BP5B 3ABZA 5DK3A 2YRLA 2PKDA 3C5JA 4DWHA 5HYSA 4XZUA 3F7QA 4NO5A 3RP1A 3V6ZA 3GIVB 3O4LD 3OR6A 4EN3C 4LF3B 1NC4A 5CGYD 5GHWH 1AXTH 2X44D 3PV7A 5AYQA 1AR2A 1HINL 4D9RE 2Q86A 2I9LB 2NY0B 1YPZA 3G6JA 3LQZA 1F4XL 2D0FA 5GGVL 4CMMA 3TV3L 2O5XL 3VG0L 4ZXBB 5SWQB 4JN1H 5IK3B 3D0VB 2OX5A 5CKGA 4AEHH 2JK5B 1ONQB 5CIPA 3M07A 1MLBB 1U2HA 4YDLB 2R1XB 1RJYA 1EO8H 2MHAA 1AP2A 3OGCA 4JREB 5HXMA 5FGBA 4MJ5A 4QCIA 1FLRH 1FYTB 1OP9A 1CGXA 1RZKL 3B2UD 4W4NA 5E8DH 1P4LA 1AFVL 1TTUA 4OUUA 4I0PD 3ZDXE 4MD0A 2KDGA 2R4RL 2D7PA 2NXZC 5CZXD 3ROOB 3HFMH 3WFEH 4UIKL 3R8BB 1GGUA 3OKKB 2QLVB 3QULA 4BSJA 1FGNL 5ADOH 3U4BH 3QJHA 1E4WL 3OAZH 5IEKB 1J0YA 3C2AH 4YHIA 3C5ZB 3QXUA 4KPHL 1IM9A 4RMRA 4ODXB 5F44A 4PJHB 5ECJE 5I8OH 2PYED 5D1ZD 3ETBF 4PGBA 5F8RC 5EC2B 5DVOA 5C8JB 3UROR 4NJAH 2YWZA 25C8H 4YDIL 3PV6B 3T4YB 3RZWA 4ENEC 3ULVD 5GZOC 3MRQB 1ZMYA 4ZOEA 5DR5H 4WO4C 4PGEA 3PWUA 4KRMB 4L4TB 4XBEL 4Y7MA 3DWTA 3V0AC 4DKFH 1ZA6B 3F5WB 1FG2A 2A6DA 1XR8B 5E9DB 3QH3A 3N85H 3AAZB 3BP4A 4U2ZA 3DI2B 2LAAA 5IMKA 1HCFX 3EDEA 4QGTA 3P4NA 4QF1B 3L1OL 3PGCB 2QKIB 4LSQH 1UXSA 3AM8A 1K8IA 5FM5O 5DI8B 3HE7A 4JRWA 3KPSD 1L7IL 4PJFF 1EX0A 4NOFA 3QBTB 1XZ0A 3S36L 3G5XA 3SGEI 1BFTA 4JN2A 3WIFA 3WUWG 3CH1B 3HRZA 2DI7A 3GBML 3MRFA 2F53D 2ZPKL 4TPRL 1D5ZA 1I1AB 3WEXA 1AC0A 3LPWA 3W2DH 4CVWA 4RMQA 3MLSH 2AJSH 4XAKE 4I5BA 4JHZA 1JGVH 4OD2B 4N9GA 4OFYD 1FL3B 5I1LA 3G5YA 3K80A 5L0QC 4YXLH 1VKXA 1A14L 1RHHA 3X3FH 4LBEB 4DK6A 2HLAA 4NQVB 2CIKA 3PWJB 3MBXL 3GSVB 4P23B 3QZWA 1DQLL 3W5NA 1OQOA 2XXCB 3PHSA 2GK2A 3TJHD 1OSPL 3KDMB 2HT2C 3MJ9A 2L7JA 3LKQB 2UVFA 4LCWA 1MJ8L 5D9SB 2WWMC 5FYJH 1J8HE 1FZMB 1MEXL 1QACA 2HJLB 2DQUL 4LASL 5ESAA 3UJJH 1B4JH 1G6VK 3GRWA 3KLAB 3O2VL 4XBGB 2NR6D 5GGTH 1ZHKB 1IILE 3RGVD 2HYMA 4MVBC 5TE7L 4X4XA 4BK5A 4JVWA 3E3QE 5EO9B 5FA3A 1T3FA 4XPGL 5GGVY 3AREA 4JFOB 3MV9B 5EU7E 5GZND 4TQEL 5JW3L 3WO3B 4U1KA 4OT1H 3KXFB 3FAXA 4M7LL 1X7QB 4KHXL 2HRLA 4J8RA 3ZDYF 5HHMD 2YD8A 3FO9A 3UBXB 1M7IB 1K8DB 3NA4A 3VFMB 2EYTA 3TYGL 1IEBA 4UILH 3VRJA 3ZMRA 1VKXB 1NGZB 1AGCA 2AKRB 1ACZA 4KVNH 3LQAL 1HILA 4OZIE 4N9GB 3MFGB 1HSBB 1KJ3H 2AJYL 1MRDH 4Q0XL 1WWCA 5C70A 2B39A 2H6PA 2BNQA 5HDQH 5KOVC 3BPNC 4HPYL 3RWHA 4DK3A 3IGAB 5DJAB 4Z7OE 4NZDA 4Y5XB 5I8EB 3EZJB 2VXVH 3CFEB 1FV1A 5MEOA 3TVMC 1WIUA 4M5ZH 4XNYL 2DQHL 2P49B 1WF5A 3BUYA 3BWAA 4PRDB 4EI5D 4OLZL 5E00B 3QO0B 3MBEC 3PP3K 4UBDD 3ARGC 4OZFA 3CFDB 3O11B 5A16A 4E42B 2MKLC 4UB0H 3DYMA 1JWSB 4QEGA 1EEYB 1IAOA 1QFUL 3EYOA 3JV4A 2GJ6E 4ZO6A 5BO1H 5DK0A 1QSEA 2XXMB 3BKCL 3BMWA 1HSAA 4MQ7B 3WD5L 1Z5LB 3BEVB 2VKXA 5DZOA 1YEJL 3JXAA 4YO0B 3REWB 1Y6KR 3FO1A 4MAUL 1LP9E 2VERN 1YNTB 5JW4R 2XV6B 1KCVH 4TTDC 4RIRA 4EKXA 1ZLVH 1CFNA 4GRWF 3SDXB 4WRLA 2E6JA 4XPAL 3OPZH 4GW4B 4ODXA 3RKDD 5EU7C 4JPWL 3KLSA 3AXLA 1SBBA 1RUPH 2DQCL 5KSBA 2AEIT 1UKQA 5FO9B 5D5MF 1CXKA 1X5XA 1B0WA 3OKKA 3SDXA 2XWJA 3P0YH 3EO1A 5FDWB 1VA9A 1OP5K 4Y5YB 2H41A 2PO6A 2AV7B 4KKCD 3SY0A 4X98A 3K74B 4DW2H 4XCYA 4YWGH 3MCLH 4ZSOB 3DPBA 3NFNA 5CUSL 4NCDA 4DGVL 2EDJA 1SYVA 1OW0A 2AS5M 1JZ4A 4LHUA 5C0IA 2VQ1A 5LAXB 3LKSB 3PUCA 2YA2A 1AI1L 3AY4C 1UM4H 3MMEB 1K3ZA 2Y5TA 4RFNC 1MLBA 2V5YA 3CDGB 3NVQA 5CIPB 3ARDC 5AAMA 2JKXA 3QXVA 1A7NH 5I15H 1A6AB 2EDDA 5CCKL 2X4OA 5E9DA 3UAJD 4JPKH 2XWTB 3STLA 4GJTB 4NZUL 1TNMA 1J12A 2NLJB 1XIWC 3QO0A 2OQJB 3PIQA 3CAFA 4X98B 1U3YA 3O6KH 3MLRL 1KTRL 3OR6B 5TPWH 1XF3B 1Q72L 4XZUB 1A6WH 3D1MC 2EH8L 1UG9A 3C5JB 5FO9A 3WHXB 2HN7A 4YHIB 1HILB 3ZYOA 3UEZA 4FTVA 2E7HA 5IEKA 2VC2L 2DI9A 3BD4A 4MCZB 3QDJD 4I77H 2JIXD 1IEBB 3RY4A 1PZUB 5B4MC 2QEJA 4JZJA 1KYOK 2FX7L 4BA8A 4KKAD 4OFKA 5D1QD 1CWVA 1RUPL 2DQCH 2OSLB 3FCTB 1U3HB 1CZ8H 1FVCA 1KN4H 1Z9MA 1UH4A 2FEDC 2YEZA 4NZUH 5GGSB 2DQIL 1FAIH 4X80H 5SX4I 3TC9A 1GJIA 4Y19D 1AP2B 4GXUM 4LQFH 4MQ7A 5EU5B 1CL7H 3PQYA 5H35B 5DK0B 3SKMA 2NY2B 3MV9A 1ZT4A 3CSBA 4ODTH 3BKML 3VWJC 1INQA 1Z3GH 3BSZH 3RPIA 4WCYH 3GK8L 3NOIA 4ODSL 5EO9A 1V3MA 3L3DB 3X13A 4E42A 3T0ED 5A16B 4F37F 2VUOA 4N0UB 3CDCA 3QUMB 3G6JB 4XBGA 1IM3B 4MQXC 4FQCL 2MFNA 3IDGB 2PTUA 4M6AA 3VXPA 3PWVA 1MI5B 3DVNB 4PD4K 3P4OB 4J6RH 2EDYA 5SX4H 4X4ZA 3CLFH 3VI3F 1WJ3A 4M7LH 2NXYD 3LKNB 1ZTXL 4M48H 4WO4B 1LEGA 2J4WH 1JZ6A 2BNQB 1W8NA 3CH8A 5BV7B 4C55A 3P9WB 3GSXA 1T5WB 5B8CA 1A6PA 3EYUL 1M71A 3FB7A 3MFFA 4GRLA 1OT2A 2E9JA 2OBGA 3EJYD 3O6KL 1NGZA 2AKRA 1YEGL 5I30H 4PJFA 4OFPA 3QUKA 3NIFE 1MUJB 4A2LA 3JWOL 3FFCD 4OGXL 5DRXB 4WUUD 2RB8A 1K8DA 1C5CL 1CE6B 1KJ3L 2EDXA 1A4KB 1G9NL 4U1MA 3LZFL 3BT2H 1J05A 5L6YH 3HLAB 3IVKA 5MI0B 4U1KB 2VN7A 3VXSD 3VGGA 3HC0A 2O5YL 2NX5A 5BV7L 3SJVA 5C0CD 1QO3B 4P4RA 1KCSH 1UM5L 3FOLA 4U6YA 4M7KH 4NO2A 4H25B 1YJDH 3IDUA 5HHME 4JRXE 5T5FH 1K8IB 3NCMA 3B9EA 2W0KA 2QKIA 5JXEA 3LEVL 1LK2B 3FQTB 1CDJA 3FN9A 5JORA 4E0RB 2R1YA 1ZHKA 2CUMA 1CL7I 1QBLL 4PD4J 3RIAK 3LHPH 5HYEA 5IFAH 4Z7NF 4G80A 1KF9B 4RSVA 5F9OL 2HT3C 1QLRB 1NQBA 5EUKA 4YHLL 5F7UA 1BJ1H 2R0ZH 4LU5L 1OM3L 1T7XA 1XGQA 4PJ9D 4JPVL 4L4TA 3OWEA 5ACMA 2EDTA 4RNRA 4KUCF 4RAUB 4FP8H 1PAMA 1P84J 2XTJE 1Y18B 1OGTA 3D39D 4N90D 3VMOA 2UY7A 3NH7L 1CVRA 1RMFL 3IETA 4PR5B 3AM8C 3C5ZA 3O2DA 3LKOA 5SWZE 2XQYG 4Q97A 3STBA 4NCC2 2A1WH 4PY7A 4LVEA 4ZYKB 4YPGA 3T65B 1EZVX 2DTML 2F5AH 1T4KB 1NANI 2P43B 4L9LB 3WEXB 4KTDH 4XTRC 3ME0A 5EA0H 1SY6H 2JJTA 4JG1L 2V9QA 5DUPH 5HPOA 5IGXH 4ZPVA 4D8PB 5CSBA 5DJDA 4YWGL 1L0QA 3ARUA 5EO1A 5FB8B 5L7XL 3AUVA 3MXVH 2EE9A 3V4UL 1R5VB 4XNZC 3S8WA 3B9DA 3R0MA 3Q1SL 1GOFA 2AJZB 4HG4K 3T0VA 4KI5D 3BRDA 1CLOL 1WCQA 4XVTH 3I75A 4I3RH 4GMTH 4XP4L 3QQ3B 4S1RH 3GHEH 3HMXA 4U6VH 4WHYG 4AENA 3FMGH 1ZA6A 3WJLC 2X1QA 5T33L 4JANB 3ZTJH 3O4LA 3T4AB 4XRCB 1MRDL 1TJHL 5TF1L 1E4XI 2C3VA 4LSTL 1MVUA 2XA3A 3VRIB 1SJEA 1MF2H 3JVGC 4PJ7B 3GZKA 3MRQA 1RZKH 3ARRA 4Y5VB 1IZKA 4H0IA 4H1LG 3ZKXB 1I75A 2VH5H 2R56L 1H3WM 2DBLL 5HHPB 5C8JA 4PGBB 4HWBA 4PJHA 4XX1E 1WISA 1WLHA 3KYOA 2VDKH 4IOIB 5DRWB 1W8OA 1VACB 1T80A 3QJHB 5J4MA 3VWJB 1UB6A 4JPVH 5D7IA 1BWWA 5IROC 3B6SA 2QJDA 4G6JH 2YD9A 3HE6B 4WI5A 5JDSB 4WWKB 5BZWA 4ZFFB 1NBZA 3LS4L 2NXZB 1X5JA 3TEUA 1SHMA 3MLWH 5I1DA 5HGGS 2A73B 2EE3A 5E99L 3REVA 1T89C 2B7DT 4O02H 2KPNA 4NFCA 5DD3L 3Q6GL 2R1XA 1WIOA 4B7LA 1JNLL 1X6LA 4KTDL 1CD1B 2XOTA 1GSMA 1MI5E 4JQIL 3VFWB 1J9CT 2DQDL 1ONQA 5C0FA 3VCLB 2PW2A 4JKMA 1U8LA 4WEUD 2AXJA 4Z7WB 4GXVL 3BZ4B 2D2OA 3C9NA 5D1XD 1EEZB 2IFFL 3C6LA 4UBDC 3EOAB 4OLYH 4LPUA 3OL2A 3QPXH 3K4ZA 5SWZA 2Q3AA 1T7VA 5E03A 5F9WC 1TJGL 3LEXA 3VE0B 5A2LH 1G7HA 5D7LB 4DFIA 2ADGB 3JSSA 4FNLL 2QQNL 3LV3A 1BD2B 3ZDYE 4I18C 2DQGH 4ONGH 4LF3A 2GHWB 3VXMB 2FZ3A 1KJ2A 1I8LC 2DYPA 3MA7B 1HKLL 3PL6B 1EMTH 3U7YH 3EHBD 1FCCA 3RJQB 1DVFB 2VSCA 3QEUB 1I9IH 2BY1A 4I8DA 2FO4B 2HKHH 4F2MA 1QSVA 1K85A 1U8PA 4AK1A 3VFPB 4PJBE 3OR7A 5C0EA 1KG0A 3BRFA 4JFDA 1U0QA 4MNGE 3TGXA 1DUZA 5I76B 2XN9E 1EBAA 3B5TA 5K9JL 4POUB 5EZOL 4TUOA 3U46B 2JJSA 4LHQB 2FGZA 3TM6A 4WJ5A 5IQ9B 1LDPH 2OYPA 4BKLA 2EKSB 2H45A 2M1KA 4PJAB 2HTLD 3MR9A 3IU4H 4G6MH 1R5WA 1F90H 1NCCL 3NA9H 3WL9B 8FABA 4X7DC 5JUEL 4X5WA 1NCBL 4FFYL 5J12B 1FO0L 3SDYL 1B4JL 2Q3ZA 3C6LC 3V8OA 4ODVL 4X6CA 1EFQA 1A1NA 1KB5H 2PYFA 1NGQH 3OAUH 5E9DE 4FXKA 5FM8A 5IB4B 5DHXB 3WSQH 3X11A 4OI8A 1ZS8B 4WY7H 1T7ZA 2IMNA 2NNAA 3RL2B 4MA1C 4QXGL 5DEFA 1QFUH 2D0GA 4OF6A 4HUVA 3L7FB 1K6QL 3TPUB 1GL4B 1EJ6A 1YUHB 5E5RB 3U30B 3QCVL 1XEDA 2XQYK 4QT5B 3NABH 1L7IH 4LFHD 4D3CL 3O2WH 3RBGA 2YN3A 2XNAA 1BPVA 3WO4B 2NY3B 3VXRB 2AABL 3L5WB 3AGVA 4QTHB 3ZZ1A 4MNHB 4R3SA 2FH8A 3FKUS 1ES0A 4PB9H 3S35X 5JXAH 1HHGA 2R0KL 1V7NH 4NQCE 1J0ZA 5F1IB 5ALBH 3LEYH 1F3JB 3S97C 1HNFA 3BQUA 2D31A 3LN9A 4LSPL 4NUGH 5E8OB 1AQKL 1RPQA 4XCNB 4UOW1 4NFBA 2HWZL 3BZFB 2FL5A 3CSPA 2RFXB 5JW5A 1JGDA 3LHPL 4QRSA 3S34H 2B4CH 5T3XH 3FO0L 3X3GH 5TH2B 5I2IB 1NBVH 3RIFK 2PETA 3SO5A 3WIIH 1TJIL 2DLGA 4YFDB 4KKCC 1KJVA 5D71L 4PJXF 1A0QH 3GSQB 1BAFL 3IDIA 5FF6B 2VQTA 2J8UF 3W9DA 3KLHD 4NM4H 5IBLC 4JFDE 4L3CB 3W39B 3ARXA 2ZCLH 5C9JA 3G04A 4Z95H 2ITCB 4IMLB 1LD9A 3DRTB 1G7PA 1IE5A 1OTUD 1TLKA 1FZJB 4F7MB 1RZFL 3SGEH 2MQ0A 3UTPD 1KIPB 5DJCB 4JZJC 4EEEA 4KROB 4DOHE 4TTDD 3MGTB 4FQXB 4XHJC 3G6AA 1L0YA 2X4NA 4LLVB 5GGRA 4K23H 1VPOL 2HRPL 5IWLA 4JE4B 1WGOA 1XGPA 3TA3C 4TSCH 1G6RH 3L3HB 4H88H 3SKOB 5LXGH 2BNQE 4OGAD 5JTWA 3HZVB 3L3KB 5J6HA 3KYKL 2LU7A 2DWDB 2OR8A 3CGTA 4Z7WF 5IOPA 4JHWH 1OGAB 1QPXA 3O6MH 3LRGA 5HI5C 5IVXE 5D71H 5K33A 1BJ1J 5CS7A 1CGVA 2QR0B 1P7KA 3DBXA 3HI5H 4Y5VC 3E3QC 3PWPA 1QEWA 1A1MB 2V5MA 4M5YH 1W0YT 3B5GA 1QFPA 5CZVL 2IC2A 1HHJB 3VGBA 2BSSA 4LDOB 3PHOA 2FDBP 5EO0A 4RQQA 2DL2A 4LCYB 3C6SA 3TF7C 5DUBB 5DFWH 5BVJA 2VC2H 4M1GL 4XNYH 43C9A 4U6XB 1MRFL 4EI6A 7FABL 4NNPL 4P57A 1TQBC 1X5YA 1KTDA 5IFJB 3K8MA 4KZDL 3RVWD 4GOSA 1B88A 4LAJH 1BVKA 4UDUB 5DMKA 4S10A 5IJKC 4ETQB 3R1GL 1G9ML 3U1SH 5KVMC 2ZUVA 2ERJC 5D5MB 1FBIL 1E4JA 1CTOA 3UZEA 1TNNA 1BIIA 1BQHB 3LB6C 3IB4A 2VXSH 3V5HA 4Y4HD 2ZCLL 1E6OL 1HCVA 3HZKA 1EIBA 5FYJD 5IKCB 1F13A 3QUYD 2M2DA 3KYAA 4CADB 5F7LB 1SBSL 2LVEA 3ZYZA 1S7TA 5D2LF 1VADB 3UO1L 4OIAA 4L8CB 3ARQA 3DTXA 3UTSB 4KUZL 1PLGL 3EFDL 1KJMA 2HFEA 4JY5H 4YDJA 5I19H 1JFQH 4ZFGH 4PS4H 4YBLC 1YY9C 1BLNA 1RSFA 1B90A 1MHHB 4YIQA 5D1QA 2BXZA 3DNKA 1P6AB 3DUHA 4XPGH 2QBWA 3MLXL 4JDTH 3PF2A 4WEBL 4WUKH 5TDPB 4YIQB 1JK8A 4HS6B 3P11L 4XH2A 1KB5A 1P1ZA 2MQCA 3HAEG 3WFEL 4UTAL 2IALB 4OLYL 3RWDA 4QNPE 2VH5L 3WUWB 5CJOH 3MUGB 1ZLUH 3L3KA 2YSSA 4HDIB 3MXWH 3GSOA 4LPCA 2CDGA 1DQJB 1FP5A 2V2XB 4IRJA 3RHWK 2FJGA 4ODWB 4HLZG 1ZT7A 3V5HB 1D9KB 3JWDL 3QNYA 3OG4B 1KLGA 5CAYB 2BSED 1A4JB 1G7IB 1A14H 1QTYT 1YN7B 2MTPA 5DFTA 4QXGH 3S4SA 3VRLE 4H1LH 1EV2E 4QOKA 2IAMD 3MODH 3OXSB 1Q38A 3SN6N 4DGIL 1U8QA 3LS5H 1S7VB 3ZE2E 5DRZB 1U6AL 2VXUH 4EI6B 4JPWH 1OP5H 2P48B 2VIRB 2CH8A 3ARDA 1LP9B 4TVPH 4K3HA 5BOZG 4X4MA 3P0GB 5I2IA 1CICB 5DMGC 1FGNH 2PXYB 2OZ4A 2X40A 3SCMD 2WWMD 4U1IA 1LNUA 2KUTA 2A6JA 2EH8H 4JRYB 3HG1E 4MXWL 2BK8A 3DGGA 3P4LA 4Z76A 5B38B 4JKPH 1F97A 1SVZA 4L29A 2WBJA 1NUNB 4UMGA 3WD5H 4RGNB 4DVBB 1HHKA 2MPAL 3V52H 5FYKD 5T3XE 5H2BB 4MA8L 3CVHA 2F54A 2APBA 1F58H 3QI9B 4Y19E 5CD3A 2IAMA 3S88H 1Y0LA 3RY6A 4X8JB 4YXLL 4QXWA 1E4KA 3GMRB 4FQQA 4JFYB 1HXYA 5FOJA 5CSGA 2Q20A 4JB9H 2XKNB 4X8XA 2AERT 3H3BC 5DJ0A 5E8PA 1AD0B 3VFTA 2AK4B 1Z0MA 4XWOD 1URLA 5FO8A 2DQTL 3ARYA 1T1XA 4FQJH 1YUHA 5CEZD 3DRTA 3EYQD 3TPUA 3VJ6A 4HUVB 4HIEB 1WFNA 5DEZA 2BP3A 3W39A 4IS6A 3FRUA 4XCEB 1SBSH 4HUNB 4J23A 3W11C 3KYMA 5E56A 4ZS7L 1U95B 1CXLA 5E6IA 4ISVA 3GGWA 5IVNA 4CVXA 5F3HA 5E1AB 2ZG2A 4N0YL 1KBGL 1XGTB 4OIIH 1S7RA 4ZUUB 3OJVC 4UDTA 1YEDA 4JKLA 3RJDA 4JFFD 1J88A 5IHZA 1QA9A 4R4FH 2RFXA 3GHEL 5EB9A 5JW5B 4NC2B 3KXFE 5HVFB 5J3HD 1QKZH 1ULVA 4LAQL 3DETC 3TA3D 1R0AH 2I07A 1QSZA 1J1XL 1LEIA 2BNRB 3VA2C 1G1CA 3ZT6A 1SJHA 5BZDB 2WK2A 1YEGH 2P5EA 5HD8C 1R3IL 4NUJA 2W59A 2DM4A 3TO4A 3UC0L 3ZLQC 2G60H 2H9GB 5A2KH 2C4XA 4U1IB 3TV3H 4PBWD 3KPMA 2VAAA 5T3ZL 4KKLD 5DDHB 3IU3A 5CHNB 2F8XC 1UT9A 3DI3B 2PYEA 4OZGF 5IBLD 5K59F 5C0EB 1R3KB 2Y23A 4MA7L 5DYOB 5F7EL 4NDMB 1D9KD 2VNCA 3HR5A 4PJ9B 4FXGB 4FQCH 3BOVA 4X7TA 4WV1A 1A5FH 5DMIH 4GG6B 3BKYH 2AK1L 2EO9A 3QI9C 4AJ0A 1G7IA 3NZ8A 3RTQA 5FYJU 4YXHL 2GAZB 4FRWA 4JM2D 5LXGL 4MJID 5E7BA 1BD2A 3C5ZC 3JWNC 4XMPL 5T1MB 2DTSA 4UQ2B 4OGAC 3PABB 4QXUH 1AGFB 4CUCA 2ZKHL 1IGIL 2IFFH 3MV7A 4X6BA 4OM1L 4YFLI 1KIRA 3RA7L 2BFVL 5FEBA 3BPNB 1KOAA 1UGNA 1A1NB 3O3BA 3D0LB 4AG4L 4LLWB 4P9HL 5C0FB 5HHNA 5IJVB 3WUWA 2IALA 4M7JL 1ED3A 1QSFE 4OCXH 4Z9KB 1CD1A 5EZIL 4KJQC 4LGSB 3VXUB 5AYUL 2X10A 2K1MA 3MV01 3DIFB 3MR9B 1IVLA 1JNNL 4PJAA 1PW3A 4G7VH 1TFHA 2DQGL 3OKLB 1MH5A 3KJ6H 2FX8H 1WTGT 1YPZF 1BLNB 4IJ3C 5FUCE 4AT6B 3NCYS 4NN7B 4I2XB 4QYOB 4F80A 4Z0BH 1MCRA 4M61B 3K3QA 2YBRB 2VJXA 4EUPA 4L8CA 2IH1B 1NFKA 4OCLC 3VFPA 2VABB 4HFUL 3HNTH 4JDZA 3SGKA 5KTEL 4S2SA 3ULUD 4CNIA 2CRZA 3HFML 4NQSB 3TJHC 4QWWD 3HTLX 3PL6A 1CGUA 3OX8B 3QDMA 1E27B 5EPMA 3MLUL 4OCMC 5HHPA 3H42H 3HB3C 4I4WA 5I74C 1LE5A 1OAXL 4LMQI 1YMMB 2CDEA 3PGDA 4FS0A 1RFDL 4JQXA 3HRPA 4QRPA 2O61B 3QDME 3C09C 3SGJC 4EBQL 5DMKB 3VD7A 4X5XB 3DURA 3GUTB 4G6JL 3C87A 5B22A 5IG7A 1FZKA 4X6FB 4P2RD 4M62H 3R06A 3WFCH 1BBJA 2EC8A 4XT1C 3IAQA 1C5DA 3I6GA 3MBEB 3ULVE 1HYSC 4RGNE 1FNLA 5EO0B 2NY1D 4HK3J 2IPTL 5LGJB 1XF5A 1HHJA 2CK0H 4QWWC 1H0DB 4M7KL 5L8KB 5T1DL 3REVB 2CLZB 1SMAA 4WEMB 4N0UE 2R8SL 4I13B 4GW1A 3GK8H 3SE4C 4P48A 3LQAC 4OCSL 3B83A 3PDDA 3BPOB 3GSRA 1JL8A 2AJVL 3VXMD 3GSWA 3Q3GA 3X14A 3FRPG 3RY5A 4HIHB 1LO4H 1BD2D 1FO0H 3ES6B 2BZDA 5DS8A 3IDYB 3C6LD 4TVPD 2FECI 1QQDB 2VZVA 3HPJA 4QRQB 5C0AD 1I1YA 1KGCD 1AHWC 1OSZA 2GJ6B 4FG6C 2D3VA 1MF2L 5DRWA 3SHSA 2R2EA 1NCNA 4Y1AB 4XVUD 4NN7C 4S1SH 1MAJA 3ULVF 4RAUA 2WV3A 4ZUWA 4HC1H 4TNWK 5HYSG 3W0WB 4WTZA 1P7QA 1LD9B 3UCRA 4JFZL 3G04B 1SJEB 5A2JH 1A6ZB 1WZ1H 3DGCR 2BOBA 3DX6A 1XF4B 4LDEB 1A6WL 3GJEB 1RU9L 1I3RA 4POYA 1WZMA 1QLEL 4NO0D 1I3GH 3S34L 1NAKL 4WU7B 3ESUF 2ESVA 4ZD3L 1RI8A 1P4IH 4V1DD 4WCYL 4HKJA 4KK9D 4NN6C 1T22B 3IKKA 4HKXA 5HYJB 1TETL 4RMTA 5HGAB 3BJ91 5F7MC 5IW1B 3SE9H 4QRSB 1JGDB 4ZOBA 1D5XA 2FL5B 3IDYC 4OD1H 5DSCA 5KBNC 5FB8A 3EO0A 1IC7H 1J8KA 1UKTA 4TN9A 5EO1B 4KRPD 3QG6A 3O45A 1KXVC 1X5ZA 5FKAA 1U91A 2R8SH 1A9EB 1GRWA 2Z35A 3O8XB 5T33H 1IKNA 4G6FD 5JDJA 1LEKB 4XP1L 4K23L 2CK0L 4BZ1L 2YN5A 3RWIA 5FUCC 1AGEB 3EYVA 4ZYKA 2YPKB 3QWOA 3TBTB 3LIZL 1QBMH 4ERSH 5C0DA 3HG1A 5B39G 4P3DA 4KQ3H 4PJFB 4PRHE 5GJTH 3E8UH 5L8JB 1OCWL 3FONB 1HQRB 3A67H 5GRWA 5LVEA 1RUAL 2WQRA 5T3ZD 3F62A 4X9IA 1D5IH 2B5IB 1XGUB 1PQZB 4NGHH 1RURL 4PB0H 1KENH 2J2ZA 4GAYA 3HMWH 4ONFL 3WE6A 4LKXB 5HDQL 5B4MD 4IJ3B 1FJ1A 2IG2L 1VCAA 3BPCA 4XVUC 2PXYD 2F5BL 3BW9A 4JJ5B 4FZ8H 4N0UA 1PKQB 1S7UB 4XTRD 3BGMB 2IGFH 5IR1A 1KN2L 3VRLF 3CFKA 5CILH 3I3BA 1GPOH 4RISL 2HLFD 1JBJA 1DBJH 1OAYL 4U6YB 1PG7H 1ZT4B 1I1FA 2COQA 3IT8D 1Q0YH 4AM0B 3SKMB 1WIPA 5T3ZE 5EFIA 4JQIH 1M6OA 1Y6NR 4DGVH 5FECB 3NZHL 4WFGD 3LKPB 2XG4A 4RMWA 2A74A 4JM2B 3N1PC 1E4XL 4Q6IA 2NW2B 3LKPA 4YZFE 4NFDA 1CFVL 1HWGB 3QUXB 1I1AC 4YEFA 4IDJH 1MUJA 1LO2H 4ZFGL 1IZJA 4OB5H 4AM0A 4YQXL 3KVQA 3PXJA 3MFFB 1KEML 2EDEA 4C56B 4F2MB 4UNVA 1UACH 2YRPA 1JF1B 4X9GA 2HN7B 2D7TH 5GS0L 1KJ2B 3UJTH 4AZ8A 1JGEA 4XP5L 5IB3B 4EIGB 4CN1A 2I5YL 3B43A 4L4TE 5CINL 4YHML 4P49A 2I60L 3CK0L 1V5JA 3EOBA 4P99A 3QIBA 1PYWB 1UXWB 3VXPB 2NLJA 5GQBA 3WFDL 3MXWL 4ZD3H 3MLTB 3TZVB 3BVNA 1T1ZA 3V9FA 5MEPA 1XGUA 4OZHA 1A6AA 1P7QD 4POZC 1WAAF 3CSGA 1P9MA 4MLIA 5DJZA 4HXAH 4J1UA 5GRUL 5LBSL 2ZOKA 4MDIB 5H35A 5EZLB 2SEBA 3AS3A 4ODHL 2GY5A 3EYVB 4LLDA 3BGFB 3C8DA 3DSNA 2N7BA 3DECA 1FRGH 4WWKA 1J5OL 5I17B 4OCRH 4LCWE 5KANI 3QJFA 3QG6B 4EVNA 5GSRA 5I6XC 1NBYB 3O6ML 4K07A 4OV5A 1VFAB 1MRCL 1G6RB 4PRPA 1MNUL 4WHDA 4JKPL 3AXLB 4YE4H 4TRPH 1A6VL 5IB5B 5C08B 3WHXA 1TQBB 3FT2A 5FM5M 1YN6B 5I18H 5DUMH 2V17H 4HIXL 4KRPC 5DA0B 4MNGB 1YEIL 2BRQA 3IXTA 4GMSH 1I3RB 3GJEA 2VLKE 3BPLC 4PJCB 4H8WH 1XF4A 3NPZB 1AY1L 2MJWA 3OJ2C 4PREB 1S9VB 3BEVA 3CMOH 4DGIH 3MLVH 2BHUA 2GSGB 2BY2A 1HINH 3NFSH 3PWLA 3SKJH 1ZTXH 4M48L 2OJEA 3BH8A 3SPVA 3CDGA 1YN6A 1JN6A 2KBGA 2AXGA 2AJZA 1C5BL 4ZAKC 4DKAA 1RZGB 1UADC 1CD9B 4GLRH 1KGCE 2YXMA 4FQXD 1QQDA 3HPJB 4KROD 4JRXA 1M1SA 1K4CA 2YD3A 2DQUH 4LASH 3OTTA 5ACZA 1C08B 3QJFB 5I18L 1MWAH 3U9UB 5JOEA 3LQAH 1X44A 5EU3A 3MZGB 4TSBH 2Q6WA 3WSQL 1MQKL 3GSRB 2O5ZH 2DLIA 1BZ7B 3ISWA 1TPXB 4Q9BA 1VEOA 2FIKA 5JR1H 1S3KL 2PF6A 3WS3B 2J6EL 2PW1B 3Q5OA 1QHPA 5C0JB 1QG3A 4I0KA 5FHBL 2NY5C 4LLDB 3DSFH 3L3JB 4GO6B 2Z91A 3N1FC 4RX4D 1EPFA 1WUNT 1DBAL 1G0YR 2E5EA 4KJYA 1NEZA 4KVCL 3IFOA 2QSQA 4AIOA 4K3EL 3KPSE 5DMYA 3ZDZF 3VFMA 1FZKB 6FABH 4IRZL 1EJOH 5J6GB 3HA0A 3EOYG 1UXWA 1NCWH 2NY1B 1KPRB 1NPUA 1Z5LA 1HQ4A 4GMSL 4MNGA 1MFDH 2PNDA 5C0ND 1TCMA 1RZ7L 4I4WB 5MHSE 5KSAA 1DSFH 5LWYH 2FGWH 3FT2B 4XI5C 1KLFA 3QUYA 3QISA 1N8ZB 1N0XH 5IMLA 1T3FB 1EEYA 3TBYA 3VXRD 1JF1A 2AK4E 3DO7A 4H25A 1OF2B 4PJIE 4U0RB 2PXYC 4QHNB 2GITA 4KXZI 4XMLH 1VFAA 3HC0B 2ZKHH 4OZFB 3RX7A 1KCVL 4M61A 2FIRT 4R4NC 4DQOL 4AT6A 4KMTL 4YXHH 4Y4HC 1GGYA 1O0VA 3QHFH 1U42A 2X4TA 3QO1B 1RZJL 4N0RA 4OKVB 5CIPH 3GMLA 4JVUA 4P23A 3K46A 3V6BR 3PWJA 5EZOH 1ORQA 2L7UA 4NNYB 1UZ6E 1KJ2L 1S5HA 4HUXA 3ZL4L 4JRYE 5I8OL 2LU3A 4HZLB 4MD4A 4XNQB 4N8PA 4YHYB 1I8MB 3VRJB 1I1FB 3G5YB 4PG2A 3EYSL 3U7WH 1HOCB 4J12A 4WW1A 2DB8A 4MS8C 3JWDH 1BVLA 1XCQA 1D5BB 1J1PL 2A6KA 1WZKA 3UBXA 2CKBL 1KIRB 1KCRL 4KH2A 1PEWA 1A3QA 2FLRT 3S6CA 4LKXA 3WIFB 5JPNB 1FFRA 3RFZC 1F6AA 3CK0H 3IDGA 1ZVSA 2GAZA 5I73B 2UY6A 4J3VA 5BW7C 5DC0A 1KUMA 4PLOB 4DAGL 3MJ6A 4GG6A 3SE3A 1Q0XH 5DURB 1L6ZA 4LQFL 2VLMD 4MCYB 1CI5A 5FA3B 4WEBH 2B0SH 2BC4B 4V1DB 3PGCA 2NY2C 2O5XH 4HFUH 1RZJC 3RI5K 4FXGA 2IPKB 5JO5A 4AL8H 3NAAL 1JNHA 1DVFD 2X89A 3S36X 3FL7A 4O2FB 3PL6D 5EN2A 3U36B 2XKSA 3F5WA 5CHNA 1RZ7H 1UWXK 3D85D 4M6NL 3MYZA 1J1PH 3E0GA 4WHTB 4GKSA 4KQ4H 4UINL 4YFLF 1ITBB 1U91B 2EIDA 3FFCA 3CLFL 4KDTC 3FQUA 5JHDA 1SQ2N 2C1PA 4L8BB 4F15B 4OLZH 3D9AH 1FORL 2ORBL 3ESVF 1K4DB 1IGCH 3QQ9D 4UDTB 4KHTL 3TCXA 2AXHA 1I7ZA 1S9WB 3UAJC 2VDKL 2MSPA 1XT5A 3H3PL 3H3KA 1U95A 5IM7A 1Q0YL 2YUXA 7CGTA 2AJYH 1LILA 1YC8A 3N0PB 3WE6B 5L8LB 3L3OB 4X7SL 1A7RL 3TO4C 3O9WC 5C7XH 1XZ0B 4OIIL 2WP3O 1KTLB 3H9SA 1NDGA 4KVNL 5D7JC 4FTVD 4JFFB 3GSNB 2OMNA 4PP1C 3WXWL 4R2GC 4P2RA 3GJFK 3C2SA 1RJYB 4G6AD 3V5DA 5F3BA 5IVXA 3SE4A 3S9DB 4RMVA 2Q8BH 4LCWD 5EOCL 4ZUVA 4O51A 2Y5TB 2UWEA 2VZ3A 5H37H 4OLEA 3BP4B 1NGYB 4I9WE 2EEBA 4FQQB 2FB4H 4JFYA 5IK3A 1LO2L 1ZSDA 4YQXH 4RAVA 2YPKA 4QRQA 3QI9A 4X0KB 3WDHA 4FABL 5I0DA 5DRNA 5HI3D 5KVEH 3CVHB 4XP9L 2IQ9L 5H2BA 4XCYB 3H7BA 1FFPB 1GGTA 3U4BL 1AGDB 1IMHC 4RGNC 3TWCL 4OZGB 1U92A 2ZG1A 3UP1A 3ZE1F 3ZKXC 2Q76A 1JCKA 4XC1H 5HJ3B 4BQBA 4GW4A 4XMKL 3QULB 1CFSB 5I1CL 3CXHJ 3L9RB 1T22A 4OAWB 5IHUH 1KCRH 2AAVA 1LP9A 2Z4QB 3GNMH 4NQDE 2X1XR 2LVCA 5IG7B 3DURB 3GUTA 4X5XA 3VFOA 4OCWH 2YWYA 1ACYL 4WUKL 3OXSA 3BI9X 1JPTL 3SCMB 1FH5H 4PRPE 3VXUD 1FNGA 3VGEA 1P7QB 1NGPH 4ZUSA 4P46C 1INEH 3NIDE 2IEPA 4DZ8A 4D0BA 4HH8A 4PJAF 5MENE 3P2TA 4NPYB 1EDQA 3JV4B 1IAIM 1QLFB 3HZYA 3WXVL 3G08B 5DC9B 1U8JA 3CZFA 3VXQB 2QQKL 5IBUG 1U8MA 4WUUE 2HTKD 1F58L 4KKBC 2Q8BL 2ZNWA 4HDIA 4O00A 2Y25A 4XCFL 1K2DA 3VI4E 3ES6A 3LH2L 3QUML 4DKEL 5L2JB 3QFDA 5KSVA 1CS6A 3L95B 4Y0GA 5DHVH 5SWSD 2GT9B 4QHKI 3K4DA 2YD6A 2YUVA 1XIWA 4O58L 2YPLD 1ZHLB 5D1XA 4FQHB 3SEPA 4FHBD 3BKYL 1HSBA 1MFBH 2R23B 5T1DH 3VXUA 4PP2A 4JFEA 2J8UE 4N8CL 3UTTB 1H3UA 3SCMC 1JHKH 4M3KB 4EI5A 1CDCA 2VDNH 1BBJB 4PJ5E 2W9DL 2WWKO 5F7WC 1RUKH 4ZS6C 1G7MB 1UVQA 4HF5L 2WBJC 4G8GD 4NWUL 3RZCC 4JFQB 4HT1L 1MAMH 4K9EH 4PRNA 3DROB 3IDNA 2CO7B 3WS6C 2W38A 1DR9A 1KPUB 1WEJH 4WNQB 3UTOA 4NQXA 3PABA 2C4FU 3FQNA 5GJSH 4UTBH 4I18B 2YPLE 1QFWL 1CFQB 1B0RA 2XTJC 1YNLL 4MJ6A 5CEZH 1ZA3A 1VGKA 3CFCH 2RHEA 5AYUH 2JCCA 1G9MC 1DN0A 2OP4L 1E27A 5EPMB 5C2BH 2ADJB 2RR3A 5HDBE 3ZHDA 4LSVL 3O81A 3WJJC 4P2QA 4PJ5D 2HJFB 2WWKT 5D7KE 1DUYA 3BKJH 1R3JB 4AH2B 1OPGH 1R6VA 4Y4KA 4NDMA 2CXGA 4HWNA 5DYOA 2IH1A 4HIIA 5KS9B 2JB6B 5DUBA 5E2WH 3PP3H 3LD8B 1J1OL 4LCYA 4I2XA 5D9SA 2KQNA 4XP5H 1J87A 2A9ML 2WUCL 4GBXC 2DOCA 4YBHA 2E7CA 4NM8H 4C4KO 4ZO8A 4BK4A 3CX5J 4BQCA 1EJOL 3IXAB 2HVJA 2AQ1A 4RGMB 3DIFA 3UBXI 2XZQH 2F53B 4HXBH 2XQBH 4NQVA 2WQ8A 5FOBA 4LBEA 2VXQH 2B2XH 3H0TA 2BRRL 4DVRL 2DWDA 3LRSB 1L7TL 4M62L 4I5BB 2AEQH 2PTTB 2NY0C 4ZUUA 2OTUA 5I8CA 5KG9B 3S88L 3P9MA 3NCCB 5E1AA 1YYLL 1IGIH 3L3HA 3O4OC 5DGRA 4I0PC 1MCBA 1ZVYA 5ALCL 2VXSL 1RULL 3IDMB 3EDKA 4G8FA 1U41A 2VDPL 3Q0HA 3FRUB 2IANB 4XCEA 3EJYC 1U3JA 5GSVA 1AFVH 1U3HD 3GIZH 4HKZA 4LCUA 4A6YA 3SJVE 1MRCH 5F72S 3EOTL 1FO0A 3D48R 5D4QA 4IMLA 5C9JB 1Q9LB 4ZS7H 4G43A 4L4TD 4M6OH 1SJXA 4X7TB 1UXSB 1TZIB 1YNLH 2EZ0D 3HI6L 5CEZL 2IANE 1RUML 1UCBH 5FF6A 3QG7H 4GH7B 4NQED 1CQYA 1NCDL 4TSAL 3FZUC 2PYEB 1UM6L 2IAMB 1DEDA 2FECL 1A5FL 5GISH 4NJAL 5TH2A 4AEFA 1I9JH 4UIMA 5DEGB 5HVGB 1RUQH 1EAPB 5EUOA 1JTPA 3T4YA 1OT1A 5FYKL 1JZ2A 3MRDA 4QOKE 4DCQB 5AUMB 4I0PB 4V2CB 4RFOL 4OZHE 4P46B 3RVVD 2G5BA 4NYLB 1FYTD 2QADB 4CVUA 3W11D 1CICA 1ES0B 3FFDA 1R3IH 3Q48A 4C59B 4LP4A 4MNHA 1C16B 1DBML 4P5TC 1XGTA 3HI6H 1U8NA 4GRMA 3TO4D 3Q5YA 3BO8B 4K3DH 3IJYA 4MX7B 1B6UA 3ARBA 4MWFB 5E6ZA 15C8H 4PB9L 4X6EB 3JVGA 2ZNXA 2ICEB 4QCIB 2G75B 2OMBA 4U1SB 2O5ZL 1NSNL 1J86A 3OGCB 4X9HA 2IQAB 5B38G 5BS0A 4NC1C 5FO8B 5HD8D 3D87B 2ARJB 3F7RA 5DJ0B 4N0FB 5DQ9A 3FB5A 4ODWA 3GI8H 1TDQA 5CGYC 5GIRB 1T20B 4NP4H 1GGCL 3KPQB 3IAGC 3UPRB 1GAFH 2W65A 1HIML 2F19H 4GBXA 1MCWM 1PKOA 2A77L 2PR4L 3CXDL 2KL6A 3P0YL 3MJ7B 2DQJH 5E2VH 3V6ZB 4NT6B 3LN4B 4PGDA 2CXKA 3VFVA 1SYSA 2X09A 2EDHA 4HWUA 1Z9LA 5HHXH 3IRPX 4GRWH 4ELKB 2XZAL 3KPLA 1AKJA 1BF8A 4YPJA 3MO1A 3AC0A 2GI7A 4YDJB 1RK0B 1NLDL 3RVUD 2VIRA 5EOQH 2DMKA 4TNVK 2LE9A 5E95B 1S7TB 3RX5A 2H26A 3MO1B 4CDGC 1T66D 3QDJA 5DJ6B 5GRJH 3T77B 4RFOH 1F4XH 3SDAB 3TFKD 5I0ZA 4LCIH 1N59B 3E6FA 4UV4H 5JOFB 3HS0B 4Z7UE 1HH6B 3I84A 4N1EA 3QCUH 2VZSA 3HI1B 1N5AA 5GGVH 4G6AC 5IB1A 1IFHL 4JFPA 4LLYB 5D7LA 5EWIH 1Q1JL 1T1WB 4ODHH 1MCPH 4M9PA 2FJGB 1NCDH 2VKWA 4TSAH 3D3VB 3EHBC 1ZLSL 1UM6H 1IGMH 5IBTH 5LJYH 3UPRA 5ERWB 3G9VA 3L5XL 3CPLA 4OLUH 4U6XA 3SDCA 3BZ4A 3BKJL 4PJ5A 4Z7WA 2XWBB 5GIRA 3VCLA 4LSTH 3BPOC 4R4ND 3C6SB 1B4RA 2J6EA 5DQ9B 1BQUA 3BDYL 3GNML 3GB7A 1MCWW 2P8LA 3FQXA 4Z77B 1WBYB 1OAQH 5H94A 5A2FA 1CTNA 3F12B 3UJIH 3D69B 5EZJA 1AD9A 5CLWA 1MHHA 1I3GL 2DQJL 3RU8L 1ZANH 1FL5A 2R4SH 1IAIH 1R5IB 5JDSA 2CUHA 2H26B 1YEFL 2NTFB 5DVKA 5D1ZC 1IFHH 4GRMB 4EDWL 3WKMH 5LKNA 3QRFM 4AEHL 3DVFA 1GGBL 4B5EA 6CGTA 3VWJA 3JTSA 3KR3H 5E4EB 1CXHA 4NBYB 1S7SB 1TZHB 2NPLX 1EMTL 1QBAA 5DGQA 3U7YL 2G5BB 3SDDC 3B9VA 4L1HA 3AREC 4M5YL 5ICZA 5J0BA 1O5DT 1SYSB 3LN5A 2CKBB 3BHBB 1MWAB 4CBPA 3L6FB 3BEWA 1LO0H 3L3GA 4G9DA 1IJ9A 2Q7YA 4CGTA 4OGYH 3CVHH 2ZCHH 2X4QB 3P9LB 4PY8J 3T1FB 2AJ3B 4BFBD 4JFFE 4FQLL 4JR9L 2XI9A 4JANA 1NCCH 4NC1E 5HI3C 1J1OH 3QQ4A 3BIKB 1TETH 4X6DB 4UAOC 4LLUA 4U6HA 4FOMA 3F8UB 3FB5B 4JEGB 4N0FA 3GMMB 1QLEH 2ARJA 2OZ4H 4S1RL 2BSSB 4LIQH 4OBSA 3TESA 4TTGA 2HFFA 1KULA 4OIBA 4WGVB 3QEGL 3PWPB 1C7TA 2G75A 4F7CA 4LKCB 2XYCA 32C2B 1WEJL 4WI6A 4DN3H 5EOCH 2W60A 4K8RD 5C3LD 3BD3A 5KVDH 1JGVL 1WFOA 4C4KT 2R2CA 1I8KA 5F1IA 4WY7L 4HEME 1JRHL 5C3TA 4R3SB 3DLQR 4QRPE 5IGXL 2KKQA 1CXEA 2APXA 4R7DB 2A83A 1F4HA 1S7QA 3H0TB 3ZHLA 2X7LA 3QR2A 5LCVL 3HNSL 1NMBL 1X5HA 1RIVH 1JGUL 4QO1A 3H3PH 4HUKB 1CICD 4Z7VA 1WBZA 4X6CF 1AD9B 5E2WL 5EZJB 1IGYB 3JUZA 4XMKH 1A7RH 1MWAL 4P59H 1KCKA 5EBLA 1RURH 3DUSA 3GHBL 3QUZA 3U0WH 5DEGA 4LQ1A 4FN0A 3CDFA 2R0KH 4UQ3A 3RQ3A 2UZIL 5DJ8B 4U6HB 4QRTB 3KJ6L 5E08H 2ZCHL 1UA6H 1YECH 2BDNL 4Y4FA 4J3TA 1JWUA 4KQ4L 1T21A 4MHHG 1H3GA 2Z8VC 4JM2C 3ARED 3MLYH 4GAJH 1MFAH 3DV6B 4G43B 4LIQE 2PCPA 4RZCA 2ADJA 2DKSA 1JPSL 4PUBL 2BJMH 5HY9A 3TCLA 2AEPL 3O41B 4BFEA 2NX5B 5IV2B 1JUFA 3NPSB 4HWZA 3SDAC 3IFPA 3WIIL 1FIGL 4ELMB 3T2QA 3A6BH 4ONGL 4OZIA 3BQUD 1MCLA 3GBLA 2GFBA 4LRIA 5ISZB 1FHGA 3OZ9L 3GEWB 3KAAA 5F7YC 3FO2B 4PJXE 1NMAH 3UJJL 3SDAA 4F8QA 1HHGB 5C0RH 1X4XA 3PWNA 3JTSB 3SQOL 3DXAD 5ACLA 5JQ6H 1BMGA 1UVQB 3ALWA 4X4YB 3KLHC 2D7NA 1RK0A 4O58H 2H8PB 3DO3A 4Y16B 5DTFA 1W0VB 3NN8B 5J11C 4PJ8B 3D25B 5BV7C 3OKMB 5LWYL 4L5FL 4MVBD 1UH3A 4K8RH 4U6VL 2FX8L 4HGWB 1CD8A 4HHAA 1U58A 5I1AA 5M95B 3MJ8A 4NNXB 5C0BE 3MRCA 3OJDB 4Z7QE 4YDVA 4PRIA 5ANMA 4QHLA 1S7XB 3RWFB 1JHTA 1NJ9A 4K94C 3GBNH 2VDML 4XPBH 1ZS8A 4PRHA 4BQ8A 2YKLL 3VE0A 5K9QI 1K2DB 4LL9A 4K94H 2XWBA 5IMMB 2P8MA 4ORGB 4HXAL 3BDXA 4AL8L 3O0RL 4GAFB 1R3JA 1KB9K 3VXQA 4ETYA 2Y6SD 3KPQA 5HBBA 4MNQE 3VXOB 2PW2B 2JJUA 1QLFA 3RPIB 3PG2A 2QV2A 3TP4A 1OTSC 4PV9A 2HTKC 1XCTA 3FN3A 5D7IF 5DD1L 3ULSA 4HLZH 4D0BB 1OGAE 4ALAH 1KIUA 4NHCH 1HH6A 4NN5C 3RPKA 1CFQA 1L9NA 1OD9A 2Y7QB 4JKKA 4X7CC 3ARZA 5I1CH 4HJ0D 4CN4A 1OAQL 2A0LD 3T77A 4O4YH 4X6EA 4DUWA 4R0LC 5C2BL 3ARBB 3HE6A 3RKDC 4OCRL 1LE9A 5INDA 2Z0BA 1HEZA 3RUGF 2J8OA 1EVTC 1U8PB 5T1LD 3AB0B 1ZK9A 4K94L 2NY6D 3NGBC 5T3ZH 4OZGE 4YHLH 3KPLB 1F4AA 4PBXA 5E9DD 1X5LA 2XA8L 4K9EL 1N2RA 2DYPB 5D7JD 4N8VB 5I19L 3FTGB 4Y4KC 4OCYL 4K8RC 4XAWL 3L95A 1AGDA 2EIZA 2QQQA 2YUZA 3QA3A 1FFPA 4UINH 4PJ7A 2AQ3A 4LPVA 4XHJD 4PRPD 3KWWB 2PUQT 2Z8WC 1KCSL 4XI5D 4QRRB 3QQ9C 1PVHA 2APFA