1GHFH

Anti-anti-idiotype gh1002 fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
212
structure length
212
Chain Sequence
VQLQQSGPELKKPGETVKISCKLWYTFTDYGMNWVKQAPGKGLKWMGWIQTNTEEPTYGAEFKGRFAFSLETSAFTAYKQINNLKNEDMATYFCARVEAGFDYWAQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTI-ANTI-IDIOTYPE GH1002 FAB FRAGMENT
publication title Crystal structure of an anti-anti-idiotype shows it to be self-complementary.
pubmed doi rcsb
molecule tags Antibody fab fragment
total genus 34
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1995-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfH02
3DHMA 4R4FH 4R3SA 2YN3A 1J9CT 5H37H 4WI9A 3EJJX 3PWJA 2VQ1B 5IVZB 2DD8L 1T1YB 3QEGH 3MLZL 1RZFL 4Y5XA 4EVNA 1D9KA 5BMFL 4GRWE 3OR7A 4PBVC 3RDTA 4O00A 3O6ML 2XKNB 1OOAA 5JHDE 3D0LB 1YEIH 5B4MC 2FR4A 3UJTL 5DEGA 1EHXA 4QHMA 3BD4A 4JPWH 4XPHL 1XGPA 1WBZA 4HPOL 4DVRH 4HUXB 4X4YB 1SHMA 3T2NH 3K0WA 1U8NB 4CW1B 1J0ZA 4Y2DB 1A9BB 1M1SA 2ADIB 4KI5E 5TQ0H 5CINH 3QHFH 3R0MA 1C08B 2BRQA 4DUWA 3DMMD 3GSOB 2CKBB 1QRNA 2H26B 2C1OA 1EAPB 1CVRA 2G75A 1AO7B 2IADB 5EU4A 3T8XB 1FVDB 1I7TB 5ESAB 2WUBH 1SYVA 4YDJA 1MELA 1RUQH 5DJAA 3C8HA 1ZHNA 3TZVA 3VFSA 5T3XE 5JDSB 2Z31D 1S7WB 4Q2ZB 1LO3L 3U4BH 3TBTA 3FCTB 1T89A 3IXTA 2GAZA 3IDGB 4DQOL 3VXTA 1NFIB 2O5XH 3QUXA 3TIEA 3MFGB 5E9DB 2K1MA 3EO1A 5HJ3A 1CGVA 1CDCA 3HG1B 1RUMH 3RKDC 3BN9D 4ZFOB 5DVOA 2GT9A 4Z7OF 5KJRL 3CDFA 3JWDC 5TFSL 2DBLL 3PGDA 3V6OC 4F9PA 1EVTC 1CLYH 1TMCB 2E9BA 1IAKB 1CDBA 2D03L 1I7RA 4HAFA 2P7TA 3DYPA 1H0DB 2OQJA 4F7PB 5C0AA 3WHE0 1MVUB 3MNVB 1F5WA 4DTGL 3TH4T 3WDIA 4NHUB 2EE3A 5I1IL 5IFJB 1T1ZA 5IEHA 4NQXA 3T0EB 3RL1A 1EHLH 2NX5B 4HJ0D 3SE3A 3EYSL 4KQ3H 2ESVD 5EZLB 2EYSA 5D1XA 5HI3D 1YEHL 2EE2A 2X1QA 3M1BB 5C0FA 1XGTA 4FQHB 4NYLB 4OLYH 4KHXL 4JO3H 3RUGF 4JFXA 4QHUA 4KKCC 1FFRA 4ZTOH 1CFNB 5CD3A 2J7LA 2DQEH 3BQUB 3SKJH 4HBCL 4PLNC 1MFEH 4KJWC 4MJ5B 4UOJA 3AM8C 1ZHBB 4QF1B 1JZ3A 3V4UH 4Z7WB 2XZAL 3QCTL 5DHVB 5IB2A 4G9DA 3U2SA 2H2SC 5JW5B 1TIUA 1D3CA 1SBSL 3EYOA 4GXUN 5F8RC 4BSJA 1J0HA 2IQAA 3GSUA 2F9BT 3QDMB 1IKNA 2R23A 4QTHA 5C0BD 4NQCA 4B41A 1CFVL 4X6FB 1I7UB 2BMKB 3I3DA 4K3HA 3SKMB 1X5FA 5IHLB 4PB0H 2P48B 5GGTA 2NYYD 4OLXL 3C2AH 1DL7H 3CFJA 4D3CL 3MMEA 4OUOA 3PWNB 1FE8L 3REVA 4WDIB 1MFDH 1WAAE 3SJVB 1EEZB 4DWHA 3QIWA 1P7HL 3LEYH 2QADB 4HGKC 3U1SH 1KEGH 4JHAH 5F7HA 1VADB 1I1AC 4K8RH 4JB9L 1ZANL 3LB6D 2EEAA 1MCEA 2X4PB 1EJ6A 1G7LA 4NWTH 3SY0B 4YC2B 1BBJB 1F3JB 3TWCH 3CAFA 4IHOA 4N0CD 5D2LB 3Q6FB 5E1HB 2FLRT 3WFCH 3GHEL 4JFOB 2R1WB 3RIFF 4KUZL 5IFAL 2NX5D 2UY6A 5HVGB 1BBDH 1F3RB 4V1DA 3NACL 3BRDA 3BP4B 5GRYA 2VLLB 4IDLA 3OX8A 4RNRA 3RZWA 4NGHL 1T80A 3NBNA 2PR4H 5L9DL 1KCKA 4IRJC 1U8QA 4FQ1H 2FWOA 4M3JA 2DLFL 2VITB 3OKNB 2HTKD 3ZTJH 4JFDD 1QUNA 3ZT6A 3B6SB 4YK4C 4M4PA 4NNPH 3KPMA 4LGPB 5DEFA 1D7FA 3FO1B 3VFTA 2B0SH 4U1NB 1G7QB 4R7NA 1GPOH 2FEEL 5D9SA 1V7ML 4TUJA 1D6VL 2RQ8A 5I74B 2OMBA 1EV2E 3LKSA 4NNXB 1MCOH 1A14H 1YQVL 2H6PA 1H3XA 1ZVHA 1HHKA 4JQXA 3QDMD 4MCYA 2AEQL 2FL5A 1P69B 4ESKA 1DVFA 4NBZB 3S3JA 1VEOA 1MCIA 4HUUA 2D7MA 1HILB 2A0LC 1D5IL 3HZVA 2ICWA 4JN1H 4X0KA 3MO1B 2GJZA 4X6DA 5T1LD 4X6CE 4DOHE 4NRYB 4FQQB 4R4NC 3SJVD 3ZYOA 2QADD 4P2RB 2R8SL 4HXAH 1DTUA 4O2CA 4AEEA 3IDNB 5KTEH 1EXUB 35C8L 1NBVH 5TE4L 5EU5B 5FKPB 1RZGB 5JDJA 1SM3L 1OAYL 5T5NF 5GGUB 3BVNB 2J8HA 3QDJA 3QWRA 4H26B 5DHYA 3BH9A 3HE7B 4WHTB 4OBSA 3RJDA 5L6YH 1A9EB 4M1DH 3SDDA 1ZS8A 1X5ZA 1YYLH 3PIQB 4BQ9A 1RZ8B 1QFWL 4M43H 1B3JA 3PV6A 3SGDH 4HUKB 1D5MA 4PJBA 3DSFL 4U1GB 5E8OA 4FQIH 4NPYB 4NZJA 4MNQE 1M7IA 3CVHH 3TLRA 5IQ7H 4S1DC 2APWA 2ATPA 1WVZA 3G5XB 2VNCA 3ILQC 4M93B 3TCLA 3FRUA 2EH7H 5B39A 1R6VA 1NMCB 5LCVH 2IQ9L 4JY5H 1JGVL 1ZLVH 3GJEA 5B38B 4KJQD 5C08B 3AB0C 1JNJA 5L2JA 4XAKD 2BNQE 4OLUL 4KPHH 1BVKA 4WTXA 3KHQA 4HK0B 4KK8C 2P5WB 2HFFA 2R1YA 2HT2D 2X4RA 1R3JA 3HC0A 4C57C 4HWZB 3B4NA 1KPUB 4UINH 2BOCB 2CRZA 2Q76B 3TT1H 1TZGL 3HUJA 3OKYA 4FS0A 1VACA 4XVJH 3VWJB 5CJ5A 2J5LC 2HJFA 1A6PA 3IFLL 5HGBA 4GG6A 2LFGA 5FDWB 2WUCL 3MJ8B 4XPFL 3MLYH 3QUXD 2IANA 5I8EB 2MWCA 1ZLUK 2Z8SA 3N1MC 5I76B 3I50H 5IIEA 4ZAKC 3CMGA 4M6NH 2ZWLT 3LRHA 2SEBB 4O5LL 4P2RD 4CU7A 3GBMH 3T3ME 3MBEC 1B2WH 4HIHA 5SWZE 1FQ9C 4ONHB 1NGWB 1KYOK 3S37X 5D71H 2A6JB 4YR6A 1WTLA 4KKBD 3V5HA 5JOFB 4OZIA 3F7YA 1BJ1J 4NKOA 4JR9L 4BH8A 2ZPKL 2VLKA 4G7YH 1L9MA 2XA3A 5D8JL 1AFVH 2DQCL 3RZCC 4LMQI 5C0AD 2JKXA 1YMMA 5T3ZD 2R1XB 1RZJL 1JIBA 2R2HB 2DD8H 1RZFH 3VH8G 5BMFH 1KBGL 2EIBA 4IIQB 2Y6SC 1WQVT 4I2XB 4J4PC 3O6MH 5A2IH 4WWKA 4H20L 3UJTH 1T1WA 4XPHH 5IJVB 1INDL 5IMKB 3BEWA 3U4AA 3OXRB 4N68A 2VWEE 5F7WC 1T1XB 3LS5L 2VLME 2YUXA 3HB3D 2EYRA 1JVKA 5BQ7B 2F8VA 3FQNA 5SWSA 4U6XA 5GS0D 1P7KA 3KJ6L 5E94B 5ICYA 2MJWA 4M62L 3P4OB 1G9EA 3O4LB 3VWJD 1I9EA 1T5XB 1J87A 4PJFB 4NQCD 2EDNA 4F7CA 4TNVK 3T4AA 3ROOA 4U49A 1LO3H 1ZWIB 1EMTL 3DO7B 2Q86B 4M6AA 3Q1SL 2GJZB 4F7MB 4DQOH 1ZGLM 3JTSA 1PDKA 3O0RL 4IMKC 5DJCA 5HYSG 2NZ9D 3NFPA 5EDXA 1MUJA 5FM4A 3X14A 4YUEL 4OCSL 2A74A 3EHBC 5KSBE 4KHTL 4U1LA 5LG1A 3ETBF 5JORB 4RBPH 2J6EA 3EW3B 3GMMA 4LAJH 4YGVB 2GJ6A 3H7BB 4DUXA 1LEGA 3C5ZA 3G6AA 2AQ1A 5KJRH 5TFSH 1C5CL 2DBLH 2E8ZA 3W9DA 4P59L 2D03H 2EDTA 2ARJB 3CFCL 3KPLB 1NL0L 2MQCA 4HG4J 4DTGH 3ULSA 4ZUVA 2ZSWA 4LF3B 4GRWF 4PJ9A 5DVNA 4I4WB 5I1IH 3MV7B 5I8CB 2H2PD 1YPZB 5DRXA 3U0TB 3U7AA 4LVNC 3EYSH 1IC5L 1WLHA 4P46C 1AKJB 5C8JA 5CEXB 4GAFB 4JCLA 3ARBC 2AJXL 1E6OL 1YEHH 3GRWA 5MHSD 2AJ3B 2N1KA 1E28A 2XZCL 3IU3B 3BD3A 43C9B 5C6WH 4X6BA 4KHXH 1QFOA 2X4QA 3WN5A 4YPJA 5B39B 4TSCL 5EORL 3DRTA 3GMQB 4PR5A 2HT4C 5E70A 5SX4I 3WIFA 4HBCH 4KI5F 4P48A 1IZJA 1A3RL 3G6JB 3TVMB 1BVKB 3WNNA 2XZAH 3HI1A 5FYJD 5LAXB 3QCTH 4Y4FB 2YPKA 2X4RB 5F44A 1MNUL 4P4KA 2HMID 3C6SB 2A73A 4G8GA 4G9FA 3RY6C 5F9OH 2VIRA 4K23L 4PJ5B 1AC0A 3O4LD 1SBSH 3DECA 5HDBE 2X4OB 4F33B 1UVQA 3MNWA 1DVFD 2RIKA 2JCCF 4HKZA 2IH3B 1CFVH 1U9KA 5DXWA 2JTDA 2QQNL 5JA9A 4OLXH 3GMOA 1XH3A 2CSPA 3VCLB 4D3CH 5ENWA 4AEIL 4F7TB 1FE8H 2Z93B 3V6FA 5ID1B 3MUHL 1ERNA 1CFSB 2H8PA 2FJHB 5C07B 3SGKC 2Y72A 4JZNB 4XNQA 2BY1A 5BRZA 3DVIA 5MERB 3QRGL 3Q3GB 4F9LC 3OGCA 5D6CA 1O7VA 4JB9H 3QDJD 4N90E 1ZANH 5A2FA 2KQNA 4XBPA 4F57L 4UQ3B 5K59E 4MQTB 1AHWC 3SDDD 1UCBL 2R2BB 4KROC 4U1HB 5E03A 5CEZL 1CLZL 3QULA 4Z6AT 3C8DA 2E9WA 1BLNA 3OBAA 3EKCA 2R9HD 3GHEH 4PJ8B 4KUZH 5IFAH 2MFNA 2R0KL 5EBMA 3QUKB 3NACH 4RQQA 1K2DA 3L3DB 3A6OA 5DD1L 1EGJL 4AK1A 1CF8H 4NGHH 3RBGA 3MRQB 2VE6B 5L9DH 1BQLL 3OG6B 4ENEC 4HH9B 4PS4L 3G08A 4Q97A 2DLFH 4XTRC 4HFWB 4EN3A 4EDXA 3MCKB 3TBWA 3LKOA 2QTEA 1IEAB 3VFRB 3MUJA 2AXHA 5DDHB 3PQYA 2V5TA 1OSZB 4XMPL 5JNYA 2DKSA 2NTFB 4O58L 3WNLA 5GXBB 1W0VA 4Q0XL 1V7MH 4Y4FD 2IBBA 1D6VH 5FGBC 3IS0X 2E7LC 1YDPB 1ORQA 3VXOA 5I1EL 3CX2A 5LGJA 2Y9RT 1XR9A 4QY8A 5HGAB 1YQVH 2F19L 4NN5B 5DJZB 1MIEL 1WK0A 1DLHB 3FQRA 5BS0A 1R5WA 2MCPL 4BA8A 1NLBL 1GGTA 3QUZC 1INQB 2AEQH 3LRSA 1NFDE 4CN6A 3BGMB 2A9ML 2F53B 1D5IH 5HDQL 3LKQA 1UWXH 2IAND 3F7PC 1OAUL 1LEIA 3VXUE 4PJ7E 1QSFE 4DZ8A 5IMMB 2Q3ZA 4FFVD 2EDEA 1WAAF 1RHHA 4NQDE 3STLB 3SDXB 5C07D 1U3YA 4ODVL 3KYMB 2UZIL 2GUOB 1KNOB 2R8SH 1I7ZA 1Q9WB 5FUCC 3M8OL 3Q6GL 3GMMB 1BPVA 5MENA 35C8H 1ZA3B 5TE4H 5AZEL 5I1LB 1V3JA 1SM3H 1OAYH 1N26A 2VLKD 3U79A 5HHPA 3VXSE 1JHKL 3EOBA 1T3FA 3O3AB 3S4SA 3M07A 5IBUG 2NY2B 1QFWH 3P0VL 4WFFD 1K4DB 1P1ZA 4LLMB 5D93C 3DSFH 5DJ6B 5B3JE 2R29L 1LDSA 2OSLA 4WWKD 1EO8L 5ALCL 1C16B 1LGVA 1WFOA 2EDKA 2HRPL 2V5SA 5CWSB 2EIEA 4BK4A 1CT8A 1ZVSA 5JXEA 4XCNA 2H45A 1FZMB 1FYHB 4JFYA 4JJ5B 2IQ9H 2VISA 1I4FB 1WF5A 3ARFA 4OLUH 5KVFL 1GGIL 5SWSD 4K8RD 1RIVL 5C3LD 5KSAC 3I2CL 3ARYA 1BQHG 1NAKL 3A67L 1JZ4A 3PHOB 2PN5A 5GGSY 1TZGH 3FHQA 2JK5B 4U1GC 2A6IB 4ZDHA 3IFLH 3AREB 4I0PC 5KOMC 3GSRB 4X5WB 1H5BB 3ARDC 3S5LG 5K93A 2WUCH 5DJYA 1A6AA 2F54A 1DQTA 4LDEB 4XPFH 4UTBL 1A4KA 4X6CF 5E6YA 3MUY1 3HLAB 1DDHA 1TLKA 3CVHB 3HE6C 4XBGA 1S8DB 2OJEA 4O5LH 3RAJL 3ZKQD 1QBBA 4ERSL 3V5DB 3WHXA 5AG8A 5DUBB 5F89B 3UMTA 1YY9D 5JO5B 1QD0A 4PGCB 5EU6E 2UWEE 2VAAA 3HN3A 4JR9H 1X4YA 2ZPKH 3MRJB 5D8JH 1MFCL 2DQCH 1NCAL 4CRPA 4MSWB 3PL6A 3GM0A 1RZJH 2X4UB 2NY2D 3W5NA 3SKNA 3STZB 3JV6A 4PJ9D 2H9GA 1AD9A 1DFBL 5E1AB 3ZKXB 5GS1B 2LVCA 4MA3A 3PXHA 3FN9A 3MROA 4HEPG 1KBGH 3MRNB 4ZNEE 5LWYL 4LHQB 4OI8A 2OS7A 2ENYA 4H20H 1PKQE 1CGTA 5DI8A 3QZWB 2DMBA 4Y2OA 1OAXL 2GSGB 5SX5H 5KS9F 3RTQB 3PDOB 1YN7B 1PSKL 3QG6A 1LE9B 4PJGE 1INDH 1X5LA 3HS0A 4XRCB 4GJTB 4UNTA 4PREA 3S3SA 1YA5A 3UTZA 3QDHA 3MLTB 3MRRB 3LS5H 5HI5D 5CJ8A 1CR9L 4R2GC 3DURA 4P4KD 5T1KB 4LKXB 1LHZA 4G9FD 4OF3A 3H2WA 5KAQG 3WXWL 2V7NA 4PG2A 4E41E 3KJ6H 2XN9B 2I25N 2XWBB 4JY6A 2OI9C 4M62H 3DTXB 4LLQB 1C12A 2X9WA 4TNWK 4WNQA 2AK4A 1QBLL 5IK3A 4WTWA 2OMNA 3QCVL 1EMTH 2NXZB 4U1MA 1WIPA 1L9NA 4NUGH 3Q1SH 3Q48A 1IC4L 3O0RH 4HX1B 3E1F1 3LHPL 3A6BL 3RVUD 1EIBA 4YUEH 4OCSH 3T3MF 5CBAB 3GSXB 1UEMA 5BRZD 1KGCE 1K9TA 3MODL 2J3SA 1VFUA 4R97B 1KCSL 2M8XA 5A2JH 3HR5A 4MAUL 3T77B 5C0ND 5F96L 4X99A 2Q7NA 1C5CH 5DRNB 5B8CA 2DQHL 1IILE 4IRSA 3T0VA 5J9PB 4WI7A 3MJ9A 4XBEL 4P59H 4DCQB 1QQDB 3CFCH 1U3HC 4Y5VA 1NL0H 4HIJB 1W0YT 4ISVB 5TQ2L 3WV0A 4LDLB 1OQOA 1IC5H 3T0AA 5F1IB 4YH6A 2AJXH 1OTTC 1E6OH 2DI9A 5D5MB 2FZ3B 2XZCH 3TBYB 4O02L 1G7PA 4TSCH 5EORH 4S1QL 4KXZI 2ZUQB 5IW1B 1JZ7A 3PQYD 1MQKH 4UUJB 1IM9B 4PV8B 3FQTA 5DMIL 5EPMB 2Z92B 3RWGA 1A3RH 3QYCA 3MJ7B 1CIUA 1T5WA 2KBGA 3RUGA 5CS7A 1GGCL 2D7OA 1MNUH 3MJGX 5EOCL 4K23H 3F62A 4TVSa 4JGJA 5C0GB 1Y18A 5BS0D 5DS8A 4LEOB 1HKLL 1EJOL 1DQQA 2CDEB 5BCAA 1LEKB 4HMCA 3P4NA 2EDJA 3IDYB 2V2WB 3U9UB 4EQ2A 2QQNH 4IDJL 4PRPA 4PRNB 1IARB 8FABB 4W6WB 1KB5L 3MRDA 4AEIH 2R2CA 1F4AA 4XBGB 5KSBF 1WWBX 4OB5L 1NANI 3WLWC 3D2UA 1ZGLB 1PGRB 3K4AA 2XTJB 3GDBA 1T7ZA 4Q6YA 2J2ZA 4L3AA 5MEND 4LCUA 1S5HA 3QRGH 5J7CC 3OG4B 5FYKU 3QFDB 5GHWL 3L3OA 4R26L 4U3XA 1KJMB 3P9LB 3T2QA 4LCCC 2IC2A 4TVPE 3BWAA 4F57H 1WFTA 1UCBH 2YA0A 4HFUL 2I24N 4I5BA 3N85L 5A3ID 1CLZH 3DX6B 3S37L 1S9WB 5I0DA 4F3FB 1HYSD 4MNHB 4P3DB 3SDCA 3RVXC 2DKMA 2D2OA 3DUUA 1NQBA 4FN0A 1U0QA 2R0KH 1N7ML 4F37K 2C7UA 2DL9A 2EKSB 1EGJH 1S7UB 5JW4Q 3WNKA 3T0WA 1AP2B 4L3EA 1BQLH 3AMKA 5L88L 4PS4H 5D2NB 1XIWA 3WHE1 5E2UL 5JXED 3ECBA 3GM8A 4M9OA 3TT3L 3TO4B 3LQZB 3WE6B 1JPGA 2D4FA 4M7KL 5FOBA 1IM9D 3IJHB 4HS6A 1JWMB 2XIDA 3EDEA 3MXVL 1JNHB 1BZ7B 1QLFB 3IKKA 3E8UL 4XMPH 4UT6L 5F1OB 3ZE2E 2Z8WC 4O58H 5LQBL 2NQCA 5C7XL 3E6HB 4Q0XH 5KSUA 3QEQA 4X7TA 5GZOD 3I6KA 4P2CG 5I1EH 4WFEE 4H25B 3QCUL 3X13A 5F7FA 2K9UA 4PJHA 5HDBF 5JZ7D 4OAWB 2F19H 5EA0L 1MIEH 1KTRL 4D9QD 3GNML 5IJKC 1T20A 2MCPH 4GLRI 1NLBH 2OTUB 3LN4A 5H35B 3SQOL 2V2TB 1VGKA 2BVUA 3ILPA 4GRWH 1TNMA 2F54D 2WLYA 4Y5YA 2A9MH 3AXLA 5IW6B 1GAFL 5HDQH 5AYQA 4XH2B 4YE4L 2HT3C 1IAIL 1MCWM 1HIML 2E6QA 3DRQB 5I66A 1WCBB 3QDGB 2XTJD 4ODVH 1KLFA 5I17A 2UZIH 4PRHA 4XWGL 3M8OH 1FFOB 3Q6GH 5I9QC 1H8SA 3BRFA 3ZE0E 1FZJA 4CUCA 2X70A 2Q3AA 1EUUA 5AZEH 5CD5C 5ELIA 5K59F 1JHKH 4HDIA 1NMBL 2NY5L 4HWBL 3B3IB 3EOAA 5IVXB 1FLTX 3O3BB 3G04A 3PL6D 2DTML 3EFDH 5BV7C 3UTQB 5EWIL 5DSCB 3P0VH 2AQ2A 4GKSB 1ZLSL 5ACZB 1B6UA 5EO0A 3INUL 3ULUC 5FKAA 2R29H 5I6XC 1KYOJ 1EO8H 5ALCH 3D18B 1SJEA 1HCVA 4MAYB 2HRPH 3GSWB 1XMWA 1WBYA 3VH8B 5GRUL 5AWNL 4QGTA 4Z0XA 1NAML 1DN0B 4OZ4A 4YBHA 3TO4D 5MEQB 1GZPB 1FCGA 3C5SA 1W72B 4FXKA 1NCNA 4RGND 3S98A 2E3VA 5DURB 1SMOA 4UDTB 1OAQL 3GGWB 1QSEA 2DTSA 4P5TA 3QWOA 4JO4L 1WWWX 4K3EL 3FFDA 1N64L 4M5ZL 4L8CB 4PUBL 5KVFH 1VSCA 1GGIH 1RIVH 3I2CH 4DVBB 5HYQA 3FOMA 2NY1C 1NAKH 1JV5A 3QNXA 3A67H 4O51A 3W0WE 4EUPG 3RHWF 2EDOA 3IJSA 4P49A 1HN1A 5TH2B 1J5OL 3L3JB 1UB5B 1Y6MR 2AK4D 2O61A 1DJSA 1S7QB 3D0VA 3RWHA 1MRFL 3HHRB 3MLUL 4QOKA 5E8EA 4U31A 1LK3L 3WMSA 4HHAA 3P4LA 1A8JH 2O93L 4PJ7F 1KIRA 5C0EA 4UTBH 5JLZA 4N8VG 1MHPL 3RI5F 2EYTA 5GSVB 3ALXA 3RAJH 3MGOB 2FEDC 1SVCP 1JBJA 5HYSB 4XZUB 4L8BA 3VA6A 4ERSH 1NCWL 4OF5A 5EO9A 1CG9B 2EKJA 1KPVB 3L3IA 3CFEB 3PJSA 5HHVH 1IL1A 2OL3B 1MFCH 4NJAL 3ZSTA 5HSFA 1EK3A 3MRFB 1NCAH 4J8RB 2FRGP 4WV1B 4JRXA 3WJJC 4CVXB 2CO6B 1DFBH 2KKQA 1V7NL 4M7ZC 3ARPA 5CHNB 1I1RA 2EDDA 4JPVL 5B3JF 5LWYH 4J12A 1YEEL 3F12B 1LD9B 4MAYD 3EYFA 5C0RL 4X8XA 5D7KE 4GH7B 1U3ZA 2VLJA 1MRDL 1OAXH 1AR1D 1I1FB 4QHLA 3F6IA 3U36A 4I3SL 1PSKH 2P47B 4HKJA 3SGJC 5CIPH 5FOBB 1KLUA 1T0MA 5KSVB 2YPLB 1AC6A 5EOQL 4F8TA 1H3GA 3NCYS 4RZCB 1CR9H 4Z5RA 3FN3A 4NC1E 2DMKA 2PXYA 5IHZA 3OZ9L 1FNGA 3EJYC 4I0KA 4F15B 3PV7A 4YFEA 3WXWH 1Q9KB 1CBVL 4HBQA 1J05B 4PJHB 4Y4KC 1H3UA 2P8LB 3VMNA 4RWYL 3LDBB 3LMJL 2ATKB 4U05A 4DUVA 3U4EA 3NH7L 1Q9LB 4UB0L 1JZ8A 2BK8A 4HF5L 1NUGA 4JLRA 1QBLH 1F2QA 2CQVA 1SYSA 2WK2A 2VDKL 4Y5YB 2IPKA 4WWID 3QCVH 1AO7E 4PRPD 5I1AA 2P45B 5GSRB 5EO1B 3QIBB 1IC4H 1EGJA 3LHPH 3A6BH 3O4OB 2OTWB 1UH4A 3S5LA 3D2UD 1KTLB 4AG4L 1EZVX 5I1KL 2G9HA 4P9ML 2VLRB 3MODH 4NZRH 5I75B 1T2JA 5C0DB 1KCSH 3C09B 4BKLB 1HQRA 2NY0B 4GOSA 4DFHA 4MAUH 2UWEF 5F96H 3K2MC 1G6VK 2BCKA 1U8JA 4M6ML 2DQHH 5E9DE 3ULVC 4XI5D 3DVGA 5JXAL 4WU7B 4XBEH 3QQ4B 5ANMA 1L0XA 2VUYA 3HG1E 4PTUB 2RFXB 3SDCD 4NT6A 1MQ8A 3AS3A 3FB5A 1CD8A 3GSNH 4JFFB 1UADC 5TQ2H 2IH1A 1GOGA 3DV6B 3PWVA 4PJDB 1JRHL 5F7UA 4OM1L 4UI2A 3MSPA 4GRMB 5DA4A 3KLAB 4CVUA 3SO3B 2UYLB 4L3ED 5FEBA 1XIWD 3UTSB 4Q6IA 5SV4A 1UJ3C 1UXWA 5K9QG 3UO1L 3R0NA 1OD9A 5E8NA 4O02H 4RIRB 1HH6A 4R96A 4LSVL 4PJGF 3KPQB 4OUUA 5INCA 2GJJA 5DD6B 5JHDA 4S1QH 4NZDA 5DQJB 3T0EE 2NX5E 4GT7A 1FH5L 3H3KA 5DMIH 1FL3B 5SV3A 3TV3L 1MCJA 4G80B 5D7JB 1GGCH 3PWPB 1KF9B 2XI9A 3TC9A 1YUHB 4LPUA 2NY3C 3TN0A 3O3DB 3VRLE 4HAGA 3MV01 2XV6B 5EOCH 2ZUXA 3CXHK 4JKLA 4LSQH 3O45A 1HKLH 1EJOH 1P9MC 5F88B 4TUOA 4ODWA 5JOPD 3RL2A 3FO9A 2PTTA 4Z7WE 3U6RA 3VWKB 4XPGL 4IDJH 3OKDB 3WO4C 1S7SB 1MWAB 2FIKA 3QIBD 3MRPB 1KB5H 4CDHA 1ONQB 3IJYB 1EBAA 5C92A 2HTLD 1RMFL 1MHCB 2JJVA 4OB5H 4XHJD 3QDME 1D5XB 1U8HB 3FHAA 1HOCB 2GTWA 2NY0D 1P2CB 4YBQC 1GJIA 2HN7B 5GHWH 4N1EA 1EZVY 4R26H 3AU1A 1SJHB 3UYOD 2DMCA 3DBXA 3MA7A 4HFUH 3N85H 3SJVE 2AV7B 5CSZA 1KCVL 5CGTA 3S37H 1U58A 2ICWI 1KIQB 2P46B 2CDGB 1CE6A 2XQYG 4XNMA 4XX1E 3NABL 3TA3A 4W6YB 2I9TB 1M05A 1N7MH 1U2HA 5GRVL 3QB7C 4MMZC 5IBUB 2BC4B 5E5MA 2E9IA 3VXRB 1S7VB 1A6VL 4RMWA 4LLDB 5D2LE 3H7LA 4JM2F 5E00A 5L88H 2ZSVA 4OV5B 2CK2A 3TJHD 5E2UH 1AIFB 1AQDB 3RVVC 2WINA 3TT3H 3VW3L 3RWEA 1DEEB 2ZCHL 3FONB 4M7KH 4Y0GA 4RAUB 4G42B 4P5TD 5GGQL 3IAGC 3MXVH 4OFKA 3E8UH 3BPOB 4UT6H 5JPNB 5DRZA 5D7JD 5LQBH 3PWPD 5C7XH 4FP8L 4NKIL 4G8FB 1NGQL 5HHNA 1MAML 4X5XA 3HZMB 4Y16A 4JQIL 3W82A 4EI5C 2ZOLB 3MRIB 3QCUH 4LHUA 1YQ2A 3L9RB 3R1GL 1Q9OB 4IBLT 3IXAA 5EA0H 3TNMB 4U7SA 3GNMH 2X89A 2KPNA 1JHTB 1BQHB 1UZ8A 4ZOCA 2AGJL 4E0RB 1ES0A 1I9RL 3D25B 3SQOH 3I02B 2LTQB 1FYTB 3AROA 3KR3H 2IPKB 4JG0L 1TCMA 1OAKL 2W91A 3QQ9D 1GAFH 1J0IA 3FB8A 4YE4H 1Q94B 1TITA 4JREB 3MRGA 4OD3L 1IAIH 1T0NA 4HZAA 1HIMH 4HCRL 2DWDB 2W1NA 2RAMA 2A38A 4D94A 2EE9A 2OR7A 3F5WA 4NZTL 5HXMA 1J86A 1MOEA 4PBWD 2CIKB 5EU3A 4DK6A 4XWGH 5EN2B 2M1KA 4ZXBA 1DBBL 5CIPA 2EXYD 5AD0B 5C9JB 1JUFB 1WAAA 2XPGA 5L0QB 3FMGL 3MCG1 3NAAL 3RIAK 3IDXH 1AD0A 1NMBH 2NY5H 4HWBH 1YEFL 1NEZG 4BELD 3C2SA 3WLBA 1MI5B 4KQ4L 4P2RE 3S7GA 5EIQA 2DTMH 4LPYA 2FECL 3MRHB 5EWIH 5DVMA 3ZKNC 4I18B 3BN9C 2Z8RA 1U8MA 1F11B 1ZLSH 5D7LB 4W4OA 3INUH 4QRRB 3W9EB 3RWJA 3VXRD 2ZNXA 4X9BA 5F1SA 4P2OC 2BVPA 1RK0A 2VLJD 1J8KA 4QCIB 4NKMB 5AWNH 1NAMH 3V79C 4LPTA 3KYNA 3D1MC 3BWUC 4JN2B 1OAQH 1J10A 4Y19B 1N6QL 4PPTA 4X6EB 4HJ0C 4JO4H 3ZE2F 1S7XB 1FSKC 1K5NA 4K3EH 1RSFA 1R24B 1MSPA 1N64H 4M5ZH 4ZYKB 5HI3C 4PUBH 2PNDA 4RMRA 3MGTA 4JG1L 3VD5A 1EERB 5J11C 1QP1A 1IGJA 1NMAL 3V0AC 5IVOA 3ABZA 2IPUK 5C08E 2XWTB 3OB0H 5IHUL 1J5OH 1WIOA 3QUYC 1FG9C 1FYTD 1MRFH 3MLUH 3K81A 1LK3H 2P5WE 4KWUA 1KG0A 1YMHA 4PGEA 4XNXH 3GSNA 3S35X 2DIAA 1G84A 1QSVA 4I9WD 2APVA 1MHPH 4KK9C 3IGAA 3HPJB 1NDGB 4LP4A 2R4SL 1U41A 5C09B 1NCWH 3G6DL 4X6CA 1JI1A 2VKXA 3ESVF 3V0WL 4OF0A 2NYYC 1D5BB 3WDJA 1YEDB 1MI5D 4NJAH 1ZSDB 4FMKA 4TTDC 3S96A 4TSBL 4UV7L 5BVJB 4FA8A 4AENB 3EDJA 5E8PB 2I60L 1V7NH 5D7LD 3KNBB 4X98A 4JPVH 3IDIB 3FFCB 4WFHD 1YEEH 5HYIA 3WFHB 3MACL 4NQVA 1IFHL 5C0RH 4W68A 4XB7A 1MRDH 5FGCB 1H3VA 4APQA 4I3SH 4YHKL 4MNQA 4ELKB 3TYFB 3ARUA 3BKJL 4Y19D 1KB5A 4I2XE 2BVOA 2PO6A 4YHLL 3E6FA 4KDTC 5EOQH 2OR8A 4G43B 1IVLA 3UPCA 4GRLC 1QFHA 1HXYA 3L3HB 4LRIA 3TN0D 3VFPB 4A6YH 3OZ9H 1EUTA 4G6AC 5TF0A 4POUB 1SBBA 4KY1L 1LK2A 1CBVH 4GBXA 4NKDA 2BNQA 4HC1A 4RWYH 2HTKC 4KK5C 3ZDYE 3LMJH 3L3KA 1LDPL 3JWOC 3O8XA 2A83B 3NH7H 2R0ZL 4WI8A 3UPAA 4UB0H 2FJFB 4HF5H 3MRBB 4YX2L 4P5MB 2VDKH 3B5GA 4LLYB 1JYXA 4M7LT 1GOHA 2NW3A 4YHIA 3C8KB 4MS8D 5K9KA 4U6YA 2BNUB 3O4LE 5IMOA 5B3NA 5D72L 4EIZC 3LKNB 3FTGB 4YHYC 5BVPL 2FX8L 4PJFE 4AG4H 1PQZB 4P9MH 5C09D 1N2RB 2FO4A 5C2BL 4N8VA 4M02A 3MV8B 4GAYB 1AH1A 4WI6A 1D6EA 4WENB 4ODHL 4ETQB 3FL7A 4WW1A 4DKEL 2AEPL 4M6MH 2IMNA 4MXQD 5SWZA 3V6ZB 1V3MA 2ICCA 5JXAH 4U4BA 2UZXB 3SDAA 5EBWB 3SEPA 1U95A 2R4RH 3KYOB 4ORGA 4NQSA 2YA2A 5CKGA 3I6GB 4S1SL 3FFCD 5FV2A 3KYKL 4P4RA 4L8DB 1HHGB 1OP9A 2V5YA 4QEGA 3UO1H 3MQIA 5B22A 4PY7B 3K4ZA 2M26A 2G5BB 4PRBB 4LSVH 3FO0L 1N0XL 4WW2B 1QA9A 4Y5XC 3SDYL 1D9KC 3MV7E 1M71A 3VGAB 1YPZE 1I3RB 1QLRA 3RDTC 5GIRA 3STBA 5JW3L 4JZJB 1FH5H 1A0QL 1QPXA 2PCPA 2NXYC 2D31A 3TV3H 4N0FA 5SWQB 3L1OL 4Y16D 4TRPL 3P77A 4G5ZL 1NBZA 1S7TB 4QRUB 5LGHL 2B1HL 1JYWA 2X89D 2Z4QB 4GUPA 4HWBA 1G1CA 3SKUD 3O9WB 3G6JE 1MCPL 4KJQC 5JPMA 4LCYB 4FHBD 2VUOA 4IS6B 4WEBL 1HSAA 4XPGH 2HT2C 2BVQA 4JANA 4PJ5E 4XCEB 1QO3A 4UMGA 2DQIL 1NEUA 4PRAA 2PYFA 3TZVC 3OR6B 1RMFH 2CUIA 4C58B 4ZXBD 1OD7A 4NO2B 1F58L 2I27N 3IETA 4Z8FL 4YWGL 1HNFA 2AXFB 1KSRA 1T89C 2C1PB 1U8LA 4RDQG 5KSBA 1PX3A 1H15A 4F2MA 3QUXC 1FC1A 4PJXF 5F93C 5FM5O 1CN4A 2LABA 3RWFB 5C07E 3ZYIA 3N1GC 3QFJB 2NZIA 5D1ZA 4G6ML 5KG9B 1VKXA 3FQXB 1NGYB 2FGWL 2L0DA 5FOJA 2ICWJ 3RX8A 43CAA 5GS3A 3QXAA 3NABH 1BOYA 3CFDA 2ZJSL 4F9PC 2EEBA 2CMRL 2P4AB 1A6VH 5EZJB 5ECJE 1MH5B 3S3PA 2LU4A 1K8DA 2EE6A 5E4IA 4D0CA 3CH1B 2CKNA 3VW3H 3BP6B 5BOZG 2ZCHH 2BY0A 3RIFK 4WFFE 5FK9B 2CDFA 5GGQH 4UNUA 3SE3C 1EFQA 1NBYB 3F8UB 4MQXC 5ISZB 5D1XC 3WL9B 4FP8H 1NGQH 1QRKA 1A4JB 1MAMH 3VRLF 3DXAB 5DF0A 4GMTL 1J1XL 4JQIH 3R1GH 4NO5A 1CXFA 4PIRF 1OLLA 1F4XL 1P4IL 4S10A 2AGJH 5CP7B 3L3GA 1I9RH 4EUPB 4JG0H 1U91B 3HB3C 2WWMC 3LKPA 3LZFL 4OF7A 1OAKH 4U6HB 1P5UA 5ABDE 2GY5A 4R8WL 5I73C 4OD3H 1NJ9B 4KVNL 4K7FB 4HCRH 1S9YA 4NZTH 5IT2L 3CFKA 1IKNC 3NZHL 4N8PA 2P1YA 2IBGA 2V9RA 2F53E 4Z7UB 3MX0A 1DBBH 4U33A 2NY6D 3QAZC 5SX5K 3FMGH 3NAAH 4XC3H 4MXVE 4YDIL 1GC1C 5F9DC 3ALPA 4LEXL 1YEFH 2BHUA 2APTA 3RGVB 3BAEH 3SDXE 4A6YA 3B8YA 3QIWC 4KQ4H 3BPCA 4U1JB 5KBNC 1T21A 2A1WL 2C9AA 3BYYA 2WBJB 3HAEG 4XB8A 5J4MA 3MLXL 1N3NA 4RAVB 1RJYA 3TBVA 2YMXL 5F7LB 2CKBL 4I48A 1SY6L 4XVUD 2H32B 5D2LF 1X5YA 4APQD 4QXWA 4MNQD 3L5JA 3FT3B 2A9NL 4BH7A 1FJ1B 4HUWA 3CZJA 2H2PC 3QIUA 1N6QH 1RUPL 3HCVB 4HUMB 4K3GA 1XGYL 3M17A 5CUSL 5FO7A 3DX7B 3QNYB 4JCMA 3E3QE 4DGIL 4LVEA 1U8KA 1NMAH 4HH8A 3WUWG 3O8XD 2EDBA 3DO3A 3NTCL 5IHUH 2CO7B 1M7DB 2D0FA 3MZGB 1I8LA 4MA8L 2GTZA 3X3GH 4LU5L 2V17L 4YNYA 4NO0B 4R90L 1ED3B 3M45A 4CKVX 2PTUA 3NFSL 1AY1L 1T04B 5CBEB 1FVEA 4U1IA 5F3BA 4AEHL 3LS4L 1CD0A 1NFDA 4HKXB 3IAPA 1H8OA 3TYGL 4JQXC 1NAMB 3CGTA 3RJQB 1B9ZA 2R4SH 1DVFC 2YEZB 3NN8A 3VXUA 3F7VB 1RURL 4PJ7A 1QSFA 3G6DH 3S8WA 4NQDA 3V0WH 1AGFA 2QHLA 4MLSA 2GSIB 3ARGA 5J6HA 3K3QA 3FQWA 5FYLL 3RGVD 1X5AA 2YWYA 4FQXA 4OFYA 1QPPA 5DJDA 4LLVA 3MV9B 1CQKA 4X7FC 4TSBH 4UV7H 3TIDA 1ZHLB 1UM4L 3C60B 3VXSA 3VJ6A 3BH8B 3KWWB 4WY7L 2I60H 4OD2A 1V3KA 4NQEB 1CICB 1UXSA 3OAYH 4ODUA 1IFHH 1DP0A 2RHEA 3CZFB 4GKNB 1SVZA 3SDDC 2F58L 2CIIB 3HRPA 4J3VA 1Z5LA 1S9XA 3OKLA 4TOYL 2OXGA 1BX2B 3DYMA 2P8PA 4O9HH 4YHKH 1J8HB 3P9MA 1FVCA 3PNWA 3BKJH 1VCAA 3D5OF 3BPNB 4LPVA 3T08A 4YHLH 3D85B 2R69H 1LO5B 1FLRL 1X5IA 3OMZA 4WO4B 5DTFB 5FFLA 1Q1JL 3FB7A 2HYMA 3FKUS 5IOPA 4KY1H 3DV4A 5E6IB 2V7HB 3VFVB 1N5AA 1OGTB 5AUMA 4KKAD 3QO0B 1LDPH 4Y4HB 4J3OC 4L3CB 4QHKI 3T09A 1NC4A 2R0ZH 4YQXL 3RNQA 5EC1A 2AKRB 5C0CB 2ZUWA 3MA9L 4YX2H 2CJUL 3TESA 3N9GL 1XCQA 3MNZB 5D1QB 4FZ8L 2XN9E 3L5XL 3B83A 1KELL 2AJZA 3IFPA 5LXGL 3BRGC 3WFBL 2IAMB 5D72H 3CXHJ 5BVPH 2FX8H 2QSQA 5A16B 4JM4L 3CFKB 3VFGL 4JDZB 4MJ6B 1CS6A 3MRKA 2AV1A 5C2BH 1HWHB 1U93A 1MCHA 5MEPB 5BXFB 4ODHH 1QFPA 1S9VA 4DKEH 4KH2A 2AEPH 2OJZL 5J12C 4FFVC 3P3YA 4J1UA 3JSSA 3P73B 2EC9T 3MV9D 4K3JH 4UQ2B 3NMEA 5EU6A 5EBLB 3C60D 4Q9QL 2UWEA 1AXSA 4GW1A 1CICD 3BGFC 2WV3A 4S1SH 3VFWB 1IGTB 1X5KA 2W59A 3KYKH 4CU8A 2W0FB 2KZWA 1WT5A 2C4FT 2DWEB 5GGSB 2CLVA 5ALBL 4OM0L 4HWNA 1PBYA 3RA7L 4Z7VB 3HZKB 3LQMA 3DI2B 5DEZA 4ZNEA 4M9PA 4PB9L 3FO0H 1N0XH 2C26A 4NNYB 3SDYH 4D8PA 1PKQA 2Z35A 4WGWB 4U1SA 4NDMA 2AK1L 5JW3H 1A0QH 2F5AH 1PYWB 2HKFL 4R0LB 4WWKC 2YBRA 4XMLL 4NN7C 4PJGA 5D5ME 3MV11 3U0WL 4XCFL 3L1OH 4TRPH 3VE0A 2PW2A 3ZDYF 1IAOA 9CGTA 2Y7QA 5LGHH 2B1HH 2XWJA 1MFAL 2X9XA 1F3DH 3WEXB 3FO2A 3MFFB 3WIIL 1MCPH 3HFMH 3REWA 2MTPA 2B8OT 3QJFB 4E41A 2VTFA 4S2SB 3HAEH 3QH3A 1BD2B 2QR0B 4WEBH 1DBKL 1FO0L 3OKKB 4AL8L 5D1QD 3ARXA 4YO0A 4LAQL 2YC1A 4M48L 4KRPD 2DQIH 4IOFD 4QRQB 3U0PB 2IAMD 4D9QE 4NRXB 4PJFF 1GVIA 4JDVB 3OXSA 3WNMA 1FG2A 1MHHB 1NDMA 3CIQA 4QT5B 1F58H 3C6LA 4Z8FH 4YWGH 2OTPA 1U42A 3S35L 3RWCA 1CVSC 3JV4A 1RK1B 2WQ8A 1ZGLP 3JTTA 3L7FB 1UT9A 3SOBL 4XNZC 4HWUA 2VABA 4LKCB 2XTJE 1QYGL 5DMGD 4WHDA 3VFUA 4Q9RL 2ZUSA 3SCMC 3ES6B 1NEZB 2FGWH 1E4JA 3EYVA 1U92B 3C5ZC 4YDVB 3CFBA 5HGDB 2APFA 2ZJSH 1V05A 1S3KL 3UPRB 1ZE3C 2CMRH 3KPSB 4YPGB 1TPXB 3VRIB 5ITBH 1PZ5A 4G7VL 1T6VN 1MLBB 4L29B 4GO6B 4ODSL 4E42B 4Y1AB 1OT1A 1YPZF 4PJ9C 4UAOB 3QIUD 4PFEA 3B9KA 3PHSA 3BP5A 3X12A 4ONGL 4QRTA 5JMRA 1JYVA 1LQSR 3E2HC 4JM2A 4B7IA 3GUTB 2FHFA 3T1WA 1NCCL 2A6KA 3KPRB 4XVSL 5H2BB 1RJLB 5A2LH 5D2NE 3DOSA 5FUZL 1R3LA 5FV1L 5TDOA 1P4LB 4N0RA 3WN5C 4GMTH 1J1XH 4ZPTB 2P24B 1QR1A 3MR9A 3W11C 2G2RB 2BSRB 1F4XH 1P4IH 5FXCH 5DQ9A 5HPMA 1BD2D 5L8JB 3I75A 2CLZB 3LZFH 4P4KC 4HJJH 3JXAA 2XXMB 1HNGA 1F13A 4M7LL 4R8WH 2Q7YA 5IBTL 3U7YL 2ARJQ 4KVNH 2J1KA 5IV2A 2ILLA 1MCSA 1DQDL 4MX7A 1UM5L 3VXUD 4QHNB 3WSQL 2HJKB 4XNYL 3NZHH 3BHBB 4ZSOB 3UEZA 2VZVA 1T66D 1IEBB 3MREA 3ARGD 1KENL 3IF1A 3IRZA 3UDWA 1FAKT 4LEXH 4OFYD 4P23A 3QDGE 1RZIB 5LJYH 2Q6WB 5IB5A 1BFTA 5IVNA 1QBML 5EU7E 3KDMB 4I3RL 1VFAB 2A1WH 4OF6A 4AIZA 1WFUA 3MLXH 4KJPD 4M8QA 4C83A 1LE5B 3NZ8A 1A64A 2XNAA 2DYPB 5C0NC 4NO3B 2YMXH 5BZWA 2CKBH 1SY6H 4HV8B 5IVXE 3DPBA 2ADFL 2HFGL 4XXCA 1XF2A 4YDLB 2FO1A 4MDJA 1UYWL 3GZKA 3L5IA 3RWIB 5EFIA 4HGWB 5M94B 4JZOA 3LKRA 1TQBC 2ARWA 1BWMA 1RUPH 3KPRD 3PP3H 1JI2A 5JIPA 5GRWA 3VRJB 1XGYH 1JK8B 5CUSH 1BF2A 4NM8H 1G6RA 1QLEL 4OFIA 3FB6A 4Z78A 1JGDA 5ESVB 4DGIH 4U1KA 4EN3C 1KJ2B 1U36A 4ZQKB 1MCQA 1OGAB 2FYYB 4AM0A 1AGBA 5B38G 3EIFA 2YRLA 1S78D 1X7QB 3NTCH 4WJ5B 3QXDB 5C2UB 2ZNWA 1XGUA 3DX8A 4LLUB 1DCLA 4MA8H 1OB1B 4X7DC 3QEHA 4OLZL 4LU5H 2V17H 5TE7L 1IMHC 1HHJA 4PP1C 1EPFA 1WICA 3NFSH 1AY1H 2YN5A 1G7JA 4AEHH 3LS4H 3CU1A 1OF2B 5HD8D 4ZFFB 2CK0L 3TYGH 2ZOKA 1XGRB 2P49B 4MQSB 2YKLL 1RURH 3KHOA 3GFUA 2JJTA 3EYQC 2YHGA 4JFPB 5TDPB 1G7MA 5F7DA 4MXVF 2H3NB 3PWLB 3ROLB 3H9HB 1I1YB 5FYLH 3BUYB 4MDIA 3SDXF 1C1EL 2ITDA 2EC9U 5EU6D 5TDNB 4N9GA 3ZE1E 1BFOA 4GMSL 1UA6L 5ETUA 1M6OB 1XF5B 2BX5A 2IGFL 5B4MD 1UM4H 2MQ3A 3WKML 1T7VA 2I07A 2D9CA 1OY3B 1KULA 4YXHL 3BP7B 4YIQB 2C4FU 1R5VA 3DIFB 3QI9B 5ESQB 5DHVH 1NC2B 3GIVA 4OD1H 4EKXA 3HAEA 4TULL 2F58H 2NW2A 2BY3A 5A3IC 4H88L 4TOYH 4L8SA 5AYUL 1HYSC 4ZO9A 3FT4A 5HHXL 3EYUH 3BJLA 3KLSA 3IFNL 4L9LA 1TZHA 4Q58C 1FLRH 3AS0A 3G5VA 2ITCB 4YEFA 3W39A 3I85A 1Q1JH 4X4ME 4JHWL 2VR4A 1A6TA 5E8DL 2IJ0C 3MRMB 1OGAD 1O0VA 2YPLE 3HI6L 2LAGB 3V5KA 3MZTA 4EDWL 5LGKA 4YQXH 3ARFC 4E41D 3N50A 3W0WA 3B2VL 3MA9H 2GFBB 2ZUTA 3WUWA 4BM7A 3N9GH 3R06A 3RKDD 4KMLB 1K4CB 4PJHE 4FZ8H 1BOGB 2HG5B 4WUKL 4PJCB 3VD7A 3L5XH 1I1AB 4KUCD 1CU4L 4OKVB 5JZ7C 5LXGH 3DSNA 3DMMA 4NSKB 5DK0A 3WFBH 2AXGB 4B5EA 2O5YH 1LO4L 5JOPE 3QR2A 2BNRB 4JM4H 3VFGH 12E8L 1T4KB 3MBXL 5INDB 3MYJA 1MLCB 1FZOA 5TE6L 4C54A 4ZS7H 2Z31A 4QGYA 4JPIA 2OJZH 1HH9B 4KU1A 3R8QA 2VLRE 1BFSA 4Q9QH 1CFTA 2HVKA 4IRJB 4HG4K 1KPRB 3IU4L 4DZBA 1XGQA 3HRZB 1ND0A 1JFQL 2HLAB 3OAUL 4LPCA 4KKCD 4CJ1A 4PRDB 4YK4B 1HHHB 1Z6JT 1T22B 2Y5TB 4KJWD 2AI0L 1A3QA 5ALBH 1R3KB 1XZ0B 4OM0H 4WUUB 1I9JL 2Z91B 3WFEL 3PL6C 5H94B 4CVZB 5I2IB 1TENA 3QA3B 3QXUA 4PB9H 3PGCB 4R7DA 3MLRL 4NM4L 3X17A 4JFFE 4F7EB 3IFOB 1NCDL 1HDMB 5H8DA 4PJDE 1INEL 2H2SD 1B90A 1T2QL 1OTSC 3ZHLA 2AK1H 2VQ1A 5IVZA 2HKFH 1T1YA 4XMLH 3UTSE 3ULUL 1RUAL 4CADB 3U0WH 4XCFH 4OTXL 1T2XA 2XKNA 4ZD3L 1XF3B 3ARSA 5IR1B 2YK1L 3D0LA 3UTOA 4RGNC 3WIHL 1C7TA 4AM0B 1MFAH 2FJGB 4JQVA 4RRPG 1A1NB 3WIIH 5HHOB 4NRZB 3RX7A 4HUXA 4X4YA 3PWPE 1H3TA 1U8NA 4JRYB 1DBKH 1FO0H 4LCWB 3TPUB 4AL8H 1HWGB 4PG2C 4Y2DA 1A9BA 2ADIA 1ADQA 4LAQH 4KV5E 4RISL 4M48H 4ZUTB 1C08A 5I8KH 4YHOL 5I1JL 3VXNB 3GSOA 2CKBA 2H26A 3O3EB 1EAPA 4HJGB 1AO7A 2IADA 3T8XA 1FVDA 4FZEL 1I7TA 5ESAA 1KLGB 4NUJB 3K80A 4MHHG 1B0WA 3S35H 1LNUB 3H3PL 3DVNB 5JDSA 4LVOC 1AI1L 1S7WA 4Q2ZA 3DVFA 3SOBH 2VL4A 5I1GL 1MCBA 3FCTA 4JDTL 1QYGH 3IDGA 4Q9RH 1NFIA 3LEXB 1L7TL 4HIXL 3QXTA 2C3XA 5E9DA 3VXMB 2X2YA 2IBZY 1TVHB 1YY8B 3CSPA 3HG1A 2R39A 3OKEB 5B8CC 4IRSC 3ZT5A 4ZFOA 1S3KH 2NLJB 5CEYB 3AB0B 4WUUD 3NCMA 4Y5VC 3P4MB 1PZUB 1H3WM 4G7VH 3VG9C 2EEDA 1DSFH 1UACL 4ODSH 4ACPA 4X7SL 5J89A 1IAKA 3QQNA 5EULV 4ONGH 4F7PA 1H0DA 3I3EA 5F7KC 1NCCH 1MVUA 3MNVA 3VXRE 2DM7A 5D5MF 3CPLB 5IFJA 3PUCA 1NUNB 2BZDA 3ZDXE 3T0EA 2J5LB 1RJZB 3CLEL 3GJFH 5FUZH 2NX5A 4UDUB 4PV9B 5GISL 1AR1C 2A0LD 1IGYB 2JCCB 4I8DA 4OSUL 5EZLA 3M1BA 1OLZA 3DUSB 1MEXL 4FQHA 4NYLA 1A6ZB 4CBPA 1N59B 4L5FL 2B7DT 4JRYD 4ZAKB 1QR4A 1CFNA 4OKDA 4LCWD 3BQUA 3BZEB 3MBEB 1IAMA 3AVEA 4WI2A 4WFGE 1ZHBA 4QF1A 2E5EA 5IBTH 4Z7WA 3U7YH 4KZEL 5DHVA 1DQDH 4KJYB 5CEZE 1W0WB 1UM5H 2CXGA 3OAZK 4ZNCD 1HE7A 3UCRA 2EIZB 1VFOA 1FYTE 2A6DB 3WSQH 4XNYH 3VFNB 3RZCB 1TTFA 5F1NB 3RPIB 3IKCB 4QTIL 3QDMA 1KENH 4ZO8A 1I3GL 1YN6B 4UIKL 4X6FA 1I7UA 2BMKA 2NY4D 3SKMA 2HFEB 4ZOBA 3GMRB 1IT9L 1DQLL 4S1DD 1QBMH 4I3RH 3PWNA 3ILQD 4WDIA 2B5IC 4G8EB 1GXEA 1ZHKB 2VN7A 5TGBB 3SJVA 1EEZA 1WBXB 2BSTB 1FL5B 1FV1B 5F97E 1NPUA 5BZDB 1MI5E 4XI5C 2ADFH 1VADA 2EECA 2HFGH 2V9TA 3CC5B 2A77L 1UYWH 3ULVL 1X6NA 5KVEL 2DQFB 2X4PA 4KK8D 3SY0A 3GMPB 2EZ0D 3SDCC 5J56B 4QRSB 1BBJA 1F3JA 4CNIB 2XQYK 5D7LE 1T7WA 3CCHB 3HMWL 3B43A 4QRRE 2GK2A 3Q6FA 5D2LA 1HHIB 4QRPB 3NCBB 4WFHE 4R4BB 1IKFL 3EDFA 5DC0A 4JFOA 1J0JA 2R1WA 2BSSB 3MLVL 5A43C 4NBYB 1P84K 1BVLB 1XIWC 1G7IB 3VD9A 2E6PA 2DS4A 3MOQA 3BP4A 4I13B 2VLLA 2VQTA 4NWUL 4Y19E 4NCC1 3S97C 4JGMA 5CCKL 1MRCL 4CMMB 2VITA 3OKNA 1TZIB 5GPRA 3W0WD 3B6SA 5ICZB 1JNNL 5HYJB 3VI3E 3FO1A 4OLZH 5TE7H 4YDLC 3VG0L 4U1NA 1G7QA 4U2YA 1WZ1L 1KXTB 3LEVH 3T1FB 1E4KA 2LU7A 3RHWK 4P99A 2CK0H 1UGNA 3T2PA 4C56B 4NNXA 2CUMA 3MOAL 3RZCD 1RZJC 2YKLH 3B9AA 4WU5B 2XT1B 1KIPB 5JHLL 4P2YA 2ADGB 4G8IB 3V7MA 3AAZB 3L5WB 4LLWB 3GSVB 1SJXA 2Y6SD 2B4CC 5EIIB 1HILA 1C1EH 2A2QT 3OJDB 3RI5K 4LVNB 3EZJB 4P46B 2E7BA 3QDAA 4D2NA 3ARBB 4GMSH 4U0QB 1UA6H 3MO1A 2IGFH 5C09E 3S36X 4NRYA 3WKMH 4FQQA 3KXFB 3SKOB 5ILTL 2QHRL 4P2RA 1BZ9B 5IVXF 3IDNA 3CD4A 3CXDL 5EUOB 1EXUA 5I16B 3I9GL 2R0LL 5EU5A 3MOBL 5FKPA 1RZGA 4TULH 2DQTL 2OXHA 5GGUA 1KB9K 3BVNA 4H88H 4OIAA 1GZQB 2P5EB 4H26A 3HE7A 5AYUH 4WHTA 5D7KD 4KK6C 2X4SB 5HHXH 1A9EA 3IFNH 4P3CL 3FFCE 5HI4C 1U8PB 3PIQA 1RZ8A 5HHQB 5J6GB 1P5VA 4OLVL 3PHQB 3U9PL 1LVEA 3QZWG 3J8F7 3ZDZE 5FGCE 4NPYA 4JHWH 1FNFA 4RFEB 5E8DH 5J1TC 3QT2A 4LFHG 3HI6H 1MHEB 1RI8A 3G5XA 4PBXA 5DD3L 4P5TC 4Z77B 4EDWH 3OPZL 3PWUB 2GK0B 4QYOB 4GW5B 2J88L 2W60B 4E5XB 5HYJD 3AC0A 3QI9C 4YAQB 3B2VH 5MEOB 4Y2DD 5B38A 5C08A 3BGAA 2VDOL 1A7BA 4WUKH 2FNBA 2F74B 2DJ4A 4JFQB 5K9JL 1CU4H 4HK0A 2P5WA 1AO7D 4JFZL 3ZKSD 1IM3B 3D69B 5E4EC 4HWZA 3LQAC 5IM7B 1AHWB 4NKQB 1KPUA 4KROB 2BOCA 2Q76A 12E8H 3O41B 3MBXH 4GW4B 2WMPA 3VWJA 3H8NA 5TE6H 4TN9A 3ZE1F 4P46D 5FDWA 4XP4L 3ARBD 3MJ6A 3MJ8A 4U7KA 5I8EA 5E9DD 4NOFA 5J13C 3MV8E 5I76A 3IU4H 1VFBB 3CVIL 1VENA 1JFQH 1EFXB 4HW6A 3OAUH 2SEBA 3HG1D 2L7JA 5KS9B 3WS3B 1DUYB 4MA1C 4ONHA 1NGWA 2A6JA 4LPWA 1PVHA 2AI0H 4ELMB 4PJIB 5JOFA 3WFEH 2P5ED 4KVCL 3MLRH 1P7QB 4NM4H 5DD0L 4EJ1C 1NCDH 3MUGB 4GKZB 2GYSA 1INEH 1FNLA 3QEUB 1T2QH 2R1XA 5T33L 5FF6B 1PY4A 2R2HA 4LNRB 5JIIA 2ED7A 5EB9A 3T3PE 3VXPB 3T0ED 3ULUH 1RUAH 1BGXL 1CL7I 3QUZB 4R6UA 4IIQA 5I0ZA 1KT2B 1Q72L 5IF0B 4F8QA 4OTXH 4I2XA 4ZD3H 2BVTA 5IFHL 2YK1H 1OP5H 1ZMYA 1ZT7B 3FT2B 2V2XB 3O11B 1C5DB 3WIHH 5DMYA 3F7RA 5JTWA 5EZOL 4GXUM 5L8KB 4GQ9L 5IJVA 5DK2B 5IMKA 3BQUD 3TO2B 2PXYC 5IBLD 1DBJL 1FIGL 5K9OB 4HIIB 4M03A 3OXRA 4PJHF 1T1XA 4RISH 2WIIB 2J8UB 3OSKA 4YHOH 5I1JH 2QKIB 2OLDA 3LN5B 3GKZA 5BQ7A 4NN6C 4KROD 4FZEH 5E94A 1JGLL 1NCUA 3P4OA 1RY7B 3O4LA 1E6JL 1T5XA 2X4NB 5GRJL 3H3PH 4GXVL 3G5ZB 3KJ4C 4PJFA 1AI1H 3NCYP 5D93B 3U48A 1ZWIA 2X4TB 1W72L 5I1GH 1ZKAA 3DO7A 5T1MB 2Q86A 4JDTH 3ZO0A 3FAWA 1X5HA 3C9NB 4F7MA 3K4DA 3T0DA 2WP3O 1L7TH 4HIXH 4X80L 4PD4K 1EFXD 4ZPVB 1N8ZB 1YNLL 4OZFG 4XXDB 5JORA 1W2KT 4X9IA 4YGVA 3H7BA 2YXFA 1GH7A 1FO0B 3QFJE 1CE1L 2Y23A 1UACH 5JOEA 5HGHB 3BZ4B 5KSAB 4PJDF 4X7SH 4GG8B 2ARJA 3HI5L 3KPLA 5I18L 5AEAA 3EO9L 4X8JB 2K3TA 5C86A 3KLHD 4LF3A 1ETZB 4Q6IC 5DJ8B 4I4WA 5I8CA 3MV7A 1YPZA 3CLEH 3U0TA 1AKJA 5GISH 4OQTL 4I0PB 5J3HC 2BOBB 4OSUH 5CEXA 1DE4B 3ARDB 3SGEH 2AJ3A 4G3YL 1MEXH 5CGYD 2ADJB 3IU3A 43C9A 1PD6A 4MA7L 4X83A 4BUGA 5ISZE 3BFOA 4L5FH 2W07A 5DJ2B 2OZ4L 5LBSL 4KC3B 7CGTA 3GMQA 3HE6B 3NPSC 4HWEL 1MREL 2N4IA 4RRPA 3X3FH 1PY9A 2MKLC 3DXAE 5F70A 3TJEL 3TN0C 1T0PB 4KV5F 1QACA 3G6JA 4KI5C 1X9QA 2OL3L 4I77L 1EBPA 1ZTXL 3TVMA 4BK5A 4LLAA 5LAXA 4KZEH 4Y4FA 3C6SA 3HNSL 1N6UA 4PJ5A 4U6VL 3JWOL 3OAYK 4L4VB 4HZLB 5BW7A 5F6IC 1CXIA 1SEBB 2DI8A 2X4OA 4F33A 1B88A 1FZKB 5FYJU 4QTIH 1I3GH 2IH3A 2VSCA 1JWSB 4UIKH 2HJLB 5DRWB 2NMSA 4YZFE 2QBWA 4HIEB 1IT9H 3GJFB 3VCLA 5IEKB 4CN4A 4Z7UE 4F7TA 4FFWD 2Z93A 4MWFB 4XNUL 5FB8B 1I8IB 2UY7A 3BW9B 5ID1A 1CTNA 2VDQL 1CFSA 2FJHA 5C07A 2DOCA 1CDUA 3QUML 4GS7C 4JZNA 1FFNB 5MERA 3Q3GA 1J1PL 4WEMB 2EDXA 3LSOB 4ZODA 5HVHC 3QO1B 2LVEA 2A77H 3ULVH 4R2GB 5KVEH 4LK4A 3HE7D 4UQ3A 5KSAD 3MLWL 4OJFL 2R2BA 4U1HA 4P9HC 3TNNB 2BXYA 3HMWH 2LQRA 5CJBA 3TA3C 1IKFH 2OI9B 1I8KB 1Q0YL 3MLZH 4C55A 4PJ8A 4KZDL 3MLVH 3ZDXF 5IHBA 2FCBA 3Q0HA 4UIMB 2DM4A 5CMAB 5EOCJ 2G60L 3QUKA 1WITA 3L3DA 4CL7A 4PGDB 4N0UB 2BDNL 2DLHA 3MRQA 2VE6A 4PLJC 3ZLQC 4OQ1A 4IM8A 4NWUH 3UP1A 2C3VB 4HH9A 5CCKH 3N1QC 4L4TB 1MRCH 3QJHB 4HPOH 1T7YA 4MHHI 4HFWA 3HE6D 3BESR 5F6HJ 3MCKA 5C08D 1JNNH 1IEAA 1JN6B 3VFRA 5DDHA 3TP4A 4Y16C 1OSZA 3VG0H 3OQ3B 4DKAA 1HI6B 3UBXI 1WZ1H 3K8MA 2NTFA 1JGEB 5ITFB 4LGRB 2P5WD 2VDNL 4LASL 5IWLA 4M1GL 4F58L 1RZKL 5DZOA 2EXWD 4UOW0 5IROA 1KEML 1I8MB 2XKSA 2X7LB 1YDPA 4ZO6A 1UWGL 4NQTA 4WTZG 3MOAH 5HGAA 5DJZA 5DR5L 3WNOA 3ZSSA 5FA4B 4BQ8A 1U3HB 1DLHA 3MRCB 4U7MA 5IMLB 1CK0L 2D3VA 5L7XL 5JHLH 3O2WL 1GRWA 4XCCL 3MLPA 1FC2D 1INQA 4ZMAT 3P30L 3DETC 5CSBA 2FBOJ 4OFPA 3NGBC 5DYOB 1F2XK 2GY7B 3BGMA 2F53A 2XY1A 3DLQR 4Z7QF 1LP9B 2B2XL 4FRWA 1HQ4B 5IMMA 4ZXBC 1YECL 2R0WL 4X4XB 1JPST 3ARWA 4I1NB 3U7WL 4W4NA 3STLA 3DGGB 3SDXA 5ILTH 2E8YA 2QHRH 5J1AB 3KYMA 2GUOA 1KNOA 1Q9WA 4YHPA 1UQSB 3RGHA 3TFKC 4IJ3C 5IB1B 1CFBA 1NCBL 3DYOA 3CXDH 1ZLWK 1ZA3A 2R0LH 3I9GH 3MOBH 5I1LA 2DQTH 4R2GD 3MV9E 4CVWA 1YEKL 1KCRL 4H1LB 3RWDB 2ZUUA 3PDDA 1XCTB 3O3AA 4NQEE 3ZTNL 4POYA 4W4OC 4P3CH 1XF4B 1RAMA 2VXSL 5CJXA 1MCKA 4YHZL 3ZHKA 1VDGA 5ERWB 3D3VB 4WI3A 4OLVH 5I30L 1K4DA 1MWAL 3U9PH 4LLMA 1QG3A 1MIML 5DJ6A 3VGBA 5F21B 2B20A 4H0IA 1J8HE 3GSQB 1C16A 3W81A 3UAJC 3T65B 1OW0A 5CWSA 1IBGL 1OHQA 5DD3H 5FO8B 1TDQA 3OPZH 4H0HB 2J88H 1FZMA 4ETYA 4JJ5A 3H9SB 2QL1A 1I4FA 4HS3B 3EFFB 4OZFH 2VDOH 2YD1A 4BQ6A 3B9EA 5KAQF 1A7QL 4RX4A 5L2KB 3DX9B 5K9JH 1T6WA 1A02N 3MLSL 4LCCB 3U30C 5C0CE 2X09A 4D0DB 1U3HD 3PHOA 1T83A 1ORSB 2JK5A 2BJML 3CSGA 4RA0C 3UYPA 4BSVB 3L95B 3QNZB 5FO9B 2A6IA 3RVTC 2JF1A 3BD5A 4DEPC 3AREA 4MVBD 3MCLL 3GSRA 5HY9B 2YA1A 4X5WA 1H5BA 1DZBA 4XP4H 1FL6B 1L7IL 3OHXB 4OGAD 1OTTD 1OTUC 4RGMC 1F6AB 2X1XR 3HLAA 1BMGA 3UBXB 3CVHA 3CVIH 3DROB 1BAFL 1S8DA 1Q8MA 2NY6C 2NNAB 4PTTB 4K7PX 5KVDL 3V5DA 5DUBA 5F89A 1DQJB 5JO5A 4PGCA 1GC1L 1KCLA 1JTOA 3JWNC 3MRJA 5DD0H 2DJUA 1AE6L 2AABL 5CFHA 3QG7L 2DLGA 4MSWA 4NQUA 4XCYB 5T33H 4MCZA 2X4UA 5E5RB 3BMWA 3STZA 3D3VD 4M61B 5IB3B 1S5IL 3MV7D 4KXZH 5E1AA 3AMLA 5GS1A 1A7PL 2E7HA 1WGOA 1F42A 4Z7VE 3MRNA 1AKJD 1Q72H 2EH8L 4APQC 1O7SA 5D96C 5IFHH 1LILA 1ZT4B 1A1OB 3QZWA 2PO6C 2GSGA 5EZOH 4K71C 4KDWA 3RTQA 3PDOA 1BWWA 1YN7A 1LE9A 4MQ7B 4GQ9H 2D9QB 4HKBB 4BYHA 3WLWD 4LRIC 1JNLL 2W9EL 1DBJH 4XRCA 1FIGH 4MD4B 3MLTA 4GBXC 3TVMD 3MRRA 5I9QB 3BKYL 5T1KA 4LKXA 3O8XC 1WZLA 3KS0H 4PJ5D 2BVEA 5E7BA 3NFNB 1BD2E 2XN9A 1JGLH 2XWBA 2P44B 3DTXA 1E6JH 4CN1A 5BV7B 4LLQA 5GRJH 1NANH 3VI4E 1WSST 4GXVH 1TJIL 2ZZUT 1FFQA 2YD9A 4LCIL 4ZS6C 5I6XB 2O5ZL 1EA9C 1W72H 4NP4L 1UKQA 2BY2A 1KTDB 1P4BL 4NC2B 1TTUA 4HX1A 1TVBB 4X80H 5C0JB 3VGDA 3IDUA 2X44D 5CBAA 6CGTA 3GSXA 2DJSA 1YNLH 2FBJL 4YHPB 4QKXB 4ZFZB 1IQDB 4PGZA 3T77A 3SDAC 3LV3B 1CE1H 3S36L 4K7PY 4YBLC 5DRNA 5EUKB 1B0GB 3FOLB 4P57B 1K85A 5J9PA 2ICES 3GEWB 1A1MB 3ZHDA 2NY1B 3X11B 4DCQA 1QQDA 2YD4A 3HI5H 5I18H 3T3PF 4HIJA 4LBEB 4PYHA 4PJ8D 3KPSE 5FA3B 4ISVA 3BEVB 3RBSA 4JY4B 1KJVB 4Y1AE 1I3UA 5KVGL 4OQTH 2BXZA 5F1IA 2HVJB 5ICXA 2HT3D 1E4XI 2FZ3A 4G3YH 5D5MA 3TBYA 2WUBL 2CRIA 4H5SB 4MA7H 3KPRE 5IKCB 1S7RB 2OZ4H 6FABL 5IW1A 2CGRL 1JGVH 5IB4B 4HWEH 1CGSL 1MREH 4UUJA 5HBBA 1IM9A 4PV8A 2AJUL 4GLRH 3TJEH 5CZXC 5EPMA 2Z92A 2VWEC 1U8IB 3MJ7A 2H1PL 1P84J 2OL3H 4I77H 4OCMC 1AGCB 3RPKA 2LV4A 4HD9A 3V52L 2O5XL 3HNSH 4KKLC 4G6JL 3MRLB 4U6VH 1ZT1B 3JWOH 5C0GA 4LEOA 2CDEA 1LEKA 3TBSB 1L0QA 1HSBB 1AGEB 4M7ZB 4U0RC 2F53D 3F65A 2V2WA 2YRPA 4ONOA 3ULUD 3V8CA 3U9UA 3BT2L 5KN5B 3D39B 4WGVB 5TJWK 1HZHL 4ZTPL 3GB7B 4PRNA 1TCRB 5JR1L 3NA9L 4ZSOE 3UJIL 8FABA 4D9LL 5JQ6L 2ORBL 4XNUH 2Z8VC 4AH2B 2VDQH 1ZGLA 4BFIB 3QUMH 1J1PH 4JVPA 1ITBB 4ZOEA 3QFDA 3EOTL 4MZ2A 1KJMA 3P9LA 5D1ZC 2WLZA 3MLWH 1A2YA 4FG6C 3ZT7A 3UXFA 4JO3L 4WIQA 4Y4KB 3UTTB 4Y8AA 1VPOL 4MCZB 3DX6A 2VZUA 4HK3J 2YD7A 1F02I 1S9WA 5E7FA 4AT6B 4F3FA 3FQUB 1RV6X 2YD2A 2HH0L 4MNHA 1Q0YH 4P3DA 2P42B 4KZDH 1JF1B 2MMXA 4PGBA 4XT1C 2G60H 2DLEA 3V4UL 2EKSA 2W65B 1S7UA 4S1RL 5IQ9B 2BDNH 1OM3L 1AP2A 1D5ZB 1N4XL 5D2NA 3HNTL 1KB9J 2EICA 3ARRA 2IWGA 3KPNB 3TO4A 3LQZA 3WE6A 1QEWB 1UB6B 3IJHA 5GS2H 1JWMA 5ID0B 3PABB 1JNHA 1BZ7A 1QLFA 4RX4D 2W0LA 2X9YA 3VFMB 1MCRA 2VDNH 3E6HA 4LASH 1OGAE 4M1GH 1RZKH 4G6FB 4F58H 1Z0NA 5DMKB 1DL7L 1RQ5A 1KEMH 4F80A 3CDYA 5BJTB 4H25A 1UWGH 5HYFA 3BZFB 4MXWL 4OAWA 5DR5H 1RZ7L 3AY4A 2GCYB 3GBLA 5FUOL 1FN4B 3CUPB 1CK0H 5L7XH 2OTUA 3O2WH 2RGSA 5H35A 3ARED 4XCCH 3P30H 4KRPC 2V2TA 3GKWL 4JE4B 32C2B 4OCLC 2ZKHL 2R2EB 4YZFF 5IW6A 4NWTL 4XH2A 3V6OE 2B2XH 2YRZA 1NGZB 4Z7UF 4NHCL 1YECH 1UJ3B 2VAJA 5F9AC 3DRQA 1WCBA 3VD3A 1MVFA 4IMLB 1BF8A 3QDGA 4KHTH 2UVFA 3BXNA 2VN4A 3U46B 5D70L 1DLFL 2DL2A 4RCAA 4FXGB 1FFOA 2FLBT 3VGGA 1NCBH 4MNGB 4ZUUB 5FECB 4D0BB 1AR2A 1YEKH 2EDHA 4Z18A 2UUDK 3B3IA 5IVXA 3HZYB 4PRIB 2NY3B 2J6EL 4LSUL 3ZTNH 4Y4KD 3UTTD 3O3BA 5EZIL 5K33A 2VXSH 2VZSA 3UTQA 5DSCA 5DJXB 4YHZH 3IVKB 3ARQA 1FP5A 4FTVB 4GKSA 5ACZA 5I30H 1MWAH 1MIMH 4K3DL 4OCRL 3D18A 4MAYA 5AZ2L 5ICXB 4Q74A 3GSWA 1IBGH 3VH8A 3WO4B 3H0TB 3RTQD 1DN0A 3QIUC 5MEQA 1GZPA 2J4WL 3NCCB 1W72A 4LFHD 5GGVY 3IDMB 3QP3A 1A5FL 4UDTA 3CSYB 3GGWA 2CLRB 1PKOA 2CPCA 4P2QA 3GRWL 1Q0XL 2APBA 5L8LB 4HS8L 4G6FD 5T1KD 4L8CA 5F3HB 1KN4L 1A7QH 2JJWA 3KPOB 2YOCA 4MJIB 5F7YC 3MLSH 4DVBA 3ULVD 5TPWL 2XN9D 1I8LC 4Y8DC 1G9MC 3EOYG 4OF8A 4DJMA 5D7IB 4K9EC 5TH2A 3L3JA 1UB5A 2BJMH 5ACMA 1S7QA 2LU3A 4PJCE 4TUKL 3SPVB 5DJ0B 4WTZA 1Y0LB 4IEFB 3MCLH 1F6FB 2NXZD 5C0IB 3OKOB 2MPAL 2BNRE 2J12B 4PJAB 1L7IH 2P8MB 4OQTA 1JWUB 3RNKB 1W8NA 3WD5L 5GSVA 1T66C 3L6FB 1BAFH 3MGOA 2E7MA 3ARGC 5HYSA 4XZUA 1CXHA 1P53A 4PG9B 2VOTA 4JKPL 3V0VB 5KVDH 4XPTL 1CG9A 1KPVA 1JGUL 4FQXC 1GC1H 1BEYL 1BZQK 4OZFB 3CFEA 4WHYG 2CRMA 4Z7NE 4PRID 2NY3D 1A2YB 2BHZA 2OL3A 5DFTA 4J3XA 5CEZH 5EC2B 3PGFL 1AE6H 4EI5B 2AABH 3MRFA 3QG7H 4J8RA 4UV4L 4PD4J 1FRGL 2JE8A 4O2FB 4WV1A 1ZA6B 1S5IH 4FTVD 2Y36L 4CVXA 1A7PH 5BOPA 4WUUE 5CHNA 3MGAA 4PGBB 3OKMB 3F12A 5F1KC 2EH8H 2XACC 5DD1H 1LD9A 3F6LA 4LDOB 4YXLL 1PLGL 1FFPB 3OJMB 1I1FA 3GMNB 5EOTB 5I1DB 2I26N 4X4MA 1E27B 2JB6B 2FSEB 1JNLH 5KSVA 2W9EH 2YPLA 1EEYB 1N6VA 4JFHD 1R5IA 3LPWA 3CMOL 2GITB 3SN6N 4ZUSB 4RZCA 2XFXB 1HEZB 3BKYH 3T4YB 5HGGS 1AGDB 5HHOE 4HT1L 3AS1A 4EI6B 4ODBD 1Q9KA 4DK3A 1J05A 4OZGB 2ID5A 2P8LA 3AS2A 2VXQL 2ATKA 4JRYE 4LCWE 1CQYA 4MMXC 1Q9LA 4CMHC 1JPFB 1TJIH 4RMQA 4LCIH 2AXJA 2R56L 2O5ZH 1K8IB 4JFEB 4KKNA 4NP4H 1OAUH 1WTGT 2ZG3A 4P2OB 5GSRA 4YHNB 5F9WB 1P4BH 3C5JB 5EO1A 3QIBA 3RVVD 1JPSL 2JIXB 2OTWA 4HUVB 5FAAA 4U3CA 4PP2B 1KTLA 3RY4A 3BXNB 4PJEB 3Q5OA 2FBJH 2IEPA 3K7UA 2VLRA 5GRXG 1MCCA 2YS4A 5C0DA 1ZAGA 4BKLA 3CDGB 1C5BL 1CDYA 1A3LL 4O4YL 4L1DA 1FSKB 3S36H 2ESVB 2OM5A 3VXME 2OR9L 4M1CD 2EIDA 4BJLA 4TTGA 2O26U 4EI5D 4Z76B 3AGVA 3GMLB 4WU7A 4LHJB 3QQ4A 4DN3L 5A2KH 5J11B 1WWCA 1FNEB 1TETL 4PTUA 3L7EB 4TPRL 2RFXA 1FPTL 3GBNL 4KTEL 1WT5C 1VGEL 4POZC 3FZUC 5HHMB 1NGXB 3TM6A 4BSWB 4Z7VF 4JFFA 2E27L 3VFOB 1CDIA 3QUYB 3DV6A 4PJDA 5E08L 4GRMA 4XPBL 3B2UD 3JBG7 3KLAA 2ED9A 5KVGH 2UYLA 2DIJA 1A7OL 3UTSA 2PYEB 4BUHA 1QNZL 4RIRA 3VMPA 3WFDL 3KPQA 3LD8C 3VXQB 5DD6A 6FABH 2CGRH 4YFDB 5DQJA 2VJXA 1CGSH 4P2QB 2AJUH 5GGRB 1FL3A 2JCCE 3O6FC 5C0BB 2H1PH 1DUZB 4G80A 2EDQA 1BQUA 4XGZB 5D7JA 3PWPA 1YUHA 2XXCB 3V52H 3T0BA 3O3DA 4PLOB 1HXMB 1R3HB 4G6JH 1K6QL 4PJXB 1VEPA 3HPLB 5FCSH 1BREA 1V3LA 5F88A 3VI4F 3ZKND 1NFDF 3BO8A 3BOVA 3S6CA 1UWEL 2VL5B 5IG7B 4MD5B 3VWKA 2ZG1A 4HXBL 1J0YA 1YNKL 4JFED 4PY8J 3BT2H 4IOIB 3OKDA 4P2OD 1S7SA 4J3WA 1MWAA 1HZHH 2IMMA 3IDJB 4ZTPH 5JR1H 3NA9H 3C6LC 3MRPA 3UJIH 2JIXD 4D9LH 2AAVA 5JQ6H 2ORBH 3QDGD 1ONQA 3IJYA 4XC1L 3BIKB 1MHCA 2FATL 4P5KB 1D5XA 1U8HA 3RVWD 2KDGA 1HOCA 1L0YA 4JAMB 1BVZA 1CTOA 4RSVA 5KVMC 1P2CA 2HN7A 3BIAX 3EOTH 4QXTB 4GRLB 1SJHA 4RFNB 4R9HA 1WC7B 2PW1B 2AV7A 4K7PL 2MSPA 1VPOH 4JFDB 5HHMD 3LOWA 5DQDL 1U8OB 1BIIB 1KIQA 2HH0H 2CDGA 3BISA 3QUYD 1KUMA 1JL8A 1PX4A 3LCYA 4OZHB 2I9TA 1TXKA 1G7HB 2BC4A 4S1RH 1F3DJ 4O2EB 4P3WA 3ARVA 3VXRA 1S7VA 1OM3H 2PYED 3B9KC 4LLDA 4OV5A 3P11L 1N4XH 4QRPE 5E5UB 1QVOB 5F9OL 3HNTH 4CDGC 5I71C 4JM2C 4DAGL 1AIFA 1AQDA 4U2ZA 3QQ3B 1B0RB 4HMDA 4KK9D 3VDCA 5DURD 3EO0B 1DEEA 3FONA 4YHYB 2MHAB 4RAUA 2YSSB 4HQQL 2I9LB 4P2QD 5CLWA 4G42A 1H9VA 1H3PL 1R5IB 3MUZ1 3O6KL 5DHXB 2ICEB 5JPNA 3QUMB 4M00A 4G8FA 4WHYH 4B50A 3EGSB 3HZMA 2ZOLA 3MRIA 4LVHC 5T1LB 4TTDD 2WWKO 4MXWH 2Y07L 5HYJE 1A6UL 3L9RA 1Q9OA 5DA0B 3TNMA 1RZ7H 3TEUA 5FUOH 5F7NC 1JHTA 1BQHA 4WEUD 1XR8B 4E0RA 3D25A 2QQKL 3I02A 3S4SG 1FYTA 3GKWH 2ZKHH 4MD0B 4DFIA 4C56E 1Q94A 1FNSL 3N1FC 1UCTA 4R3SB 2VKWA 4NHCH 2KZ1B 4UILL 2DWDA 2HP4A 2BERA 3PWJB 3D9AL 4Y5XB 4EVNB 1D9KB 2CIKA 5D70H 3UDWC 1DLFH 3OR7B 5EN2A 3S34L 1OP5K 5FM5M 3RDTB 5CKAA 2JJUA 5FYKL 4P23C 3PP4L 1UEYA 1XT5A 5AD0A 5C9JA 1JUFA 1CF8L 4GRLD 2NXYB 1GYAA 3Q2CA 2EDFA 2FR4B 1RUKL 4G6AD 5DEGB 2F15A 3KXFE 4QHMB 5J1SC 4J3SA 2J6EH 4LSUH 1MI5A 1XGPB 1WBZB 4KK5D 5EZIH 3MRHA 4IRZL 5EUOE 1FGNL 2IPUG 4I18A 3KPPA 4YDKL 1F11A 4XXCC 3K2UL 5D7LA 5C6TL 2XZQL 4QRRA 3W9EA 3MJ9L 1YJDC 2P5EE 1QRNB 3NVQA 4K3DH 2XY2A 4OCRH 2C1OB 2G75B 5AZ2H 4QCIA 1HINL 5EU4B 4NKMA 4K07A 1SYVB 1PAMA 1CLOL 4YDJB 3UROR 2J4WH 5DJAB 1ZHNB 1CDJA 2YPLD 3TZVB 5J06A 2XG5A 3VFSB 4JN2A 1A5FH 1U3JA 2X1PA 4Y19A 4X6EA 3GRWH 4LQFL 5GRZA 1Q0XH 1S7XA 1R24A 4HS8H 1RIHL 3TBTB 1KN4H 5FYLE 4ZYKA 3JZ7A 1WZKA 3IXTB 2GAZB 3EUUA 3VXTB 3KYAA 3QUXB 5TPWH 2XA8L 3TIEB 2JLLA 3EO1B 5HJ3B 5JA8B 1JHLL 2X41A 2AEWA 2XWTA 4RMTA 5FGSA 4TUKH 3BO8B 4UOW1 3BE1L 2GT9B 4KUCF 1AJ7L 3PGDB 3MXWL 2MPAH 2JJTC 1I7RB 2P7TB 2OQJB 3WD5H 5C0AB 3HPJA 1NDGA 5E99L 2VLRD 1D9KD 3BIBX 4WHCA 4WVRA 3RDTD 1T1ZB 5IEHB 4NQXB 3RL1B 5C09A 4JKPH 5GS2D 4XPTH 2NY4C 2DN7A 1JGUH 2NXYD 1BEYH 2EYSB 2C3HA 5D1XB 1D5BA 1F8TL 4P0DA 5C0FB 1XGTB 5D6DA 1YEDA 4LQ1A 4M6OL 1ZLVK 1ZSDA 3PGFH 4JFXB 5KS9E 4QHUB 5MI0C 4UV4H 4EUPH 5CD3B 5BVJA 1FRGH 4JFFD 4AENA 5E8PA 2Y36H 4ELME 5J57B 1FAIL 3KNBA 4LIQL 4PJIE 3IDIA 3FFCA 1QRND 4L8SC 3UTSD 3WFHA 2EZ0C 5IB2B 4G9DB 5F8QC 3U2SB 1IGCL 5I73B 4L9LC 4OIIL 4I3GA 1PLGH 4YXLH 1JMZA 3ET9F 3EYOB 2KL6A 1IGFL 3TZVD 4ELKA 3TYFA 4LOUD 2IQAB 3GSUB 3JUZA 5GGVL 2R23B 4QTHB 4NQCB 2QSTA 4G43A 3CMOH 3DJ9A 2NPLX 3L3HA 3VFPA 3QAZB 4KRNA 3CFJB 3HC4L 4HT1H 3MMEB 2VZ3A 3REVB 1QOKA 3CSBA 2VXQH 2YR3A 3QIWB 3W2DL 1EAJA 2A83A 5FUCE 2ERJC 4PJCF 3P9WB 2OX5A 2FJFA 2AJVL 2J8UE 3O2VL 2H32H 1TJGL 3VWKD 3MRBA 1Z9OA 4EBQL 3DMMC 4GFTB 4P5MA 3ME0A 4LLYA 4S11A 2AVGA 1G7LB 2R56H 3C8KA 4IHOB 2BNUA 1JPSH 5EG6C 3LKNA 3FTGA 5DMJB 2DDQL 4GAGL 3V8OA 2DAVA 1PQZA 2Z31C 4MJ4A 3PE9A 1N2RA 4V1DB 3MV8A 4GAYA 5DFWH 4N9OB 4RDQF 4MQXD 4RNRB 3OX8B 5D1XD 1IEHA 1C5BH 1A3LH 4ETQA 4O4YH 1KJ2L 2B4CL 4QWWD 1IE5A 4Z7NF 1CDGA 1U8QB 2OR9H 2FWOB 3V6ZA 1PG7W 3G9AB 2OCFD 4DN3H 1TETH 2BFVL 5EBWA 5JIKA 3KYOA 4TPRH 1FPTH 3KPMB 3SBWA 3GBNH 4KTEH 1VGEH 5DEFB 3KPPB 3VFTB 3BPLC 4R7NB 2E27H 3I6GA 5E08H 5TF1L 5D9SB 4L8DA 2WWMD 4TUJB 4XPBH 4FABL 2ED8A 2FHCA 2M2DA 3JWDL 5F9WC 3LKSB 1A7OH 1HHGA 3CDCA 5GRUH 1X5XA 4XP6L 1QNZH 4PY7A 1Y6KR 2H6PB 2G5BA 2VDRL 4PRBA 3WFDH 2AJSL 4WW2A 1HHKB 1I3RA