3UAFA

Crystal structure of a ttr-52 mutant of c. elegans
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
KTSCLMATGVLKCPTDPEAVKKVHIDLWDAAAAAAESDDLMGRTWSDRNGNFQVTGCASDFGPINTPDPYLYIQHNCPHRDSNATNPIQIDVIPLFLPSIVRLGNVYLDRYLEDYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords TTR-52
publication title Structural study of TTR-52 reveals the mechanism by which a bridging molecule mediates apoptotic cell engulfment
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01060 TTR-52 Transthyretin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3330 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uafA00
3UAFA
chains in the Genus database with same CATH superfamily
1MVYA 1RUQH 3ARZA 1GSMA 1SJXA 3PV6A 4I0PB 1F11B 4URTB 3II1A 5KVEH 4OF7A 1RJLB 1CXLA 2BH0A 1DJSA 1A5FL 2VDRH 4XPAH 2ICWI 4IGBB 2L0DA 1KIPA 2X2YA 5ANMB 3SQBA 2EVFA 3CC1A 3K81A 4P9HH 3EF4A 4EI5D 4HV8A 2A2QT 2G3ZA 1VDGA 1Z3GL 3HR5B 4PD4K 4AVIA 2PWFA 4U1IB 1K2DB 1GMIA 2NXYC 3PWNA 4L0YA 3VXNA 2ZUXA 3VU2A 2VLJB 1N64H 3T0BA 4FQJH 2D7OA 2FJFB 4F8PA 1I7RA 5DJAA 3G6DH 2VIRA 3MC0A 2ITEA 4IBLT 1O7VA 4UT7L 3DYPA 4HUWA 5FEBA 1JF6A 4NDMA 1DBJL 5GSRA 2EDJA 1CQYA 3WKML 2BOBA 4X4ME 4XVJH 3I6KA 1S5HB 15C8L 3ROOB 1DO5A 5ESAB 1AR2A 1GIGH 1KJ2A 4JMNA 4PJ9D 5BMFH 5KW9L 2R56L 3PGFL 1RU9L 1YN7A 1QMUA 1S7RA 2X09A 3WFHA 4KQ3L 2HT2D 5DJXA 2AAAA 2F7RA 1U0QA 4PJHE 4RISH 2FZ3A 1OM3L 2XA8L 1BAFH 1GGBL 3N41B 1CGYA 3CSGA 3ZRSA 4FZEH 1K3ZA 5B4MC 4M7JL 3Q8AA 4UTBH 5KBMA 3VWJB 4I0PD 1BQSA 3E80A 1LO4L 4B9ZA 3LCYA 2PTUA 2Y9RT 4XNMB 2Q5BA 4KI5E 5HGAB 1E4XH 4IGBD 1CUOA 1K4DA 1WUNT 3PIQB 4PYGA 4CN6A 3SSGA 4K3EH 5DJ0B 5ANME 5DHYA 1QBLL 2CIIB 4Y5YB 5DT1H 2NX5B 4AQZA 1E9QB 4Q74A 1CLZL 2GTZB 2APWA 3D18A 3P2TA 4XNYL 1NBZA 2WTOA 3P30H 3KL3A 4JO1L 2WYHA 4NM4L 1DP0A 3HZYB 2ZOTA 2CGRH 3C5JA 2GCYB 1IBFA 5GSVB 4ANVA 4G9DB 2R7EB 3DUUA 2VLJD 1MLBA 3K2MC 2J8UF 2VLJE 2EYSA 1OP3H 5J89A 3RVWC 1EFXB 1L9OA 2R15A 2L7QA 4W9CC 2Z64C 1QFWL 4G6AD 2LW3A 4F8LA 3U7WL 3Q6GH 4HEPA 2VERN 4LXFA 3MROB 4UZSA 5ECJE 5CBEA 4WI2A 3A22A 3GHPA 1IEHA 2JH2A 2IANB 3FQ1A 5KYUB 5LBSA 4ODHH 3KPPB 2ED6A 4F58H 4IBVA 3NJIA 1OCZB 3QSKB 3VFTB 4N2DA 1EAQA 3UO8B 3UOAB 3F6LA 1J5CA 4JFUA 4UU9A 3CHXA 5I8CB 1YMHB 4LARH 3GTNA 1JGDA 4WF7A 1YO4A 4EI5C 4XN4A 1P7QB 3DX8A 5HHXL 3OKOB 3FU6A 1N6QH 1DBMH 1BYPA 1JP5A 3V7AE 3VWJD 1FFOA 2QVKA 4DGVL 3ARRA 2J1KA 2VW7A 1MPAH 1JVLA 2F8XC 1CFTA 2WM0A 3L4VA 4JL2A 1GZPA 1RXLA 2CRIA 3NFSH 1MW0A 4G72B 3H9SE 1A6TB 5JHBA 1LE9B 3PNRB 4JG1H 5AVXB 4RESB 4QRQB 3IKCB 1AS7A 5LN8A 3L6FB 3DBXB 2NX5D 3FO2B 2EYRA 5EV7A 2D31A 1L7IL 5L4FA 2RA1A 4DVBB 3Q2LA 4O4YH 3EJRA 2AEOA 4XPFH 5FM4A 4XWOD 4DP4X 2DD8L 4IYKA 3MRGA 5DXWA 2ODIA 1QAWA 4OCRL 1AIFB 3ZHDA 4UQ2B 4KTGA 4PJ9C 4OZIA 2EVIA 1PQZA 3QUHA 4OM0H 3FB5B 4G71B 4KVPA 4JFYA 2WWNA 4BQ9A 4DEUA 1G7LB 2HT2C 5F7NC 1EFXD 1B0GA 2KDYA 3MRCA 3NFPA 2DEXX 2FO4A 5AOZA 3VFWA 4OUUA 4AV0A 2X4PA 3T2QA 1EJFA 3VRJB 1PTZA 4CNIB 4QF1A 4YSOA 4K94C 1RK0A 1WD9A 2X4RA 3RI5K 2MMXA 1R5WA 3P54A 2IAND 3D25B 2Y7SA 1T7ZA 2IANE 3RZCA 4XRCB 3FT1A 3QO1A 1QP1A 4P57A 4I0PC 4UYPA 2X4QB 3RFZB 5F96H 4KJQD 1SFHA 5FK9B 4GRLA 4IGBC 5CSBA 3FU0A 5D93B 3CN3A 2PCPA 3ERXA 1K4CB 5IG7B 2FD6L 4NC1E 3LV3A 5B21A 1P7QD 2NCEA 4KY1L 4MWFB 2GHWB 4XN2A 4L9LB 3BSZL 2NZ1A 2GJZB 2PR4H 2ZSVA 4HS6B 1RZKH 1CT8B 1TTFA 2L04A 3MBXH 5DC9B 4YE4L 1BVKB 1J18A 4R7DA 1CL7L 4OD3L 1DQVA 2WKOF 3GQFA 4YFDB 2WKLA 1VRSA 1N59B 1QLRA 2BSRB 2H6OA 1F3DJ 2B16A 3LHPH 4N1EA 3I02A 2AJYH 4HSQA 4FA7B 1QQDA 2ATKA 4G6AC 4F37F 1N4XL 2I7OA 3BUIA 3LN5B 1D7DA 5F1KC 2JKXA 3JZ7A 3TT1H 3KJ6L 4F7PB 4HJ0D 3LS5H 1YEFH 4OJFL 5E6ZA 1TQUA 2JKJA 2ZICA 3FB7A 3MV01 3CV5A 1P7BA 5I1AA 3FQ2A 1UM6H 2Q2LA 5T5FL 3TP4A 4JO5A 2YAHA 4N4YB 2BOCA 2JI2A 1JV5B 4CW1A 4DN4H 1S7QB 3Q5OA 4HSAC 4YVNA 4NUJA 4MQ7A 3FT2A 3V6FA 2VN6A 4HH8A 1EAJA 4JQVC 1CE1L 2LHAA 2JKLA 1P69B 4D0BB 5E6YA 3Q2WA 3ZHKA 3IU4H 3KR3L 1MHHA 2PTTA 3GSXB 3QRBA 5E4EB 3X12B 3VWJC 3KVQA 4HGWB 2GITB 3WNMA 5J1AA 1HNYA 1BM7A 5EFIA 2BSSA 2AI0L 3SPVA 1WTGT 3U9UA 1PZUB 1D5ZB 2IXQB 2OMUA 4N8UA 1K8DB 3IJ7A 4K7PY 3UPAA 4ZFOL 35C8L 2XICA 3ZMNA 4OCLC 1N18A 1P53A 4P5KB 3ZKMD 3EGSA 5HYJB 1G43A 5IHHA 5IMLB 4Y5YC 5FCUH 3GXMA 4Q7DA 4A66A 4FQXA 4HWBH 3DC0A 5HPOA 4U1HA 3ZSSA 3MRPA 4X6DE 1GGYA 3F7PC 2E0PA 1RK1A 3IN0A 3MGAA 3P77A 2EINB 4XWOC 5DZPA 2AXGB 3ZKND 3C6SA 3UIZA 3ULVF 2R27A 1V3LA 5KSAB 4ELDA 1ETZA 3LSOB 1X6NA 3KLLA 4NQCA 5KS9F 3WUZA 1KPRB 5HGHA 3QZPA 3OR7B 1FHNA 1GYUA 3Q2NA 4WI0A 3UBXG 5EOCJ 1VLXA 2W92A 3HE6A 2WIMA 3EZ8A 3DIFB 2A1WL 1L6PA 1XT5A 2VUOA 5DD0H 2V9RA 5JMOC 1DVYA 2Q6WB 3U1QA 3M07A 1CDGA 3KBEA 3BO8A 4N1CA 1T7WA 3LIZA 2N1KA 4JO4H 3ESPA 3AZUA 1T2QH 4RAUA 1K6QH 4G5ZL 2WWMC 3GMMB 1AXSB 4KJQC 3ZDZE 4R4FL 3DGDA 1JGUL 2BY0A 2Q8BH 3W1ZA 2B3RA 4QCIB 1U2YA 2ALWA 3QXDA 3T9WA 1D9KB 3G04B 3P9LB 2FE0A 5AFAA 3O3BA 1P4IL 3V0DA 3NDZE 4B9CA 3S37H 3ABMB 3UGUA 3RGBA 3MLYH 2YRPA 1KN2L 2F7IA 3FCSA 3O41A 4H1LH 4JM2F 5GS1B 3S3CB 4DO5A 2X88A 2XG5A 4HKBB 1UA6L 5AB1A 4ANXA 4Y4FB 3KL0A 4PV9B 1QUPA 1OZUA 2V5MA 2BVOA 1PL3A 3UJJH 4TLTA 3T5WA 1YCSA 3FQ4A 3JV6B 5HYJD 3DJTA 3IDMB 1WWWX 5D1XB 1A7QL 3UPRB 5HYJE 4PCTA 3VH8G 2BFVH 4YO0A 2Y72A 4IKNA 4XNXH 3AGWA 4H7VA 1OY3B 3NSXA 3THMH 3WY4A 1JPTH 4AZ8B 4EDXA 4HJ0C 2Z8RA 3KDPB 2H3NB 2IALB 5EULV 1S5IH 1VGEL 3BKYL 4WTZG 2PP9A 4LBEA 1LO5A 1WIOA 1HH9A 4JM0A 1OP5K 5KSAD 1OPGH 2A9NL 2P26A 4RRPA 5MEOA 1F4HA 3DGCR 3GRGA 3QXVA 4YFLF 2GK0A 3AACA 1G0YR 1PY0A 1XF5A 4BWUA 4ATTA 2VWEC 3KWWB 2EJ1A 3TA3A 3UX9B 4HPHA 3KBPA 2GSMB 2AQ2A 1NPJA 2F6AA 3OB0H 4N0UA 5A40E 5J12B 1UWGH 1A02N 1A3LH 1Q72L 1FE8H 5DLML 3SDDB 5DZJA 3W57A 4K9EC 4U6XB 1ULVA 2EDHA 4UQBA 1AE6L 1CZ8L 3ULUF 1YN6A 3T6WA 4YN3A 3LKSB 1YUKB 2DI7A 3JWNC 2GBTA 3TONA 1OCWH 3RFZC 1JWSB 4LQFH 1GZHA 3I75B 1ZT1A 3QUKB 3VD2A 1IL1B 3BH8A 4XPTH 5EUKA 1VZHA 4PJCA 4UQCA 1ZT4A 5D93C 1A1MB 1D9KD 5EC2B 3ZKMC 1YMMA 3FHQA 2D03L 4D0CB 4UM8B 4ORGB 2QQQA 3C2SA 3K6SA 2MTPA 4TVUA 3W39A 4L9LC 4P23B 1QFWI 5E6IB 4QXVA 5MHSD 4OI7A 2NW3B 4HXAH 1XEDA 3STZB 1VEPA 1XB8A 5MHSE 4Y4FD 3AXHA 3F83A 3ZKNC 3GMRA 2AJZB 3U2JA 4LT7A 3GRBA 4DIXA 1QR1B 4AQ8A 4OI8A 2APTA 4K07A 3HC4L 5FS5A 4Y1AB 1E9OB 2YA2A 4HUUA 5D1XD 4IJ3B 2JCCA 2NR6D 1UZ6F 1AI1L 3BRFA 1GYVA 1KY6A 4YHZH 2EIZA 3VXRE 3IXAA 5L7XH 4NZTL 5L88L 1NCDH 4PQXA 3GRWL 1KELH 3DTXA 1ZTMA 3ZGHA 3I6SA 5IVXF 2DKUA 3U7YH 2ZF8A 1CXHA 4J7RA 2OYPA 4KROB 2YLKA 3COOA 3QYMA 3SDXF 3TIDA 3U0PB 5CN1A 1J9CT 4NZUL 4LCWB 5E0QA 4C56A 1XHHA 4AM0B 2NTFB 1NCUA 4Z77A 4XNAA 2C7FA 2E8YA 4OFYD 3SDDD 3EO0A 1KFAL 1YPZB 1DUYA 4JKWA 4J3BA 5D4JA 4C83B 3QZWG 4Y5VA 4XO3A 5JR1L 3S2CA 1BECA 1FFNB 5E4EC 1U58B 4JE4B 2OYKA 4WI4A 1PPIA 2AEQL 3A4FA 1TMQA 1SN2A 1VF5C 5FIEA 4TRPH 5EZPA 4X6CB 3A47A 3OPUA 4HDIB 3AITA 4EUPA 1LO2H 4NWTL 3FQNA 1VFBB 1M9SA 3TF7C 3BDBA 3VVVA 4QD2E 3JZYA 3EFDH 2EDNA 5AENA 3U1SL 4N85A 1XIWB 3QR2A 2XIDA 5I1EL 4P23D 5E6ID 1MDTA 2MQ3A 1QSEB 2VDQB 4LMQE 2WWOA 3MLWL 3EOBB 3ZIMA 3GJFA 4BCYA 2J73A 5JUEH 5KSAC 4G80A 2JKSA 3CH1A 1IAMA 4A6YA 4L9DA 1TLKA 2YPLA 4GP4B 2J6EA 3F5WB 4M62H 4Y1AD 4OJAA 4XMLL 3X14B 5E2WH 2P5WB 2OK0L 4Y1AE 2CMRL 3NPSB 5F7EL 1KEMH 1ORSA 4MA3A 2NY4B 4X7FC 1BGXH 2G3XA 1QWUA 2VDRB 2P4AB 4FP8H 4KK5D 8PAZA 2MTAA 3UZQB 2FR4A 2I32A 4M7ZB 5IV2A 2WIIB 1DFBL 2VXVL 1PEWA 4KROD 1DLFL 2PLTA 3UC0H 4H40A 2C9QA 3CFNA 3GLEA 5TD4A 3MJWA 1W0YT 5CINH 1M1XA 4LCWD 2G60L 4DESA 4IHOA 4EN3A 2V5RA 2A83B 2N7SA 2XG4B 1D9KC 1CL7I 1UZ8A 3PP3H 1ZGLM 2IBZX 2IDCA 4OLWL 3OHXC 3RJOA 4WW1A 4P5RA 4QXTB 5I8OH 4KZEH 2C1PA 3O45B 1ICTA 1V3KA 4G43A 1T7YA 3RVXD 5GS1C 4LASH 4BHUI 1JE6A 2MOQA 4N9GA 4Y4FC 5DUMH 3HNVH 1OE1A 4LVOB 4PGDA 4X6CE 1JZ8A 3CLFH 4P2OA 1UH2A 4X9IA 3KH3A 3JUYA 3ZUNC 4H8HA 1OAYH 5D1XC 1XIWD 3BAIA 2NR6C 2A6DA 4QRSB 5CLYA 4X7SL 5K9OA 1CGVA 1DEDA 4GW1A 2AQRA 2XRAH 1UD8A 1YAIA 3JWDL 1TZIA 3WUWG 1QSED 3VU1A 3HHMA 6TAAA 1AR1B 1TTUA 2BERA 3WIIL 4NWUH 3CN1A 4PJBF 3V2AR 5IQLA 5DJ2B 1WJ3A 1LWHA 3F01A 4KHXH 1CLOL 1XBDA 5EBMB 3BHBA 2BS9A 2P5WD 4Z7QB 1A7PL 1RSYA 2YSSB 4R90H 4B0MM 3L4ZA 2C3WA 4DVRH 2AK1H 2NY4D 3T6QC 5J12C 4KZDH 1NOFA 3SDDC 4W6YB 3WIFB 5KTEH 4OD1H 4Q4EA 1XEUA 5E2VL 4LCCB 4ZDHB 1CXFA 4N8VB 5JIPA 4MD5B 1SY6H 3OMZA 4IEFB 1JYXA 3UP1A 4X6EA 5I6XB 4OLUL 1LEGB 5KOMC 5AB2A 1HWHB 5KSBF 4UB0L 2Y22A 3B34A 4N86A 1AO7A 5GZOD 1AS8A 4NUQA 1OT4A 3CFTA 1XCTB 1PDKA 4Q58C 2HLAA 1R9FA 2YHGA 3V0WL 3D8MA 5BW7A 3UG3A 1DBAH 4P23C 3MLXH 5E6IC 3TBWB 1SM3H 4Y0GA 4RA0C 4IRJA 5BZDB 2W0FA 3QNFA 4GSXA 1NAML 2XN1A 4X4XB 1F56A 2BP8B 5CU9A 4RX4D 1MFAL 4XCCL 4FN0A 1KJMA 1VGKA 3OKLA 1VZIA 5HYFA 5BO1H 5LQBH 5L2KB 3HBQA 1L9QA 4LU5L 4IJ3C 4YPJA 3MLSL 1UUNA 4NP9A 5IR1B 2VDLB 5DMJB 1FL5A 3QEQB 3OPZL 4HZLB 5L9DL 2LLGA 3H0TA 1AR1D 2PYFA 3C5ZA 1QTYT 4KK5C 3CVIL 4Z7OF 2R29L 5JPMA 1SJEA 4X4MA 3VI3B 2ORBL 4U0RB 4LMQI 1CYXA 4ELMF 1B4JL 4Q4IA 4KROC 3QWRD 2B0SH 5K33A 2GJ6B 4MNQB 2YD3A 3VDCA 3QIWB 1KENL 1Z0NA 5A2LH 1NUFA 1UCBH 3UAAA 3WXVH 2IAAC 3VTMA 1I8MA 4GW4A 1I1AA 2GHZA 3T3MB 4DWHA 2VKWA 1U95A 1QHPA 5I82A 4KTEH 4IMLB 2VH5L 4HU8A 1NEZB 3DOSA 2WZ0A 4L3FA 5FA4B 1AJ7H 2GFBA 1KLGA 3GZOA 2FCBA 4LAQH 3RVXC 5CD5D 2DQTL 2E7HA 1WWAX 1RI8A 3T1WA 2H8PA 2ENJA 4RZKA 4ODUA 4LSVH 2ADYA 1XH1A 1SF5A 4L29A 4JW3A 3FHEA 4AG4L 4KZCA 2QVIA 1JXKA 4XB8A 3KYKL 2DQUH 4H88L 4BQCA 4MJ5B 1Q9OB 1XIWC 3OGCB 2I07A 4Z7VB 1HL9A 5MEPB 2UZIL 1NANH 1KCWA 2D8KA 1KYDA 4BQ8A 3CTTA 1O9WA 3LQMA 4WTXA 2VKXA 4J6RL 1RUAL 1U8IA 5C7XH 4FFZH 5EUOB 3R7RA 1NAMB 1BW8A 2VW6A 1UG9A 3VG9B 1R3JA 4GSDH 2HVKB 3DURB 4NNXA 1QUNB 3GMOA 1MFCH 4NCC1 5FV2A 4XAWL 5L2KD 1BJ1J 4OLEA 4PBWD 5L2KE 1VPOH 4KO6A 3NPSC 3IFOA 4XBGA 1G7JB 3SOTA 5E51A 2NY4C 2XETA 3QEQD 1FNSH 3ZTCC 1QPPA 3MRNB 3Q9PA 4YHIB 5LDSA 2UVEA 4G3YL 3U6XA 4M7ZC 1BMWA 4ZTPL 1GGUA 5FO9B 2CCLA 3VFNB 3VI3E 2X53A 1NL0H 5TQ0H 1DBBL 3GSOB 1AY1H 2B20A 2GJ6D 2GSGB 2W81C 4G2AA 3QIWD 4GBXA 4MNQD 4UDUA 2GJ6E 3S8WA 2BIMA 1OCCB 5IM7A 2X41A 4HCFA 5GZOC 4HHAA 3I84A 5D1QB 3G9VA 1WZKA 2ED8A 4WI6A 4XP9H 2ATAA 4RNRA 2BZ7A 1IGJB 1N26A 2HJFB 3O3DA 4MX7B 4QTFA 3IFPA 3HHRB 4MJ2A 1ZHKA 1XR9B 3VRIB 2JB6A 3CGTA 1F13A 2NUTB 3L5XL 4JDVA 4ONFH 1SYSB 1SGKA 3DHUA 4XXCA 4UOJA 3B3IA 4LVOC 3CHQA 3H9SA 4G1MA 4Q52A 4XN5A 1MAKA 4LKCB 4OTXH 1DQQA 1II4E 2MNJB 1G7HA 3EBHA 3HI6L 1L3NA 5AVUB 5CFHA 2YMOA 1ND0A 4GKNA 3S97C 5A2IH 3ILDA 3QUXA 1A6WH 1Z9SB 2BNQA 2O5YH 2Q76A 2Y6SD 1A7OH 4IOFD 3HAEB 1AR1C 2HCZX 2MHAA 1OCRB 2B9BA 2V5YA 3VRLF 5I75B 4JCLA 1E9PB 3DV6A 4PRNA 1ES0B 1MWAA 1IBDA 3L17A 1EZSA 4X4KA 3VJ6A 5IEKA 5K39B 3C9NA 1A7RH 4JDTL 4QAWA 2AEPL 1WPCA 2Q0ZX 5DGQA 4PGCB 4BSJA 1HILA 3GSQA 4LCCC 2BWQA 4W1TA 5GRUL 2Q9OA 5BZWB 4A1RA 2AQTA 4NNYA 5AW2B 3BZ4B 1TYRA 5CD5C 5I6XC 3ZLQC 4H8UA 4HAKA 1WZLA 4UTAL 1MW3A 4G11A 4H25A 3KPQB 1ILUA 3KXFA 4E9TA 1P5UA 1T1WB 4MXWL 1FPTL 2ADFL 4BWWA 5D1QD 1JTPA 4K5PA 5I17B 3P3YA 4K23H 5H35A 3SD2A 1Z5LB 4UZUA 2WLLB 5DHVB 2R0WL 2JXMA 5FF6A 4CVUA 4FABL 3HG1A 4LNRB 3WFDL 1I8IB 1GC1L 4YX2L 5C07B 1QG3A 4N0FB 4OKVB 1B3JA 1JZ7A 4IU3B 3APNA 1V7NL 4JJ5A 1N3NB 3D85A 1QVOB 4XH2A 2YLHA 1EWHA 1D6VL 3JTBA 4F7TB 2DEYX 4HKXB 4IRZL 4ZD3L 1P6AB 5D4IA 4QTIH 4C47A 1ZD6A 3KDMB 2YR3A 4QTHB 2YGPA 4BD4A 5ALCH 3JWDC 4YHYB 1MRCH 4G6FB 3V6OA 2DBLL 3LZFL 4O9HL 4S10A 1ED3B 1MCOH 4YBLB 4U0RC 3UTTE 4TM9A 1TF4A 1CJYA 2BFGA 5JIKA 1D7FA 1UYWH 4HCIA 3QIWC 2XOTA 4Q6IB 1JZ5A 1SDYA 1LJMA 2BWDA 3B8SA 2BP3A 1TNNA 5GIRA 4I48B 4Z0XA 1T0MA 2W9DH 5IQNA 3M1CA 5EZLA 2PO6A 1BLNA 2V9QA 1EZLA 4AQEA 2ZX7A 5DMKA 4RGOH 5FYKH 2DQIH 3DUSB 4PR5B 3RDTA 2C4FT 4EI6A 4FHJA 2IFGA 1T4WA 2NY2B 5B22A 2TAAA 5KYYB 5IFJA 4CJ1A 1RERA 1FNAA 1NUDA 3NESA 1FIEA 4DP0X 1A9EA 4DK5A 5JW4N 3GSRA 4JRWA 1KN4H 5FO7A 1QWHA 2K70A 5I1CH 4EF3A 3ULVH 1ZANL 1AP2B 3DUHA 4FYRA 5B1KA 1MH5B 1JNNL 2NY6B 4XC3L 3NZ8A 5CGYD 1WF5A 4NO5B 2QSTA 3IETB 1W0VB 3QFJA 2JCWA 4M48H 2UY7B 4FTVA 3NVQA 5B7EA 3SE9L 4WCYH 3S34H 1KWGA 1CR9L 2Y6SC 2FHFA 4IOFC 4X6DA 5CIPB 3GXNA 1I8LA 4FQ1L 4OLYL 4LLDA 4ZBJA 4ZMOA 5HYQB 3QGVA 5C07D 3VFGL 2K0RA 1AQMA 5C07E 3VG9C 4HPYH 2F53E 3E6HB 3EUUA 5EO0B 3L8QA 2JTDA 3R7QA 4TYUA 4H8PA 2MQ0A 1L9MA 1I1FA 1QD0A 1LK3L 5B38B 5FM5M 3C2AL 1MCEA 4TSAL 2NNCA 3LMJL 4NRZA 2C3XA 1TJIL 3WDIA 2HX9A 1ORQB 4G6FD 5DI8B 4U7KA 2OR9H 3L7EB 4J3VA 1UB5B 5D7IE 3CFUA 1TOXA 2MKLC 4RIRA 1LVEA 4QRTB 4WRLA 2X1QA 1JTTA 4M1GL 4PFEA 2WCSA 5CBAA 2X4UB 1Q9LA 3FQTA 4LLQA 3QJSB 1ZLUH 4PD4J 3MTXA 4CDGC 3DRTA 3K74B 2CR3A 4K7PH 3BDXA 3LZQA 1DE4A 2C9XA 5D1QC 1ASPA 3DSNB 4OD2A 3MA7A 5E8EB 3FRUB 1NFDF 4L1LA 2C34A 5EC1B 1JN6A 1H6EA 3HN3A 1I8KB 2H32H 2NY2D 2VDML 1WAAE 3QHTC 1NIEA 2Z7WA 4KXZH 4BV1A 2GSIA 3P9MA 4IOSA 5K1JA 2V2XA 2HRHA 4NKOB 4PHXA 3ZMEA 2JI3A 3KPMB 2V2TB 2WO2B 4KO5A 3CZSA 1MVUA 4MJ6A 4DUVA 3DX4A 4BQBA 4D9QD 3IAPA 3LY6A 4LLYA 4NQXA 5DVOA 5C8JB 5IUSA 5MERA 3BVXA 4D9QE 2NY6D 4PW3A 4D8PA 3E3QE 5CZXD 4AGLA 2N59A 3FB8A 1PZDA 2K9FB 1X5YA 3GM0A 2XN2A 4JBSA 4PWEA 5EH1A 5GRJH 4X4YA 4M4RA 2FNBA 4M56A 1IM9B 2E56A 4DZBA 4HIHB 2LFGA 1JL8A 3EXJA 4M00A 5I75C 3OB0K 3HBGA 4FCHA 1D5BB 3VNYA 4Z6AT 4FQIH 5EEWA 4M9OA 3V4PA 3VGDA 4L37A 4I3GA 3MO1B 1UT9A 1TVDA 3QPXH 4XC1H 2RAMA 4A2MA 2Z35A 5DHXB 1IBBA 1TXKA 1R34A 3HI5H 4DGWC 2AQNA 3BFWA 1L0PA 1KBGL 2EXSA 1MLCA 5FUOH 3DGGB 1ZHBB 4G7SB 1OK8A 4ZXBB 4A55A 1CD8A 1SDAB 4IQHA 5DZAA 2JB5H 4IS6A 5C0RL 12E8H 1FNEB 4G6KH 4OF6A 5C0EA 4Q2ZA 2W88A 3MJ7B 2R4SL 3HPLB 1G4RA 1NFAA 3AY4A 2G2NA 1I9IL 1P9MC 4PB0H 5FB8A 1JWMA 3EFFB 3ESUF 5CGYC 3FT4B 5IVNA 1K8IB 4KUCF 3K71A 2XQBL 1KZYA 3IS0X 3PYCA 1Q1PA 4LP4A 1WCBA 1YEHH 5EN3A 2EIDA 5MP6L 2VDMB 4WK4B 2YOAA 3RIKA 1U91A 2QVFB 2RMNA 5FGBC 4K5NA 5DUPH 3AT9A 5KWYC 1MIMH 3VSUA 5IQ9B 4U1SB 2XBZA 5FO2A 5IB1B 2XWBA 4XODA 4WGVB 2BCKB 4XOAA 5FYLL 1PSKL 4ZFOA 1DQJA 3RWJB 4AWJC 1T2JA 2F54A 2CJUH 4RAHA 1IM9D 3HE7A 2IH9A 2YOCA 4AL8H 5EIIA 3GJEB 4YHYC 4E9XA 5IKCB 4YS4A 4YBLC 4JFSA 3MRJA 2EDMA 2HSIA 3ZDYE 1L4IA 3FN9A 2HH0L 2WB1A 5FV1L 1N10A 4UI2A 2V33A 3TBTA 3WKQA 3KBHE 4Q6IC 2J72A 3HJEA 4JPWL 5LNDA 2N1TE 3L3HB 1NCOA 3GEWB 2G30A 3NFNA 3UZEC 3JXAA 4S1SL 4PB9H 1E8WA 4ZXBD 1QPXA 2D73A 1JHTA 1ZWIB 2CXGA 2NY2C 4M9PA 3X11A 2WQRA 2N7BA 1JGVH 4P2QA 3B9EA 2VL5A 4S2SB 3Q3GA 4NI6A 4J23A 1MJJA 1UA3A 5G5DB 4MBOA 2WTRA 3TO4B 3E3QC 4I3RH 5DQDL 3VM5A 2NY6C 5CZXC 1CD1A 4L1DA 1EHNA 4O02H 4Z7UB 3NRPA 1IILE 1MNUH 3P4NB 5KEZA 5AUMA 3U0TB 5BRPA 1JNLH 4IU2B 1IGML 4J3SA 1LMKA 3TCLB 3ETBF 3CIAA 2YD0A 4PS3A 4KKNA 3KEDA 4KXBA 4S11A 5CUSL 2BJMH 4U3CA 5ETUB 2CK0H 2BVUA 4QLWA 2QPEB 2WUCL 3ARVA 5BV7B 5LAXA 4C58B 5T5NF 3KLAA 3CZNA 3MGTA 5K9QG 3MRFB 1YLBB 3QQDA 1K85A 3B56A 3MV9B 1TZ8A 4ABQA 1SJVA 1TVHA 1MFVA 2IQAA 5D5ME 2AZUA 2VN3A 5CNHA 4MRCA 4EIZC 3IRCA 4Z5RA 4PJGE 4F57L 2YFNA 4LRIC 1JRHH 1GL4B 3ARFB 4BINA 2YQBA 5IHWA 5D4QA 3B2VH 5TE6L 3VFSA 1TJHL 5FGCB 3V5DB 2AW2A 2QR0A 1M6OB 2B2XL 1PBYA 3LPFA 1IQDA 3TJEL 4KQ0A 1F41A 3SN6N 5E99H 3A5VA 5I8KH 1WBXB 1S7VB 4NKDB 4LDLB 3VTTA 1AOZA 2O5ZL 5I18L 2QKIA 5CD3A 1ZE3H 2GIXA 4NO3A 2DTMH 2B1HL 1BXUA 2YGNA 3L3DA 4MMYA 1G9NH 5A2FA 1X5MA 1CFVH 2J56A 3I6GA 4FX5A 1TQCB 1CN4A 1FVEB 1M56B 5HGGS 3TX4A 3VQMA 3K6OA 1KTBA 4MA1B 5HDQL 4ANUA 2WP3O 4JHVA 3TO4D 1KXQE 4HAFA 3SE6A 1SXSA 3ILEA 4X6FA 4K8RL 4DUWA 1NGQH 4BRJA 2DWDA 5C6TL 2LT9A 5DUBB 2VQ4A 4Z7UE 5E94B 4E42A 2ESVA 3NQIA 3MCLH 2G75B 4LHUA 3BAEL 4P9MH 4KKBD 3APMA 2DYRB 4IBQA 3WS6C 2ZX8A 4DN3H 2HG5A 1KB9K 5KJ4A 2CGYA 3K4ZA 4E9QA 2BZDA 5AG8A 3SGKA 3VX1A 3GUFA 1ZDSA 2YD5A 2OTWA 3MNMA 5F3HA 2IPTH 4AITA 3S8GB 1RULH 3MV9D 4GSRA 4U6HA 4LSQH 5FYLD 1K5NB 4NPJA 3OKDB 3MV9E 5SX4I 5FYLE 1PKQB 2A3TA 3SKMB 4X0KA 4MDIB 1NWOA 3FF7A 4NSKB 4F3FB 2HN7B 1KGYE 2X4TB 4ZXBC 2CO2A 2YPVL 3R18A 5CWSA 4DGUA 1LLAA 1KJVB 3LN9A 3G5YB 5FKAA 1A4JA 3GRWA 4HK0B 3IBEA 2VLKB 1T89A 3DROA 4DK6A 3IJSA 1CF1A 3NCYP 4GRMB 3OZKA 4TXVB 1MAJA 3ARFD 1OVZA 1JERA 5AOLA 2VN7A 5CSZA 5C0JA 5F72S 5J8OA 3QULB 4ISVB 5ACZA 1A6AB 3BVDB 3RGVB 3O6KL 1QO3A 5FGCE 1XH3B 2WBJB 2XZQL 1JGEB 4KJPD 2JMRA 1J5DA 2X2JA 4P4RA 4UF7C 2C7UA 2F1AA 1QOKA 2FATL 2BSCA 2N0KA 4HJ1A 2QQKL 2IPUK 1FDLH 1YAZA 5IHLB 1R5IB 3CXDH 3S4SB 1FZKA 1YECL 3QBTB 4XBPA 4J28A 2YD2A 2RCSH 5EU6A 2ATPA 3LHAA 5KAQG 3MRKB 3T0EA 4XNQA 2DB8A 2CUIA 3MUGB 1DQML 2AAVA 4NJ9L 5JIQA 4NERA 2B4CL 4LOVA 2A4ZA 5CLWA 3FL7A 1Z3RA 2NSXA 3IJHB 5MI0B 3CDGB 4B9KC 1S7SA 1EA9C 3SZKC 2C3VA 1BFOA 1YEDA 3QI9A 3VYPA 5C97A 2HVJA 1QLFB 4CBPA 1TPXB 4KNQA 2Y5TA 1HNFA 5JZ7D 3FT3A 5TH2B 3JWNG 3R8BB 1A6UH 5LG1A 4DO6A 5HHVL 2IOMA 4KO9A 4PS4L 1WZAA 3PHQB 3QWNA 4HEME 1ZTXL 3DDFA 2E7DA 1NC4A 4AMKH 3UJIL 3ARGA 2P80D 4Y4HA 1HQ4A 4DKDC 2ZP9A 2C26A 2Y5EA 3HMXL 2BRQA 4XP4H 1HU8A 5FO8A 5KVGL 1FFPB 3WN5B 2Z4QB 5FFOA 1PKQE 3UYPB 1ZPLA 1UD6A 5B39B 3K46A 4HX1B 2IVFC 2CZNA 5T1DL 2F5BL 2VLKD 3G5ZB 2R69L 2VLKE 3NA4A 3NJKA 4U6VL 1MXGA 2DQFA 1A2YA 1E6OH 1T3FA 4ZUWB 4TVPD 4GQRA 2R0ZH 3G6AB 4N0CD 1U6AL 3RGVD 3SDAB 3TO4C 1LDPH 1PZSA 4TVPE 2EH8H 2WBJD 5DD3H 3RL1A 4ANKA 2IGTA 4JFXB 1T5WB 5EEUA 2VR5A 3UAEA 4GLRI 3O9WA 4RSYA 1T5XB 3BGMA 3BD5A 2JELH 1MCNA 4X5WA 2WVTA 2EIMB 1ZLDA 4DTGH 3RQ3A 1D7BA 4R4BA 4KV5F 2UXGA 3NH7L 3VXME 2VRKA 4EJ1C 1QHQA 1UB6A 4JG5A 4BZYA 4KKBC 4N2EA 4MCZB 5AWNL 3LQZB 2MCMA 4IIQA 5D2LB 1I31A 1BWMA 5C6WH 2HFFB 1BQHG 4R3SA 2E9JA 5ID1A 3VD9A 2GC4C 2FB4L 3SKOB 1J8KA 1L5GB 5BV7C 2OTUA 5CU5A 3SHSA 5FAAA 2NOYA 2CLZB 3FS9A 4EKJA 1LP9A 2PPCA 3QCTH 4HFUL 1HL8A 3NJNA 4OQTH 1SN0A 1YEEH 4UDTA 2AJUL 3FQUB 1ZGLP 1ECZA 4R5TA 2WXQA 3L3JB 2EACA 3ZTNH 1ZVYA 5H8DA 1AQDB 1J8HE 2EYTA 4GMTH 4N24A 1D6EA 4UBDD 5TGBB 3SJVE 2KHAA 1J10A 4X5QA 5DQ9A 1ACXA 1Z9OA 1U42A 3HA0A 3MUHL 2FUTA 3ARFC 1J5OH 3KPLA 3QAZB 4QMEA 2F5AL 3MU3A 3QT2A 1N7MH 3VFUB 4KJPC 1CGSH 5F88A 5ICZA 1QZNA 2CLVB 1NKRA 3B9DA 1TQWA 1R1CA 2YD4A 4KFZC 5DRXA 2VISB 2L7EA 1PJ9A 4MGXA 2IH8A 3U25A 1TQCC 2BDNL 4A7TA 5JHLL 1WBZB 1OARH 5I1LA 4MDJB 4AC2A 4MA1C 3WYRA 4B7IA 3SDAD 5LGJB 2PW1B 2HWZH 3B2MA 3UGXA 3WUWA 5IB5A 1J5HA 3GKZA 1PZAA 3N44F 5CP7B 1XGPA 2R1WA 4CN1A 1CDCA 2YUZA 2DH2A 4ZAKB 2NY5H 1HCVA 3TYFA 2Z93A 2WC7A 1QBMH 2M8XA 1XGYL 3IGAB 1U8MA 4MASA 4EDWL 3BMVA 3HZVA 1CICA 3MRBA 1F3RB 1R5VB 2N01B 1JUFB 2H9GB 5JZ7C 1BZEA 2I60H 1JPSL 4FMKA 1YQVL 1CFSA 4L8BA 1RIVL 4JO3L 3SKNB 2MCAA 4ETQA 1AXTH 3U9PH 4I85A 3R1GH 5D2LE 5GGTH 3L81A 1RZGA 1BD2A 2BCMA 3FYIB 1IEAA 4JKPH 3I2CL 2AJ3A 1O6SB 4B95C 1KIQA 4AQAB 5JOEA 1FJ1B 1RCYA 1T83A 2K3HA 3FOMA 1UH4A 4NC0B 1Q1JH 4UILL 2IH3B 3M46A 2PP7A 3ABGA 1F6FB 1MFDH 1SVZA 1N8ZB 3ZE2B 4EIUA 2ZOUA 1B0RB 3SGEH 1PZ5B 1SYVB 1Z9PA 3CSYB 3KS0J 3P4OA 4OZFB 2QSCL 3WE6A 4AJYV 5B8CA 5KS9B 4UUJB 2R29A 1JI1A 3BIKA 4Q8BA 1OLLA 3HNTL 4TNVK 2V17H 4D8OA 1NCJA 1YC7A 1JZJA 3LQAH 3K6IA 2WB7A 3RGVC 4N0CC 3UO1L 1ZTXE 1O7DE 1UCTA 3BWUF 4NXKA 2WBJC 4I1PA 1RLWA 4JZOB 3OMIB 3O8XB 1T1YB 4RCAA 3ENEA 5EN2B 5EZIL 3WTWA 2NLJA 3NSCA 4R26H 2K8MA 1ACYL 1G6RL 2XWTB 2VR3A 3U2SA 5DYOB 5L6YH 4L5FH 1HESA 4ZTOH 2E6QA 4YDVB 4HKJA 3HUJE 1A3RL 1CIDA 3NP3A 1E27B 4YE0A 1MFBH 4BKTC 3ME0B 1BV8A 4OSUH 5JW4R 2DWXA 4ZAKD 3DX6B 3L1OH 1U8LA 1J12A 5MI0C 3MNWB 2YGVA 1ZA3B 5C0GA 3FQRA 4HULB 4JM2B 3O6FA 3WJMB 1KTRL 2WLHA 4N2BA 4QHPA 3MRHA 5IHUH 5J1TC 1TPXC 5BJTB 4FULA 3RUGF 4UBDC 2JWYA 2ITDB 4OLZL 2AXFB 3UTTA 5KYWA 4XGZB 1Q9WA 1OF0A 2GB2A 4QYOB 1HHHB 3STLB 1YYCA 1BG9A 3S96B 4HUMB 4EVNB 4XO4A 3ET9F 5I5RA 1HSAA 1QLEL 2C9UA 4NT6A 1EO7A 1XGZA 5AB0A 3ESOA 1MCJA 4MMZB 3WJJC 4LESA 4YSPA 3WN5C 4AQOA 3ZE2E 4TUKH 5JYLA 1S7TA 5I2IB 2E7LC 2H0FA 3LZNA 1MY5A 4ODXB 1BVNT 3D05A 4HWEL 3L08A 1KNOA 1KBBA 4MJHA 4KVNL 1OZTG 5DJYA 2AJXH 1AHWA 2GIYA 3F7VB 3O2DL 4WW2A 2EABA 1SN5A 3V5KB 5E8NB 3SDAC 4XHJD 4JRXB 2DJSA 2H1PL 1JK8B 2OMXB 4P2AA 5CJXA 3O8XD 1W6WA 4NCC2 3RZWA 4AYFB 4HQQH 5J57B 1ZLWH 3D2TA 5EORH 3GBNH 1P4UA 4K3DH 3QUMB 4Z0BH 5HJDA 1IBYA 5E9DA 1PLCA 3KNBA 5IFAH 4MNGB 3BEWB 1I9JL 4ZX4A 1U8JA 1JF1A 4EE2A 1G6RB 3AS0A 1FNHA 2VZSA 2BRRH 2FIKA 1J05B 3MQIA 2F53A 3CFDA 1IC0A 1ZHLA 3O0RL 3QG6B 5E08H 4MAYA 1MREH 4GQQA 4YDKL 4WFGD 4BK5A 5F7MC 3ASNB 4DJMA 4WFGE 1R3LA 3C87A 1B0WA 3IU3A 4JM2D 1GY2A 2FBRA 2R0KL 1BBDL 1ZLUK 1XVSA 3CFKB 2DLFL 4PCKA 2FSDA 4ZO9A 4FQ2H 3OJMB 5D7IA 5BQ7B 1RURL 2PWGA 2AQPA 1ETA1 3D4GA 2A6JA 1J8RA 3HC2A 4H26B 5D9SB 3VSTA 2YD9A 3OLDA 2VC2B 5GXBB 3FFDA 1MZZA 2P9RA 1S4IA 3QAZC 1O7DC 4L23A 3VFRA 3ATAA 3WIHA 3ARWA 1LXMA 1YNTA 3DSFH 5ABZA 2J55A 5AW5B 1SLWA 1QLEB 5IOPA 1RZFL 4YSTA 2IO5A 2UXFA 4J3UA 2G2RB 4XB3A 4ENED 2EE6A 4OGYH 2D3JA 4PLNC 3SDYL 3L95B 4QHUB 1J1PL 1WAAA 5ID0A 1RV6X 2XWXA 3SDXB 4JGJA 2FNWA 4XVTH 3FTGB 4Y7OC 1N67A 4KX9A 3F58H 1M6UA 2BNUA 2B14A 4UT6L 4WJG3 3PDGA 4JRXD 5GRYA 3H2WA 5A16B 1TQSA 1DTUA 4Q0XH 2APVA 3RA7H 4JRXE 4NQSB 4UTAA 2F8VA 5L0QB 5KJRH 2B8OT 3C5SA 2FHCA 3ULUD 1THCA 4ZAKC 2VSKB 1SJHB 4GKZA 4YZFE 2J1WA 3QJHB 4PGBB 4PJIB 5JLZB 5F9OL 3MJ9A 3ZVVA 1AG6A 4MNGE 4WI8A 1GPOL 1OB1B 1XB3A 2YXWA 3D2UB 2K6WA 2Y7OA 3KLSA 3ZN6A 4DZ8A 3ZE0F 3D69B 2DQCL 3FSAA 4PM1A 4R7VA 5M7QA 1BJ8A 4HIEA 1N5YL 1CE6A 1RZ7L 2FGWL 1SXZA 2IG2H 2ZOOA 5SWZB 3CPUA 5D7SH 3PGCA 3BOVA 1X4YA 5C0AA 5DS8B 4OZGF 4PJCF 1EJOL 2JK5B 4N8CL 4MYPA 3NOIA 4YGVA 2YKLL 4DPRA 4FKKA 1RUQL 2R9HD 4IRZA 4JFWA 5BNXD 1G7PB 1F1DA 3AREA 4OZHA 4WO0A 3DX3A 2DM3A 4I5BA 4JVUA 2AV1B 2P24B 1NGZA 2BSED 4XPAL 5T3XH 1YDPB 5KANG 5A6MA 1RZIA 1USQA 4ZSOB 4F33A 4TQPA 2GUOA 2HTKD 2XNAB 1ZJAA 3OKMA 4BE5A 1H3PL 4FHKA 1WIUA 2D2CC 2HT4D 2ROXA 4XHJC 1RZJH 1QA9A 2OXHA 4G7RB 4LEBA 4H2CA 3MACL 3O8XC 5IGXH 2A38A 1IZJA 1IBGH 4NZDA 2JCCF 1ZV9A 1IJ9A 1H0DA 1KG0B 3CSBA 4F15B 2WQXA 2CDFA 1RJYB 2X05A 3IDJA 3LOWA 3DO3A 1N64L 4KQ4H 1WAPA 4OV5B 1MG2C 3LZLA 3N85L 3B3BA 1SEBA 4FQJL 1HHKB 3SDXE 5AAPA 1E50A 1UKTA 1JVKA 1SMAA 3MV8A 5EBWB 5KBKA 1F6AB 4HS3A 5DC2A 2BXYA 1KGUA 4MD0B 1AFVL 3QQ4A 5F9AC 3L1GA 1I3RA 1QRNB 4NFBA 9CGTA 2NT1A 4PWIA 1ZAGA 2BM3A 3KGRA 3TH4T 4YWGH 5I6NA 4FLSA 4CGTA 3VFMB 4NNPL 4TUOB 4JM2C 5FDWB 4HIJA 3BN3B 5DRNB 4N8VG 4XVJL 1LEKA 3ZYJA 3L3GB 4PJIE 4NQVB 1Q0YH 2Y5QA 1G1YA 5BMFL 2XXGA 3D2UD 4WDIA 5J4MA 4PJEF 2R2EB 5SWZD 4RISL 1S7XA 3IFLL 5SWZE 3IF1B 1BAFL 1DDHB 1FZJA 3EO1A 1TLMA 4FZEL 5CCJA 4HZ1A 5T1MA 4X9HA 3V6BR 4MMZC 4PJBB 2DLEA 4ENEC 2IBZY 2VR7A 4MHHI 1LNUB 4KMTH 2EQDA 5TDPA 1E4XL 4EOWH 5IB3A 1QSFE 5C3LD 1NBCA 4QHLA 4ZMLA 4K3EL 1DSFH 4PBVC 4LVEA 3QA3A 1F86A 3HS0A 1XXDC 2WXLA 3QFDB 7FABL 3QK0A 2NW2A 2QL1A 3ULUC 1FVDB 3TNMB 3FQXA 2XX0A 5E03A 4B41A 2CGRL 1TTAA 5CS7A 5CFAA 2CG9X 2X2IA 1EZUA 2EE3A 4IKJA 3KCWA 5EPMA 1JV2A 2Z31B 2OZ4A 3TBSA 5KSBB 3FF8A 3ZJAA 3ZL4H 2F1BA 2R8SL 2JFCA 3B7SA 5T3ZH 4YDIH 2WXFA 4YHKH 1QRND 2OSYA 2FSEA 4OW6A 2ZX6A 4ERSH 5I19H 3CAFA 3Q6GL 4S1RL 2Z92A 3APDA 4I3SH 1KJ3H 1CXEA 3L3OB 2FEDD 4CVXA 5DMGD 4ZFFB 2CO6A 2CRZA 3DX0A 4ODHL 2H2SD 2WLIA 2ZNWA 5D5MA 2CKBA 1RZQA 3RPKA 43C9A 1NKGA 2B1AH 1QKZH 4JQXA 4F58L 4HMDA 3FFCE 5DFVD 5IHBA 3V0JA 3CHRA 3OBAA 4PJGA 1WBYA 1AIZA 1DQDH 1NGPH 2KS0A 3TT3H 4WKZA 1E28A 1HH6A 2I26N 5AG9A 2Z91A 3D4ZA 2HTKC 4PW4A 5T8IA 4A2HA 4LARL 4ZFGH 4ZUVA 3V0IA 3EYOA 5GS0L 2HT4C 4KHTH 4ALAC 1GOGA 1U30A 2VJXA 4AV5A 1U8NA 2L4OA 4Z7OB 1F00I 3GHEH 3LS4H 4WJ5A 1N6QL 2A6KA 5IJCC 1KXTA 1MPAL 2EEAA 4ELMB 1QHOA 2OL3H 4N3UA 4JO8A 5K5YA 4GUPA 1G6VK 4K73A 4UV7L 3FDWA 1C12A 3NFSL 5DRZA 3UZVA 2ED7A 4JG1L 2WYIA 3MLRL 2XQ0A 3CUPA 1I1CA 1FG2A 5J6HA 5L0QC 4HF5H 1P2CB 4HS8H 4AIZA 2X4SB 3PPSA 1M7DA 4YSQA 4O4YL 3HRZB 3KMDA 1H6TA 1PD1A 1WISA 3QQ3B 3APFA 3T08A 1S9YB 1TJGL 2ZPKH 1UWEH 2XTLA 2Z31D 3QDMB 5DK2A 3RWGB 2X70A 4WGKA 1SDDA 4LLMB 4OM0L 4QOKA 2BINA 5C9JB 4FA8A 1JZGA 3H3KA 5ADPH 4NLHA 3MNVB 1CI5A 1DN2A 5DJ8B 3P3UA 2P43B 5D71H 3W9DB 5FFGA 1ZLSH 4Z7NE 1I1YA 1ID5I 2ZYSA 1CLYH 3TO2B 4HH9A 1FV1B 4I18A 4I13B 3RG1C 1G0DA 2JE8A 3BPCA 3BWSA 1WEJH 2F68X 1RHHA 2HPTA 5F96L 3SPJA 5H37G 5DWUH 5EMYA 3DV4A 1EUUA 2M26A 3FAWA 2E8ZA 2VMFA 3CFJA 1LL1A 4TN9A 2MOVA 1E6JH 1UXWB 2FYVA 3I9IA 5LAPA 3RY6C 2HFEB 4FXGB 2N56A 1KYFA 3HW7A 3QUZB 4N0RA 4PV8B 4TUJB 4UZGA 5BZXA 5J0BA 1S3KL 4B9JA 4ZYKB 2X3AA 3S5YA 1A21A 3FONB 4LHJB 3LKOA 2Q86B 5IIEA 3QZMA 1BFVH 1TTRA 3HAEG 4AJ0A 4F15C 1R0AL 2DWEB 2AKRB 2W0KA 3GUTB 4W9FC 3MZTA 5GHWH 2C1OB 3ABKB 3MBXL 3L5JA 1SBBA 2Q1EA 4QRUB 4Z3JA 1DJIA 3IDUA 1GJUA 4KK8D 3VTAA 3RWHB 3ISWA 2KPWA 3LTVA 3LHPL 4YHOH 5A1AA 2AJYL 3CK0L 5BS0A 4Z76A 1KGIA 4J3OD 1BF2A 1L0YA 4MD4A 4JN2A 1ZV5A 3JVFC 3OZ9L 3PDOA 4GXUM 2JQZA 2FEDC 2QHLA 4DKFH 1UM4H 5EA0L 3LS5L 1YEFL 5DMGC 5E2JA 5KVFL 1T1ZA 5CKAA 5I1KH 1AGEA 4XCYB 4E41B 3A4EA 2P28B 3P73B 4M61A 3L7FB 1XX9C 2H2SC 3QDMD 4DGIH 4Z7WA 1EFQA 1CGXA 1UM6L 2EC8A 4XVOA 4QT5B 2X89D 3QDME 4XOBA 3CBRA 4MMXA 2ZCHH 4QJ3B 5J11B 4U6YA 2NSMA 3MR9A 3QR0A 1ZE3C 3GS0A 3FRPA 4BZ2L 5E9NA 2CO1A 4KI5F 2YGOA 4DK3A 5A2JH 4I4WB 5E1AB 3MLTB 3BWAB 2QHRH 2WNGA 1OANA 2VQTA 2ZNXA 2PCYA 2DQGH 3PHOA 2AQ1A 1W6LA 1P6FA 4M1DL 3CX5J 2GY7B 4OFVA 4PRHB 1HXYB 5IHZA 4AW4A 3VFOA 7PAZA 3G5VA 4DERA 4Y19A 4E9WA 2V7NA 4FYSA 4JFHE 4LEXL 2N7AA 3EGDA 1PZCA 2NRDA 3LRKA 4AGNA 2UY6A 1NLBH 4MJJA 2KL6A 2EVJA 3IMRA 4O5LH 3QUZD 1UD4A 2OJEB 3WEOA 3PREA 5GS0D 5FCUL 4C55A 3EOTH 4HWBL 2VXTH 3AUWB 2IMNA 5ESAA 1MI5B 4LLAA 1CD9B 2H26B 2VTFA 3WKNA 4UWQB 3VXMA 1OE3A 1ID2A 1NDGA 2Z31C 4FI8A 1IO4C 1EQWA 1TDQA 5F7DB 2Y7QB 4O2CA 5KVDE 3BYYA 1PGRB 2EDWA 5IB4A 3VE0B 1U8CB 3PWJA 4H1LG 3OXRA 4U1NB 3BYTA 4H0LC 5CJBA 4WWOA 3GSNH 1KB3A 1FRGH 1PLAA 3L3OC 4M6NH 1JWUB 3K2UH 5DD0L 5I8EA 5C2BH 4F80A 4BRVA 5IT2L 2BNRE 4E41D 4OGAD 4FQCH 4N2GA 3QIUB 4E41E 5TDOB 1QNZH 4JO4L 3TZVB 1T2QL 3AROA 3MRIB 5BOZG 1J8HA 4KC3B 3SJVA 4LOUD 3T2LA 5JW4M 5JPNB 2GTZA 2Q8BL 4QLRA 2LTQB 2VM4A 2W1NA 2RJMA 1X7QA 2ZCKL 4G6MH 1DL7L 5D1ZA 5DFAA 3QS3A 4AH2B 4LPWA 2HKHH 3DOIA 2KLRA 3KJ4B 1MUJB 3S37L 3VMPA 5AVTB 3EDEA 3MLYL 1T2XA 2G9HB 1M53A 2R7EA 3BMWA 3CVHA 4PRHD 3MRLA 4YHML 1WA2X 2EDQA 2R2BA 3KBFA 4PRHE 1IKNC 4YSUA 2CU9A 5SV3A 4DO4A 5ADOH 1ZA6B 2BHZA 3WO4B 4UNTA 5I30L 2YPVA 3U0WL 1T21B 1U8QA 4KDTC 2Q8AH 2PCFA 5F89B 4JZNA 4JFEB 4KK8C 1BZ9B 2H41A 3B4NA 1JD7A 3Q6FA 5M95B 5FXCH 3VXQB 3D39A 4Q97A 2VOTA 4J3OC 5B38G 4P5TA 4MJIB 1UACH 4HXBH 3HRZC 1W72B 2WLMA 5SX5K 1MI5D 1CD0A 1CQKA 1NOLA 4KNSA 3ZDXB 1MI5E 1S5IL 1XGQA 5G55A 1QFHA 3DXAA 1OPGL 1Y0LB 3VCLA 2LVEA 4H13C 1YUHB 4V1DE 1BAWA 1FCCA 1E4XI 2OMBA 2VDKH 1J0YA 4YLBA 5ABDE 5EZJB 4ESKA 5F1IB 4GAGH 2EUZA 1TKWA 2JKIS 5AW3B 2NTSP 1TZGH 1NGYB 3N40P 2RR3A 2X6BA 3EDJA 3SQOH 1C5BH 1LYQA 4O51A 3QIUD 1XCWA 1A6TA 4L05A 5KVFE 4MCYB 3WAJA 3TZVD 4HBCH 1BOYA 3P4LA 2PPFA 1OCWL 3PQYE 4LQFL 4RZCA 1CG9B 3RILA 3DBXA 3CDZB 1F45A 2BVQA 3BFQG 2XPGB 1WT5A 4XPTL 5IBTH 1KB5H 3SY6A 3JWOC 1R47A 3LPOA 4HGKC 4X5RA 1QASA 4FZ8H 3LKQB 5TPWH 1YY8B 2PN5A 4FXGC 4A7SA 4F20A 1FIGH 1BMZA 3QUZC 5FW8A 3PJNA 4V2CB 5GS0C 3DVNA 3MVSA 5AYUH 3LRGA 1AHMA 1ILSA 4OM1H 1E5UI 4HXAL 3HMXA 3JTSB 4Z8FL 4WQOA 3RNKA 3FU9A 4Z3GA 5HHQA 2B77A 1Q38A 1H6UA 2QQNL 3FH8A 4PRIB 4QRPA 5ISZE 2ODHA 3MRMA 4JFQA 3HZKB 4DP2X 3O4OB 5F7UA 4GT0A 2ZAIA 3QJOA 4JFED 2WP3T 3HUJA 4N3TA 1LO0H 3MREA 1NFDB 4XMWA 5T33H 1PIGA 4YHZL 4H8QA 4MJID 7TAAA 5L7XL 4OFPA 4M8UA 2NNAA 5BZZA 1A22B 1NCDL 4MJIE 2R4RL 1KELL 2Y7NA 2PW2A 5D6CA 5ALBL 5F0PB 2BX5A 5DJDB 2DQJH 4OGAC 3ZDXE 4NO2A 1E2ZA 5LNGA 3HCVB 3EYSL 5EWIH 1U8HA 1T7XA 3QNYB 3G9AB 3HFMH 2EICA 1AGDB 4I9XA 4OR1A 4P4KB 4LOUC 3BQUA 5TE7H 5J11C 2YWZA 2XKNA 2DWSA 3MN8A 2ZOLA 3MGOB 4ZZKA 5H2BB 4UQEA 2E86A 2FTAA 5FYJD 3US0A 5EOQH 4YHPB 3CFEB 5FYJE 5LGHL 3HI1A 1ZIAA 1U92A 2A73B 4KPHH 2UYLA 3FYEB 1KEGL 1NM4A 4TRPL 3U4BH 4X6DF 1XQ4A 1SLUA 2EDKA 2WLKA 1LO2L 4S1QL 4UQAA 1JYNA 2IBGA 43CAA 4L4TB 4XO9A 2LV4A 2DMHA 4J2XA 1ITCA 4Y16A 5I66B 3HRPA 4DP5X 3EFDL 2V5TA 4X7CC 5HGDB 3VD4A 2K3TA 4ZUUB 3U4EA 3WFCH 4ZX6A 3V4VB 5BCAA 3OKYA 1JNHA 5KN5A 3T4AB 1KB9J 1RL1A 3NJVA 2VZ1A 2FECL 4N9OB 4HOMA 1M05B 1YJDC 1BQHA 1IGIH 1FP5A 3OKEB 2Y24A 1VADB 1UUSA 3S3JA 4PRID 2X6AA 4XMPL 2KBGA 4X99B 3RX5A 3EXLA 5ERWA 1E90A 3SKUD 4A7GA 1OAXL 3TEYA 4PRIE 3V0VA 1HHGB 3FN3A 2XY2A 4PWFA 4FMFA 4OCSL 4M62L 4PTTA 3WLBA 2FRGP 5FOJA 2WZPA 4D3CL 2ZKXA 5E2WL 5JXEA 1R3KB 5D6DA 4MXQD 5JHLA 3ULSB 2W60B 2JJTC 3QO0A 2RFXB 1KEML 1NFDE 5CP3H 3HC0B 3ZDZF 3Q2CA 3X12A 5JDSB 1IC7H 4XNUH 4M5SA 1ADQH 2WY3B 1XD1A 1NCIA 4FQLH 3Q1EA 4YR6B 4L8DB 4PIRF 4L4VB 3QIUC 5GJTH 1XF3B 1PF3A 3EHBB 4UIKL 2VLLA 1EPFA 3EO9H 3TZVC 2J43A 2H1XA 3UC0L 4W6WB 1MEXH 2AVGA 2YMXL 5EB9A 3P3RA 4P4KD 2LOEA 1MCWW 2CIKB 5CINL 3VM7A 5JPNC 1OF2A 2LTQC 3WSQH 1M1SA 3W9EB 1SOQA 2YQ3A 3OC5A 4AQ1B 4F5CE 4ZPVA 3KJ4C 2H6UA 2H45A 5E8OA 2OJ1A 5I8OL 4KZEL 5J6GB 1GOFA 4HD5A 2A6IA 4YVUA 2WO3B 5ILTH 1HZHL 1RUPL 1TVBB 3MA9H 1M9WA 4LASL 2EUVA 2ZG2A 1RP8A 2X40A 5DUML 3HNVL 1IGCL 3OGOE 1TFPA 4JFFB 4UNIA 3WO4C 4YSEA 4R8WH 2FJGB 4L4TD 3REVA 2XUWA 4B6ZA 6PAZA 4L4TE 2VABA 3DECA 2EKSB 1OAYL 1KCVH 3MOBL 1KXHA 1ZJBA 3SPGA 3TWYA 1USZA 4LL4A 4KK9D 2XRAL 4NJAH 3B2DC 5D7LA 4C4UA 4NWUL 2JVUA 2YJLA 4X8XA 5C86A 1YEIL 2D9CA 4HT1H 1NBVL 4Z18A 2HUEA 3WEXA 3MNZB 3F65A 2CPCA 4JFOB 3FTZA 1LO3L 4KHXL 1NJ9B 3GKWH 4AIEA 5T1KA 3WY3A 1F90H 3S35X 1CDBA 4WLCA 4KUCD 4DVRL 2PF6A 4BFIA 2BHUA 2AK1L 1GW0A 1IQWH 3A3YB 4G8FB 4I88A 4KZDL 5EU4B 3BE1L 5KTEL 3CHSA 1FO0A 2C3HA 2X12A 1IAOA 5DMYA 1EAPA 3NRQA 1SY6L 1R3IH 3LEVH 4IDJH 1EHLH 4L4VD 3W0WE 3EHBD 1OGAB 5AVWB 3ATFA 1PKOA 5I9QB 3UTPD 4L4VE 3ZKSD 2BC4B 3QYCA 3QEGH 5BUAA 2TSBA 4ZMVA 4ZZFA 5F7YC 3FHAA 3VD1A 1CB4A 2H3XC 1EX0A 1WSST 3BD3A 1RPUA 5GGVY 4YLQT 4ZMNA 3EYUH 3BLBA 1G9HA 3G5XA 3BH9B 4XX5A 4QRRA 2W65B 2YJQA 1AD0A 1KT2A 2VZVA 4YHNB 2JNZA 2F2HA 4QO1A 5L2JB 4JR9H 3AUVA 3LX9A 5CLZA 3MZGB 2Q3ZA 2XFXA 5EO1A 1HDMB 3MLXL 1X5XA 4LGPB 1REIA 2BIIA 4BELD 3W2DH 4X8GA 5INCB 2DQ6A 3IRZA 1XO8A 2X3BA 2ZXAA 4JFFD 2ZWKA 3LRMA 3WOVA 1F4WH 2ZCZA 3CNKA 5I76A 1T22B 2Q7YB 2IAMB 1GYCA 3O4OC 1WFOA 3UTZA 1R3HB 5BO1L 1T6WA 3SDDA 5LQBL 3T2PA 5HPMA 5LVEA 2Z0UA 1B0IA 1BVOA 3ZT5A 3GMPA 3GZQA 3O2DA 3QQNA 2IH1B 4PRDA 2ZQKA 4RWYH 2XV6B 2F19L 5E5MA 4EBQL 1KLFB 1MCPL 3B2XA 3KPRA 4XVSH 5E6SB 4ODTL 1KJ2L 4G6JL 4U2YA 3UACA 2B0SL 5G4OA 3FU3A 3TIEB 2ARWA 4P4KC 3CMGA 5GGSY 4D0CA 2ADJA 3TH2T 4Y4KA 1UCBL 3ALPA 3WXVL 3EADA 5EU3A 2IGLA 3BP5B 5DFWH 1ERNA 4L1TA 5CEXB 3CLWA 3ZZSA 3G08A 4L8CB 3ZHFA 4P8QA 5F8RC 3V5HA 2VE6A 5AZEH 1OGAD 4LAQL 5K1VA 4ZMYA 4KRPB 1IKFL 1OGAE 2BPBA 3PV6B 4YGAB 3S4SG 5DEFB 3OG6B 1N19A 2XC8A 3IGUA 4LSVL 1P7KA 5FECA 4P3CH 1QSFA 3FNKA 1CYWA 1KIPB 2KMWA 1KBPA 2DQUL 3SQBB 1IAIM 3FZUD 3HC3H 3U36A 4UNVA 4IMKC 1DR9A 5EOTA 5A7BA 3T4AC 4KK9C 4HV8B 1IMHC 1KGWA 3RKDD 1HINL 1FUNA 3II3A 5HVHB 3HKFA 3D0LA 2BLFA 1PYWA 3PWNB 3VXNB 1XAKA 4NRYA 4PJ7E 2WBWB 2IAMD 1LQSR 1I85C 1QTSA 3PAZA 5MEQA 2NXZB 2Z8VC 3VSVA 1I7RB 1H8OA 2N0MA 3WNPA 5GGSA 4A37A 1OAUH 2VIRB 1FFNA 4MAZA 1QI3A 2XBDA 1MRDH 4HUWB 4JY5H 1CDYA 2E47A 1OP9A 2F8OA 4NDMB 5GSRB 5LBSL 4P59L 4NP4H 4YAQA 5B39G 3AT8A 3EHBC 3I6KB 3BW9A 2DQHL 1NL0L 2H6PA 3NABH 4JG0H 1AY1L 4NN6B 1KJ2B 5TQ0L 4IBWA 4AT6A 1YN7B 1S7RB 3WFHB 4OCNC 5DJXB 4NEHB 5CJOH 4XP6H 2FZ3B 4AQ1C 4X6CF 3DMMA 3FTUA 4M43H 1FLRL 3VFVA 1FNFA 1N5AA 1EIBA 4XPGH 1SOSA 3AM8A 4LDEB 5HHMB 2JJSA 2Z1KA 4GFXA 4LIQH 4ONHA 4WFHD 5I1GH 3T0DA 3PWUA 1CVRA 4C54A 4CILA 4KRPD 3MODL 1Z5HA 4V2BA 4LGRB 2EDYA 5I1JH 3P11H 4YXKH 4MQTB 2P5WA 1GYAA 1GKEA 5ECGA 4TPRH 3WD5H 4OTXL 1K4DB 2B7DT 4JRYA 3KLQA 5DQJA 1AXIB 2WXKA 5DHYB 5DCCA 5B1JA 5GGUA 5EEYA 1A6WL 3ETTA 1INDH 3D18B 2VDNH 2OMVA 3KM1A 1NBZB 1ECYA 3VVWA 4FLQA 3ML9A 1HHIA 5FM5O 1F4XH 2GQHA 1T4KA 2NUPA 3C5JB 3L5IA 3JT0A 5AQ0A 1J0IA 3DUUB 2WLNA 2WXGA 5HHOA 3ZKQD 1MLBB 3IAQA 1JYWA 2EYSB 2NXZD 3NTCL 3A6CH 3DVIA 4YDZA 3DVFA 1FNGB 2XI9A 3O45A 1WZ1H 3ML8A 4ZMTA 2YD8A 4G5AA 3KYNA 4HD9A 4XBMA 3GXDA 4ELKA 5CBEB 3CC5A 3NMEA 2VDOH 3MAWA 5I9QC 2W0LA 4KRLB 5CN2A 2NMSA 2JKRM 2FECI 3D3VD 5IFHL 1U41A 1UT1A 2B59A 1HXKA 4UU9B 2VB5A 2HYMA 3FTYA 3FZUC 1NM9A 4GQ9L 3ZDWA 1JGDB 3R4DA 4K23L 5HHMD 1NAKH 1W8OA 3DX8B 1E7VA 1GHFL 2GC7C 4W9IC 5DDHA 3RKDC 5ACLA 1FFOB 2XYCA 4UTBA 3NIFB 4KWUA 1FZOA 5DS1A 2V2WA 1CFTB 4JPQA 3LNEA 2A9DA 2C9PA 1GZPB 4JY4A 3TBBA 1GGCH 1RFDH 2SEBA 3CZGA 2IAMC 2WV3A 5DF0A 2DL9A 5KUMA 5DRWA 4K94H 3UJTH 5EEZA 4ZDHA 1Y6KR 3VACA 2AITA 4FCAA 2EYRB 3BIBX 5K59E 2BVPA 3SB3A 1S8DA 2J4WH 3ILPB 4XNZB 4LQ1A 5AZ2H 2D7TH 1AMXA 3N1QC 3T6ZA 3E6FA 1BYOA 3KZ8A 4XXWC 3B5HA 2LAGB 4EXKA 1MCOL 5JQ6H 4PCYA 3GBDA 3IFNH 3IGFA 3MRGB 4OZFG 4HUXA 1UYWL 4P07A 1Y1DA 2CHDA 1BEYL 2CUHA 3CU7A 1PQZB 1E4KA 2KQMA 2XACC 4MKTA 5G2NA 4JFYB 3AABA 3LEXB 2XXMB 2EEBA 2QZQA 3NT0A 1B0GB 3MRCB 3VFWB 2FO4B 4BK8A 2KI6A 2W9DL 4OUUB 3RIAF 2X4PB 4KAQL 3US1A 4CN4A 3DBSA 4HCRH 3L2LA 4QF1B 3WI9A 5C71A 1T5KA 1X44A 1JHKH 1RK0B 2DQIL 2X4RB 1H9VA 4KV5E 4RGOL 1R5WB 5FYKL 1SEQL 5DFTA 5I6MA 1TU2A 4OFQA 4X4XA 3ZE1E 1Z7JA 2R23A 3RZCB 3V0FA 5EBGA 3QO1B 4KRPC 2ZF9A 3E0GA 4OIBA 4P57B 2ISDA 2DYPA 3MJGX 3P2DA 1F1GA 1VFUA 1IE4A 1KN4L 5SWSA 4GRLB 2FLBT 3C60A 3BP7A 3C5XA 4RLDA 3QEQA 2CDEA 3MCKA 3O3EA 5F0LB 2PCPB 2IBBA 5E8PA 4HALA 4OH2A 4ICWA 1SNRA 5H4YA 3LV3B 4WCYL 3S34L 4D0DA 4LCYA 1E2WA 1HK6A 2QT6A 2GT9B 5B7FA 4PBDA 5HVHC 1OOWA 4MNQA 2ZSVB 1IKOP 2P49B 3NIFE 2PXYA 2Q2EB 3UXFA 4UV4H 3AADB 4HPYL 3VD0A 4R7DB 1KTLB 3WS3A 4L1HA 2NXZC 4BKSC 5E6RB 3SQRA 1OSEA 1QLRB 1IZKA 5ITFA 4I2XA 4AV4A 5IJVA 1QQDB 2ATKB 4OUOA 5JIIA 5AKSA 3CBJB 1RIUH 2D7QA 3HZ3A 4DHLA 2OR9L 3D51A 2C9AA 5F7FA 3ZW3A 1A5FH 3FB7B 4GT7A 5I1AB 4NQEA 4NN6C 1CDHA 3REWA 2O5XH 1CO1A 1U3YA 4R96A 2BOCB 4OZIE 4CW1B 4YQXH 3RWDB 1NDMA 1THAA 4GH7B 4K7PL 4NUJB 4PMEA 4MQ7B 1T04A 2CHZA 3FT2B 3V6FB 3TWCH 2IADA 3QG7L 1M2VA 2BHFA 4LSRL 1MHHB 1EEYA 2PTTB 3RZCD 3CPLA 2AEIT 5J1AB 4PY7A 2BVYA 5EFIB 2BSSB 1A14L 3SPVB 3U9UB 3AQZA 2OMUB 1EAOA 4Y5XA 2X5PA 2OMTA 2CHNA 3SYOA 2ENYA 3WGUB 5C0FA 4OGXL 1F4AA 3EGSB 1AGCA 4U1GB 5EZOH 2H4EA 3QRFM 4N2IA 3WKMH 3K72A 3K0YA 4FQXB 5GRWA 5A2CA 1SVBA 3MRPB 2KUTA 3K8LA 5KW9H 1RK1B 2JKNA 1JGIA 2HRPL 3PGFH 1RU9H 3P77B 5IW1A 1BZ8A 3C6SB 3TN0A 1OW0A 1RVFL 1S6NA 4JDZA 4PS8A 1ETZB 3QPXL 4NQCB 4XC1L 1OM3H 5HGHB 3D52A 2AV7A 5TE4H 4V1DA 1JFQH 2X38A 1KIRA 4PH8A 1OOAA 1XSJA 3EJCA 4DKAA 5F7LB 3T04D 4FDWA 4WI0B 4G8GA 4WNQA 5FUOL 3HE6B 5D72L 1HXMA 3NSFA 1LO4H 3CLEL 4JN1H 1NLDH 3PL6A 4K9JA 3BO8B 2JB5L 4AYEC 3CFCH 4K5MA 1B4RA 12E8L 1PLGH 3H6AA 3PQYA 5DGRA 4RAUB 1ODUA 1GOHA 1QBLH 4N2CA 3VX0A 5BPPA 4WV1A 1CLZH 1CFNA 1EEZB 3H3PH 3HNSL 4PB0L 4EEEA 3QXDB 2ZE0A 2ZKWA 1UWYA 3O3BB 1TTGA 4QHKI 4NM4H 2YXVA 5IROA 2Z8WC 5FYKE 4F9PA 2UWEE 3FCSB 1AAJA 3O41B 3F12A 2XG5B 4NYLA 4X7EC 2WQUA 5ISZA 3MRRA 1MIML 4DW2L 1X5JA 1S9VB 2VLMD 5K39A 2ETWA 1LD9A 4Y8DC 3U7WH 1Z1WA 4K9EH 4PPTA 4G8AC 5DVKA 2OTPA 2KERA 5KJ7E 3WMPA 5E6UB 1OQOA 2YKKA 2ZOWA 4FQXD 4YO0B 3AU0A 4XNZC 4AL8L 5I0ZA 5I73B 3I85A 5HJ3A 1M3IA 4EDXB 1HJCA 4HWBA 4A2DA 4JKLA 3VFPA 3ZTEA 4LBEB 1LO5B 5D96B 1HH9B 3S3SA 4AJVA 5MEOB 2GK0B 1P5VA 4NQCD 1D5IH 5A3ID 5H94A 3GM8A 4YH6A 1XF5B 4F9LA 2BSTA 4ZW8A 5E4IA 1SHMA 3EIFA 3OX8A 3OKNB 2WLYA 4ODWA 1WFUA 1X5KA 4N0UB 4PB9L 3BZFA 3HE6D 5FOBA 4EIBA 4DGVH 2X4OA 2WSPA 5C09E 5FA3A 1NPNA 1O6TA 2IPKA 1OAKH 2ZZUT 4BWTA 1KGXA 1YN6B 3RZCC 4KO7A 1CFBA 3ZE0B 5C08E 3FH7A 1I7ZB 3BJLA 1ZT1B 4PYHA 4YOKA 4UM9A 3BH8B 4GRLC 3E1ZA 4I3RL 5EUKB 4OZGB 4PJCB 4YL4A 4BE6A 3PWVA 4K55A 5IF0A 3C12A 1ZT4B 3KVDD 1I8UA 3D48R 2JJVA 2WANA 4O02L 1FL6A 1SVCP 2Y36L 4MXVE 3H42L 4BZ1H 3K6SB 1JNLL 3MTRA 2DD8H 4S1DD 4WUUE 3W39B 5JIDA 3ILQD 4TLUA 4YK4B 4OCRH 1J7VR 5GGQH 3WENA 3DK0A 4H1LA 1PZ2A 4DT2A 1C5DA 3DX1A 1YYLL 1WTLA 1F2XK 2CK0L 3GMRB 4I48A 3LKNA 2BIQA 3BCFA 2HJLA 2OMZA 2J6EL 3BWUC 5DTFA 3TV3L 3TESA 5D7IF 4MA7L 5J3HD 4AVHA 5FHBL 5JW5A 4FNLL 3KHOA 4PR5A 4HUUB 2JCCB 2P8LA 5KYYA 2R83A 3CU1A 3UG5A 2EIZB 4NOBA 3ZK0A 3IXAB 1FGNL 1YNTF 1RY7B 3HFFA 3V6ZB 3DTXB 4JHBA 2MWCA 3QJQB 3RWFB 4Y9CA 5HDLA 4MZRA 4XBEL 1JK9A 1WAAF 1T80A 2IGFH 4FNUA 1FFTB 3B2VL 3TIDB 3KLHD 2CA4A 1G1OA 2FD6H 4Y9GA 3SE4A 4C56B 3WHXB 2OI9B 3UTSA 4KY1H 1VACA 4PJAA 1CBVL 2DZEA 2UZXA 3GHBH 4ABVA 1O5PA 1PFOA 3BSZH 4F5CA 4Z77B 5E99L 5KVMC 3EO0B 4XT1C 3QW9A 4QWWD 4N0UE 4PW9A 1DUYB 4Q9QL 3IN2A 2XWEA 2CJTA 1YEJH 2DTML 1NC2A 2P45B 4Y5VB 3SPIA 3L9BA 5AL8A 4PJEB 3GLZA 3OWRA 4OD3H 3OXSA 4DEPB 3NSDA 1AHKA 3HOGA 4X42A 4EUPB 2DL2A 4Y2NA 3BT0A 5B38A 3LKRA 3RWCA 5L4IA 1N4XH 4PJCE 1NGQL 1M3JA 4GRWB 4U1GC 3KJ6H 1L9TA 3M8OH 1YMME 4BFOA 1TZAA 3TBCA 3B6SA 3CE1A 4FQXC 5CSGA 5T5FH 2OPCA 2D3NA 5K9KA 4DN3L 4NHUA 3GJFB 3SY0A 3TFBA 4QY8A 3PNWA 4KFMA 4HLZG 2GIMA 2BMKA 4JLRB 1JYVA 3FSZA 3CH1B 4G80B 3PJSA 5JNYA 4A6YB 5A3IC 1I7UA 5F9JA 2YPLB 1CE1H 4YJZL 4LSQL 4P2RA 3RRQA 2DJMA 1JZ6A 2JCCE 1ORSB 4MA3B 4ILDA 2NDFA 3HE6C 4HJJH 3V55A 1A3QA 3WTSA 4FXKB 3MJ6A 3MLVL 2FR4B 1MAML 5AVQB 5IV2B 2WVVA 35C8H 5I1IH 2C4XA 2WUBL 2O6CA 5IW3A 1M1XB 4C56D 5IMMA 4IHOB 4EN3B 4GO9A 1MCRA 4B7LA 4C56E 2Y06H 4XCNB 1UZ8B 4J3OG 4WW1B 3NCWA 1D5BA 1AZBA 5A6LA 2C1PB 4OCWL 4S1DC 5CEZD 3T77A 4G43B 3ILQC 1RSFA 3CXDL 4PGEA 4XAKD 3RL2A 2Y1AA 1ETB1 4N2LA 3CXFA 4ZOAA 2RCSL 4L48A 4XAKE 4N9GB 2YQ2A 1E3ZA 4RVBA 4N6QA 1OALA 4ZTEA 4PGDB 1PLBA 3K4DA 5AL0A 4P2OB 5CMAA 1ACCA 1DVSA 5I5IA 4IKIA 4U1KA 1OM9A 5J3HC 2BW4A 4A7QA 1G7QA 3ZDYF 2A1WH 2W0PA 3ARQA 4ZUTA 2A6DB 4GRWE 1PU0A 1SRDA 2DM2A 2HJKA 4JCWA 5K9OB 5D7KD 1C8PA 5KBNC 5FYJU 5I73C 3VGHA 4GW1B 4MS8D 5D7KE 1TZIB 3T8XA 4UQIM 4I9WD 3X13A 3QNZB 2X4NA 4G5ZH 1PZ3A 4I9WE 5D96C 3HS9A 4R4FH 5HDBF 4D94A 4HK3J 4KXZI 1JGUH 3RHWF 1FWXA 4E5XA 1KF9B 3DHPA 2YPLD 3KLHC 4AMKL 1P4IH 3BHBB 4TF4A 2YPLE 2DDQH 2IIJA 2ZUTA 3TA3C 2FWLB 4XP4L 3QEUA 2WQ8A 3WV0A 1KN2H 1E4HA 2B3IA 3I6LD 3GXTA 5GGVH 3BVUA 3MPCA 1OQXA 1I3VA 4QWWC 4A7VA 4Y2OA 4H0HB 3MX0A 5HHPA 1UA6H 3D5OF 1HI6A 4XP5H 4DGYH 2UZPA 1YEGH 1ZS8A 4X6EB 1HL4A 4FERA 4D2NA 3IMSA 3K6NA 1GZHC 2A9ML 2XQYG 2R0ZL 1A7QH 1LDPL 4EN3D 3P4MA 4X5LA 2EH8L 5E7BA 4KJWD 4KOCA 1PDKB 2HLAB 4DTGL 1VGEH 3BKYH 2ERJB 2LFEA 5E56A 4YK4C 2A9NH 5B4MD 1BPVA 2D3VA 1EEQA 4IRJB 4DETA 4CMMA 2W0FB 5I6OA 2O61A 4NC2B 5D5MF 4FEMA 4PJ7A 4JPKL 2MCPH 2AGJH 4P2OD 4MYWB 4QXUH 2WXIA 1KJMB 1VGKB 3OKLB 2QELA 1DCLA 3FO1A 5DZNA 4PJFA 4AQ8C 2X1XR 4PJGF 1Q72H 5DLMH 4OQTL 3BUDA 2ZXGA 4X5XA 4F7CA 1FL5B 1GS6X 3V95A 3PFUA 3H0TB 2PYFB 3C5ZB 3ZTNL 4S2SA 1BXAA 2Q3AA 4FQQA 4B50A 4GMTL 3KYMA 4X7TA 5KZCB 1T20A 4ZS6D 5JPMB 1SJEB 5MENA 1Y18A 4BSVA 2P5EA 1BG1A 4AZUA 5KYNA 1J5OL 3QHZH 4BH7A 2D03H 2I9LA 1G94A 2OI9C 4JB9H 1I8MB 1N7ML 1E42A 2VDQH 1I1AB 1INQA 4GW4B 1M7IA 2OCFD 3S36L 1JHLL 1U95B 3X1BA 3P2BA 2GJRA 1RK7A 4Z7AA 3DOSB 4Y5VC 1IAKA 1TETL 4ZPTA 1HSBA 4HJEA 2GFBB 1NSNL 1KLGB 1SY6A 1TEFA 2IQ9H 3EFOB 1PG7X 4DEPC 1OARL 5E2UH 3CD4A 3HC4H 1J1OL 5F6HJ 1EO8L 2H8PB 4ODUB 4LSSH 1KLUA 2HWZL 1UD2A 1MCQA 3N6YA 4L29B 5SWQA 1AYRA 4HLJA 3VYNA 5KYXA 3NCXA 5L88H 5CEYA 1AO7E 5C6PB 2NY5L 1IVLA 3HG5A 1B2WL 4HMCA 2AQ3A 4MS8C 5FR3A 5JA8B 4IRJD 3B37A 4ODVH 3BKJH 3R8QA 3H55A 3BP4A 1AXTL 3U9PL 3TBYA 1WWCA 2X9ZA 1R3JB 3J8F7 1MWAL 3NJHA 4JKPL 3OWEA 3GMOB 4NNXB 4Z3IA 5A7EA 1UASA 4HSCX 3NDYE 2W07A 2CO3A 2HPOA 3MBWA 3ZRCC 3OAUH 4XBGB 5JR1H 4PLKD 3U46A 2Y69B 3C5ZD 4FXKC 1HEHC 3UYRL 1ZCRA 2WZ5A 4O00A 5KZCD 4G7VL 1NCNA 4NWTH 1JXDA 2DLIA 2WGXA 2LU7A 3PAUA 1BSIA 2V17L 4UDUB 4ZT1A 1S9XA 3O6LH 4YDLB 2OULB 3VW3H 4CSTA 3S5LG 1L9RA 4HW6A 4EN3C 1BX2A 5IM7B 5I1EH 1I1AD 2FO1A 1NBQA 4HHAB 4KJWC 3ASOB 5FCSH 3DX9A 5FGRA 4RNRB 1HNGA 3O3DB 1NCGA 1FYHB 4TULL 1HKFA 2M1KA 3IFPB 4R26L 2XT1B 1CC3A 1ZHKB 4PRAA 4BFGA 4DEWA 4FA6A 1AH1A 4ACPA 1JGLH 4ZW5A 2JB6B 4FL4B 4JDVB 3L54A 5L6YL 4L5FL 2EKJA 1SF3A 4NB7A 4ZTOL 3GBLA 4KI5D 3B3IB 4F8OA 4Z7WF 2OK0H 25C8H 2CMRH 3H9SB 4G1MB 4GSUA 4NBYB 4P2OC 4R0LB 5F7EH 1DQQB 5AAMA 2F7PA 1G7HB 4OSUL 5DD1H 2J88H 4N5UA 1FAIH 1ND0B 2CXKA 4GKNB 2J8UA 4HIXL 1X5ZA 3G5YA 3QUXB 5A6IA 3M88A 2BNQB 2Q76B 5IHUL 3Q5TA 2VXVH 1DLFH 2MHAB 3DO4A 1MFMA 4IIZA 1H5BA 4ZS6C 5ESVA 2G60H 3F8UB 4FFZA 4G70B 2W9EH 1XH3A 3E8UH 3DV6B 4ICXA 2RHEA 3KCPA 4PRNB 5K93A 5B1AB 5JHMA 1I4FA 3FFOA 1CFMA 3VJ6B 5IEKB 2XV0A 2ZXEB 3EBAA 3C9NB 4OZ4A 3T2NL 3VXUE 3FSWA 4TUKL 2Z9TA 1HILB 3GSQB 2FO8A 3FSOA 4C4KO 1MSPA 5D2NA 1NUNB 3D4CA 1FAKT 2CDGA 4NNYB 3GS7A 1L0XA 4I87A 2AJXL 1A1NA 4LCUA 2OA9A 5DC4B 2EDLA 3OR6A 2X9XA 2ITCA 1UD5A 2VAAA 4AKOA 2G5BA 2VDLH 4H25B 4QKXB 4RAVA 3ZTJH 4HOWA 3KXFB 1KCRH 1T6VN 1P5UB 3LH9A 1X9UA 3JWDH 3QRGL 4HQQL 3P69A 5DSCB 2P7TA 5TK4A 4GUOA 5H35B 4WY7L 2Y1YA 3WIIH 3NK4A 1A4KA 5EORL 2ERJC 4NENB 5BW7C 4Z0BL 5LXVA 3CN0A 3KEHA 3PU7A 4TOYH 3FTWA 4QHNA 5I28A 5IFAL 2JXMB 4IRJC 3HG1B 4D7PA 1ZDQA 1U8OB 4GKLA 3TC9A 1CLOH 1OSPL 1GTFA 2EDEA 1DVFB 3H9SD 4R5VA 5IJDC 1BAGA 5E08L 1TSRA 5E70A 4JJ5B 1MREL 2OJZL 3J07A 3PHAA 3MOAL 5E2TH 3D85B 4XH2B 1G87A 3AXIA 3IXTA 2AJSH 3QUXD 2BNQD 3D0VA 4PLKC 5FUCE 2BNQE 2COQA 2X28A 3C5ZC 3FOLA 3NZHL 1M7XA 1PY4A 3C6LB 3N1MC 1HE7A 4FQ2L 4OLUH 5JPMC 1NIFA 3H9HA 4L1BA 4UB0H 5AW0B 4NKIH 1G5GA 3OJDA 3EF7A 4HWNA 1T5XA 4L8SA 5KSUA 4JQIH 5I1DA 1H3WM 3V0WH 5GIRB 4Z0XB 3WNNA 4XZUA 2HT3D 3QCUH 1T0MB 2X6VA 1I1AC 5EZLB 4ZNEE 2O6DA 2RACA 1BLNB 3EJTA 3RI5F 5IB2A 1QSVA 1U8PA 4TL4A 3MRDA 3F2LA 4AQEB 5DMKB 4OGYL 1NAMH 3ZX1A 3RDTB 4EI6B 5HD8D 3SPHA 5IFJB 1MQ8A 4RDQF 1OD9A 1MFAH 5F0MB 5CILH 3F58L 3OLEA 4RMSA 5L8LB 5E1QA 4PHZA 1A9EB 3HG4A 4KI5C 3GSRB 4LU5H 2WWMD 3AG3B 3ZL2A 2DIJA 4Q0XL 1FYTA 3KXFD 5FO7B 3ZKXB 5FM8A 3KXFE 3OPZH 4HWZA 2J8HA 3NZ8B 4O2EA 5D2LF 5L9DH 5LJYH 4WI9A 3IMWA 1R46A 2MQGA 3UGEA 5KSVB 1I3GH 4N28A 3BKML 5I5JA 4X6DB 2EDRA 3HG1D 1BVZA 3JVGA 3QJRB 3HG1E 4LLDB 3V4PL 4BA8A 2OBGA 5KVEL 2DV6A 1KENH 2GK2A 3WJLA 1DVFD 3NP4A 2J12B 4L5FE 4X8JA 3PFQA 2ZKHL 3D85D 3I9GL 4FQPA 2JF1A 2ICCA 4LSUH 1YZZA 3S5ZA 2XHNA 1I1FB 3FB6A 4U6TA 3UCQA 5JO5A 1MJ8L 4UINL 5H37H 1ZSDB 4NRZB 4JANA 4AGPA 2IDQA 3C6LD 1GGIH 4HLEA 3KYOB 1AOHA 3EJZD 4GFTB 4Q6YA 2PW1A 1IARB