2LOEA

Structure of the plasmodium 6-cysteine s48/45 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
EKVKGCDFTTSESTIFSKGYSINEISNKSSNNQQDIVCTVKAHANDLIGFKCPSNYSVEPHDCFVSAFNLSGKNENLENKLKLTNIIMDHYNNTFYSRLPSLISDNWKFFCVCSKDNEKKLVFTVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords 6-cysteine protein, putative
publication title Structure of the Plasmodium 6-cysteine s48/45 domain.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2loeA00
2YMOA 4YS4A 2LOEA
chains in the Genus database with same CATH superfamily
3ZDWA 2RAMA 4X9FA 4C83B 4PJCB 2JLLA 1QTYT 3LQZB 1XH3B 4WI0A 3DIDA 3UBXB 5ISZD 3SGJA 2XX0A 4YDLB 1BD2A 5KANI 1A7OH 4OGYH 1HXMB 3DSNA 4MAZA 2P8PA 3DMMA 1OGAD 3HJ0A 2F54A 4E68A 4OCMC 3AQDA 3DX8B 3IKCA 3P30H 1TEGA 3FQXB 1MJUH 1KBVA 2Q1EA 3CLFH 1E2ZA 1FGVH 1URIA 1GMEA 2XQBL 3BDYH 4MYWB 4E9TA 4U1GC 5I6KA 2Q5BA 2YO3A 1GW0A 3JTSA 4H8UA 5GISH 3VWKA 1AAJA 3QIBA 4P3DA 1DEEB 5LNEA 4A7SA 3FTUA 1YN6B 4A2DA 1ASPA 2VLMD 4NQEE 2OM5A 1U6AH 1LEKB 2H26A 4NXSA 1FC1A 5F8RC 1T1YA 5KTEL 5D8JL 4C4KO 1M2VA 5DZJA 1KN4H 4AIZA 3A4DA 1YMMD 4JDZB 3NFNB 1COBA 1Z7JA 4PJHB 2D2CC 2DV6A 2X1PA 1DQLL 1PGRB 5TDOA 4WFGD 2WLLB 1NAKL 5DWPA 1F5WA 5E8NB 3AREA 5AWNH 2V2TA 4GIAA 2NQ3A 3ZXAC 3GSRA 1C08A 2JQAA 4NAQA 1RV6X 2ICEA 2MKLC 3NFSH 1IGCL 1H8OA 4TNVF 4XP5L 3WD5L 1U8NA 1YHPA 4H8WC 1TLKA 1Z0NA 1QNIA 3DIFA 4IU2B 2V3EA 4ODUB 4PLJC 4QY8A 3IFLL 4AV5A 4DAGL 5K69A 3CFJB 2VO8A 5D4QA 5LUMA 2DLEA 1G94A 4WWKC 1HKLL 5L6YL 3II1A 2H0JA 3OGOE 3CN2A 1BXAA 4D0DB 2VJXA 3PXHA 3T09A 3BJ91 1E5AA 4RZCB 3UROR 4MJIE 4DP7X 4UQ2A 1UWEL 4YNYB 5C71A 2EVGA 4Y9CA 3OAZK 1MJ7L 1N68A 2HB0A 2MMXA 1FZMB 4WFFD 1F0LA 3G6JB 4JJOA 4OBSA 4OQTH 4XXCA 3H53A 5EIIB 4R4BA 1AR1B 4GT0A 3VFVA 4FQJL 1JVKA 2ADJB 2WOYA 3U0PA 3PWNB 3MRJA 4XPTL 4E5XG 4LOVA 2VKXA 1DQTA 3MGOB 5DURB 4CMMB 1FYTA 2DQGH 4HIJB 4Z78A 4LRNH 5ESQB 2WLJA 2ZKMX 3F5WB 5EZJA 3UJTL 3GK8H 4AEHL 3KPMB 1SYSB 2IANE 2EUVA 2CPUA 4QXUL 2WSDA 1IAKA 4M02A 2VXVL 1VEPA 1BPVA 1QBLL 1WUNT 4M9OA 1JUFA 4PJ9B 2DQEH 2N56A 3F7VA 4XGZA 2AQPA 4QJ4B 2Q8BL 1HOCA 4ORGA 5KYUB 2AQ3A 4LCCA 1BXVA 1DJZA 3IFOA 3M8OL 3OMNB 3GS7A 4NQCE 3SDAC 4K94L 4D8OA 4YLBA 1JGDB 3I6GA 3RGVD 1UXWA 2G2RB 4WWID 4M6NL 2VABA 1ZA6B 5CINL 4P5TD 4XCEA 4FZEL 2DDQH 4OV6F 2FNWA 1JGVL 5ABDE 4LOUD 5J1SC 4PP1D 4J3VA 4RGOL 1I9EA 2EECA 5C0FA 4U4BA 4HF5H 4QHPA 5IB5A 3IJ8A 4JCWA 1PZ5A 3UBHA 3ZMRA 5D55A 2R51A 5DD3L 3QDMD 3BGFC 4YHOL 5EO0A 1I8LA 4TV3A 4IBSA 4PS4H 1QO3A 3R19A 4CNIB 4F8QA 1AD0A 1FNFA 4Z77B 2VGLM 4AT6A 2EXYD 1UD3A 3Q05A 4LKXA 1P1ZB 2J1XA 3V0IA 2I07A 2OA9A 2AV1B 3ZDZF 3PGDA 1SXCA 1UXSA 4JKPH 4F3FA 4K71C 3NN8B 1H3GA 1ZTXH 3ALPA 5T5FA 5TDNA 2VW4A 3TX4A 4MCZA 4JK0D 3KGTA 1GY2A 4LCWA 4UM8B 2GK2A 4U1SA 1WBYB 5BZWA 4PV8B 1U3JA 1YJDL 3DURA 2H9GB 3PQYA 1U8PA 3B83A 3MRCA 5BO1H 2J5WA 1N4XH 3HLAA 4HCRA 4IBTA 4NYLA 5F1SA 3KLKA 3T65A 3VCLA 2GY5A 1MVYA 2FHBA 4G6FB 4L4JA 1ZIBA 2YEVB 4NFBA 2AK4D 1I1AD 1PF3A 2PW1A 4FQIH 1U3YA 12E8L 2AITA 3K46A 4NO3B 1ZWIB 3R06B 4P59H 2Y3AA 3EJYC 1LO3H 2NNRA 1ZT1B 1AGFA 1AH1A 5KN5A 3T8XA 3B2VH 3DX4A 5GJTL 3QC5X 2A5UA 2XWTA 2Z7WA 3FUHA 1UH4A 3LEXA 4Y5VA 3U30B 2QQNL 1UWGH 5KYXB 2E7LA 2CHNA 1EAPA 2D3VA 2H6PA 4KDVA 5GS1C 4F2MB 1UT1A 5C86A 1IM9B 1G7IB 4JRLA 2K8MA 3X13B 3UADA 1RZIB 4UAHA 5J9PA 1QBML 1TVBA 1CICC 2BPBA 3ZE0B 3F7KA 2BW4A 4Q6KA 4XNQA 4ZUWB 3VFUA 3CZLA 3QFJB 1KTDB 3PXLA 3LKNB 4N2IA 4LVEA 4YSSA 4LQ1A 3EJTA 1DVSA 4LL1A 5FYLH 2BRQA 3GSNB 2ALWA 3RVWD 4XXDA 3RWFA 2WO3B 5E2TL 3CLEH 5J8OA 2FYVA 4PI0A 1YEGL 1KN2L 2GK0A 4ZYKB 3P4OB 3LCYA 4MJHA 3FSAA 4KKPA 3TBVA 5GRVK 5D7JD 1FGNL 3OHXA 2BSDA 3V0VA 1CUOA 3HMWL 3MCKB 1MRCH 1NMAL 5FA3B 3CHSA 2ADFL 1IGTA 3QISA 1MAML 1LO2L 1NFIA 2KBGA 4HKXA 2AFNA 3I02A 1TTRA 3B8YA 3ARGD 3HG0A 4R97B 1KIRA 1ZK5A 4CUCA 3ESOA 4QRBA 1S8DA 4H88H 1GHFL 3NDYE 3NJHA 5JHMA 1DSYA 3BHBA 3V52L 1OAXH 2BNUB 4W9HC 4WWKD 3TYGL 5KVDH 2YAQA 3S88L 5I75C 3UGXA 1BBJB 1BZQK 1TENA 5I8OH 2ED6A 1KLUA 4IBZA 1SY6A 4LDLB 4ESKA 1EZLA 1D5BA 5SWZA 2BOBA 1M4KA 3EYUL 1ACCA 4GS7C 3JXAA 3LZOA 2WSKA 3B7UX 4AQ1B 1BECA 4A7QA 4BKLB 3L8QA 4EOWH 4HUVB 5C09D 4IGBB 4DKFL 4KRPC 4QRQA 1VACB 2OJEB 1ES0B 3L1OL 4FQXA 4YR6A 5EN3A 3FRPA 3SODB 4S1SL 3O2WL 3UTSA 2WCGA 5LBSH 1WO2A 3VU2A 2DM2A 3QUGA 3TNMA 1N0XH 3D06A 1G5AA 3U4EB 5D1QC 4P3CH 3T1FA 3B6SA 1XZ0B 6TAAA 1BBDL 3K72A 5I1LA 4N0FA 5E6YA 2PF6A 3E7JA 3IJ7A 4ZFZB 4FXGB 2XTLA 15C8H 4E36A 3FH7A 1XMEB 1F3JA 4Y4HB 4IU3A 2Z92A 1QVOA 4HZ1A 3TN0C 4QXVA 4OLZH 5DK2A 3ARFD 3FTVA 3KDMB 4WDIA 1YEJH 4XN5A 4YXKH 3THMH 5AB9A 2OV0A 4HU8A 2NXZC 4Q2ZB 3SDAD 2WGNB 4QRTA 1YAIA 4YN3A 1QFWL 3MRFB 5KSAC 1YNLH 1M7DB 2FUQA 4E9RA 4GQ9H 1JWSB 3Q9QA 5TE6L 2IC2A 3EYSL 3O0RH 3N42F 3VX1A 3QG6A 5A2JH 4B53A 5F9JB 4N3UA 2IOIA 5GS2H 4P9MH 2ESVA 3TIEB 1RVFH 3HHSA 3LKSA 3ZE2E 1GCYA 1NM4A 3NPSC 1KV7A 2DTSA 4JANB 4NWTL 4OLYH 3V4VL 4BZ2L 3UTTE 3WSQL 2O5XH 3PHOA 2VXSH 1FL5B 1OCWH 2FEDD 3QUML 4TTDC 4FJ6A 3MV9B 4MKMA 1ZXQA 2E9WA 2FWOA 3NIGF 4KKZA 2JNZA 4H8VA 3D39E 4MA7H 4PG9B 2KDYA 5D2LB 1WIPA 3P40A 3WE6B 1DBMH 5ERWA 2P26A 5JXEC 3QZBA 4K5LA 4KI5D 1S9XA 1EO8H 3IU4H 4ZFFB 1LXMA 1I3UA 1TOXA 2XWDA 4FKEA 1WAPA 4WIQA 3OR6B 4HUCA 2DWEA 2NY0D 3VFWA 2RR3A 3ZHDA 1SGKA 1UH2A 2PP8A 4JFFD 4U6VL 2CO6B 2Y07L 2JELH 1MLCB 1RIUH 2IPTH 4NRZA 3O9WA 4QF1A 4L1TA 3LH9A 4ODSL 4RMTA 1FNEB 4QRRE 2HKFH 4HWBH 4ZXBB 4EIBA 5E8DH 4KVCL 3CC1A 3W5MA 2OX5B 3P69A 1TZ8A 5EUOB 4BH7A 5C08A 3LSOB 4YSUA 5KJ4A 4P0DA 1LNUA 1QHQA 2K9UA 5AUMB 5CSBA 1XAKA 1Q0XH 1TCMA 4HFUH 1AC0A 3U0WH 3L1EA 1ZMYA 1VPOH 1F97A 3ES6B 3CPLA 5DJ2A 1NC4D 2OJZL 5PAZA 3UJJH 5ALBH 5FCSH 1I85A 2ARJB 3K6IA 3MLWL 4LIQE 4GIOA 1XTMA 5JPMC 1J5DA 1A9VA 2K8QA 2WUCH 1GZQB 2TAAA 4PEEA 4YWGH 5KW9H 2J3SA 5GGUA 1T7XA 3HR5B 5C0CE 2WWNA 4LHUA 4WFED 3UTZB 4FTVE 5INCA 4M4RB 1CIUA 2MCAA 1C5BL 3Q7JA 1QTPA 1USQA 4HSCX 3HNTL 1Q1JH 3L1FA 2WQAA 2IPKB 4I3RH 4KGLA 3MUJA 5E8OA 5L2KD 4LKCB 2OXHB 2CK2A 1MFCL 4GT7A 4N8CL 1O9ZA 3OX8B 3WTTA 4YZFF 5I1DB 1KTRL 1HTYA 1N2RB 5B7EA 3JV6B 1M42A 1QWUA 1SMDA 4L8CB 1NLBL 4ZW8A 3OAUL 2E7MA 5I1EH 5D7IE 3S37H 2VNCA 3BUIA 1T2QH 1IC7H 4XRCB 2I5YH 3HE6A 2PP7A 1M71B 3AG1B 1CGVA 5E56A 4M6AA 4MS8C 5EOCL 3K8MA 4QJ5B 3TBTA 4PJIF 1MY5A 1O75A 4IEFA 3WELA 4DVRH 1AQDB 3W3BA 4DERA 3LN9A 2CDFA 3RBSA 1IARB 3DYMA 5BQDA 3VSTA 5IMLB 2VB5A 4FG0A 3PNRB 4WO4C 2RH0A 7PCYA 5M95B 5L0QB 3EHBC 3CE1A 1K5NB 1BREA 2FBRA 3QNZB 3WJLC 4NUGL 3TNNB 4BFIA 2EVIA 5GS0C 4JFSA 3BPLC 2CJSA 2QLYA 2EYTA 2P48B 5D7LB 4LLYA 3KJ4C 1RZJH 5F70A 4KRPD 2UXFA 2C3WA 2I7SA 2KPNA 4WW1A 2XWEA 4JHUA 3UL4A 3KBEA 2XWZA 3HI6H 4PB9L 3FO2A 5DJYA 4J4PC 5C0ND 2JCCE 5SWQA 5TH2A 4MTMA 2HMIC 4IRZL 2QR0A 3JTTB 4RDBA 5IJVB 1ZPLA 5EEYA 3MLYH 2SEBB 4PS3A 1Y1UA 4BK8A 4JO2L 5D1QD 3NFPB 2FQGA 3KR3L 4J3XA 3WFBH 4Y7MA 4BFOA 4C47A 2WIMA 2YFNA 4E41D 5IVXE 1YPZE 4OQ1A 5D5ME 3FH5A 1CURA 3QQDA 2ENJA 3QG7H 1G9NC 5D93C 4BQBA 3J27A 4UM9B 1XIWC 2VDRL 2UYLA 1HL8A 1ZSHA 2NSXA 4FZ8L 3OVUB 3C9NB 3F12B 4KMTH 3TN0D 2ZXGA 3NA9H 5H94A 2Y7OA 4FG4A 4FABH 4BYHA 1X5IA 3BQUB 2AK1H 1YYMH 2LU5A 3DVNA 4WEUD 3UIYA 4X5PA 5CU5A 4D8PB 2JJWA 4OGXH 2JB5H 1BIHA 3LPPA 2RA1A 4EUPA 3PIQB 1I9JL 4NQDB 5KBNC 5T3ZL 4WI0B 3SBWA 3AG4B 3SKUD 2NPLX 1H0DB 3GKWH 4BQ6A 3FCTA 4XN4A 3WHE1 2A9NL 1HDMB 3DJTA 2NNCA 2R4SH 2APTA 4APQA 1U3HD 4PH8A 5GGRA 1F4YH 3D09A 2FBJH 1LDPH 2OTUA 1KJMB 4BCYA 5JR1H 1QFWI 3FT9A 1CDBA 1IBBA 2AGJL 1A4JA 4K5MA 1ZCRA 1ZK9A 2PP9A 3ETBF 3ZZQA 2EACA 4JPKL 4RRPG 3JTSB 5K9KA 4F58L 3S35L 5KSVA 3QIBB 3GZKA 4W4OC 1GYVA 2PPCA 4PV9A 1DBJL 5EWIH 3O11B 1X3DA 3GBNL 1OAZH 1M6OA 3MBXL 1RUPH 4N2HA 4ONOA 4Q97A 4YQXL 5HPMA 4AIZB 5JXED 5FGRA 2FH8A 3E2HB 3AQXA 4V11A 4WI8A 2D31A 2N01B 2EIJB 2X2IA 1J5HA 1QWHA 1ZD6A 2W88A 3DA0A 5B21A 3H4HA 3GNMH 4K3DL 3WXVL 2IGLA 2YPKB 2VWEE 5TDOB 3SO3C 3BVTA 4L37A 4BINA 1BXXA 2F53B 2GBAA 3AU0A 3OTTA 5HHOD 2ZUTA 3WNMA 5JPNC 2ZP8A 4BELD 2EADA 3BZFA 3GSRB 3T4AC 2F2HA 2KERA 4B3EA 2ICEB 4M1GL 4ADIA 1RFDH 4JB9L 1A6UH 1U8NB 3PHQA 2MPAL 1H9DA 2D4DA 3DUSA 1PYWB 3BAXA 5IIEA 4FEMA 5DJ6A 4HS3A 4QY8B 1VCAA 2HA1A 5IB3B 2GHWB 1D5IL 3JSSA 3RUGB 5J1AA 3LHPH 4X6EA 3DVGB 5FW8A 3WIHA 3RFZA 4E0RA 5LQBL 1OIOA 1L9OA 3IT8D 4HBQA 4CDGC 4P5MB 4D0BA 4XMTA 3VQ1C 2CR0A 5TD4A 3IGLA 4G42B 2HN7A 5BXFB 2VDQH 4UQ2B 3FF7A 2DKMA 1MCFA 4V1DE 1MIMH 4UTBA 3G5WA 3IAQA 3C60A 5DHDA 2APSA 4R4BB 3WAJA 4AYID 1AZZC 2X6MA 1NANI 1X44A 1JZDC 3U0PB 3U79A 4XX1E 3MRJB 4UUJA 2XXGA 2F1BA 5ESVA 2EUWA 3H42L 3ZSSA 4K5PA 1AY1L 3VD0A 4UB0H 4RBPH 3VI4E 2EDXA 4YIQA 2BJMH 2HKAA 5F9DC 4AMWA 2E0PA 2JKTM 5G4MA 4N2NA 1HH6B 3SE8H 5F89A 1EVUA 1IAKB 3FTGA 3V4UH 4Z3GA 5JMRA 3T0EA 1AJ7H 1SLVA 5C0AA 4IMKC 4M56A 1AO7D 5B3JF 1TLMA 3SDXB 2XFGB 3WTXA 5T5FH 2EO1A 1SJXA 4LK4A 2CRYA 1HOCB 3ZL2A 1GVIA 4KTEH 4PJ5D 3IFOB 5E1IA 4TNEA 2TSBA 3RZCD 4ZMWA 3TEZA 2X0WA 2VABB 1KCWA 4DP0X 1DBKH 4W4NA 4XCEB 5EEUA 2BY2A 4PRHA 1TPXB 2AJ3A 3F3HA 4WO4D 2QLVB 4OB5H 1A14L 2YC1B 1S7QA 4J8RB 3REWA 2PR4H 4FXKA 5ACZA 1XCWA 5IB5B 4P06A 3ARDB 4M7JH 4YHZL 5GPRA 2Y5TB 1UJTA 1BF5A 1BZ9A 1J12A 2BXZA 4UQ9A 5GS0D 4H20H 3TBCA 5EO0B 4QXGL 2YA0A 2YPLE 3QXVA 4P2RD 4MWFB 4E5XA 1I1YB 4NDMB 2BXYA 4J4PD 3D1MC 2HMID 2XV2A 5T3XE 4ZUVA 2I07B 1A5FH 1CFVH 5AYTA 3ESVF 3PGDB 3FQWA 1GC1L 4LSPH 1UXSB 2X4TB 1EEZB 4WSGA 5CLWA 4BUQA 5JOPD 1SHXA 1U33A 1U8OB 5I18H 1UEMA 3PUUA 4XN1A 5TDNB 4PRAA 4NO0D 4N8UA 1FG2B 3T2NL 4MS6A 4EDWL 4IQHA 3QNYA 2NY7H 3AM8A 4YDZA 3HTLX 5AG8A 4WUUE 1LK3L 4L4TA 4L8DA 3IAPA 1U8PB 3HLAB 4NYLB 1N10A 1WZMA 3CAFA 3V0EA 4M6OH 3VCLB 1J87A 5CN3A 2R4RL 4XAKE 5KZCB 1HVXA 3ABGA 3KGSA 3BCFA 4YVUA 3RNQA 1H5BC 3FFCB 5IFAL 1P84K 3MV8B 2IFGA 3B1TA 3MV7B 1ZLDA 3RQ3A 3KG5A 3T8XB 4HW6A 2NDGA 3H9HA 4G6KH 4QUOA 1N8OE 3LEXB 4KV5F 3QCVH 4DW2H 1IC0A 4TNGA 2X28A 4LSUL 2WQRA 5SX5K 4EKJA 2RQ8A 4EE2A 3V4PA 3FUFA 4ICWA 1U92A 2ZCHL 4IYKA 3FL7A 1G7PB 4XNMA 2VITB 5I2IB 1R17A 2XNAA 1TVBB 1T22A 4TPRH 3L4XA 1N8ZB 3RIFF 1SY6H 2B59A 3RIAK 2ARWA 3UGEA 5EO9A 5AAMC 1RH8A 1OCZB 1MCCA 4N9GA 4NQXA 2Z35A 1H3PL 2XSKA 1MH5A 4YK4B 3QQ9D 1EHLH 1U2HA 1SOQA 2J8UB 1MVUB 2TRHA 3BSGA 1IBFA 1RIHL 3DX9A 4XPHL 4XNXL 1SXBA 3PL6C 4JRYD 5AW1B 3OAYK 5TPWL 3ULUH 1A6AA 5D2NE 3EUDA 3IWUA 1NGYB 1UCBL 2CK0L 3S3PA 5JW3L 4A6YB 7TAAA 4H5SB 4W6WB 5E6IB 3T3ME 3TBVB 4BK5A 1NAML 1A25A 2LGNA 3QJHB 2X9YA 3HG1E 2JKJA 3V0VB 3OWEA 4KKLD 4Y2NA 2OL3A 3QVAA 3TP4A 2WNKA 1BQRA 1NFIB 3CFIC 1J1OH 3QI9D 4XI5C 5I8CA 2UY7A 4K3HA 1CF1A 4CU7A 1S8DB 4Q52A 1WS7A 3RG1C 1TZHB 3QDGA 3SGKA 3VG0H 4F5CE 2Y7MA 4YPGA 3RWJB 3VXQA 2X1WL 3DX6A 4UYPA 3HRZC 1CLOH 4N2BA 2ITCB 4K8RC 1FNGA 3H0TA 1F3RB 4AVKA 2BCMA 1ZXKA 4MJ5B 1IC4H 3GXDA 5TE4L 4JFUA 2BOBB 1C16A 4P07A 1G6RH 3W82A 5LDUA 2DLIA 3D4CA 5B38A 1UD5A 3IFPA 1NBZA 3N44F 4QRQB 3SGDH 1KFAH 4AQZA 5DZ9A 4R4ND 4X83A 4YR6B 2BW5A 4YE4H 2XN9D 2WW8A 4K7FA 2H4EA 1QI5A 1ZJBA 5JHDE 3I50H 3AQYA 1IC5L 2LAGB 2ZSVA 4M48L 4ABQA 1QW8A 2HYMA 5DQ9B 2YUXA 4Z0XA 4MMZC 4AEEA 4V33A 1ETB1 2IMNA 4P2OA 3T1FB 3B6SB 4QXWA 1EXUA 3VG9C 1N3NB 1YNKL 2EH7L 4CU8A 4N0FB 1S2EA 4OCWL 5DA4A 3EKCA 3EO0A 1SOKA 3LXCA 2GIXA 1F3JB 3ZE1E 3LRSA 5CEZD 5I66A 3KCPB 2BDNH 2EKJA 5I1IH 1QVOB 3LEYL 2Y7QA 4JG0L 2OMUA 4KRNA 3MUUA 3WFZA 3MDJA 1SDDA 1ZHNB 4G9FB 3UTPD 1DJSA 4R2GD 4WDIB 3ZE2F 4B9ZA 3VWJA 4FQPA 2R69L 1MCLA 4GAJH 5ITBL 1Z1WA 2O4EA 3MNMA 4OZHB 4ISVB 2BP8A 4DOHB 4X4YA 4A2MA 5F44A 2DIBA 2B14A 4AUYA 1VFOA 3A24A 4JM0A 1I31A 4KK8C 4FKHA 4PJHE 3ROOB 4JG1H 2ESVB 2EDOA 4NKOB 1PY9A 3MNDA 3LKSB 4JUSA 2OR8A 1KNOB 1PZAA 4GSXA 2CJUH 1KTKE 4KVPA 1E4XL 2MCG1 2KQMA 3ETBJ 5HVGB 1UVQB 1QSFA 3MHZA 4JREB 4KH2A 6FABH 3PWVA 5DJ8A 5BVPL 1UM6L 3A4FA 3TV3H 5KJRL 1KDJA 3PHOB 2JJTC 1C5CL 5E1GA 1MDAA 2A6JA 5I76A 3LHAA 1Q9KB 2ZUUA 3VFRA 3NQIA 2ED8A 3VMOA 3BDBA 4GRLA 1ICTA 3H8NA 1ILUA 4WU7B 5ERWB 5I17A 3FSWA 4YXLL 4KXZH 1OAUL 4NCC2 3TVMA 3WTYA 2WUBL 3IE4A 4ZW5A 1S9XB 3TCXA 2NR6C 2KUTA 2PWGA 4CU6A 2P5WD 2VRQA 1OP3H 2DWEB 3VFWB 3I6LD 3G9VA 3KPQB 4JPWH 4PREA 1ZLUH 2MQ3A 1KBKA 5K39A 4NRZB 3D2UB 2B4CL 1FORH 2D7OA 1TQTA 2JIXA 1S7VA 1KB9J 2CKNA 3BKYH 4ACPA 2P43B 1UB5B 4CL7A 4GP4B 3K4AA 1LLAA 5E51A 5AVWB 2XWJB 2UUDK 1H3UA 2FSEA 4Z7IA 1LNUB 2NY2D 5IG7B 5D96C 3VXSD 3I6KA 3OD3A 4G2AA 4QCIA 4Y2DC 3MRDA 4P3WA 1NOFA 3WUWB 4DQAA 3ABZA 1JXDA 4K5OA 5A16A 3CPLB 1Z3GL 2Y22A 2IV8A 4A1RA 3VI3A 4F8NA 4PB0H 4J3OC 2Q8AH 4RGND 3EZJB 1HE8A 1MREL 4LFHD 5EV7A 5L8JB 3FN9A 2K78A 5HVHB 1DSFL 5IBTL 3DROA 2QVIA 3R8QA 4AVJA 2VL4A 5GGUB 4LHUB 5AYQA 1ZT4B 4ZMPA 3TZVC 1QUNB 3OL2A 5DFAA 5INCB 3AVEA 2AC0A 1JGUL 5I0YA 1JV5B 3NK3A 4GAAA 3S34L 1SBBA 3F58L 4RISL 1RSYA 1AGBA 2BFVL 3KL3A 4HZAA 1ZLSL 3E6HB 1DQJB 2OI9B 4M1DL 5FS5A 2C1OA 5LGHL 3O81A 3LVTA 3NCYS 5GGQH 3P0YL 4N8VG 4GSQA 3T5WA 4GQZA 3TA3C 1R6VA 3Q43A 5A40E 4M61B 1X6LA 3MNWB 2VXQL 3Q5TA 3A21A 3GB7B 4OH2A 2ITDA 3BWSA 4YSAA 1L7TH 5GRXG 2NUTA 1OAQL 5AVVB 4AKPA 1M1XB 3C2AL 3IDMA 2XWRA 4AL8H 1F90L 4KQ4H 3HE6B 3DGDA 1FFOB 3LS4H 5B8CA 4OLWH 4FYSA 1J1PL 3CD4A 2LTQC 2XZQH 1PLGH 4XAWH 4A7GF 4D9QD 2W60A 2HT2D 4EBQL 1F4WL 1KB3A 1ACYL 4ZTOH 4F7MB 3GXUB 1YJDC 4BKTC 4HS8L 1GKOA 4UQCA 4BHUA 1KENH 5EEZA 5I82A 2JCCF 4HYTB 5CD3B 3SJVB 2M83A 1JNNH 3HBGA 1X7QB 1PS3A 5IT2L 4MCNA 2HH0H 3KS0J 1CDYA 3L16A 5IW1B 4IBUA 2EIEA 3WNKA 3BW9A 1PD6A 3EYVA 4PJAE 1E8YA 3OV6A 2EYTB 1YPZF 5D5MF 4LLYB 1TJXA 4L8BB 4NP4L 3T0XA 2XN1A 5CWSB 4LPWA 4WW1B 5HPOA 2BNQA 4D9LH 2B77A 5HI5C 3OKDA 5LDSA 1JRHH 1VFBB 2ENPA 2PWDA 2WJ5A 3N06B 5FF6A 4M43H 1JL8A 4JFXB 4M03A 5D7KD 2R27A 1KB5A 1IBGH 4F7EA 1OB1A 2LU4A 1GAFH 3CMGA 3QQDB 1UOVA 1AOHA 2YZ1A 2OYLA 5L9DH 1LP9A 3JV4A 4F57L 1DVUA 3A67L 4F2ME 1QSED 1WQVT 4LPCA 4EXKA 2CD0A 5I30L 1WWWX 1JF5A 3EBIA 1A9EB 1OARL 3TF7C 3GO1H 2I27N 4DPCX 1SF5A 1GTNA 4LSSH 4MA8H 4HPOH 5F6IC 3M7OA 4EUPB 2CGRH 3HVDA 4M7LT 4NQQA 1W72A 2DWXA 4ZG1A 3FBQA 4NZRL 3TEYA 1T0OA 3IDXH 1A7PL 4HWNA 3DI3B 4XE5B 4ODHH 3ZO0A 3SKOA 4APQB 1JWMA 2WXGA 5GGRB 4HKZB 4ODXA 4XC1L 3CZKA 2PO6C 2OTUB 1WCBA 4UF7C 2XT1B 4TM9A 1VGKA 3WIAA 1A4JB 1D6VL 3O4OB 3WIHH 2YRLA 5A1AA 3OF6D 1J1XL 1YEDA 5K9KB 5KSVB 3QZOA 1UJ3A 4MYPA 1WBZA 2ATKA 4XODA 2BLFA 4ZUSB 3MCLH 1J05A 4YHMH 2J4WH 1F58L 1WE5A 5B7MA 1M6OB 3ZU8A 2K3HA 35C8L 3IJHA 5CJXA 3ARYA 4M29A 2EQDA 1E9OB 4UTBH 5HHQB 1E4XI 1TSRA 3CXFA 2ZKHH 1RZKL 2R29L 3CZGA 4YFDB 1X5MA 2NR6D 5DMGC 2WTRA 3LRGA 4XCYA 4ZI8A 4UTCA 1MCDA 1I7TA 5PCYA 2YGVA 5C8JB 4GW1B 4X99A 1OZUA 1WCQA 3K7UA 4LU5H 3RVVC 3F7PC 4L37B 5DHEA 4GO9A 1PZUB 1RERA 1YLBB 1F11A 1M57B 4Z7QB 2AEPL 5GZOC 3ESNA 3KWWB 5FYLE 3CVHL 2VAAB 1QSZA 4QAWA 1Y1DA 3GXTA 3PHQB 1JZGA 1KT2A 1J8HE 2YXMA 3DUSB 4DZBA 4DK5A 5LGJA 4AK1A 3LMJH 1BQUA 2AVGA 1A1NA 3H6AA 5DJ6B 4HS3B 1HCVA 5FYJE 4G1EB 3LZRA 3QIUA 4Y19D 1VFMA 5J1AB 1XGYH 4KBPA 1SZNA 3FW6A 4LZKA 4X6EB 4Y2DD 1SHMA 3QCTH 2CGZA 3GS4A 2W95A 5EZLB 1PZBA 1QFUL 4OIAA 3NPZB 4OR1A 3OAZH 4OJYA 4RRPA 4Z7NB 3SOBH 4I77L 5D7EA 3VI4F 1C12A 1JZ7A 4QHUB 3BKJL 3RL2A 2L7EA 3D3VE 3DARA 1DE4A 3CFCL 3TZVD 2BZ7A 3C60B 2QDVA 5KVDE 1DVFD 4HH9A 4M6MH 3RVTD 5T33H 4Z9KB 2IDTA 4OTXH 4Z95H 5ICZA 3BJLA 4UUJB 4X5XA 3GJFK 4GG6A 5ESVB 5I8EB 3HFMH 2KLTA 2O6FA 3QNXB 3BZ5A 3L08A 5ECGA 2E27L 1PG7W 4JFDE 1JXKA 4OCRH 4YIQB 2GCYB 4GNKB 4LQFL 3ZPDA 3QXDB 1CE1L 2NY3B 1ZHLA 3S5ZA 3MJ9H 1JPTL 1UZGA 3HLKA 5F89B 1A6ZA 3T0EB 3TCLA 1DQML 3AXLA 1FFQA 5I1KH 2VSCA 1IFRA 4Q0XL 3F7YA 5T3XL 3EFOA 4L5FH 3QZWG 3D48R 4U05A 1BA9A 3P9LB 3REVA 3SOTA 5E9NA 5HI3D 1XBDA 2C9SA 1ZVHA 1JZ8A 1X5KA 3FB5A 2VXUL 1OP9A 3HG4A 1TMQA 5JHAA 4JDTL 3HBZA 2WVUA 2AEWA 1SM3L 4PRHB 4DGVL 1ITCA 3VQLA 7PAZA 1XFPA 2VT0A 1S7QB 3REWB 3DTDA 4FXKB 3WL9A 4NZ8A 1I8UA 2GTQA 4MX7A 3D4GA 2R2BB 4RWYH 2Z1PA 5CJQL 4ELMA 1AC6A 1RZ8A 1OEZW 2W9DL 1V8HA 3QUXA 3V4PH 3O6ML 4TSCL 4C56A 1NCHA 3VRIA 1QRNA 3FFDA 5I9QC 2OSWA 6CGTA 5F7MC 4AW4A 4WI2A 1KV3A 3Q2CA 3FK3A 2CRIA 2O26U 3MV11 1PL3A 3CV5A 3FQWB 3WEMA 3R8BB 1FVEA 1FFPB 4DEUA 4NPYB 4DN3L 1F13A 2W9EH 4C54A 1CTMA 5C07A 3D25B 1MFUA 1UM5L 3FS9A 1D9KA 2WXHA 1P7QA 4PRAB 3BP5B 3BLKA 3E8VA 1FZKA 3VH8G 3LKQA 4HPYH 3QNYB 4HUWB 2HFTA 3TONA 5JLZA 4GAGH 1CXFA 3WO4B 2FB4H 1JK9B 4L8DB 5FCUH 4ENEC 1C5DA 1AGEB 4OKDA 3MODH 1HQRB 2GIMA 4HHWA 1LE5A 1BQ5A 43CAA 1KY7A 4Z5RB 3LV3B 3BMWA 2LVCA 4K7PH 1I4FB 5D4JA 4M5TA 4R83A 2DZEA 5EBGA 3IDUA 4I7ZC 2R2CA 5FK9A 4UQIM 5A7EA 5JA9A 1F1AA 2OL3H 1FC2D 3T3PB 2NY6D 4HC1A 3FT3B 4K3EL 3TWCH 1CLZH 2X0VA 3GUFA 5JOFB 4OKVA 4WWOA 1FPTH 2NY4B 4ZRGA 4YSTA 3VXMB 3ZLQC 4EN3B 3MRLA 3KEHA 4N25A 4FNLL 1R3HA 4X6DF 3US9A 1W6WA 5FHAL 2DIEA 1TQCC 1JZHA 1XGPA 1TQUA 3AMKA 2VLJA 5CP3H 4Z7VE 4ZO7A 3V4PB 2PO6D 1FI8C 2CE6A 2DD8H 2X44D 4PM1A 3W9EA 1ZANL 2FX7H 4Y1AA 1P1VA 2AMUA 3CSFA 4GSDH 5JIIA 2V2XA 3G5XA 2FAUA 4UINL 4MJ2A 2B1AH 2XNAB 3DX1A 4POZC 1IJ9A 2B59B 3X1FA 5EO9B 1M7UA 1MNUL 1YY8A 1KYUA 2A74A 3UCQA 4D94A 1NH6A 2EIZA 4KOBA 4R5TA 4XP4H 3X12B 3F65A 4WO0A 3D9AL 4HQQL 4L3EA 3MREA 4PPTA 2YXWA 1YVLA 4Z3IA 3MLVH 4ZMLA 2NX5A 3UX9B 2XKNB 4YHYC 3FUMA 1R19A 5E99H 3V0JA 1HEJC 5DMGD 2X3CA 4KK6C 2W81C 1W6LA 4MCYA 2YZ8A 1ETJA 5T1LA 3RI5F 4A2EA 1FO0H 3RVVD 2DM7A 2WKOA 2ZUSA 7FABH 5FOBA 4WEBL 1BZ7B 2QTEA 3ZQ9A 4LGPB 4AIXA 3KPLA 4I3GA 5HGDA 2A38A 1YYCA 1IAIL 4OZIB 1FIGL 3TBBA 2QFPA 4AYEC 3PAUA 3IDGA 4PW3A 4XWOD 1T7VA 4FFYL 4WNJA 2ISDA 3GRWH 3LQAH 5EZIH 4HUXA 4FNPA 2YQBA 2WQSA 5CR1A 3SCMB 3DETC 5ISZA 4CAGA 3SGEI 2ZXCA 3QDGB 2PR9A 5HYJE 4YPGB 3VXQB 5K1VA 3DX6B 5IMOA 3C8KA 2J7LA 3BEVB 1U30A 3SQOH 4XHQA 3TT1L 1L6PA 5AQ0A 3W2DL 3L5JA 4RFNB 4PJCF 1CD1A 1RLWA 1FNGB 3HN8A 2AQRA 4RDQG 3B43A 1Q72H 2J44A 2Z3FA 3LAFA 4OZGA 4GXVL 4H0GA 4XVSL 1B4LA 5I73B 3L95B 2GSGA 5B38B 5DJZB 1S4IA 5GRUL 5BRZE 2C7UB 4LSQL 4P2AA 5E9DE 2LFGA 4XTRC 3ZE1F 4L18A 1RZ7L 1IAMA 2ZOOA 1L6XA 1IEHA 4X6FB 2P46B 2E47A 5IROD 3WY2A 2BSTA 1TQBB 2ZX7A 5D1ZC 4YSQA 2A99A 3GSXB 4KX8A 4UT9L 2EXSA 4DP4X 5DEFA 1OWWA 5CBEB 1DLFH 4LSVL 1BD2E 2JI3A 4QHMA 5D72H 4XPFL 1TZGL 4R7NA 3VFPA 2CLVA 2F54E 2Z0UA 1B6UA 3EO0B 1ID5I 1ZVYA 3LIUA 4QRSA 1Y0LA 4R7DB 2Z4TA 3LRSB 4F1SA 5BV7H 3GTVA 4OFYD 2YAFA 1AQHA 1HYSC 3L9RA 4PSPA 4PJHF 1TT6A 4WLCA 2X89A 3HHMA 1AXTL 2NRDA 4Q9CA 4JFEA 2CH8A 4PRPA 1MJUL 4P23A 4ZDHA 3VWJB 3CLFL 3S8GB 4Y88A 4KROC 2OMWA 4OF3A 4X4YB 4G7SB 4X9GA 5FECA 5JYMA 2VOTA 4FMKA 4X0KA 4A66A 1S7SB 2BIQA 3QXUA 3QQ4A 3SY0A 1JVOA 3RTLA 1O7DE 1OM9A 1TETH 2CRZA 2FCBA 5DC0A 3ZK0A 5KSBA 4OZFA 2X87A 4ENZA 4Y2OA 1N70A 1XR8A 4GBXD 2OQJA 3N41B 4MHHI 1QSFB 5K5YA 3L3DB 4HFWA 3ZRCC 1W16A 2P7TA 2DQJL 3ULSA 3AXIA 3KM1A 1UT9A 4KPHH 3LB6C 2A6JB 3BP4B 1FDLL 1JERA 1X4ZA 3PWLA 4IRSB 5EBMA 3VFRB 1DL7H 2JWYA 2PMZA 3EOAA 1OCRB 4D9RE 4GRLB 1MFAL 3G6JF 1XF5B 1QFPA 4WW2B 5BV7B 4YH6A 3I9AA 3TVMB 2ADYA 4I0PB 3BPOC 2ENQA 3K1DA 4TVPH 2IMMA 1FZJA 1P7HL 1K4DB 2Y6SD 2PLTA 1WWBX 5GHWH 2WLZA 1U8IA 1MCSA 4PREB 1EMTH 2IFFL 1GYCA 4JHAH 2NT1A 2DYRB 5IFHL 2JE8A 4HV8B 1AHWA 1EZVX 2YLKA 1D5RA 3CVIH 2QADB 3QT2A 2JIXB 4PJGB 3SDCA 1S7VB 1A6WL 4A2HA 5AVSB 4GO6B 1YY9D 1NLDH 4QIRA 4UQEA 4Q9QH 4RFOH 3RGVA 4DUWA 3TURA 2FSEB 2FTAA 1E8WA 2FGWH 1K2DA 2WZ0A 2R0WL 4P5TA 4OQTL 3I6KB 3CHPA 1DJIA 3HB3C 4NI3A 1GL4B 1FYTE 3MRDB 3NESA 4FQ1L 4LVHC 4QYOA 1Z9MA 3NACH 5DLMH 5E2WH 1EGJA 1VHPA 1BQKA 3I2CH 3VE0B 2DWSA 4JFYB 3VI3B 2BVQA 4PBVC 1CXIA 3LRKA 2JLPA 1I1RA 1TQVA 3DROB 3QDMA 3CN0A 4XOBA 2DICA 5FYKH 3PGFH 3D52A 5D1XA 4DP6X 3DX7B 5IB2A 3PABA 4POZD 2LHAA 3PY9A 3U2SB 5IBUG 3UG3A 1RZJC 2WAQA 3DMMC 3JUYA 1JE6A 1WBXB 4XP1H 5F1IB 2A9BA 1X5ZA 3A0OA 1RJZA 4RX4A 2C1OB 4PAZA 5TGBB 3IB4A 4JNXA 2N0MA 3VWKC 2V4LA 3L4YA 5JHBA 1W0YT 3D08A 3A6CH 3ML8A 3T77A 1XBRA 1ORQA 3P3SA 4X7SL 2J6EL 3UABA 1HWWA 3GIZH 1CDIA 2PYEB 2ARJQ 1SXNA 2A77H 1GGCH 4RNRB 4TQHA 1AVAA 1KB5H 4XHJD 5JHLL 3IDMB 1SPDA 4HF5L 1NA8A 2HLFD 2AK4A 1I1AA 5EU6D 5B8CB 4TUUA 1ZLWK 1O7DC 4HJGA 1DQQA 1G7JB 4PJAF 3QDJD 1AGCA 4S0TD 2W60B 1H15A 1BW8A 2BCKB 4MXQC 1TTAA 2DF3A 3LNGA 3BEWA 3DETD 5BO0D 1O6VA 1KWKA 4F9LA 3PP3K 4M1CD 4NQED 5IQ7H 4R26H 1MCWM 4DK6A 1OT1A 1JHKH 2APBA 3MRBA 2C9RA 1HL4A 5FO7A 1W72H 4W9ZA 4LCWE 4NENA 1I1CA 1D5XB 2Z1KA 4DKDC 1J0ZA 1AR2A 1FRGL 3PQYE 5GGVL 3EYVB 5T3ZD 2AZAA 3HAEB 1DP0A 3CC5A 3MTXA 1UQSA 3TO4B 3V0WL 1XSOA 1M3JA 1IX2A 4M8UA 3N55A 3BRGC 5D4HA 4MJ4A 4HLEA 3V7MA 5HD8C 1S5HB 3GSNL 1KF9B 3RYMA 4AEFA 4N8VA 4PD4J 3T0BA 4S1QL 2HT4C 4CJ0A 3VRLE 3ZE0F 5LKNA 5IQOA 3R1GL 4P59L 1E3ZA 4MASA 3S96B 5IFJA 3QEQD 4QXTB 3MRIA 1UHVA 2V7NA 3UPCA 1NGWA 2IWEA 3BIKA 3CUPB 3GGWB 3FTYA 4M5YH 5KBKA 3VX0A 1LP9B 3QIWC 2P3YA 3G5VA 3JV4B 5EF2A 5D7JA 3KDPB 2LLNA 5IB4A 3LH2H 3VB9A 4HWEH 3ZDXB 2XU9A 4LBAA 2X4OA 1N59A 1JZEA 5D71L 1X9RA 4MJID 4W9GC 3C6SB 2XIDA 4FHKA 4IK6A 4CGUB 2F5AH 3ALWA 4M93C 4KROD 1BYPA 3QSKB 4AITA 4WWKA 1YNTB 5EDXA 3V6BR 3FQUB 5DD1H 2MNWA 2WBJD 2HX7A 4UAOC 4MD0A 4ZS6C 3QO0B 1PKQB 5BOZG 2WZAA 3P3UA 2BIMA 4K9EH 4AC2A 1WCBB 4DWHA 4MNHB 5KYWB 4E9XA 1VGKB 5DFVC 9PCYA 3OMIB 2IAND 5C09A 1Q4NX 4GP5B 5DQJA 3ROLA 3HA0A 3LTVA 1T04A 1YEDB 1IKFH 3MRPA 4IBLT 1UJ3B 5FYJL 1ZT7A 3LIZL 2CKBA 4HKJA 1B0IA 4BIKA 3M6DA 4NQVB 1AKPA 4TUOA 4RGMC 3LZQA 1CI3M 4GG8A 1YEHH 2ZOTA 4NQCD 2A2QT 3VM5A 2V8MA 2EDRA 5LO7A 1RJCA 4XCYB 4PY8I 1I7UA 1V55B 2JVUA 1XGRB 4YZWA 1FJ1A 1MFDH 2J21A 4X99B 1IQDA 4PHXA 5SWZE 3EOTH 3MPCA 5HYSB 4G72B 5KVDL 2YGOA 4PW4A 1B88A 4ETQB 4I0CC 5B4MD 2YEQA 1KCKA 2YD9A 1F11B 3O4LD 2VLRA 5T1KD 3ARFA 4HWZA 4QHNA 3PPSA 4O51A 3Q2LA 3LZNA 1KT2B 1MCOL 3SDAA 4DZBB 1QRKA 5I6XC 5LGJB 1RAMA 2OZ4L 3ULUE 1A1NB 1WTLA 3UTSE 4XBEH 4EOWL 4TSBH 4XVOA 5BQ7A 3G5ZA 1BF8A 1BVLA 3HB3D 4H4NA 5EZOL 4JHVA 4G8GD 4JO3H 4XP6L 1X5YA 3SKJH 3L4ZA 4A55A 2Y6TE 5ID0B 1BXUA 2QQLL 4XMPH 3AB0C 3GEFA 3L9EA 2VDMH 1JGLH 3MLUL 3EYFA 1RP9A 4NLAA 1C12B 1P5UB 4MQXD 1GJUA 3RL2B 4LFHG 1EUTA 3DXAB 1DE4B 2DH2A 4FGMA 3CFTA 5HI4C 3O2VH 1JI2A 4MSWB 3L4CA 4Y5VC 1A7NL 2YQ2A 4ZFQA 2X4RA 3MCG1 4HK3J 1LE9B 4AQEA 1JG9A 4DOHE 3SD2A 4LARL 4AKQA 3NRQA 4U1LA 4U1KB 4WFHE 3FCGA 4OLZL 4X5XB 4DP1X 4DPRA 1TYJA 5A6MA 5IESL 5J5EA 4GG6B 3CFBA 4MMXC 4EIUA 1CN4A 2DQFA 3BIAX 4KQ0A 4YO0A 2ITFA 4NP9A 3ZR5A 1CVRA 3SO5A 4O2FA 2ESVE 4MBRA 3G08A 1ZHLB 2A73A 1N0LA 3O6KH 1A6ZB 3H7BA 3ECBB 2H7WA 3TCLB 3L5WB 3KEDA 1MDTA 2ZE0A 3AXLB 4W9JC 5E6SB 3KWXA 3EFOB 5KBLA 3EUUA 3LDBB 1F02I 1S7XA 1ZRUA 3K8KA 3M17A 5HY9B 3GDCA 4HALA 2FLRT 2JSFA 2JJSC 4MXQD 1E9PA 3FB5B 1NJ9A 2KDGA 5DZNA 4IOIA 1BFOA 1BMGA 1M6UA 3Q8AA 3MA7A 1OCWL 1DCLA 4UCFA 1WHOA 1B2WH 3GRGA 4IDLA 5DF0A 5F9WB 3U36B 4RSVA 5EUOF 1HCYA 4N0UB 1R46A 2BNRD 3OHMB 1A6VL 2DI9A 3G6AA 1F45A 1DBML 3QORB 4X9HA 5I1AB 3GJFA 1EWHA 1NMCB 4Y4FB 5GS1A 2AEQH 1R3LA 2X53A 4IRJC 4HC1H 2OTWB 5LN8A 5A2AA 4K3JH 2GY7B 1P6FA 1CGYA 1NUDA 1CICA 4WJ5A 1AIFA 1EDHA 1P53A 2XJLA 4ANVA 4UIKL 3GM8A 3QUXB 1R3JB 4P9HL 3NCJL 1AP2B 5HD8D 4C56B 1NUGA 3BX7C 1IM3D 1X5GA 1OTTC 2WBWB 3LKPA 5C08E 3TJEL 4U1JA 3TXAA 5CS7A 1NDGB 2HT4D 5AALA 1KBGH 3IMBA 3WS6C 3OKMA 4U49A 5L2KA 1H3WM 4WUKH 3AJ7A 4MZRA 5LCVH 3FTSA 2JI2A 4B3VA 1TTFA 1P7QB 4JPSA 5DI8B 4AYDC 4OI7A 5FUZL 3BGMA 3RWDA 1VADB 1NUNB 3QUZD 3QZWA 3ECWA 1HI6A 3H7LA 5T1MA 1IBYA 2E8ZA 4EQ2A 3D0VA 1YCSA 4JVWA 4DEWA 1JTOA 1C5DB 1CBVL 2Y2WA 4FG6C 2DPKA 1W91A 1LE5B 43CAB 3VXUD 4Z7VF 5KAQF 5DZAA 4XMKH 3O6LL 1SLUA 4R8WH 5KW9L 4IMLA 1D6EA 5FK9B 5IHLB 3F00A 1IT9H 3HC3H 3IWVA 5SX5H 2ZCLH 4DQOH 1L5GA 3QJUB 2IF7A 2WZ5A 4TNVK 1QLEB 4FQ2H 2X0UA 4OKVB 4N24A 5C9JA 4JAMB 3K6DA 4TQEH 3FYEB 2VLJB 4QRPD 4KJYB 3FSZA 4I3RL 3OLDA 2AQSA 3AGWA 1WSST 2QJDA 1X5HA 3ARBC 3OKNA 5DFVD 3KXFB 1DSWA 4PCTA 4UZSA 1JDDA 4AYSA 1THAA 3UOAB 1FN4A 4FXTA 4FCAA 5JZ7D 5G4NA 4PS8A 1W0VA 4AGLA 4PRNB 3ZO9A 2OR9L 5ALCL 5I1EL 3LPFA 2EDYA 4L3EB 3MREB 5JW4N 3OAYH 5C0EB 2NX5B 1JI1A 3BYTA 4UNUA 4ZPVB 5D1QA 4I2XB 3VH8A 5F3FA 4K3GA 4CVZB 1FLRH 2GBTA 4P46D 1MW0A 3JZ7A 4E41A 3BD4A 2L04A 5AENA 5C6TH 5MHSE 4MCYB 1YEKL 2ZF8A 3N3EA 3WCYA 2WNXA 1XGUA 5FOBB 3GIVA 1LEIB 6PAZA 5IHWA 4YDKL 2WOBA 3PDDA 4K07A 1BVKA 3TN0A 5HGDB 5BUAA 4OGAD 1E9QA 2B2XL 1IFHH 4U1NA 1UOLA 1ZY9A 3IDGB 4J28A 4UT7L 4XCCL 4KK9C 3PV6A 1KGJA 2CBTA 3CSYB 4FNUA 5MENB 1BYOA 1S7RB 3DDGA 2ZQKA 1IGJA 4KFMA 4F33B 3AG3B 3NUKA 5KVEL 2GITA 1UWXK 1JD7A 1JK8A 3NIFB 3C8KB 4TOYL 4XO9A 5IMOB 2ILLA 1A7RH 3HNSL 3O9WC 4LL4A 1MY7A 3FCSA 5ACLA 3RWIA 1L0YA 3MCYA 2HPTA 1EERB 3MJ7B 1CD1B 5CIPB 4NO2B 1G9MH 1PJWA 1IVLA 3K2IA 5CCKL 5E8PB 4QTHB 2Z91B 5G5DA 4FHBD 4J3OG 3GSUA 3QR1A 1T6BX 1RMFH 3EJJX 1NCBL 2HAZA 3B5HA 2V17L 3US1A 1TU2A 3IRZA 2QV2A 1OSYA 2XZZA 2ICWJ 5DQDL 3U6RA 4D0CA 1EAJA 1SN5A 3KYNA 3L9BA 1BM3H 3IJ9A 5DRNB 3HEIB 5JXEA 1U95B 3QQXA 2JJUA 1OW0A 1FAIL 2VUKA 1BEYL 1NFDA 5BOJA 4FLHA 2YBRA 4W9IC 5DFWH 4QHMB 2WVVA 3D6GA 4JE4B 4FADA 1KTBA 2YGPA 2OK0L 3EBGA 3MVSA 1WITA 4HP5A 4QRSB 1RUQL 2V2WA 1PZ3A 4MAYC 5HHOA 4DO4A 2EDTA 3BSZH 4N0CD 5CSGA 3L9RB 3RU8H 2IH3A 3AG2B 4UYQA 1NCWH 1U91B 3V5HB 2XFXB 4JFEB 2ZKWA 3GJEB 4PRPB 3BE1L 4P23B 5EFIA 5AB2A 3TO2B 4OCYH 3LJ3A 4KTDL 3KPRD 2ATPA 3BUTA 1IL1B 4X0KB 2XRAH 1NCTA 3ASNB 1U3NA 3QQ4B 3SY0B 4DTGH 3L7EB 5EU7E 4N0YL 4U0QB 4BFKA 3KVPA 1T5XB 5AVYB 3M1OA 2BVEA 2XTJC 4KKCD 2DL9A 3MRGA 4PGZA 3WKNA 3VXRB 2HRLA 5CEYA 4HSQA 4OZFB 1K6QH 4IRJD 3IDJA 4JR9H 1JPGA 2VN6A 2A9MH 2JXMA 5AKTA 1KELL 2CM5A 4CN1A 1AIZA 4H0HB 1EGJH 1OM3L 1MQKL 1MJJA 5E7FA 1A7QL 5C6WH 3VXPB 4Q9RH 4H8QA 4AE1A 3UO1H 5EBMB 3BH4A 1OTTD 4NQSB 4ONGH 2ZG1A 1A3RL 4LHJB 5SWSB 2IBBA 2BRRH 1NCAH 2FJUB 2ZXWB 3MRQA 4ZX4A 1UKQA 1QLFA 2R15A 4OF7A 3P3RA 1JYXA 3KNBA 1FZJB 1UEYA 1G7HB 4IBWA 4FCHA 1HYRC 3QA3A 2X4UA 2G5UA 1AO7A 3FU7A 1AHWB 2UUDH 1T3FA 4EF3A 2VN7A 4FG6D 2DJSA 1TNNA 3SDCB 2LLLA 1CR9H 3FYIB 4M8QA 4PJ5A 2OMTB 1DDTA 1RK7A 3BD5A 4AL8C 2GAZA 3V5DB 2DBLH 4N85A 5AG9A 3SDXF 5C0GA 2WTPA 5J0BA 1K2DB 2ORBL 4WO4A 1J9QA 4XVTL 4X6CB 2CNYA 4OCSL 3V6FB 3VXNA 1WIUA 3PJSB 2W65A 2W94A 4YDMA 3WJLA 1OGPA 1UYWL 2OJ1A 5TF0A 1ADWA 5D6DC 5IB1A 2H1PH 3BKCH 4FD0A 3T0EE 5HYFA 2DQDL 5C0AE 4EN2A 3ARBD 5D1XB 1DVTA 3T4YB 3S0PA 1DANT 4P2RA 3QH3B 4LCIL 2ED7A 2Z7ZA 3PABB 5IB2B 2CLRA 2GJRA 4G59C 3W5NA 1JZIA 2YN5A 3BAJA 4J4PA 3NJJA 1AJ7L 5F3BA 3WKMH 5TDPA 1N12A 4W9LC 1GGYA 3I6SA 4LESA 4ZFOB 3CN1A 4HZLA 4PRHE 4BJLA 3BH9A 3A6BH 1EIBA 3GBML 3IDIB 1Q9WA 3BVWA 3HE7C 4NEHB 5JNYB 4HCRL 4RA3A 2NXYC 5CSZA 1XIWA 1ORQB 4TULH 3FT1A 3EDDA 4JFHE 4QHKI 4OV5A 2BP3A 4EJ1C 3RPIA 1MELA 3P77B 3ILEA 3L3KA 1ORSB 3I9IA 1CDJA 4KK9D 4HUUA 4NAJA 2OMZA 3GPEA 1AGCB 4FNSA 1H15B 2J5LC 2WWMC 4ABVA 5CD5D 2DLGA 1R47A 1CGSL 2ZJSH 3GMQA 3KYOA 3NAAH 4MDIA 5HVFB 5CKAA 3MLZH 4UQDA 2XV3A 5EDSA 1KPVB 4H8WH 4OFQA 3MRBB 1AI1L 4XN7A 25C8L 5IVOA 1E4WH 4AOFA 4F1ZA 3BKMH 1A5FL 4L5FE 1JTPA 1TO4A 2HG0A 3VRLF 2W0FA 3B9KC 2CHZA 4NENB 4KHTL 1BZEA 2ZYSA 1CGTA 2KHAA 3NRFA 1TR7A 3FAWA 2Y69B 4L4TE 4U1GB 4GAYA 4S1RH 2Y72A 3IMSA 1XF1A 4JFQA 2N0KA 3TT3L 5JQ6H 1NKRA 1UQSB 3SSGA 4W4OA 1ACXA 1A1OA 3MFFA 2DQUH 1ZV5A 2F8VA 3LPWA 5CHNB 3TFBA 1KIQA 3FTXA 4U4IA 4N8VB 2FWUA 4HT1L 3GI8H 3K0YA 4YSOA 4P4KD 3TBSB 1U8HB 2BP5M 2P5EB 4WTQA 3T3PE 4KKQA 2IWKA 2CKBH 4A6YL 1D5ZA 5AVXB 5IFJB 4AEIH 1Z32X 1BG1A 3BIKB 1MF2H 3ULVL 4RAUA 4FI6A 4LAJH 5JPNA 2J8UF 3GMRB 1IUZA 4L9DA 5DVPA 5EZPA 1G1YA 1OAJA 5HDRA 3VTMA 3T4AA 3B9AA 5LAPA 1CLYH 1NBVL 5IB4B 2BMKA 3JVFC 4Y2LA 4MXWL 2X4OB 4L9LC 4I87A 4PU2A 5J6GA 2H0EA 4FF9A 4DGIL 1N9PA 4LPUA 1ZV9A 1N6QL 2OZNA 1ECYA 5E94A 4YEFA 2Z8RA 3LNDA 3U82B 2GUYA 4JMNA 2ATAA 1KTJA 4BSWB 3NJLA 5BUPA 3FN3A 3MOAH 3LXUX 2ZYRA 1CBJA 3GHBH 2FIKA 1JP5A 1MJ8H 3ATAA 2Y5EA 2X6UA 3GBLA 3T0DA 3LEVH 1UFGA 2D3JA 5C09B 3V5KA 3GTTA 2WPGA 1UOWA 3ROLB 3MRPB 2UXVA 1SRDA 2W0LA 1S6NA 1B3JA 2CKBB 4FNRA 4HKJB 3MLXL 1ZJAA 2XN9A 4MDJB 1ODUA 1QHPA 1P4IL 4GG8B 3DLQR 3QDGE 2BO0A 4MRCA 4KNTA 5DK0A 2OP4L 3CQFA 3V6ZA 3UG4A 2ZOKA 4MAUH 5CFAA 3OAWA 2XWBB 1BMZA 1WISA 1JNJA 5BCAA 1NOAA 1MWAL 2CO2A 5AVUB 1QYGL 3ZTEA 1T4WA 3BRDA 4LPTA 1KXTA 1M7IB 3FT0A 1ROWA 2VLRB 2ZWNA 4GSUA 5DJ0A 3FAXA 4QHNB 3NSYA 4XH2A 3NZHH 3RWEB 5EORL 1FL3A 2VMJA 2VAJA 1GSMA 3SDAB 3EJZC 1BF2A 4ONFH 3JVGC 1PSKH 2YPLD 5DWUH 1NGPH 5LJYH 1NBYB 4Y5XC 5HGBA 2YUVA 5JORA 1QW9A 5BQ7B 2AJUL 3G5ZB 4JRXD 1MPAL 2O72A 3HPLA 1JBJA 2V5YA 4BZ1L 3L5XH 4TF4A 3QE5A 3KCWA 1K72A 4I85A 4F8OA 5KVFL 4Z8FH 3RL1A 1OT2A 1T7YA 4LAQL 3MROA 4U3XA 3BGFB 4XWGH 2WKGA 4Y89A 4JO4L 5A6IA 1QLRA 3CDZB 1TSHA 3QXAB 4ODTH 4WUUD 4LP8A 1N6VA 3BWUF 4PLOB 3G5YA 2HRHA 2XN2A 4PWJA 3GJFH 2O5ZH 1FBIH 2GPZA 3RAJH 2X4RB 3T2PA 2MEJB 1DYZA 4G8FB 3UAJC 4IBYA 3M1BA 4AQEB 5BJTA 5DUPH 4F7TA 4NN5C 5ITFA 1SEBB 1SEQL 1WDAA 3NABL 5C9KA 2F58L 5KS9A 2GSIA 4NJ9L 3EJCA 4JEGB 4OCXH 2DLTA 4J2XA 3CFBB 2MTPA 2KYIA 1H9VA 2DQFB 3ASWA 5IWLA 1NEUA 2P5WA 3FO1A 3NZ8A 3DJZA 4PGDB 1GA2A 3IFNL 4O2FB 1PNDA 2C3VB 3HE7D 3MTRA 2Y0SA 2EZ0C 1UTDA 1NSNH 4PRID 3G08B 1A1MA 4JKWA 4U1MB 3U7YH 4A2FA 4S0HA 2ADIB 1RULL 1ET5A 2DIJA 3CQPA 3WTSA 3CXDH 3PAZA 1KGIA 5D6CA 1QSFE 2IH9A 4X50A 3DJSA 5ADPH 2D8KA 3P11H 3LKRB 1N7ML 2VM3A 1UB6B 3RX8A 1PG7X 3RNKA 4XBMA 1KJ2A 3GUTB 1S7XB 3FUIA 3QRBA 1SJEA 5F7AA 2WB7A 2XPGA 5DD0H 3CXHK 4YDJB 4HMEA 2JKNA 1NJ9B 3VXSA 1BFOB 3MA7B 4ODVL 2HFGL 3UTOA 5BMFH 1KPUA 1DO5A 4GKLA 5BVJB 4YGAB 1BWMA 5FA4A 1D3CA 2Z9TA 2D73A 3ZY7A 5C0BA 3G6AB 1NCOA 1Y18B 2XA8L 5IOKA 3B9KD 3WXWL 1GJWA 3MV01 3WNJA 5CILL 2H47C 1IGIL 4PR5B 3US0A 4AMKL 3SGKC 1CICB 3ZKSD 4WJ5B 3WEAA 3VD2A 1BFVH 1MRDL 1E28A 2EE3A 5AAMA 3SPVA 1OSEA 4NIKB 4OD3L 3LKPB 1NWPA 2GYSA 3QUYB 2ODIA 5K93A 2OMYB 2P28B 1SUHA 2X38A 3BKYL 3OKMB 5CN2A 3JWOL 3HZ3A 5AW7B 2A1WL 2IQAA 3ECVA 5JIDA 3VMNA 2AMGA 4RRPM 1G6VK 3VI3E 4M8VA 2D0FA 2EXWC 4I18C 1AZUA 3RWDB 3BGMB 1YEIL 3EFDH 3HW7A 2CUAA 4KJPC 2IDUA 1AQ8A 2C7FA 3MLRH 1CU4H 4R9HA 4G6JL 5ABZA 1TJGH 4BZYA 5HBBA 5FWQA 1GXEA 5GJSH 4PWEA 2FR4B 4P5KB 3QZNA 4F37F 3GSOA 4XO4A 3Q6GH 2HCZX 2DQMA 3DV4B 3GT6A 3MLTB 5FGBC 1B90A 3HI5H 4F7KA 3ZYIA 2YRZA 5BPPA 3AAZA 2UZIL 4TVPE 1Z66A 3WHXA 2W8CA 1KJ3L 5I8KH 4NJAL 5C3TA 4DJMA 1EZUA 3VXOA 4HGKC 4NGHH 4LSTH 5C9JB 1JPFB 4J6RL 1KB9K 3QK0A 5K1JA 1MNNA 3TH4T 4EI5C 3NMEA 2B9AA 3MJGX 5E1QA 2MQ0A 5CGYC 1OALA 4U33A 1DBBL 3OKNB 1HZLA 4NFCA 4NN6B 1EO5A 1RIVH 2IVFC 2ZZUT 4XZUA 4KU1A 5HHMB 4B9PA 4EI6A 4GKNB 3NZSA 1FNSL 1CTOA 5F96H 1KCSL 1CVSC 3LNFA 1D5MB 1K85A 2CXGA 4MNGA 4QI3A 3CZNA 2X7LB 3G04A 4KQ4L 4YBLB 2HTKC 4MMZA 3CBRA 4ZUTA 4KZEH 3II3A 2OXGA 3EYOA 4QGTA 1GW6A 4QO1B 2ZP0T 3D18A 3TLRA 1AQKH 5CO1A 5KG9A 4PCYA 1QSEA 4KZCA 4KUZL 1CTNA 5I6PA 5T1DL 3VO0A 3MXVH 4LGRB 4QRAA 5CGMA 4K7PY 2O5YH 4TL5A 3RB7A 4U1NB 4ZMXA 1B4RA 5FV2A 4YLCA 4QTIH 5FO2A 2LU7A 2B20A 2BNQE 2NXZB 3LPOA 4ZFGL 2FX8L 2J1YA 5KSAB 1BV8A 1T20A 1IGJB 5ICXA 4GRWH 1WFJA 1DQDL 4R97C 2GITB 3VGDA 5D7SL 2J73A 3GSWB 1Z9SB 3CFKB 1TITA 3FRUA 3N85H 3FCSB 4HJ0C 4X5RA 3RWIB 3UAEA 1I1FA 2CNZA 3MI6A 4M43L 3NPSB 2F7IA 1LP9E 3H6JA 3NVQA 3TJHC 3ZYZA 2XG4B 5G5DB 2DRUA 3OF6A 4G5ZH 3GSUB 1HHHA 4ZTEA 1WC7B 2AI0H 2JJTA 2WYIA 1T5KA 1Z9LA 4ERSH 4QLWA 1F8TH 2VR3A 5IK3A 4OI9A 2WN3A 2Q6WA 4D0CB 2HG5A 1RZFL 1QD0A 4ZODA 1AR1D 3K2MC 1GOFA 2DEYX 4AM0A 4QYAA 3GMLB 1V7ML 2FATH 2NR6A 4YHNA 4F8PA 1S9WA 4HPOL 3D85A 1U8MB 4DK3A 2EZ0D 1PPIA 5DURD 3D12B 4MFHA 2Z64C 1NL0L 3T6VA 1XF2A 1NUFA 2VC2H 4N22A 4R3SA 3WFDH 1CD0A 4X5WB 2IH3B 1YDPA 4Z0BL 4FXGC 4DFIA 3WYRA 3MAWA 2CDEA 1MIEL 4W68A 5IQNA 1U8LB 2RB8A 2F5BH 4PJ9D 5EFIB 4UQAA 4ZAKB 3SYQA 2BVPB 3FPXA 1S7UA 3NCCB 2WXKA 3HNVH 5E4OA 1OTSD 2F8IA 3LNEA 1FL6A 2ATPB 4O02H 3TGXA 4Y2DA 1MW1A 3DWTA 2XBZA 3OB8A 1KUMA 2QBWA 1CXEA 2J4WL 4IHBA 1CG9A 2D03L 3SBRA 5DVOA 2WYHA 2LE9A 2CALA 2NOYA 2DQHL 2XY1A 3FQTA 5JPMB 1QR1A 3HZVB 3IDJB 5MEPA 1BCIA 3GXNA 5DEGA 3WN5A 3MOBL 5KYYA 1AHMA 3MBEB 4P8QA 3TZVA 4UNTA 4Y8AA 4JM2B 2IJ0C 3N50A 1DVFA 5FM5M 3QHZH 3DBXA 5DRWA 3VJ6A 5GS0H 3CSTA 3FCUB 3INOA 4HJTA 4Y4KB 4DP2X 2B8OT 2MOVA 1RHHB 2BC4A 4FQHA 1PZ2A 3FQ1A 4QWWD 4KXZI 5AOLA 4A7UA 4DGUA 2VC2B 4O00A 5AZUA 3CSBA 4UIMA 2YXFA 3TA3A 5FO9B 3RDTB 2CIKA 4WHTA 4JDEA 3WUZA 1JF6A 4X8XA 4YBHA 1UZ8A 3KNBB 3QO1B 2WHVA 3HMXA 4ZX3A 1UATA 3UACA 4QKXB 3QA3B 3P9WB 4KJPD 2X4UB 4F9PC 1GYUA 3FU7B 5FUOH 3TC9A 1BQHA 3VFGL 1ACZA 1T3FB 4DVBB 3U9PH 1LWJA 2ZSWA 4H1LG 5F88A 1G9NH 5MEOA 3SOBL 1JNLH 1ZEAH 2Y9RT 5B1CA 2QSTA 3PRZA 4BKSC 2IWFA 4L3AA 3OPZH 4G6FD 3UO8B 4ZXBC 3LN5B 4OLXL 3EO9L 4XP9L 4GG6E 5IQ9B 3TBYB 4FN0A 1XZWA 3UTTB 3RZWA 1YECH 1CF8H 4I5BA 3QP3A 3EHBB 4N2LA 2RCSH 3VXNB 2PXYC 1CFQB 1VGEL 2W65B 4F7CA 5H4ZA 4K73A 4OM1L 1B4TA 1MHEA 3QFDA 2ZUQB 2G75A 1T03H 8FABB 5DMIH 1HILA 2J88L 3BPLB 4NZFA 1SLWA 2EDBA 2AABL 3ELQA 4PSRA 2FUTA 3VTAA 1Q0YL 3KJ4B 3QEHA 2FWSA 5K9JL 1TCRA 1IM9D 1DJGA 4OUUA 1FH5H 5ADOL 2F19L 1E90A 5FW7A 4TRPL 3VXTA 4M62L 5F3BB 5TDPB 4TMPA 2XHNA 1T1ZA 2HTKD 3CN3A 3UZVB 5J11B 2FO1A 4E9VA 1PTZA 1RXLA 1PX3A 1EEYA 1G7QB 1VFAA 3E9UA 3QFJD 4WCYL 2AJVL 3VGHA 4WAFA 2B3RA 2X4NA 1Q9WB 4QRRB 4S10A 5K9OA 1NCGA 3QFGA 4GMSH 4YX2L 5CSZB 1XIWB 3DX0A 4FFZL 4JZNB 4LLVA 2CHXA 4OV5B 1IFGA 1ZLWH 3X3FL 1N5YL 2C1PA 4ATWA 3D0AA 2PTUA 3EOBB 2HKHL 4XB3A 3G3LA 1IGML 5SX4I 4ELME 4ODWA 4WY7H 2CIIA 4IDJL 3AC0A 3PP3H 4HUUB 4C56E 1M7XA 1QRNE 3DVIA 4JFOB 5T5NG 2XVKA 4L29A 4LLMA 4LOEA 2ZPKL 2F6AA 3HC2A 2RIKA 3KYOB 1DVQA 5DC2A 2CGYA 2C9UA 5C0CB 2VDKH 3OJDA 5C07E 4Y8DC 1C1EL 4FTVB 1LO5B 4HJ0D 4N6QA 2GT9A 3VFSB 2CO7B 1URLA 2PO6A 2QVMA 1UZ6E 3T3PF 1WICA 2FSDA 4KNQA 5L0QC 4OSUL 3I3DA 3HJEA 3CZUB 4GAYB 4E42A 5TQ2H 2Y1VA 3QIUC 1ODAA 2YSSA 3MX0A 3GTNA 3NSFA 3FO9A 3JTBA 2Q3AA 1N64L 2EINB 3A47A 1MI5A 4NNXB 3KBPA 4HCFA 4IGBD 2YK1H 4IJTA 1I8IA 1WWAX 2E6QA 3CFMA 1DJWA 3I75B 4ZMAT 3HUJA 5D7IB 3OKLB 2VW7A 3BAEL 4GINA 5DD5L 3DIVA 4XNDA 2F74B 3FOLB 5FYJD 3H3PL 2ROYA 2WMPA 1JV2B 1TQSA 5E08H 1ASQA 1J9SA 2RGSA 3SO3B 3WLBB 2VDOH 2ZX9A 3AT0A 4FQLH 4PJFA 2VLJE 5JPNB 4UV4L 5MP6H 1CLZL 2H8PA 3T4AB 2XIIA 4Y1AE 5EBLB 3V55A 5KVGE 3C2SA 5GZOA 2BMKB 1W0WB 4Y4HD 1DN0A 3K4ZA 2DD8L 2Z31C 3I9GL 4OLEA 3EFFB 5J6GB 2K4WA 4JHWH 4K2UH 5E5UB 2E4TA 3P4NB 4GSDL 1IGFH 4YOKA 5E94B 4TN9A 4L3EE 3QPXL 3BQUC 3GBEA 4DN4H 2GB2A 3L54A 2NX5E 4NHCH 4WJKB 1BJMA 4FERA 2D7NA 2A3TA 3DDFA 4EAEA 4AUUA 2OMBA 2RQEA 4XP4L 1W8EA 3WIFA 1HKFA 2OCFD 1HINH 5AKRA 2PCFA 4KO5A 2P5PA 3SKNA 2YMXH 2Q7AA 2PTTA 3QJFA 4R7XA 5E5RB 4OVVA 2JB6A 5E99L 4JDVB 5E5LA 1QBBA 3V5KB 3W81A 3EH3B 1QACA 2QSVA 3OKKA 5KBMA 5CZVH 1JPSL 2B5IB 3DOIA 3U83A 2OPCA 4LEBA 5IVXB 2XVBA 4HUNB 5J13C 4ZQKA 1I8MB 3O8XC 1F4XL 5ISZE 3B3IB 3MV9D 3V4VA 5I0XA 1Q9LA 4BZ2A 5J3HC 1IAOA 3NIFE 1E4HA 5DR5H 3SYPA 1P4LA 2IALA 3QRGH 2PW2A 2M8XA 5F7WC 2BP0A 3LKOA 1GGIL 4RIRA 4OFYA 4G8EA 4OZGE 3RFRA 3DOHA 1V54B 2XKUA 1HC1A 1KXTB 4XCFH 3U4KA 3C08H 3GZQA 1XGQB 1PY0A 1O6TA 2Q86A 1CGUA 3OR7B 4IHOA 4G70B 2VLME 5E8EA 2C4FU 4O5LH 5DMJB 1L0XA 4JPVL 1EAQA 1PBYA 3STLB 5LNGA 4DT2A 2HTLC 1JNHB 5DJCB 2H3NB 4M3HA 2NTSP 4G7VL 4ZXBD 1WD8A 3UZEC 5H37G 5JORB 1C8PA 3IDYB 1T4KA 3GXIA 4B5EA 1JHLL 1OQOA 1ID2A 4MGXA 3QQNA 5DHVA 4S2SA 1UACL 3S35X 2GKIA 1CK0H 1RUKL 1BOGA 2FZ3A 2IGFL 4WFGE 2UWEA 5DUMH 2B0SH 4PJXA 3G7TA 2XX1A 4PJBA 3RL1B 5I1GH 4HBCH 1QAWA 4MMYB 2EUXA 5ADOH 4XMLH 2YRPA 1SJHA 2AS5M 4KRLB 3PUCA 1QLRB 3QHTC 5IR1B 1JZ4A 2X12A 4JFEE 3G6DH 2EC9T 3G5YB 4PRPE 5IVZB 5BV7L 5AZ2H 2QHLA 2Z4QA 1DJXA 4LRIC 4GPVA 3N41F 4CC4C 4N86A 1QNZH 5DGRA 5JUEH 3M1BB 3KHOA 4NWUH 1BQSA 4F7TB 2CO3A 5LXVA 1BGXH 2VDNH 5C0DB 5KS9B 5IKCA 2Y06H 2AXFA 2GSIB 3MGTB 2AERT 3DPBA 4R0LB 5F7BA 2GUOA 3VDCA 4FJZA 3ME0A 4OY9A 4PJ8C 4CN4A 1O6SB 2B7DT 4OJFH 4WW2F 5DJAA 3GPSA 3PP4L 1RURH 5KSBE 4DKEH 1SYVB 3QEGH 1CLCA 1F2QA 2Q2EB 2Q7YA 4YFEA 1INDH 1YEEH 3OZ9L 2QGBA 3O3EB 5GSRA 1JFQH 1KXVC 2FE0A 3U7WL 4PRBA 2UX6A 3RNKB 1KJ2B 5E95B 3RDJA 1XVSA 4PJIA 1SJEB 3S6CA 4NI6A 3FB6A 1H5BB 4L48A 3T6ZA 1J5OH 5HHNB 3KE0A 4GMTL 4FYQA 4AWJC 2WN2A 2KS0A 4PJGF 3BXNB 4DP5X 1IGYA 1KPUB 2NYKA 3EZ8A 2Z93A 1KIPA 3ESUF 4V1DB 1XT5A 5FA4B 4GXUN 5C0BB 3NSJA 1AXSA 1PLCA 4WK0B 1LM8V 1XF3B 3S36H 3H3KA 4RCAA 1TPXC 2AKRA 2DQTL 4UDTA 4FHJA 4N1HB 1QKZH 4G1MB 3L3OC 3R4RA 3O3BA 5CEXB 3SE4C 3ARDC 3FCBA 4UBDD 3VI3F 4U6TA 2YOAA 3O0LA 4RETB 1LDSA 3UC0L 5I1HL 1E28B 2Q3XA 3RY5A 5IMKA 1RUAL 4H7VA 3H54A 4LO9A 1J0IA 2UV3A 4OJCA 5D7LD 1BVNT 2OMVB 4R4FL 3SPVB 3TYFA 1YC7A 2B16A 4HMCA 4BGDA 4JRWA 3LYRA 3IJSA 4I48A 3O6FB 4LLQB 2DEWX 3E8UL 3IGKA 3WS3B 1MCHA 4RWHA 3WMPA 1NC2B 3PL6B 4MQ7B 1F2XK 2FHFA 2IQAB 2ZXDA 4WKZB 2DQCL 3ILDA 4ZPTA 2BZCA 3HKZA 4IRZA 1AZVA 2XQBH 4QPEA 1F41A 4AG4L 3ARTA 5E00B 1EJOL 3QDME 4EQ3A 3PFUA 3O3DA 2VZTA 1Z5HA 5D1XE 2D3NA 2XICA 5HSFA 1FE8L 1FHNA 3AU1A 3NCXA 4U1HA 4UM9D 5EU6A 3WEXA 3BIBX 4G8IB 3GSOB 1R5WA 4N4YB 3STBA 5KTEH 3QDJA 4FS0A 5D8JH 4M5ZL 2A6DB 4YDVB 5GRZA 3VB8A 2QPSA 4O9HL 4DHLA 1HSBB 1A22B 3BQUD 2IBZY 2XA3A 1NGXA 4X8JA 1DQLH 3MYJA 5DD6A 3HRZB 3DOSB 1SDYA 4NQDD 1NAKH 3A6OA 1TYRA 1I3RB 1WZ1L 4NOBA 2NUPB 5FR3A 5IF0A 1I3GL 3ZUNC 3NJIA 3UXFA 2C26A 2Z8SA 1WV7T 2VR5A 2FJHA 1AD9A 1PIGA 1U0QA 1IGCH 2YOCA 2EDKA 3D87B 3OKOB 2B3IA 4TQ8A 4XP5H 3WD5H 4EI0A 4G6ML 4JQIA 1JZ5A 1G9MC 2JTDA 1JGIA 5FKAA 2MIZA 1LO0L 4XZUB 4K15A 3T2OA 4C8XA 2AK4E 1KEMH 4EI6B 4TUKL 2VDPB 4JY5L 4Y16B 4OZ4A 4DH2A 2V9QA 3L4TA 3IFLH 5C0EA 4DAGH 3GLAA 3N1MC 2I60L 1T6WA 3IK2A 3O8XD 2HX8A 3QIBD 5JMOC 4X7DC 3BESR 1HKLH 1XQ4A 5L6YH 3TIDA 2YXVA 3ERXA 4MMZB 4BXSV 1TEYA 5HDQL 5J3HD 3QEQA 4ZUTB 1H6UA 3S2CA 4WTWA 3VG9B 3VVVA 4ZUUA 4AIEA 4LDEB 4EIZC 2OXGB 1GGBL 3LZLA 5KBDA 3IMWA 3U9UB 2D7PA 4YK4C 3D18B 2ZKYA 1UWEH 3II2A 4XB7A 1KSRA 3WJJC 5FYKU 1MJ7H 2KKQA 3JWDL 1JHKL 3ZT6A 4IJ3B 2G60L 3FBKA 3HZKB 2F53D 2E8YA 4FQJH 3TESA 5E6IC 4YE0A 1LP9F 4I9WD 5EN2B 4KKBD 4XPTH 5JTWA 3N1FC 4RFEA 1UWXH 1V3MA 2HTLD 3ULVC 3D5OF 1T20B 4FG2A 1A2YB 4PVBA 5AB1A 3KYAA 2C3HA 2BHZA 1CYXA 3UJTH 4BD4A 4AEHH 5CU9A 4F20A 4FI7A 3FRUB 4QXUH 3L3JA 4NUJB 4FNQA 4XBGB 2VXVH 1IEAA 3NTCL 5L2JA 1ZOXA 4AW7A 2K7QA 4MLIA 5CBAA 1A65A 3QJRB 1YO4A 4ZOAA 3RB5A 3JYCA 3FN0L 4UTAL 2X4QA 2Q8BH 4HLJA 4DF9A 1HHHB 4HCIA 3PHAA 2R2HB 3M8OH 1HIMH 4PP1C 1EBPA 2Q7NA 2BSBA 4K94H 3DX2A 2EABA 4KUCF 4PYHA 5L4IA 5DSCA 1QI3A 2VLKA 5AVTB 5IK3B 2K0RA 5CINH 4M6NH 5D2NB 5BUGA 5BZDA 2Q6WB 4LDOB 3FO0H 4FZEH 1JGVH 4FC3E 4AM0B 5IGXL 2GJZB 3AWFA 1ZHKB 4RGOH 3T3MB 2VDLB 5F7LB 4HG4K 4JO1L 3HG1B 1V7NL 2NLJA 4YHNB 4XPAL 4U6HB 3S3BB 3D85B 4PJ8D 3HC4L 5AZEL 1HQ4A 5DD3H 3IU3B 4YHOH 3K1KC 1A64A 3OG4B 1XF2B 1WFIA 2OMXA 4HAKA 4OGZA 5KWYC 3O4LA 5C09E 1YDPB 1MG3C 1JWUA 1QEWA 1FFNA 1RUML 5BJTB 2G2PA 4TVSa 5IBLC 5C7XL 4NCC1 1ED3A 5D96B 1MCBA 2DYPB 4NN7B 1OPOA 1FL6B 2BSSA 5AOKA 5GQBA 3K8LA 1CS6A 2NNAB 4IBVA 4BFNA 4G8GA 4IIZA 3HZYB 4W9EC 1CG9B 4WI5A 3EH4B 4B9JA 3C5JA 5J1TC 4HXAL 4KAQL 3W1ZA 1MLBB 2DLFH 1YJDH 2EIBA 5KOVC 4HIIB 3ABLB 4CGTA 1QR1B 5C70A 1ZDSA 4JKLA 1I7RA 2ITEA 4L3CA 3Q3GA 5MEPB 5JHDB 4GQRA 3FMGL 4BUHA 3ARDD 4RMSA 12E8H 5KYYB 2VLRE 2A0LD 4F9LC 4OLVL 3UFIA 5FLVA 1Z5LB 2HVKB 4KMLB 3HI1A 3P0VL 4JREC 4B9IA 4LVNC 4X80L 5DRWB 3VJ6B 3VAEA 1YN7A 2BH0A 5IQMA 1OT4A 1KYFA 1RHFA 5DUBA 3EH1A 5E2VL 4GB9A 3ZE1B 4PMFA 2QQNH 5CJBA 3OMAB 4BSVA 3TA3B 2WSPA 2EIKB 4Z7OE 3B2DC 4WHTB 3RX7A 3MRRA 5E5MB 1ADQL 4RQQA 4YHLL 3L1GA 1SFDA 2DKSA 4GG6F 3L6FB 3PG2A 2JQZA 3CN4A 1CFNB 5B39B 2GJ6A 1JIBA 4EVNB 1MRFL 1QBMH 1VESA 3ARQA 1U8JB 2GI0A 3KL0A 1BQHB 1LO4L 3UMNA 2ZSWB 3RVWC 2CHWA 2LTQB 3GLEA 4ONHA 1WH0A 3D07A 3KLAA 3RI5K 4JM4L 2Q10A 1TF4A 5KZCD 1C8QA 1GYWA 1MAJA 3ZVVA 4KVNL 2XXCB 1OF2B 4KI5E 5D7JC 2DMKA 5E2TH 3FFCD 4U2ZA 5L7XL 3MV8D 2BNRA 4I5BB 1HZKA 3MV7D 5ETUA 3GMPA 4OF6A 1YEGH 1HEZA 1RY7B 3C5XA 3CVDA 1KN2H 2F08A 4GI8A 5CN1A 1MHEB 3QFDB 5EPMA 4MNQA 3RILA 3FQNA 3ARGC 2NMSA 4BHUI 5A7BA 1FGNH 4ZMYA 1HILB 3HMWH 3UBXG 5FKPB 2VZUA 1NMAH 3P1VA 2ADFH 5CMAB 1VEOA 1MAMH 1LO2H 3QEHB 3IMUA 1ETZB 1PFCA 4AV4A 5HVHC 1YUHB 2BWDA 1PG7L 3DHUA 5M7QA 2WAHA 2AZUA 4OUUB 1E40A 2YD0A 1IM3A 1GHFH 4UOQA 5EMYA 3VXTB 2CA4A 3V52H 4G83A 3TYGH 3S88H 2QQQA 1L6ZA 2WLIA 3FQ2A 1T1ZB 4C4UA 3P2BA 1EA9C 4NB7A 1VFAB 1EEYB 3QAQA 4HGWB 3QWNA 1P7KA 3EF7A 1SQMA 1S5IL 2JFCA 5K9OB 2OI9C 3EYUH 1MHPL 1R5IA 5DRZA 5I15L 3NOIA 3QIWA 5IM7B 4H1LA 1YMHA 3IRPX 4DKFH 2Y36L 3LVEA 2C1PB 4WFEE 3DV6A 2ADGA 3BDXA 3ARUA 3AS0A 3KJ6L 3L1OH 4I1RA 3U0TB 3VXUA 4S1SH 4ODWB 3QJVB 3O2WH 5E6ID 4O2CB 2CIIB 4ILDA 2NTFA 4JZOA 2LR4A 3NSDA 4K3JL 3ULVD 5J56B 1QLEL 4U0RC 1YAZA 5ESAA 3ZDYE 2C34A 2Q20A 3CNKA 1NAMA 2PYFA 2YAHA 3CGTA 4M7ZC 1IEBB 2YPVL 3OLIA 5HGAA 1BBDH 5L2KE 3SKMB 3N40F 1B9KA 4S11A 2VL5B 4OU3A 1X7TA 3ARFC 3AUWB 3C09B 3L2LA 5KVGL 5DMKA 1T66D 5AW8B 4QRPA 3T0VA 1OGTA 2JI1A 4OD2B 1P6WA 5IEHA 2YKLL 3R4DA 1UUSA 4O2EA 3E3QE 4E42B 2GVYA 1KOAA 4TL4A 2YSSB 3VD3A 3MX0B 1AKJA 2UXGA 1EEUA 1QHOA 3FO9B 4JKKA 4XN8A 5JA8B 4KH9A 2J1ZA 5IY5B 1MI5B 4XC3L 2BVUA 3UDWC 4Z7AA 3ZTDC 1KIUA 3KPPA 5TE6H 1I8IB 3EYSH 5K9QI 4P46A 5EIIG 5TE7L 4JO5A 5I0ZA 2ETWA 3S4SB 4ZZFA 3MRMA 2FEDC 2FYYA 1OSPL 2C4XA 4QJ3B 1T83A 4J5VA 4NWTH 3V4VH 4BZ2H 2ZCLL 5DRXA 4YAQB 5B1KA 4UU9B 3SZ6A 2FT8A 3WSQH 3F7LA 3C5SB 3IF1A 4BFEA 3FQ4A 3Q8FA 1FLTX 4MB3A 5HHME 4KI5C 3UPRA 2WKOF 1Y07A 4ABWA 2QGCA 5LXGL 2PABA 2E5EA 1P2CA 4KHXL 2NY0C 4G9FD 3TL5A 3HHRB 5IBLD 3K71A 4LEXL 2FBOJ 4DESA 2YWZA 5H2BA 4PJAB 2F0CA 5JO5A 5D1QE 1MFEL 4E41E 1R4XA 5L88L 4U6VH 3AT8A 2Y07H 1JPST 1JVLA 4OIBA 2PTTB 3NIFF 1K4CB 3UPAA 4PWFA 2ESVD 2WKLA 3CTTA 4NSKB 4ODSH 3AY4C 2F61A 3S3SA 5DHVH 1GKEA 4ECNA 5K1NA 4KVCH 4HS6A 4G43A 3DO4A 4IOFD 1TZAA 1G7MA 3MO1A 1AOZA 3S8WA 2I85A 1A6TB 4ZTPL 1EZVY 3O4OC 1T5WA 4CKQA 2QHRL 3B9DA 5EC2A 3U1PA 3CZFA 2WANA 2O5NA 4R90L 1PDKB 5LBVA 2QPDB 1SLXA 4N90D 3EOYG 5BNXD 3RPBA 1IFHL 2FHCA 4MMXA 3V4VB 3ZGHA 1TEFA 2ICWB 5H4YA 4D3CL 1IAOB 2OJZH 1C7TA 1OCOB 1S9VB 1P4LB 2N7BA