2LOEA

Structure of the plasmodium 6-cysteine s48/45 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
EKVKGCDFTTSESTIFSKGYSINEISNKSSNNQQDIVCTVKAHANDLIGFKCPSNYSVEPHDCFVSAFNLSGKNENLENKLKLTNIIMDHYNNTFYSRLPSLISDNWKFFCVCSKDNEKKLVFTVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6-cysteine protein, putative
publication title Structure of the Plasmodium 6-cysteine s48/45 domain.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Membrane protein
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2loeA00
2LOEA 2YMOA 4YS4A
chains in the Genus database with same CATH superfamily
3QQ3B 3LN4B 2NR6A 5I8KH 3KPNA 4NCDA 2EXSA 3TT1H 4HS3B 2ED6A 1I8KA 3L5WA 3RHWF 2WXPA 4AEHH 1FDLH 4UM9A 4XO8A 3SDXB 1OF2A 2BOBB 3FW6A 1UCTA 4ELME 4ZUUA 2BCMA 4GAGL 1CYWA 1DSWA 3PNWB 1RZKL 2X88A 1RXLA 2G0KA 5DS2A 2IMMA 2OZ4A 4C54A 3MBWA 2IV8A 3LKOA 2Y5TB 5DC0A 3BEWA 3OGCA 3MOBL 2NTFB 3JWOL 2BY1A 4ZO6A 1KBVA 5JXEC 1KYAA 4QRTA 5KVEH 1IQWH 3KGUA 2EVHA 2C9AA 4ELKA 5JORA 1QLEH 3A67L 4KHXH 4KVNH 3CLFL 4OZFB 1QA9A 1UH3A 1LILA 3JVFC 4OF8A 5TTRA 3V5HB 1RH8A 4P3CH 5FFLA 2JLPA 2NX5A 3DX4A 4EXKA 3G04A 1BM3H 3OZKA 4GO9A 2CALA 1PU0A 4L4JA 3BRFA 4JM2F 3S8GB 4TQPA 3HAEB 1LNUB 2E6PA 3C2SA 4XVOA 5IREA 2K8MA 2XTJE 3UACA 4B9PA 2F54E 4XAKD 3WJMA 2GSIA 5E2WL 3O2VH 3D85D 4K94C 2VCOA 4H0IA 1W72A 4KWUA 3UX9B 3CPUA 5FYKE 4E9RA 1UKSA 4R90L 4N2IA 2M83A 1J18A 2ZXAA 4HUWA 2W91A 4JG5A 1LO5A 2VDNL 3ZKNC 4XZUA 3BQUC 3PWPB 4X7SH 2DY2A 4M7KL 3FH7A 2AFNA 4MA7H 1CF8L 4P9HH 3I9GH 1ZLUK 3V9FA 3BKJL 3IEAA 5D1ZI 4D2NA 4NQXA 1N19A 2O5YH 4G7YL 2IAMA 4ZMAT 1C1EL 3PDOA 2Z4QB 4KI5D 4P07A 4UT6L 1RUKL 8FABB 3SCMC 1ZT7A 1G7MA 3F7KA 2VSKB 4UTAA 1ZTXH 1N18A 1RU9H 1V27A 1KJ2L 1A9BB 1IT9H 3F7VA 4L3CB 3TA3D 1JYXA 1TQBB 2W80C 3X14B 1EWHA 1JCKA 4KRMB 1PAZA 1G9NL 4OD3H 2J1WA 4PVMA 4P99A 5E95B 1CD0A 4FQHB 1OGPA 3ECQA 1ASPA 4J4PD 4X4MA 5E5MA 3MV9B 4TL4A 3PHQB 2ITCB 1PKQA 4ZTOH 3NJVA 1AE6L 2NXZC 3QW9A 1EXUA 1TEYA 2UY6A 2EACA 2WAQA 4K7FB 4FAAB 2FO1A 1YEFL 5CO1A 2Q8AH 2NW3B 1URIA 4EI6B 1EQWA 4MQSB 2AJXH 2PNDA 3MRBA 5TQ0H 3TCXA 4GQRA 2DOCA 2VDRB 2XXCB 1P7BA 4KNSA 1QO3A 3N9GL 4O58L 1CLOH 3U0PA 4PRPA 4OB5L 4PJBB 5I1LA 3NQIA 5HGHA 1GHFL 1YNLL 3ES6B 1CLYH 5BZXA 4U1NA 4HUKB 2ZUSA 3ATFA 3SHSA 4PVLA 3W11C 1OANA 2ED9A 2DAVA 2G2PA 3MVSA 1T20B 4M8QA 3BP7B 1T2QH 5J0BA 5D7JC 4CJ0A 1T03H 4XX1E 2W92A 3UERA 3PHOA 5IFHH 4WU5A 4X7FC 3DVNB 3IMRA 5AAWC 4RMBA 4XPAL 2X4RB 4WI4A 2D7NA 2H2SD 5CJXC 2UYLA 3QUZB 1A1NB 2Y7SA 1FFNA 4TNWK 1FFTB 5EBWA 5A2JH 5EF1A 4E36A 3HLAB 2YKLL 4FTDA 5HYFA 3A47A 1H8OA 4JANB 4L4TA 3PP4H 3N06B 1E6JL 3LH2L 2AJUL 4I48A 2XTJB 4AYDC 2F54B 3L95B 3GKZA 4OGZA 5GXBB 2R56H 2X87A 4FX5A 3G5YB 1A4KA 3FUFA 2UY7A 4PGEB 4L8SB 1MFVA 5K5YA 1DLFH 3SGEI 2DQCL 2GSGA 4LCUA 4IKJA 3T04D 3J27A 1CFQB 5GZND 2VXUL 3L4TA 3LEYH 3FKUS 5E8DH 1DQLL 1TLMA 1MCOH 1E2WA 1XB3A 3BQUA 4L5FH 1MCRA 2ADFL 2ZG3A 1MY7A 5EU3A 4XP1H 1NCJA 1GGCH 4R8WL 4ZW7A 4CU8A 4L4VB 4OGXH 1YJDH 1CD1B 1HNYA 2WXQA 1F3DJ 1X6NA 3OKOA 4HT1H 4JM2A 4MD0B 3CU7A 4AT6B 1HAWA 4KITB 4FFTA 3D0VB 4HPHA 3LXCA 2I69A 5AKVA 4GXUM 2YA2A 1AS6A 4UCFA 3SCMA 5E5RB 3SB3A 4L8DB 2AJYL 2DRUA 2UZXA 4LKCB 2FNBA 4PP1D 1I53A 2P5EE 5KSVA 5GPRA 5T5FH 4JKNA 3BWSA 3QEQA 5EFIA 5CNHA 4B97A 4PGDA 4NXSA 3KDPB 5H35B 3BWZA 3UEQA 4D9LL 4RQQA 4XMLH 5JXAH 2R2CA 4YHZH 3Q8BA 2I5YH 2G75A 3AB0C 2VDLL 2ZX6A 3T0XA 3L08A 5DFAA 3VCLA 5IF0A 4JFQB 1S7WB 1QR1B 3VH8A 1TKWB 2SEBB 2JKIS 1AIFA 4YPGA 3ZL2A 2HJFA 2PETA 4TQIA 5HHOA 3TASA 4X9IA 4GAFB 2ZOLA 3ENEA 3EYQC 3QUMH 4OKDA 4UNTA 2JJWA 2A0LC 2BY2A 4FL4B 4Z7IA 3M6DA 1GCFA 2D0GA 4UM9B 1T7VA 1U3JA 3WNJA 4C83A 1OF2B 4O4YL 1RJLA 4Y2LA 2XBZA 3OZ9L 2ERJC 5D7JA 2JCWA 1NQBA 3O6LH 5TE4H 3MBWB 2JKNA 2AEOA 5AAWA 2XFXA 2QSCL 3LKOB 1CFNA 3LPFA 4GI9A 4YFEA 3H0TA 2WXJA 3BEWB 1IBDA 1RLBA 2ZKHH 3CSYB 3QR0A 5HHMB 2DI7A 1BFOA 1P9MC 2AQ3A 4G42B 1YMHA 3VU2A 4Z3GA 3D9AL 4HWUA 2Q3AA 2WV3A 2DLTA 4ZOCA 5IBTH 3SQOH 5FW7A 4ELKB 3DSNA 4AKQA 5HJBA 4B0MM 4F2MA 1MFEL 1DEEA 1Z5LA 3LRLA 3VG9C 3I9AA 2OMWA 1WFNA 3VXOA 2OW6A 3WHXB 2VLLB 1V7ML 3L1OH 2CO4A 3CSFA 2AQSA 2W65A 3CHQA 3BDYL 4WHYH 4WO4C 4LSUL 5DEGB 1N59B 4N1EA 5LXVA 2NX5B 3IDYC 4HZAA 5T8IA 1FUNA 1MHEA 1HFUA 3OWEA 5INDB 3LZFL 3T0WA 5DZ9A 4C58B 5FHAH 3T0VA 1OOWA 3PNRB 1X5LA 4JN2B 3BAEH 4MNGA 2HMIC 4KTDL 1LK3L 2GSIB 1JYNA 1FGVH 1I1RA 3H7LA 1W72B 3AS0A 4PRDA 5DHVA 3CZNA 4UAOB 1XXDC 3U6XA 4XBEH 4XN8A 2GFBA 4DNLA 5C0AA 2GEQA 3CTTA 3MLXH 1E30A 4PJXA 4YHKH 4HUWB 4DCQA 2IIJA 4TUOB 5HHQB 1B0IA 1XTLA 3UGXA 4IIQC 4JFXA 4DVBA 2L04A 4CVZA 3S2CA 4M6OL 4ZQKA 3A4DA 3S35H 3KL0A 2COVD 3QEGH 3LKQA 4JE4B 4XO4A 4Q9RL 3KPPB 4UWQB 3PDOB 1AIZA 1V8HA 5T3ZD 3VFPB 1G7MB 1UH4A 5FUOL 1G1CA 4X7TA 2Z6FA 1WEJH 4APXA 2VDMB 4KROD 3NTCL 3QDHA 5IB2A 1S9XA 4XN4A 4TLTA 3SSGA 1SF5A 4EZKA 4J12A 3TC9A 4EZLA 2NY2B 2OL3L 3CZGA 1FVCA 1GPOL 3BP5A 5GGUA 3FCGA 4ZI8A 2R27A 1PSKH 4OQTH 3T65B 1OAQH 4ERSH 4PQXA 4FOMA 2ESVE 2PXYC 2KYIA 5E5UB 1JNLH 1H3WM 4LLUB 4N2GA 2R69H 4V1DE 3NCCB 2PUQT 4GIPD 5DQJA 3POCA 3GS7A 3MRBB 1JI1A 3ZE1B 4I77H 2R39A 5TJWK 4EQ2A 2ADYA 3U4BH 2GK2A 2GKIA 1MFCH 2BSDA 3BZDA 4FFYL 1AR1D 2PPDA 1QLFA 3JYCA 4PRPB 3EO9L 5I1LB 3JYBA 4U1NB 3WNNA 4IBUA 1P9MA 1BX2A 4M8QB 5E8EA 3GPEA 4YHLH 2BK8A 3VQ1C 4R5XA 5CMAA 4XZ4A 3PHOB 5T5NF 1QI5A 1LWJA 1HJBC 2BH0A 5DJ0A 4OD1L 2UYLB 5AYUH 4WO4A 1WBZA 1FFNB 5EBWB 3X1BA 4PRHB 1BZ9A 1CL7L 1G7IA 3JV6B 4HJ0D 4L4TB 3LRSA 5IG7A 4JR9L 4LPTA 4I48B 3ZLQC 3FT1A 4XMPL 5F7LB 2CLZA 4G7VH 4JNXA 4TN9A 2C9SA 4HJSA 3IXTA 3MLYH 3SGEH 1OIOA 2NPLX 1Z2KA 1UOVA 4NENA 4LCUB 4NKOA 1CQYA 5CCKL 5EF0A 1GZHC 1I1AD 4LSPH 1SXNA 3B1TA 3BIAX 1MCWM 3KG5A 4IIQA 4U1KA 3BQUB 1NMAL 1P6FA 3QUXC 5EU3B 5GJSL 1XT5A 4OCSL 3K6SB 2IH3B 1WIPA 1P84K 3NP3A 3VSTA 4GRLD 3T5WA 5AVXB 3GO1H 5JIKA 3IKCB 3EBGA 4BK4A 3SOTA 4DP5X 2E4TA 4AH2B 2AAAA 3QFDA 4QJ5B 2J73A 5AW4B 1ANUA 2IF7A 5EPMA 2EZ0C 4G71B 2H0FA 4ZG1A 1IL1A 2KZ1B 3KVPA 4MNQE 1KLUB 2UZXB 3E9UA 2W5PA 1TVDA 1AG6A 2J6EL 4HEPG 1EZSA 3B34A 4LHUD 4TOYL 5D1ZD 3OD3A 4OQ1A 4A39A 4OV5A 4ORGA 3QEQB 5EFIB 3EDFA 2VXSH 3ULVF 5FOJA 2IPTH 1FFQA 4PJDF 2NY3D 4NPKA 4BQBA 2ZUYA 4ZFZA 2JCCF 2ORBL 3VNZA 1NFIA 5HYEA 4WWKD 5JHLL 2G75B 2Q10A 2NXZB 1SVBA 2PXYA 3CSPA 5DMIH 1J1XL 4P06A 5CJQL 5I24A 1K72A 3VA2C 4WIQA 2A2QT 1OXYA 3VH8B 4BCYA 1EHNA 3CHPA 4YPGB 3QFJE 4LCCB 4J3XA 4FQPA 1J0IA 4J3VA 3ZYIA 2YFOA 5DVPA 3QZNA 4C56D 1J9TA 3WUZA 1GYAA 3FS9A 3L3HA 5CEZE 2Y07H 3LZPA 4YSPA 4J2XA 3DX7B 2WXKA 4NWUL 1TQUA 1A6UL 3ULVC 3F7YA 1EGJA 5DRWB 1A3ZA 2Z92A 2AP2A 5KJRH 2YAOA 5D7JB 2BSED 3NCJH 4P0DA 4GQQA 1H3GA 2E59A 3MROB 3L2LA 3H0TB 4M48H 3S5LB 4CMHC 4PEEA 4N2NA 3S37H 1KJMB 2WOBA 1SY6L 2ZG2A 3A3YB 3T3PE 4C4UA 4GMTH 3WBDA 4UQEA 1E4JA 3ARGD 3DSNB 4FNPA 5FAAA 3LIZA 3ZKXC 1O6TA 1DEEB 3C8KA 4JHWH 4YVNA 3VXOB 4IEFB 1HVXA 1NAMB 2W65B 5DURD 5JW4N 5LNGA 4HIPA 2DWEA 4MB4A 2F7OA 1MVUB 4ZX4A 1MNUH 5KBLA 3LKSB 3VFVB 3QWNA 3V4PH 4BFFA 1GZHA 2N7SA 2NNRA 2HLFD 2XFGB 4PRAB 1AXSA 3EGSA 4WSJA 3ZHDA 2CO1A 3FQYA 4MNGB 1ADQA 3QUXA 2V8MA 5EOCL 5KVGH 2Z1PA 3BIBX 3VXMD 3I3EA 1FC2D 5FYKL 2EDRA 1NGQL 4U7SA 4PRDB 3TFKC 2AK4A 2YAEA 4UQ3A 5DHVB 3SGJC 4AE0A 1NBZA 4FA7B 1HQ4A 2GFBB 1JZ4A 5KBMA 2P24B 3FT9A 4DCQB 4PJXB 5DTFA 3U0WL 4U1IA 1YEHH 1XIWD 2HKHL 2NUTA 4EZMA 4ZX3A 2XVBA 3GTVA 5D2NC 2GIYA 4DVBB 3DX0A 4MNQB 1VADA 3GZQA 4AYID 4GKOA 4CVZB 3MJ8B 3V55A 5B7EA 2CXGA 3DGGB 3C5XA 1HEJC 4ZQKB 4ZMQA 3HBPA 5EEUA 3QZPA 4YBQC 1CG9A 3LKQB 5DU7A 3PU7A 3EH4B 3QQDA 1G6RA 4TUUA 5DYOB 3VXQB 32C2A 4K7PX 5DD0H 3UGUA 3AB0B 4OJYA 2O93L 2V5TA 5GGRY 2VZUA 5SV4A 4DO5A 3M7OA 1F1DA 2O61A 1U36A 2VR4A 2GAZB 3B5TA 1IUZA 1S78D 3JBG7 2BSTA 4J3OH 2R0ZL 4FC3E 1FVCB 3BP5B 1HWWA 4M02A 1EAPA 1I4FA 3D5OF 1OTSD 4I3SL 4JCLA 3VXSE 1EHLL 1BZOA 3O41A 4MD4A 3NACH 4DSYA 2ZCKL 3OAZH 1KYOK 5E9DD 4RFEA 5DQJB 4GUCA 1NUDA 1AXTL 3CFMA 4PJDA 1JZJA 3OKKA 2ERJB 1ZLWK 5DQ9B 4JFTA 1ACYH 3RI5K 4A63A 4X98A 1G94A 4AEFA 1LM8V 2JCCA 2OJZH 3PDDA 2JI3A 2XYCA 4E9VA 5ALCH 1N4XH 2YLKA 3RFRA 3HKFA 1G7JA 2LAAA 4E42B 5M94B 4ZUTB 4ZUVA 3SQRA 2OBGA 1GKOA 2BWDA 5FKPA 5C0IB 3P0GB 4KO7A 1WGOA 3T3PB 2PMZA 5E8EB 2QPDB 4RMVA 4AIZB 2VC2B 2EDKA 3ETBJ 2W38A 5KVMC 3NAAH 4OCYL 3EOAA 3VG9B 4Q7DA 2X89A 1Q0XL 5DJ0B 3PQYE 5BV7L 1WBZB 2FT6A 2JKXA 4JFFE 4NQED 3NJKA 3STLA 1NDTA 3IDYB 1A3RL 1BZ9B 4G6AD 4LOVA 3HKZA 3MV11 3EDKA 5JR1H 3S98A 2VZTA 4E41D 3HG1A 1AZNA 1SJXA 1HKFA 2EDLA 4Q9CA 5CEYA 2CO2A 2GT9A 2CLZB 5AW8B 1R24A 1ROWA 3IXTB 5KANG 4IJTA 4OZGE 4WJG3 3VG0H 1BD2E 4Q9BA 3JTSA 1O5DT 4KMTL 3SGJA 3B5HA 4NKOB 5GJTH 5JNYA 4RSVA 5KVEE 1DUZA 1D6VL 3D2TA 4KK6D 5F6IC 4IIQB 1SM3L 1I9JL 4F2FA 5D2NA 2XT1B 4XC1H 5K59F 1G9NC 4I85A 4H5SB 5I15L 2OM5A 1B4RA 5SWSA 3ISRA 5I76A 4FZ8L 2TSBA 4OLXL 2VDQH 5D4IA 5KYWB 1BG1A 2DEYX 4JPVL 3V0GA 3QFDB 3GIZH 4FKKA 4NNYB 3VD0A 1WBXA 4BZYA 5IB5A 5EPMB 1GYWA 1S9WB 3DUSA 3C09C 4XMXA 5E99H 5AZEL 3T3ME 1ZDSA 4GSRA 2NCEA 3WU1A 3VFNA 4ZFQA 4HKXA 12E8L 4FQIH 1GSMA 4QHKI 1HHGB 4ORGB 4HK0B 3RUGF 5JA9A 2BHZA 4UZGA 2CO7B 2A74C 4JFED 3RWGB 2QVFB 4U1JB 4CILA 1D5ZA 5KS9E 3UABA 2VLME 3EJPA 2WBJC 3I6LE 4BKTC 4ZFZB 1YEIL 4JFYA 3ABGA 1B90A 1NFIB 1UOWA 4G9FA 4JMNA 5DS8B 3BAWA 3IMVA 4BZ2H 2PXYB 3VGAC 4YLBA 2GB2A 3BCFA 3MGAA 3FQNA 4UYPA 3RJOA 1G1OA 3EJUA 3V4VL 5MEPA 4J3OD 5BZDA 4IRJA 3N85H 4NXKA 1B0GA 1KPVA 3ZMRA 3U6RA 2ZUUA 1N26A 1R3IL 2HXAA 4CNIA 6PCYA 1OTUD 2HZHA 5B39G 1A2YB 5A2IH 3LAFA 4Y19E 4BQCA 4PJHE 2E7CA 4PJ5D 3VFWA 1N5AB 4YQXL 4MDIA 1DN2A 2UX7A 3EYUL 1F02I 3N40P 2W9DH 2CAKA 1H15B 4LCYB 3A6CL 4EOWL 3MRJA 4ZFGL 1ZGLP 5DLMH 4DTGH 5EN2A 4BDVB 3RA7L 4PMFA 2N3JA 2WQWA 5LO7A 5JZ7C 1A7OL 1ETA1 3LRMA 3O6FD 3PQYB 5CZXC 2HJKA 2IWEA 4JFFB 4KQ3L 3MHZA 1BGXL 2X4SA 4YUEL 1MCPH 3QCUH 4O02L 1E8XA 3EGDB 4JJ5A 2CSPA 1UD4A 2ZYRA 1K3ZA 3O6KH 4L8BA 5CZKA 4GAJH 4N86A 1LE9B 5G4NA 3H9ZA 1E27A 1N0XH 3LS4L 4DZBB 1GS6X 2WZ5A 5GS2D 2DWEB 2APVA 5AW6B 5JOFB 3VXTA 3UC0L 4UT6A 1DUYA 3BJLA 4HKBB 4BHUI 1FBIH 4EN3D 1T2JA 3MLVL 1H6EA 3J7HA 3KHQA 4N2FA 4FABH 3EGSB 1MIEH 2V7NA 1KJ2A 2K0RA 1TLKA 1PD0A 4QF1A 2FEDC 3QUXB 3A6OA 3BRDA 3LV3A 3KWTA 1MJUH 1B88A 3D25B 4R4FL 4XAWH 1U8CB 1G0YR 3ABZA 1RIUL 4PV1C 1U8MB 2AK4B 2EO1A 1QWUA 3D39A 4UQ3B 2XNAA 1NBZB 3WO3B 4MA8H 4KFMA 3ZTNL 1HJCA 1AFVL 3BP6A 4JZNB 1EFXB 3Q9PA 3CFEB 3E38A 3LB6C 4U6HB 2EVJA 2P44B 4WFFE 4AL8L 3FAXA 3T3MB 4ZZFA 4KDTC 4P4KD 3UAJD 1R47A 1VADB 3HE6C 1KENH 2ALWA 3RVXD 4H20H 4YL4A 1FZMB 1JWSA 2HTLD 1KTLA 2Y0SA 4HUNB 5GRUH 1INDL 4B53A 2A74A 1MFBH 2XQYK 3FQ4A 1MOEA 1G6RB 4IBZA 2VDOB 4UOQA 1WK0A 3QVAA 1E43A 1PFOA 1JNHA 4QDGA 1XF2A 3BEVB 4KI1A 3RNKA 4G2AA 2HP4A 4PJ9A 3UIZA 2ATPA 1IBBA 3NCWA 4K73A 4XP4L 2YUXA 4ODBD 4OGYH 4U3HA 3HG0A 4HSAC 4NM4L 1XGYL 4OW6A 5CN1A 3BSZL 3O41B 3IFPB 3RUGA 3QDAA 1NEUA 2WLLA 1KYFA 4RFEB 3EOTH 4PJDB 1LEIA 3OXSA 2C3HA 1ZPUA 1UD3A 2VLJB 2CRMA 3PAYA 2QQNL 5BVPL 4TLSA 5DUPH 5I8EA 2JCCB 1PLGH 4IBSA 4PRNB 3WHE0 5HPOA 3ULUC 4ZUVB 3ZDYB 1GJUA 4CMHB 35C8L 3J07A 4ACTA 2ZUTA 1IAKA 2VXTL 3CFNA 1Q0YL 4B50A 2YQ2A 3PJSB 2QJDA 2MCG1 2GJJA 2DIAA 4OI7A 3ZKXB 5GRVL 2FX8L 2H26A 3EOAB 5IESH 5IW6B 2J20A 2LGNA 4RLDA 2SODB 4EEEA 1GYUA 2XQYG 3HHSA 3L8QA 2FHCA 4G8IB 5B1JA 1NCAL 3UBHA 4K23H 3TIEA 2Z0UA 4JZJC 5CEYB 4ANXA 4QRRE 3CUPA 1JMXA 1F1GA 3ROLA 5J6GA 1VERA 2ROYA 1D5BA 1N0LA 8PAZA 3JTSB 4GO6B 4IHOA 3OPZL 1LEKA 3T8XA 5JNYB 2X1WL 2D7OA 4XTRD 5AL8A 2NY0C 1RMFH 2D31B 1F4HA 5EC1A 4D0DB 2AABH 4FDWA 2APWA 1T0MB 5D2NB 1IC7L 2P5WA 4KDTA 4YX2H 2EXWD 4CC4C 4JPQA 3HE6A 3PV6A 4DPCX 4BK5C 1AZRA 3SDCD 4HG4J 2NYKA 4AZ8A 2LOEA 5SWSB 5I76B 1A4CA 3VSQA 4HOWA 4FFVD 5L2JA 3CFCH 4XVUD 1JV2B 3SBRA 2HKFH 1IAOB 1KGUA 3UZQA 2BC4A 4HDIB 3UJIH 3VFNB 4HKXB 4F7KA 2GBUA 5ISZA 4HUUA 4N5EC 3NZHH 4WHYG 3WUWG 3GGWA 5CBAB 2VABB 1S7VB 3H3BC 3A0OA 4PY8J 1MRDH 1D5ZB 2Q3ZA 2EIJB 2QL1A 3TURA 3QS3A 2VAJA 3HIZA 5HJ3B 1C5CH 3RWIB 3T0DA 5BMFH 3HC4H 4N0CC 2VIRA 2HT4D 3ARED 5A3IC 4N8CH 3AG2B 3E0GA 4LZKA 4WF7A 2DICA 4N6RA 1DVQA 2XG4B 2OS7A 1PQZA 2QGDA 4FGMA 1B0GB 2E7LC 3LIUA 2WB7A 3IPFA 2FUQA 4KAQH 3HNSL 4KU1A 5I1JL 3U6RB 3ARFC 3DHJA 2XIDA 3SYAA 3I50H 4W4OA 4BCXA 5IVNA 4YEEA 3CG8A 1JF6A 1KMGA 3VFWB 2C1PA 4WQOA 1YUHB 4G6JH 5AW2B 4W9FC 3ML8A 5BO0D 1EDQA 4DKEH 3B3IA 3WNIA 4A55A 2COQA 2V9TA 1ZVHA 3GSXB 2ATAA 1KCSH 1OGAD 2F1EA 2X4SB 4AOFA 1PZAA 2FJHA 4JJ5B 3P1VA 2XWTB 2VL5A 2BM3A 4MCNA 4XCEA 2DV6A 4L8BB 1OTTD 3FT3A 1GOHA 3IFNH 5F0LB 2YAQA 4JZJA 3MFFA 1IBYA 4W9DC 3ILQC 5C08D 1E27B 3II3A 4APQD 1WCQA 3NZ8A 3B7UX 1JGVL 4OGAC 2NY7L 4R4BA 4B7IA 2VZSA 2NXYD 4A04A 3FU3A 3L7FA 3DTXA 3D3VB 4XVJL 2RACA 3P2DA 2LR4A 4JM0A 2WW8A 3U4AA 4BQ6A 3X1GA 5F6IB 3P2BA 3IAGC 2OKMA 4CC4A 1MFDL 5IJBC 1QBLH 3QPKA 1UTDA 1URLA 2OL3A 4BK5A 5DK0A 1S3RA 3UEZA 4BRJA 3WXVL 4OIAA 1PCXA 4OLWL 3BP6B 5FO7B 5BQ7B 3IJSA 1BLNB 2XWJA 2AK1H 3GZPA 4HU2A 3PABA 3UXFA 1G7HA 3GKWL 4NGHH 3B7TA 3C09B 1S7XA 4POZC 3TVMC 4FNLH 1M1SA 3KLSA 5JIHA 1QVOB 1KIRA 1JWSB 1KTLB 3CU1A 4DHLA 1BG9A 4A1RA 1HQRA 1OOAA 2A38A 1SLXA 2IPUG 4FFYA 1KTDA 5LUMA 1YECH 2WBJB 5D6DC 1OSEA 1JPGA 1PF3A 1VENA 3CGTA 3K72A 1JNHB 7PAZA 3VGAB 2ICCA 1O6SA 1BYNA 2N59A 4XB8A 2IANE 3JQOB 2QVKA 2OLDA 1NKGA 5GIRA 3US0A 2ATPB 4WWID 1YC8A 2B9AA 3ZBMA 5IUCA 4MXVE 3BVWA 5JW5A 2E7LA 5IROD 2XA8L 3SKJH 3ARFA 4CSPA 3B9VA 2CLRB 3AC0A 4KGJA 4XP5H 5C0DA 4LVOC 5DSCA 3RUGB 3TCLA 1BEXA 3KVDD 2C4FT 5I9QB 2EO7A 3OXSB 2ZT9C 5D7IA 3T0ED 2EABA 4PBDA 3TBYB 1P84J 1JPST 3TJEH 2OSXA 4LDOB 5EZLA 2DWSA 1V10A 1GY2A 1IGYA 2NQCA 1G84A 2B0SH 2VMJA 5TDPA 3LQMA 1XGQA 3WGVB 4ZNCD 3AU0A 5SX5K 3HG3A 1TETL 4W68A 4PIRF 3MRHA 2WK2A 3VXNA 4NRYA 1ECYA 1AVAA 3V0WL 1OK0A 3WNMA 2R59A 2H26B 2NOYA 2VDKH 1CICC 1UXSA 1I7UA 3TT1L 3KPQB 4AMKL 2R51A 1QW9A 3BE1H 4AEHL 1FDLL 2IADA 2CHZA 3K5RA 2Y6TE 3D4ZA 3HHSB 1IGCH 2WQXA 3GSQB 3QNXB 1TZGH 3QHFH 3TIEB 5I0YA 4P4RA 2J6EA 3H3PH 1U0QA 3G5VA 2BVUA 4KX9A 4WLCA 2H4EA 5I6NA 1A6AB 1GMIA 3KCPB 3CUPB 4PLNC 1SOSA 1DCLA 3CN3A 4JDZA 3OJMB 1D5BB 1Z5YD 3VYPA 2XHNA 2BY0A 1R1CA 5HI3C 4AQ1C 4QPEA 5KVEL 1QYGL 4IHOB 2UVEA 4ECNA 3QJRB 4JREC 3MUGA 3LXUX 5EC1B 1R6VA 5CFAA 2P5WB 2QZQA 3TVMA 2AGJH 2C3VA 3HE6B 3FO9A 3PV6B 4P3CL 2D3NA 4XXCA 4MVBD 3CFTA 4OZHF 1SEBA 4PJEE 2XBTA 2J55A 1A9EA 5GGRB 1V3MA 4IU2B 3VD2A 4HMEA 5D6DA 3UZQB 2G9KA 1GGBL 1OAZH 4GW1B 2J5LC 1MI5E 2BNRA 2IANB 4F5CA 5CLZA 5C07A 5IMKB 1YN7A 4MAUH 2QPEB 2NY5C 1JFQH 5BRZE 2PYEE 4OZIA 4AK2A 2WIIA 3WHE1 1P6WA 4WWOA 4IS6A 3ZGHA 1SFDA 2ODHA 1QEXA 1FFPA 1TTRA 3CXHK 3OAZK 4POUB 4X7SL 4LEXH 3WKYA 4Y16C 2PYFB 2OCCB 1SY6A 4X5RA 4MA7L 2WGXA 3I9GL 3EH5B 1U33A 2H6UA 4MQXC 2QLYA 4KKNA 3LNGA 2MQ0A 3VRIB 4YDJB 4YHPA 1SXBA 1XCWA 4UNUA 3VFOA 4G8GD 3QG7H 1PQZB 2X12A 3BPOB 3DVIA 2FWOB 5LBSH 3OVUB 3NDZE 1E4XI 5JHMA 2YPVL 3DDGA 1ZTXL 5EUKA 3WJLC 2NY4D 1RU9L 5JO5B 1KCVH 3VMOA 1YRKA 1IT9L 5FUZH 4TNWF 1FORH 1OAXH 1JZ3A 2VQTA 1BAFH 4LP4A 1LXMA 1TNNA 5KUKA 3ALPA 2Q1EA 3L2MA 1RPUA 3BLPX 3B3IB 4ZTOL 2FT8A 3E1ZA 1JRHI 4M8VA 4IRSD 1IBFA 3DSFH 4TUJA 2R2HA 1UD5A 4Y1AA 2EDHA 2Q8AL 5F6HJ 4KKAC 1KBGL 4F8NA 5TQ0L 1FN4A 3ARBD 5D7LE 2QKSA 2VL5B 5BOZG 3GMPB 4XCEB 2V4LA 3HMWH 2A6KA 4X9GA 4F7TB 1CLOL 4LOEA 3WCYA 1RIHH 3PWVB 3UTPD 2YD2A 1CIUA 3SE6A 2A4CA 1WSST 3QXAA 5IMLB 4WW1B 3NZ8B 3B7YA 1CLYL 4R4BB 3S34H 1IB5A 5EEWA 3ZRSA 5IBLD 1ZEAL 2ICWA 3O3BA 5JIPA 3L7FB 5HHXH 4LSRH 3MUUA 1DJWA 1W8OA 3OAUH 2NY0B 1KN4H 5C0CA 4G6FD 5IQMA 4AQOA 3ZO9A 4LLDB 4OAWA 4K5NA 1NBVL 2CDGA 2YSSA 3CXDL 3O9WD 4HCFA 1FA4A 2NT0A 5DK0B 1G0DA 2I60H 1BPVA 3ZL4H 1N6QH 4NUQA 4YVUA 4QOKD 1AP2A 4I2XE 8CGTA 3PP4L 2R0LL 3ETSA 1UURA 3MLPA 5B1CA 3PABB 3ZOAA 2Y06L 1BF5A 2MPAH 2R56L 1IGJA 3HA0A 1ZV2A 4JRYD 1NAKH 1KIRB 4R2GD 1QSZA 4AGQA 3OB0H 4NP4H 2PYEB 1N5YH 5HHNA 1VZHA 4QCIB 4OIIH 5E8DL 1MCOL 1TDQA 4XB7A 3C2AL 4MJ5A 4L5FL 4ZYKA 4Y16A 3K72B 4FQ2H 1GGCL 3OXRB 1J11A 2IO5A 1QLRA 4OZHA 3CFKA 3MKGA 1YJDL 2ZXWB 3TM6A 4JY6A 2CXKA 4EIUA 4FI7A 1Z5HA 2NNAB 2FJFA 2HG0A 1B0RA 3E6FB 4WJ5A 4HT1L 3TWCH 4ZFOL 1YEKH 1DANT 4GKSA 2D2CC 4B6ZA 1XVSA 4PJ7E 4K55A 5JW5B 4HJGA 4BEIA 3V0AC 2O5XH 5KYYA 2VERN 2YUVA 1SFHA 5EU7C 3WJLA 3P3YA 3RTQC 5C0DB 5T5FL 2AV7B 3Q6FA 3TCLB 2J8UE 1L9OA 2OAAA 1USZA 2R9HD 4LPYA 1C5DA 2JXMA 4MB3A 3ZDZE 2XG5A 4OFPA 5D7IB 5LAXA 3TBTA 1HOEA 4XMLL 4QJ3B 4YGVA 5C9JA 2GHWB 5JXAL 3M1BA 4YHZL 4XXDA 3QULA 2I5YL 1IGYB 1T1YA 3NSDA 3QR2A 4N8UA 1XGQB 2AEPL 4AYGA 2I7OA 4UMSA 4QYOA 5F1NA 3VXNB 1Q72L 3X3GL 2GPZA 4PRBA 5D7LB 5FCUL 2J8HA 1MELA 3OKLA 5FM5M 2QFPA 5I1AB 1T66C 4MJID 5ITFA 5FA3A 1UXSB 5D1XE 3QUML 4ABUA 3DC0A 4UF7C 4BFRA 3O8XD 3CIQA 3QG6A 4G11A 2GJZA 3P3TA 2WTOA 2IADB 5F7HA 4OCLC 3KXFD 1W91A 1FZKA 3BYTA 4FP8H 4WTXA 4BWTA 2RCSH 1NGZA 4PTUB 1NFDA 1NKRA 1KTRL 3DYOA 3L5JA 4P4RB 5KSAD 5IIEB 5TE4L 3G5VB 3B9DA 1UYWL 2YS4A 2NYYD 4JDZB 1NC2D 1AKJD 4KK9D 2ZKHL 5D5ME 2HTKC 4AV0A 5FYLE 2KLRA 5H37G 5FUCE 1DO6A 2DI9A 5IBTL 5IVXE 3SQOL 1ZVNA 2V2XA 1IBHA 4MS8D 4P2OD 1TVHA 3MUGB 3D6GA 4AITA 3ZDXF 1I1FA 3DX9A 4JRFA 3L1OL 4PV8A 3TVMB 1O7VA 3ZHFA 3V4VA 3NEXA 3U2SA 5K93A 3UTQA 2HH0H 4OKVA 3X2QB 1LD9A 2B14A 1U8KB 1A9EB 4JQXC 5FHAL 1IC5H 1SOKA 3ESPA 3HI6H 4HD5A 1AD9A 4XMTA 1U58A 1SDDA 3BAEL 4RWYL 2QDWA 4MWFB 1JDCA 2L3BA 2AQ1A 3L7EA 2X4QA 1CDYA 2VN3A 1FGVL 1S6NA 3KLAA 1OY3B 5C07B 1YN7B 3AXHA 2JIXD 3BZFB 1TTAA 4OZIB 1RSYA 4YHKL 1BZ8A 5AAMC 4RGMC 4H26B 1LK2B 1LO4H 3I3BA 2AHIA 1UVQA 4HJTA 1CR9H 3EFOA 4O02A 4FFWC 1LO2H 2IBBA 1U3YA 3NJIA 1DVTA 4LPUA 5G5DB 4I89A 2BCKA 1TSHA 1NL0H 4YHPB 3RVUC 3QEGL 5HHVH 5SWQB 2FWSA 1E4XH 1YHPA 1XGUB 4KKCC 1CGWA 4Y4KD 3AXLA 2OMTA 4P23D 1E5AA 1WEJL 5EU6E 5E7BA 3N0PB 5T1KB 4OSUH 5LCVH 1QASA 1R3KB 2R1XA 5D2LF 4Q56A 1E8YA 3HVDA 1C7SA 1KGWA 4WFHD 5JPMC 1S7UA 2Y7QA 1WP6A 3THMH 1YMMA 4HPYH 1PSKL 4OQTL 1CC3A 4JQIH 1OAQL 4ERSL 5D9SA 4JFDD 1REIA 2YZ1A 1CICB 1S7QB 3HMXH 2ZNWA 4OR1A 4BV1A 3DI2B 1UZGA 3ZUCA 1Z9SA 1G9ML 1JNLL 1OLZA 3IMTA 4TUJB 3TBBA 4NX0A 4Y1AB 1S4IA 1VFOA 4B9YA 4NQCE 4N2EA 5IV2A 3MLSL 2HG5A 5I8OH 1FN4B 5DFVD 4FXKB 1TQSA 1Z9PA 3V6FA 1XEUA 2A6KB 4U0RB 2HUEA 1MFCL 1C08A 2ZX7A 5E94A 5C0NC 2UV3A 2VLKB 3ZW3A 3IPBA 1NCCL 1A8JH 2LLNA 3WL9B 1T0NB 1P5UC 1A4AA 2WLMA 5FO2A 3GXDA 4AQ1B 5J8OA 3QIBD 3O3BB 4DETA 4L3ED 5LLIC 4YHLL 2CKBB 5T3XH 4YSOA 5DJYA 2ZWNA 1DQDL 3VTMA 5KW9L 3GS4A 3WLBA 3G5XA 5C0CB 5KTEL 2YMTA 4NC1C 1BJMA 2Y5EA 5E8PB 2WKLA 5AYUL 3NQKA 2CDGB 4PJAE 2UXGA 2Y3AA 2W9EL 3C5JA 1U8HA 3QAZC 4N1HB 3UYRL 1ML0A 3GTNA 4WWPA 2CRIA 2R1WA 5F3BA 2K4AA 4U1GB 1D7FA 4QRSB 3RPIB 4YBLC 5I1HH 3DMMD 5E6SB 4ZS6C 3JZYA 1OCWL 1IGJB 2J5LB 3FOMB 4D94A 3U36A 4YJZL 4N85A 3TZVD 3CC1A 1AC0A 1JZ7A 4YSUA 1NIFA 2FJGA 3F84A 5CD3B 1L6XA 1SN2A 4C47A 4EAEA 5HHNB 1R46A 3HZVA 4Z8FH 1M42A 3IYLW 1JTOA 2X2UA 4LSPL 3B83A 2DQFA 1RIVL 1JF5A 2FQGA 4TKWA 1GGYA 2IH1A 5GRJH 4Y16B 1S8DA 1QLRB 4XNMB 1ZE3H 3TNNB 3GO1L 4OZHB 3VFSB 4F93B 1IAIL 1K5NA 1QRND 4JY6B 2VR6A 3G6JE 2FJFB 4LCIL 4RISH 4Y8AA 3QNYA 2EUVA 1N12A 2V2TA 4GKSB 4XPBL 2J56A 5K9JH 3APDA 2O30A 4GO8A 2FBJL 3K6OA 4FJZA 2J25A 1TZIB 1FNSH 4HJGB 4J3UA 1OP5H 4QRBA 4QRUA 1BIIA 1NCBH 1YEJH 3TBVA 5KYYB 3LDBC 1WPCA 4K7PY 4MX7B 1KV7A 4PJ6A 4LGRB 2JXMB 2IPTL 2QMJA 3WFZA 4U2YA 4W9IC 1IC0A 1BQHG 1WD8A 2XG5B 3LNDA 4DKFL 5JPMA 4TTDD 3GS0A 3A22A 2M1KA 2DIEA 4BH7A 4NC0B 3N42F 4YGVB 3O3AB 3M1BB 2YWZA 5D7KE 1NINA 1DJGA 4MJ2A 1D9KC 3EUUA 5ALBH 1CDBA 3R06B 2BWQA 1AQKL 5F1NB 2JTYA 3OSVA 3ARRA 2WLNA 4HEPA 3GB7A 5DMGD 2NMSA 2HRLA 4HKJA 4LKXB 1LMIA 1OSZB 4UUJA 4Q2ZA 4DQOH 2AI0H 4DK5A 5ITFB 2CM6A 3QEUB 2Y07L 5IHBA 4B0MB 4NQDE 2XOTA 2GG1A 3QG6B 2K3HA 3UBXI 1DVFD 2PW1B 4KI5F 3DVGB 5D2LA 2MSPA 1J1PL 1XSOA 1NGZB 5FW6A 2JB5H 5KJRL 1NFDB 2WXLA 1IM9D 5MHSE 3NCJL 2EVFA 4PGZA 2DD8H 4OIBA 3GMNB 4KX8A 5IHZB 1MF2H 1UA7A 2NR6D 4PJAB 1JFHA 2F8VA 3ZE0F 4YDKH 5F7FA 1RURH 2FL5A 1FNEA 2A9BA 3P9LA 4JVUA 1JBJA 5EU5A 4BIKA 1TQWA 2Z7UA 4GMTL 2WYIA 1TVHB 5HGBB 3E6HA 4LHQB 1WUZA 3MA7B 4JHWL 3DX9B 4PV8B 3QFJA 2X70A 3NPSC 2J3SA 4QY8B 3V4VB 3C87A 3U2SB 4KI5C 4HJEA 4BE5A 4OKVB 2LLLA 4PCTA 1LD9B 1MNUL 2EEDA 4OIFA 3HRZB 5L4JA 2L7QA 4R7LA 3F5WB 4XN2A 3V4PL 2YD4A 4G9DB 1YY8B 1AD9B 2R2EA 3FCBA 1U58B 1SDDB 5DD5H 3TA3C 5J06A 3Q43A 1RL1A 4PV9A 5KVGL 3LCYA 2BVPB 1T7ZA 3L7EB 2HT3C 2X4QB 4ATTA 3BFWA 3HE7C 3KLAB 5FV2A 1PEZA 2YN5A 1PZSA 4J4PC 4LE8A 3G6JB 3LZOA 3ATDA 1A14H 1VJSA 5D8JH 1YEHL 5TF1L 4OZGF 3RJDA 1MCBA 3MOAH 1UVQB 3QIUD 2R7EB 2A99A 4YN3A 3GMMB 3EFOB 3S0PA 3RTQB 2BCKB 4PRIE 1JHLL 2Y2YA 3WS6A 3TEXA 1BJ1H 1MFMA 1QFWH 3VFRA 1XSIA 2KERA 3AXLB 3ISWA 4FG6D 1ZLEA 2OMTB 5FPIA 4YFDB 1D9KA 3MRGB 3KPMB 5BW7C 1FQ9C 3CLWA 2ZYHA 2Z65C 2L0DA 2FJUB 1S7UB 2Y7QB 4K3GA 2IAMD 5TD4A 2H6PB 1MWAH 5TE6H 4XBGA 3H6JA 2EIEA 3W56A 3V8OA 1UENA 1Z9SB 3NACL 2WO2B 1QEWA 5I6LA 4M6MH 1MJ7H 1MXDA 2VR8A 1ZT1A 4AVHA 4EKJA 2N1TE 2HG5B 4LCWA 1MW0A 5B7FA 4ETYA 1VGKB 3V6FB 4AQEB 4AVKA 5KAQG 3KPSE 4AKPA 4QNPE 5GZNC 3FO2A 2R83A 2UXVA 5L6YH 3I02B 1E9QB 3RNQA 4Z7UE 1CE6A 2CIKA 3WFEH 1MPAH 5EO9B 1MCNA 1D5XA 4YHYC 5A6LA 4NN7B 3EFFB 4Q58C 2ENYA 3NAAL 2ZZUT 1R3JB 1G4MA 2ICEC 3EZ8A 5FDYA 3VXUB 1D6EA 5EORH 1CZ8L 3CDCA 2JJUA 3H56A 4OJFH 3TF4A 2PPCA 3PAVA 5DR5H 5FECB 2DM7A 3RZWA 5HXMA 4NZUH 3C5JB 1XH2A 4N2KA 1U8HB 4N3UA 5JR1L 5T1LB 4P9HC 4PP1C 1EJ8A 2OMVB 3ATBA 4NAJA 3TA3A 2WOYA 3BGFB 3TP4A 1XR9A 4MCMA 1NC4D 2B59A 3U36B 3HE7A 3VG0L 3LOWA 4J4PA 4W9GC 2MHAA 3NGBC 2VXVL 1CBVL 5I1DA 4LNRA 2EYSB 4NO3A 1YEGH 4RNRB 1YNTA 5GS3A 5EF2A 4AYFA 2DQFB 3NUKA 4PYGA 2E3VA 4F9PA 2XWEA 3ZDXB 2ILLA 5AOZA 1JI2A 4FNTA 4XC1L 1LL1A 1QSEE 1S8DB 3JTTA 4UV4H 1ZY9A 4CADA 4OFKA 3O4LD 4K5LA 4PRIB 4E5XG 4P2QE 3WI9A 1K5NB 4G7QB 3FQXA 3TJPA 3PHAA 3W9EB 4XMWA 3GSWA 1T89C 1F6FB 4ZUWB 3Q5OA 5EU4A 5C09D 5E99L 4AJYV 4FNQA 2CLVB 3T0BA 1ETZA 4FQIL 2OMUB 5LGJB 3S36H 4JDTH 4JCMA 3BSHA 4HIHA 4JG1H 5EIIB 4EO5A 4D0CA 5BW7A 5F7UA 4NAQA 3NABH 3QT2A 5K9OB 3QPQD 4JM2D 4BH7B 4N0YH 5J3HD 1BBDH 1Z1WA 5ECGA 1VFAB 1XGTA 1E2VA 1OQXA 2WQ8A 4BZ2L 3IWVA 5LWYL 4BK8A 3SCMD 4DAGH 2AJVH 3HEIB 5K9QI 5F0MB 3SQBB 1J05A 3AAZA 2A6JB 3GB7B 4M7LH 1D7BA 4EIBA 4QXWA 4L0YA 4UUJB 3F65A 4N8VA 3WKMH 1VB9A 2RMNA 3VD1A 1IGIL 4Q9QL 5B7MA 2HLAB 5E1QA 1CDIA 3UPRA 5GZNA 1V05A 1KPUB 2P45B 2O5NA 5ACLA 1P5UB 4HIXL 5D2LB 3IE9A 1UUSA 3LN5A 4R83A 1Y6KR 2FGWH 4G6KL 3N55A 3EHBD 1T22B 3QBTB 4XAKE 1KGXA 2W9DL 4NZRH 4QAWA 5HHOD 3UYPA 1JZ2A 1SLUA 2OYKA 3IJHA 1GGIL 1T1WA 2ICEA 4W4NA 4QLWA 4AXWA 4R26H 1OO2A 4Q6YA 4J1UB 3S3DB 1TTFA 2FL5B 3IDNB 1MCPL 1FNEB 4ZJ9A 3P9LB 1B4JL 1NJ9B 3G6AB 4LRNH 2H5UA 1EHXA 1UWXH 1H3VA 5B39A 2YXWA 3OF6D 1LEGB 3QAZB 3O6KL 5LXGL 4YLCA 2OI9C 3C9NB 3OB0K 2Y7LA 1YJDC 2OR7A 4YBLB 3C6SA 1NUGA 3PREA 4XN9A 4RIRA 1VEOA 3AGVA 4WUUE 4Z7QB 3VGHA 2F8IA 2DBLL 1RUPH 2C5DC 4M3KB 4DO4A 2YPVA 2PP9A 5DWUH 4FABL 5KVFH 2KQMA 4KROC 1MIEL 4Y19A 4ZS7H 1DVUA 2ZYIA 1KLGA 1CJYA 4JS7A 4GG8B 2DYRB 3JZ7A 1UUNA 3HS8A 3BAIA 4U4IA 4U2ZA 4WUKH 3HLKA 1N7MH 1XGPB 3MJ6A 3GI9H 3DK2A 1KJVA 4ORZC 1FNFA 3AW5A 2G9HB 5EA0L 1OGTA 2OV0A 3FFDA 1T89A 4LGSB 5HP5A 1ZA3A 5DJ6A 3NJGA 2JQAA 4GUPB 4N0RA 6TAAA 3FAWA 1KJ3L 2VN7A 3I75A 4X4XA 1KENL 4B3EA 4A2FA 5DRXA 2XWBB 4PWKA 3WG7B 5JTWA 1NWOA 1KN2H 3FOLA 3QGVA 3HUJE 3K0WA 4RGOH 4XO9A 2MNJB 1OLLA 1HZLA 1AR1C 1TQCC 2ZD0A 5FA4B 2ZOTA 1MFBL 1J5DA 5C0AD 3UCRA 4B41A 1H19A 2R4RH 5SX4I 1AAJA 2GK0B 2XY1A 3VFRB 4LLYB 3BN9D 3BHBA 3FB5A 2DQIH 4X80H 1MZYA 2DB8A 5HYJE 4QLRA 3U7WH 3WSQL 3CN2A 1JDAA 2UWEE 4FFZL 4PY7A 1RK1B 1P5VA 3JWNE 4OGYL 1EV2E 3W81A 3V0EA 5H2BB 5L9DL 5IKCB 2YC1B 1WAAF 4YDVA 1KXVC 3LEVH 1WZMA 4XBGB 5IW3A 4I3RL 4HJ0C 4RMTA 5IW1A 4Y2DD 4HJJH 5CWSB 3EOTL 4M8UA 4PBVC 1L9SA 3D85B 5DUPL 1MJ8H 1PLGL 1TZ8A 1AC6A 1IGTB 4FXTA 1H5BC 1I1AC 2RIKA 5FLVA 3RNQB 2Q7NA 1NMBH 1CE6B 2CIKB 2VRKA 3KR3H 4XPGL 4N0FB 4J8RA 3U9WA 3RU8L 4K3JH 5IWLA 3WN6A 5EN3A 4GY4A 1OAUH 1D6EB 5JHLA 3ZKSD 2XWDA 2IOOA 1HDMA 3NPSB 5K33A 2X0WA 1FC1A 1EJOL 1F4AA 4YDNA 4ZOAA 1PNDA 2A9AA 4OUUB 1IEHA 5KSUA 6CGTA 4RFNB 4L37B 5TPWH 1WFMA 1WV7T 2B2XH 4X8JA 5D1ZC 2QGEA 2N7BA 5T5FA 3TA3B 1XR9B 3IE4A 4JDVA 3PF2A 2VN6A 1FNLA 1I9IH 2B59B 3FHEA 3SKMA 4NNPH 4WO4D 2MHAB 3IETA 1M9SA 1MIMH 2UZIH 4WWKC 5CXPA 5I1DB 3WE1A 4NO3B 3IFLH 4GG6E 1YNTB 1RMFL 3DROB 4BA0A 2XQYA 1F97A 1UT2A 1OP9A 2AABL 4AYEC 1QTSA 3AQYA 3MMEB 5AKTA 1RHHB 3D09A 1WE5A 2NZ1A 5GRYA 2YJLA 3AS3A 1MLCB 4WU7B 1IV8A 2R0KH 3JTTB 5D7HA 43CAA 2VDPH 4XCFL 2HMID 2QTEA 3HUJB 4ILDA 4TQEL 3BFQG 2BRRH 4H1LH 3FQXB 5FOBA 3CFCL 4CSTA 4JRLA 1S9YA 3QUMA 5C6TL 1RUQL 5IM7A 2HKFL 3P3RA 4LLMA 4BFEA 2VQ4A 4BKLB 1GXEA 2CGZA 1TMQA 4BCZA 4NN6C 4CN4A 3D69A 1KYUA 3UJIL 3BC9A 4KXDA 2DTSA 1Q9WA 4XHQA 2UWEB 5DT1H 2FBRA 1C16A 3ZKQD 4FD0A 4MXQD 2ZKWA 3BLKA 4OCWH 1MRDL 1A6VH 2D3JA 3GK8H 3KYMB 1XGTB 3O6MH 1KXVA 3VUAA 4P49A 1C5CL 3GTTA 5BXFB 5DI8A 5BMFL 5I1CH 1DCEA 3HS0C 4NIKB 4XCNA 3SPVA 1QLEB 4RGND 4TNFA 3DHMA 2WLJA 3VFTA 1J05B 5IR1B 4PJGE 3IS0X 4RVBA 2YK1H 5CSZB 4NWTL 3WUWA 3W0WA 3ARZA 3MV8A 2A73A 5AZ2L 4N8VB 1N8OE 4KAQL 1IEAA 1SF3A 3MYZA 4F8TA 3UPRB 4P2CG 3I50L 1G5AA 4G3YH 1I1AA 1R75A 2HLFC 1CF1A 4XPHH 5FIEA 4MXVF 3DJZA 3LN5B 4CVXA 3C6EA 4QHMA 4G6JL 5J11C 3HG2A 2P1YA 3OR7A 1WAAA 3I6KA 2CO3A 2ISDA 4QHPA 3IJHB 1T1WB 1C12A 5DUMH 1XIWC 1KLFA 3VGFA 3L16A 1IO4C 5DVKA 1ZK5A 5B39B 1MG3C 2ZF8A 4ZPVB 3IFNL 4HS6A 3ZXAC 3NJFA 4ONGH 4QHNB 1BOGA 3RTLA 1DJIA 4WI3A 1VZGA 4R3SA 2FQFA 4OLZH 5LKNA 5C0FA 1YYLH 2WLYA 3V5DA 5T3ZE 4QYAA 1CPUA 1IFRA 1TIUA 5B3JE 2LABA 5EBLB 1Q94B 3IXAA 2AKRA 3MGOA 1DFXA 2PCXA 3MSPA 4NC2B 4HFUH 5D96B 1EEQA 3GUFA 1QBLL 1WC7A 5DJAA 3BPNC 1KCLA 2K78A 3LHPL 3T77B 4CBZA 2ATKB 3BRGC 1SYSA 2BDNH 1OM3H 1OTSC 4OQTA 2CHDA 4LGPB 4C56A 3FTGB 1WT5C 4N87A 4GEJA 1OGTB 4G43A 4JHBA 4BQ8A 3FFDB 1J0KA 4F7PA 4WJKB 3QQ4A 4U1SA 5DJ6B 3RWDA 3WE6B 2R69A 3ABLB 4NGHL 1OGSA 3H9HA 5D71H 1Q9OA 3TBWB 3RZCA 4FNLL 4B95C 3I75B 2GTZA 2YPLA 3IDIA 4X4XB 4WI0A 5DRXB 2BSEA 4TYUA 3P02A 3WMQA 1AO7D 3QHZH 5DJ8A 4C4KT 4KJQC 3MLUH 5L8LB 3MJ9H 1I3VA 1QBML 4LESA 4LPCA 5SX4H 3JVGC 3BCDA 4PLJD 1SDYA 1X5KA 4UNVA 1D2OA 2BOCA 1AS7A 1EAQA 3ILDA 4PJEF 5DJZB 3SGKC 3FB5B 4GAGH 4QHKJ 1RZKH 1T1XA 3M88A 3OMNB 4D9RE 4BINA 3P3UA 2VSDA 5KSBE 4PY7B 4HWBL 3U83A 1ZKAA 3WEOA 1P5VB 4TNVF 3AQXA 1P6AB 4BM7A 1MWOA 1BZDA 3FSOA 3LPWA 3N50A 4G6AC 3JWOH 1N67A 2JWYA 4L1LA 4ZMTA 4YE4H 5IW1B 4XP5L 3P9WB 1VA9A 3QQ9D 3A67H 4W9JC 4NS0A 4RZCA 2KPNA 1E6OL 2YEVB 3OL2A 3Q8EA 1MFUA 1ID2A 3VXMA 2XJKA 1NCIA 3TJEL 4FQQA 2KL6A 4JL2A 3G3LA 3T71A 2B0SL 2Y22A 2NUPA 3HFMH 4R4ND 1DLHA 5EWIH 5CM1A 1XIWA 4QRAA 1VFBB 1XL4A 5D70H 1UZ8A 4F8OA 3PWJA 1TEGA 3GSVB 5DZAA 5A2AA 3AY2A 4L1BA 3RHWK 4J8RB 1DE4A 3L3OC 4WY7H 4IOFD 1EEZB 5CZVL 5E2WH 4FS0A 2OI9B 2VDKL 3D87B 4IKNA 4OI8A 1E8ZA 2AEQH 1R5IA 3F7PC 4HV8A 2E27L 5CJOL 1U8OA 2Q86A 5I5IA 1QW8A 4I88A 2QHLA 1IGCL 1JG9A 4OZ4B 1A7QL 2GITB 2QVIA 1TCMA 3G5ZA 1FF5A 2YARA 3QHFL 1I75A 5DK2A 1SMAA 3TBSB 2OQJA 3H3PL 4C57C 3QRLA 4KROB 1CF8H 5BO1L 3VAEA 1A8ZA 1I7TA 1M7DB 2CNYA 4P3WA 1AZBA 2DYPA 2E7MA 4MS6A 4WKZB 4Z95L 3SKMB 2VKXA 3DECA 1UKTA 5F89A 2YKKA 1Z3RA 1T7WA 2Z35B 2YBRB 2MCPL 4UT6H 2WYZA 1WT5A 4NRZB 4WGWB 4PJCE 5CD5D 3FT4A 3LZLA 4L23A 2CRZA 3FFCE 3GXPA 3HG1D 3FTXA 5HGDA 2AGJL 5I5JA 4J3OC 1RZ7L 2ADGB 2GJ6A 4NO2B 3D51A 5FOBB 1NEZB 5LQBL 1I82A 3CPLA 1AR1B 1TQCB 3QUMB 1OTUC 3ECVA 3JVGA 5IM7B 1E9PA 1AE6H 2YMOA 4LQFH 3AUWB 5EO1A 2VMEA 1OAZL 3NSCA 4JFSA 3SGKA 5EG6C 1Y18A 1U2YA 1XMEB 4XCCL 1L6ZA 5BJTA 2OZNA 1C16B 5KSBB 1JFQL 3N1MC 2DF3A 1S3KH 3ZYOA 3UTSE 3N9GH 3O6FC 3Q6GH 4O58H 3CHXA 4A6YH 4I1RA 4DERA 3NFPA 1H3PL 2B4CC 3U25A 4YFLF 4NQEA 3QYMA 3L4ZA 5E4EC 1QI4A 1YNLH 4LEXL 1H3UA 4NKIL 5DI8B 3STZA 4L2LA 3RKDD 4XCNB 3FU8A 1E67A 3CBJB 5ECJE 3UMNA 4E41A 2KDGA 4OFYD 1GZQA 4N8PA 4AJVA 3VFTB 3P4LA 4YSSA 4KH9A 3QG7L 3QRGH 4XPAH 3OC5A 1ZHLA 3CFJA 5CHNA 4FHBD 4EN3C 3UH8A 4F8PA 1KIQB 1H5BB 1X5XA 3ORJA 1I1AB 1KCVL 3V4PA 4F37K 2I85A 4Q97A 1TUPA 4JFPB 1FORL 3NRFA 4G7SB 2HJLB 2JSFA 1P1ZB 2HFFB 1BAFL 1MI5A 3W39A 4QHMB 4OM1H 2RBLA 3B37A 3L3OA 3HNTL 4GRLB 5HDQL 3OR7B 2WANA 4NBXB 4IRJD 4N20A 3QUKA 3VYOA 3ZDZF 2DQCH 4NIYE 4A37A 5IOKA 3DO3A 2XICA 1KPRA 4JFOA 3E8UL 1C7TA 4YIQA 4P4KC 3UAJC 1XR8A 2IOIA 5EZIL 3F12B 4LHUB 3HMWL 5D1ZB 5JOEA 2HTLC 5C86A 2VTFA 3MXWL 1LDSA 5GISH 4H25A 2ZTBA 2WN3A 3TN0D 5JMOC 2NY3B 3Q8FA 3ZGIA 1ZK9A 4R3SB 3GFUA 3CN0A 3S34L 3BUIA 5C0FB 3T4YA 3V5DB 3LTVA 4H13C 4WWKB 3L3GB 4KXCA 4H8QA 4LSRL 4PJCB 3OAUL 4QXUH 3IXAB 2X6AA 2AC0A 3NRPA 1UXWB 3TESA 1A6ZA 2P8LB 4LF3A 1UM5L 4PGCA 1WC7B 5E1AB 5E8OA 3AUVA 4YAQB 2WTRA 3P69A 3AU1A 2ADJB 1SYSB 4QKXB 3QS2A 4C56B 3ZL4L 1N6QL 1W16A 1UEYA 4U1MA 4UT7H 3U4KA 2BIPA 3BT0A 1EXHA 5AOIA 4G43B 5CGYD 5LN4A 3VQ2C 3GSNH 5D5MF 4ZDHB 3QQ4B 1QWHA 4F7PB 4IRZH 4YK4C 2Q2LA 4QKTA 1Q9OB 4NN6B 4EDXB 2MPAL 3IDIB 2X41A 3CZJA 1NAKL 2YAMA 2APFA 4RETB 5DJ8B 4KO9A 2MTPA 3RIAK 4NP4L 3B43A 3O3DA 3D39D 4AGPA 4XO3A 3O6FA 4X6EA 3GSRB 4WO0A 3PXHA 1NCDL 1MQKH 4F3FA 1E9OB 3ZE2E 1E5ZA 1NH6A 2BOCB 3PGCB 3QWRA 3S88H 4O4YH 4J3BA 2Z93A 3ZQ9A 2FYYB 3ARGB 3HS0B 3VFGL 1ZTMA 1AS8A 2E8ZA 3OKNB 2GJRA 1M05A 1YEKL 5DURB 2QSCH 4HBQA 4GW4A 2XLLA 4F15C 4J6IA 1FO0B 3CVDA 1T4KA 4N2HA 2DKMA 2OTWA 2WNKA 3IJYA 3P0YL 3DRTA 3UG5A 4PTTA 2JH2A 3QRFM 4KRNA 2Y24A 4QTIL 5A2FA 4PJ9D 4RZCB 2DMHA 2FHBA 4QHLA 1EUTA 4JKPL 3VXMB 1U8IA 1HZHH 1KB9K 5J11B 2RH0A 1YDPA 1UWXK 2NUPB 4FLHA 4XTRC 4XE0A 1FYTA 1ZHBA 1XIWB 1ZOXA 5I17A 4HEMA 2CNZA 1BEYH 4XNZC 3AVEA 3PWJB 2EXWC 3QWOA 2F1AA 2ZICA 4TMPA 5KOVC 4GRWE 5IFJA 3NIGB 1DE4B 3SDCC 2CJ3A 3ZX1A 1DO5A 4FFVC 4NUMA 5F9JA 3NK3A 2YGPA 4URTB 3BN3B 4ONOA 4YC2B 1BVZA 1CXHA 5CZXD 3FUHA 4S1RH 3JUYA 4NJAL 2Q86B 4FP8L 3RY5A 3TIDB 3VDBA 3X13A 3IGFA 3G5ZB 2VR3A 2CK2A 5KZCD 1EEYA 2WVTA 1FCGA 4G8EA 2JQZA 2FK9A 2EXTA 5I0ZA 3EG9A 4ADIA 3BPNB 5JOPD 3UBXG 1ES0B 4PI2A 2F68X 5F89B 1W0VA 2CQVA 5BS0A 2W0FB 4Z3HA 4BZ2A 4PUBL 2HT4C 5DVOA 3AREC 4BFIA 1X4YA 4X6DF 5HGDB 5E9DB 5LN8A 1HEZA 3AADB 1BWMA 3V6ZA 4DKAA 2E7HA 2FEDD 1PTZA 2D7QA 5I66B 2HH0L 4IMLA 1Z9LA 3UP6A 5D1XA 2H0JA 2D8KA 2BNQD 3LEXA 3CPLB 1IC5L 3AG3B 5HVHC 4K7PL 4HS8L 3ZE2B 1T6BX 4PWJA 1SBBA 1YEEL 3EYOA 4ZMYA 4ZQTA 4HSQA 1HE8A 1U3NA 3FRPG 3Q13A 5IBUG 4PJ5E 5FKAB 5PCYA 2TAAA 1WA0X 2FH6A 5DD6B 2O4EA 5BJTB 3T2LA 1Z0NA 1AKPA 1NOFA 3WTSA 1WIUA 3GBMH 3NFPB 5D5MA 5BZWA 5F7MC 3U1QA 1AGFB 4LDLB 3EO9H 2JMRA 1OB1A 4JPIA 4R96B 1AQHA 4NKMB 1LO2L 4IJ3C 3STZB 4AIOA 4E41B 1OTTC 2VMFA 5ISZD 1GZQB 1NL0L 1XH3A 2A7BA 5D93C 4AC4A 5JHDE 5B1AB 1NOAA 4YXLH 3NFSL 1R0AH 4APQC 1QAWA 1OW0A 1BJ8A 1CGXA 4JRXE 4OD1H 1ZHLB 2NXYC 4HH8A 5CHNB 1N9PA 2QSVA 3HBQA 4OSUL 5LCVL 1E90A 1UJ3C 4QXTA 2N56A 3E3QC 4FMKA 5GSRA 3X1FA 4A38A 3W39B 3THML 4HPYL 3L3OB 4OZFH 2EIBA 1AHKA 4JQIL 3PGFH 1FFOA 4EI5A 3KHOA 3HMXL 3QUKB 1T5KA 3CCHB 2HVKA 5ID0A 3H42H 3N1FC 3K6IA 5F7EH 2KZBA 5EUOE 5AVYB 3W2DH 1KPRB 4MYWB 5CCKH 2IBZY 4JFOB 2MRYA 4P2RA 5C0EB 3IPEA 1NBCA 5I8OL 3AT9A 1NMAH 4MD5B 5GJSH 4IKKA 5E24E 2NQDA 4JGMA 5IEHB 1JXJA 3PLYA 4OBSA 4R7NA 5DDHA 4E9LA 3SPGA 1JK9A 4ZSOE 4JFEB 1GCYA 1FHGA 3KDMA 1YYMH 4F7CA 1Q0EA 4AKOA 4OY9A 4OJDH 4YEFA 2VQUA 3K3QA 2YQBA 4EE2A 5T3XL 1SJHA 3VM7A 1Z3GL 4B9FA 2XRAH 3F62A 2XZCH 3AREA 3RWFA 2PR4H 4TOYH 3LRHA 1A6PA 1A6ZB 2E86A 1D3CA 1J0ZA 2MNWA 3IDJA 3QRBA 3FN3A 1CXKA 3GIVB 3KCWA 3HBGA 3SPCA 5E8OB 5A7EA 1HNFA 1Q1PA 2XV0A 5I5RA 4R97B 2WTRB 5T33L 4FULA 5DGQA 5IROC 1S7RA 4DP1X 2UZPA 2ORBH 4DFHA 3SO5A 4XX5A 2C7UB 3MA9H 2MOGA 2CBPA 1J1XH 3ZL1A 2F53A 5I1HL 4ZO9A 4PJ5B 3T0EC 2A6DA 2AVFA 4K5MA 1BZQK 3KYNB 4NCC2 3BPLB 4RMWA 5CBEB 1QP1A 4MCYA 2Z9TA 3QORA 2ZXDA 3O3DB 4Z8FL 3FPYA 3O6FB 1L0QA 4X6EB 2WNGA 1OGAA 1RLWA 1Q4NX 4X6DA 4KJYB 4F2EA 2E9BA 2C1OA 2H3NB 4N2OA 1J8HD 2HVJA 1BQLL 1KUMA 2Z93B 1MDAA 1LQSR 2V2WB 2ENSA 5JIMA 2VDRH 5DZPA 5C08A 5AAPA 1S5IH 1I85C 4N5ED 4QMEA 5HDBF 4OM0H 1M05B 3UTTA 1M6OA 5BUAA 3EAKA 3BZ5A 4EMZA 4Z3EA 5F3HB 4A7VA 2IDQA 3VXRE 1O6VA 1O5PA 3DXAE 4N4YB 1CIDA 1NCBL 1YEJL 4EN3B 3H9YA 4JAMA 2OTWB 2NSXA 3IJYB 3E9TA 5TH2A 3FQRB 2FIRT 3QO0A 1KCUH 3QZWG 3QK0A 4FTVD 4JFWA 4N0CD 1IU1A 4FERA 1AZVA 1FZOB 1X5AA 2DLFH 4H1LG 4QHLB 1F56A 1JS4A 4IDJH 1RUAL 1U8IB 2WMPA 5TQ2L 2X9WA 3DVFA 5F9DC 1YDPB 3BP4B 4GINA 3UJJH 5HYQA 5IB1B 3ARFD 1NCGA 1IBZA 1OHQA 5I17B 5ICZA 2CO6B 3NZSA 3Q2VA 2PWFA 2NYZA 2OMBA 1MLBA 2W60A 4P4KB 1SHWA 1WBYA 4CA4A 4PWGA 1RJZA 4MVBC 1GSKA 3ZT6A 4L1DA 2AI0L 1IEBA 4Q6IB 4ZSOB 1BQHA 2OA9A 2VDQB 3OBAA 2CM5A 3I85A 1J0JA 1KOAA 5K9QG 5KAQF 3U0WH 5DD1H 2PF6A 4F24A 3KEHA 3BO8A 2X0UA 3V4LA 4YDMA 1R5VA 1Y1DA 3B9KA 2F19L 3FNKA 5BVJB 2WD0A 1KGYE 1MF2L 2WVUA 1E5YA 1QUPA 4XPFL 4Z7OB 1YEWA 3WXWH 1RURL 3B2VH 1DJSA 2OMNA 1W0VB 4OGAD 4PB0H 1UACL 2BIQA 5IROA 2AXWA 4QNPF 1GC1L 2C4FU 5E5LA 3SZKC 1INEL 5DCCA 3MRDA 3VGGA 1IVLA 4C59B 2PO6D 3QR1A 4WNJA 1M7XA 4YK4B 1HEZB 5DZOA 5ILTL 3V6ZB 4X9FA 3PL6A 3T0EA 1I3UA 1UWFA 4WNSA 2YR3A 4RZKA 2R0ZH 2LAGB 4MHHG 4L3FA 3ZQWA 1WZKA 3LEXB 3IGUA 5EC2B 1HHJA 2V8LA 4I3SH 1EHLH 2NY4C 4Y5VB 3F64A 2KLSA 1QHPA 2MNUA 3FRUA 5L4MA 2YRBA 3JSSA 4POZD 2K70A 5JQIB 1JF1A 1ZSDB 2X40A 5I28A 1I85A 5D8JL 4GSDL 2X3BA 4IRSC 1MHHA 4KY1L 2HKAA 3KGRA 1RPQA 5BZWB 2NW2A 4YR6A 4YHMH 1KF9B 4XPTH 3ARBC 1NA8A 4WV1A 1DBJL 1IJNA 5DF0A 1G7QA 3HPJA 4AQAB 2BNRD 3QPXL 1BQ5A 3TOPA 3LD8C 1XH3B 3K74B 1K9TA 4EDWL 3HVNA 2HX9A 4U3SB 1QFWL 5AVUB 5DS1A 1GW6A 1ZD6A 5IBLC 5BV7H 4BHUA 5KYXA 1A3RH 1T04B 2TRHA 3L5XL 1NBQA 4PW3A 2HA1A 5JW3H 3OJDA 4WKXA 4CW1B 1NCWL 1VIWA 3O9WC 5CP7A 3SDCB 1MWAL 1R5WB 2BERA 2WXGA 5TE6L 4A7GF 3MRNA 1CT8B 4JQVA 5CLTA 4KMTH 2HVKB 4RWHA 4Z7WF 1USQA 4M6ML 1J5HA 3WDIA 4U49A 4J27A 1Z9NA 4FCAA 3QDGA 3HN8A 1SM3H 1I9JH 3T6QC 2MCMA 2WIMA 3VW3L 1TFPA 4EUPB 2AQPA 1IJ9A 3WNKA 5I0WA 5AUMA 4HXBL 4YSDA 3SDAD 5DVNA 5GRXG 5FYKD 4R7NB 4BGLA 5DDHB 5ETUB 4K8RL 5I15H 1JK9B 3EYVA 2VERA 4OLXH 2VITA 1OAKH 1XCQB 2H3XC 3FTWA 3WFEL 3IDMA 5GS0L 3HN5A 1SJHB 3GNML 1F42A 3NT0A 3AREB 3RWFB 2DEXX 3C5SA 4MGXA 2IQAA 3T9WA 3MU3A 3H9SA 1J8SA 4HWBA 1EX0A 2X4TA 4MCZB 2C9PA 4HOMA 1DBBH 1AD0A 5DR5L 2Q7YA 4H0GA 5ANME 4NZUL 3OKDA 1CWVA 1S7RB 5BUPA 1U8NA 3L3JB 3NIFE 3D30A 3HJEA 2VDMH 4IOIA 3KPRE 3FB8B 5D1QE 3WEMA 5FEBA 1HI6B 5KJ7E 3BJ91 4P46C 1FHNA 4LSSL 2ZWYA 3KJ6H 1X5IA 2KKQA 3ELQA 1WCBA 3E2HC 1OGAB 4X6CE 1K8DA 4F33A 1QACA 4X6DB 2ADIA 4HKZA 1AY1L 2HVJB 3ARBA 4UV4L 1IBGH 3VVVA 3QZLA 4YHOH 3V2AR 4Y5YC 4ABVA 4XP6H 3EH3B 4Y7MA 4YQXH 2KZWA 3MRFA 5C08B 4YMPA 4PFEA 1WUNT 4EOWH 3A6CH 5D93B 3L3KA 1JE6A 5EBGA 4H4NA 4APQB 3QUYA 1A7OH 4HYTB 4KQ3H 1BGXH 2NXYB 3FCSB 1BXXA 2BXZA 1OAJA 4JAMB 2FX7H 4I8DA 3S36L 3KYOB 4JW3A 5TH2B 2Y2WA 3LRGA 1DBKH 1M1XA 4X5PA 1COBA 1UJ3B 5KSAC 1KC5L 2Q76A 4AV5A 1E40A 1AOHA 4BWWA 3OLGA 4PPTA 4KK9C 1JN6B 2E6QA 1E3ZA 3FUKA 3O9WA 4E5XA 3SE9H 4MS8C 2AJVL 4P2OC 4DAGL 4NHUA 2QDVA 4S10A 4HK3N 5ICZB 5CIPB 3TXAA 4AWJC 4DEPC 4KBPA 4N24A 2NQ3A 4M7LL 3CFIC 3NZUA 3EUDA 4JRYA 1RJZB 3CSBA 4PJFE 4BUGA 3WKML 1JJUA 1RIUH 4KDVA 5TDOB 1O7DE 4JE0A 1AFVH 3SE8L 2OMXB 4IBQA 5DJ2A 2V3DA 2R4SL 4FG0A 1RAMA 1FRGH 1JPTH 3SJVA 2FGWL 4PD4J 3N3EA 5ID1B 5INCB 5J56B 1R19A 3B2MA 4NZRL 1CQKA 3NSXA 1R5VB 4P9ML 4A7GA 5HJDA 3ECWA 2G2RA 2FATH 2UXFA 4Z7WA 5AVVB 5I16B 1GOFA 5IMMA 1INDH 4IMKC 2PTUA 1HXMA 3QJQB 4ODXA 4PG9B 4N9GB 1MRCL 4LRNL 3K6FA 1UG9A 5ENWB 4P3DB 1BMGA 5C7ZA 3IRPX 3KNBA 2RAMA 4D8PB 1QKZL 4HHAB 2P5ED 3HPLA 4YXHL 3WV0A 3BZ4A 1DQKA 1LP9E 4HPOH 1MW1A 1U6AH 3T0EB 4BE6A 4FI8A 4FHKA 3MJ7A 1BAWA 4G8GE 1TF4A 2XVGA 2XZQH 4P46A 5LBSA 1JNNL 3TO4D 1HHJB 4NM4H 3FTSA 4EBQH 3BSZH 5DWUL 4LEOA 4MMYA 3V6OC 4BUQA 5E6ZA 4ZS7L 4Z78B 5B38G 5E51A 1EBPA 3LZNA 1BOYA 3WO4B 1N7ML 5HDRA 3A4FA 4HUXA 3GI9L 4Y5YA 3KGSA 1JF1B 4OU3A 1K4DA 4MRBA 2QQNH 5L2KE 3VX1A 1NZRA 1BVOA 3BKML 4FQJL 3MRLB 2NW2B 1ZS8B 4YR6B 3KXFA 2J5WA 2YD3A 35C8H 2VAAA 2JI1A 3DX1A 2XUWA 4XN7A 5DFVC 4GG6F 2F8XC 3TYFB 2WM0A 3HPJB 1EA9C 4LPVA 5KSAA 2XQBH 2FX8H 2XKUA 3UTZB 3HS9A 4I0KA 3PAZA 1NC2A 4XI5D 5C70A 5HD8D 3DX6B 2R4RL 1KY7A 1IFGA 4ZMOA 4K07A 5KANI 3QIBC 1O9WA 1U92B 3BH4A 5HVWA 4ZW3A 3OHXC 4X80L 4P2OA 1LWRA 1NCAH 4XMZA 3VE0B 4IHBA 3S2AA 4QEGA 4C4BA 3KLQA 1UASA 5IMOA 1Z0MA 3BPCA 5HDBB 2IDSA 3ZHKA 4WFGE 3FCTA 2GCYA 4UDTB 1TJHH 3T08A 5I26A 1NAMH 2XWCA 2X10A 3V95A 2EDMA 4XMKH 1I31A 3DYMA 3GD1C 1X3DA 4R7XA 3U9PH 3NOIA 1WO2A 1JVLA 4JO3L 5DC2A 2FWLB 2XA3A 2X4PA 4OLUH 3DMMC 1H9DA 1IC7H 2PCPB 3UAAA 2MPVA 4QRPE 3SE4C 3TZVC 3WFHA 1MJ8L 1F18A 1U95A 4BFJA 1LO3H 1A4JB 4ZX6A 3O2DL 3U46A 4RDQG 3TJHD 1T66D 5HPMB 3EYVB 4PJGF 5GHWH 1FGNH 5AOMA 2VITB 2VR5A 4IMKA 4WAFA 1NMBL 3IDMB 2C26A 2EECA 5IB3B 3KPLA 1C8QA 2VMCA 5HYJA 1U8JA 3DGCR 4K3JL 4D7BA 3QHTC 1OAUL 3P9MA 5JLZA 4GAYA 1AZUA 2X4TB 4G8GB 3FU7B 3IGAA 2Q7YB 4EN2A 1KB9J 1QSFE 2ITFA 4KQ4H 1IAMA 1U8NB 2DDQL 5CEXB 2B2XL 2NY4B 3V6OA 1PZ5A 1JHTB 3LKNA 4G70B 4GAAA 4MNHA 4S2SB 5L4IA 4YHNB 1V7NL 1N3NA 4TM9A 1T5WA 1I9IL 1M7UA 4KKPA 4TTDC 4U7KA 4YZFE 3RVVD 4DOHE 2JJTA 1G6VK 1MIML 2UZIL 5C1MB 1KTBA 5CEZH 1C5BL 2ESVD 1DVZA 4U6YA 4IRSB 4DP8X 4HHGA 4E0RA 3HNSH 1P2CA 4JKKA 2JKSA 4F33B 2ADIB 4CC0A 4V1DD 4ZTEA 5J13C 5DMGC 1EERB 5DZLA 3ARBB 2R0KL 2VDPL 2H6OA 3SKOA 5MENA 4JDEA 4UZUA 2F7QA 3MRFB 3NJXA 4MJIE 3LD8B 4AGOA 4M93C 1F0LA 3EBIA 2WWMD 4ZODA 2WGNB 1JWUA 4B9GA 1PD6A 2P9RA 2X53A 4QJ4B 2BVEA 3QIBA 2H9GB 5IQ7H 1PJ9A 4L3EA 1AQDA 4KOBA 3GLAA 1FPTL 3OHXA 3D7PA 5E2VH 2EVIA 5DT1L 3VJ6B 1M1XB 2VC2H 3D0LB 4G6FB 3FUMA 3ZHNA 1EZVX 3CWGA 3PWLA 1PZUB 1S46A 3BT2H 4YE0A 3D2UA 3CBKB 3T4AA 3O9WB 3PS6A 3S96A 1A6VL 2VISA 4MASA 3GK8L 4E5XB 1UA6H 5GGVY 3SDXE 4GG6A 4QOKB 3ESMA 2G5UA 2PTTB 4NHUB 1MXGA 3PWNA 3QZMA 1HXYB 1UT9A 3OKMA 1CFSA 1X44A 4JRYB 3SE4A 3MYJA 1AG0A 1NDMA 1TO5A 4R2GB 2OXGA 4RMQA 3MGTA 3WEAA 5CUSL 3WFDL 3IT8D 3S9DB 4G3YL 2WHVA 4Q0XH 4XPHL 1AQ8A 1K5WA 5TK2A 3EADA 1QQDB 2PCFA 3GKWH 2B08A 5IQOA 3K8MA 2BINA 3CZEA 3QQNA 5JDSA 1QRNA 5J6HA 4OVVA 2G2RB 4URKA 4F1SA 3W5NA 5C0ND 4Z7WB 3GHEL 5DUML 3D4GA 3QJOA 1P69B 5E2JA 3A21A 1JPFA 4KXBA 4ODXB 1QOKA 3S8WA 3QIUC 3P4OA 1CYXA 5DUJA 2PW2A 2JQMA 2XKNB 5KYUA 5K1JA 3NJMA 2Y7NA 2OSYA 3HR6A 4OZFG 3BZ4B 4ONGL 4MJ6A 1XDTT 3IM1A 1A22B 4MDRA 1LHZA 3SY0B 4FYTA 4L0PB 4MA3A 1YYLL 5B1KA 5C2BL 2WSKA 2YJQA 3S5ZA 3BAXA 2DH3A 3HAEG 2B15A 1PD1A 1GYVA 4AIEA 1BF2A 2WWOA 3E2HB 1ZLVH 5LCVA 3VQLA 1EUUA 1HHKB 2A9DA 3OC8A 5C0GA 5T1JA 2V3FA 4WFHE 2R0WL 3QFJD 4Y5YB 1FL6A 3P73B 4OTXL 1H0DA 4MJIB 1K4DB 1OM3L 2CG9X 4E9QA 4JQIA 4QD2E 2QPUA 2ZP0T 3DV4A 4JFDE 2Z7YA 3HMXA 1MY5A 1I7ZA 2FQEA 3O8XB 4U1HA 4ZTPH 3K2KA 4XRCA 3TEZA 2H8PA 3C60D 3KXFB 2D2OA 3TWYA 1D7DA 1ORQA 1KCRL 4JM4H 1OCCB 3QHZL 5FO9A 5KSAB 1GZPA 3V0WH 1PZ2A 3MLUL 3MJ9L 5AYQA 2HN7A 3F01A 4QIRA 4O2FA 4WW2F 4P2YA 3MV9E 1NC2B 1AKJB 1IZKA 1UFUA 4A66A 4AMKH 4M6NH 2Y4SA 1FLTX 4W6XB 2Q5BA 4Y9GA 1F6AA 1PLBA 1F3RB 3H2QA 3ASOB 4LLWA 2W0PA 4P2OB 4F91B 2GBVA 2JF1A 1Q9LB 5T1MA 5I1GH 4D8OA 3CC5A 5IMOB 4DEPB 1WQVT 4K3EL 3T6XA 4PH8A 4LVHC 5SV3A 1JPSH 4HA1A 1U93A 4PJBE 2JK5B 1ECZA 1JGDA 5GZOD 4YE4L 3WFCL 4LLAA 4UQDA 4NAMA 1QYGH 1KB5B 4EIZC 3BIKA 3RX8A 3L1GA 1D9KD 3FQWA 2VWEC 5EV7A 1I8AA 3WIAA 3GMLB 1ZHNA 4LK4A 5DEZA 4XCYA 1U95B 2ZUQC 3AMLA 1R33A 1ZCRA 2CRYA 1AGBB 3KBEA 3DURA 1JUFB 1PG7H 2E47A 2JIXB 2X1OA 3U46B 3UO1L 1UT1A 1CMOA 3HFML 2E9JA 5EWIL 5AB1A 2F8OA 3BUQA 5D70L 4DFIA 1BFVL 4AW7A 1B9ZA 1VAHA 4M3HA 3QIUA 1PW3A 3KPLB 4WY7L 1GGBH 3U1PA 1U8JB 2QFRA 4LCWD 5E6UB 1BXVA 4GP8B 2QQKH 3OKEB 2XETA 3WIHH 3P9MB 2HFGL 2VW4A 4UQAA 1H6FA 4HFWB 5JLZB 2AEQL 4GBXD 1MDTA 5MEOA 2APSA 5EOTA 1JHKH 1V3LA 3TA4D 1P53A 2ITEA 4ICXA 4Y4KB 5DXWA 4P23B 2OSLB 3LPPA 2CDFA 2X28A 4QHUA 4MNHB 3LKNB 1SLVA 4HUMB 3NVQA 4PJIB 3SOBL 3ZVVA 5HI5C 2BFGA 3DUUA 4Q14A 4JCWA 1EBAA 4GKNA 4LFHG 4L4VE 3RGVC 1MH5B 3QPQC 3QJVB 4JM2C 5J3HC 3MLWH 1XAUA 4JFDB 1YZZA 3VXSD 1TZHA 4U6YB 5J4MA 2YPVH 4C8XA 3LZQA 2M26A 5F71A 2Z8VC 3UJTH 2XXGA 4HIIA 3MRQA 3Q3GA 1CB4A 1HC1A 4JGJA 4WI6A 4FEIA 3VD9A 1Q9KA 4XNDA 3B8YA 4F37F 4O2EB 2HT3D 3HE7D 4U3CA 4XB3A 1CFBA 1UEMA 1PNCA 2Y6SC 5FXCH 3WEBA 2DZEA 2KDYA 1KYDA 3FJTA 1JWUB 1SHSA 4DEUA 4LQFL 2ZJSL 4NSKA 3Q05A 2VM4A 3QIBB 4HWEL 4PJ8B 4CAGA 3EHBC 3EOBA 4BKSC 1KBGH 1A1OA 1S3KL 4MRCA 1YEDA 1BVNT 3Q6GL 4Z7NB 4A6YL 4P5TA 3BYYA 1VKXA 2FO8A 1OWWA 2VISB 2A6IA 3HZYB 1DVXA 1L9RA 4OI9A 4UQ2B 4Q89A 4PSPA 4AVJA 4GQPH 1AZZC 1ZEAH 3ZKMC 1J87A 2VT0A 3GQFA 5DUBB 3JTBA 1NGXB 4YPJA 4MA1C 1AGCB 3OKMB 3HB3D 2Y7OA 4WW2A 1Q90A 3DMMB 1CFSB 3S4SB 1OSPH 1LTXA 2XTSA 3QRGL 1NC4A 4TLUA 1BXUA 3MYJB 3TZVB 2I26N 1NBVH 1NDMB 3DHUA 1KIUB 3CXDH 1BD2D 5L7XH 1KIPA 5HHME 3CVHB 5L0QB 3EO1A 4KXAA 5H94A 4OV6F 4R0LA 2R0LH 2WYHA 4XX1G 2DMKA 4OM1L 2Y06H 2ZOWA 2W88A 3O4LA 4N0UA 1HE7A 1TJXA 4LL4A 1RZIA 2O6PA 2ZOKB 1QRNB 3UTSA 5J6HB 5JDSB 2NX5E 5LAPA 1E50A 1TJGH 1KDJA 1XGZA 5F97E 2AQ2A 2ZX8A 1NICA 1JPFB 5C09A 2R29H 3P4OB 3C2AH 1JCVA 3NYKA 1NCHA 1O0VA 4U6TA 5GRZA 2BP5M 4KJPD 4NYLB 2Z0BA 4UV7H 4X6FB 3RIAF 4PS4H 4KV5E 2XSKA 1MVFA 1YSOA 5GISL 2FR4B 1AQMA 2A1WH 3CDZA 4NDMA 4XC3H 2M2DA 3PJLA 3RGVA 5JHLH 2P49B 1E5UI 3H2WA 1IAII 2YRZA 4ODUB 2VLMD 1KCBA 3ILEA 3BN9C 4QT5A 3REWB 2DKUA 4QXUL 1EO5A 5JW4Q 4BSWA 2RALA 5HY9B 3IB4A 4I9XA 2EAEA 4JO4H 1TU2A 3BH9B 5J13B 3FSZA 3WFBH 5C0GB 1BFTA 2AEIT 1MAMH 5ESAA 2GC7C 4XMVA 5HYSG 4O51B 1FL6B 3D18B 3O45B 2ZPKL 3N41F 1MWAA 2X6MA 4RBPH 4M93B 1HU8A 3DV4B 1P4UA 4UT7L 4U1HB 2R1YA 4Y2DC 3GSNL 4XRCB 4MZ3A 2AXFA 1DVFB 2AEPH 3M86A 4IRZL 1HX0A 2EDXA 5IGXH 2EDFA 4Y19D 3V52H 3X3GH 1IM9B 1Q72H 2FZ3B 4OLEA 1ORQB 5FCUH 2CR6A 3KLHD 5FO9B 5FB8A 1SXSA 2C4XA 5A1AA 1GZPB 4MKMA 4QO1A 2WLZA 1CURA 4X4ME 3KPNB 1F3DH 2I07A 1MQKL 1I8KB 3L5WB 5EO0A 5AENA 1PKQE 1RCYA 5K9KA 1F13A 2RJMA