3UAFA

Crystal structure of a ttr-52 mutant of c. elegans
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
117
structure length
117
Chain Sequence
KTSCLMATGVLKCPTDPEAVKKVHIDLWDAAAAAAESDDLMGRTWSDRNGNFQVTGCASDFGPINTPDPYLYIQHNCPHRDSNATNPIQIDVIPLFLPSIVRLGNVYLDRYLEDYHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TTR-52
publication title Structural study of TTR-52 reveals the mechanism by which a bridging molecule mediates apoptotic cell engulfment
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 25
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2011-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01060 TTR-52 Transthyretin-like family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3330 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3uafA00
3UAFA
chains in the Genus database with same CATH superfamily
5CF3A 3SPGA 3MRDB 2OZNA 1GC1L 1OF0A 1KG0B 3GHPA 2D7NA 5B1JA 3VG9B 3VRLE 1G6RA 5H35A 2H32B 2X9XA 3V4VH 2NPLX 5IMKA 1E43A 4MTMA 1BZDA 3HB3C 1IC0A 5IFAH 3A6CL 2NLJA 2V5MA 5DHVA 2UY7B 1XB8A 4UINH 4AQEB 3VD9A 3NCYS 4H0GA 1BREA 1DR9A 1VEOA 4LDCA 1TT6A 4LOEA 2VMDA 4YSPA 4RMRA 1MJ7H 3SPCA 4K94C 4XNUH 1P7HL 1ED3A 1ORSB 4Z9KB 5LCVL 2VR9A 2G5BA 1KCRH 2ZX9A 1OE1A 2DQHL 5C07B 3WIHH 4ENZA 1AE6H 1NBYA 2ZOLA 4RCAA 1LDSA 2W60A 4BK5A 1SHXA 3IETB 1ZPLA 1OSEA 2LQRA 3FFCE 3B8YA 1KJ3L 4D0BB 4DIXA 4W4OA 4BINA 1JPST 4GAJH 1OAKH 2MIZA 1MCKA 4POZC 4POZD 2YLKA 1MVFA 1JZGA 2CKBL 4XPGH 4L9LC 2JV6A 2AXWA 1KOAA 4BUQA 1G1KA 5D1ZB 2FECL 5KW9L 3E38A 2LE9A 2BVYA 3IB4A 3DETC 4HAFA 1LO3L 3DETD 4S1QH 1JUFB 1E2ZA 2FQEA 1KDIA 1OALA 2EH8H 1YCSA 3MU3A 4F24A 4NDMB 4ES9A 5HHNB 4AQ8C 3DBXA 2AQPA 1QMUA 4PWHA 5JUEH 3CSGA 3V2AR 1PZ5A 3KWVA 1MWAA 4TQEH 4MA1B 1EWHA 2C9AA 3NAAL 4JANB 5IBTL 2EYRB 2DQIL 4PJCA 5E94B 2VLJE 4A7GA 3L4XA 5BS0B 4PP2A 1I9IH 5IWLA 1ULVA 4PCYA 3VSTA 1GTFA 2YK1H 2X1XR 3PJSB 3LKQB 3QZPA 4ZXBA 4KITB 4E5XA 5IESH 4OZHB 5EPMA 2AZAA 5BZWA 5H2BA 3D51A 5GS0L 5KSBF 1BW8A 4Y4HB 4WNQA 3MLPA 3ARGB 3G5YA 1N18A 5IHWA 3P77B 3QRLA 3SE4C 2W91A 5CEZD 5CJXA 1CG9A 3HZVA 1CL7L 4HF5H 3FT0A 4OM1H 4JFWA 2F53A 3OSVA 4GG6A 1BP3B 1D6VL 4WY7H 1T2JA 1JMXA 3GJFA 4G1EB 4XPHH 5D55A 5J3HC 5J3HD 1PEZA 2YAHA 1VFMA 4X99A 2AITA 4OZHF 1JF1A 2CO7B 2ZWZA 4O2CB 2IFFH 1JZDC 4NFDA 5FC9A 2ATKB 2C5DC 4L2LA 1QFUH 4XNYH 3FONA 4O9HL 4LESA 1I3VA 4NKDA 4U4IA 4FXGB 2W65A 3EOTH 3HS8A 2Z4TA 4NO5B 4GKZB 2G60L 1BMZA 3T1FA 4J27A 5HHXL 2W9LA 1YNLL 5HGDB 4PJGE 1KF9B 2ZXWB 3LQAC 3DXAB 5FHAH 3ETBF 4Z7VB 1CGUA 5EN2A 1QRNE 4ZG1A 1S5HB 2NW3B 3I3BA 5AALA 4MD0B 3G5WA 4MDIB 4PY8J 2FJUB 3QEGL 3S35L 1NICA 3AG1B 4O51B 2VM9A 3UMTA 1T5WA 3JUZA 3TPUA 3Q5OA 4PCKA 5T5NG 4Z6AT 3QRGL 4KRPB 1UZ8A 1SFDA 2OK0L 2YD6A 3P54A 4EQ2A 1VHPA 4U3SB 5C86A 4NP4H 3DOSA 3X1EA 3M6DA 5C0EA 2WVUA 4Z7VF 4OF3A 1A6WH 1DQLL 2CLZB 3ILEA 4LNRA 3MRGA 2EDHA 4FNRA 1QW9A 4OLVL 4YIQB 1BBDL 4L3EE 1HYRC 1T0OA 1IQDA 5G55A 3V0HA 4FL4C 5EZPA 2YJLA 2XWJA 1H8LA 3EYUH 2H2SC 3JVGA 2H2SD 3QHTC 4J7RA 4OZIB 1NCIA 1FYTA 4CADA 3D39E 4DKEH 1E30A 1KLFB 3D4CA 2FT8A 4JQVA 3CFCH 4MA7L 5LGHH 1KDJA 5E1AB 2F54B 4BKTC 2WQSA 2DJUA 4NZJA 1FPTL 2ZAGA 4EN3B 3V6ZA 1NLDL 1W8NA 3NCFB 5ESVB 5SX4H 1CDIA 4D3CL 1C5CH 1KB5A 1IGIL 1MFCL 2VMCA 3VFGH 2NOYA 2LHAA 3LRHA 4LQFL 2ARWA 4TULL 4FFVC 1ZIBA 2AJUH 4WEBH 4FFVD 5AYUH 3H9HB 1E5YA 2AJYH 5ESQB 2VJ0A 4JVWA 1TQCC 1BIIA 3EAKA 2Z35A 2ZKWA 3APDA 5IJVB 5LVEA 1NCWL 4ELMA 2VZTA 1E67A 3PUCA 1GYUA 1T1YA 5I2IB 4N6QA 2XQYG 2JJVA 1U0QA 1H15A 4IHOB 3MV7B 1N4XH 4K9JA 2YMOA 5I75C 4CVUA 5KVMC 5M7QA 2JXMB 1T20A 4LSDA 1D7CA 2FIKA 4X6DB 1XF1A 4I2XB 2GJ6E 3WFCH 1W0YT 1XGQA 1YEGL 3NZHH 1WA1X 3H3PL 3L7EA 3NJMA 1YEWA 3JWDL 1DFBH 1TETL 4NCC1 1BMWA 3NYKA 2Q8AL 1G7HA 3FL7A 3RB7A 4BH7B 5C6PB 1HESA 2LOEA 4JM4L 3FQ4A 1C8PA 3MUY1 1FZOA 1UB6A 1WUZA 4YEEA 5ANMB 3QDJE 4ZFFA 1XGRB 2VSKB 3CXHK 2EDDA 1XQ4A 3UYRH 4HG4K 1J1XH 2DTML 5ABDE 2D3LA 2QKIB 4N24A 3NIDE 4MXQC 4RNRB 5AW0B 4MXQD 2WOBA 3WMPA 3VD3A 4BFIB 5I17B 3US1A 2VC2B 1JS4A 2FZ3A 1HKLH 1MJJB 4X6DF 2AV7B 4BWTA 5DD6B 4HKJA 1PNDA 1FHNA 3KVDD 1NKRA 4WTZG 1GC1C 2WUCL 2MCMA 1YYLL 3W56A 4CC4C 2Y06L 2IWKA 2X0WA 4C4BA 1GZQA 1R3LB 3QWQB 5D7JD 5TQ0L 1DCLA 2VQ4A 3D4GA 1GPOL 5ILTL 3FUMA 4HLJA 4HFWA 1PU0A 2IVFC 1AG6A 4N5EC 2VXTL 4N5ED 1L0YA 1DLFH 5J11C 2DTSA 1BAFH 2EVJA 2M2DA 1ZSDB 1SF3A 3EJPA 1QLRA 4ERSH 1GIGH 2E7LA 3WXVH 2R29H 1F3DH 4XNBA 4LSUL 3ZE0E 3P4OA 1S3KH 1XCQB 3FQXA 3BAWA 3M46A 4OCYH 1MLCA 3B5TA 1PX3A 3HVDA 1YYML 2KPWA 4JUTA 1GY2A 2ADIB 5KVFE 5F1NB 2CRYA 2D2OA 3KDMA 1U8QB 4HS6A 2WP3T 1CURA 1YPZA 3WKML 3ZMEA 3MV9E 4H8WL 3D2UB 3BFOA 2R1WB 3BVNB 3KVQA 1P53A 4F33B 4W6YB 3UPRB 1QKZL 4G6JL 1Z6JT 3JTSB 3EXJA 1T5KA 1J48A 3ZYZA 3T0EE 3DA0A 3LPOA 1R9FA 5F89B 2W94A 4R26H 2D03L 4LLMB 4JKMA 1YN7B 2FEEL 1QR1A 2FAUA 4ZTPL 1ONQA 1G9MC 2YSSB 4LVNC 1NCCH 1A0QH 1E5CA 3PQYD 1HOCA 1REIA 2BM3A 1NM9A 1G7IB 4M3KB 4F2MA 3IAQA 3W57A 5E9DE 1HTYA 4M1DH 1NCGA 1O6VA 5EIIA 1M6OA 2QGDA 5TF0A 4BJLA 1YMME 4EEEA 3MO1B 3U0WH 3OR7B 3CVBA 1FDLL 1DVTA 4ZUVA 3E3QC 4BV1A 1RKRA 5F0MB 1AD9A 4N9GA 3SJVE 3S97C 1DVUA 5GS0C 5GS0D 2G2NA 4GQ9L 4YGAB 1CFTB 2I07A 3CXDL 3RI5K 4B53A 4JDTL 2BIMA 3L3OA 2NCMA 3FCSA 4G8AC 2JB5H 1W0VB 4XP1L 1NAMA 3C6SA 3QDGB 4FX5A 1WTGT 4PBVC 4TOYL 2B08A 4LIQL 4QRTB 1RVFL 1KIPB 1ZT7A 1H3VA 4I0CC 2H26A 3VYNA 4WJ5B 4JFOB 1NUNB 4UM8A 2KQNA 3TBSA 4AYDC 5HY9A 5EU4A 1TZHA 2F19L 3IKCB 4RMUA 3BEVA 5F1OB 2BZ7A 1SBSL 3BP5A 5E0QA 2K6YA 3FO9B 1INDL 4FTVB 2K7PA 3QB7C 2WO3B 4JZNB 4ZUWA 5DXWA 1GW0A 2YD1A 3CFTA 2YN3A 2NNRA 1DZ0A 4DETA 4NPJA 3QR2A 3TBYA 4G7YL 1U8MB 4WKZB 3WHXA 4ZNCD 3DTUB 3KL5A 2YD8A 1GYVA 1IBFA 1AZUA 5HHVH 4XHJC 5T5NF 4XHJD 4UAOC 4JPKL 3NN8A 2WXLA 1LEGB 2YZ8A 2GITA 2RR3A 4M4PA 1T7WA 2BNQE 5FUOL 5ICZA 1J9TA 3APFA 3D6GA 4P5MA 4YFLI 5DD1L 4C47A 4DGIH 3FB7A 4GUPA 4NO2A 2HFTA 4X80H 5CS7A 1P4BL 1C5DA 1VCBC 3PYCA 4WFFD 3L1OL 3KYKL 3JV6B 4DUXA 4NJ9H 2J6WA 1P1VA 1UWYA 4PGZA 2GTWB 4N2BA 3U6XS 3QFJB 1A7PH 2NW2A 5CP7A 1FBIH 3OKEA 3MRBA 4NHCH 4JFXB 4YDVA 1LXMA 3PCYA 2X38A 4OIIL 1U9KA 1KLGA 4ZO7A 1VFAB 2VH5H 3JZYA 3L9YA 2HKHH 4GS7C 1KCSH 4MXVE 4BZ1A 4U1NB 1YEFH 4OD2B 4YX2L 3SKOA 3K8MA 4K3GA 4H25B 1X5AA 1IV8A 1WEJH 4P57B 3MR9A 4DERA 1QSEB 3QCTH 1CICD 2QSCL 4C4KO 1I8IB 4Q8BA 4NUGL 2P4AB 1FIGL 3TBVA 4I1NB 1T04B 5E2VH 4K5NA 3FB5A 4S1RL 1JE6A 3H9SE 1LWJA 1X5HA 1ZANH 5CLWA 3ZZSA 1MFBH 2D7PA 2OQJB 3AGVA 2HJLA 2W07B 1DSYA 2PXYB 2APTA 1BFSA 4XXCC 2BC4B 4APQA 5AKTA 1GR7A 2CUHA 2WLKA 4FJYA 3K6FA 3BD4A 3V5DA 1F4YL 4I9WD 5H94A 2CDEB 5D7LB 5KZCD 3ZO9A 3MRDA 5IHUH 1GZPB 1L5GA 2RCSL 4NM4H 5HHQA 3SGKA 1A7RH 4XN8A 4AW4A 5LGYA 1BOGB 3OGOE 1AJ7L 1JIBA 3VXRB 3V52L 5HSFA 3FBQA 1NANH 3ECQA 2EVHA 4N2KA 3MCYA 4TPRH 2H32A 4QXUL 2XPGA 4ZX3A 3O2DH 3VXMB 3QIUC 3QIUD 1Z9NA 4JO2H 4N2EA 3ZZQA 4AQEA 5IHZA 3UTPE 5EF1A 3SDDC 1AQ8A 1IFHL 2GI7A 3SDDD 3H42H 2I9LB 2Q8BH 5I1GL 3UMNA 1FVCA 4LP5A 3U36B 4DPBX 1OVZA 4PJ9A 5C08E 5ADOH 1HYSC 2AAAA 1HYSD 1W80A 4OGZA 3PABA 1N5YH 1UH2A 3HMXL 4GG8A 4NSKB 5B3SB 1Z3RA 5HPMA 5FYJH 3BXNA 2QQQA 5DJ0B 1Z3GH 3RKDC 3TOPA 1KC5H 2HH0H 3RKDD 4BKLB 3ALXA 4HUNB 3L48A 1SEQH 4LPWA 5EHFA 1CPUA 3C5ZA 4LZKA 5SWZB 5KS9B 4D0CA 4ZNEE 3AB0B 2HUHA 2O5NA 4YHKH 1SDDB 1E8ZA 3HZMA 3UTTD 3IJSB 3IKKA 1P2CB 2X4NB 5HHMD 4NUQA 2FLMA 1OZUA 3OPZL 2DYPD 1SMDA 4LHQB 5FGBC 3KE0A 1FYHB 1RJLA 3MNWB 5D1ZA 2ZUSA 4QDGA 4BZ2H 1JRHH 1XZ0A 3X13B 5CZRA 5FKAB 2AEPH 2X2IA 5E8EA 4S11A 3BE1H 4NN5C 4L1LA 2IDFA 1RLBA 5INCA 4FA6A 2NZ1A 1I8MA 4PRPA 3MGTB 2VERN 3MV8A 4IKJA 1A3RH 1OARL 3OHXC 5KS9F 2A2QT 3V0VB 1FGVL 1Y1DA 1MCWW 1W16A 4XMVA 1E65A 1R3IH 3G6JE 4KO5A 1ZT1A 4X6CA 1ZLSH 2A6JA 2IMNA 1EHKB 1L9QA 1V7NH 3GMQB 5I0ZA 1TG8A 2EYRA 4FADA 5IROD 3FB6A 1JV5B 4PJIA 2ZZUT 4X5WB 5BS0A 2QVTA 2GY5A 3QUKB 2Z8VC 3L5WB 5C09B 5J1AA 3QUZC 4JK0D 3QUZD 3PJSA 3KBEA 2CSPA 2DLIA 4PGEB 5EEUA 3C8KA 5DJ8B 4KOBA 3FHQA 1INQA 4H8WC 4NNXA 5I1EL 4LHJB 3T8MA 4PJHB 4M48L 3UTQA 1CDBA 3VH8G 4JDVB 4XVSL 4L8DA 4BBWA 3RDTB 2HX7A 2WIIA 3EYVB 2OSLB 3HUJF 3BQUC 4Q97A 3BQUD 1NGWB 3QJFB 3G9AB 4N86A 1YN6B 4Q56A 4CL7A 5T3XH 4WW2F 4YHOH 3V0GA 4LSVH 3NDYE 1CF8L 4PIRF 4X5PA 4I1PA 4YHPA 1EMTL 3CUPA 5D7IE 4GRWH 1Z7JA 1KJ2H 1WWWX 2XJKA 3MLRL 1A4AA 4KK9C 1H5BA 2J57A 1CXHA 4KK9D 4FNPA 2XU9A 4JG1L 1S7QB 5EH1A 3RPIA 1ESOA 3DMMB 3IDUA 1MXGA 2Y07H 1MIEL 1F6FB 2A5UA 4M7LL 4PJHF 4ABVA 2ZWYA 4AQZA 1N6UA 1RZIB 4FKHA 4M8RA 2DMGA 3MRCB 3RFRA 4Z7NE 5FLVA 3FN0L 1UXSA 1GAFL 3VGEA 4WHTB 3QCVH 2BIHA 1MJ8H 2BW4A 4YXHH 5AENA 3R0NA 2ZWNA 1B0IA 4PJBE 2EE6A 4N0UE 4U1IB 2WAHA 5EU6A 1B6UA 2PR4H 5HGDA 4YSRA 3VQMA 5IQLA 4IMKA 4DCQB 4HWUA 1UYWH 3HN5A 1BIHA 4KK8C 1TENA 4KK8D 1RULL 4MMZA 4W9ZA 4JG0H 4KDWA 5CILL 3T0WA 4YLCA 3G6AA 2D3NA 2HJFA 1PGRB 1WFIA 2AEIT 43C9B 1DN0B 3I6LD 4WSJA 1SLUA 3UG3A 5EU7C 4N0FB 2IANA 1K4DA 3H1ZA 3N3EA 5IZ7A 4M7JH 1VKXB 4F9PA 3OKMB 1QX1A 3AMLA 2ITEA 2FWLB 3D8MA 4JO1L 4DQOH 4YHYC 4HU8A 1J5HA 1KBBA 4QRRA 5D8JL 5K1NA 2XZQH 1I75A 4PWIA 4M02A 4V2BA 4DP8X 1AKPA 1FAIL 1BVNT 1OXYA 4AGQA 4GSDL 3FT4A 1QABA 2Y5TA 4KQ4H 1U3YA 4P3DA 1R5WB 2BPBA 3U2SA 2L7QA 4WIQA 5D71H 4YIQA 2YFOA 3C6LA 3KYAA 4OLUL 2P5ED 3ULUF 1H6TA 3NGBC 2HFEB 1UM5L 2J7LA 3FYEB 3JWOL 5KBNC 3RFZB 1LE9A 4CVZB 1SN5A 1NM4A 2WO2B 4EO5A 4NO0A 4FG6C 1KGIA 4FG6D 2V17H 4YBLC 2QKSA 1KENL 1XFPA 3GO1H 2XXFA 1HSBA 5DJ2A 4QJ4B 1QBBA 5L6YL 5E1AA 3ESNA 3AROA 1BM3L 5A2CA 2R2BB 2FYYA 3TBWB 1QW8A 2J8UB 2R8SH 3VWKA 2O72A 3LPWA 1D9KB 3FUJA 3VE0B 1JOIA 4ODUB 3TXAA 3BUBA 5EU3A 4OAWB 3WAKA 2DRUA 4JFPB 2PTVA 2YD9A 3BUTA 4HHGA 4IRJB 2R4RH 3KBFA 1WFUA 5F1SA 1W72A 5ESQA 1MCQA 3NCJL 4WDIB 2H1PH 5AOIA 1NOFA 3QS2A 2VR3A 3CFQA 3IWUA 4FQLH 2EACA 4ZO6A 5C0JB 1F3JB 2DICA 3HEIB 1M6UA 2VMJA 1NMCB 2LU5A 3GSNL 2EE0A 3BYTA 2YRBA 1MEXL 3IU4L 1NCTA 5JNYB 2J8UF 1RZ7H 3HR5A 3FU0A 1ZHNB 3M07A 4ZO9A 2EYTB 4XCNB 2VDLH 4TUJB 2JCCB 3UCRA 5TK4A 3LEXB 2X4RB 2Z8SA 1LILA 4M6ML 5GRJH 2V5TA 1IKNA 1O6SB 2XV6B 1A3ZA 3GIVB 5HGHA 4AG4H 4GNKB 4LDOB 2J1YA 5EA0H 3LSOB 3PXJA 2YS4A 2ZKXA 4JFHD 4XAWH 5IVZB 2BDNH 3RGVB 3RIFK 3UTZB 4DK3A 2IG2L 5CCJA 4GAGL 4P8QA 4BH7A 4P49A 2WNWA 1JXGA 5D7EA 2RD0A 1FL5A 5CJQH 1YNKH 4NZRL 1XGRA 2GCYB 4NCC2 3MJ9L 2DJSA 2AQRA 3N91A 4RNRA 5DO8A 5TE7H 5IJCC 4G7SB 3T5WA 4XCCH 1OP4A 2GSGA 2JCCF 1MJJA 3BCDA 1RY7B 1XVSA 3I50H 4WFGE 1BXAA 1A6UH 4YC2C 3VU2A 2UXVA 2BSRA 3QIWC 3QIWD 1WHPA 4G8GB 4HKZA 4XPAH 1R3LA 2DW5A 4MJ4A 3K2UL 3A22A 4ZAKB 2EVGA 5LNDA 3GM0A 5D9SA 4G7QB 1I4FB 1KBGH 4PJFE 1SLWA 3KPSA 1ZE3C 3QUMB 4DEUA 5JMOC 2D0FA 2WLZA 1JK8B 2FO4A 5GISL 2UZYA 3G7TA 1ADWA 1VGEL 3W38A 2ZF9A 4P46A 3EF7A 3ROLB 3RQ3A 2YGPA 5F72S 1MAML 4HT1L 2ZD0A 1OGTB 4D94A 5DURD 3IYLW 2VDPB 5BO1L 4MJ5B 5JR1L 1JNNL 2DQDL 4G6AC 3DRQA 3UABA 3Q6FB 4G6AD 2CCLA 3CH1B 4X2UA 3W5MA 4BSJA 1MFDL 4EI5C 4EI5D 4QXTA 5D5MF 4B41A 1TEFA 3D2UA 3FOLB 3H8NA 4AVJA 1SPDA 3T77B 4TQHA 4MS8C 4JRXD 1WD9A 4MS8D 1C1EL 4UT6H 4M61B 2ADYA 3UPRA 3HZYA 3TV3L 2EYSB 4XBPA 3AREA 1HQRA 2DLFL 4NZFA 1CGSL 5HGBA 3B7YA 4FMVA 1TJMA 3TVMA 4ACPA 3WMSA 1ZTXE 4IGBB 5FOJA 2ARJB 1KGUA 4F8OA 2YUVA 1EJFA 3BKJH 4B0MB 4ALAH 1I7TA 2O6DA 2A4EA 1NFDA 3WU1A 4TRPH 1JHKH 1BEXA 4QRPD 4WU7B 4N6RA 1CD8A 1DE4A 5GZNC 5GZND 3DGGB 3GRWH 3MRMB 3HCVA 4NQCD 5C0CD 5D7SL 2R39A 5BZDB 1ZRUA 5JIQA 2FRGP 4MNGB 2CK0H 1NCOA 5JMRA 3Q9PA 3EADA 4OLEA 3OR7A 4QEGA 3OR6B 2Y4SA 4BH8A 2YWYA 4OY9A 2Z1PA 3MOAL 1DJGA 4C59B 2PPCA 2CLVA 4ZMLA 6FABL 3OWRA 4PRPE 4LU5L 1UC6A 2IXQB 2VSMB 1MFNA 5DEJA 1CFTA 1BVKB 1QFOA 2DN7A 3HMWL 3HE7A 3O9WB 3EKCA 1WE5A 3RGBA 2VQTA 1BSIA 2F6AA 4HEMA 1V54B 5E2TH 3BH8B 3EJYC 3EJYD 1IC4H 1BD2D 1MKFA 1S7XB 4JFOA 3KAAA 5ALBL 4WSGA 5BV7H 4N2HA 2MH4A 5DYOB 2OCCB 4ZQTA 1PJWA 3H3BC 1BVLB 1QNIA 4JRYD 1SGKA 4KXAA 3GTVA 2R59A 1NGZB 2FBJL 1DZBA 2X44D 4KHTL 4PLKC 2F7OA 3FO9A 4PLKD 5TF1L 2DQGL 1EDHA 4Q4EA 3ZGHA 4MJJA 5KSAB 1JVOA 1HHGB 2B1AL 3UX9B 1U8IB 4JR9L 2YJQA 5JIDA 2R56H 3HFMH 3I75B 4RFNC 5B38G 3X11B 3PDOB 3C60C 4JY6B 4AYEC 3C60D 4FQ2H 5JOPE 1LEGA 3HAEH 3V4VA 2BMKA 5D1QA 3CFKB 2NY5C 4W9KC 1PY0A 2P8LA 3P02A 4PRIB 2RIKA 1SQMA 3BUDA 1VESA 1IAKB 3JV6A 3UJTL 4F57H 1CXKA 1HINL 3FQUB 3D0AA 1DVZA 2ZONA 3PGFL 4GFTB 4KNQA 3WIHA 3CHQA 3U0TB 2Y7QA 3ZHNA 1DJHA 1ILUA 3OD3A 5KJ7E 4YH6A 2B2XH 2IH3B 5CSGA 3P3SA 2VLKE 3PIQA 1DBJH 2NNCA 3FFCD 1BV8A 4ZOCA 3F5WB 4AENA 1N59A 4L1DA 1W0WA 1OK0A 5D6CB 1VFBA 4OD2A 1DBKH 1DJXA 3O6LH 3QARA 5C0AA 5K5YA 1XMWA 4ZS6C 5F3BB 4YFLF 1FSKB 4ZS6D 4N2AA 4K7PL 2H1XA 5DC9B 3WHE0 1A6AA 1K72A 3IJEB 1RFDH 1QSEA 4DKFH 1A4JB 4KKRA 1RLWA 4M5ZH 1I8IA 1G7JB 1KTRL 5J12B 5LLIC 3BKYH 3WYRA 2XJLA 2UXGA 4HBQA 1DJWA 4IM8A 5EUOA 4GSXA 1B88A 3GXIA 2EIJB 1I7ZA 3HPJB 1BF2A 2X53A 1IT9H 3K71A 3BAJA 5EEXA 2Z6FA 4K23H 1Y1UA 4ZW6A 3TO4C 1ZK5A 3L95A 3TO4D 3EJCA 1E4XH 2P8PB 3LIZH 1FO0L 2YRPA 1GKEA 5EC1A 3D69A 5LAXA 4Z78B 3DIFB 4Z7IA 1I9JL 3VWJC 3VWJD 2CDEA 2VLJD 2BVTA 3WS6C 1GZPA 3ZY7A 4JFYA 3KLQA 3HC3L 3Q5YA 1CIDA 2OSYA 3OKLB 4ZX5A 4JLRB 1W91A 3MHZA 1BOGA 1MRCL 4L4JA 3RAJL 2I26N 3ISWA 3JBG7 5J57B 4BCZA 2G3NA 3T4AC 4UV4H 2FX8L 5C3TA 4FYTA 7TAAA 2I9TB 2LFEA 1ML0A 3ARYA 3O41B 2JJUA 3P2TA 4F8NA 5B3NA 2ZUXA 5KANG 4F1ZA 1VAHA 1XH3B 3ZE2E 1MY5A 1U3HA 5F7KC 3C09B 5L4JA 1BPVA 1JGIA 1BVZA 2CGZA 2C9QA 3VFVA 2EECA 3G5ZB 3Q8AA 4HXBL 4F27A 3V5KA 4UV7H 3KWWB 3TF7C 4X9YA 5D2NB 1I1YB 1JGVL 4QJ5B 5EOTB 3RL1B 4KMTH 1MCHA 5JA9A 4NRZB 5LN4A 2NY4C 4GAFB 2NY4D 3QVAA 1YY8A 4Y4KD 3GPSA 3L16A 2XNAB 5EIQA 3V7AE 4OB5L 2K0RA 3GB7B 5I6KA 1Q0EA 3D0VB 1YUHA 4BRVA 5T1MB 5ITBL 3X3FL 3BKML 5DS2A 3ASOB 2YPLA 1F3DJ 1OCCB 3WE6B 2LLLA 4RX4D 4Y19E 5DMJB 1FZJA 5H4YA 1WRFA 5CEZH 1UA6H 1GRWA 1SJXA 3FUHA 4JZJB 1J1PL 1HL5A 3HG1E 4KI5C 4LO9A 4KI5D 4IU3B 5CD5C 5CD5D 1NLBH 3QEQB 4J1UB 4A7QA 5T1KB 5D2LB 3FTXA 1QRND 3GSWA 2AXJA 1CXEA 3U1QA 2WWKO 3LPFA 2KDGA 4J3SA 4GXUM 3NFPA 3DX9B 3O6MH 3P9MB 3GTNA 4EJ1C 1RJZA 4FFYH 3Q3GB 2YMXH 4P2RA 1MRDH 4XGZA 4XVJH 5BZZA 3NCCB 1JV5A 1CU4L 2XN9B 3VQLA 1AKJB 2J6EH 5IVOA 2Q86A 2AK4E 3QUKA 4L05A 4K5OA 3AM8A 3OXSA 3LS4L 2G5UA 3FKUS 3SCMC 2BLFA 5B22A 1E3XA 5CEYB 4CILA 3VXUB 5IB1B 4JFZL 2XUWA 3Q1SL 5D2LF 4IIQB 2EH7L 4G7RB 1PYWB 5GS3A 3ESOA 2X6AA 5ISZB 3CX5J 1CI5A 1BX2A 2WV3A 3GF8A 1WHOA 2AJ3A 4K15A 4L3ED 3VTAA 4JFEB 3R1GL 4JDVA 3REVA 1P7QB 2YD5A 3IJ8A 2WAQA 3U9UB 3VO0A 5GGSY 3D9AH 4A2DA 1KIQB 1ZWIA 4X98B 3ZTNH 2R0KH 3GLDA 2X6VA 3D39D 3FC8A 2ZKYA 4MHHI 1JPTH 2GC7C 3Q8FA 2PO6A 1IQWL 1WF5A 2W0KA 4MA3B 4EDXA 1UKQA 1BEYH 4QHLA 4JJ5A 3DV4A 5E6ZA 1S7QA 4AWJC 4LL1A 2WN2A 1F45A 5CHNB 3S4SB 1PZBA 2NMSA 1NFIA 1J05A 1RZIA 3QQ3B 5FCUL 3MRCA 3UO1H 5GGSB 3A67H 4TNVK 4YUEH 2AF2A 3WENA 2LAGB 3UZEA 5HDQL 3PJNA 3HNVL 5LO7A 4EAEA 5CAYB 3UJIL 5G4NA 1TQSA 3L9RB 4U1IA 1I1AB 5EDXA 5AW5B 1JN6B 2XWEA 4LVOC 1MFEL 1EAQA 3OAYK 4RZCA 3S3JA 2BCKA 4XNXH 25C8L 4Y5VA 2H8PA 2WKLA 3PV6B 2FBOJ 3L4ZA 2D31A 4I3GA 1N5AB 5AAMC 3RYMA 4A37A 3JQOB 5A3IC 3HE6A 5A3ID 5I6OA 2ZCZA 1WVZA 2CA4A 2DBLL 2FJGA 1D5MB 2DWYA 1OB0A 4ZZKA 1IAIL 4JMXA 1AHMA 2GJ6D 2B4CC 1T0NB 4BFGA 4KKLC 3L2MA 4G7VH 4KKLD 2D3VA 4EDWL 2J2ZB 5BRZA 4PJXF 1HWWA 2GJJA 2XV3A 1IEBA 2A4CA 5GGUA 5HYJA 1JD7A 3GS0A 3QDJD 3MACH 1WK0A 2IPUK 5J13B 3H2QA 3IFOB 5IM7A 1PF3A 3WNKA 3QJSB 2VLRE 2CKNA 2R0ZL 1MIML 1KXTB 3ZDXB 1FAKT 5DUML 4L8SA 2X89D 1OPGH 5F1IB 3L2NA 1NGYB 3RFZA 1KNOB 4J3VA 1K5NA 1KFGA 1W8EA 2VMFA 2GTZB 4EPSA 2OZ4H 4HGKC 3V0EA 4MJHA 3BX7C 5JW3H 3ARFB 2YN5A 2DJMA 3L3KA 5A7BA 3GXTA 2R2BA 5LKNA 1HSAB 1N7MH 1GA2A 1KJVA 2PYEA 2WXMA 3E9TA 3KL0A 4ODUA 3P4NB 4NT6B 4A2MA 4BCXA 5AAWA 2LGNA 1PQZB 3D85B 1CE1L 3MDJA 1P9MC 1QSFA 4KPHL 3VI4E 1WC7A 2PWGA 5ICYB 5EN3A 4FI7A 1S7SB 3ZKQD 3G3LA 3VMOA 2VITA 2VXQL 4KAQH 1VPOL 1N64H 3O8XB 5DUBB 2EVIA 4AMKH 32C2A 4R96B 2MPAH 1ITBB 1TDQA 4KTEL 3VRIB 1ORQA 5L9DH 3RVUD 3W0WB 1L3NA 2TAAA 2OMWB 3DGDA 3GT6A 3MV9D 3DK2A 4OCWL 4UM9D 2F8VA 3VFRB 4HGMA 4XCNA 1PZ3A 2ERJC 5CSBA 2VDQB 4G6FD 3S37X 2X2HA 1HHKA 4HQQH 4PUBH 1F86A 2B5IB 3T0EC 3T0ED 3UTSA 1AQHA 3BLKA 1BFVH 1OP5K 4LLQB 1HEJC 4FYRA 3BN9C 4KI1A 1KIRB 3BN9D 2C8NA 2X4OB 3RGVA 3PXHA 5KJRH 1DQKA 1WYJA 2EAEA 2IALB 4CDHA 3MJ7B 5ALCL 2DDQH 3OZKA 2EIZB 2QZQA 1YVLA 4X0KA 2ZSVB 2GCYA 1JDDA 1RZJL 3JUYA 4KQ0A 3MGOB 5KW9H 1WZLA 2OMYB 3AACA 4NHUA 5E9DD 5HHOA 2VW4A 1SUJA 1F6AB 5EBLA 4NRXA 2BWIA 1GY1A 3ME0A 2DWEB 3V10A 1YMMD 1C16B 1L3WA 1LO3H 3LS5H 2Z31A 3S3PA 1PSKL 3RIFF 3P11H 5IEKA 3FCTB 4FEMA 4HC1H 3T1WA 3ALPA 1YEIL 3SJVD 4ZAKA 1OB1B 4Y7OC 2WIMA 3GSRA 1T1ZA 1U30A 3MRKB 3MLTB 1G9MH 1HHIB 3PWPA 3LPPA 3MBED 5B3JF 5GGVL 4XP6L 3TIDA 1JK8A 3ZDYE 4S2SB 3AU1A 1FF5A 1SXZA 4XMZA 4GRLB 2AGJH 4QRFA 3I6GB 5JW4N 4KUCD 5EEYA 1M1XB 1B0RA 1M1SA 5F9WB 2J4WL 1AY1L 4LSTL 2DF3A 2QLYA 5K1VA 4V1DA 1OGSA 4QOKB 4MJ5A 1WZ1H 3DX7B 3JTTB 1MQKH 1UOVA 2GUOA 3P9LB 5FX3A 4LLDA 2VDOH 3KS0H 1YYCA 4X7TB 3FOLA 4LASH 3T77A 3WEAA 1QASA 4OLXH 3CVHB 3FBKA 4M5YL 1A6TB 3FT2B 3JWNC 4P2QE 3GK8L 4M61A 4H20L 4PJ7F 4WUUB 3OAZK 4HZAA 43CAB 5BO0D 4I77L 4LL9A 1DSWA 5IQ7H 2BNQD 5AEAA 2C3VA 1D6VH 3AY2A 4K73A 5IMOB 1UASA 4O02H 1AGBB 5T5FH 4AGLA 4P9MH 3HG2A 2E3VA 4ZPVB 3MUUA 1SEBB 4FN0A 2E6JA 4JZOB 5EOCH 2PCPA 3CGTA 4O9HH 2XQ0A 4DGUA 3PFUA 4BHUI 1FRGH 3DGGA 3ZYIA 1LO2L 5DZLA 4ZZFA 4UOW1 1WWAX 4CKQA 5JW4R 1RK1A 5IVXA 2WUBL 2YPLE 3TONA 3VX0A 1OQOA 2GW5A 2FX7L 4NCDA 5E8DH 3Q13A 4R2GC 5B8CC 1JFQH 3HB3B 4R2GD 3OF6D 2XWTA 3B2UC 5D1XA 3BCFA 3B2UD 3OKDA 3TH2T 1U8LB 4ABQA 3V0DA 5GSRA 1NWPA 4IKNA 2CM6A 1E4JA 4Q0XL 2Z93B 4H40A 1MPAH 2YEZA 4G5AA 2YA2A 3BWUC 4FXLA 3WO4C 1YAZA 4A6YA 4LCWE 2OL3B 1WFMA 3O9WA 4AJ0A 4UQ3A 1G1CA 2E27H 3MLWL 2BP3A 3VFPA 4KY1L 4J3OG 4NQEE 7PAZA 2OK0H 1UD2A 3QBTB 3U0PB 4P2CG 2ZKHL 4A7UA 2X4PB 4EVNB 3H9SD 1D3CA 1DQDL 5EEZA 1YA5A 2AJZA 2IADB 2NXZC 2NXZD 1S7XA 4FQJH 3S3CB 3ZHFA 2VZ3A 2AXGB 2Y0SA 4M43L 12E8L 1PX8A 2HG5A 5I1LA 1KJMB 4JB9L 4PRHE 3ZE1B 4NUJA 2WPGA 2Z92A 1PJ9A 4L9LB 4R90L 5KSAA 1HHGA 1U8IA 3R4DA 4QXVA 4JO4L 2J21A 1JWMA 3PDOA 4Y5YC 5IW1B 3S3DB 4MA7H 2ED8A 5FWRA 5JPMC 1WFJA 4GSUA 4MCNA 2X70B 1FPTH 1BM7A 1FYTD 2GIYA 3CFKA 3KYNB 4Y2DB 4A63A 3OX8B 4GAYA 4JQVC 1NLDH 4PJDB 3UTPD 1EERB 4PRIA 5EF2A 3MX0B 4Z7WA 3BO8B 1MFCH 1YC8A 1IAKA 5CCHE 1CDHA 1U8JA 4HIPA 5DLMH 4HHWA 5C08D 4BZYA 1CQYA 2EEBA 2FHCA 3FU7B 4LQFH 4OD3H 1SXAA 4F15C 1FORH 4R97C 5FECA 3BDYH 4E9XA 4Z7QE 2NX5A 3GMLB 3KW7A 3FQWA 2CBMA 2JIXB 3U0TA 1TZGL 2EDKA 2QQKL 2XV2A 4LMQI 5GSVB 4Q89A 1O75A 4LEXH 4RMBA 2C4XA 1F58L 2HPOA 3TYGL 4IS6B 2OTWA 3ZQWA 5BMFH 3U1PA 1MI5E 2B15A 2D7TL 5JQ6L 3VTMA 5F7FA 4C56E 5I1AB 1NJ9A 4YFEA 2AABH 3ULUH 1O5DT 3MRFA 5L2KB 1EHLH 4UBDC 4UBDD 4J3OC 1KXVC 4J3OD 2VZVA 1A4JA 4BZ2A 1G7JA 3WSQL 2WBJB 4NC1E 4O2FA 5KBDA 3HFFA 1XV8A 3H4HA 4NQVA 3TBTA 2L4OA 4G6KH 4AC2A 1E7VA 1QLEH 4MNQB 2MCPH 4XC1L 1ZTXL 4UZSA 3SYAA 4UDTB 3ULVF 1S7UA 4OV5A 2GT9B 4HUUB 1T0PB 1DDTA 1XCTA 4Z7UA 1TLMA 1TOXA 1RSYA 2GBTA 1GS7A 4JL1A 4RDQG 5AZEL 1QP1A 1FFPB 2YD0A 5I1HL 1BYPA 2BFVL 2N4IA 3MJGX 1TVHB 2FK9A 2WUCH 4WHYG 1JNHB 4ZFOB 2Y06H 5EZOH 2WZAA 1IM3B 2XY1A 2QHRL 4JLRA 2X4QA 4PN6A 1HH6B 4ODWA 2JKTM 2ZYSA 4NKOB 5IBUB 4XVTL 2V8MA 4YE4L 1QEWB 1KT2B 4FCAA 3HZKB 3P3RA 1KB9J 2OMXA 2GYSA 4XVOA 3A3YB 1L6PA 1LP9B 2EXTA 3DIVA 5I19H 1J1OL 1EEYB 3F04A 3UZQB 1ECYA 4JO3L 3BIKB 1XH3A 3IEAA 2NUPA 3IBEA 1CFQB 4DVBA 4PJEB 1G7LB 4GKOA 5DJZA 3HRZB 4OJFL 4OZGE 4JFFB 3NG5A 4XP5L 5DSCB 1KJ2A 3MLXL 1PZCA 3QWRD 1UVQA 1KYOJ 3WLWC 4DKDC 3LQZA 3WLWD 4CU6A 4ICWA 4K71C 3B56A 5I1IL 2QR0B 4S0HA 1OOAA 3V5HB 3SDXB 3H0TB 4FLRA 1EFXB 1CDCA 1EO8L 3GB7A 2ZSWB 1RZJC 4AUUA 3B2MA 1IBDA 3EIFA 3G5VB 4UIKH 3WAJA 3FQTB 3DYOA 1J0KA 3NA9L 1Y18A 3SZ6A 4G8FB 2A9MH 3ARDC 2GJPA 4JFDA 3ARDD 4HW6A 5DK0B 5BUAA 1SYVB 1N3NA 3K0WA 3L17A 1O7SA 3VDCA 5AW9B 4DP5X 3F7VB 3BJLA 5EULV 1SOSA 3IT8D 3GBEA 2D03H 2A9NH 3MYJB 1ES0A 4HJGB 4F7EA 1UQSA 3EGSB 5IF0B 4PW3A 2NUTA 5TJWK 3NJHA 1T0MB 3IPFA 2ED6A 4WV1C 2CE6A 3SDXF 2WP3O 3ZT7A 5MI0B 1T1XA 1U8OA 3OJMB 3OB0K 1XMEB 3Q3GA 4R0LB 1EDYA 4Q9CA 4TSCL 4B7IA 5ECJE 3PGCB 4GOSA 3TNMB 2WOYA 2X4UA 4JFQB 4XRCA 3MLUL 1E2VA 1UUNA 1E50A 2XN9A 1AKJA 1TQCB 3D87B 2OTUB 4U05A 3L3HB 3L3GB 3SD5A 1XCXA 1X6LA 3DX4A 1NEUA 4UOW0 4PTTA 2DI8A 2R4SL 3VXUA 5TD4A 3UBXA 2P26A 3T0XA 3V6OE 3WN5A 4JDTH 4JJOA 3ZN6A 3I9GL 1U4FA 4XP1H 4YBHA 4OGAC 4H1LG 3WS3A 1Q1JH 4OGAD 3R8QA 3U9UA 1RVFH 4HKXB 4PLJC 4TNGA 1R34A 4PLJD 3ZKXC 5AVUB 1DJYA 4XZUB 1RK0A 4I1RA 4XH2A 1U6AL 3FUEA 2H6OA 4GQQA 5E56A 2Q7AA 4HDIB 2FO1A 3F84A 2Z8RA 2CJUH 3KPRA 2QADC 2QADD 4Y16B 2DY2A 4AIZB 5DFTA 1EXUB 3GBNL 3THML 4AYFB 1INDH 5AOJA 4KX7A 2F8OA 4KV5E 5CHNA 2ICEA 3S4SA 1L7TH 3QQ3A 4OGYL 1S7VA 3QUXC 3LRKA 4NN6C 3QUXD 4RGOH 2VIRB 1WS8A 4HUVA 3CFEA 4IKKA 5EU5A 3EO9H 4AM0B 3AT0A 3R06B 2HVJA 2ADGA 1DQVA 1EHNA 5A2LH 1A64A 2YAPA 5DD1H 3VXNA 1BQRA 3WXWL 3BEWB 4XC3L 4AYBA 1LQSR 1TJIH 2PNDA 3NJGA 2N59A 1FJ1A 1ZA3A 3OKYA 2AQ2A 3UOAB 1G9NC 3PV6A 5I66A 1F5WA 3D4YA 4PTUB 1H3UA 1U36A 4L1HA 4QGTA 3U7WL 4TNVF 2IOOA 3ETBJ 2FLRT 4R7LA 1IIIA 2PP7A 4DUVA 2ESVB 3QDME 2O5YL 4U1GC 4OIIH 3MRQA 1KELH 2OMNA 3SGDH 3LYRA 1GMEA 4IBSA 4J3WA 4YX2H 4BK8A 2Q9OA 5ITFA 3QQ9C 1PD6A 1W72L 2XG5A 3QQ9D 1A1OA 3QG7L 2ZP0T 4ATTA 4G42B 3MUGA 1S7TA 1KB3A 2E4TA 3TIEB 1K85A 2H3XC 3GGWB 3RZCC 1CXIA 3HLAB 3V8CA 3RZCD 2VT0A 4I18C 4ELDA 3PGDB 3DBSA 3E1ZA 1HKFA 4TVPE 1JL8A 1NIDA 1SJHA 4S1RH 2YMTA 1KNOA 4ZT1A 1TPXC 3DWTA 1YECL 4S0SD 5HJ3A 2H9GB 3N5AA 1N8OE 2LW3A 3OC8A 4YGVB 3ZQ9A 3ARFA 2MRYA 4B9ZA 2DQFB 2R69L 4G80B 1HSAA 5L7XL 2EUXA 4HFUH 1P5UA 1QWHA 4U6YB 1WZAA 4AYSA 1NIEA 3II3A 3IGAB 4I3SH 1D7FA 1F4YH 1ODAA 4F8TA 3DJSA 1GHFL 1OK8A 3UP6A 4G1MB 2RCSH 2V5YA 4MCZB 1JVLA 1S7SA 2ATPA 4MQTB 5IR1A 4LGPB 2EKSA 2PW2B 4PAZA 1N19A 4PJBF 4JVPA 5DHYB 4EE2A 3QK0A 3QW9A 5C8JB 3HI6L 3SGKC 1NSNL 1CLVA 4WTWA 1KBPA 4F9LC 4EBQH 1NMBL 3L45A 2IDCA 2G75A 4PV8A 4RGNB 4ZS7L 5C9KA 1K2DA 1LK2B 1AQKH 3QXAA 1IFHH 1W6WA 3UC0H 4Q4IA 4E68A 4MLSA 5CBAB 4QTHB 2NNAA 3LZNA 4MAYC 4UT6A 1IUZA 4MAYD 4E9YA 3H7BA 1QWNA 2WLNA 3KPLB 4XBGB 1AZZC 4HALA 4FLOA 4XCYB 2DMCA 1IAOB 1WT5C 1TTFA 2VLLA 4K5MA 4LLQA 4ODTL 5H4ZA 5I8EA 2FT6A 2J72A 4DTGL 3N9GL 3RG1C 5IP4A 1MCWM 4ZO8A 2EEAA 3BHBB 4P23C 4P23D 5GS1A 1LO0H 2P24A 2HKAA 4MXWH 2VXSL 4IBQA 2K6ZA 5H37G 1DO6A 1RU9L 4HH9A 1T21A 3UAFA 4Y9BA 3M8OL 3ARBC 3G08B 3ARBD 4GBXA 3QH3A 1YY9C 5FB8B 1YY9D 4XMPL 5GIRA 3QUYC 1D5BB 3QUYD 4HD9A 5B7EA 3STBA 1T3FB 4LLYA 5HYQB 2Y6SC 3FTUA 2Y6SD 1Z9LA 1XBDA 3P73B 4JDZB 3SSGA 2GQHA 4U7MA 4PS8A 1J12A 4P5KB 5MEPA 1B0GB 4TUKL 3U30C 4PRPD 1XGTB 4XCFL 4C55A 4F5CA 3TA3A 4WK4B 4QJ3B 1A14L 1F2XK 1GJWA 1BBJB 2DS4A 2ZXAA 3HVNA 3L1GA 2DQ6A 4OLWH 4TVUA 2RJMA 3U83A 3FPYA 3H2WA 1R5VA 4MJIE 4XXWC 4M8UA 1UWEL 4GRLA 1PIFA 3TWCL 1NDMB 3OG6B 3I6GA 5AVQB 3NRFA 5ID0B 5E5MB 1N8ZA 1IL1B 1AYOA 3GPEA 3GUTA 5DEGB 2NTSP 4IRSB 4J4PA 4L5FL 2CLRA 1NAKL 2WSDA 3CFJA 3DX7A 5DF0A 4MD5B 1UJ3A 2LAAA 1HI6B 1UFUA 4Z77A 3W1ZA 1K3IA 4NZUL 1U8HB 1AI1H 4WW1A 1F4XH 4DGYH 5DZNA 1IGYA 3NJNA 4NOBA 4M62H 2O26U 3SPJA 3CE1A 4HEPA 4P3CL 1A5FH 1RV6X 2EDXA 4ACTA 5L0QB 3S88L 5JOPD 3FU5A 3GMOA 3CDZB 3KXFE 2X2YA 4R4BB 5T3XE 3VNYA 2VDKL 3M1BB 5CNHA 2YIHA 3SY6A 4M7ZB 3CSYA 3LIUA 2ZAHA 3GI9L 4JN2B 3IJHA 4YDJB 4ZPVA 3WIAA 5TE6H 1H5BC 1SEBA 4JZOA 5FUCE 4OI9A 4LEOB 1TNMA 3MNZB 2VZOA 4G9DA 4WI0B 2BS9A 5DJ6B 1KBVA 3ZT5A 2DI7A 5JQHC 4QHKJ 3MNVA 1VCAA 4OCXL 2IDUA 5FYLE 4GRMA 1ZVSB 5C0BE 2VLKD 3PHOB 2BSSA 5CBEB 1X9RA 3QWNA 1OV8A 1TCMA 3KW8A 3FO2B 5CIPB 4KTYA 3VXQA 3QIUB 1JPSH 1UATA 4JHZA 4YAQB 2XVLA 2NY5H 1AZBA 3SDDB 3V7AG 4HUCA 3V4VL 1CD1A 3PWVA 1XCWA 4MMZC 3I02A 1TJHH 2R2EA 4FMKA 5IFAL 3ZXAC 5DK2A 4UINL 4GT7A 1BFOB 1CF1A 1Q94A 3MRPA 3GBDA 4PJFF 2OL3A 4HPOL 2AKRB 2Y1ZA 2B16A 3RTQB 1MJ7L 2XDHA 3U0PA 2HRPL 3CC1A 4XNUL 1BA9A 3WUWG 4JO1H 3AG3B 2IADA 2ZF8A 3O45B 2Z0UA 4F8LA 1NEZA 5D8JH 4ZTEA 3WIHL 1J86A 1AE6L 3BGAA 1FAIH 4M8QB 1IM9B 1X5YA 1HHHB 1I8KB 3LIZA 1ZEAH 2P43B 3N1QC 5HHMB 3SHSA 5KBPA 5GRVL 4L9LA 4OLUH 2DYPB 1HU8A 1CZ8H 4GAJL 1BF5A 4K8RL 1L0QA 1UM5H 3VDAA 4KU1A 5JHLH 4XPGL 3C6LC 3C6LD 3CFNA 3D0LB 2FHFA 5C0FB 4WVRA 1JMZA 2ZIDA 5IW1A 4UQCA 3E80A 5F3FA 5KUMA 3P4LA 2B1HH 1BM3H 3OHXB 3KYNA 4X6FB 1JCVA 1IGTA 4S1QL 4AQ8A 3VFOA 3H54A 5ACZA 3VDBA 4P59H 5M94B 4Q9RL 4FXKC 5F7EH 1FWXA 1OIOA 1JTPA 4GKSB 3FU7A 4M6NH 3LN9A 5JUEL 5HPOA 1EEUA 1KTJA 2A0LC 3IGFA 2A0LD 4TLKA 4QR7A 1FLTX 2XA3A 5GS2D 1HFUA 1IZJA 3BPOB 4FQ1H 2FWOB 4HMDA 2NQDA 5CN2A 5LB1A 3GSNH 1R0AH 1J8HE 3MI6A 4U1SA 2B3IA 3I9AA 1AIFA 1I9IL 4MCYB 2ROXA 2P5WE 1WP6A 2YK1L 1QA9A 1A6VL 2ICWJ 4M93C 5JXEC 5IESL 4JEGB 5JXED 2BK8A 2F74B 5DTFB 1VDGA 4D8PB 5DJCA 3LNDA 4Y19D 2A6KB 2PCFA 2CZNA 3K81A 3VD2A 7FABH 3BZEB 4KKZA 2ADJB 2DH2A 5F6HJ 4HOXA 4HOMA 1EV2E 3NJIA 3Q01A 4ZUTB 3QI9A 2EDWA 1Y0LB 4AGPA 3BAYA 4NUMA 1DVYA 2IG2H 5D70H 3OQ3B 5BQDA 1SOKA 1PLBA 3GMPB 3EGDB 1IC7H 4OM1L 1JXFA 3COOA 4I88A 4NZRH 4HUUA 5JORB 1XF3B 2WB7A 2UWEE 2M83A 3GSXB 4FNLL 1WAAE 3MJ9H 3EJTA 4LAQH 4FFYA 4NM8H 5EZLB 4CC0A 2ZXGA 3AWGA 1A6ZB 3RA7H 1OD7A 3QQ4A 2WVTA 1EEZA 4K07A 3WKQA 2EDFA 8FABB 2VE6A 3CFDB 1QFUL 4XNYL 1O9WA 1JNHA 3N42B 2AK4D 1WIUA 3DX6A 2YXMA 3KDPB 3EOTL 5GJSH 2QMJA 4BYHA 1IAIM 1LE5B 1BDYA 4MB4A 1BPLB 1QEWA 3VYOA 3HZKA 3SQRA 1EAOA 1RZGA 2F08A 3PWUB 4CA4A 3T6WA 3QNFA 2HT3C 1S78C 3UZQA 2G2PA 1A7NL 5CD3A 4DZ8A 1RZFH 1CFQA 1XIWB 1E28B 3NJKA 3AS2A 3OLIA 1A9EB 1AGDA 4JO5A 3SQOH 5BO1H 2YD7A 4F37K 2LTQC 1O7DE 3SBWC 2DQDH 4FHBD 1TQBC 1ZVNA 3EG9A 4N2CA 4Z95L 5HHPB 1MFDH 3UL4A 1SYSB 2OX5A 2P44B 1ETJA 3K8LA 3PRZA 1AXSA 3LOWA 4P4KC 4P4KD 2DZEA 4OFPA 1Z9SB 1N6QL 1A6WL 3Q5TA 4G83A 5IEHA 3PAYA 3B83A 4Q9BA 4G8FA 2B9AA 2X6BA 5DJAB 2EIKB 2DLFH 2ZCKH 4HIIA 3GNMH 3T3MB 5C07E 4N2DA 3G04B 2COQA 4HIJB 3EYUL 4B60A 3AREC 3ARED 1NIAA 2KLSA 3MYJA 4GKNB 4YNYA 4LCIL 2A83A 3EGSA 5DDHA 1UH3A 3TVMC 5CJOL 4DKEL 4XE5B 4EUPB 1ZKAA 3CFCL 3WE1A 5LGHL 1T0MA 4A1RA 1CE6A 4IEFA 5KG9B 4U0RC 1IFGA 3QS3A 1J18A 2CJSA 4L0PB 2RFXB 3I74A 4FQCL 5ECGA 3V7MA 4AJYV 2XN0A 1P5VB 3SODB 3VFGL 4KNUA 1HAWA 4UTCA 1IBZA 5EZIH 4WEBL 5AB1A 1F11A 2AJUL 5AYUL 3AUWB 4JCMA 2AJYL 4YXKL 2WM0A 4S10A 5EOCJ 3WNIA 2CBPA 4KHXH 1FP5A 4LLVA 4IOSA 4LU5H 3HMWH 2VLRD 1ETZA 4BFKA 5CZVL 5KSBE 2B59A 1X5JA 1YHPA 5EBMB 4HZLB 5AW7B 4AZ8A 2Q20A 1N4XL 2H1LM 3MJ6A 5I0VA 2ZNWA 3MUHL 3T65A 2B4CH 3LXUX 2OZ4A 1J8KA 3WFEH 5ALBH 4UB0H 2XIDA 1XXDC 3GEFA 3I6KB 4KK6C 4KK6D 3NZHL 5DT1H 1N0XL 3RWDA 1ID5I 4YHIB 4IK7A 2EC9T 3EXLA 4Y5XC 4OZHE 1DFBL 3GI8H 3BP6B 2EE2A 4LRNH 2DQGH 4A2HA 2AJSL 4H8PA 5IK3B 3RVXC 3ORJA 3RVXD 1CXFA 4QD2E 5MENB 4HIXL 1HXMA 4H0HB 1KYDA 3UYRL 4BSWB 4M6OL 1J1XL 1CMOA 2BS8A 2MEJB 2PPDA 3L7FB 4ONHA 2YGQA 5DS8A 4CC4A 3DRTB 1HKLL 5B1CA 4JQIH 4ZOAA 1FFOB 4DPRA 2HLAB 4LCVA 4ISVB 3X12B 5D7JA 2VDRH 3BWAB 2XFXB 4NWTH 2YARA 4KKAC 3G5XB 3WFZA 4KKAD 5FDWA 3UCQA 3ARRA 2F8IA 4BUHA 2DV6A 4MDJB 2Y7OA 2VL5B 5FOBA 2R2HA 1QFWI 3C5JA 3OKOA 1C8QA 4W9GC 1SDYA 1TTUA 1R3JA 3QXVA 1NFKA 1QI4A 4XB7A 2OM5A 2PYFB 4XP4H 3Q2CA 1UGNA 2MTPA 2W9EL 2NQ3A 4TV3A 5G4MA 5DGQA 1DLFL 2XKNB 4U4BA 5DURB 1X3DA 1BAFL 4AMWA 5FGCB 4ERSL 3EUUA 1GIGL 2CMRH 1DUYB 2R29L 3DXAE 4RAUB 3E6HA 5KVFH 2XQYA 3OPUA 4Z7VE 4KMQA 1S3KL 2F18A 2CKBA 4YR6A 4OCYL 4MASA 4CGUB 1IGJA 4DAGH 3K72B 4K8RC 4G42A 4K7PH 4K8RD 4PRDB 3TIEA 2ZOKA 4UT7H 4EF3A 1CK0H 2YAOA 3EJZD 4YQXH 5GGRY 4HJIA 5I16B 3O3AA 1WUNT 2YEQA 3T4YB 2F9BT 1LD9B 5E4EB 1FVDB 3IXAB 4PS7A 1N0LB 1I1FB 2E6QA 5B1BB 1PIGA 5IV2B 5JHDB 2DQFA 3U9WA 4R26L 1FO0H 1BZQK 1S9VB 2ICES 3PQYA 4QRPB 1JCKA 1NDGA 3IGAA 5J06A 1PS3A 2WSKA 1A4CA 5C0CB 1TYEB 1ZDQA 4PV9B 5GGRB 4WTZA 1QSZA 3NCEB 1OW0C 2MJWA 1RAMA 4DEPC 2VABB 1B9KA 1N9PA 3OV6A 4P2OC 2UY6B 3I2CL 4P2OD 4NERA 5DVNA 1CYWA 2WBWB 4OZIE 1DUZB 4M1DL 2EUWA 3RWFA 2VR4A 1XWVA 2ZE0A 4H0LC 1HILB 1QVOB 4FI6A 1J0HA 3U0WL 2F54E 3L1EA 1XF5B 5DYFA 1YEEH 1LK2A 2OV0A 1S9XA 2FGWH 3QG6B 5AB2A 5I18L 2BHZA 1FL3B 1CFNA 3JV0A 5FWQA 4DF9A 5AG8A 3QO0B 5HTSA 1U91B 1IC1A 1JYXA 4P2QD 2LLGA 4LKXB 1I7RA 4R4ND 4Z0XA 2OMZA 4TLSA 3PHAA 4XI5C 3D3VB 4FLQA 4OF5A 2JB5L 4FF9A 1MJUH 1U3HC 4XCYA 4ZYKA 1U3HD 2X9YA 2XQBH 3SD2A 2BSCA 4B6ZA 4O02A 1KPVB 4ZUSB 3EBHA 4U3HA 3DUSB 2RALA 4HX1B 2WLIA 1BQHB 5T5FA 3SDAB 3X1GA 2FWSA 5IUSA 1XZWA 3VFTB 4UTBH 3KGRA 3P30H 4A7VA 1UZGA 1NC2D 1ERNA 3D18B 5ITBH 2WKOF 3X3FH 4AQAA 4A55A 1DQTA 4GEJA 4LRIC 5EO1A 5DZ9A 3MV7E 3BPLB 1QHPA 3GC3A 4P07A 3H6AA 4U1HB 4RFNB 4X6DE 1HDMB 3J2PA 1G7QB 2YPLD 1WDAA 1KPUB 3C60B 3M1OA 4MQSB 4KKPA 3GMNB 4MWFA 3WIFB 4PJAB 2D4DA 1T3FA 3LNEA 5HHVL 3FTWA 4S1SH 5DQJA 5EMYA 3BZ4B 2HVKA 4Q9QL 4W9CC 2CBOA 3SY0B 3N40P 2C1OB 4DGIL 3LZPA 3ABLB 5ANME 1CGTA 2DKUA 1IBGH 4LCWD 3BJ91 2VNCA 4P48A 4KDVA 4FZ8L 4MA8H 4OZFB 2YBRB 3KCWA 5AYTA 3K5RA 1ACXA 3POHA 4NQED 4NJ9L 4PBDA 1S6NA 3K2IA 1FBIL 2P28B 2E4FA 3CXHJ 4NHCL 3W9EB 4HG4J 3FTYA 5DEGA 2VAAA 3PS6A 4UU9B 3NSXA 1DN2A 4PRHD 3F8UB 3LRSA 2N56A 1OAXH 3R18A 4O4YL 3X1BA 2VH5L 1LK3L 4CNIA 1A02N 4UILL 1KCSL 1IKOP 4RIRA 5HD8C 3I9IA 1CICA 2EICA 3OHMB 1AMXA 2X1PA 2DI9A 4N0YL 5JDSA 2YPKA 2Y6TE 2VM3A 3NFNB 4X4ME 3DROB 3QCTL 5F88A 1FFTB 1LMIA 4HK3J 4JKLA 1Q9KB 4N2FA 3QPKA 4L4VE 4XO9A 1X5IA 9CGTA 5EO0B 4R7DA 5E2VL 4N8VG 3O3DB 2PO6C 2PO6D 4Q2ZA 4YDJA 4HHAB 4K9EH 2FLBT 1MFBL 2CIIB 4OBRA 5CCGE 2K8QA 4ZFGL 4M00A 3ALWA 3ZKMC 3ZKMD 4NNYA 5DJ6A 4EN2A 4G9FB 4HPYH 1J87A 4EQ3A 3HG4A 4YE0A 3D07A 3F58H 4BXVA 4OQTH 5HYSB 3S96B 1J0ZA 1NA8A 4CBZA 1IX2A 3BLPX 4NM4L 2CDFA 1MFEH 3FO2A 3K0YA 1A7RL 1MI5D 3HZ3A 3LKPA 4JM2B 5FIEA 1CFVH 3WNOA 1JZFA 3MOQA 4FQIH 4C56D 3SDDA 1HS6A 4TPRL 3FRPG 3P0VH 3SGJC 2GG1A 3O2DL 3F65A 1AXTH 3LKRA 3DPDA 3L81A 4JO2L 4Y5VC 1IAIH 4ADGA 1GS6X 3MKGA 3JT2A 3LCYA 4GMTH 1NGXA 3H42L 4Y1AB 4PI2A 2AKRA 3DSFL 4WWKB 4DT2A 3ZDYF 4NKIH 5ADOL 3KJ4C 3L5JA 4KTGA 1LYQA 3I85A 1N5YL 2HKFH 1PX4A 1THAA 5BRZD 2NY4B 4J5VA 3ZMRA 1JGUH 2WZPD 4JM2F 1J0JA 2JB6A 4Y2OB 5IIEA 3CZFA 1Z3GL 3RWIA 1HHHA 1MW2A 4DOHE 5E8OB 1FFQA 3UTTA 1HL8A 3ZT6A 1RUQH 3OJVC 5C2UB 2R0ZH 3CPLA 4YHKL 1XR9A 1JYNA 5DUMH 5FGBA 5A2BA 2IFGA 2E47A 3A4AA 4J3OH 5FGSA 4Z3GA 4CJ1A 4A2EA 1RHHB 3QDGE 3D0LA 4PJGB 3HC0A 4L8SC 3VFSA 5FK9A 3FMGH 3TCTA 3FAWA 1SHWA 3JV4B 4YS4A 1INEL 1OCWH 3IVKA 4HS3B 2AEPL 5DK3A 4U6VL 2L3BA 3BE1L 4S1DC 4F20A 4S1DD 4AIEA 3RJOA 3MA9H 2PWFA 1D6EB 1SLVA 3QYMA 1ADQH 2EQDA 1A3RL 5A7EA 3U46A 1T66C 4FTVE 1CE1H 1T66D 4KPHH 4RMTA 3PPEA 5IROA 4DW2L 1HCZA 2OMBA 1S9YB 5AAWC 2FWUA 2E9JA 1VZGA 1ZLSL 2H41A 3H9ZA 1U95B 1P6AB 3BVUA 3ETSA 1PY4A 3BFWA 2KBGA 4FQQA 5J6GB 3SCMB 1PG7W 4HU2A 3RURA 5ID1B 3QFGA 1ZGLB 3QUZA 1S5IH 4AGMA 3MXVH 3HKZA 1I8UA 5GZOC 5GZOD 2WXNA 3AFLA 1KIUB 4MCYA 1WIOA 4J12A 1FI8C 4Y9GA 3RWEA 2CQVA 4URTB 1BECA 1JGEB 2V7HB 3BD3A 4YDZA 1D5ZA 4AXWB 5IFJB 4HS8H 4GQZA 2B14A 4F7TA 2A99A 1PDKA 1P7BA 1NC4B 3DDGA 3BMVA 5DTFA 3NJFA 4IBZA 3O3BA 4BDVB 4QIRA 5CLZA 3DTXB 3DX8A 3QFJE 3VB9A 2A6KA 3HS9A 3VXSE 3BQUA 2MHAA 2XTJE 4JE0A 4HWBH 2A6DB 3EFDL 4E42B 3HHRB 4QO1B 1OAQH 3AY4C 3FQYA 3QRFM 5CLXA 1HIMH 5EUKB 1SNRA 3P69A 4R8WH 2XTLA 5KUKA 1S9WA 3GMRB 4KXZH 5K9KB 1PCXA 4MS6A 5T3XL 4YHOL 5IB2B 4LSVL 1S7WB 1F1GA 3L4WA 1IBBA 1AC0A 1Q72H 3VSUA 2Q3AA 3FRUA 3A6OA 5J6HA 4AGNA 1IE4A 2QV2A 1RZJH 1ACYH 1UM6H 2NDFA 4F1SA 5FFLA 3IPBA 3RUGA 5DRZB 2Y07L 5HGAA 2IQAB 4PS3A 4R5TA 2OJEB 4WJKB 5JTWA 5FYKE 4J23A 2CUAA 1NPNA 2WNGA 2V7NB 2ZG2A 4V33A 3QCVL 4YXHL 1MJ8L 3TO2A 4GI6A 1TUPA 3LKOB 1PKQA 2QQNL 4LVOB 3SKMA 1ACZA 5D5MA 3RY5A 5DZOA 2PR4L 3EYFB 3MXWH 4YDLC 2Y3NA 3M45A 1D5IH 1NZRA 3V6OC 2HT4C 1IGCH 3QNYA 1OGAB 2HT4D 4OTXH 5E2WL 1UYWL 5F7DB 5KWYC 2P7TB 1UWGL 3PWUA 2P42B 2VDMH 1UB5B 2ZOOA 2IAMB 3T08A 4WHYH 3EJSA 1AP2B 5D7LE 4MQ7B 3WTUA 4FABL 1H3PL 5JOFA 4XWGH 3B9AA 1WBZB 2J4WH 1AY1H 4OJYA 3NSJA 4LSTH 4FI8A 4PRBB 2TRHA 3VXRE 4M7JL 4IBWA 3S36H 3PHQB 3C6EA 1E42A 3IJ7A 3O2VH 3HPLB 3VXME 1AGEA 1SYSA 1E7UA 3VH8A 4O00A 3PAZA 1B4RA 5DJYA 2WTPA 2XZQL 2ARJQ 3NUKA 5CZXC 3NEXA 3QZWG 1NINA 5CZXD 1RD6A 4MBRA 2P5EA 1WGVA 1N6VA 5AD0B 4YJZL 4FQHB 3MJWA 4U6HB 2K45A 3QZBA 5JLZA 4PHXA 3GDBA 5HVWA 5B39B 5LXVA 4F37F 2CGYA 2EDOA 5JA8B 2PPEA 3H56A 1VFOA 2V17L 1ZHLA 3GO1L 5SWZE 5KS9E 4PREB 1TF4A 1KTLA 4OUUA 3ATBA 4NOFA 3N85H 5E2JA 3Q6GL 1E9PA 2O61A 2AXFA 5SWQA 3VI3B 3ARSA 4ZFQA 2LVCA 4XMXA 5KYWB 2R8SL 1LO2H 2DQJH 4OJDH 4Z3EA 4NI3A 1F6LL 2WUBH 3QDMD 3WIIH 5KYNA 2PWHA 2Y25A 3FSAA 5JIKA 4XB3A 1VEMA 5F8QC 3RBSA 1FGNL 2R4RL 1XT5A 3LAFA 5F2FA 3KHQA 5H35B 1G6RB 1KCVH 2H1PL 2W80C 5IMKB 2IPTH 4Q0XH 2P1YA 3NK3A 3UG5A 2W59A 4UM9B 1R47A 4K7FA 2NLJB 5DHVB 1G9NH 3W39A 4ZMVA 5KYUA 3VI3F 2ERJB 4G6FB 3MLWH 4Z1PA 4KY1H 4WO4C 1RZ7L 4X9HA 4WO4D 4ZMZA 5E6UB 3HUJE 4DKAA 3T0EB 4JKPH 1UD6A 2VDLL 1YG9A 5KYXB 2UVEA 2XLLA 4ZQKB 3QR1A 1NBYB 2G9HA 3I6KA 3VGHA 4AG4L 5C09E 5C71A 2NY6B 4IYKA 1JV2A 4ZTOL 2WZ6A 2JQMA 2CRMA 2RQ8A 4XAWL 3SDYH 2WLJA 1JGDA 2BDNL 4KROD 3UGEA 3K1KC 3Q2NA 4PJHE 2HP4A 4E41E 1UACH 3LZLA 5CJQL 4XN9A 5D1ZI 3OAZH 4H1LH 1YNKL 2JCWA 1A3LL 4JGUA 5ENWB 4BA8A 3CDCA 4EI6A 2Q6WB 4YHLH 4ETQA 3MCLH 1EGJH 2V5RA 3MRJA 4FULA 4JO4H 4QAMB 5TE7L 3F12A 2M1KA 4RGMC 3DRTA 4XCCL 3QIWA 5CR1A 2CPUA 2HLAA 2GJZA 4KVCH 2D0GA 1A6UL 1DVFC 4J3TA 1DVFD 4JS7A 3KPPA 5T1LD 3LN4B 4QGYA 4QXGH 2HPTA 4MDJA 2OW7A 3DBXB 2Q7NA 4LCYA 5ABZA 2JKNA 3HMXA 4C4UA 1MWAB 1KBGL 2G2RA 1TZGH 5E9AA 1T5XA 3AXLA 4PJCB 1ROCA 2F5BH 2CO1A 4UDUA 1GJUA 5EO9A 1BGXH 4ABWA 3K7UA 4PP2B 4RAUA 3S37L 4XE0A 5FLUA 1ZHKA 3V9EA 1X5XA 4ZXBB 2Q3XA 4E5XB 4EI5A 3KEHA 3C5SB 2HFFB 3K72A 5BZWB 5E51A 5H2BB 3RWJA 2BRRH 4JRXA 4JY4A 3HKFA 4Y4FC 5C6WH 4Y4FD 3ULUE 1NOLA 4AOFA 3L4CA 2MOQA 3G5YB 4DN3L 3CZEA 4LXFA 4NKMB 3T2PA 4NQUA 3FQRB 4TLTA 4FG0A 4I13B 4PJCF 4UT6L 4A7GF 1CG9B 4OFYA 3HZVB 3VM5A 1N0LA 2F53B 1VZIA 1WFNA 4GG6B 2E9GA 4M1GH 3GJFB 2WK2A 5I26A 3AG4B 3ILDA 4F7PB 4X99B 4PB9L 1JF1B 5AZEH 3U48A 4QRPA 3BKJL 2BFVH 3PNWA 4ALAL 5GZNA 4LHUG 4NQCA 5E4AA 4FKEA 4KH2A 4XNMA 4MJID 5CM1A 1PZAA 4TRPL 3FONB 4R7NA 3UGXA 2IBZY 3NZUA 3GRWL 4Y88A 2SODB 2AQNA 5DRXA 4N9OB 4OSUH 3T1FB 3MTRA 3QZLA 2ZXCA 5ERWB 1HILA 3DX2A 3FXIC 1QVOA 3VJ6B 4GG6F 4YSTA 5EN2B 4JHWH 4PU2A 2YKKA 2J8UE 1CDJA 3WO4B 2Y72A 1J1OH 5GJTH 4L1SA 1A7OL 1T5WB 1Q0YH 1TZOA 1KGCE 3TPUB 3S8GB 1BD2A 2DWTA 3CQFA 4PMEA 4XP5H 1JZ5A 2F8XC 3ZLQC 3KXFD 5JQIB 1UZ8B 3T6ZA 5T3XD 5E2TL 1NCUA 3DUSA 2A7BA 2YOCA 3QHFH 2APWA 4JRYA 4HD5A 4PS4H 4KRNA 4L23A 1XEDA 2NYKA 5C0EB 3L4YA 5D96C 1MCPH 4X8JA 4WENB 5BV7L 2GVYA 4X9GA 3ZL2A 4NIKB 2DMKA 1UA3A 4LNRB 3MRGB 1RSFA 3NA9H 1AYRA 3P4MA 2F5AH 2F7IA 4XMWA 2BP0A 3K6SA 1CUOA 2CH8A 1DP0A 1BCIA 1AR1C 2JCCE 1AR1D 1IQDB 5IJDC 4YL9A 1OWWA 4NN7C 5LQBH 1ASOA 2XWJB 2BJMH 3VD4A 3GMNA 4R7VA 2R56L 3HFML 4HISA 4W9FC 3X1NA 1FYTB 4CADB 2HYMA 1RIUH 5HJBA 3BZ4A 1OHZA 4FQ2L 3SY0A 4IDLA 5EDSA 3FYIB 3VFUA 1LEIA 4LHUD 1JPFA 5H37H 3V6ZB 2VO5A 3KYMA 4R97B 1IILE 1KB5B 2J55A 3T04D 2GAZA 3UYPA 3BGFC 3ZBMA 3MLUH 4F57L 2KKQA 1JD9A 4DN4H 4WI9A 1F13A 5D72H 3NP3A 3FFCA 3W9EA 3GZOA 5JYLA 2R4SH 4DGVL 4TTGA 1TNNA 5GPRA 2B2XL 1MHHA 2B1OA 3EHBB 4G8GE 1FG9C 3RNKA 4WO0A 1DBJL 5AW1B 3FHEA 1YLBB 4ELMB 5A43C 3BZ5A 4OI7A 1D5XA 1T1YB 1OO2A 4X4YA 3I9GH 1BYNA 1H15B 3O6LL 2JJSC 3WN5C 2KPNA 1FCCA 4HV8B 1T20B 5FV1L 2ZCLH 2FIKB 1RFDL 5CKAA 4GY4A 4M5ZL 3EH4B 1JSYA 3ERXA 1S7RA 4HIQA 1XGQB 4WCYH 3BKYL 2O5ZH 4Y9CA 1Q9KA 5G5DA 3L7EB 4XP9H 2LV4A 4EI0A 5LBSH 5J56B 5TFSL 3SGEI 4ZK8A 3RX9A 1G7HB 1IGFH 3Q48A 4IMLA 3N43B 3TO4A 1NBQA 3NJLA 1IT9L 2ODIA 4ELMF 3TNNA 2ZT9C 1UB6B 4K23L 3HR6A 4OGYH 3UIYA 4ZFFB 1ZAGA 2YAEA 5LAPA 4GAAA 2VLJA 3VWJA 2ICEC 5B38A 4GSRA 1SHSA 4FFZH 5E99H 3WS6A 2AEWA 3CZSA 1IB5A 1NPJA 1Z1WA 3QORD 2FZ3B 4HKJB 5E8PB 3KBHE 1KYAA 2FJSA 3TT1H 3GSNA 1WG3A 3WXWH 4KO9A 1FNLA 5FYKU 3SO3B 1J8HD 5FO7A 1YQ2A 4EUPH 3TBCA 1GZQB 2P5WD 3T4AA 3OB0H 2P49B 4F80A 5TH2A 3N43F 4FQXC 5GRUL 4FQXD 2PW1A 4MMXC 2EC8A 1U8CA 1XF4A 4UV4L 5C0RL 2OXGA 2WBXA 4I0PC 4PGDA 1MG2C 4WTQA 4I0PD 3TYFA 2P47B 4HFWB 1M4KA 3T6XA 3JZ7A 3FSOA 1A8ZA 4AL8L 3FOMA 2GK2A 4MNGE 4PVLA 4D2NA 4AEEA 2V2TA 1ZMYA 1XXFC 1QLRB 5D7IB 1TFPA 3OJDA 3P4OB 4ADJA 3EBAA 2CXGA 4UV7L 4Y4KA 4KTDL 4PSPA 3QUHA 1MLCB 2J20A 3RY6C 3MJ9A 4G8IA 3KDMB 4HS6B 5GGVY 1J5OL 3NSFA 4RX4A 4LBEA 3ECBA 3NCWA 4Z18A 1WJ3A 1UURA 2F58L 4PJGA 2H0FA 1DDHB 4GSQA 5G2NA 1H6FA 3LDBB 3JV4A 3PL6D 1GGYA 1X7SA 2AQ1A 5CEZL 2C9VA 4U7KA 1MHEA 1QRNA 1UA6L 1OGPA 3SB3A 3LNFA 4WV1B 3T0VA 5I1JH 1QR1B 3CSBA 3PU7A 3ZPDA 1E5AA 2KL6A 1VSCA 3FH5A 4A2FA 1ONQB 4BK4A 3LN5A 2ZUTA 4M8VA 1YPZF 1BVOA 5D4HA 3VUAA 3O6ML 1UD8A 1HOCB 2C1PA 3S8FB 5ABAA 3DUUA 4ODVH 4X7FC 2VC2L 4F2MB 1IIKA 3WTTA 1WISA 2YMXL 1MRDL 1CGVA 4XVJL 5J6GA 2FYVA 5EIIB 1O7DC 1M6OB 2F1EA 3VG9C 5ID1A 1TTAA 4QHUA 4XMTA 3TCXA 3EH5B 2J6EL 4B7LA 5MEOB 2IPKA 3VXTA 3WNLA 1AD9B 3NIFF 5E7FA 4N9GB 3RLSA 3BIBX 2Q87A 4M4RB 5BVPH 4L3EA 2CM5A 2G4GA 5HVHB 1QWUA 5I0WA 1H9VA 2I07B 4RAVA 3MC0A 4KJYA 2ETWA 3L3OB 4WAFA 5JHMA 3ZKXB 3D7PA 1QFPA 5G4OA 3CJJA 1NAMB 3C6SB 5AVVB 3D39A 4ODTH 3S36X 4E42A 3ARWA 4LCCA 2KDYA 2AVFA 1VJSA 3KH4A 3D9AL 5PCYA 2H26B 1V3JA 4DTGH 3QT2A 4MB1A 4UM8B 5GGTH 2R0KL 3ZTNL 2BSTA 2BIPA 2FSDA 3AITA 4QF1B 5HY9B 5EU4B 1TZHB 2QGBA 1JPTL 3HAEG 4P06A 1KCKA 1EZLA 3DX3A 4U1MA 3QHZH 4ALAC 3O3EA 1BEYL 1RU9H 3BP5B 5B4MC 4GIOA 3QUXB 2X7LA 4NN6B 4X4XA 5DRZA 4RDBA 4ZUWB 2OJEA 3VGGA 4I4WA 1AR2A 1YNTF 3A6BL 1N2RB 1MVYA 4XMPH 3UO1L 3VFMA 2HX8A 3RDJA 1SF5A 3ZHLA 3A67L 4QT5A 2V7NA 2PMZA 4YUEL 4CBPA 3FTZA 3NN8B 1XD0A 3Q8BA 3VG0L 4ESKA 5IHHA 5ICZB 4P5MB 2OR9L 2X28A 1WO2A 2MNWA 3LNHA 4LF3A 4N2GA 4TUKH 3FB7B 3L13A 4FLHA 4GUPB 4LSSH 4NO2B 4NWUH 1C5DB 5AAMA 3IDMA 2A1WL 5TDNA 4V2CB 4XNXL 3TA3C 5C0NC 1F18A 3TA3D 1QQDA 2D8KA 2GJ6A 3ABMB 1VA9A 3QP3A 3D30A 4MQ7A 2VYRE 2FT7A 2VMEA 5ETUA 3OKEB 4X7CC 3MRBB 3BUYA 4C58B 4YDVB 5BW7C 4MQXC 1WBZA 4MQXD 3S35X 4Q6IC 5E1GA 4G7VL 5BV7C 4NLHA 1KLGB 1AGFB 3QDJA 3D1MC 3SKOB 3NJJA 3SZKC 3AT9A 4NZUH 2Z3FA 5I23A 5T3ZE 2BXZA 2EE3A 3OKKA 4I18B 1OSZB 2IAAC 3MACL 3MR9B 3ARGD 1XAKA 2X89A 4U6HA 5DD3H 4UZUA 1TPXB 1RIHH 2WXFA 3ATAA 3V4PH 1OPGL 2C26A 3FB5B 5D2NE 1L9MA 1IO4C 2OPCA 5E00A 3KPMA 3NFSH 3CHOA 3OKNA 3B9EA 4PLOB 4DK6A 2OZ4L 4JM0A 4Z5RA 1FL6A 4W9IC 4MZ3A 2EO7A 2LU7A 4WU5A 5LHDA 5DQDH 1DBMH 2HJLB 4UQ2A 4YL4A 1N7ML 4APQB 2X5PA 1P9MA 2R0LL 3RWGA 2Q2LA 1FHGA 3R4RA 3CSPA 3SN6N 4FXGC 5H94B 4YDMA 1ZV9A 1QLFA 3V6BR 1L5GB 1UGKA 1LL1A 5HHQB 1F2QA 1G0XA 3DXAD 4ZW3A 2B7DT 2EDLA 3IDYC 4KAQL 3QEQE 3TH3T 3EO1B 1N64L 3GSOA 5D2LE 4AMKL 2XPGB 2MPAL 4LSQL 3DHUA 1HH9B 3MV9A 3B5GA 1KYUA 1QFWM 2PP8A 4UM9A 5JIHA 5L9DL 1WITA 4TYUA 4N0CC 3DI2B 4N0CD 5CUSH 5IHZB 1IC5H 4P5RA 4HPOH 1GXEA 2ZYRA 1FVCB 2DAVA 1B6DA 4PJ9B 2HRPH 3T0EA 2CR3A 3FULA 3PABB 4FLSA 4JFVA 4GG8B 5KYXA 3WTWA 1EAPA 4ZQKA 5EBWB 1BZEA 4HQQL 5HPMB 4PUBL 3BXNB 2DM7A 2MFNA 4KNTA 3STZB 1BFVL 4HMEA 1FO0A 3CVDA 4PWFA 1GGIH 3C5ZB 4D0CB 3ZVVA 5KJRL 4F8PA 2I7OA 4K8RH 5ISZE 3HZMB 2DDQL 3R8BB 3KBPA 4JFEE 5E9DA 3ARBB 4WI2A 1CCZA 5ENWA 1TFHA 4APXA 1YJDL 2Q6WA 2CHDA 4N25A 1RJLB 1YMMA 3D25A 2V6HA 2CRIA 1XZ0B 2WVVA 4ADIA 2J1ZA 4IIZA 5E8EB 4AKQA 2X6CA 1DBBH 1RZ8B 4XNQA 2F54D 3SJVA 3LS5L 2C7UA 1NBVH 5INCB 2WQVA 1I8MB 4QRQA 4PRPB 4HJUA 3U30B 4G71B 3MV8B 3P11L 4CSTA 3HN3A 4HC1L 2CPCA 3U4EA 3BYYA 3LN4A 1Q0XH 3LNGA 4Q9RH 4AW7A 3MBEA 4JY5H 1WCQA 4AL8C 5DZPA 3LEYH 1ZT1B 4X6CB 2XZAH 2Y3AA 2A6JB 2WCPA 4FG2A 1MFUA 3DDFA 4PYGA 1G9ML 1K4CA 1SHMA 1L9PA 3MCKA 1PAZA 2WN3A 3FB6B 5DVKA 2BCMA 2JJTC 2WANA 4PJIB 4PJXE 3A5VA 2AGJL 3IN0A 5TDPA 3UAJC 2I60H 5HDWA 1HZHH 3N41B 3UAJD 4UTBA 3ISYA 3LKSA 5J1AB 3BGMA 3CHRA 1A6VH 2A38A 3C8KB 4NLAA 4RMQA 2BOCA 5CU5A 1INQB 1WZ1L 3C5SA 2HFFA 4NNXB 4ZBJA 1ET8A 3GDCA 3MV7D 3H7LA 4H8QA 1MQKL 3QDHA 4WK0B 1OP9A 3UTQB 5KVEE 2VDOL 4L8DB 1WBYA 4X6CF 5DRNA 2WIIB 4LASL 4NKMA 1JZ7A 2JQAA 2QEJA 3FQRA 4OLXL 2BNQA 3DIDA 4PJIF 4JQXA 3TFBA 1A7QH 4FC3E 4FHJA 5FO8A 2CCWA 2VN6A 3QI9C 3QJHA 3QI9D 4YHPB 5SX4I 3CUPB 4LVHB 5IQ7L 2OULB 4FNLH 1H5BB 4O02L 3FSWA 4F7PA 1Z0NA 3LZFH 3Q7JA 5T5FL 3ARVA 3RPIB 2QKIC 4P9ML 5AWNH 2I69A 1LHZA 3ZL1A 5TDOA 5EOCL 3IGUA 4IKIA 3WBDA 1UXSB 2EDYA 4HBCH 2E74C 4HLZG 2VLKB 3UYOD 1FRGL 3CIAA 3MRHA 3PFQA 5I1CL 5B8CA 1NFAA 3OF6A 5EU6B 2CIKA 2WXRA 2RH0A 5ERWA 3VJ6A 3H55A 3WV0A 4CDGC 5E8DL 1E4WH 4B50A 1JFQL 4MMZB 4PYHA 4TQ8A 3G6AB 4XN7A 2HJFB 4B95C 3FQNA 3ZYOA 1BXUA 1VEPA 1A7NH 2JKWA 1MPAL 4XOBA 1UA7A 2VN7A 1WCBA 4TM9A 2IANB 1K4DB 3H9SA 5F93C 3EO0A 4L4VD 2E27L 4N2MA 4QKXB 4Z0BH 2GEEA 2DLTA 3EJUA 2UUDH 2IDTA 3BP7A 3IDNA 4Z95H 3ZTDC 2WQRA 3W0WE 4IRZL 3Q8CA 4FQJL 4QRRB 1PMYA 4QYOA 1ZIAA 1N6QH 2GJRA 1H9DA 1E5ZA 4EKXA 1MHCA 3FT4B 2Y5TB 4HCRL 1OL0A 5E1QA 4P3DB 2QPSA 2VN4A 5BXFB 4I3RH 3U2SB 1O7VA 3C6LB 3NPSB 5DQ9A 3IE4A 3QULA 2BIOA 4YDNA 3TASA 1DBAH 3GMMA 1XBRA 3VD5A 3O4LA 4Y5YA 4ZMNA 1LE9B 1MCCA 4LCIH 4NO0B 2X88A 5JPMA 2OYKA 3QNZA 1GSMA 1MAJA 4QHNA 4X5XA 1TVBA 5CJOH 2F7QA 1HSBB 5DJ2B 5HP5A 1A4BA 3V0JA 3UTOA 3FTVA 2FYYB 3BVWA 4FFTA 1DQMH 5C08A 3VWKB 3C9NB 5I8OL 1XTLA 3CLFH 4FQCH 5B3JE 3SOBH 5EU3B 3M17B 1FNGA 3KPQA 3IU3B 2H3KA 5MERB 1F8TH 5DLML 1JERA 1T89C 4OD3L 1QFHA 1FORL 4PCTA 5I5RA 3BDYL 1CTMA 3DVFA 4YXKH 3P0GB 1W72B 4IBTA 1AD0B 2MNUA 2PLTA 4F7CA 4OZIF 4ZNEA 3X3GL 1R6VA 5C0DA 2HB0A 4LEXL 1Q9LA 3KVPA 5BMFL 4H7VA 5CGTA 2CAKA 5CZVH 3T8XA 5IB3A 1F00I 2X9ZA 5CCKL 4IOSD 1MNUL 2FB4H 2L7UA 1KXVA 1F41A 2NY1C 1E3FA 3HR5B 2NY1D 2DBJA 2AABL 3V9CA 4W81A 3ULUL 1EHLL 3QDGD 3L3JA 4HV8A 4PJ7E 4TTDC 1KZQA 3DLQR 4TTDD 5AB0A 2ZCHH 1TSRA 3UAAA 5HGHB 2ZG3A 4BQ9A 1N0XH 4G43A 3GSQA 4AM0Q 2V3EA 5JDJA 4G6KL 4GH7B 1L6ZA 4QOKE 4L8CA 2BIIA 2AJSH 2DYSB 3G6JA 2DLEA 1QLEL 3ZSTA 4HA1A 1QG3A 1FL5B 4X4ZA 1TZ8A 2MCPL 2HTLC 3O81A 3PXLA 2X4TB 2HTLD 2Z7UA 4W68A 4HIXH 8CGTA 3II1A 5KVGE 1MH5A 3JXAA 4M6OH 3MBWA 1LTXA 1KBKA 2EEFA 2VXQA 4LDLB 4PVNA 3QAZB 3SPVA 2GSGB 2VQ1A 4WUUE 4EOWH 5E8PA 1DJSA 3LZRA 3KLAB 3KPNA 1OCOB 2W0PA 3GLZA 1TEYA 5EZOL 2P80D 1QO3A 2BSRB 5AW8B 4F2EA 1SJVA