2LOEA

Structure of the plasmodium 6-cysteine s48/45 domain
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
127
structure length
127
Chain Sequence
EKVKGCDFTTSESTIFSKGYSINEISNKSSNNQQDIVCTVKAHANDLIGFKCPSNYSVEPHDCFVSAFNLSGKNENLENKLKLTNIIMDHYNNTFYSRLPSLISDNWKFFCVCSKDNEKKLVFTVEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Plasmodium 6-cysteine s48/45 domain.
pubmed doi rcsb
source organism Plasmodium falciparum 3d7
molecule tags Membrane protein
molecule keywords 6-cysteine protein, putative
total genus 19
structure length 127
sequence length 127
ec nomenclature
pdb deposition date 2012-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07422 s48_45 Sexual stage antigen s48/45 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2860 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2loeA00
4YS4A 2YMOA 2LOEA
chains in the Genus database with same CATH superfamily
4G7YH 4H0LC 4ZXBA 1JGUL 4JQVC 2NTFA 3SCMA 1NUFA 5GISH 4R9HA 2XY1A 4LT7A 3PPSA 1J8HB 4ELMA 3IT8D 4GNKB 4X5LA 3BGMA 1BXAA 4DUWA 3B9KD 2J1ZA 4YQXL 3D25A 4C55A 3X3FH 4PJCE 3QUZC 3KPMB 2WYZA 1YEEL 1M2VA 2A6DB 4FNLH 4RISL 4JRYE 3WHE0 1TCRA 5C1MB 3W39A 2JI2A 3KG5A 1TG8A 3QDAA 3ABMB 4R7NA 4U1GB 5L2KA 4MSWB 2P5ED 4BDVB 3MRGB 1NDGA 3E7JA 2ZUTA 1RFDH 2HVKB 4BE5A 3LZOA 1LE9B 5JPMB 2LQRA 1CL7H 4FFWD 4PRDB 3CU7A 2VUOA 1YECH 1OCCB 3KJ4B 4KK9C 4EN3C 4FG2A 3WDIA 3E2HC 4NN7C 3L1EA 2QADD 5DZNA 3U36B 4RDQF 1RU9H 3CC1A 5I8OL 2YO3A 3TZVC 3NCBB 2X89D 4UDTB 3GXTA 1CICC 3V10A 2R1WB 2RIKA 3DVNB 4P2CG 3W9DA 4BFRA 3MV11 5CZXC 2E9IA 4GP4B 4Y2DC 2GSGB 3ZR5A 4Y1AE 4EZLA 1WICA 1T20B 2COQA 2BHUA 4R2GB 3WG7B 4DN4L 5C0FA 3NJXA 3QZWG 4PJ5B 1WK0A 3Q6GL 4YR6B 3GRWH 1NCDL 3LB6D 4QHKJ 2FJGA 5DC2A 5CN2A 1EBAA 1N3NA 5GS2D 3T04D 3TP4A 1AC0A 2YR3A 3HE6D 1UCBH 1DBAL 1BZ7A 4FQ1L 4MQXD 4BCYA 1HYSD 3HBQA 4F15C 1NMBL 1UM4L 4R3SB 4G3YL 3KD4A 1Q9WB 4GO9A 5HY9A 3LKNB 3JV4A 5SWSE 4NNXA 4G1MA 4FXTA 1JZ4A 3B9VA 3T6VA 3CVHH 1GMEA 3TO2B 5FAAA 4U1NB 3EYQC 3AU1B 3NFSH 3FRUB 4LAQL 4GUPB 3FJTA 4J12A 5CWSB 5DJ6A 4GO8A 3KWTA 1WZ1L 3TT3L 3Q2NA 3ZKND 5GSVB 4AYFA 1QR4A 4WTZG 1U92B 4YHKL 3BZ5A 2DQHL 1XIWD 2P28B 2UZXB 3BD3A 1PY4A 1SDDA 3GMLA 5FYJD 3UO1L 5JHBA 1AQHA 2AVFA 1H3WM 3AS1A 1JWUB 4EQ3A 1F18A 1CMOA 2W91A 2BRQA 5CEXA 2WIIB 1KBPA 4PJAA 5CCKH 4ICWA 1TJMA 2GAZA 4PJIA 4ZMOA 3US9A 1UOWA 1E9OB 1IEBA 4AENB 3TS8A 4HSQA 4J4PC 1IQDA 1A6TB 3HRZB 2F54A 4JG1L 4U1IB 5ERWB 1AE6L 4XVJH 2A1WH 2CO3A 1FBIL 2NXYC 3NPSC 1BZ9A 2AVGA 3F04A 2G5UA 5IVXB 3BQUA 4D2NA 1DLFL 3EADA 3VH8G 3WIHA 7CGTA 4XO9A 1D5MB 1EDYA 5E8DH 3VGAC 2WXFA 1T0OA 3GZKA 3QRLA 4L48A 1LO0L 2ATKB 2GW5A 5E95B 4IOIA 3PHQA 4OCSH 2X89A 1IBYA 3ARFC 3DJZA 5HHMD 2AJVL 2R7EA 4XXWA 4ZW8A 4PB9H 1KPVB 1H5BB 2AGJL 3BAWA 3L4UA 1O9WA 4LU5L 3RGBA 2YJQA 4TQEL 2UXVA 5FGCE 2G60H 4TLSA 2VXUL 2X09A 1HK6A 3GSRA 4TVPH 4M9OA 3JWDH 3RL1B 4AT6B 4M8QA 4WDIB 3QFJA 1SN2A 1NIAA 4NHCH 4OCNC 4R5XA 3U9UA 3ET9F 1N6QH 5KZCB 1VEOA 2Q7NA 5JOFA 2A74B 4WFED 4KRPD 1LEKA 3W2DL 4G8GD 35C8L 1UACH 4LDOB 4BUQA 3LNHA 5JIPA 3BZEB 3ILQD 5C8JB 1NKOA 1I1FB 1YJDH 1Z9SA 4NCDA 6CGTA 5IQ7H 4AUJA 3VD9A 4FXKA 2V9QA 1F58H 5GRVK 4S0HA 2VQTA 4PRHE 1OGAA 2I27N 1UZ6E 2UYLB 4NEHB 3ESNA 2BVOA 2KL6A 1WBYB 4P5RA 3VTTA 1B0GB 1Z0NA 1V27A 1VFMA 1WWBX 1UD5A 2BNRB 2VDNH 2WZ6A 5CLXA 5MEND 4PIBA 2XYCA 4JZJB 1PLCA 1CZ8L 4MCMA 1ZDSA 4U33A 4M6AA 3IMTA 2NY2D 3SOBL 3H6AA 1R5IA 1DLHA 1JRHL 1NDMB 2Y7QA 4PRIE 4S0TD 3WFDH 3ESPA 1BQSA 2A77L 3CHPA 1E5UI 4NUMA 5C0JA 3B2DC 1NCWH 1OAYH 3PHSA 2F58L 3QZPA 2EE0A 4ILDA 3GYRA 4HSAC 1ZWIA 5HDWA 1RPQA 3KPRD 1ZVSA 2RAMA 2IADA 4FHJA 2Z7YA 4YDIL 4JK0D 4EEEA 4GT7A 1Z9NA 4P2RA 5JZ7C 5E2JA 3QBTB 2GJJA 5E23A 5FGRA 3RNQB 3UO8B 1CIUA 2YOCA 4PJEE 4BZ1H 1K2DB 3DX8B 3L08A 2G5BA 4NKDA 5FYLL 1J0JA 1JN6A 5I75C 1YQVH 4U1KB 2E76C 2EXWC 3OAWA 1NAMB 3BHBA 2O61B 5I8OH 2RTTA 1PX4A 2C3HA 3FSWA 1AQKH 4M7JL 2BIMA 5A6LA 3NJMA 4HUNB 5I17B 3BPCA 1OL0A 4H88H 2R4RL 5TPWH 3FTSA 3W5MA 4PJGB 5EIIA 3QO1B 5BV7B 2J5LC 3EF7A 5IM7B 4F37K 5DVPA 1SYVB 4QKXB 2I60H 5DUJA 5E4EB 3DLQR 3ZJAA 4R90L 3GQFA 25C8H 1N70A 3FQNB 1ZVSB 3BKML 3F7QA 3GZOA 2GJ6D 3EO1A 5CJQL 2V5YA 1K3ZA 3O3DB 5HHME 4EUPB 3OMZA 5KYYA 5T1DL 3ARRA 4G2AA 4FF9A 4PJ6A 1UOLA 1TIUA 4UU9A 5KS9E 1JFHA 5EBMB 1ONQB 2WKGA 1N68A 4XI5D 1UQSA 2P8LA 4OM1L 3V6BR 4MAYD 3CMOH 1WYJA 1MRDL 2VR4A 1VSCA 4R0LB 3UJJH 1T20A 3AS3A 3QXTA 3UP1A 2X6VA 1KBKA 1CDCA 1A7OL 4MJHA 3U1PA 1CGSH 2C3GA 1MOEA 1QW9A 4NN7B 5M94B 5FUOL 3T8VA 3GUTB 1BD2E 2ZWSA 2X6CA 5SWZE 1WGVA 4IRSD 5GGSA 4JPVL 2HG0A 4JR9L 1MWAL 1GA2A 2D7OA 3SY0B 43CAB 3VI3A 1RZKL 2H41A 2BZDA 2CRIA 4IRZA 4S1DD 2EEXA 5EBWB 1NGZB 1Y18A 2CLRA 4N2FA 1DQJA 1I1AC 4Z7QE 1H19A 2APTA 2PYFB 1KT2B 4OLVH 4AJYV 3VGDA 5JDJA 3KS0H 5BW7C 5HD8C 3WNJA 3DGCR 1SXAA 1PX3A 1VADB 4WU5B 3MRIA 4G42A 2QSQA 5DRXA 1MCJA 3MACH 2VXQL 5IHLB 4P3WA 4GKSB 5TGBB 4HIPA 1D5ZA 2B3RA 3PV7A 4Z0XA 4OZFB 3U7WL 1CDUA 3K5SA 2ZOKB 1N59B 1R3JB 5D8JH 3CN2A 3F7VB 4JO2L 1WPCA 5I6PA 1O5DT 1VFBB 3UP6A 4BK8A 3EIFA 2VW4A 1KB3A 1TSRA 1FPTL 3UDWC 4AQZA 1C8PA 2WVVB 4MLSA 2AZAA 3Q8BA 2R2BB 3V0FA 2NY2B 2IG2H 4PW4A 3SEPA 2DQMA 5GIRB 4F7CB 2YOAA 1MREH 5MEQB 1T5XB 5DHVH 3LEYH 3EZJB 3DX3A 4XP1H 1PEZA 2X1WL 3NFPB 1AAJA 3DMMD 5E51A 5ENWA 2SEBA 2OZ4L 3MRKB 5LNGA 4H26B 3ESUF 4AJWA 1S8DB 2F8IA 1H0DB 3RZWA 4PMFA 3TO4C 3QDMA 2FR4A 1LK3L 1FHGA 2Y7SA 5ECJE 2X28A 5EFIB 5DJ2A 1AXIB 3WEXB 2JCCB 1CYXA 5FF6A 5BUAA 1PS3A 1XGRB 3BRDA 4XMPL 4O2EA 1BIIB 2VSKB 1SYVA 2YXWA 1Q90A 5KZCD 4TTGA 5E2WL 2WBWB 1K4CA 2HWZL 4PRAA 2PTVA 2CK2A 5E03A 2DRUA 2YPVL 4B9GA 2G75B 2F18A 1T1YB 2EC9U 4IOSA 1CICD 3NSCA 5BS0D 5CFHA 1E5CA 3CLWA 1P6AB 1WFTA 5CZXD 2X1PA 1FA4A 2DTMH 4FLOA 1GPOL 4NQCE 4OM1H 4HLZG 3HMWL 1MIMH 3V4UL 2JJWA 4G9DA 4U1MB 4Y5XA 4J6RH 3GGWB 4LLQA 3O41B 2XLLA 4ZI8A 4LCCB 5T3ZD 2H8PA 3OAZK 1S3KH 3OF6D 2WQRA 1RMFH 1A3ZA 3NABL 1P9MC 3D2UB 1NANI 4FZ8H 4NPYA 5DI8A 1FZJA 1MRDH 3T0ED 5F9WB 4KWUA 2Z0UA 1I4FB 4UF7C 4WSJA 1KCKA 3KLLA 2BVUA 5E4OA 5DZJA 3BDYL 5LQBL 2J6EL 4XCFL 3L5WA 4Q7DA 2WGNB 4WI3A 3VRLE 4EF3A 2VERA 5A2JH 4QRBA 3S36H 4TS6A 1OALA 4YDVA 4NNYA 3IJEB 2C9PA 3BZFB 3FN9A 4PWGA 4XVUD 5BRZE 1XSIA 4I0PA 4M4RB 4KFMA 2NUPB 5B22A 3MV7D 3BKMH 1MAMH 3ESVF 3RU8H 5T33L 1QTSA 5ALCH 3J7HA 1NSNL 1KLUA 1NCHA 5FIEA 5C7XL 1XIWC 5DHDA 5I24A 3RTQB 2X44D 5D7HA 2XWJB 3FSOA 4WY7L 1ZHKA 3AY4C 5HJGA 4PJIE 1UWXK 5K59F 5J1SC 4Z18A 3K6NA 5D7LE 4P5TC 4KTDL 3QDJB 3PJSB 4NQED 4D9QD 2Y36L 4KK5C 1EX0A 3NJFA 5FGSA 5DD5L 2K3TA 2R4SH 3TN0B 4WO0A 2R0KL 4MJIB 4WDIA 5AENA 3TV3L 3V5KA 1OKEA 3ZE1F 1JV5B 4X0KB 3IAQA 5KOMC 4ZO9A 4YBQC 2E0PA 2X4UA 1NLDH 2JKSA 4KHTH 5AYQA 3V0DA 4M1GL 3L3JA 4MQTB 3CN1A 3LOWA 4X6CA 3O9WA 3SDXB 3ATFA 4XCNB 2GSIA 4YUEH 3RWEB 3MYZA 2E7LC 2AQSA 2J57A 3NCJH 3BVUA 4NM4H 5DFWH 3RVWC 3PHOA 5C0CB 2ZXAA 4BFKA 5HYJA 4KX7A 5FXCH 1DJWA 3G5VA 4XGZA 3VFVB 5E99L 1BEXA 4RZCA 1EEQA 4PLKC 1OT2A 3N5AA 3WMQA 4AUUA 4PBDA 4Q9RL 1LYQA 3LEVH 4EN2A 1M7IB 5JPMC 1WA2X 4HWNA 3VSQA 3NA9H 3MOAH 2OK0H 2A9MH 2UVFA 1IB5A 1YPZA 5I1JL 4UCFA 4MA8H 4U6XA 1CXLA 2E7BA 3LKOB 2Q5BA 4WUKL 1EXGA 2XG4A 3BESR 4XNBA 4FQQA 3AU0A 4JRYB 5DUPL 4HC1A 2Y6SD 5ID0A 1MFAL 2JELH 4JQXC 1CFNA 4Y9GA 5D1ZA 1T0MA 2Z31A 2NXZD 2R83A 3DI2B 3E1F1 1HXKA 2Z4TA 3KLQA 2KC0A 4JFOA 2R39A 4JFFA 2B3IA 4TVSa 4JN2A 2VL5A 2EEFA 3NSFA 2BK8A 3BFOA 1J8HE 1IC0A 2IGLA 1PY0A 3CFTA 3V2AR 3O11B 5I8EA 1BVLA 5AB0A 1KJMB 3SBRA 1HHKB 4AGMA 1F8TL 1ETB1 4I89A 3HRPA 2JVUA 4LLQB 4A7GF 3UJIH 3F7RA 4I4WA 3V6ZA 4Z78A 1KF9B 1I8LA 3ILPA 5DRNA 4DNLA 4JDTH 3VWJA 5I1GH 1IAMA 1MFVA 4LFHG 2ERJB 3C08L 3IS0X 5F93C 1AY1H 1NBYB 4HEPG 4P46C 3TA3B 5BV7H 5FKPA 2KT6A 4Z7OB 4HUVA 4H8UA 2XPYA 3K72B 3IMWA 3O9WD 4LCUB 4KAQH 4MJID 1PEWA 3KLKA 4NQCD 3DXAB 2YSSA 5JW3L 3KPLB 4NIKB 5E8NB 3WU1A 1LEGB 1CE6B 4HU8A 4JEGB 4XTRD 3HFMH 3LZPA 1FYTD 1XD1A 2HG5A 4TPRL 3S3JA 1J86A 3X1NA 4P2RB 1CGYA 4AGQA 5IMMB 3SJVD 1HESA 4DVBA 5DA4A 2QFPA 4N0CD 5DMIL 1QLFB 4HLZH 4Q2ZB 2WCSA 3VD0A 3E80A 4X4XB 5T5FH 3GMMA 3K2UH 1HDMA 1MJ8L 3C6LA 3V6FB 1JGVH 4J3SA 2GCYA 3KR3L 2R29A 4LFHD 4ZS6D 4PV1C 1CFTB 3BN9D 4ZW5A 1YMHA 2FT7A 3RKDC 3WTXA 1KSRA 2P7TA 5HYIA 4JFEB 1F3JA 3Q0HA 3I9IA 4N2DA 3TT3H 3TTSA 2RBLA 3QPKA 4XNDA 3QO0B 3FYIB 2YPKB 1UA3A 1MF2H 5AW1B 1NUGA 5I9QC 3UTTE 3MR9A 3ZUNC 3EFDH 4OKVA 1HSAB 4L2LA 2E47A 1AKPA 2DEXX 1FN4A 1CGVA 5E8OA 3M8OH 3MCKB 1OVZA 4K5LA 1UEMA 2DQEL 3DYPA 4G7VL 4EIUA 3FU7A 4ZUWB 4JFDB 5JDSB 2ZWZA 4AIOA 3RGVC 3L4VA 2DEWX 4XNAA 2OYKA 4EXPX 1OAQL 2J2ZA 3OPZL 3X11B 3B2VH 3NEOA 3PQYD 1XWVA 5KANI 3IDNB 1FV1A 4HD9A 3SGEI 3V5DB 1TU2A 2FB4L 1O9VA 1DSFL 1NAKH 1SPDA 2XG5B 4L37A 1HX0A 5ITFB 2W0FB 4A7SA 4YZFF 3IDIB 5HGBB 3LB6C 3T0BA 4DPAX 4EN3A 5IJBC 5B1JA 3IJEA 3VU1A 1AANA 1UB5A 3T3PB 2BVQB 4QTIL 3TWCL 3L4XA 1BZ9B 3RTLA 1YEKL 2MEJB 3PLYA 1MJJA 5EU4A 2IBZX 3CJJA 4XWOD 3V52H 5ERWA 2EIDA 1I82A 3OJDB 3REVB 2B1HL 5ISZD 1HWGB 5GRJH 3B9DA 3UYPA 4N2CA 1GRWA 5G4OA 1E4JA 1QASA 4C4UA 4P4KA 3ZVVA 1IVTA 5DQJB 1A6WL 4XC3H 4BH8B 4AITA 3VG9B 3EDKA 4A68A 2NSMA 4MDJA 3II3A 3QULB 2B59B 2IDCA 4X50A 1NJ9A 1HHHA 2KLTA 2E4FA 1WUNT 1JERA 4FNLL 1BPLB 5TFSH 4APQC 1HQRB 1Q0EA 1HSBA 1QFPA 2CRMA 4LCUA 3GLDA 3U4AA 2Z91B 4M7LL 1QLEB 3GMRB 3NJIA 1N6QL 2A9ML 2ZUVA 4PS8A 1IBFA 4L9LA 3EBGA 3PGCB 3MLYH 4L29A 2Z9TA 1CDBA 2QVKA 4X99A 4NZUH 2DDQL 2YRPA 2VR3A 2UVEA 3C5SB 1ACXA 1OSPL 3D51A 3QQ9C 1OGTB 5AAWA 2Z8SA 1T2QL 2UXGA 2ZKWA 1KN2L 1BD2A 1ZS8B 4AEIL 3ARBA 4X98A 5DDHA 3ZSTA 1X44A 2EDDA 1H8OA 1DVUA 3K3QA 4GRWF 3UTZA 4JLRA 4AV4A 5CN3A 2ZOTA 2GTQA 1M7UA 2BP8A 1CK0L 1ITBB 1VGKB 2SEBB 1J0KA 3KE0A 3BSZA 2CBOA 3DXAE 3P9WB 3QJXA 4GMTL 3BXNA 3HE7A 1SF3A 2FBRA 4KH2A 3D8MA 5HP5A 1V55B 4YHOH 4ORGA 3LD8C 4Y7OC 1USZA 5JIMA 2ICEB 4KKCD 1YUHB 1G0YR 4NNPH 1QUPA 4OUUA 2AXWA 4DAGH 2AXGB 2Z8WC 4D9RD 2P5WD 2BVTA 5DHVB 2ZCZA 3ROOA 1JTPA 5EDXA 4XNZB 3TF7C 1MVYA 3I3EA 4KRPC 2WXJA 3ARDA 3HJ0A 5TE4L 3DOIA 2ZSVB 1I3VA 3ILQC 3RPBA 4Y2OB 5HJ3A 1PQZA 2FSDA 1E43A 2AI0L 1BAFH 3EYOB 4MAYA 3O2DA 4MJ5A 4ZZFA 1BSIA 1O5PA 5J56B 2Y5EA 3LKRA 3SCMD 4UTBL 3CVHB 3L3GB 4KGLA 2WJ5A 3LSOB 5D7SH 1A6UH 1U21A 1G1OA 2NR6C 5D9SB 4YK4B 1FFOA 2WXRA 3W39B 3JBG7 4DHLA 1X5HA 1NTDA 3P0VL 3OMNB 1NGXB 2NY7H 5EBLB 3GBMH 3SDAC 2XFXA 4FZ8L 1GIGH 3NK3A 3VI3B 1BF5A 2FX7H 3WFHA 3SO3B 3ARGC 1A9EB 2O1AA 4TKWA 3BMVA 3VWKD 4E41E 4L4VB 1U93B 5C0GB 4Y88A 4RWYL 3MN8A 2Y2YA 1D5XA 2FJHB 2D31A 3ULUF 1SMAA 3BH8A 3M88A 5HHOB 1KG0A 3R7QA 1ACYH 2Y3NA 5JZ7D 1OSPH 1U8QB 2OI9C 3W9EB 1RJZB 3L1FA 1P53A 3CBRA 2BNQD 2WSKA 1CFTA 1B90A 1JK8B 4RFEA 3GXMA 3FUEA 2UZXA 1A0QH 1ETZB 3WJJA 3L2LA 4G8IA 4GG6E 1KLFB 1PIGA 4PRNA 4JDEA 5D1QB 3TURA 3LRKA 4WSKA 3HMXA 4YDKL 5C2BL 3L4CA 2WW8A 1E7VA 3ME0A 1H8NA 1TTBA 4KROC 2GAZB 1P4IH 4PJIB 5HI4D 1J1PL 1KTKE 4YMPA 5L8JB 4CVWA 3VXRE 3PGDA 4JFQA 1JYNA 3DXAD 4A2DA 3IFLL 1SM3L 4PRBA 5IVZB 4OCRH 5CBAB 4UZGA 4JFYA 3GBEA 5F71A 3GI8L 1AR2A 2VLKE 2EABA 2DL2A 5C0AD 3DIFA 4ZMYA 3WD5H 1EUTA 1JP5A 4PJBA 1D9KC 2NCMA 4NOBA 4TXVB 2VMFA 1WWWX 2EEAA 2K4WA 2ZSWA 4PCTA 1RZQA 3MNWB 4PG9B 4OGYH 2NLJA 1P4UA 2FX7L 4WENB 4YR6A 4K3DH 4TRPH 1IEHA 1ECYA 3N44F 4TULH 2C7FA 1MF2L 1J5CA 1EHNA 1FRGL 5E2VH 4KNUA 2CBMA 4AK1A 4WW2F 2XFGB 3QXVA 3RDTB 3QNXB 4LSPH 3ILEA 3FTUA 4ZFZB 2ARJA 5HY9B 5L2JB 5DR5L 1EFXD 1OB1B 1Q38A 2DI8A 1T0MB 4AYBA 1CBVL 1B4RA 4OFIA 3GB7B 4G6MH 5K9JL 3QUMA 2VDRB 3IFPB 1AZNA 3FXIC 4NQXA 4UNTA 4CC1A 4OZIF 4WEEA 1T5XA 4JPSA 3PDOB 3M8OL 1P5VB 4CC4A 3JWOL 3FB6A 2CIKA 2XIIA 5K9JH 1LNUB 1UM6L 2VRAA 3B3IB 3ZSSA 4AI7A 3NIGB 3DVNA 4DPRA 4JJ5B 1BFOB 1V3MA 1J8SA 1E8YA 3VXRB 1WBZB 1HXYA 5SWSB 2WBKA 4YO0A 1J9CT 1IGFH 3MNVA 3QIWD 1DN2A 5FYLE 4D9LH 1KXHA 1NAMH 2NY1C 4KXZI 2F8XC 3TPUB 3OLGA 1QABA 2AJSH 1U8JB 4WNQA 3H85A 3SDXA 1A02N 3G6DH 3HUJB 1G6VK 4IIQA 4OZHB 5L9DL 3PXHA 3UZVA 3ZGIA 4N0YL 2FJHA 1OTSC 1GGUA 1DQDL 2YD7A 4N0UE 4V33A 3T4AA 1LP9F 2O26U 1HHGB 1XB3A 3U2IA 4ICXA 2OMVA 1DQLL 1UXLA 3H2PA 1VZGA 3FYEB 2OQJB 1SM3H 3QNZB 5F3BB 1PZSA 2DTSA 1V10A 2FYYB 1A4JB 2IJ0C 3S97C 3T8MA 3VRIB 4BQCA 2WQWA 4FXKC 1S7UA 5LGKA 2HLAA 1XBDA 1WZMA 2BSRB 1EXUA 1GSKA 1F13A 2WN3A 4PY7B 3RUGB 1DEDA 5CNHA 4B9JA 3QCUH 4ELME 2EDYA 4M7LH 1BQKA 4QXGH 2DYPA 1RJLA 5MENE 1CYWA 3VI3E 2ITDB 4CSSA 3BCFA 4NSKB 1E6OH 2BVEA 1Y7VA 1MCOH 3VD4A 4I48B 3ARUA 3VCLB 2PR9A 2EVHA 4I0PB 3TZVD 3GJEA 1U33A 4NNYB 4JCMA 4Z76B 4K71B 4ODTH 4X4ZA 5D4HA 3AG1B 2VSDA 4HISA 2ITEA 1KTJA 3HAEB 4MA7L 4ONGH 2I9TA 4J3VA 5AYTA 1NCAH 1AD0A 1BQLH 2DMCA 4X4XA 2FEJA 4IW4C 3TFKC 5GSVA 4AYFB 4BRJA 1OLLA 2RALA 2VM4A 4QF1B 3ES6A 2V2XA 3VXSA 4ELMF 1KTDA 5K39A 5F88B 2YPLB 3TYGH 1D9KA 5JR1L 3UAJC 4WK4B 1SNRA 2ENJA 1YNKH 3P69A 3SOBH 1W0VA 1INDH 2WXGA 3EUUA 3RRQA 3Q2WA 4XH2B 4AKOA 3N43B 1Q1JL 4HWEL 2Y25A 3QR2A 3MA9H 5T1MB 1ZJAA 2QTEA 4DKFH 2B5IC 5KS9B 1QZ1A 4FS0A 5DJ8B 1R9FA 1FVEB 1HILB 2G5BB 1IQWH 4NKDB 1OP5H 3CFKB 4GLRH 1H3PH 4LOFA 2MKWA 2HX9A 1ZLEA 5CSBA 5GGSY 5AOZA 3AW5A 4FL4B 1VKXB 3ECQA 2PO6D 3FB8A 2Y23A 2WO3B 2BSBA 1D2OA 4HZ1A 4YVUA 1TVBB 3LKSB 1QO3B 4KXBA 2DYPD 5G4MA 4ALAC 3MCLH 1Z66A 5DVNA 2NX5D 3WIFB 4H88L 5E56A 3G9VA 3T65A 1QLRB 2W9LA 1Z5HA 1NDMA 3DUSB 1H6FA 1XR8B 1IAOB 1UA6H 1B4JL 5I8CA 4XBPB 5E1AA 4XPBL 2D7TH 4XVTL 4ZUVA 4JM2C 3MYJB 3K2KA 3PWPA 3A4AA 1T22B 3O6ML 3VJ6A 1QACA 4LO9A 4HIHB 5IHUH 3UABA 4IKIA 1XEDA 4BKLB 5T3XE 3FBQA 3BH8B 4M48H 1XL6A 3REVA 5DD6A 1HEZB 2IMMA 1ZXKA 5DUML 2NZ9D 2YKLH 1AI1H 1BFSA 1BQHG 2WXNA 1FBIH 3RVWD 1U3ZA 3DYMA 1TSHA 4S1QL 4G7YL 3HAEH 1JD9A 2X4SA 4MA7H 5EUKA 4ZOAA 4C4KO 1FGVH 3DROB 1J1OH 1DCLA 3W0WD 1X5FA 3X3GH 1EGJL 3MXWL 1Z1WA 2XPGA 1R6VA 4URTB 2VDNL 1ID5I 5E6RB 3KNBB 3RAJH 4HAGA 3UAFA 3VXQB 5MP6L 3UMNA 3L3OC 2ZCLL 3NABH 4K94L 5JIHA 2VLJD 1TETL 1XF3A 3BP6B 4Z8FL 1BXUA 2FJSA 1VERA 2ADYA 1CVSC 2DJUA 4GAFB 1MJ7L 4W9DC 1HHIB 3PWPE 2HT2D 5EU6D 1WQVT 4NYLB 4KX8A 3MJWA 3MOQA 1E2ZA 3B1TA 4I85A 4AYDC 5I30L 2ISDA 1I53A 3UBXA 2YMXL 4FQ2H 1FI8C 3LN9A 3IAGC 5AVSB 2QPSA 1G9EA 1FF5A 2WSDA 3VFSA 5J13C 5D5MF 2I7SA 2GTWA 3IE9A 3LAFA 1I7TB 3HE7C 5BZWA 2XBZA 4UIKL 3GKWH 1FLTX 2C9SA 3VXME 3MBEA 2GC4C 5I76A 1KN4H 4Y4FB 4P48A 2VR6A 1CB4A 1ML0A 1AGDB 1GYCA 2CH8A 4RA3A 1I7UA 3IKCB 2ZYIA 1O0VA 4ADGA 4BSWA 4CVZB 2CM5A 3UTTB 2VQ1B 4ELKB 1NOFA 4G43B 3PWPD 2C7UB 5KN5A 1BBJA 1JDDA 3HKZA 4F8PA 1DSFH 1NAKL 2FB4H 1ZEAH 3T65B 2ID5A 3RGVA 3SHSA 3LEVL 4ZAKC 4WEUD 4ABVA 3FQYA 5CZVH 1G1KA 2YS4A 1M53A 1KEMH 3IRPX 4JHAL 1UT2A 3N06B 4G7QB 1H15A 3GXDA 2IEPA 4PGBB 3C5ZA 3EOYG 3ZTJH 1PFOA 4XPHH 5KSBE 3QFGA 5BVPL 3ZE2E 3SO3C 4PSRA 5IW6B 2NYZA 3I84A 5LNDA 2CUIA 4LSUH 1W15A 3P73A 1A4BA 3L7FB 4B7IA 2E5EA 1KOAA 2OL3A 4M3JA 3OM3B 3BPCB 4BZ1A 4V1DE 4X4MA 3QXWA 1H3VA 3B9AA 4E9WA 1AYOA 1CXKA 4BJLA 2ED9A 1BBJB 1RZ7H 4RGNE 5SX4I 1DQVA 1UGNA 4DGIH 4S11A 4Q52A 3AXHA 2J1KA 4XB7A 3DSNB 4MCYA 4Z5RA 3FN0L 5C09D 3LKOA 1JNLL 4L4JA 5T1KD 2ENYA 3I74A 4LARL 1S9YA 3KBPA 4DIXA 2Z4QB 3PAUA 4N2OA 1ZA6B 3HBPA 3RVTC 4ZPTA 1JMXA 3WN5A 4RZCB 2IGFL 3CQPA 4P2RD 4YHLH 5KSVA 3D4CA 3NUKA 2CJ3A 2EILB 2YLKA 4TPRH 5IUSA 2AERT 2IPUG 4L8DB 4DKEH 5KBDA 2L0DA 4JFPA 1UADC 1L7IL 4X7SH 3NIDB 1J9TA 2IOOA 5JW3H 2NNCA 4W9EC 3HN8A 4OZFH 5K9KA 4NQSA 1GC1C 3KPSD 1NDGB 3LH2L 2WOBA 4L8BA 5KYNA 4ZMQA 5MEPA 1TVHB 4OGYL 4NERA 4XX5A 4DGWC 4PJ5E 2VZ3A 3O45A 4L4TE 4OSUH 2WUBL 4QRPB 4W9CC 4ZPVA 1A9EA 1RU9L 5DJ0A 5C08B 4D0CA 1I1AD 5B3SB 1I7ZA 3QFDA 4PIRF 4D94A 3QIWB 5H8DA 1PZDA 1QA9B 3GM0A 4RQQA 2J73A 3FSZA 1A6AA 3HCVB 3WHXA 1NDTA 1VZHA 1OSEA 2OYLA 1KELL 3ZMEA 1RZKC 3EYQD 1FDLH 2BY1A 1M9WA 3ERXA 2VDLL 3NQKA 3C9NB 3SQOH 4KUCD 5AD0B 3CPUA 4BEIA 1IC7H 3P9MA 4WO4A 2X7LA 4RZKA 2YN5A 1H3TA 5KBKA 3HVNA 5TE7H 2Q7YB 3QEUA 2ARWA 2KZBA 1ASQA 4JFUA 1D2PA 3LJ3A 3OHMB 1JGIA 5CO1A 3SDXE 4YX2H 2B08A 5IEKB 4OGZA 3T2OA 3HG0A 2JFCA 5D96C 2E3VA 2V0AA 2NSXA 1Z6JT 1OTSD 4FXGB 2HXAA 2OULB 5AL0A 3V4VB 3RA7H 3GM8A 4AGOA 5GISL 4YBHA 4JVUA 4ODHL 2CIIB 3VJ6B 5D7LB 3FPYA 4WIQA 1DHKA 2NSQA 5CHNB 3S3SA 3QQ9D 1TQUA 1WAEA 3BQUD 3INUL 1UENA 2W65A 5A2LH 4QCIA 5BRPA 2ADJB 1V7NL 3L9RB 3U9PH 1KJ3H 4IKNA 4FQJH 5CAYB 2N56A 4DZBA 5LDSA 4MD4A 2K45A 4RX4D 1UA7A 5AOIA 3VFOA 2YEQA 5J3HC 3IDXH 3HC2A 3NDZE 1U8KB 5CIPB 1N0LA 3CSYA 4XH2A 3N6YA 5FFLA 1KB5L 1GTNA 4MTMA 1KIPA 4LRNH 3OR7A 1SOXA 1S6NA 4BFFA 5DJYB 4BV1A 4KI5F 5F3HB 4NWTL 4ZO7A 2X4OA 1QBMH 3RIFF 1XCXA 4AM0A 3ZDYB 3OJVC 4G8GA 2AJVH 4JDZA 4OZGB 3TBTA 4Q9QH 2WLZA 2WQSA 4JFFB 4RFNB 2E9WA 4F7EB 4N90D 5E9DB 2BDNH 3N50A 4H0HB 3BDBA 4M7KL 4X6FB 3WJJC 3RVUD 4QAMB 3UYOD 5SX5H 4Z3GA 1AGCA 3S5LG 4AOFA 1ZLDA 3HG1E 3UAJD 3ZYJA 3K4AA 1P7BA 3K2IA 2JH2A 4LLYB 3SIKA 2IQ9H 4Q4IA 1BIIA 5C0FB 1KTDB 5K39B 3JQOB 2DIEA 4PN6A 2FHFA 4GRLB 4XCFH 2RGSA 1QEWB 5HDQH 2ITDA 1L7IH 4X7SL 5LCVL 2QADB 1VFBA 3BGAA 4M93C 2VR5A 4QI3A 4X9GA 1MY7A 2NY2C 1TPXC 3NIFE 1IIKA 1A7OH 1X4ZA 4L4VD 4FABH 3DV4A 3HC0A 5F6IC 3VFRA 2UY6A 2CAKA 5FW6A 1HXMB 1MFUA 2YWZA 1EH9A 4KO9A 2ZF8A 4AM0Q 1LO5A 4XX1G 4F2MA 2H6PB 5EO1B 2H1PH 4HU2A 5FV2A 2R9HC 2YK1H 4BA8A 3NJGA 4ZQKB 4UMSA 1SOQA 1JZHA 3VSUA 4IU2B 3PL6C 4OZIE 4XMXA 1LJMA 4PVLA 4ZDHA 1ZVHA 2EXWD 4M4PA 3KPNB 3OKKA 4U3SA 1QYGH 4L0PB 4DP5X 5DO8A 2GFBB 3UZEA 3MGTB 5E2WH 2KLSA 5GS1C 3C6LD 1AP2A 5GGSB 2DQHH 3GBDA 3MV8A 4NS0A 4HIJA 4Y8DC 3SQBB 1UVQA 1N6VA 4A2GA 5IB4A 1G9MC 3T4AB 4OKVB 1WZ1H 1Y6NR 2VR9A 1T3FB 1NUNB 3BO8A 5HYFA 1BX2B 1I3GH 2QZ5A 4NKIH 4PJIF 2F7RA 5ANHA 4CU8A 3HHMA 4LBAA 4PJBF 2Q0ZX 4UNVA 4NAMA 4R0LA 4FERA 2H6PA 5EO1A 4KY2A 4GAJH 5BZXA 4N5ED 4CU6A 1EPFA 1ZLWH 2ESVD 4N0YH 1VCBC 2VMEA 4HKBA 3C6LB 4RIRB 3KCPB 4HKJB 4WFEE 3WE6B 3AQZA 1NIEA 1X5JA 1WBZA 3QAQA 2IANB 5FHBH 2X6MA 4HBQA 1BFOA 3DV6A 4JO1H 1C7TA 5IUCA 1YUHA 3MRHB 2C3VB 1NAML 5C0BE 4YGVB 1UFUA 1S78D 4HC1H 2VISB 1CZ8H 4MCYB 2OSLA 1OSZA 1Q0YH 1KXTA 1U2YA 3P40A 4POUB 3IMBA 4HCGA 4N2EA 3G6JB 2ZCHH 3M1BA 3PWVB 2YBRA 4LKCA 4N2HA 3MFFB 2YMOA 3HE7D 5E9AA 5H94B 4F7EA 3K2UL 5D2LB 5HDRA 1BIHA 5ESAB 5I23A 2FSEB 3RY6C 3P1VA 4ZMXA 4JY6A 3O3UN 5F96H 5AAPA 5IQ7L 1IRAY 3V6ZB 4M6NL 3AACA 4JR9H 2XV6B 4GI8A 1QTYT 5E4AA 3BVTA 3HFML 3HC3L 2J43A 5FKAB 4NI6A 2DI9A 1GGCL 1E42A 4DKEL 1BM7A 2CE6A 3WELA 4TULL 4FQCL 2HA1A 3SDCA 3EJYC 2ZZUT 4LOUD 4AVJA 2HVBA 4JPQA 3BZ4A 2CK0H 2K9UA 1CC3A 1O6TA 2Y4SA 2UY7B 3QWOA 3NGBB 4PVNA 4GINA 3ZQWA 1HE7A 4PV8A 2NW3A 3WN6A 4AEFA 3O8XC 2XC8A 1RJZA 4DP1X 3RKPA 1FAIL 3L2NA 1I75A 4W4OC 2EIJB 3VM5A 3QZBA 3UAJA 1BX2A 3UOAB 1RJCA 3VH8A 1DDHB 3K74B 3PREA 4OZ4A 2K7PA 2QGEA 2MPAL 3GRGA 2ZXGA 1X5YA 3RNKA 4PAZA 3O6KL 5LNEA 1P7QA 1NBVH 5AW7B 5IR1B 2O6CA 2DN7A 1E27B 3H55A 4WFGD 1ZGLA 2WBJB 4XRCB 4TNVF 1SBSH 2JXMA 2FAUA 2VLJB 4PJ8A 4YK4C 1T7XA 2EDXA 1SDYA 3J07A 2V7NB 4XCNA 5E5RB 5TPWL 1DVXA 2V8LA 3BP6A 3DARA 3RVTD 1IM9D 1JPFB 2K4AA 3QG6B 4M3KB 5ESVA 2HH0H 5DVMA 2HJFB 4IBZA 4EI6A 3KPPB 1RXLA 1LO4L 3ZT7A 1DEEB 4FXKB 5CEYA 4HX1B 1G9NH 2CO6A 4OGQC 4WJG3 4ZUTB 2F5BL 2ZX8A 1G7HA 3VFMA 1XH0A 4N26A 2J71A 1BD2D 4QTFA 1PQZB 2DQDL 3S35H 3NFNB 2QSCH 3T0VA 4AXWA 2YGPA 1TZIB 4YVNA 4YDLC 1KB5H 4NM4L 1AGBA 1AO7A 4C47A 4UAHA 1JNNH 3GDBA 2N01B 1N4XL 4G7RB 3QUHA 1T83A 15C8H 1KPVA 3WNNA 3QO0A 4M93B 5EEUA 1QPPA 2WIIA 2WMPA 3T0EC 3AQXA 2Q8AL 3VTMA 4AV5A 3ZL2A 3IMUA 3GMOA 1A14L 4R97B 2QGDA 4WQOA 3OJMB 4KU1A 1EXHA 4DJMA 4RMSA 5FO7B 5IVXA 3U0WH 4JZOA 2C3XA 1NBZA 1JPTL 5D2NB 3FO1B 4E41A 3QRGL 4FN0A 4IQHA 4WO4D 3AREB 3MV8E 2AXFB 1ZTXL 3MO1A 1FZMB 1BVKB 2HVJA 5DJ6B 4DESA 1E40A 3F12A 4JDVB 5EH1A 5L4IA 4OZIB 2FT6A 4HIIB 1C08A 3BWZA 1U42A 5TFSL 1TETH 1HE8A 2AJYH 2Y1ZA 2OYPA 1BREA 3BXNB 3HE7B 5AW5B 3FOLA 5LGYA 4RFOH 2J4WL 1E9QB 1KY7A 4ETQA 3MLPA 1GOGA 3IPBA 3GMLB 2MWCA 1QRKA 2LVEA 1ROCA 5CN1A 2F53E 3RDTC 3SE9H 2RMNA 1PZUB 1RUAL 4PWIA 2R51A 4KKNA 3FULA 3PPEA 3SKMA 2WO2B 3MRDB 3MRBB 3VGHA 1NINA 1YMMB 3SKOB 4I1RA 1SHSA 1XH1A 2AFNA 1QEXA 5LDUA 4PLOB 1MN4A 2YGNA 3QJHB 2HLFC 4UV4H 4MS8C 4UTAH 5F2FA 2OCJA 4IEFA 3QDMD 4P4KB 3BKYL 4HK3J 1ND0B 5D7JA 3F8UB 4WHYH 3OXRB 4M61A 4OLYH 2ITCB 2IMNA 4H1LG 1PAMA 1BXXA 4BCZA 1IGYA 5T8IA 4I1NB 5C0RH 3MX0A 3GHBL 5E5MB 1B2YA 3P2TA 1YMMD 2YUWA 3L54A 3B9EA 4MBOA 1HCFX 2Z92A 1GZHC 2IFFH 1E90A 2BS9A 4DSYA 3MZTA 1I7UB 2H26B 4EAEA 3BT2H 3HKFA 5LGJA 1SXZA 4DGVL 4N2KA 3UO1H 4UV7H 4B41A 1T2JA 3MRFB 4AQAB 4QUOA 1T3FA 4PJGF 4TVPE 4NUPA 1TQCB 3KLAB 3JTSB 1U95B 3X14B 4BKSC 1S7RA 2DKUA 3X11A 2AK4A 1GPOH 3SBWA 3WHXB 5B8CA 1CXEA 1YVLA 1T6VN 1KCRH 1OCOB 3NFNA 5FYKD 1SEBB 3MLVH 3QQ3A 5FHAH 2EACA 4JFSA 4YBLC 1INQA 3MRIB 4HUUA 3OHXB 1XAKA 3LZFL 3OGOE 3QPQC 4HC1L 4DW2H 2WKOF 1QQDB 1NMBH 5DJXA 1TVHA 4QRRA 1JGVL 4ANUA 1JZIA 3WUWA 4H25B 4NO2B 3EUDA 3NZ8B 2W9DL 1F3JB 4OCWH 3VA6A 3O9WC 3TPUA 2AEQL 4DK6A 4GAJL 4QO1B 1EAPA 3CC5A 5CGYC 1A3RL 4AZ8A 1XCQB 3OL2A 1FN4B 1XT5A 5B4MD 4FD0A 3T5WA 1FIGL 2XV3A 3ULVH 4HIHA 2DMKA 2XQYA 4FLSA 1X4YA 4IBYA 4N0CC 5F7FA 3EXJA 4EBQH 4JFPB 3PDOA 5BV7L 1MHPL 1C5CL 1U8IA 3X13A 1JWUA 4KNQA 4Q9CA 3WUZA 3LRHA 3N0AA 4QY8B 4GLRI 4P9MH 1OARH 1NLBH 4KROD 4UAOB 4WWKD 2YUXA 5HI4C 4EDWH 4UILL 1BZ8A 2CMRH 2DMBA 4FADA 3P3RA 2NRDA 5IQMA 1CN4A 3HS9A 4KKLD 3WJMB 3H3PL 3VFNB 1YEJH 3BFQG 1K6QL 3CV5A 1HN1A 3SDXF 4I2XB 4LGSB 2K1MA 4NRZB 3UXFA 1WAAA 2RQ8A 4LGRB 3SQRA 1E4XI 3FCGA 4OZFG 4F80A 1WA0X 2A6JB 2DWDA 2R0WL 2PO6B 3PL6A 4NO3B 1HILA 2FVNA 3VFTA 2VZOA 3RVXC 2GITB 1L9TA 3IAPA 4OCXL 3DO7B 2X9XA 4A66A 4HPYL 3PE9A 5DSCA 1EHLL 3EKCA 3P0VH 2P46B 3D0LB 1W0VB 3FOLB 3MBWA 4JPWH 2EIZA 1X9QA 1BZDA 5ANMB 4QHMA 5BS0A 4KX9A 5DK3A 4UMGA 1MIEH 4NQVA 1IBZA 4OVUA 2XX1A 4OQTH 5CJXA 3ZDWA 4AVHA 1TKWA 1FH5H 1CLOH 1A7QL 1AQDB 1GSMA 4N8VB 3T4YB 3NP4A 2VM3A 3IMSA 5DMGD 5JMOC 2FBJL 5CMAB 2DYSB 3RDJA 3O81A 3QVAA 3WEBA 1EAOA 4U0RB 1EDHA 2DKMA 2EUWA 4L1LA 4KHTL 3CN0A 4N28A 5JOPE 3S8WA 3CSTA 4M1DL 5EZLB 4XWOC 4IMKC 1DJZA 4PWFA 2EVFA 1G7PB 2ADGB 2QHRH 4KNSA 1ADWA 4LOVA 3ZN6A 1G9NL 3EJZC 2MCG1 1GJWA 3FF8A 4HIXH 2ILLA 4G80A 1MVUB 3MREA 3B7TA 3LKPA 4HWBH 2XVKA 3GSQA 3GXNA 4GKNA 3EBIA 1MFAH 1ZT4A 4HJGA 3BJLA 3TV8A 1JV5A 4X0KA 3HI1A 1JFQH 4Z7VB 2WBXA 4EUPG 4OKDA 3OWEA 1AR1C 1ZANL 3QS3A 3DGGA 4P2QD 5C6PB 3K71A 5I1JH 5I26A 2XZCH 2BNUB 4F57L 3WS3A 1I7ZB 4QRUB 4NZJA 5SWZA 1G7HB 3VFMB 1J8HA 4GS7B 3BDXA 4IRSA 5DK0B 3LZNA 3RX5A 3CVDA 4LVHB 4IK7A 2WLLB 2N1KA 3W56A 3UBXG 3AMLA 1WGOA 2ZUQB 5JHMA 4Q58C 3LKRB 2EDRA 3RTQD 5DC4B 4TUJA 1G0DA 4FQHA 3EYOA 4MAYB 4MJ5B 1F90L 1AD9B 1T1XB 3ATBA 1SFHA 3IBOA 3LQZA 4HSCX 3NESA 4ANWA 4O02H 1N5YH 3I6GA 1VB9A 4G9FE 2WXPA 4L4TA 4N2GA 2YUZA 1E4WL 1F02I 1PBYA 1TYEB 2DY2A 3C8DA 3F3HA 3GS0A 4AZUA 2BSDA 3N40P 4ZOBA 5JPNB 3HRZA 1IUZA 2JCWA 4U1IA 5E0QA 2VXUH 2Z4QA 1FSKB 1AIFB 2VXSH 2MIZA 3A6CH 3EOTH 3VG0H 4DP2X 1M6UA 1GH7A 2VH5L 4ZFFA 5KSAB 2YPVH 2J8UA 5JYLA 1G7QA 5D1XA 3EYFA 1SUHA 3IF1A 1G7LA 4XP6L 5IOKA 1HKFA 2HFEA 3RVUC 3TXAA 2XSKA 3LCYA 5I6NA 1WC7A 3FDWA 2XOTA 4YGAB 3C8KA 3VRJA 3CCHB 3CLEL 3P73B 1LK3H 4KO7A 3D39D 4JNXA 5GGUB 1EEYA 3UAAA 5ANMA 5BS0B 1U3HA 3MLXH 4M56A 3ZE1E 4JM2F 3ECBB 4AGNA 3OR7B 1XTLA 2QZQA 3D1MC 2CDEB 3D7PA 4I77H 4IM8A 4PYGA 3LKQA 3ZHDA 5JYMA 4ZXBD 3T0XA 1PLGL 1Q9KB 2X2HA 3HG4A 3JV4B 2YZ8A 1OP3H 1WS8A 2ENPA 3EO9L 3CZFA 3ARBC 1E6JH 3ARGD 1PG7H 1RIVL 5IJVA 1H3UA 3CDZA 3T0WA 2DJSA 3CSGA 3O6MH 3AJ7A 4N68A 3IDGB 3BYYA 3G04A 2YFOA 3S5ZA 2VXQH 3KS0J 3HMWH 1J0IA 1V7ML 3SBPA 5HXMA 5HGGS 1ADQA 1QP1A 4KJPD 4P2QE 4HIIA 3B5HA 4KGJA 1UUNA 3DX7B 3IJ8A 4XO4A 5DWUL 5EFIA 2A73B 1KUMA 3U25A 4I3GA 3ZHFA 1CGTA 2DYPB 4JRXE 4GUCA 3P3SA 5E8EB 2IANA 3K6FA 4AK2A 2PPEA 4QXUL 1JXFA 3TBVA 3S3DB 1SXCA 2AJ3A 1CFVH 5EZOH 3L16A 4XMLL 3C6LC 5C9JB 1TJIH 5H4ZA 1I8IA 2IBZY 5BRQA 3V7MA 3FT2A 1FVDB 2YEVB 3MXWH 1TYJA 4F7CA 3C2AH 3KGSA 4PJXB 1HEJC 4GQZA 1Y1UA 4KV5F 1KGCE 3QFJD 1S9VB 2XKUA 4G9FD 4X9HA 3ZKXB 3RFZB 3EJTA 3VI4A 3KBHE 1KG0B 3MUHL 5D7LD 3LD8B 1LTXA 4LPYA 4PS3A 3D3VD 5HGAB 2HJKB 2ZXEB 4KVCH 4LHQB 3PWUA 5F89A 1PZ2A 2EDHA 2YK1L 1THAA 3BE1H 1S9KC 1EXUB 3KZ8A 3AUVA 3QQXA 3FOMB 4LLAA 4PV9B 4XP5L 3EGXA 3PJSA 3PUUA 4OCYH 4K8RL 1HINH 3QIUB 2FIKA 3MRPB 2EVJA 3VG9C 1DO6A 2B0SL 3LNDA 1NCDH 2FEDC 3O4LD 5F7UA 5MEPB 3WJLA 4UIKH 1TT6A 3W0WB 5E5LA 1OWRM 4YBLB 3VXTA 5F7AA 1Y18B 3MGOB 3U4KA 2DQTL 3D2TA 2NUPA 3P9LA 1FLRL 1P5VA 2EXTA 3VWJC 2AQ1A 3MRNA 1PLBA 2I69A 4WFHD 1G7PA 1RZFL 3MUGB 1K8DA 1UH3A 1UXSA 4EVNA 4PJFE 3LVTA 6FABH 2HH0L 2XQBL 3TESA 3X14A 4LKXA 1NLBL 4EDWL 4X7DC 3LPPA 1FIEA 1MFDL 5ABAA 4JN1H 4KUZL 5E6IC 1KB9J 4E2OA 1OE1A 1DDHA 3ABZA 3Q7JA 3E8UH 5ISZE 5FYLH 5HHQB 2YC1A 2JKXA 2QDWA 3GIVA 5IFJA 1L9OA 3MFGB 4GY4A 4KPHH 3CIAA 4MVBD 4IK6A 3V95A 1QUNA 4ZAKD 1L5GB 1KCLA 2H26A 1JDAA 1FSKC 1NM9A 5HGHA 3B34A 2ZKXA 3KLHD 1W72A 3QDJD 5CGYD 3FO0H 2E59A 1AKJB 3CZUB 3HZYA 3O2DH 3QJTB 3HI5H 1QSZA 4I9WE 4LLWB 1A66A 3IVKA 3T4AC 2AJZA 2AEPL 2G4GA 1E5ZA 3X3FL 5K59E 3OKOB 2PCPB 4G6AC 3H9HB 4LCCC 3JV5A 3TVMC 3MODH 1MAKA 4G8GB 5KYWA 4TNGA 5EEWA 5GS1B 4PREA 5CM1A 4PVMA 2L7UA 4MA1B 2EVIA 2VDRL 4FX5A 2OMYB 4HJSA 4ATWA 5IEHB 3S5LA 2NY7L 5KVFH 3F84A 2FCBA 1A6VH 3ES6B 2E7LA 5JLZA 4L23A 4FG6C 4ZJ9A 3S37H 1N0LB 1WISA 4QEGA 5C0BA 5FUCC 1LP9B 3MRRA 5I8KH 5J6HA 4LIQL 3LZLA 4UTBH 3AUWB 2IH3B 3KR3H 1TUPA 1IM9B 3A4FA 4GUOA 4LLWA 2ED6A 2AJUL 4LSQH 2X88A 3V0IA 4UZSA 1DUYA 3L48A 2A0LC 2ODIA 1MSPA 1OSYA 3VO0A 1A3LL 4D3CH 5TQ2H 4AUYA 3WOVA 4YHMH 4FP8L 2XKNB 4HIXL 5KYUA 4WI7A 2IDQA 2CZNA 2AXFA 1TFHA 3FHAA 2FQDA 3CX5K 5DR5H 3MBXH 3QUYA 1NBZB 2VJXA 2IIJA 4ACPA 3DBSA 2KYIA 3R1GL 1BYPA 1CS6A 5J89A 4ENED 4LVEA 1Q9LB 4GAGH 1JV2A 4EI5C 4OFYA 5EOCH 3B83A 2BX5A 4HZLB 1RPUA 1MFBL 5DYOA 5IEKA 1AD9A 1T1XA 2H9GB 4ZSOA 1NGXA 3GF8A 4L8CB 4OSUL 2ZAIA 2WV3A 5BOJA 4YIQA 4Y4HD 4RFNC 2XWDA 3MXVL 3E3QC 1W0WA 1DUZA 1UWXH 1DZBA 4HJJL 2B7DT 3TLRA 4LVNB 3KPSB 3W0WA 5A2BA 3FAXA 1JGEB 3C87A 3D3VE 5JXAH 5EF3A 3FTVA 1UJ3B 2AAAA 2QKIC 1XMWA 5C0GA 3QXUA 1AYRA 4JCLA 4WI5A 1KCWA 3E1ZA 4WU7B 4ACTA 1AHKA 1RURH 5I1IL 3HB3D 3ZY7A 4KFZC 2AJYL 3F2LA 2OTWB 2DF3A 2W95A 1U6AL 1J0YA 1D5MA 3IJ9A 4GFXA 4KDTC 4U1LA 5DZPA 1P2CB 4RAUA 3ZZ1A 3P30L 1FFNB 1O6VA 3MMEA 3I6SA 1S5IH 4UQBA 5TTRA 4HS8L 1MZYA 2PO6C 5AWNL 1UYWL 5DURD 5GGTA 5D5MA 3NCXA 5IFAH 3AWFA 1SN0A 2M26A 4HCFA 3VQLA 4P2OD 4PUBH 2GI7A 5E6IA 3BWUC 4U7MA 4G80B 2FL5A 2GUYA 2R23B 4PHXA 1XD0A 3CZEA 3MOAL 2OK0L 1I8IB 4KXCA 3K4DA 2B14A 3ZL1A 1ES0A 5CSGA 3G6AA 1PF3A 4N2IA 4PGJA 1UKTA 4BSVB 3OLDA 4GO6B 4I0PC 4WVRA 3G6JE 1ET7A 4ZPTB 5L2JA 1F56A 4G82A 1XGPA 1A6TA 4EBQL 3BKJH 4HJEA 1C5BH 4Q4EA 2C9QA 4JHUA 4TQHA 1DQDH 2Z35A 2FD6H 4PGDA 1E8XA 4JQIL 4BA0A 3U6RB 5BVJB 2XWBA 3H9SB 2BOBA 3BIBX 4UTCA 4NB7A 3NCYP 4Y2LA 5CKGA 5AAWC 3SPIA 1NEZB 5C2UB 4LLMA 4UM9A 1RK0B 5FK9B 5D6CB 4XPBH 3SPVB 1BVNP 1UH2A 4JRLA 4TQPA 2RFXB 4PJ9C 2LLLA 3IEAA 2AEQH 3DTXB 1M9SA 4DN4H 5JIIA 2H1LM 3AAZA 4ODSH 4P5TB 4KKAC 3L6FB 5DJAB 4I1PA 2V7HB 2ZUQC 1BZ7B 3I3BA 4Y4KC 1G4MA 1N3NB 3WL9A 1I8AA 2HRGA 2MSPA 1OGTA 2EDBA 1RV6X 1LGVA 3MQIA 2AMGA 5D1QD 1HS6A 2CDGB 2Q6WA 1E28B 1N8ZA 5AG8A 3GNMH 5GGRA 4XMTA 4H8PA 2VDLH 1XGPB 1BZOA 3MLRL 1FG9C 1FGNH 1CFSB 2WKOA 4M3HA 4OH2A 3CAFA 4LSDA 1ZS2A 1EAJA 1MHHB 1ETZA 3QC6X 3LEXB 4LCIL 4ODVL 4RIRA 4Y9CA 4ZAKB 1TQWA 3QULA 2IDSA 2F53A 4ZOEA 5HHOD 1A4KA 1S9XA 5HGHB 1YNKL 5AVZB 1CLOL 5BRZD 3ULUH 3GS4A 4MNQB 2WB7A 4B9CA 2CCLA 1EFXA 2YPLD 3FONA 3D0VA 3S98A 4RSYA 1QLEL 2IDFA 2X1OA 4MD5A 4NZ8A 3SGEH 4I18C 4X5WB 3GXFA 2V6HA 2X3AA 4OFQA 4XNUH 4HH9A 3ULUL 5CGMA 1ZHBA 1CT8B 2YQ2A 4J3OG 4Y1AD 4HUCA 4GKLA 3AS2A 1J9RA 5EN2B 3RWFA 1BAGA 3A6OA 4I5BA 4KJPC 4WLCA 4QXVA 3MRNB 3P0YH 1HJBC 3N41F 2OQJA 3F00A 2J20A 2AI0H 4UNUA 2VN6A 2Q7YA 3HVDA 1QFWI 3Q9PA 5EO9A 1PCSA 4R90H 3V5DA 3V6OC 5I71C 1AGEA 5DURB 2YD1A 1YEWA 1IBHA 4F24A 1XH3A 5IF0B 2VLJA 2VO5A 3T8XA 4WWKA 1NPUA 4I3SL 5KBLA 3PAYA 3WV0A 1A25A 1ZGLB 5D55A 2X4RA 3O3BB 1T1WB 3U9WA 5IT2H 4WTXA 4D0CB 1XF5A 1HXMA 4PPTA 1T21A 2VLLB 1L6XA 3MLRH 2H7WA 1Q94A 1CI3M 2TRHA 4KKZA 4PJEF 1UEYA 4G83A 4ZFGL 3VQ1C 3VI4B 2C5DC 3AQYA 3FH5A 4CADA 3CHQA 3I02A 4DVBB 1NUDA 2GJRA 1KV7A 1OLZA 2DQJH 5TH2B 3GPSA 4LCYA 5E2TH 1SVZA 2G3MA 3HI6H 3GSOB 2ZJSL 3FKUS 3IGAB 2B16A 3HUJF 5AW4B 1JUFB 3FUIA 4QJ5B 2Q8BH 1ONQA 1JAEA 3ZT6A 1R5VB 3LRSB 2P42B 2WP3O 5A7EA 3L9EA 2CA3A 4H8WH 2XXMB 3Q48A 1I4FA 1D5BB 1LP9A 3MRRB 3FS9A 4K23H 4XAKE 5GS0D 4DO6A 2F61A 2EKSB 4JHBA 4MWFA 4QHKI 2O30A 2MCMA 2VC2B 3HG5A 1IL1B 3SB3A 1S7QA 2WAHA 1X9LA 1QFWH 3D07A 5CJBA 2VZVA 4ANVA 2ATPB 4WKZA 1BAFL 1B9ZA 4ZTEA 1T5WB 4XO5A 2ORBL 4OGXH 1KB9K 5I8EB 1YEIH 3ZTDC 3TBYA 1CU4H 3FQXA 2KLRA 4WKXA 1QAWA 5EEYA 5TDOA 1CBVH 2VXSL 4LASH 4ZTPH 5IESL 1CR9H 1F1AA 2DH2A 4APXA 3V4VL 4MD4B 5HHPB 1R46A 1JN6B 2R4SL 4ETYA 5C0EB 1TJGH 4OD3H 3WFBL 5B7MA 1KIQA 1E2VA 3K6IA 3FQWB 3KM1A 1E4WH 2VISA 3BOVA 2E7MA 1XGRA 4C56A 3EO9H 3G5WA 1I1AB 5LKNA 3CVIH 4MWFB 5IFJB 5I1LA 2CIIA 1ZD6A 4MKMA 1ZCRA 3MLSH 2Y5QA 1IT9L 2F74A 1YEDB 1AR1D 5B38G 4HS6A 3EJJX 4XPFL 4CNIA 5HDQL 2BVQA 3WNKA 4K2UL 1DN0B 4WW2A 5I1IH 5I1CH 3L9RA 4E9RA 5KW9L 2NNRA 3PWJA 2J8UB 3TNMB 4FABL 5IV2A 4FMVA 4S1RL 3T2NL 5KUKA 5MEQA 1LD9B 1PY9A 1JVLA 3ULVC 1PJWA 3MZGB 4P4RB 2XN9D 1MI5A 1S7SA 4ZO6A 3SE8H 3ZW3A 1M42A 1HQ4A 2KDGA 3BAKA 4UOJA 1M7XA 4KAQL 4BZ2L 5B3JE 5IB3B 2ZQKA 1QFUH 4R7NB 5C2BH 3IDMB 3HE6B 2EDMA 4KMLB 3ARGB 1N59A 3P4NA 4FQPA 3QJOA 1NCBL 4WI0B 3MLTB 2OMTA 2X70B 3T1FB 2FIKB 3MRPA 3J8F7 5HVHB 1XO8A 4NCC1 2EDNA 4NXKA 4IS6A 1A2YA 3DGGB 2E9BA 4IOFD 1NGQH 3T6WA 7FABH 3QE5A 5F1SA 4CVXA 2HKAA 1RHFA 3PQYB 4PG2C 1TDQA 4QGTA 5ACMA 4PCSA 4LASL 1G6RB 1RUMH 1RVFL 2J8UE 3EF4A 4WCYH 3EFFB 2AV1A 1AGFB 3CBJB 2W59A 4CAGA 3QYMA 1UWEL 4H20H 2ORBH 4AJ0A 1MCPH 4HOMA 2Q76B 5JTWA 5E1GA 1QG3A 2I32A 4RWHA 2X4PB 3UIZA 2EYTB 3ZE0E 5JW4Q 2X38A 4WI0A 2ED7A 3DV4B 5IG7A 3BPNB 2IXQA 3GRWL 4PGCA 3OKEA 4HH9B 3ARWA 5T1LD 5CJOH 1JZ7A 1T22A 2E6PA 5B1JC 5DZAA 2UWEF 4C56B 1MLCA 5JR1H 5FDWB 3MRQA 3NSDA 3LXUX 4B27A 3K4ZA 4GW5B 1WBXA 4YSSA 1QD0A 4JN1L 4KUZH 1OF0A 2VABA 3V0VB 2BIHA 1K5WA 1IM3A 4GH7B 2DQEH 1G6RH 3CFJA 2PPCA 4HIEA 1JZGA 5TDOB 3QDJE 3HW7A 2CJSA 4YSPA 1BG1A 3GSNA 3ZDYF 1XBRA 3DKHA 3EFDL 2YMTA 3GLEA 4BH7B 3CX5J 5C6TL 5I71B 2G9KA 3QUKB 1KCBA 3FCBA 4YSQA 3FQWA 3I50L 3WY2A 2JKLA 3AWGA 3MA7B 3O4OC 4DTGH 4APQA 3SQOL 5DO2C 5I66A 4KTEH 2BFGA 2H2SD 4OBRA 4X5XB 4EQ2A 2W94A 3CUPA 4Q6IA 4YSUA 5DJ2B 4FYQA 3BPLB 4GMTH 3RL2A 2HLFD 4NN5B 5I1DA 1TZAA 2IAMC 5EZJB 2D3JA 5GGTL 3F6LA 4WTWA 4E9QA 4JFOB 2DL9A 5C7XH 4YQXH 1ZVNA 5F6HJ 3MFFA 2X4TA 3UJTL 3KYAA 5AOLA 3RWIB 5BNXD 4KNTA 4NO3A 3APDA 1KLGB 1WBXB 4QCIB 3ZKNC 2C4XA 2DIBA 5GSRA 2GBUA 3FUMA 1DZ0A 5DHXB 5DLMH 1Q1JH 2BOBB 3D3VA 3FTYA 2ZONA 4PGBA 4J3OD 4YN3A 5EF0A 1JXDA 4PGDB 3VDAA 5JORB 4GIOA 3BKCH 5A3IC 4PJDA 5C0CD 2BOCA 3D50A 3CLFH 4Y4KD 5KSBB 1Z5YD 1EQWA 2LU7A 1E4KA 1ZLSL 1R0AH 4Y1TA 5IOPA 3D30A 1GW0A 4Y16A 5IBUG 1F42A 3L4YA 3TJHD 3OLIA 3F7LA 1YHPA 2X4RB 3GMOB 3SKNA 2PP8A 1B4JH 3RWCB 3SDDB 2NXYD 3EOBA 2WMPB 5LXVA 4WI4A 3B37A 1KGCD 1GOFA 3QFJE 1OK0A 3TTYA 1L6PA 1IJ9A 3BO8B 4UQ3A 1G6RA 1NWOA 1P0SE 4PR5A 1BOYA 4N1HB 9CGTA 1Q94B 1UD2A 3QGVA 1UD6A 3LIZL 4P2QA 2OJ1A 3QA3B 3EJPA 4LL1A 3HOGA 4U1LB 1OAKL 3GEFA 6TAAA 1NICA 2PKDA 2OJEB 1AQMA 4K07A 4LXFA 4U0QB 1IGIL 2J7LA 3GSXB 1NEUA 3DPBA 1XH3B 2NW2A 2WQUA 5LN4A 4B6ZA 2XTJD 3OGCB 43C9A 2CUHA 4LRIA 1HL8A 3IDMA 1EVUA 4HJGB 3ZMRA 4KVNH 3BGFB 3HUJA 2YPKA 2GJ6B 1GGTA 3PABA 3QDGD 1DBML 4IIQB 5K9KB 2QKIA 3MYJA 4MX7A 2CNZA 9PCYA 4UYPA 3SN6N 1M71B 4WFHE 1WCBA 1A1OA 3SY0A 4ADIA 4AE1A 4D0BB 4GBXC 2V9TA 3QORC 4R0LC 1XF4A 5GZOC 4YDIH 1ZEAL 1CBJA 3II1A 4ZAKA 2HUHA 5ABDE 1P7QB 1JZ3A 1HT6A 4XNZC 5E5MA 3WHE1 4CC0A 2VCOA 1XGYL 3G6JF 4C54A 3IFLH 1JRHH 3H8NA 3NAAL 1EFXB 3FONB 3ZMNA 4KKLC 5AYUL 4Z7QB 1FNSH 3TCLB 3UADA 5IM7A 1EGJA 2MNUA 2B77A 3BVVA 1V8HA 3QEQA 4W6YB 2FX9H 5E4EC 2YD5A 4KJWD 1I1YB 2DJ4A 2FZ3B 3IXTB 5IFAL 2HRHA 1NFDF 3MRJB 3TF4A 3SJVE 4MDIB 4Z9KB 5E8PB 4EUPA 1RK1B 2A0LD 2LW3A 1BHGA 4WV1B 1NIDA 4GUPA 4NO5A 2KMWA 3N1MC 5IBLD 1IC7L 3F7YB 1SN5A 1N6UA 1U6AH 1Y1DA 3OKLA 3NBNA 1A1MA 2ZUWA 5MENB 1D6EB 1OHQA 1ED3B 1CLYL 1P69B 3MROB 3F12B 3QPXH 4JDVA 4PJGA 1F45A 2OL3L 2ZSWB 3O11A 3D9AL 5AW6B 2PN5A 3QCTL 2KZ1B 3V7AE 4A67A 2Q3ZA 2DMHA 4FFYA 3TH3T 4OLYL 1K72A 1S8DA 4OF6A 5I15H 4BFNA 3JT2A 1NAMA 3BHBB 1GYAA 1JPSH 1R19A 3CHOA 4QYAA 1IKOP 3SE4A 2OTUA 2FJGB 1AI1L 4CJ0A 1AG0A 1KXTB 4BSWB 3WSQH 1CLZL 3SJVA 4CILA 4N0UB 4YXHL 4F8OA 1IIIA 2LTQB 2QPDB 5CHNA 4PP1C 1AIFA 4PSPA 1NMAL 1U2HA 5F7NC 1KBWA 4HGMA 4XVSL 3UH8A 2CPUA 3Q06A 3CG8A 4UM8A 2YD6A 3WNOA 4FP8H 5INDA 3HAEA 3S35X 4N8VG 5IHBA 3MV9E 1PKQA 1FUNA 4HETA 3SDAB 3SDYL 2JI3A 5J1TC 3BUYA 5CP7A 1XGUA 4IRZL 4B95C 3E9UA 1DQMH 1TTRA 3WIIH 4Y0GA 2RH0A 4N4YB 4O2CB 2BNRA 1WSST 3QIUD 4HS3A 3GSRB 4BFBD 3SODB 2VITB 4HJ0D 4QRAA 4HWBL 1ZA3B 4R2GD 5A2AA 1F1GA 1I9RH 2XCMC 1W0WB 1A14H 3GC3A 3QRGH 1UVQB 1FO0L 1X3DA 4LVOB 3RDTD 3UEQA 1D5IL 3FQUB 5F7HA 3U0WL 5F0PB 3NFSL 3DRQA 3I75A 3MGAA 1OP9A 1YSOA 2BNUA 5K1NA 1A6ZA 2MTPA 4R96A 1DBKH 5IBTH 4MNGE 3I85A 4JE4B 4WHDA 1SJEA 3O4OB 5LN8A 4ELMB 2QELA 4C58B 3RTQA 3BVNB 2W38A 4K7FB 2CK0L 4HH8A 4NXSA 1KLUB 1KN2H 4PRPE 4TV3A 3QI9C 1LEIB 3CZSA 3TC9A 2WWKO 2XWRA 3Q5OA 4JO2H 4N0FB 5JHLH 4YFLI 2P7TB 1BVNT 3VXUA 1A64A 5D1XD 5HJDA 5I8CB 2K6WA 1LO4H 2XX0A 1XAUA 1WD8A 1MDTA 3D05A 5C0IB 3UERA 5LGHL 3ROOB 5C07A 4ANKA 2BHFA 4LF3B 2GK0B 2FUTA 4BXSV 4PJ7A 1Z3GL 3HZKA 4KY1L 5F72S 3BUPA 4UOW1 3P30H 1KXQE 4HYTB 4DZ8B 5E1IA 2XA8L 5JQ6H 1J05B 3GJFK 5CFAA 5BW7A 1OE3A 1RZFH 3TO4D 4HF5L 4O9HH 2XU9A 4DUVA 4K0OA 5IK3B 1QI4A 1YPZF 2L3BA 3TPKA 5I30H 3QCUL 3UTSE 2HJLA 3KHOA 3MHZA 4FYSA 3HPLA 5FYJU 2NXZB 3BW9B 3L8QA 4FMKA 4EMZA 3DUUB 4F20A 1HTYA 2P4AB 3FW6A 1CLZH 5K9OA 2AGJH 2BP0A 3F58H 1ZK9A 4HWZB 4ZXBC 2XZZA 3M7OA 2HTKD 3H3BC 5JOEA 1P1ZB 3APCA 3ZTJG 1IKNC 3FO9B 1S3KL 1ZLSH 1LO0H 3TYFA 3C5ZB 1P7QD 1T4KB 3IU4L 5CJOL 4L3FA 5J9PB 2VXVH 4XNQB 2OSXA 3R1GH 1ZWIB 2GK0A 4E41B 3LIZA 3PGFL 3O6FD 1DJGA 4JY4A 3OX8B 4JZOB 4IBVA 1KEGL 3VU2A 2D2CC 1LM8V 4GPVA 1OTUC 4QY8A 3ARQA 5F9JB 2W92A 4RFEB 3C5JA 1EJ8A 1U41A 4Y5YA 1GXEA 4JZJA 4J3UA 4R83A 4JFHE 3L95B 5D2LF 3IXAA 4QOKD 3I6KB 1LE9A 1A3QA 2JKTM 3HG1A 3DHPA 5T1JA 2NY0B 2CO7B 3ROLB 4OJAA 1T03H 5D7IA 4JKNA 5D1QA 1OD7A 1X5IA 2R0KH 5IIEA 2IFFL 2Y36H 3B56A 4QHNA 4ZZKA 3BZEA 4YDNA 5I5JA 5ITBL 2UV3A 3DURA 1KWGA 1HNYA 1M05B 1MJ8H 4DGUA 1M71A 4KV5E 1JYVA 1TQVA 4WY7H 2WNGA 3QUZB 2H1PL 3F01A 3IDJB 3K0WA 4GG6B 3BAYA 3TWCH 4K73A 5A7BA 5FWQA 1QRNE 2E6QA 2HJKA 3L4ZA 3FCUB 3P77B 4GSQA 3NIFF 1H3PL 3OF6A 4KK5D 4DCQB 5BOPA 5E6UB 4UTAL 3CVHA 5J1AA 5I6LA 2AC0A 4AMKL 4MASA 3RVXD 1MW0A 2XPGB 3T2NH 4S1RH 3MA9L 4L8CA 1M2VB 2A6DA 2FEDD 1ASPA 5I73C 3FO0L 4CSTA 4IS6B 4C83B 5GGVY 2GFBA 5C9JA 4XPGL 3APFA 4TNFA 3PRZA 2X53A 1HCZA 1E27A 4FZEH 5FW7A 4BFGA 5IIEB 5J11C 1IT9H 4G71B 3EFOA 4M1CC 5J6GA 2BIIA 1GHFH 2CHNA 4UOW0 1OAQH 3T3ME 3HFFA 3MR9B 5FOBA 5F44A 1XSKA 3TA4D 2AXHA 3Q44A 4FNTA 3F62A 1S7TB 2JKNA 4HT1H 1CDGA 3BFWA 1XZ0B 4ALAH 1BEYL 1Z3GH 3QH3A 4KKQA 1XXFC 1SXSA 2FLMA 2QQKL 2WB1A 5AVWB 3QUMB 4Y19B 3SDDC 4LLYA 6PAZA 3A6CL 4JKPH 3F64A 1AACA 3NRPA 1QBLH 3FTGB 3LEXA 3N0PB 5GS0L 4Y4FC 1CG9A 4HCRL 3PIQB 2AHIA 1EHAA 5J6HB 1BLNB 2VR7A 3HR5A 4JY5H 1TPXB 4ES8A 3GI9H 5DUPH 4IDJL 1MJ7H 1VEPA 3D2UA 3POCA 4S2SB 2V8MA 2D0FA 2OSYA 4XHJD 3BAJA 1C12A 4N0UA 4YAQB 1UFGA 4G6AD 1DDTA 4BFIB 5F9AC 4PJFF 2NY3B 4JJHA 5KVEL 3TO2A 5FECB 2DWXA 4K3JL 5INCB 2GBTA 3B2UD 3L7EB 4MB4A 4HIQA 4G1MB 4HBCL 2I25N 4UQAA 5T1MA 2AK4E 3SZKC 4LCWE 3SDCC 4KVCL 3NMEA 2AV7B 3FQXB 1JVOA 4JKMA 1KJVB 2IQ9L 2BRRL 4K3GA 3B2PA 1G7QB 3BZDA 3PNRB 5D1XB 4X9IA 4LRIC 2EIEA 2V2WB 4DFIA 2VYRE 5DJZB 3PFUA 4QYOB 1CTOA 4JFDD 3VXSB 4JHWL 4XWGL 1SHWA 1S7WA 5FF6B 1ZPUA 1I8LC 4BHUA 1L3WA 3B8SA 1NA8A 5DJDA 5JIKA 3C08H 2G2NA 1MFBH 3HR5B 4G72B 5I1KL 3U1QA 1KYDA 3VQMA 2IGTA 3VYNA 2DQGL 5F97E 1QWUA 2Z31B 4BZ2A 3VDBA 1J5IA 1O9ZA 2DLGA 3W11D 3ZKMC 4V2BA 2IQAA 4Z7UF 5ID0B 5FPIA 2BZCA 3K8KA 3IF1B 3WFZA 2TRYA 4WZ9A 5LWYH 4PJ8C 4U49A 4MQ7A 1PZ5A 5DZ9A 4JCWA 4ZTPL 5KVDE 2R0ZH 2DWEB 2FWOB 2MH4A 3BGFC 5GRXG 2XN9E 4CADB 3AXIA 4P0DA 1CE1H 1FAIH 4XN5A 4FTVE 1SY6A 1YEIL 1JJUA 3HHSA 3VFSB 4A7VA 1YAZA 4BYHA 4P2OB 1IQWL 2XA3A 1LK2A 3BVNA 3LTVA 4K7FA 4QTHA 1NCWL 1HOCB 5ECGA 2ADFL 3SE3C 5BZDA 4FFWC 3MGTA 2DZEA 4NZUL 1IGJA 2BSTA 2P5WB 1OEZW 5HDBE 2X12A 8FABB 3DX1A 5D71H 2GJ6A 4F58H 1XF3B 5C0AE 1S5HB 3SCMB 4OLZL 4EDXB 1WFUA 4D8PA 5EU3A 2PF6A 5ESVB 1AZCA 2C4FT 4MAZA 3SPJA 1ORQB 3OR6A 3UJJL 2PXYC 1IKNA 1H8SA 5F96L 1U8JA 5F7BA 2A6IA 4OAWB 2JJTA 4OGAC 2HYMA 3T0AA 3O0RH 4XBEH 4Y2OA 4FEIA 1F4HA 3QK0A 3QDGE 1KYOK 4LCWB 2EINB 3AREC 4M02A 5F3FA 2AK4B 4OCRL 5INDB 5IR1A 1RHHB 4X8XA 3TBVB 3DX0A 4LLVA 3BAXA 1SQMA 1KC5H 4R4FH 1A7PL 5ANME 2B1HH 3JWDL 3HE6C 3ATAA 2J21A 4XXDA 2BOCB 3FFCB 3BEWB 1F41A 3I9GH 1HQ4B 3HNVL 1S7XB 1OTTD 2WXIA 3D0VB 1N5AB 1XFPA 3BVXA 3KPOA 4QTIH 4B3VA 4NFBA 2QR0B 5CEXB 1SLVA 1NCBH 3HAEG 4JG9A 3FQRB 3KYKH 3FQTA 2NNXA 2E7CA 4K71C 5KG9B 5L8LB 4GAYA 2Y0SA 5D1ZC 5ALCL 4LEOB 1TYRA 4MAUH 2IV9A 2BMKA 4KO6A 3DVIA 4JY4B 3GPEA 1QSFD 1T1ZA 2PW1B 1OIOA 1QI3A 3KYMA 1VLXA 4FCAA 2OA9A 1EJ6A 4A2MA 5HYQA 3IS1X 1J9QA 2BS8A 4KMTL 1HOEA 1OGAE 2CSPA 3W3BA 2G9HA 1YYMH 4HJTA 5FM4A 2JWYA 1U8HA 4OD1L 3LRLA 4XCEB 4ISVA 4KRMB 4RESB 5JW5A 3FO2B 3DXAA 4M1GH 1B0RB 2F0CA 2JK5A 4TUKL 3ULSB 5DJAA 2ZOOA 5IREA 3K72A 3NRFA 1Q0XH 3LN5A 4XP9H 5IROD 4LLDB 4NPJA 1IKFL 2B4CL 2D73A 3NJLA 4IGBD 3VX1A 3MRCA 3QIBD 4B97A 4ZFFB 5AOKA 1LO3L 4KBPA 4OU3A 3UL4A 3N55A 3RZCC 1MLCB 4EE2A 1M1XA 4NQTA 2YC1B 4W1TA 2GTWB 1IBDA 1Q1PA 1EEUA 1XR9B 4GKZA 2FR4B 3MJ6A 4WUUD 3DPDA 4AL8C 2Z64C 5EU6B 4HHWA 2IC2A 2LAGB 5D7EA 5B8CC 2WTPA 1MRCL 3BT2L 1JXJA 3IPEA 4NLHA 4XMPH 2PPFA 1GTFA 1OCWL 3OB8A 1A8ZA 5MERB 1BA9A 3E8VA 1NC2B 2NYYC 1OE2A 2SODB 4WHYG 1LLAA 5FDWA 5DWUH 1GZQA 3MLXL 1TEYA 1XCTA 3V0GA 1RK7A 4F7TB 4TQEH 3INOA 2N7BA 1WUZA 5DRZA 2DAVA 5B39G 2HT4D 3S4SB 5DEGA 3FT4A 2Q87A 1OV8A 5DS8A 3G9AB 1DJHA 2V17H 4FA7B 3UBXB 5B7FA 1P2CA 1WJ3A 3M6DA 4JQVA 3SCMC 1YY9C 2BY2A 4WEBL 5GZOD 5C0CA 2ZAGA 1XGTB 1NMAH 1S2EA 4FULA 3QDJA 4XR8C 1KB5B 2WLIA 1VADA 4BFOA 2MQ0A 1MCDA 5LCVH 3FUJA 4S0SD 3WUWB 3ULVE 4QHUA 1OP5K 1L9RA 4J3OH 5KTEH 2R1YA 2X4UB 3KH3A 3ALWA 4FFYH 2Y1AA 3EBAA 3MVSA 3BD4A 4JREB 2H0EA 4H0IA 4XXCC 1XCTB 2JELL 4NQQA 4JFEA 2P5WA 1JG9A 2R0LH 5D70H 4AQ1C 1ID2A 4FKHA 3EDJA 3X17A 4QHNB 3FU6A 1U95A 3UTSB 2PYEE 2X2UA 5FYKU 2UUDK 3OSKA 1NWPA 4CSZA 2PABA 4HXAL 1L6ZA 1JHLL 2E46A 3X3GL 1FIGH 5AKVA 2CLZA 2EDEA 4YHPB 1A6VL 2C4FU 1RURL 2XWTB 4P4RA 2JCCE 5MP6H 5FA3B 5CBEA 1S3RA 2J72A 2V2WA 2DBLH 3BYTA 1EJOH 1FNEA 4K7PL 3O6LH 2F53B 4X6CE 3EW3B 4AVIA 4XN9A 1JPGB 4HJJH 4HCRA 1CCZA 1FPTH 4KTGA 3R19A 2QQNH 3EYSL 4PJCA 4G8EB 1SJXA 5AW2B 5HDOA 3SY6A 3NAAH 4LNVA 1UWGH 2GY7B 1VAHA 1WRFA 4X5QA 1HH9B 3RL2B 4F3FB 4WUUE 3G5XA 2NQCA 2FJFB 3D39E 1UA6L 1T4KA 5GGRY 5EO0A 4HMCA 5L2KE 3VXPA 5AUMA 3VI4E 3C5SA 1O7DE 2R0ZL 4IMLA 4ONGL 5D2NE 3F7YA 5GS2H 1FDLL 4TSCL 2FSEA 4OLUH 5LG1A 2RACA 6PCYA 2YFNA 2ZPKH 2ZYHA 4ESKA 1LO2L 3FU0A 1Z9LA 4FLRA 5E1QA 2BCKB 2K8QA 3T1WA 5JHAA 5IB5B 5B7EA 2OXHA 4PM1A 5JQIB 1FH5L 4JKLA 5ICXA 2FDBP 3W0WE 3ZO9A 4CVUA 4FQQB 4LQFL 2HMIC 1DFBL 3AXLB 3VNYA 2BNQE 1S7QB 1QUNB 3B43A 2QMKA 1CFQA 1VEMA 3MLZH 4S2SA 4XCCH 5I18L 4H1LH 1LVEA 2X9WA 4PJ7B 1YQVL 3LX9A 3SPGA 4DP9X 4XAWH 1MJJB 5EU4B 1F00I 3V4VA 4HWEH 5TDPA 2WQVA 2NX5B 4YDJB 4H8VA 1MRFL 4I0PD 3TZVB 4LPTA 3CDCA 3ZRFC 3U7YH 3EXLA 4Y19A 1W91A 1NC2D 4ZS7H 4KUCF 2IALA 1JUFA 2Q76A 4ZMWA 2VWEC 3LN4B 1J8HD 4LCYB 3O3EA 4P05A 4RGOL 2I5YL 3CU1A 2CDFB 1MFMA 4J2XA 3MV7B 5DF0A 3X2QB 5GRUH 2NY1D 1BP3B 1OQXA 3W11C 3ZKMD 2NUTB 1YEJL 4BQ9A 4YZWA 3A67H 1KULA 4OY9A 2F15A 4JVPA 5D1XC 2LFGA 3QUML 3ZHNA 5KUMA 4DH2A 3WEMA 2QFRA 3ABKB 2BJMH 1T2XA 4JRFA 4ZUWA 1BQRA 1I85A 1BVZA 3QP3A 4MB5A 5HHMB 1ODUA 4Q14A 3HN3A 1MHPH 1R3KB 4ZUTA 1U0QA 4P2QB 4P07A 3HRZC 3M07A 4ENZA 4Q6IC 1HEZA 1JXGA 3CK0L 3TEUA 2H4EA 4G6FD 4QLWA 4TN9A 4HWBA 2F1AA 1H5BA 3EJCA 4K9EC 4NC2B 2CIKB 1G1YA 2FWOA 4ELDA 2G3ZA 2WQXA 1XCWA 4WV1C 3RUGF 4Z7IA 3P0GB 3LS4H 4TVPL 4Y5YB 2WD0A 4AYSA 1R24A 2GK2A 3R06B 3MNVB 2X3BA 3T77B 3JVGC 1DCEA 4I0KA 4Y16B 5EB9A 1NPJA 3P4LA 1HXYB 4MXWH 1AZUA 5MEOB 1MNUH 3AZUA 2WCPA 5L7XH 5EA0L 3PG2A 4LNRA 4HG4J 4MZ3A 4AMKH 1MVFA 2WO4A 2AXGA 1SVBA 4FKKA 3C12A 1TNNA 2AF2A 3FFOA 4G6FB 5LBSH 1HIMH 4XT1C 4LGPB 3PS6A 5DEFB 2AK1L 2KH2B 2WQAA 3SYAA 4GW4B 4H1LB 1I1RA 3ARED 1AHWA 3U79A 1YA5A 2OJZH 2OKMA 1XZWA 5EBMA 3B2VL 3CLEH 2GJZA 3T2PA 1AGCB 2EDOA 2YKKA 1KEML 3O6FC 1J1XL 2P1YA 3EO0A 3FH8A 3U7WH 1IVLA 3C60A 3NJKA 4L9DA 1WFMA 5E5UB 4W93A 2E8YA 3DO7A 1G7IA 3VAEA 2EUVA 5DO2D 3ZBMA 1IMHC 2H2SC 5C0BB 4KQ0A 2Z1PA 3OAYH 4BHUI 2VKWA 4YUEL 4YC2C 1OCWH 2BNRE 3VD3A 4C4BA 5CCGE 5A1AA 3DTDA 2XT1B 2ALAA 1YECL 3ILPB 3FCTA 5DRNB 5JO5A 5CLZA 4M5ZL 2APFA 1A0QL 1YEFL 3QG7L 4ONOA 4YGVA 4XVUC 1QYGL 4MA1C 4P04A 3FH7A 1R3HB 1H8LA 2G60L 1B6DA 2YPVA 3WE1A 4MDIA 5F8RC 3CFJB 4HKZA 4QJ3B 4Z3HA 2R29H 4HQQL 5DYFA 2H2PC 1G7LB 2I5YH 2QADC 4GSDH 3IWUA 5IP4A 4NHUB 4LLMB 4UM9B 3PWNA 4A6YL 3QH3B 2BWDA 2PETA 4N6QA 1E6JL 1MAML 1QNZH 3E6FB 2KZWA 4NN6B 3KPOB 1LEIA 4FQ1H 5HDBF 3AG3B 1CGUA 1N7MH 1TZOA 5I1HL 3BEWA 5DK2A 4KK6D 1IJNA 2D7TL 2PWGA 4N9GB 3L3KB 4IGBC 5ALBL 3F7VA 3SSGA 3T6ZA 4AKQA 3K6SB 4JFZH 4BZ2H 1ZXQA 1A21A 4MB1A 5D7KE 3T77A 1MJUL 5CR1A 1T04B 2ZWNA 3L3DA 3O3BA 3SE9L 5IVXE 2KBGA 2RB8A 3IDYB 3N91A 3P11L 4G59C 3VXOA 4PD4K 5FO8A 3N43F 5HHNA 2UUDH 1W6LA 1OQOA 1I7RB 4JDTL 4OJEH 3EFFA 3RWJB 2UX7A 1ORQA 3OR6B 1A7RL 3JWOC 5DRWA 2ZP0T 2OI9B 5HHOA 5KAQG 4K2UH 5DFTA 1JXKA 1RP9A 3ARPA 4PP2B 5HI3D 1TJGL 4F7PB 4JFFD 1OPOA 5JHDA 3FL7A 1ACZA 3QWRA 4ZQKA 1F5WA 1Z0MA 3HBZA 3QQ3B 2PCYA 2CALA 2F54E 5AVYB 4WFFE 1EK3A 1AKJD 2OBGA 3FOMA 4PV9A 5D7IE 2NOYA 2OMTB 1Q9LA 2X70A 1NFKA 1LQBC 1HFUA 2HT4C 4KDTA 3KXFE 3MJ7B 5E8OB 4NBYB 3O45B 2B0SH 2OZNA 2W0LA 2BIPA 3L3KA 1UWGL 4PJDF 1MFEH 2WVTA 1ZA3A