5F97E

Blood group antigen binding adhesin baba of helicobacter pylori strain a730 in complex with blood group a type 1 hexasaccharide
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
114
structure length
114
Chain Sequence
VQLQESGGGLVQPGGSLRLSCAASGSIFSGNVMGWYRQAPGKLREWVAAITPQGVPNYADSVKGRFTISRDNAKNMLYLQMSSLKPEDTALYYCNRLPNYRSWGQGTQVTVSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Adhesin binding fucosylated histo-blood group antigen,Adhesi
publication title Structural Insights into Polymorphic ABO Glycan Binding by Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
total genus 27
structure length 114
sequence length 114
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2015-12-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5f97E00
4MNQE 1E4KC 3UYRL 4LRNH 1ZSDA 4NO5B 3VFSB 3MROB 4W6YB 4WFHE 3UTZA 2WWKT 3DUUB 4JAMA 2QR0B 3L3DA 4LLQB 3UTTE 4Q97A 1NC4D 5HDQL 4WI4A 5L2KD 3MRKB 4MS8C 1MI5A 4PJBF 4G9FD 4NPYA 3P0VL 3WJLA 3RWCB 1J8HD 2CJUL 5FV1L 4GRMA 4P99A 5FA4A 5JUEL 5GRJL 4GKSA 3LRHA 2DWDB 3QIUB 4JKWA 3VMNA 4L3ED 4Y19E 4XAWH 4P3DA 4UOW0 1MF2L 3WUZA 2FR4B 3JV0A 5FYKU 3MRPA 3SBWC 2CJUH 2X89D 1RIHH 4JB9H 5MERB 3IF1A 6CGTA 4OLUH 5GRJH 2IFFH 1D9KC 5CJXC 3K0WA 4X4MA 1PG7X 2D3VA 2EE9A 2DLIA 2YUZA 4HIHA 4P46D 4QOKE 5IESH 4GSDH 5T3XD 2JF1A 3O3BA 4OLVL 3LKOB 5EUKA 5EC2B 4S1DD 3D18A 4S11A 5FO9B 1TTGA 2JIXD 4MAUL 1MFBL 5EZOL 4YXHL 3L7EB 4NJ9L 2VXSH 3S3PA 3D69A 2HJLA 3LPGA 5D71L 1D5BB 3THMH 4HG4J 1NFKA 1OGAA 2DLGA 4NUJB 3C2AH 5D1QA 5KSAA 4ELKB 4Y4HA 4E42A 3CK0L 1EJ6A 3CFBA 4UIMA 4M7KH 2EDNA 1UB5A 3RVXC 3SDAB 5BV7C 4XP4L 4P5TB 3DVGB 4QRPA 2I9TA 5K9KA 2YD6A 4E41D 4POZC 2W9EH 1XEDA 4R97B 2XY2A 4JY6B 3RL1B 1F00I 1NDGB 4GG8B 3CDCA 2LVEA 3DGCR 1QNZH 1T2XA 1I8MA 4BSWB 3EYSH 5JPMA 5IHZB 1KCLA 2QQNL 4HGWB 3VCLA 2YEZB 1T6WA 1X44A 2PXYC 4D94A 2DQFA 5DSCB 1NC2D 4KQ4L 4CL7A 2V2TB 1D6EB 1J0KA 3P4MB 3C09B 1DUYB 2QQNH 6FABH 2F8VA 4OLZH 2ZOLB 4KHXL 1OPGH 3OKDB 2DL9A 5D7LE 2F54E 1KXTB 4PRHE 1VGEL 4U1NA 3U4BL 1Q94B 4HUWA 1CU4H 4TNWK 3UTSB 3S37H 3FOMA 4PRIB 3UEZA 2EO9A 3WNKA 4LLYA 4U6VL 4JHBA 3O9WC 4WJ5A 1U95A 4ODXA 4WUUE 5KSVB 1ACYH 3H3PH 4XHJD 3MRGB 4OT1H 3GSWA 2ZUQB 1JGEA 2CGRL 4UBDC 3V5HB 3KJ4C 2QSVA 4X6DB 2B7DT 3TT1L 1E4KA 4TUJA 5L0QB 1P7HL 2GSGA 1MRDL 3WEXB 2WBWB 4ZFOB 4O02H 4PJIE 5AZ2L 2YUWA 3ULSA 1ZT1A 4F37K 4KRMB 2BSTB 1TITA 3M1BA 4HCRL 5B8CC 1Q38A 1FSKC 2XFXB 4XVJH 2BVPB 4IOSD 3ZLQC 1GXEA 1CFTB 1SJEB 1G7HA 1HH6B 5CCKL 4HCRH 3ULUD 4RFOH 2P8LB 2FATH 3OKKA 5CJOL 3MLVH 3SBWA 1GL4B 3OF6D 4M48L 2GYSA 4LCUA 5T1KA 4FP8L 3MRLB 1BOYA 1D9KA 5I8EA 5CJXA 3SO5A 1L4IA 2HRPH 3WFBH 5KANI 4JY4A 1AC0A 4HBCL 1GC1L 1HXMA 2ARJB 3GK8H 5IQ9B 4PLKC 2PW2B 2L7JA 4Z95H 2CIKB 1J0IA 5JR1H 5EG6C 4KKNA 2CIIA 4P2QD 4OZGA 1YEIH 2MQ0A 4Y16C 3MUY1 5C0EB 5KSBF 2VLRB 3O4LA 3L1OH 5J12B 4WFFE 2FJFA 3CIQA 5ID0B 1ZA6A 5IVXF 3CMOH 1CD8A 5LGKA 2P5EB 4PJFE 5JA8B 3PABA 3LQAC 4HFWA 5ANMB 4D9LL 5DRWB 3EOAB 3RWDA 3VGDA 4HIIA 1DSFL 1I3GH 5L88H 4K3EL 3G5YB 3O2VH 5I1DB 2UYLB 2P8PA 4NO2A 4ZOEA 2G9HA 3VDAA 4UQ3B 4Z7UE 4NHCH 5JQ6L 1FNAA 2PXYA 3O6FC 4MNHA 3G6AA 3HZVB 3CZFA 3VFTA 4LHQB 1DSFH 1AY1L 1RZJH 3S5LA 2BNRD 2O5XH 4XCEB 1HHKB 4LSQH 5JQ6H 1K8IB 1ZMYA 1DQQA 4JZJB 3L5WB 4KUZH 4UB0H 4PPTA 3ZYJA 3VXMA 1JUFB 3WE6A 2E8ZA 5A43C 3RVWD 1S9XB 4ODVH 2EXWC 3QJHA 4JFHD 2B1AH 5IEHB 4B0MM 3MV9D 4PJBB 4OBRA 1R3LB 3DGGB 1YY9C 4GW5A 1LE5B 3VGEA 3O9WA 2LAGB 5EN2A 5DEGA 1S7TA 3MREA 4WFGE 4Q58C 1SY6H 1KC5H 2HWZL 1R3JB 5DQDL 4QHLA 1AQKL 1CFBA 4QRUA 3CC5B 1GJIA 5D7JD 5C0IA 2ERJC 3TZVA 2D4FA 1N7ML 2BRRH 4U2ZA 1EFXA 5B8CA 1NCAH 2GHWB 1WBZB 2WLYA 3GSQA 4QRSB 4HEPG 4CU8A 4ZTOH 3Q1SL 4G42B 4MA8H 1V7NL 3GMOA 4EN3B 1S9WB 2NY0C 2PUQT 2E7BA 3BGFC 2ESVA 4YNYB 3UROR 1OWWA 3TJHD 3B9EA 4CADA 3L3GA 3NCCB 1QFUL 2W0PA 3RGVD 2KUTA 3LIZL 3VGBA 1JNJA 1BHGA 2A6DA 4YH6A 3HI1B 3H7LA 5IEKB 1CGVA 3DBXA 2IAMB 4U1JA 5CILL 1IGIH 1BZ9B 2NXYD 5DD6A 3S6CA 4D8PA 1FO0B 4WGVB 5D8JH 2VLJD 5HDOA 4G8IA 4LVHC 3RI5F 4KJYA 5K59F 2R2BB 1UA6L 5J6HB 1KCRL 4O9HH 1NPUA 5T3ZD 4Q6YA 2Y06L 5I2IA 5FUCC 4Y16A 3QQ3A 3NFPB 4NQSA 5TDNA 1N5AA 3S97C 4M1GH 3ZL4H 3D0VB 2O61B 1DBAH 4APQB 3JTTB 4GKNA 3HC0B 3SGEH 3LEVL 2XT1B 3GMQB 3HE7B 3TVMB 1DBMH 1JI2A 3T77A 4OCRH 3EDDA 4AMKH 1JJUA 2AERT 3C8KA 4I9WE 2CDGB 4JFQB 4UI2A 4LGSB 4LPYA 1FDLL 5A1AA 3IDXH 3MJ9A 5BJTB 3UO1H 3L7FA 2DMCA 2VH5H 5F1NB 1G7IA 1V7ML 5AZEH 3VFNA 1IBGL 4NKOA 1MQKL 2VLLA 5ICYA 1LP9E 3HMWL 2J88L 3SDXB 5AEAA 3SQOL 1IZJA 2R4RL 3O6FA 5CEXA 3F58L 1A3LL 3WXWL 2HKFL 4MAYC 4J3TA 4ZS6D 5GGUB 5I19H 2X4UA 1L0YA 4C59B 4I3GA 1E4WH 1KJ2L 3S36X 3UMTA 4PUBH 1FFPA 4GRWE 3PIQA 2HAZA 1XCQA 3GJEB 1EEQA 2HKFH 1IMHC 3HS0B 4CNIB 4NO0B 4BYHA 1LDPL 3QAZC 3MSPA 1E0OB 1X9QA 4QHKI 1I8KB 1OAKH 3KPLA 2Y7QA 5F96H 3MFFB 4HLZH 4NNPL 4LARH 5EZLA 3V8CA 4KRPD 1IM3A 1YEDA 2VSDA 3UTPD 4UDUB 5FYLD 5SX5H 2BSRB 2FH8A 3VRIA 4FHBD 4JG0L 1BWWA 1J8HE 2DIJA 1VCAA 5DC0A 4C56E 3BX7C 3HR5B 5DVMA 3UTQB 4KH2A 1OCWH 1PX3A 4YDLC 4YBQD 3O2WL 7CGTA 4HIJB 1MCCA 1FAKT 4MCZA 1HEZA 1XR8B 2W0KA 1R3KB 3HCVA 1HHJB 3PJSB 5DO2C 1AI1H 4CVUA 4KK8D 3KPSA 4BM7A 3G6JB 1HN1A 1YEHL 5I1CL 3RIFK 3QFJD 3MGOB 2WBJC 4WV1C 3QHTC 4UTBH 5H8DA 5JW5A 4KI5D 1BOGB 3A6OA 2BVYA 5KSBB 3QH3A 4G7VH 3N06B 3RWJB 1S9YA 5F7DB 4FQQA 1WBXB 5TJWK 2B8OT 5E8EA 1JIBA 1JGUL 3VE0A 3FQTA 2XACC 1KN4L 2J5LB 1BLNA 1LO4L 3I75B 3IDYC 3HRZA 4NFBA 2EDBA 5E1HB 1B4RA 3LN5A 4AENA 1J1XH 1AJ7L 1M7DB 1WIPA 5C92A 4OJFH 3VXUD 3IS1X 1LO4H 3R1GH 4ZYKA 1J11A 3O41B 2VZVA 1NJ9A 1YMHA 5C0AA 3EZJB 2ICEB 4Y4KB 5F9OL 1CCZA 3FAXA 5GS1C 1RZ8A 3EGSB 1R24B 4KFZC 3HZYB 1V5JA 2BCKA 4O5LL 4ONFL 3QYCA 1A21A 4IRJC 1KTLB 5DQ9A 5CHNA 3V4PH 3VGAC 1KIUA 1I7TB 4F9PC 2Y1VA 1D5ZB 4GAJH 1VEOA 4NNXA 4OTXL 4U49A 1R5IB 4NFCA 4O2CB 4HS8H 4ESKA 4MAYA 5C0GA 4KTEL 1F3JA 1YY8B 4K9EH 5T1DH 1BD2D 3KYKH 5LJYH 3R4DA 1MHCB 4G8GE 3HLAB 3CH8A 1VPOH 4HLZG 2JLLA 1A6AA 2NLJA 4JPKL 3EOYG 3RP1A 4Z7VA 3C6LB 1MJUL 3E6FA 4ZUTA 2VISA 4XPAL 5EU4A 5LWYH 4PJ7E 4CVXA 2ADGB 2GT9B 4Q6IB 1IL1A 1KJ2A 3PHQA 4X4XB 3RBSA 4K55A 2FNBA 5GXBB 1CGUA 1CGSH 3CUPB 3WFEL 3TO4C 5MEQA 4FXGB 1TZGH 3LQZA 3RWHB 4MLSA 4FFYL 1KENH 5DHVB 1JZ4A 2EE6A 5DZNA 4YHPA 1KJMB 4JFXA 4NP4H 1A7NL 1N64L 4Q9QL 2ID5A 4RAUA 3GSXB 3NABH 4TSBH 5D6CA 5GRVL 1EDQA 2NX5B 4OZ4A 1A7NH 4L8CB 1JGVL 4Z7QE 4AIZA 1LO2L 1U3HC 2WBJA 4PJIF 4WV1A 4YWGH 3U7YL 2YKLL 5JNYA 4XCCH 1BFOA 1G84A 3B6SB 1RJYA 1MFEL 2FX8H 1OAYL 1I7ZA 1EUUA 4P2QE 3S35X 5DEZA 3VXRE 1HKFA 2CH8A 3RL2A 1PG7H 1JFQL 4JFDD 1IVLA 5HY9A 4GRWH 1EZVY 2ZSVA 5HHOE 5GRUL 2PTTB 3DX8B 5D7SH 3DURA 1CT8A 4UV4H 1JFQH 2SEBB 3MOBH 1WK0A 4ZUWB 3V6FB 4YZFE 2A9NL 1WAAE 1K2DB 1F4WH 1HSBA 3C5ZB 4H1LA 1T03L 3QCTH 4GLRH 1SEBA 1I8IA 4R90H 4HHAA 2DQGL 4P4RA 4MQXD 4XNZB 1OTTD 1CGWA 4LEXH 4X8XA 4NM4L 2ATKB 3CFEB 1YEFL 1SVZA 1U8PB 5GS1A 1Q1JL 4RGNC 2GK0B 5T3XL 1BZQK 5E99H 3C5SB 3EFFA 4AQ1B 4FQJL 3LOWA 4U1GC 3MMEB 3KPOA 4QWWD 2BNRE 4IRJA 4XP5L 5CEZD 4F9PA 4JFFD 4JHZA 1E4XH 5T3XH 2I60L 3L3JA 1RULL 4LCIH 5C2BL 1OAZL 2ZCHL 2NY6B 5C0BE 2C3WA 2XTJB 4PJFF 4KVCL 1W8OA 4WENB 2BJML 1MCHA 1D5XB 1W0WA 1URLA 3MYJB 2F53D 1ZWIB 4GAFB 1JZ2A 2HLFC 4L4VA 5GGRB 5AUMB 3BRFA 3WHXB 2BJMH 1A7RH 5FK9B 2X05A 5INDB 4UT9L 1ZLWH 2W60B 5C0JA 4Z7UF 4HS6A 4ZS7H 5DMKB 1T1ZB 3QA3A 4M8QA 5B3JE 4KTDL 3INUH 4OZHA 2BX5A 3FB6A 3TO4A 3AFLA 2AK4B 5ETUB 3BJLA 4ZQKB 4G8FA 3WJJC 5HHXH 4A2LA 2A2QT 1CLYL 1GOFA 1Z5LA 5C8JB 2BVOA 1V3JA 3IXTA 2HFFB 2O26U 5GS0L 1ADQH 4QHUA 2O5ZH 5SWZE 3LAFA 3C8DA 4RIRB 2NY3B 4M9OA 5GRWA 1GYAA 1UG9A 4GH7B 3WD5L 5C7XL 4P5TC 3HUJE 1XF5B 3H9SB 2VLMD 4IOFD 4AJ0A 5GS0C 1JWSB 3C60B 1U3HA 4MD5A 1KELL 4GUPA 4J12A 1TENA 2JJVA 5EOCL 3OKOA 3PG2A 1HSAA 3P77A 5I8CB 3PV6B 4LOUC 1FVDB 2R1XA 4P57A 4POYA 5EU5A 4QOKB 1KT2A 4WY7L 4PP1D 2XWBB 3QHFH 5TE4L 4AEFA 4XI5D 3BSZL 4YQXL 4JGJA 3ILQC 3GHBL 3P11L 4XPTL 3U4AA 1CDYA 2XKUA 2D2OA 4XB8A 4TUKH 1IAIL 4ODHL 4WRLA 2DD8H 3C09C 4FQLL 3VD4A 1CXEA 1FVCB 2VDML 4P2RA 1WISA 5E6IC 3ULUL 4UIKL 3OKNB 1KYOJ 5IHUL 5CGTA 1HYSD 3PV7A 43CAB 3AXLB 1QR1A 1ONQB 4K07A 5A2KH 4ZXBA 4PJ5D 2MKLC 3DMMB 1A4JA 1G9EA 2AEQL 1OD9A 3G5XB 4BQBA 4F9LC 1BJMA 5CZKA 5L0QC 1NCCL 4XH2B 4NO5A 4D0BB 5C0FA 3MROA 5I8KL 3QXWA 5BQ7B 1A9BA 5EBLA 3DUUA 1L9MA 4LNRB 4RAHA 2QR0A 1M05A 5EIVA 4S0TD 5IW1B 4F2MA 3MRKA 3O3DA 2WMPA 1CE6A 5A2JH 4KROC 1RIVH 3T3ME 5FM5M 1MH5B 5DUPH 4PJXB 3H9YA 1MIML 1YN7B 2DWDA 3O6KH 1J1OL 3MJ8B 3AB0B 5D7LB 1C5BH 1CG9B 5DJAB 4UU9A 4PRHB 1U8JB 3N85L 4YDIL 5FUOH 5GGVH 5I1JH 1LP9F 4ZPTB 3MGTB 5SV4A 1A7OH 3NOIA 4GQ9H 3VG0H 2F74B 2ZUTA 5JOPD 3DHMA 4HPYH 3PP3H 1FL5A 3LKOA 5EC2A 2PN5A 1YPZA 5E5MB 4FQIL 4GRWF 3WJJA 4N9GB 4PJIB 5I1EH 5EO0A 1NGQL 5MP6H 4BK4A 1JV5A 5IUSA 3LZFH 1L7TL 4YO0B 4BH7B 3QFJE 3SJVA 3S4SA 3SCMB 4NUJA 4ELKA 1A14L 4KI5E 2XY1A 5BXFA 3C5JB 5CUSH 4WHTB 4HD9A 4P5TA 1NCDH 3DVGA 1DDHB 3MNZB 4HIXL 5FGBC 2P1YA 4RFEB 4IJ3B 4HWUA 2E3VA 3MXVL 1I1AD 4DAGH 1GGBH 4NQTA 3MLSL 3RL1A 1NDGA 2DQCL 5HYJB 5JO5A 4QRRB 3EJYC 5L8LB 1S3KH 3NIFE 4KUCD 4KK5C 4M7JH 2DQDH 3VXUE 1Z2KA 3MLSH 4IOIB 4JPWL 3FQUB 3W9DA 1FBIL 1QSFE 1VFAB 3GIZH 2WSKA 5F6IB 3KPNB 1YYLL 4JPVH 4FQ1L 3DARA 4ODTL 4JZJC 4JO3H 5E6IA 5I76B 5D2LE 3K81A 3QEGL 5KVGL 3QUKA 2BHZA 3SN6N 1R3HA 2E6PA 2XZAH 2NW3B 4IRZH 4WWKD 4PJFB 1KIQA 1V3KA 3IGAA 1RUML 1HCVA 1TMCB 2CDEB 4U6HB 1P7QA 1QQDB 1OHQA 3I50H 3WEXA 4JO4H 5GGQH 3GSVB 2BSTA 4HK3N 3BKCH 2FD6L 4MJIE 5T3ZL 2AEWA 4DGIL 1T22B 5EIIB 4YX2L 2XFXA 4YIQB 2ZZUT 5IGXH 3KPPA 4HS3A 1SJEA 5HGAB 4EN3C 4EOWL 2RBLA 1LK2A 2ADFH 1IC4H 5L2JB 3R0NA 1JPGB 3U4EB 3S36H 3U82B 3UPAA 5FGSA 5ESQB 2R2EB 3LKSA 5D1ZB 3P9LA 2IAMC 4PJGE 3BE1L 3N1QC 3SQBA 1OSZB 3ARFC 3SDCD 1QSEE 5IJKC 1RZIA 3L5XL 4U6YA 4Y2DC 1NBZA 3HE6A 3VH8A 3WFCL 5HHNA 5JXEC 1A2YA 4KKAD 1T4KA 1I3RB 3NCJH 5LAXB 4RISH 3AS1A 1FIGH 1SEQL 2E7CA 1LVEA 3MLYH 5FUZL 4PJ7F 4GKOA 4FQPA 5JW4M 4APQC 1A5FH 3HE7C 2P8MA 5JMOC 3JVGA 4FG6C 5IB4A 1T1YA 4JFDE 2C3VA 4M5YH 3O3AB 5FGBA 5DRWA 3UC0L 5FYLL 1HDMB 1RPQA 2VITB 4MB5A 1JRHL 5F89A 3OJ2C 3G5YA 2P47B 2Q76B 3F65A 4YK4B 1OM3H 4CN6A 1TCRB 3P2TA 4ORZC 5FYLH 5C1MB 3PWNB 2GJZB 2HTLD 3HZVA 5D5ME 4UOW1 5EZIH 5HHMD 1C8PA 3BQUB 3QUXD 4Z7QF 1RUQL 1BBDH 1OP3H 2V2WA 1DVFB 4N0UA 2OK0L 5I1AB 4QTHA 3IJSA 3DRQA 1K8IA 4JZJA 5IB3B 5GGTH 2FLBT 1NDMB 2F58L 2G75B 2VB5A 1MLCB 3SOBL 3TIDA 3ZHDA 1IAOB 1S9XA 4I3RH 5AYUL 3ULVD 2VXTL 3ESVF 2HFGH 3E3QE 5CEZE 1YA5A 1R3LA 2M26A 1LE5A 5DMYA 2CK0L 1JHLL 4M7ZC 3MXWL 4H0GA 5CBEB 5J89A 5E94A 4MZ3A 4L5FL 2R0KL 2BFVH 3RI5K 4YZFF 1HOCB 1WAAF 4Z7WE 5C0DB 2VDOH 3ILPB 3CC5A 1FLTX 1D3CA 2XKNB 1I1CA 2EC9U 2YN3A 4P5MA 3KLAB 3LH2H 2F53E 3QT2A 5KW9H 1NBVH 4J1UA 3GI9H 3NA4A 2DQUH 4G42A 1A7QH 4EN3A 1S9WA 2G5RA 4U0RB 1P4IL 3BMWA 1A02N 1XT5A 2V5MA 4GRWB 1ZHLB 1IILE 3J8F7 1BM3H 1RZ7L 3LKPA 4LSSH 5D9SB 4MXQC 5C70A 1CLOH 1NMCB 3TBTB 4OFPA 2AJXH 5IEKA 1AXTL 2ADIB 3TFKD 2IAMA 4RA0C 5SX4H 1ZT4B 1BZ9A 1ED3B 3JBG7 1OT1A 1NGPH 3ARFA 1FO0A 4FMKA 1NC4B 5IJKA 3I3EA 5L2KB 4A6YA 4Y2DA 4ENEC 3RZCD 2Q8BL 3BKMH 4YHIB 4G9FB 5CZXC 5JXEA 2E9BA 3ARSA 4PRAB 2VQ1A 1J8HB 4M43L 2BP3A 2J6EH 2R8SL 1BBJB 2R2BA 1FE8H 3VFPA 1FNFA 2QJDA 4HBQA 1AGEB 5J6HA 1NCBL 3MCKB 4X7FC 3EO1A 4L3EB 2E9IA 4B50A 4LLUB 2VLME 1PVHA 3HMXA 1CDBA 3PWLA 1PSKH 1D5IL 2R9HD 1OB1B 3TF7C 4MWFB 2AJZB 2PYFB 2OL3A 5DK0A 4LQFL 4APQA 5B3JF 2LAAA 4MQSB 3HE7A 4DK6A 4P46B 3VFGL 2OMNA 3OL2A 3BOVA 3IYLW 2PW1B 3LN4A 4LVOC 5FAAA 2CDGA 2EICA 4OSUL 4U1LB 3W0WD 4Y4KC 4EI6A 4YHMH 2JIXB 1HYRC 2Z8WC 3NH7H 4PB0L 1T5WA 2P5WD 5F1NA 3NPSB 1TFHA 4W4OC 2Q6WA 2VE6A 3GUTB 4M03A 1UZ6E 2AJVH 4XVTL 1CXKA 4UINH 2VLKD 4XHQA 3S35H 4OM1L 3UJTL 3X3FL 3W11C 4JM4L 4NM8L 3MUGB 4DW2L 3DROB 3HUJF 3S9DB 5IMMB 3UBXG 3NMEA 1HHIA 3L5HA 4QRQB 1NANH 2X4NA 1FNEB 4IIQB 3KPTA 1XGUB 1F02I 2Q7NA 2OZ4A 3MJ6A 3GJEA 4OGXL 4G6MH 4DW2H 4E41B 2YXFA 5KS9A 4CNIA 4HIEB 3CCHB 1F3DJ 2KQNA 3C6LC 4XMPH 3DV4B 2D9QB 1I8KA 3P30L 5SWQB 4HG4K 2H2SD 1IARB 3MFFA 1AGBB 1ZVSB 4Q6IC 1E6JH 2AKRB 4R4BB 4DTGH 1FORL 1Z6JT 4UDUA 1IEBB 4HC1A 1DQLL 1NC2B 2G2RA 1D6VH 2APTA 3EBAA 1MCWW 4J3XA 3K2UL 3ME0A 2WQRA 3KNBA 3GSUA 3MV7D 1AGDB 1HINL 1RJLA 2CMRL 4Y5XB 3HR5A 4M1CC 2XOTA 5IBLC 4ZUUB 4FQCH 4CVWA 1IC7H 3PJSA 3PL6C 2BC4B 1BVZA 4LCWD 4YHLH 2XNAA 3MUHL 1KCSL 4I0PD 1HH9B 3WIIH 5ERWB 1MNUH 2NTSP 4QXGH 5E56A 5EC1A 5DD0L 1CF8L 1MCFA 5ALCL 3MV11 4HPOL 1Y0LA 5EOQL 1DQJB 5KSBA 2PETA 5DS8A 1RZFH 5HSFA 3RWJA 3O0RL 5HVGB 1I3VA 3T3MF 4X7SL 5IVXA 2GTWB 3IU3B 4HPOH 5ACLA 4KK6C 4LSVL 2UV3A 2NMSA 2RJMA 1WWWX 4EQ2A 4U7MA 3WKNA 2FZ3B 2YA1A 5CEZH 1I75A 4X7SH 1WUNT 3C5ZC 1QBBA 5IHBA 5A3ID 3IDGB 4NN5B 4EVNB 3BT2L 3TBVA 4LSVH 3O41A 1JYXA 5B22A 3N1GC 4XNZC 5BMFL 5FKPA 4X6FB 5FCSH 5C08A 4D9QD 1TNNA 4Y4KA 3T0XA 3ROOB 4JLRB 1R24A 5DJDA 3HZYA 5E8NB 1MSPA 2VO5A 3ARWA 5DHYB 4W4OA 1VHPA 3MBEC 4P2QB 4HK0B 1KTLA 4HUXB 3QDGA 3CLFL 3FT4B 3OB8A 1I7TA 4M3KB 5DVNA 4KI5F 5KSUB 2ZUWA 3EYQD 4J3WA 1R5IA 1IC1A 3LKQA 1KCKA 3RPIB 4QRTA 4O2CA 2XTJC 4NSKB 4ETQA 3VJ6A 2Y07L 3QNXB 3S7GA 3CLFH 2VERN 1CDUA 3PWJB 1QBLH 4X7TB 3DVFA 4DGYL 1O7VA 4N0FA 2EIZA 1U0QA 1C5DB 3QB7C 5I66B 1AR1D 2DLFL 2Y07H 3NIFF 2ZUUA 4OFVA 3C6LA 3OBAA 3TIEB 1EMTL 3KG5A 3IVKB 4ETYA 4Q6IA 5EH1A 1YDPB 5C0NC 2DLFH 2ITDB 4ZAKD 1T3FB 4FXGA 5FCUH 5EU3B 1LEIB 2A6JB 2FHBA 2JB5L 3D48R 4XC3L 3QCUL 4MQ7A 2BNRB 4KZDL 5D2LF 1QFWH 2FECI 5IMKB 4ELME 1S9VB 5B3NA 3OPZH 3W5MA 2DJ4A 3PL6A 1MCKA 1X3DA 3MRJB 2NY3C 2YUVA 2ICWA 3CFIC 3QI9D 3RY4A 3MV9B 2DM3A 2FCBA 3K46A 3MRMA 2BNQD 1ZS8B 4Z8FH 2VMFA 3T4YA 3MBXL 2HJKB 2I25N 4L8CA 4F8QA 5FECB 4R9HA 3OKEB 4PLOB 3RY5A 4FZ8L 1RZJC 1DL7L 4X6BA 3B6SA 3OZ9H 1EVTC 3ALWA 3MBXH 3LV3A 5B39G 4JQXC 5D7JB 3PGCA 2WV3A 5T1MA 2LFGA 1SYVB 4GAYB 3OKLB 3T09A 1G0XA 3CU1A 4X4ZA 4G6JL 1F90L 3QZWA 1MRCL 3LB6C 2E7HA 2X42A 3BIKA 4JQVC 4FOMA 3CZJA 5DWUL 3LKNA 1A64A 2IAND 3FMGL 1DLHA 1K2DA 4DUXA 5J9PA 3C5ZA 3RGVB 4GXVL 4XNUH 4PJGF 5DI8A 1X5IA 2I9LB 2DQEL 2NY7H 2NXYB 1INDH 1LEGA 5E2VL 3UZEA 3O4OC 4KRNA 3HUJB 4OV6F 2VLJB 4NT6B 3W39B 3NFSH 4GXVH 2IH3A 4ZOCA 3DMMC 1D7FA 4XPBH 2BXYA 1U8PA 3FRUB 4K7PX 2OR8A 4GBXD 4BZ2L 5TF1L 3C5SA 4XVSH 1NLDL 5DJ0A 2VR9A 1XGTA 3MBEA 2IG2L 3MMEA 1MLBB 3IETA 4IS6B 2AQ1A 2GY5A 4HXBL 1UGNA 1IGFL 2E9WA 2AAVA 3VDCA 3ULVE 4RMRA 4YR6B 4LBEA 3BKJL 1RUAH 3TH4T 1D5XA 3CLEL 2X1XR 1FGVH 3AB0C 5EIQA 2X9YA 4XPHH 5I1IH 5AUMA 1EEUA 2G5BB 3QXUA 3WHXA 2R69H 5FGCE 1KG0B 2EE3A 4V1DA 3TJEH 1C5CH 1BAFL 2W60A 4H5SA 4MSWB 4JFZL 4DKDC 1T1ZA 4H8WL 5D5MF 1SYSB 2EC9T 4OQTL 5F1SA 3TCXA 1RUPL 1MOEA 3P0YH 3MRHA 4MNQA 3V52H 5I71B 4HQQL 3BGMB 3TN0D 3ARYA 3GGWA 3CX2A 1DFBL 1OW0C 3QRGH 3T04D 3VFUA 3UTTA 1RUPH 2QV2A 4N8VG 1G7LA 5L9DH 1G0YR 1QKZL 2MCPL 4ERSL 4RIRA 2C7UB 1JPFA 4NRXB 5DXWA 1NLBH 1B0GB 2DICA 2W9DL 7FABL 1YQVH 1G7MB 4KRPB 4OD1L 4Y1AD 3QDMD 4Y19A 3GJFH 5EBWB 3REVB 4DKEL 2BY2A 3T0ED 1MHPH 2X7LB 3OR6A 3VRLE 1JHTA 1JWSA 4QHNB 1S7SB 3DXAD 4X98B 4OD2B 3O8XD 1XCTB 5MEND 3B5TA 3P73B 4LASH 3WFZA 2W9DH 4N5UA 5EDXA 4QF1B 1A6ZB 3HG1E 3F12A 4JQXA 5I8CA 4XZUB 3UBXB 4ZD3L 3WXVL 3QDAA 4QOKA 2B2XL 3IU4H 4GOSA 1FYTD 2XWBA 4I2XE 1P9MC 3CVIH 1NFIB 4QYOB 5EZJB 4NOBA 5CSGA 4JQVA 3LMJH 3HAEH 3T1WA 4JZOA 1ITCA 2X4OB 3JWDH 5F9DC 1P6FA 3VDBA 3QFJB 1AD9B 4GXUM 3W0WE 5C6PB 2EZ0C 4KMTL 2P5WE 5DZLA 2IMMA 1TNMA 4S1QH 1INQB 3WL9A 5I6XB 2ZCLL 1BQUA 3DMMA 1YEEH 4W68A 2MFNA 4TN9A 2QHRH 5DLMH 5FM5O 3RWGB 5C71A 1HNFA 3W9EB 1NAKH 5JTWA 2YC1A 5DYOB 1JPSL 2BOCB 4LKCB 4OFIA 2V17H 1MHEB 2CUIA 2DB8A 4PRPE 1RUKL 2R4SL 4S1SH 3VXUB 4XCYB 4PFEA 4C83B 1A6PA 3H3KA 1F6LL 1MH5A 2H41A 3U2SA 3SE8H 1RUKH 1WEJH 4CVZB 4BKLA 1I9IL 5D7LA 5FA3B 2F54A 5DJAA 3V5DA 5DRZB 1UZ6F 4PRHA 1U8JA 4UNVA 4Z7NE 2YSSB 1EHLL 4NQCE 4ZPTA 5BRZE 2VTFA 3NZHL 5GSVA 5T33H 4M1DH 4G5ZH 2OTUA 4GRLD 4LP4A 1I9IH 1I7RB 4WUUA 4HUMB 3RDTC 4NQED 1KOAA 4NNYB 2EYSB 4UDTB 4ZSOE 4DN3H 3SGEI 3D9AH 4LLDA 4AEHH 4LCWE 5B21A 3U1SL 1Q0XL 1BD2B 4N9GA 4PJIA 1OW0A 4YO0A 1JMXA 2WUCL 1OARL 1DN2A 4PLJC 1Y18B 4JGMA 4HAFA 3WIFB 5CP7B 1T1XB 4KHTL 4GT7A 4CMMA 3AS0A 4MYWB 4WHTA 5TE6H 2FRGP 3R8BB 1DDHA 1X5GA 2GEEA 1RAMA 2BDNL 3OB0K 4RFEA 1QRNE 1B0WA 3WN5C 1JK8B 1P4LA 3PGDA 4I77H 4K9EC 1U8HA 4PJGB 3X11A 3ULVH 3UDWC 1P9MA 3L6FA 3HAEG 5CKAA 4I48B 5T1LD 1KB5L 4NBYB 4UUJA 4PTUA 5LQBL 1VFAA 5ADOH 4X0KA 4TYUA 5C9JA 3IAGC 1T04B 1AR2A 2VDNH 4D9QE 4I4WA 1NEZA 3RNQA 1ND0B 15C8L 4XCFL 4OCXL 1LDSA 2NW3A 1X7QA 1TPXB 4JFDB 4PJFA 4QXUH 3QDJD 5CS7A 4TUOB 1QQDA 1UKTA 5GHWH 4ODWA 5D1XC 2D03H 3T2NL 5D72L 4F80A 1HI6B 1Z3GL 2AV7B 4EDWH 4OUUB 3GSVA 4ODSL 1UWGH 3FJTA 1AHWC 2W0FA 2Y36L 3MJGX 4KXZH 4X6CB 3STBA 3S8WA 4Z7UA 3I84A 4PRDB 2FHFA 5EIIA 3HFMH 2R0ZH 2A6KB 4RGOH 4YHZL 5D5MB 5D72H 1MPAH 1FFRA 1U58B 4U0RC 1H5BB 1P2CA 4F7CB 4NUGH 3CH1B 3TEUA 1B6UA 2ZKHL 4UT7L 2C4FU 3B9AA 4MA1B 3ARGD 3IAPA 2ZPKL 5HDLA 4LL9A 2OQJB 1IC5L 4MNGB 4L8BA 3PDDA 1KTRL 1NMAH 3GBLA 4JFFB 3RDTA 1IQDB 3MRDA 5H35A 3BZFB 2R0LH 5F9WB 3GSNL 1FFOB 3ZT7A 3CU7A 1MRFH 4Z7WB 3IDMA 2XWJB 2H3NB 3IDJA 1KPVA 1KEMH 1ZA3B 2F53B 2K1MA 3NZ8B 2DTML 5E9DD 1J5OL 3B3IA 3QPXL 5E2WL 2FO1A 4OZIE 1NKRA 2MHAB 2GW5A 4W4NA 4P46C 1AE6H 3GMMA 3BXNA 4DGVL 2C1OB 3U0PB 1A6UL 1MCOL 1J5OH 1JTOA 2V7NA 2EDJA 4TSAL 3O3AA 4S1DC 5I0ZA 4PRNA 3SE4C 2NR6D 1KACB 3WN5A 5I8OL 1VFMA 3FQNB 4ELMF 3NPSC 4PJCB 4JRYE 4H20L 1HDMA 3FRPG 3L3KA 4PR5B 2VITA 1FL6A 2WP3T 3LEYH 2O93L 1E6OL 4I3SH 4TPRH 2IANE 3UDWA 1BECA 3QWOB 3S3JA 5DD1H 3UZQA 2VOTA 3KLHD 4O2EB 1YN6A 2QKIB 3PWNA 2GJZA 4QCIA 4ZFFA 1MUJB 4JRXE 3QJFB 4MVBD 5JXAL 3HZMB 1XIWD 3RIAF 2ZUSA 3EAKA 3TBWA 3BHBA 4MJ4A 5CGYD 2FX7L 1VSCA 1FRGH 1NDMA 4FQ2H 1UZ8B 5JXAH 1MLCA 2VYRE 3U0TA 4LSPH 2NY5H 5C07D 3Q6GL 1L7IL 1B3JA 4QHKJ 3QRFM 3B5HA 1NGYA 5HTSA 1JF1B 1N6QH 3CSBA 1R0AL 5CBEA 3WV0A 2ZJSH 1A9EB 4N8VB 5D1XA 4LLVB 4QT5B 4LSUL 1Q72H 1T6VN 3RWIB 5C0DA 1TVBB 4Y5XC 3ILPA 4X99B 2CLRB 1G7QB 1LP9A 2XKNA 1AHWA 5E7BA 3D25A 1DP0A 4JDTL 4K71C 4ZMAT 2X70A 3HNTH 4FABL 4YHNB 4JFPB 1MHHA 1CLCA 3O6ML 3QXVA 1QACA 1ZEAH 4PJ5B 2R1WB 4AEEA 4M6NH 2YBRB 3IFLL 3K7UA 4LHUD 3OAUH 5FHAH 3WNOA 1A4KB 3STZA 4KJWC 3QWQB 1ITBB 2VC2L 5D2NB 2JJSC 3TBTA 5BOPA 3VXSD 4LCCB 1UCTA 3O45B 1CIUA 1YECL 4WIQA 2QTEA 2JCCE 1ED3A 3G5ZB 1FCCA 3ZSTA 4GJTB 3P9MA 5J57B 5DJCA 3ZKXB 2N1KA 2OJZL 4GLRI 1NC4A 3ULVF 5GZNC 1MIEH 3ZDYE 2DTSA 1JMZA 4WDIB 4M8VA 4YHIA 1G9MH 3UTOA 4PRAA 1J8HA 1BBJA 1H15B 3NA9L 4C4KT 5C0CD 4YHYC 3N1FC 3QUML 4HXAH 1YMME 4C56A 4PJ8D 3OQ3B 12E8H 4Y1AE 4NKDB 2HJFB 1A1MB 3X14A 3SKUD 1KTKE 3T0EE 1U6AL 1ZAGA 4LLUA 4JO1L 4QXWA 1EAPB 3RAJL 2FL5A 3DXAE 1OB1A 3GSNA 4H88H 5J13B 1HCFX 3CSYA 4WCYL 3L5JA 1FAIL 1PJ9A 2JJUA 4P46A 3KYNA 4NGHL 4Z0BL 2IH1A 1E4XI 2Q8AL 1FYTE 3D2UD 3K4ZA 3I6GA 3VWKD 4U1LA 2GJJA 3DUHA 3SE4A 1L6ZA 4DN4L 5KTEL 2P7TB 3QEQE 4TTGA 1FAIH 1KIRA 2XG5A 3Q3GB 4PJEE 4KKCD 2HP4A 1U91B 3GUTA 1ZANL 1WITA 1QLEH 2AVGA 2D0HA 4GO6B 3LPFA 1N4XL 4LEOA 2J4WL 5DR5H 5E08L 5IJVB 3MUGA 1BJ1H 1ZXQA 1UJ3C 5IMMA 4HX1B 3BKYH 4PJ9D 5K9OA 3VRLF 3FFCD 1N4XH 1TQBB 4QRQA 4CJ1A 3V7AE 4TVPD 2QADD 3ZTNH 3KXFE 1I1AB 2NTFB 2RQ8A 4HIEA 4ONGH 2ITCA 4MXVE 1AFVH 3FO2A 5JDJA 5KN5B 2VKXA 5FGRA 4U3CA 5FHBL 1TZIA 3DRTA 1ADQA 2AKRA 4JO2L 2QQLH 1Z9LA 1IEBA 3CVHL 2X4RB 3GNMH 3KYOB 4JM2D 1NC2A 5LKNA 4K7PH 3CXHJ 3H8NA 5GGSA 2M1KA 1UM6L 1RURH 2DQHH 4NKMB 3QIBC 1QO3A 3WUWG 4U3XA 5JDSB 2X4TA 3MRIA 4HH8A 2J8UB 2VXVH 2HT4D 1UM4L 2L0DA 4ZUUA 1DBBL 1RVFL 8FABA 3VU2A 3MRCB 1B6DA 1U8KA 3BPLB 3FQXB 5TQ2L 1UM6H 2Q86B 5FO8B 3RVWC 5FF6A 2MTPA 5IVOA 4YDVB 3QULA 3TYFB 4E5XB 1HH9A 2YD1A 4WWKB 4BSVA 4PGJA 1H3PH 4NCDA 4J3UA 4G8GA 4KTYA 5F7KC 1DBBH 4UILL 3P40A 1W2KT 4GMTH 3O81A 5IW6B 2BNUA 1BGXL 1CK0H 4WI5A 2GJ6D 3HAEB 1JCKA 2JJSA 1EGJH 3RWFB 1K4CB 3NIDE 4PJ7A 2K9UA 3IT8D 3KPMA 1S8DB 3M45A 2R39A 3OR7B 4M61B 4KJQC 2D9CA 1DN0B 4OFYA 3GB7A 2BOBB 3GHEL 2MWCA 1TJGH 5IF0B 5CZVH 4CDGC 1W72H 3CFCL 4FXLA 4LSRL 2HLAA 4Z7NF 1N0XH 3DYPA 1P1ZB 3E8UL 1LD9A 3RGVC 4PV9B 2OCFD 3OF6A 5DTFA 4OAWA 1ORSB 2DYPD 5F71A 5IQ7H 4Z18A 5I75C 1NL0L 1IQWH 1U41A 2NXYC 3QUMA 2M2DA 4JN1L 3SDCB 4K23L 1J87A 1XR9A 4LHJB 1HKLL 5EORH 1YYMH 3DO7A 4PP2A 4RGMC 1WC7B 2DS4A 3B2UD 1WLHA 3ROOA 3AAZB 1YEKH 4JLRA 3PE9A 3U0WH 5I1KH 3WO4C 3TO2A 1ZT7B 4P2QA 1TJHH 3MX0A 3VXRA 5IBTL 2YK1L 1A6VL 1RZKC 2EYRB 5HHOA 2CQVA 3RPIA 3VFVA 1HXYB 1UJ3A 1OAXL 1IE5A 1VKXA 2VDRL 3QNXA 4YEFA 3D3VD 1WAAA 2VAAB 4IBLT 4X7TA 3QPQD 4G6FD 5HHQB 1C5DA 1MWAL 5MEOA 3L3IA 5CD5C 4XGZA 1MJ7H 4JY5L 3FT2A 5IVZB 1J12A 3VFMA 2RHEA 4LIQE 1JNHB 4K8RD 4L1HA 1IEHA 1MI5D 1U93A 2ITDA 5JOFA 2QBWA 1FZMA 3HKFA 2UUDH 2A6JA 5HHMB 1P53A 1VACB 3QUXB 3DPBA 1XFPA 4C54A 1FLRH 3QIBA 3TYGH 1DANU 2OSLB 2ARWA 4R2GC 2OYPA 1Z0NA 2C4FT 5C0BA 2W0LA 4JDVA 3DUSA 3WYRA 3G5VA 4K3GA 5I18H 1QVOA 5TDPB 1ZS8A 2HTKD 2X2YA 4X4YA 1XF2B 1GZPB 4KRPC 1A6TA 4M6MH 5I74B 3DVNB 5GJSH 3QSKB 4C55A 3R0MA 3N50A 1IGTB 5F7MC 4YC2B 1BJ8A 1NUFA 3WIHH 1XGPA 2EIBA 1TTUA 3SKMB 2XA8L 3MLWH 4CUCA 3MACL 1KB5B 1OGAD 4YBQC 3CDYA 1W0VB 3H2WA 4XNYH 3V9FA 3OKLA 5KSAD 4F7EB 5L8KB 4ZDHB 5BZWA 4ZNCD 1UXWA 1ZLSH 4KK8C 4P9MH 4MXWH 4EUPH 1WSST 4HGMA 4QRPD 5ITBH 2EDHA 2MQCA 3MLUH 4WI7A 3HNSL 1BZ7B 4XNQB 5SWZA 3V5KB 1EAJA 4OI9A 4KI5C 5IR1B 4U1IB 1CDHA 1QFWM 5IFHH 3QG6A 1C12B 1LO3L 1JHKL 1QEWB 4N0YL 4FXKA 5E4EC 3RZCB 2HG5B 3Q6FB 4KQ3H 4LGRB 5EO1B 3MOAL 1FNHA 3RTQC 5ID1B 3NCYP 4QO1A 4RFNB 1C1EL 5DJ6B 4Y2OA 2A1WL 3GKZA 1DQDH 1JPST 4OZIF 4YXLH 1F58H 1Z0MA 4X5LA 4LPUA 1GZQA 4K3HA 4EBQL 1FG2B 4JFEA 1OQOA 4MJ5A 2R15A 5HPMB 1VADB 3ZSSA 1HQ4A 2EEAA 1JTPA 2V9QA 2YPKB 5I0DA 4FTVD 3WS6A 3W0WB 2GSIA 4L8DB 3DSFL 1NGWB 2P5WB 4LSTL 3BW9A 3GMRA 4F58L 4UAOB 2VLKB 5DRXB 4BQ8A 1LEKA 1NBQA 4NQUA 4MS8D 1SYSA 4FFVD 5IWLC 2IPTL 4YE4L 2H1PH 1JGLL 3O2DH 2IBGA 4HJJL 4WFEE 4IDJH 3VFOB 3JV4B 2YMXH 3L3OB 4I5BB 1TZHB 4FRWA 3WSQH 3ORJA 5T1KD 4OV5B 1D9KD 3VXSE 1BVKA 4EIGB 1EEYB 2WIMA 3UTSE 1B0GA 1AXSA 2AI0H 2FBJL 5LCVH 2MCG1 2AJUH 4PRIE 1SBSL 1ZTXH 4P48A 3RJDA 3REVA 1Y6KR 32C2A 1HIMH 3JWOL 4X98A 3QEUA 4WEBH 3BPCA 1F4XH 3MV7B 4DQOL 1AH1A 1A6ZA 2ENYA 3V7AG 3MCLH 1T7WA 4PBXA 2WIIA 3FN0L 4EUPG 3Q5YA 3O4LD 3EYVA 3TCLA 1NFIA 1K3IA 3TV3L 4JKMA 4LCWB 1T1WA 2P48B 1GGCL 3IKCA 1CFSB 4I0PB 4LAQL 1JNLH 1IT9L 3NTCH 2LE9A 3TNMA 2XZCL 3QFJA 5FDWA 2BSED 1AD9A 1PKQB 4D0DB 43C9A 1IRAY 4G3YL 2JCCF 1FJ1A 2V9RA 4DOHB 1I1RA 4PS4L 4GMSH 3RVUD 5IB5B 3ZDYF 3FTGB 1M1SA 4G6KH 1OGTB 1TPXC 2PXYD 3PP4H 4ISVA 4LVNC 4YFDB 4LLWB 4HUKB 1YNKH 1QSVA 4L29B 4JQIL 2J8HA 4Z0XA 1I9JH 3RWGA 5HI4D 3MYZA 4FFWC 3RTQA 1RY7B 2JB6A 4DZ8B 3W9EA 3MRQB 4NIKB 4HWEL 1A1OB 2C3GA 5TPWH 5DYOA 2XQBH 3VG9B 1RFDH 5GRXG 5DMIH 1C08B 3PNWB 1B88A 4OB5L 4R3SB 4AL8H 1CD1B 4TVPE 4YDJA 5IB1A 1PFCA 3BDYH 3WNLA 3VXUA 4OF8A 4XCYA 1JYWA 2DWEB 2OTWB 4WTZG 1QSFA 2VLRE 3FCTB 2FLRT 4Y88A 5EO9A 3FHAA 4OFKA 2EDDA 5C6TL 3GO1L 2BSSB 4CN4A 4OCWH 5ITFA 4PJEF 4UBDD 5EBMA 5D2LA 4XMKH 5DRZA 2J6EA 1N5YH 2P24B 3HC4H 2YSSA 3SY0B 1RK1B 1MREH 2VIRB 4P0DA 2D31A 2Z91A 1PEZA 3E3QC 4QWWC 3TZVD 4CW1B 1EFXD 1K4DB 4OIIL 4XBEH 5HVHB 4WTWA 3MO1B 4WU7A 2DBLL 1EJOH 3EFDH 5IWLA 2BVUA 2NYYC 4TTDD 1BMGA 2VABA 5F9WC 3H3BC 4EIZC 3ZTJH 2CKBL 2ESVD 4X80L 1ZLUK 4BQ6A 1YNTA 2EDRA 3HB3D 4WW2F 4DZBB 1UACL 4O2FA 2VUOA 4MJIA 2Y25A 4MXVF 3IFPA 5EFIA 3OAZK 3HC3L 1UB6B 4X80H 4K3DH 1BIIA 1UACH 3G6DH 1T1XA 3BWAA 1T20B 4XPFL 2DQIH 5ICXA 4HV8B 4ZAKB 2LTQB 4PLKD 1NGXA 4OLXH 3V4UL 1JK8A 3T3PE 3SPVB 1KJ3L 2YRZA 3V4VH 4NZTL 1NANI 4D3CL 5FYKE 4Y16D 2X5PA 1QSEA 4YAQA 1YUHB 3QG7L 3V4UH 1EEZA 3QI9B 3QNZB 4BH8A 2AK4D 2HN7A 4AH2A 2YD7A 2BNQB 4O58H 3RHWF 1MFCH 1YEGL 2E6QA 3MRRB 3AGVA 4QXTA 1GIGH 5CINL 1U8IB 4IOFC 1T04A 3OKYA 4N1EA 5GRYA 3KPRD 3NIDF 3H7BA 4WWID 3UJJL 3GJFK 1EHXA 2AEPL 3T65B 3ZDZE 1XGYL 3CPLB 1B2WL 1U8QB 2F5BL 1KTDA 4XI5C 3S98A 1INEL 4TUOA 5GJTL 2WINB 1KPUB 1EO8L 3LCYA 3D3VE 3DHJA 3TGXA 1BQHA 2IANB 2IGFH 1INEH 5FYJL 4YGVB 1FNGB 4Q7DA 2RCSH 1JYVA 2EXWD 1R5WB 1G0DA 3B2VL 5D5MA 3SKOB 1J88A 2W91A 1YY9D 2EH8L 1I1YB 3BEWB 3O6LH 4ODUB 2PKDA 4BZ1L 1TXKA 5ILTL 5B39A 2E27L 1P4BH 4GBXB 4PD4J 2H2PD 3TBYB 4QTIH 4LF3B 4OZFH 1XGRB 3RUGE 4IHOB 1UVQB 4H25B 1I9RH 1E4JA 4PGBA 1WGOA 4LCCC 3LSOA 3IJYB 1IQDA 1DANT 5KVFH 4F33B 3ZKXC 3ZTJG 1T89C 2X44D 3BZFA 3KPSD 5DD3H 3SDXE 2N7BA 1KEGL 2NY0D 5J3HD 1FFOA 3DSNA 4LQ1A 3CXDH 4OCSL 4B41A 2XWJA 4JVPA 1X6NA 1ZA3A 3BAEH 3RIAK 1J10A 1OLZA 4HKJA 1GGIH 2JELH 4R26L 5DEFB 4K94L 3JUYA 2B0SH 5LBSL 2CKBA 5ACZA 3VFWA 2EYTB 1MEXL 3B8SA 1QFOA 4OF7A 5IT2H 3DYMA 4NJAL 3BH9B 1KLUB 3HN3A 3N9GL 2H6PA 1NUNB 1EK3A 4TVPH 5CJQH 1NMBL 3FQNA 5DUBB 3TN0B 2JCCB 4PR5A 4MMZC 4X6EB 3RU8H 5I1HL 1G9NL 1MCDA 5FKAB 1OD7A 4FZEL 1RJCA 4MD4A 4RWYL 2E7LC 5HHPB 3JSSA 4G9DB 4HWBH 4EJ1C 2EDTA 3G6JE 3A6BL 3QJFA 5C0AD 1A7PH 4RX4A 4Y1AB 3QDMB 1G9NH 1EV2E 1MWAB 2CDFB 3T0EB 3DXAB 4X8JA 3BJ91 3O8XB 1WZLA 4ZPVB 5MENB 1A0QL 1I1AC 1EXUB 1T83C 2GUOB 3OX8B 1QFWI 4LHUG 4U31A 5H37H 4LKXA 2ZNXA 1FYTB 1O5DT 1SHMA 1IGCH 3SKJH 1BIHA 1EERB 3GRWH 4GW1A 4E9LA 1KCVL 4F7MB 3QXTA 4MAYD 3TT3L 3LRSA 2PTUA 5CMAA 4N8VA 4PJEB 2C3XA 4GW4A 3LS5L 1MFAL 4LMQE 1VERA 1BX2B 2FBOJ 2XWTA 1JGDB 1TVBA 5A40E 4FTVE 5I1GL 5TGBA 4XP9H 3RNKA 1CTNA 3GMNB 1YJDL 5ENWA 4PGCB 3QIWB 4HJGA 3K8LA 4RNRB 3QNYB 5D93C 4NZRH 4JFPA 2FSEA 1PQZA 2AJSH 2V7HB 4OZFG 2ZWLT 1KBGH 5FYKH 1KPRA 2OTPA 1AD0A 3GIVB 1G6RA 8CGTA 1FGNH 4WW2B 2DQJL 1AIFB 3GKWH 3NACH 2EH7H 2EIDA 1OQXA 2I5YL 4EUPB 1IM9A 1BVLA 4M7LL 1F11A 3JWDC 1OL0A 4XWOD 4LCCA 1NAMH 1CL7H 1JNNL 4Z76B 1XF4A 2FGWL 4QY8A 1TQCC 2IALB 1BREA 4HF5L 1T89A 4ZUVB 4DEPB 4U4BA 4M7LH 1OSPH 5D4QA 1OF2B 4R96B 2XRAH 4OQ1A 4FNLH 5DJ2B 2HJFA 4NN6B 4YEEA 2WBJD 4ZO7A 3GEWB 4NYLB 4KAQL 5DQJA 4OGYL 5E4IA 4MHHG 2YZ8A 4Q9RL 4I18B 3RX7A 3EOBB 4GRLB 3EYOB 2IF7A 4NQEB 4QGTA 1RMFL 1NGZA 4KAQH 4NQXB 4F57H 3O4LE 1KFAL 2OJEA 3MJ7A 1TETL 2P7TA 4NRYB 1N3NB 4XC1L 2GTZA 2QSQA 2XXCB 5EULV 4ZFGL 2O5YH 3VW3H 2VXUL 4J8RB 4TNVF 5TFSH 2AEIT 4K8RH 3U9UB 5BVPL 5IB2B 4DKFH 1VEMA 5JHLH 2DIAA 4ZFGH 1B4JL 2VXUH 3QQNA 1F8TL 1VFBB 4HX1A 5GISH 3E2HB 3KR3H 5DJZB 5HGBB 2DL2A 2AABL 4X6DF 3ARTA 5H37G 1OAQH 4PTTA 4NQVB 1I1AA 1T83A 4K3JL 4PY7B 4IRJD 2IQ9H 1UCBL 3U9PH 1PW3A 3WNPA 1SJVA 2Z92B 2DLHA 2VSCA 5I16A 3P4NA 3LEXB 5T1LB 1WV7T 1P84J 4S2SB 3ZYIA 1UCBH 4G43B 1ROWA 4TRPL 5KVDL 1N2RB 5JPNB 1UWEL 3GJFA 2GITB 2A77H 2NXZC 5JDSA 5JW3H 4FQXC 4L4VD 4L3CB 1JWMB 5J1AA 2Q86A 5FO8A 1CR9L 2IBZY 3ULVC 4IMKC 3MRFA 5E70A 1PZ5A 3LS4L 4KPHH 5I30H 3WS3A 4O4YL 1X6LA 3ARBD 3QDJB 4I1NB 1ZHBB 4LFHD 4NZDA 1H3VA 3BP4B 3SGDH 1T2QL 3CFJB 5IMLB 4YC2C 3UP1A 3HAEA 1G6VK 5BZDA 2OR9L 1DR9A 4J23A 2PR4H 1GAFL 4O4YH 3H6JA 1SM3L 1G7JB 2JE8A 3KAAA 3OXRB 1U92A 1MVUA 5IOPB 4PBVC 1DN0A 5EU6A 3GSOA 5KVMC 4X9FA 1U8MA 1JI1A 3FB8A 4XBPB 4HFUL 2FIKA 5IF0A 1A3QA 2XG4A 3U36B 1GH7A 4ELMA 1BEYH 3V6ZB 2EC8A 2H32A 2Q7YB 5HYQA 4HAGA 3ARGB 4AM0B 1Q9OB 1W0YT 1I8LA 4S1RH 1U8OB 4ZFZB 3TFKC 4ZO8A 1IFHH 4EEEA 4B5EA 5I73B 1FZJB 2AXFA 2WM0A 4P9HL 3H9ZA 3RZCC 2MQ3A 3E6HB 2P46B 4H26B 4Q9BA 5L7XL 1QLFB 1TLKA 1X5AA 3TM6A 4XWGH 2AK4E 1ZT7A 4FFZH 5LXGL 4P2RD 1DBJL 4P9HC 3L95B 1FL3B 5E9DB 4FN0A 2R9HC 3KWWA 3KPRE 2RFXB 3F7YA 5FO7A 3UJIL 1PG7W 1HHHB 3UYRH 4C4KO 5KOMC 4TOYL 1J9CT 3MODL 4PBWD 3M17A 4RMUA 4ZXBD 4XAKD 1FV1A 4ORGB 5TQ0L 1TVHB 4AG4L 4RGND 3DYOA 3T3PF 5HDQH 3I6LD 3H9SE 4JGUA 5ESAB 4TOYH 1S5HB 4OM0L 3P0VH 5IROC 5JUEH 5SV3A 3WLWC 5DJYB 3G08A 2UY7A 3A0OA 5IVZA 1UH3A 1PDKA 1JNHA 1MF2H 1TDQA 4Y89A 2FYYA 2R29L 1SJXA 3RVTD 1VACA 2V2XA 2DKUA 2XPGA 1XIWB 3BESR 2VR5A 5BV7L 5IP4A 2XZQL 4OLVH 2OSLA 4IMLA 4K7FA 2HLFD 5E7FA 4FQXA 4X7EC 5DK2A 1FZKA 3X12A 3C87A 4MAUH 3ZDZF 4HUVB 1MFBH 5EZOH 4YXHH 1MFDL 2IQAA 3VFRA 4YBLC 1W8NA 4NJ9H 4IMKA 3QXAB 1LMKA 5C07B 3OKMB 5BV7H 3BH8B 2H2SC 1KGCD 5D71H 5DHVH 4RQQA 4KGJA 1GZPA 2FB4L 3FRPA 3KPSE 1MFDH 3H9HA 5GIRA 3LQMA 3SE3C 2EEBA 3CK0H 2LV4A 3MPCA 2PF6A 4P2YA 4JR9L 3MQIA 4QLRA 4XP4H 1HWGB 4L1DA 3SJVD 5CEYA 1IKFL 3SO3B 3SDDC 5A2FA 4WO4D 2UZIL 3V6BR 4J4PD 4YHOL 4KGLA 2NY5C 4I0PC 5ALBL 5GS0D 4LHUB 3RUGF 4PJXE 2E7MA 4YUEL 5A16B 1NUGA 4KQ4H 3DV6B 4PG9A 4XNQA 1FNLA 5EOTA 4LOUD 3VXSB 1K8DA 1K5NB 3MRNA 3S34L 5H2BB 4Y5VB 4HLJA 4KXZI 3SDXF 4KHXH 4MDJB 1UKQA 3ILQD 4KJPC 3FO1B 3LHPL 4FQHB 3HNVL 4OCYL 1M7XA 1VGEH 1SBBA 3U4BH 5IFAL 1Q9WA 2NW2A 5C0CB 5ID1A 3D1MC 3HG1A 4PJ8B 3S96B 4U6VH 3LHPH 5DJ6A 1ERNA 2Z93A 3VG9C 5E6ID 4Q9CA 3DETC 4I2XA 4OZFB 3IFNL 5IFAH 5D7KD 2CGRH 5C09A 5CSZA 4U2YA 3ES6A 1KNOB 1CQKA 3TT1H 4ALAL 1MRDH 4XRCA 5AZ2H 1NH6A 1WBYA 4P2OC 2Y23A 3D2UB 2VDQL 3OAYK 3VWKB 1P7QD 5F7HA 5I1LB 2XXMB 4UT6L 4L8DA 1ES0A 1G9MC 1XGQA 4HKXB 1NGWA 2P5WA 5KANG 2XYCA 2Y5TA 1EX0A 1MCPL 3FB7B 3PF2A 1J7VR 5IROA 5E8OA 2GK2A 4LDLB 5LG1A 5HJ3B 5CCKH 5DFWH 3FOLB 2Y6SC 5HYJE 4QRRE 4V2CB 1ORQB 3G6JF 1ZGLB 5CJOH 2K7QA 1MCPH 4KROD 5DGRA 4M48H 4UV7L 4FP8H 5ESVB 4ZNEE 4PJ9B 2A74A 3FFCB 1T66D 3VA2C 3L3OA 4M3JA 3RKPA 3UPCA 2VZ1A 1PYWA 3LDBB 5J6GB 3QUYD 4HBCH 4PRPA 2QADB 2BK8A 1GC1H 4U7SA 1XF1A 3BZEA 3MNWB 3LQAL 3MJ9L 3QO1B 4OV5A 3V0VB 3PWPD 3MLZL 1EBAA 3TP4A 1MCJA 4TULL 25C8L 4LSDA 3HE6D 4V2BA 2AK1L 3G04A 4ZAKC 1F45A 4JM2B 4BUHA 2VWEE 3IAQA 1X5FA 2A9ML 3SE3A 3MRBB 2GCYB 1P7KB 4NQCA 5DRNB 5BRZA 4AEIL 1LO5B 5DFTA 1QA9A 2F8XC 4R4FL 1CICD 2H26A 1XZ0B 3SDDA 4D9LH 4ZSOA 1KV3A 5E1AA 4LCWA 3EO9L 3QI9C 4AT6A 5EA0L 4HH9B 4I0PA 4JDZB 1UEYA 2EDOA 4K3EH 2XTLA 4EI5D 3IDIB 5JHDD 5DMGC 1A1NA 3CXHK 2NY2C 4D0DA 1JVKA 1L6XA 2GJ6B 5INCB 1AQDA 2AXGA 1GOGA 2DQTL 1MCNA 1AY1H 1H8OA 3EJYD 2ZG2A 4KK5D 5DC9B 2A73B 4L4JA 4I0KA 1FIEA 1OGTA 4EXKA 1CFVL 3WUWA 4L29A 1QRNA 5F1IA 2Z8SA 3U30B 2JK5B 3FQWB 1EBPA 1V3MA 5E8PA 5F93C 1U2HA 3BGAA 1F4YL 3FO9B 1S7XA 2HFEB 1Q9LB 3PNWA 3C9NB 5GS2D 1J1PL 4CRPA 2HWZH 2DYPB 5DQDH 4BQ9A 1NAMB 3C6SB 1AQKH 2QL1A 4XNMB 3IB4A 4P2OA 1N7MH 1Q9KA 3LN9A 5TDOB 2BSSA 5F3BB 1VGKA 3Q1SH 4P23C 5CSBA 1V7NH 4PYHA 5B4MC 3WMSA 2YPVL 3K8KA 3B9KD 2R2HA 1I1FB 2FO4A 2XICA 4UQ2A 1I4FB 2DBJA 4PJAB 2CXGA 1QFUH 4R7NA 5F6HJ 3MO1A 4CAGA 3KJ6L 5EU7E 2B4CL 3KHOA 3LIZH 5GSRA 1ZHNA 4X5WA 1PZUB 2J1KA 3DTXB 2Z8RA 5CILH 3D3VB 5BS0D 2N56A 4DZBA 4NDMA 4AQOA 4MD0A 4QHMB 3RHWK 3P0GB 2FJHA 4W81A 4PGEA 4G6FB 2YHGA 2VNCA 5F3HA 2B4CC 1ZSDB 3VXOA 1R3IL 3P4OB 1DUZA 3QHZL 3BZ4A 1UA6H 3ESUF 4JAMB 1VESA 1KCRH 3ARFD 3GBNL 3L3DB 5E2TL 1T20A 1UFUA 1NCWL 2Y06H 3D0LA 3TWCL 2D7TL 4Y2DD 4RDQG 1MI5B 4R7DA 5JXED 4ZAKA 3KGRA 2R0WL 2XKSA 3RUGB 5FA4B 3MLRL 5JIHA 3LEVH 4GKSB 1DBKL 2KH2B 3SPVA 3TWCH 4PV8A 3PHOA 3AVEA 4P3DB 2VDPL 1H8SA 1FP5A 1OP5H 1FDLH 2CUMA 2P49B 1ETZA 4XXCC 3ARVA 2NNAA 1YUHA 4K2UL 1ZK9A 3DIFA 4XXDA 5F97E 1X5XA 1V7MH 3QI9A 3QNZA 1K3ZA 1MCQA 1MCLA 1IBGH 4WI2A 3O3BB 1MQKH 5EUKB 3AU1B 3D18B 3KDMB 4Q0XL 3HMWH 4DJMA 2J88H 5BO1L 3T0EC 4Y4FC 3SQOH 2CPCA 4HJ0C 2R4RH 3F58H 1A3LH 3WXWH 2APBA 3O8XC 3D69B 3U83A 5C0RL 3DX9A 4OZIA 5HD8D 1CDJA 3T65A 4LPXA 2DM7A 1OGAB 2DI8A 5BO1H 1KJ2H 4XMLL 3CPLA 1U8QA 2W59A 4F7TA 1A3RL 5KSAB 4E42B 5IV2B 2B20A 2B1HL 3CFBB 4UIMB 3TA3D 4BFIA 5C0RH 1G1YA 5L2KE 1LDPH 1KPUA 4XCNA 4G9FE 4JRYA 3OXSA 4XAKE 5DD5L 4QRPB 4OF6A 4NNPH 2I9TB 1A3RH 3QWRD 5K9KB 2IANA 4U1KB 2ILLA 4L3EE 4YGVA 3I6LE 4JG0H 2ZSWA 3PQYD 4LLMB 3ZYOA 1I8MB 5JPMB 4JRXA 1I1YA 3VGHA 1DEEA 3ELAT 2AXJA 4HKBA 3VCLB 4ODUA 3O2WH 2ATPB 3W5NA 2DQFB 5T3XE 4WW2C 3DX7B 3TBYA 1JP5A 1YEHH 4P23A 4LF3A 4XNXL 4IHOA 1UVQA 4H25A 1W72A 4N1HB 2F5AL 4CU7A 4FA8A 5I1CH 1V8HA 4M7LT 3BN3B 4RDQF 1RK0B 2Y72A 1F6AA 5KVEL 3ZKMD 4DEPC 3BP7B 3FOMB 4NFDA 4D0CA 4LLYB 3UYPA 2QSCL 4JANB 1U95B 4ODXB 2VDLL 4WJ5B 2G60L 1LE9A 1KGCE 2VJXA 2PYED 3WLBA 4FTVB 3GSWB 1YC7A 1JGEB 2B5IC 1HHGA 1H0DB 3MLXL 4TUJB 3GSRB 1YPZE 2GSGB 4HT1L 1JGUH 2AGJL 5DUML 1HQRA 4E41E 1KN4H 4WUKL 3ULSB 1ZT1B 3TPUA 5FB8A 2D4DA 4I18C 3M1BB 4ENED 1EO7A 1AJ7H 3ARED 2V5RA 1J05A 3RWEA 1G7HB 3ARUA 4HGKC 3WFHA 5KJRL 3AUVA 3ZKSD 2JCCA 4X6EA 5CIPA 2MMXA 1WQVT 5F9OH 1SVCP 5FKAA 3WKML 4LCUB 4XXCA 2NY1C 5T1KB 1H8NA 1D9KB 5I8EB 1CFNA 2HA1A 1WJ3A 1AGFA 4G9DA 4O5LH 4ONFH 2OR7A 4JY4B 1T7ZA 2LU3A 1YMMA 2A6IA 4BA8A 4Y1AA 5C08D 1PY9A 3KYMA 2CUHA 4Z78A 2CDFA 4OTXH 1BQLL 3T0EA 1F6FB 2GFBA 4NHUA 4Y4FA 4P3CL 1AKJA 1UT9A 2CLVB 3O8XA 4ZPVA 3ARDC 3I2CL 4KTEH 5CBAA 2J8OA 3QDGD 4KY1L 5I9QC 1CBVL 2XZZA 5L6YL 1FYTA 3O4LB 1ZGLM 2I24N 4JPKH 2DJSA 3QEQA 1S7WB 2BVQA 2R2CA 1MJUH 1ZA6B 5BV7B 2DN7A 4XPAH 4PJXF 1MAJA 1CLZL 1JGDA 5A2LH 4HFWB 2W07A 4HMEA 3WFEH 4I8DA 3ULUE 1UXSA 3RWDB 3BPOB 2APFA 1S9KC 3KS0H 4FFYH 4HIIB 4GKZA 1F13A 4RNRA 5IMOB 3KPQA 2P8PB 4NO2B 2ZUYA 2G9HB 2BMKA 5IIEA 3ROLA 4M62L 2V7HA 4MNHB 2PXYB 4LIQL 1N64H 3ZHKA 2ORBL 4Q9QH 3VFTB 3MV8A 4L4TD 4WW2A 3D85A 1UWXH 3S5LB 3KXFA 4EUPA 5E2UL 1JYNA 4M1CD 4U1HA 1QRKA 3K4AA 5LVEA 3PDOA 1JGVH 3BN9C 3JTSB 2VXQL 4DCQA 3WE6B 2IALA 1LO2H 3PL6D 4D9RD 3LKRB 3U7YH 3QJHB 5K9JL 2FWOA 2YKLH 4NQDA 5GGSY 2IBZX 1MFEH 3PWPE 1OAYH 3PWVB 4GW5B 2K3TA 5DEGB 4R96A 2PO6C 2DKMA 1S7TB 3MREB 3X3GL 3KJ4B 4U6XB 5GRUH 5JLZB 3MA7A 3T1FA 5H94A 3REWA 1ZLVK 3TZVB 4I18A 1EFXB 5I73C 5B8CB 5E8DL 2A9NH 1FSKB 1E28A 1DE4A 3JUZA 1T03H 1K85A 2GKIA 3GMOB 5EWIL 2DQGH 4KK6D 2CLZB 2QSTA 2AP2A 2ESVB 4LRIC 2YOCA 3V0WL 5LGJA 4CADB 4WTZA 3VD3A 5JHDE 4NM4H 1YEFH 5AYQA 1WCBA 4R4ND 1Q1JH 5ICZB 4U7KA 4U1JB 4FQJH 5CD3B 4D8PB 4JFHE 4XP5H 4HWZA 3MV9E 2R56L 2NCMA 5DJZA 1FVEB 2BY3A 4KJYB 1FCGA 2I60H 5GPRA 3QIUC 1RULH 5C2BH 1OAZH 2ZCHH 3O2DA 3ALPA 2Z4QA 1WTLA 3ARDA 3MBED 4KVCH 5I2IB 2R56H 1SMAA 4LFHG 4Y16B 3QQ3B 4NQSB 5TDNB 3HPLB 1N5AB 4OLYL 1S78C 2FHCA 3S37X 3KLHC 1CVRA 5DFVC 5DC4B 3T77B 4S2SA 1ZGLP 4UT9H 1CIDA 3C8KB 4MVBC 2HVKA 1N2RA 1H3XA 3IKKA 2YWYA 1XIWC 2MSPA 1IKNC 4AZ8A 2GITA 3SKNA 3U7WL 4KTDH 3L7FB 2ICCA 5CGYC 3KPRB 1G7IB 4UTAL 4V1DD 3VFNB 1MJJB 3K74B 4NKOB 1CYGA 3VA6A 2ZP0T 2YD9A 4KDVA 1GVIA 2YWZA 5ICYB 3WFDL 1CLYH 2J3SA 4NZUL 3SDAC 5CEXB 5GS0H 2VLJE 4IM8A 5IM7A 4MNQD 5EBGA 2J2ZA 4GAGL 5IMLA 1F2XK 2X40A 4N68A 1FNSL 4R97C 3WD5H 3ZKND 5BS0E 5C7XH 3PIQB 2J7LA 3D6GA 3UTTD 1XCQB 5T3ZE 1XF3A 1G7JA 5DURD 3SO3C 4YJZL 4M6OL 1KELH 1L0XA 5EOCH 3KPLB 3QP3A 5HHVL 1FH5L 2Y7QB 3PGFL 4PREA 4HDIA 5EZLB 3UZVB 1UYWL 3AS2A 4XBPA 1YEDB 4WY7H 2PO6A 2MPAL 4Y19D 4OCNC 4P2CG 4DUVA 3U36A 1QBML 1XH3A 5TE4H 3VRIB 3V6ZA 2Q7YA 2YD2A 3BSZH 4YQXH 5DVKA 4F15B 3GHBH 3P11H 4XPTH 1UH4A 1FFNA 4KDTC 1TJIL 5HHVH 1RIUL 1LNUB 1PKOA 2CRIA 1JL8A 2H8PA 3MA9L 3WHE0 1IAIH 4OD3L 4ODHH 2KKQA 4FQLH 2BY0A 4LU5L 4MCZB 1HEZB 2VDMH 2D7PA 2MJWA 3L9RA 3HCVB 1TJIH 1RIUH 3KPSB 4R0LB 3ULUH 4UIKH 5IHUH 3B9DA 4YHKL 2NY0B 3LB6D 1QLFA 2ZUQC 1SJHA 4ZTPL 3BGFB 1MCSA 5CJBA 4LRIA 4JFYB 2X4QB 1GPOL 4N90D 3VFSA 4PJ8C 4PD4K 1NCNA 1FL3A 2AEQH 4LLQA 2OP4L 3EZ8A 4JREB 1WZ1L 3QH3B 4M9PA 1JZ6A 1HHHA 1NCCH 5I8KH 3RWCA 4FQQB 2QEJA 2ADJB 2YRPA 4NKIL 2FJGB 4LVHB 5E8EB 3U7AA 4HEME 4X7DC 5MEPB 1CE1L 3QIUA 3VE0B 3VWKC 3UTPE 5FYLE 2R23B 1BLNB 5ESAA 2NZ9D 2IWGA 2FR4A 1S5HA 3EYUL 1NEUA 3HRZB 4G7YL 5MERA 1WIOA 2Q3ZA 3KLDA 3EKCA 3LN5B 4AENB 1MIMH 5M94B 5DJYA 1J1OH 4R8WL 5KS9E 2KL6A 4YDIH 3N85H 4ZYKB 3PQYE 4LLAA 3FO0L 5FO9A 3S4SG 1YMHB 5C0AB 3JXAA 3L7EA 1XIWA 3PXHA 3FL7A 2IFGA 5BQ7A 1D5BA 2AXHA 2DDQL 3FO0H 2BCKB 2V9TA 3WDHA 4FQIH 3V79C 1NGQH 2DIBA 4WUUD 5J12C 3BH8A 4NNXB 1L7TH 4Y0GA 3SDAA 4WEUD 3M8OL 4MAYB 5C0GB 4JJHA 1F3JB 4XTRD 2EXYD 1YNLL 4ZO6A 1A14H 2UVFA 4PRBB 3JWNC 1IGML 2KZWA 4XX1E 4JY6A 5B38G 1LK3L 2PYEE 4GG8A 5J56B 3OV6A 2VRAA 4HIXH 1A6AB 4BSWA 2NLJB 3C08L 5HI5C 2FX9L 5IHZA 3QAZB 4UZGA 4ACPA 4JKKA 3E6FB 4HGWA 4RMWA 2VISB 2YEZA 3MXVH 5EU4B 3EJZC 2DQCH 5DSCA 1IL1B 4MX7B 4WHCA 1KJ2B 3PHQB 2V2TA 1D6EA 2WWMC 3P4MA 5MEQB 1DUYA 4DVRL 2ZOLA 3LQZB 4OLWL 3OKDA 4KDTA 2DF3A 4JPWH 5A16A 5GS2H 1FBIH 1KN2L 3VXSA 3CFDB 4JFXB 1Q94A 4YDLB 1K5NA 3UTSA 5H2BA 1YYLH 2WUBL 4FQ1H 1N8ZB 3FB5B 4PRIA 4MDJA 1IGJB 4ODTH 5KSVA 1C16B 4N8CL 3QEGH 5D6CB 5KVGH 3MRGA 3EOTL 4F9LA 3HI5L 3V5HA 4X6DA 4OZ4B 4PJHE 1YPZF 4ZFOA 1BD2E 2WAHA 3CMGA 2EZ0D 2WBJB 4WV1B 3NAAL 1RUMH 5JNYB 1KXQE 1RJYB 1I7ZB 4WFFD 1PX4A 1JF6A 3H42L 3GI8L 3GMLB 4KVNL 4PJDE 2BVPA 4WHYH 1CFTA 4KRLB 3D2UA 2FD6H 1HH6A 2ZSVB 5T3ZH 2IPKB 3VWKA 1FO0L 4DGIH 4YX2H 2P8LA 4A6YL 1YEJL 4QKXB 4HUUB 3DURB 3IDYB 5DVLA 4EOWH 3WNNA 5TH2B 3VH8G 2NY4D 5HJ3A 3MRLA 2F19L 3BISA 1LO0L 1I3UA 4HHAB 5HYEA 5FFLA 3HMXL 3W2DL 2ARJA 2OL3L 4NO3B 5IQ9A 4N8PA 2A0LD 3BE1H 2PW2A 1MAML 4MHHI 4N0CC 2WWKO 5GS1B 2CIKA 5DT1L 1HZHL 5J6GA 4PB9L 3L5XH 2NZIA 3EFFB 4L4TE 3WFCH 3RX5A 4G6AD 3KPOB 5C0EA 2NPLX 4IRJB 4RSVA 2VLRA 3VGAB 5HGDB 3R06B 3RDTD 1HE7A 3TVMC 3I9GL 1SEQH 3L3JB 4TQEL 5ID0A 4Y5YB 2WBKA 1FPTL 4WFGD 3TESA 2P5EA 1F3RB 5FUZH 1M71B 1BFVL 3Q5OA 4HWBA 3ISWA 5ANMA 2HRLA 3MRBA 3EOAA 3JV5A 3ULUF 1W0WB 1LO5A 2F15A 4XT1C 1OAUL 4XP6L 3MLTB 4L4VB 5I1DA 2UYLA 1JZ3A 2OZ4L 4X6CE 3ZDXE 4UQ3A 3UC0H 2AV1B 5C0JB 3CSPA 3FN3A 1JRHH 3ARBB 4OZHB 4IRSD 3GRWA 3IDIA 3FB6B 1P84K 4XCEA 1JPTL 4XP1L 1HHKA 1BWMA 4KKBD 1OTSC 3L5WA 4G8FB 3S88L 5INCA 4HC1L 1CD0A 1JUFA 1RUQH 1FC2D 5IEHA 4MNGE 2A73A 4PJBA 4QHUB 2OK0H 5DHXB 3DGGA 4JFFE 2DLEA 3QCVL 4JZNB 3AMKA 3MFGB 2F58H 2A38A 4NWTL 4KWUA 3HI6L 3SOBH 5AYUH 4LDEB 2VXTH 1R3JA 2VZUA 3KYAA 2BVTA 2AQ2A 4MD5B 2CK0H 1JHLH 4WHYG 3MXWH 3OKOB 3HI6H 1BQSA 4L5FH 1HSAB 3P77B 2R0KH 1WBZA 2DYPA 4P57B 3A6CL 5EU5B 1NAMA 1KT2B 1CL7I 4QRSA 3HHRB 4XNMA 4I9WD 3SDYL 4YNYA 5D1XD 1DLFL 1PLGL 5LGHL 1CQYA 5F9JB 4FMFA 5DVOA 3NCMA 3HI1A 4P2RB 1P4IH 4PJCE 2MKWA 3VXPB 4JVUA 1DLFH 1RZ7H 4HZAA 4LPTA 1UENA 1QR1B 1RJZB 3QQ9D 4LRNL 3UAJC 1AXTH 4ZXBB 2ARJQ 2J5LC 3D3VA 1A4JB 1WWCA 4RGNB 4XVUC 2Q8BH 3NFPA 4U1GB 5C0FB 1H3WM 2YUXA 4KKLD 4M43H 2R8SH 1MELA 3P4OA 5JIPA 1A9BB 3D0VA 5EBLB 1U8NB 3FZUD 4CGTA 2O61A 2K7PA 1IAKB 1NCBH 3JTTA 3HC0A 1M05B 3TVMA 3GMQA 5FIEA 1CVSC 1U3JA 1MY5A 5ADPL 4XAWL 4F2MB 3X13B 3O3DB 4FFVC 1D5IH 1CE6B 1CGYA 4JFQA 1PEWA 4JB9L 1RIHL 4LQFH 5BJTA 5F1KC 3RUGA 4U33A 4OLUL 4C56D 2IFFL 3JV6B 3VFGH 5ADPH 4Z9KB 2V5SA 2VZOA 3K2MC 4UU9B 5IESL 4GSDL 2HYMA 4OSUH 3U46B 2KZ1B 4WI9A 2E5EA 4PB0H 3SDXA 2FEEI 2VXSL 4XVTH 1FL5B 5GGUA 3AU1A 4X5XB 3KDMA 4PJ5E 3THML 4OM1H 4CMHB 3UJTH 3X3FH 1YPZB 4JM4H 4NM8H 1M4KA 3C2AL 2HT3D 2Q20A 5EO0B 3HS0A 4NO0A 4M7KL 1JV5B 4JG1L 1CDCA 3TPKA 4N90E 5D2NE 2X9WA 3SJVB 4JFOB 3S4SB 2KDGA 1Y6MR 2FECL 4OGXH 5EB9A 4WO4B 2YD3A 5IV2A 3RVVC 2W9EL 3RJQB 1VEPA 2BSRA 2EDKA 4JG1H 5BXFB 4YXKL 3P30H 3ZE2E 1QNZL 3F6IA 2EDEA 3EYSL 1T80A 2BVEA 1VENA 1FORH 3UTQA 3SGDI 4U1KA 4CDHA 4HIJA 1DQLH 4XX1G 4YXKH 2W92A 3BPOC 1XR8A 3K2UH 5JO5B 1R3KA 1HHJA 4LLMA 2CMRH 3G6JA 1HINH 3RVUC 2R1YB 4W6XB 6FABL 2NQCA 4OLZL 3BDBA 1OPGL 5B38B 2ATPA 5JOPE 2XN9D 4EXPX 3W9DB 3MGOA 3DX7A 5HI4C 3EDKA 1CU4L 1KCSH 1TIUA 3S37L 1AXIB 1BOGA 5J1TC 5E6IB 1RK0A 1ACYL 3H3PL 1MJ8L 5DD0H 3QUKB 1CF8H 4OT1L 5F7DA 1WBXA 1R3HB 4XBGB 4EKXA 3BP7A 2ZG1A 5ALCH 1OWRM 4LMQI 5EOQH 1KIQB 3RKDC 4O02L 4JANA 4G8GD 3IGAB 2MOVA 3I75A 1MJ8H 4FTVA 3GM0A 1A6WL 1P7QB 3O0RH 4KJWD 1H0DA 4XVJL 3GSRA 1M7DA 3O11B 4OGAD 1VFUA 5EPMB 2ED7A 3B83A 3MUZ1 3TH2T 3TZVC 5KS9F 3L3HB 1A6WH 4J2XA 2Z8VC 5GZND 3TNNB 4RFOL 2FATL 3Q48A 1CI5A 4OFYD 3NIGE 4TTDC 3CDGB 4KROB 3KPPB 2ICEA 4HS3B 4OLEA 3MLVL 3BT2H 1EZVX 2LVCA 1T5XB 2JKXA 3EGSA 1LK2B 3HB3C 2HRPL 3WFBL 5BMFH 3QUYB 2YZ1A 3LKSB 1D5ZA 2J8UE 1DJSA 3P9LB 3GK8L 1E27B 1S7VB 2PNDA 2NY6C 3PWPB 4Z95L 3MZTA 4X9GA 5JR1L 1YY8A 1YEIL 1RZIB 4U6YB 1NBZB 3HE6B 3VH8B 1MHCA 5HHNB 1NBYB 1A2YB 1T4KB 3HLAA 1P69B 2CLVA 3L1OL 3VXRD 3CMOL 1D5MB 1CICB 1GC1C 2ADGA 2GT9A 5HHOD 4DGYH 4X4XA 3CUPA 4PY8J 5I17B 2P8MB 1S7WA 1EMTH 3BD5A 3RWHA 1OP5K 1LILA 1T1YB 1I3GL 2ZOKB 5DHVA 5IB4B 5L88L 2C3VB 4EI5B 3O2VL 5JHDB 4O00A 2OXHA 4HMDA 1KJMA 5KAQG 4NHCL 2CRYA 3O3UN 2JB5H 5F89B 1RZJL 4XC3H 2HFTA 3GSXA 3QCUH 5IMOA 4KZDH 2O5XL 2NX5A 4LSQL 4KUZL 4UB0L 4PJHF 4N0RA 3C60C 2V2WB 3VXQB 4ODVL 2EDWA 2B1AL 2D7QA 3QIBD 5FM8A 4N0UB 4QTHB 3IJSB 2CSPA 3DRQB 1IJ9A 3QZWG 5SX5K 2VZ3A 3JTSA 4MCYB 5C0BD 4PJDF 4RRPG 3LKRA 3TIDB 4FZ8H 1DL7H 1SY6L 1KC5L 4NN7B 4Y8AA 2PTTA 3PWVA 3H0TB 4NZJA 3DX8A 2BRRL 3AM8C 2YA0A 3IFOB 2SEBA 5E94B 2RR3A 3B4NA 4ZUWA 1NCAL 1SMOA 5HI3D 3V6FA 4F15C 4G6JH 4U6XA 1F90H 2H2PC 2VL4A 1EHNA 1B0RB 5JLZA 2OI9B 5DK3A 4ZTOL 4MA8L 4OI7A 1MRCH 3B9KB 3CSGA 5DWUH 4P5MB 5DF0A 3FMGH 4J1UB 4KJQD 4N5EC 1SQ2N 2ATKA 3CFEA 4R0LC 1REIA 4HZLB 1KB9K 5J3HC 2DQEH 2GK0A 2CLZA 5IBUB 5E2VH 3DECA 1IGIL 5HHME 5BS0B 4HCRA 5D8JL 3LKPB 1WWAX 5SWZD 4BZ2H 5ICZA 4JREC 5TF1H 1T7VA 1NLDH 5CD3A 3ZYZA 3ARFB 2IG2H 4O9HL 3CD4A 1G1CA 4Y2DB 4A6YB 3TLRA 1FVEA 3RQ3A 3F5WB 5KAQF 4HXBH 1LHZA 2ED9A 2VQ1B 1KLGB 4M1GL 3ZL4L 1IGFH 3MYJA 3VFPB 4JPIB 1ZWIA 1DBAL 5GGRA 5FV2A 1XAUA 3EO1B 1DBML 5FK9A 4OCRL 5INDA 3BUTA 4AMKL 3BKJH 3I3BA 4X6CF 3ZDXF 3PWLB 1U36A 1QTYT 3HPLA 3CLEH 5DMKA 2OL3B 5DK0B 3IDXL 2EDLA 3UO1L 2VH5L 2YA2A 4JFED 2VQTA 1KULA 2AK4A 1BAFH 5AZEL 5ETUA 4M00A 3LN4B 4ZQKA 3BFOA 4JFZH 4U1SB 1AO7D 3IRZA 4H8WH 4EI6B 3J7HA 5C8JA 4OQTH 4LP5A 1T5WB 3LY6A 2E8YA 2X6MA 2HFFA 3KPRA 2CK2A 5CD5D 2Q6WB 3SCMC 2VE6B 1MJJA 4HQQH 5I19L 1DFBH 1E4WL 1ZV5A 4PUBL 4B7LA 1XF5A 3TA3B 1QKZH 3H9SA 2J12B 4Z7WF 2MCPH 4ERSH 3C60A 4IJ3C 1HHIB 3DI2B 1OAKL 2HT2C 2X4NB 5F96L 1JE6A 2RGSA 7FABH 1J86A 4LARL 4R2GD 4OD1H 5E24E 3PV6A 1FVDA 4DKEH 5KS9B 3PQYB 2LQRA 3TH3T 5GZOC 2VN7A 4S0SD 3WXVH 1UKSA 4ZD3H 1OCWL 2B2XH 5F9AC 4M7ZB 4P3WA 3AM8A 4QNPE 5F6IC 2G2RB 4J3SA 1FVCA 3IRPX 3QXDB 2LABA 1IEAB 1AI1L 4PJCF 1SY6A 5CFHA 3GSUB 1AGCB 3KNBB 1RJLB 1LNUA 5F7UA 3QIWD 3OKNA 2X1WL 4XWOC 43CAA 3AXLA 1RZGB 1ONQA 1T0PB 2X1PA 2I27N 5JW4Q 2EKSB 2W9LA 1UWXK 2VLKE 2Z31D 4I0CC 1V3LA 4JN2B 4F8TA 4KMTH 2Q87A 1JZ5A 4R0LA 2YRLA 2XNAB 5GRVK 2VWEC 4BELD 4UTBL 4L3AA 3G5XA 2AJYL 1QFPA 1QHOA 2CRZA 2AJ3B 4G7VL 2X4QA 4JFYA 4XH2A 2PYEB 2OM5A 5EC1B 4D0BA 4OIAA 1CTOA 1CXHA 2ZCLH 5GQBA 2FEDD 4LNRA 2CD0A 1Y0LB 5IW1A 2AJYH 5F44A 5DS8B