1GHFH

Anti-anti-idiotype gh1002 fab fragment
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
212
structure length
212
Chain Sequence
VQLQQSGPELKKPGETVKISCKLWYTFTDYGMNWVKQAPGKGLKWMGWIQTNTEEPTYGAEFKGRFAFSLETSAFTAYKQINNLKNEDMATYFCARVEAGFDYWAQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antibody fab fragment
molecule keywords ANTI-ANTI-IDIOTYPE GH1002 FAB FRAGMENT
publication title Crystal structure of an anti-anti-idiotype shows it to be self-complementary.
pubmed doi rcsb
total genus 34
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 1995-11-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ghfH02
1QSZA 4KZDH 2Z35B 3MBEB 4PJGA 3DRTB 3CGTA 4PP2A 3W0WD 1BFVH 3QJFB 4JQIL 3BFOA 3RPKA 3UC0H 2C3WA 3D1MC 3RP1A 1MHEB 2EDHA 5CJQH 3T0WA 4HX1A 2XWTB 1A0QL 5E00B 4ZUWA 3H7BA 4ZOEA 1SJVA 3UYPA 3V6ZA 2Y5TA 1FN4A 4N0UE 3NCYS 2ZCKH 4AM0B 4P23C 1ZHNB 2H32H 4FXLA 5HHNA 5ERWB 3L3JA 4NHCL 1CE6B 2WBJA 3MJGX 3U1SH 3ZT5A 4ERSL 1QQDB 3UTZB 3GRWL 4JY6B 5JXEA 4UNTA 4M1DL 5AG8A 2N4IA 3VFVB 3LH2L 3GJEB 1S9KC 5B4MD 1KEMH 4OFYD 1BZQK 3BKML 4PRHA 4DEPB 2CSPA 2XG5A 3EO1A 1B3JA 5KJRH 3QDJB 4LQ1A 2AP2A 3MRQA 3HE6B 3FQNA 3U79A 3GJFK 1L6ZA 4LOUD 5F7YC 5ID0B 5FM5M 2ZOLB 4OM0L 5DD5H 4G8FA 1GZQB 5FGSA 1JNJA 1G9NL 2UYLB 4BQ8A 3OQ3B 4MX7B 1IAIM 4WHTA 5MEQB 4PJ8C 1S7SB 2R39A 2MFNA 1MJ8H 1MIML 4QXGL 2LVEA 1E0OB 4Y4FC 3UBXG 5K9OB 1XH3B 2DQCL 3MFFA 4Z95L 3TA3D 4EOWH 2DM3A 3TNNA 5LVEA 4JANA 1A2YA 1TZHA 4L3EE 2X70B 3RDTA 3B9DA 3FT2A 1OP5H 4WGWB 1UACL 4ZPVA 1BWWA 3QZWG 4PJHF 4UUJA 1OD9A 5HHQA 5HYJB 4PJ9B 4NNXB 3OKOB 3LKSB 4JFDA 5L2KA 1G1YA 3MRIA 2RIKA 3NMEA 1QRNB 4UV4H 3MRCA 3TN0D 5B3JE 1URLA 4L5FH 1DBAL 1EVTC 4NJ9H 4R8WL 2F53D 5KTEH 3VWJA 5AYUL 1N0XL 1XF4A 4IOIB 1KNOB 3F12A 4KMLB 5E6IC 5D93B 5ECJE 5IEHA 1SJXA 5JXAH 2EKSB 5I1GL 2ERJC 1JI2A 3QUYD 3SE4C 1IL1A 3V6FB 1PEZA 2EDXA 5C09A 4IMKC 5GJTH 1KTDA 3B43A 3VFMA 1KIRA 3CFJA 1PG7X 5FYKD 1J5OL 3U2SA 1IKNA 5C3LD 3EFFA 4G8EB 5E8DL 1AD0A 3FO1B 5E8EA 3V7AE 4BFIA 4RFOH 4ZOAA 4R7DA 4Q0XH 1LD9B 5HI4D 4ZFZB 1V3MA 4NN5B 2HT3D 2AAVA 3F58H 3O2WH 2R4RL 5D2NA 4CN4A 5BMFL 4HS3B 4LASH 3V79C 4ISVB 1K4DB 4RIRB 3T65B 1CDHA 1XGYL 5IVZA 4WFEE 4Y16B 2QQNL 2RFXB 4EI5A 2W0FA 4XXCC 3FHQA 3P73B 4G9FD 2DAVA 2WIIB 3DSFL 2PCPA 4NUGL 1J86A 12E8H 2ZKHL 3V5DA 5HPOA 3DRQA 5E95B 1NCWH 4NKOA 5DVLA 4J12A 5B8CA 4PJAF 1RULH 3G5XB 1FORL 1T2QH 2MKWA 2FYYA 3MLWL 1R3IL 2A9ML 3MV01 4KJQC 5D2LF 3VE0B 3VFRB 4HF5H 1LO3H 5IMOB 5IOPB 4GOSA 1OGTA 4Q9BA 4DUVA 1V7MH 2AQ3A 4XMKH 3P4OB 1N6QH 4LDOB 1S9YA 3MCG1 2WM0A 5F7DB 3U7WL 4JQIH 4JFXA 4XNQB 3R4DA 1OARL 2RHEA 1PYWA 1MI5D 1MPAL 1FYTD 1X7QB 3TO4C 5DK3A 1A0QH 4BZYA 4CADA 1IGJB 1J9CT 4LCCC 4AH2A 1TDQA 3OWEA 3FL7A 2UY7A 1XR9A 1GOHA 3JWNC 4YR6B 4I2XB 1CICA 4NHCH 3HZVA 4XB8A 4ERSH 3LY6A 3GRWH 4MXQD 1CDGA 4BFEA 3E2HB 1GGIL 2K3TA 4NHUA 4M1DH 4PJFF 1M1SA 4N9GA 3LH2H 5KVGL 4ETYA 5ENWA 2NY6B 4NQDD 2ZNWA 3BKMH 4R4FL 4U7MA 1F02I 5HHOE 1ZSDA 2H3NB 4LCYB 1PQZB 5T1LD 1DTUA 3SDXE 4PIRF 1UZ6F 1YEEL 3CLFL 1KN4L 2C1OA 3SKMB 1XGUA 3OF6D 4YXKL 4EN3D 4BH8B 2JLLA 3SGEH 1A1MA 2VL4A 3CK0L 4OM0H 1BBJA 4YDLB 5KSAB 5DQ9B 1G9NH 4TNWF 5B4MC 3DX7B 5HDOA 3UTTE 4JQVA 1S7QA 1AQDA 1LK2A 4RMTA 3I6KA 1MIMH 4QXGH 3E6HB 2KH2B 3QFJA 4PJIE 2DQCH 4Z95H 3DUHA 3O11B 5IB5B 3ULUC 4ZUUA 4LOUC 4R0LC 5D9SB 3WMSA 1KIPA 4MYWB 2C4FU 1MCFA 4ODBD 1BVKB 5C3TA 2CUHA 4BSJA 3CSYA 1GGTA 4UDUA 4XTRC 2GJ6A 3WN5A 2XQYK 5E9DB 1MH5B 4K94L 4JFHD 1UACH 1JGDA 3NCJL 2F9BT 3FQWA 2XIDA 1ZLWK 1QLFB 5ESQA 3D85B 4HKJA 1CDUA 4Q6IC 2DWDB 1QEWB 1G7PB 5ACLA 1S7RA 5TGBB 3IFOA 2DIAA 1U8JB 4KKNA 2DJUA 1DBAH 1ACYL 4R8WH 2HRPL 2XXCB 4XP9L 2Z31D 5IVNA 1N0XH 2V7HB 4HWZA 5HGHA 3SGKC 5F8RC 5I1GH 4LRNL 4HUNB 4WIQA 2YBRB 5LQBL 2IQ9L 4OLWL 3TJEL 3M45A 3KNBA 3FN9A 1LP9A 1RZIA 4J8RB 4S11A 3TN0C 5GZND 3ARGA 3CMGA 3KPLA 4JM2A 3IDMA 5C2BL 3CNKA 1EJOL 1QHOA 2R0WL 2KKQA 5INDB 1J5OH 1EXUA 1KCLA 3DTXB 3WLWC 1NCNA 5E8DH 2GK0B 1ZA3A 3S96A 1S7VB 5D1ZA 5F7LB 1HQRA 3QUYC 4PG2C 2CR3A 2AXFB 3DYPA 1G6VK 2HMID 3BH9B 4KK9C 2I9TA 2R4RH 5EPMA 4TSBL 4CDHA 5BMFH 5F3HA 4HIJA 1F5WA 1VENA 1EO8L 1GGCL 1FQ9C 1XGYH 4P2RE 1F2XK 2QQNH 4GUPB 4U1HA 3WNMA 5HI4C 5L88L 4X7TA 4NUGH 4LPCA 5FK9A 2HT3C 2ZKHH 3FFCB 4YBLB 1A3RL 1D6VL 1U8QA 2YPLA 1EAJA 3EJZD 4PGEB 1QNZL 3HUJA 4HUWB 2PYEB 4V1DB 1ZVHA 5FOBB 3JV4B 1OY3B 3P0YL 1FORH 3D5OF 3MLWH 3OAYK 5HHME 1R3IH 2A9MH 1H0DA 1U3HD 2YWZA 3B8YA 3X13B 1DUYB 1NMCC 3IB4A 2NX5D 1EDQA 3CXDL 3AMLA 4CW1A 4RBPH 1LEKA 2X4TB 3LN4B 5CEYB 3P4MB 5DURB 1DL7L 2I07B 3LKOB 4Q74A 2OXGA 3U7WH 3D39E 2OL3L 2XA8L 5IHZA 1IAIL 1YEFL 1E4WL 1RIUL 4WFHD 4C4KO 1OARH 5F6HJ 2FH8A 1MPAH 1UH3A 2BCKA 4OM1L 2BMKB 5E5UB 3EOBB 2XACC 3CXHK 5DJ2B 4TNVF 1HHGA 2KDGA 4L4TA 4XVSL 5GRVL 3RI5F 5I73C 3PWUB 1FO0L 5E8OB 5F89B 3MLPA 4EDXB 1RZJC 2VLKA 3WLBB 4ORGA 5F8QC 4QXTA 2M2DA 4Y2DC 3B9KB 4AT6B 3L5JA 3QDME 2FWOA 1B6DA 5FECB 4PJBF 1GGIH 3FTGB 4HCRA 1BZ9A 3SO5A 2BOCA 5KVGH 4XPTL 4ZODA 3SOBL 3OG6B 3MYJA 3OKKB 4R4FH 2BY0A 4EQ3A 5HSFA 3T2NL 4J4PC 1EO5A 3EHBD 2YEZA 4F8QA 1I8IB 2AJZB 4HMEA 5SX5K 5JW5B 2FIRT 2YUZA 2KUTA 3HAEA 4HLJA 4UILL 1YEEH 4YX2L 3CLFH 4XBEL 4YXKH 3FO9B 1IKFL 3TPUA 3EYOA 3O4OB 3CK0H 3JV6A 4X6DE 3UTSD 4U2ZA 3QI9C 1QLRB 4F33A 3QIWD 4KRLB 2FR4B 3DMMA 1F4WH 4PRDA 1P7KA 5IMKA 5KW9L 3EAKA 1AHWC 4WI9A 3G5YA 6CGTA 3EZJB 1MVUB 2A6IA 2R1WB 4JG0L 4C56A 1NCAL 3PGFL 1HHJB 1WIPA 5IFJA 1MCSA 1T21B 4NQTA 2EH8H 2ZUXA 5CSBA 3QG7L 3WXWL 2Z92A 5GS2D 3S37X 1N5YL 3KYOB 5ICZB 5T3XL 3BPCB 3OGCB 4V2BA 4XPFH 3I6GA 1NGXA 3O9WD 3OKEA 1Z2KA 2GSIA 2ADIB 1AGFB 4CMHB 1VKXA 4K94H 1TQBB 3NCJH 5C07D 1YMHB 4LCUB 5GHWL 4JFYB 1I1AA 1D5XB 3Q6GL 4OV5B 5KOMC 1DR9A 1A7RL 1ZT1B 1NFDA 3D87B 1BOYA 1CU4L 4IDLA 2QADB 1RIHL 3BAEH 1IM3A 2Q76B 3CDYA 5I15L 4XP9H 1WT5A 2XYCA 4K3EL 1XGPA 3CMOL 4HWUA 2ICCA 5JQHC 1KTLA 4P2QA 4P0DA 4LRNH 1JGEB 2Z93A 3ARDA 5LQBH 2AEQL 2IQ9H 2P5EE 4OLWH 3TJEH 5HYSA 1RJZA 4U1JB 3ULSB 3VXSB 3QAZB 4HT1H 5C2BH 3MRGA 1EGJL 1CS6A 1EJOH 5H8DA 2F54E 5KSBB 2Z31C 4R4BB 5DRNA 2ZSVA 3KPOB 5CP7A 4LIQL 3OB0K 1WC7B 1DN0B 4PJ7A 3C5ZC 3LIZL 3MMEB 3RA7L 4OZGB 5GGTL 4EXPX 3ORJA 5GZNC 2J8OA 4TSBH 1B4JL 5C0AB 4RWHA 5C9JA 4Z7VA 1EO8H 1JK8A 2XG4A 1H8NA 3MA7B 3ARZA 3MV9B 4PY7A 1KULA 5DC9B 5EO1B 3QJHA 3M8OL 5C0FA 3IAQA 5L88H 3UPRB 2HMIC 1DBML 3MACL 4G42A 1H3XA 5GSVA 2V7NA 1A3RH 1D6VH 3C60D 4PY8I 2YC1A 1UJ3A 1Q72L 3BWAB 4BSVB 5JHDE 3RIAK 4LVOC 5MEPB 4JN1L 1YEDB 3MC0A 3PL6B 4HZLB 4L3CB 3HNTL 5KS9B 4C83B 4XHJD 4N0YH 2GW5A 1SYSB 3CXDH 4GKSB 4XP4L 3HRZB 4NRZA 2BERA 3EJZC 1DL7H 1RUPL 1T04B 2O93L 1P1ZB 2OL3H 3CIQA 2XA8H 4OZFB 5D7JC 1IAIH 1YEFH 1E4WH 1RIUH 3SJVA 1UKSA 3HMXL 3QXVA 4MD0B 4OM1H 5I1EH 4FQXD 2RR3A 5EOTB 5CBAA 1M6OB 1KT2A 3EO0A 4JO2L 4DOHB 4JGUA 3ZDZF 1T1WB 3UZQA 3GIZL 4XVSH 3QUZD 2IMNA 3LSOA 1FO0H 4JRYE 3VXTA 3K4AA 4QRUB 1Z9OA 2FD6L 4MJID 4BH7A 4OLXL 1DDHB 5IB2B 4OKDA 1D3CA 2E9IA 4G6JL 4F15C 2VTFA 5C08E 3SGJA 5DTFB 3VWKB 3H3PH 1R3KA 3LRSB 1CFSB 4BM7A 3LD8C 3D25A 2F74A 5L0QC 4XPTH 5CFHA 1EPFA 3RPIA 3SOBH 1BFOA 1YEGH 1CI5A 3T2NH 3ZE0E 4CGTA 3FN0L 1KB5A 5IJKA 4UU9A 1B6UA 5ADPL 1R5WA 3GSVB 5EU3B 4MXVF 3QCTL 2NZ9D 4YX2H 3KHQA 4XBEH 5JA9A 3REWB 4Y5XB 1IKFH 1IGTB 4JREB 4UQ2A 5I76A 1I7ZB 3BRDA 3QDGD 2NW3A 1WQVT 5K9QG 1IAOA 2VZUA 4TUJA 3EHBC 1PG7W 2V6HA 4PPTA 2IBZX 3LZFL 5KW9H 3L3GA 4NOBA 4JG0H 1IEBA 4PGBB 1NCAH 3PGFH 1F2QA 4WTXA 5IQ7L 3GNML 3QG7H 4NN7C 3WXWH 1N5YH 2DKSA 5CIPB 3O41B 5T3XH 3H7LA 3QIWC 1A6TB 3P3YA 3RVUC 3S37L 3VMPA 5A2JH 4HLZG 4KGLA 4EUPB 4PR5A 5J6HA 1TPXB 8FABB 3AAZB 3MJ8A 1T3FA 5GHWH 2C4XA 1A7RH 1JZ6A 2JK5A 4I0PD 4K8RD 5D1QA 5C0JA 2OSLA 2FIKA 1CU4H 3O9WC 1CDJA 3ARRA 4CUCA 5BW7A 5EORL 5I15H 3WE6A 2VDQL 2RAMA 1CD8A 4GRLC 4K3EH 3L5HA 3CMOH 4ZFFB 4X6CA 3KPNA 5JPMB 4ZXBB 2PTTA 4XMPL 2B4CC 3M1BA 3I6LD 1SHMA 4JG1L 4PRIB 1YMMD 2AEQH 1A4KB 1G6RB 3KXFB 3ULUE 4WTZA 2FJFA 4OGAD 1CFQA 4YHNB 5MI0C 1EGJH 4OI9A 3JBG7 3UPAA 5J13B 2DD8H 3O2DA 2C3VB 4LIQH 1T2JA 3MLSL 3RGVD 2ZUVA 1CXEA 4QKXB 4QRRA 3LIZH 1A5FL 3HI6L 1SVZA 2XWJB 3LKQA 1T0PB 3RA7H 5GGTH 2RB8A 4G6KL 3WHE1 4YPGA 4GFTB 2BSSB 3FRUA 3SCMA 1B4JH 2J8UF 5IUSA 1PKOA 2IALB 1TETL 4M4RA 4XRCA 4O2EA 2BNQA 4HEPG 4R97C 2MKLC 3M8OH 4ZO7A 4WO4C 1C08B 1DBMH 2PO6B 1PLGL 2WP3T 3HI1B 3MACH 1I85C 1A7QL 3GMMA 5DD6B 4L9LC 1C12B 5IW6A 4PJCA 4TTDD 3ARSA 1G7LB 3MBED 3T3MF 2AV1A 4HBCL 3KYNB 4RNRB 4PV9B 5F1KC 3RU8L 4JN1H 4OV6F 4YUEH 4ZS6D 1PFCA 3T4YA 1MCCA 2CDEB 2VLJB 2F53E 2YRPA 1NPUA 1MLCB 3VI3F 3GI9L 1FVEA 4XP4H 2XT1B 1JHLL 4OCSL 5B38A 1D7FA 4RISL 3GUTB 1YEJL 2CLZB 4OCWL 1ZS8A 3C60C 3HE7B 1RUPH 3MPCA 1WBXA 4MVBD 4JZOA 5DT1H 1Q9OA 3HPJA 3QIBC 3HMXH 3G5VA 4ZTOL 2R23A 4XHJC 5FYKE 3WS3A 4PLOB 4XCNB 1IQDB 1BQUA 1I8LC 1FLRH 3GKZA 4JO2H 1UB6B 1XGTB 3GIZH 1DQJA 4PJ5B 2I27N 3ZL4L 4P2CG 2HJLA 1N59A 3L3OA 4ELKB 2D0HA 2FD6H 2Q8BL 2BDNL 5L9DH 2D7MA 2W0LA 4OLXH 5DJ0B 1MCQA 4W6YB 3VD5A 4FQXC 4QTHA 3CFBA 1MLBB 3BIKA 3MUGB 4ONHB 4G6JH 4S0TD 4ELMB 3QUZC 1IBGL 1F11B 4OZHA 5IVXF 3HE6D 3NN8B 3STLA 2CIIB 4X7SL 3VGAB 3FN0H 4GMSL 4I48A 3UCRA 5IFAL 5ADPH 5F97E 3WJLC 1INQB 4W81A 1QO3A 2R29L 3QCTH 1MHCA 4LVNC 4L8BB 4OGXL 5T1MB 1P69B 5CBEB 1MCLA 1RUAL 4QRQB 5FUCE 3ZE2E 4N68A 3NZ8A 4GRMB 3KPSA 3NFPA 1VERA 2YSSB 1QP1A 2R2BA 1U8HB 4HDIB 3LZFH 3K8KA 3ZO0A 4GBXC 1J18A 3EJYD 1FYTE 2NZ9C 1H3VA 1TZIA 4E9LA 3BUYB 4F7EB 2WUBL 1GSMA 4Z0XB 1U92A 1N0LA 5IQ7H 3GNMH 5HYJD 2OR8A 4PJ9D 4BK4A 4HIHA 4F7TB 3IS1X 1QRND 1KEGL 2BVOA 4H0IA 3MNVB 3QHZH 4K7FA 3WHXB 2PF6A 4IDJL 4P57A 4BUHA 2X4OB 5GGRA 3AREC 4ODVL 5DEGA 3TFKD 2E9JA 5E6ZA 1LHZA 2MCPL 1K9TA 1GC1C 3K8LA 4HBQA 2FHBA 1U8PA 3EO9L 3SHSA 3OAZK 5C0RL 5EORH 2VDQH 2DTML 3UX9B 5FA4A 4Y5VB 4HS6B 2VQ1B 5I1LB 2EEAA 3RWGA 1EFXB 5I6XC 3D3VE 3WD5L 4XMPH 2CH8A 4ZFGL 3DVGB 5EO9A 4HC1A 4JG1H 3BZFB 4I0PC 1NDGA 4CMMA 2FSEB 1OAXL 1OB1B 1MFDL 2XY2A 5BVJA 2EYRA 4U6XB 1M7IA 2D9QB 1Z0MA 4K71C 5FO7A 1NBQA 4WENB 1JMZA 5DVMA 3QUMB 3MLSH 3IKCB 4Y16D 4QCIB 3LEXA 5EUKB 3VXUE 3NCBB 1A47A 1JVKA 1MFEH 1A5FH 3HI6H 3RTQA 3GMOA 3EYUL 1CG9B 1J0KA 1EV2E 4G6KH 2DS4A 4MXWL 3BT2L 5IW3A 5JNYB 4L4VB 4PLKD 1SEQL 1TETH 5DUML 5J06A 3D0VA 1HE7A 3RGVC 4OQTA 3L7FB 4P9HL 1BREA 1X5YA 3REVB 1PLGH 3U7YL 1G0YR 2HFFB 1FVCA 2ESVB 2OR7A 3NPSC 1W0VB 4AYFA 3C8HA 2XQYG 5GGSY 4Z7NE 1D9KA 1HKFA 4PRPB 3RU8H 1Y18B 2QSQA 3L5WB 4GXUM 5CSZA 4JFEA 4G8IB 3QDHA 5LG1A 3GI9H 1JHLH 4OCSH 5IB4A 1FG2A 4RISH 2UWEB 1YEJH 4LVHC 4OCWH 4Y5YB 2DQHL 3QRGL 2ZUSA 4TTDC 2BY2A 3OKNB 4WU7B 3MBEC 1IFHH 1TNMA 4HJGA 2JJUA 2XICA 4ZS6C 4PTUA 3UTQB 1R5VA 2V2WB 5MEOB 3CSGA 5F72S 1XMWA 4U2YA 5HVFB 1KUMA 1Z5LA 3ZL4H 4BKLB 4HHAB 4MVBC 3HFML 4FQCL 1R3LB 5C6PB 3L9RB 2Q8BH 3QPXL 5JPNB 2NY6D 3RNQB 1NGPL 1YEIL 4P2OB 4X6EB 4KKAC 1CFNB 2DRUA 3CFDA 1BZ7B 2W0PA 1CK0L 2P24B 1UA6L 5I9QB 5KVDL 1XFPA 1IBGH 3VFTB 3EFDL 1FV1B 4OLYL 2GFBB 4Z7UE 2R4SL 5KSAD 1CXLA 1QUNA 4NRXB 4X7SH 1G9EA 4DEPC 2BY1A 4GMSH 5IFAH 1JTOA 4ZNEA 3LKRB 1ZAGA 2R29H 5J8OA 4H25A 4OGXH 1T83C 4PJGB 1MFBL 3OX8B 3MCKA 1RUAH 3U82B 3HNSL 4TRPL 5DO2D 4L8SB 3RUGE 5GGVY 4Q58C 1D6EA 1NCBL 2IPUG 2JJSA 3T3PE 5D96B 3STBA 5I30L 4QRPE 3PQYE 1P6FA 5EN2A 3QUKA 1J87A 4OD3H 3H7BB 4Y19E 3CDGA 5DMIL 5E9DD 4XH2B 5H35A 2PR4L 5SX4H 3WDHA 2WUBH 3MLXL 1GL4B 1I7UA 3GSUA 4KUZL 1JIBA 1GH7A 2DIJA 3D85D 3BE1L 5IF0B 3CH1A 1KEGH 2GQHA 3NAAL 1AO7A 4PY8J 3OTTA 4WW2C 4F7PA 3R1GL 5EUOA 3RX8A 2UV3A 3BP5A 4IDJH 1TVHA 5TDNB 5DFTA 1J8HB 4P5TA 2MCPH 1UXWB 4PJ9C 4HWBA 4YIQB 3EOAB 3EO9H 2Q86A 4K8RL 1F90L 2DTMH 2PTUA 4OI8A 2VR5A 4H1LA 3EDDA 2Y5EA 3OL2A 3U4EB 1FFQA 4OAWB 2CD0A 2QEJA 1TQCB 1P9MC 3WD5H 2YKLL 4ZFGH 2J4WL 5D93C 5D72H 4MNGA 4JDVA 5HDLA 3ARPA 1LEGA 3QA3A 4LSVL 1OAXH 2B1HL 1MFDH 3L1OL 1I1YB 2E9BA 4FTVA 4M1GL 3QNYB 2NMSA 3X12B 1WZMA 3O3EA 2Q7YA 4X4ZA 5T5NF 1IEAB 4K2UL 2YPVL 4N8VA 4NZRL 4WUUE 4JANB 3VXMA 5FEBA 3EYUH 5F7MC 4OZIE 3EOYG 3LV3A 4NN5C 5CGTA 5FB8A 3FFCD 4MXWH 4QOKE 3RFZC 3BT2H 1YC8A 3GEWB 4ZPVB 2PYED 4V1DD 5TPWL 1SEQH 2CUMA 3V5HA 2P8LB 4MCZA 4UUJB 5DUMH 5HHQB 2PETA 2NY5L 4Y16C 1K8DA 1HNFA 1X5FA 3ETBF 2FBOJ 4P9HH 5SWQA 2XZQL 1UM5L 3TIDA 3U7YH 4PJXE 5IMLA 3RJQB 4H88L 5E99L 5D7IF 3JZ7A 4TQEL 1IGYA 3TYFB 5DURD 2PYFA 2K7PA 1JHTB 1ZT4A 2PN5A 3DX6A 3UAJD 4PLKC 1WGOA 1WWCA 1NKOA 3NABL 2Q1EA 5T5NG 2ORBL 3G6JF 4JCLA 4LPVA 1XF2B 4LLWA 1YPZE 4OD2A 5SX4I 2YPKA 1KTDB 4P5KA 1AI1L 2DQHH 3QRGH 3TH2T 3QH3B 5GS0D 3CFJB 2NY3D 3QIUA 4TSAL 1X5GA 3U2SB 2GJJA 3PV7A 1BFSA 5JDSB 1AR1D 5I1DB 4YZFE 5E8EB 1H8OA 5KG9A 1TIUA 4R7DB 4GG6E 3B9KD 4MCYA 5IM7B 1QHPA 4MJ4A 5ADOL 1NMAL 3U7AA 4HK3N 3WIHA 3RIAF 5I2IA 2EDKA 4RSVA 2I9LA 4FQPA 1WAAF 3HFMH 4FQCH 1L4IA 5IVZB 1J12A 1G7IB 1NGPH 3FB7A 1YEIH 1M7DA 4Z0BL 4JB9L 4PJEB 2OI9B 5BOZG 1CK0H 1UA6H 5KVDH 2X89D 5H94A 1C16A 1U8MA 3V5DB 4MHHG 1F42A 4GQPH 4NKOB 4NPYB 3EFDH 5B8CB 2I5YH 4OLYH 2X1PA 3E2HC 4Y1AB 4C54A 4O51B 1D5ZA 3W39A 1KPUA 2J3SA 2R4SH 2FYYB 2NY6C 4PBXA 3S88L 1HNGA 3MJ9A 4LLYB 2VLME 1FL6A 2OTUB 3UO1L 3MO1A 4AZ8A 5DJAA 1MFBH 2ZG2A 4U6YB 3HNSH 1MF2L 4TRPH 1EHLL 5D7SL 4JFXB 5F21B 1NCBH 5I30H 4YDLC 4HH9B 5KSAC 3BPNB 3TVMB 1HILB 3MGOA 3LN5A 2EH7L 4Y4HB 1MCKA 2EDJA 3PDDA 3BPLB 2P43B 4CADB 5DMIH 5EBLA 3C2AL 1FSKB 4L8CA 3JWDC 3KPPB 1E4JA 2PR4H 3VGEA 3MLXH 3E6FB 2CKBB 3CD4A 5DO2C 4JN2B 4KUZH 3MUJA 1MAKA 4QHUB 3G5ZA 3MRFA 1CL7L 3BE1H 1CICB 1RQ5A 3HZVB 3NAAH 1A21A 2CLVA 2QADD 2YA0A 2W38A 4TVSa 3R1GH 4MJIE 4HPYL 4U1MB 2IH3B 4D0DA 3ILQD 3FB6B 1AIFB 5E7FA 4N9GB 2HFEB 4UMGA 5FGCE 4MNQA 3PWLA 1UZ8B 4KK5D 5HGBB 5KVFL 3GSQA 5ALCL 1ZSDB 5IHBA 4K8RH 1F90H 3ECBA 3VXSD 1S5HB 5DC0A 2IANE 1HI6B 1XGUB 2YKLH 4P99A 3TCXA 2J4WH 4HUMB 3CFKA 4G6MH 3MUZ1 4XCYB 5C0DB 5JW3L 2DYPA 4LSVH 3WNOA 4G3YH 2B1HH 3T1WA 3KS0H 2M1KA 3L1OH 4JFPB 3B8SA 1LK2B 5FHBL 3QDGE 1NGZB 4M1GH 4P46B 4KPHL 5C0AD 3GMNB 1MCHA 4I9WE 4PFEA 4X99B 2EO9A 3MV9D 1KIPB 5SWZA 4K2UH 2NXZB 2GK2A 2YPVH 4NZRH 4F58L 3AROA 3F5WB 2AJSH 1RZKL 1FZJB 2GY5A 4UTBL 3O3BB 4DAGL 3O4LB 4N0UA 3HKFA 5FYLD 4DKAA 3CFEA 3HS0A 4G8GB 2GJ6B 5TDOB 1CWVA 4I18A 3IFPB 5TPWH 1QFUL 2JF1A 3QXTA 4RAUA 2NY5H 5E24E 3PL6D 3JTTA 3MRHA 5EH1A 2XZQH 1UM5H 3B9VA 5ILTL 1S7RB 3K8MA 3Q3GA 3F65A 4H88H 5E99H 5TH2A 1LE5B 2DICA 4YBLC 3T77A 3HZKA 4X80L 2E7LC 3RX7A 2BJML 1AFVL 4H20L 4OFPA 5HGHB 3FQUB 3NABH 2VDKL 1G9ML 1QA9A 3MRKB 2ORBH 1JGLL 1QSVA 3U6RA 3TO2A 1JZ3A 1RFDH 3NIDF 4GAGL 4MMZC 2H32B 4TSAH 3UAJC 5FF6B 4E0RB 1R3HB 5GRZA 1ZA3B 1C7TA 5DDHB 1OP9A 4XPHH 3BHBA 5F7FA 3S96B 1EO7A 1DLHA 1FFPA 5CZVL 4M6OL 2YD1A 2W60B 2APVA 4J23A 1VFBB 3VWKD 5ADOH 1NMAH 2DOCA 1JRHI 1Z9MA 4HFUL 2HT2C 4HIJB 3OAYH 5HHVL 5LCVL 1AJ7L 2W65A 5C71A 4M6NH 2BFVL 1AR1C 3AB0C 5ICYB 3B5HA 5I1AB 1SYVB 4Z0BH 4JB9H 3RL2A 4NQCE 3B9KC 1JYNA 1T1ZB 1WBZA 3OJDA 5IG7A 3UZEA 1YYLL 1AXSA 1U8QB 2A73A 3HUJB 3P9MB 5CJ5A 1TJGL 1ZA6A 5HGAA 3PNWB 5IJVA 1FG9C 3S88H 5F9AC 3IDGB 1NC2A 5IROC 3LVEA 2FECL 4W6XB 3BEVB 4U4BA 3T2OA 1KLUB 3UO1H 5E2VL 3U0WL 5DQJB 3CFIC 5B39A 5IBUG 3K1DA 1P5VA 1CIDA 1MF2H 1EHLH 5D7SH 3KWWA 1MQKL 2BNRA 3O4OC 1NUGA 2I24N 3IXTB 2EH7H 4WFFD 4Z7WB 3L3HB 3MREA 5MENB 4MDIB 3C2AH 1L7IL 2Z91A 1A1OB 1CXIA 2R2HB 1FGNL 4ZFOL 5DMKA 1C5DB 2HN7B 1RJYB 1CL7H 1T2XA 5TE7L 4QXTB 3OKLA 2DMCA 3ZT7A 3UPCA 3MV8B 4GAYA 5IIEB 4WV1A 1J8KA 1GYAA 4J1UB 4HPYH 4POUB 3UROR 4M8QA 3OHXA 4CMHC 3GBLA 5LGKA 3TNMA 1I3GL 2BOCB 3D6GA 3QPQD 4NQSA 1KFAL 4ZXBD 3JWOC 4TTGA 3MRBB 3RWJA 3QEUA 3QDJE 3MYJB 4PRID 5I75B 3O6LL 5KVFH 3KXFD 5ALCH 3STZA 1NL0L 4TOYL 3TBWA 2QADC 3MBXL 3HAEB 5DXWA 4M62L 4ODHL 4L1HA 3GGWA 3L3DA 1KPRB 2J6EL 5AAMA 5J6GA 3JV6B 5KSBF 3MV7B 4G9DA 5MERA 5EBGA 3VCLA 5JW3H 4F33B 4PP1D 4CU6A 4JFDE 5L2KE 4KTEL 5FHBH 3IT8D 5IMKB 1UB5B 3QAZC 1JGVL 3CSPA 2BC4A 1BOGB 1QBML 4KPHH 2W91A 5ABDE 1K8IA 1ZGLA 3O6FB 3ZMRA 3IXAB 3VH8A 5I71B 2X4UA 4QHNB 3VDCA 1RZKH 2HH0L 4UTBH 4DAGH 3I6GB 1NGXB 3I85A 2CDFB 2ED7A 2H6PA 2PO6D 2VOTA 1IZJA 2JELL 4KRPB 2GSIB 4ZS7H 3KLHC 2VH5L 2Q6WA 5TE6L 5HI3D 3O3AA 4KZEL 2AQ1A 3V7MA 1QFUH 1QRNE 2JCCB 4IMLA 1K85A 3N1FC 4X8XA 1XIWA 4LLDB 2VLJD 5ILTH 4PD4K 5DSCA 4KDTC 2AK4E 4OCXL 3EDKA 3C6LA 4RMVA 3WO4B 1AKJB 4X80H 1YDPA 3HE7D 5D2NE 4XBGA 3OB0H 2BJMH 1AFVH 4H20H 4XNZB 3VMNA 3ABZA 4J2XA 2LVCA 4N0RA 4P2QB 2VDKH 4XXDB 3PL6C 5HHOA 1G9MH 1JGLH 3LKNB 5JORB 3SDXA 4M48L 4GAGH 4FRWA 1OF2B 4PJ5D 3MRGB 4UT9L 1HSAA 1UWEL 4RCAA 1OAUL 1KTKE 3UXFA 2QKIB 2ZSVB 5GS0L 3T0EB 3HR5B 3TBSA 3UTTA 1P7QA 4E5XB 5C0EA 4NKMA 4M6OH 4DVRL 3SDAB 5TF1L 5AG9A 3QCUL 4PJIA 1UGNA 1U93A 4D8PB 4PJDF 4HFUH 2YD3A 1WWAX 5LCVH 1HSBA 4FQ2L 2OM5A 1PD6A 2YR3A 2ZUTA 1T66D 4L3AA 5DWUL 2ICEB 1FNHA 1QSED 5TDPA 3BW9B 4OZFG 4G42B 1YYLH 3QNXA 5IKCA 5GSVB 3VWKC 1CD0A 4P3WA 2YC1B 3LPFA 3L7EB 4P4KB 4RFEB 1TJGH 1A1NA 2OXHA 3WFCL 5KAQG 1DANT 4Z6AT 4GRWE 4KQ3L 3ZKND 2J7LA 5E2VH 4IHOA 3U0WH 1UWGL 4KY1L 1AGDA 1EIBA 2EKJA 1CLZL 3SE3A 3G9AB 2GAZA 1ZT7A 2HYMA 2ZCHL 1VHPA 3MOBL 4Y5XC 4F9PA 1MQKH 3GMPB 4P3CL 4RRPA 2VSDA 3SQBA 2H2SD 4LKCB 4OKVA 3MGTA 1K4CB 3DWTA 1L7TL 3HC0A 4I2XE 1MUJA 4LDLB 4X9BA 1L7IH 1S9VB 1NKRA 1FGNH 3VXTB 3ULVD 4U6HB 4UINL 1QFPA 4QWWD 5CEZD 1OGAA 1BQHG 1MJUL 4DK3A 3F8UB 2ARWA 4JO1L 1LEIA 1Q38A 1B90A 1U8IA 1MCDA 2W07A 4MZ3A 4LBEB 4BSWA 2D7OA 3IVKA 4YHZL 2YUWA 5AD0A 2OJEB 4P2RA 3KGRA 1WWBX 1TPXC 3L95B 1EFXD 1KFAH 3CJJA 2XKNB 4NFBA 5D7LA 1JWUB 1GCFA 3O6LH 4D0CA 1KB5B 1NL0H 5DK0B 2X4NB 3VA2C 5LJYH 2NYYD 5AYQA 3MBXH 3MRNA 3ZLQC 5BV7L 5ISZE 2ADFH 5FV1L 3V8OA 2ED9A 1QSFB 4M62H 4ODHH 2X6MA 3MLVL 4M61A 1IM9B 3HNVL 4R90H 4ZXBC 2J6EH 2X42A 4UQ2B 3FQTA 3WO3B 4LPUA 4ODSL 3LHPL 3CFCL 4EUPG 4JY5L 4KTEH 4MQ7B 2HAZA 4NOFA 1JF5A 1NGQL 3CVHA 2DI9A 1JGVH 5ELIA 1PAMA 1QBMH 1UM6L 4OLZL 5J13C 4L4VD 1WBYB 1LILA 1M4KA 3RWEB 2BRQA 4DN3L 3AS3A 1IVLA 2HH0H 3VRIA 1NMBL 1IE5A 3DURA 4XPBL 2JELH 2ESVD 2N7BA 2VH5H 1LP9E 5TE6H 1DEEA 1QR1A 4KZEH 2EIZA 1T5WA 1CGSL 2FECI 4PRPD 1PZUB 4BK5A 1MRDL 1U8OA 1XT5A 5LAXB 4ONGL 1CR9L 1WLHA 4OCXH 2PO6C 4G5ZH 3RBSA 5ACMA 5JIHA 3ZTNL 5HI3C 1RJCA 2JJTA 1YN7A 4JO4L 4XNYL 2KZ1B 4OUOA 1ONQB 3AUVA 1W0WB 2IF7A 1I9RL 3UEZA 4QT5A 4OF0A 4UNVA 1IZKA 2FJFB 4B53A 4UT9H 3S36X 3HE7C 1UWEH 1OAUH 1EAPB 5GS0H 4UNUA 2UUDK 32C2B 1FAIL 1TCRA 4P23A 3L6FB 4P2OD 2IBBA 4DVRH 4APQC 2GUOA 5EA0L 1U8LA 3DV4B 3MRRB 3F62A 2AJ3A 5TF1H 3QCUH 4TVPL 5K9KA 4EVNA 4JZNA 2FZ3A 4P49A 5TQ0H 1QBBA 1CDCA 1YA5A 1FNSL 2DLEA 4FQ2H 3FFCE 4ELMF 4HMDA 4KKBD 3KVQA 5DWUH 3ARFB 5FKAB 3SDDD 4V1DE 1KJMA 4F80A 3UBXA 3CSBA 5DRZA 4UV7L 5IW6B 2FRGP 5JR1L 1DJSA 2GT9A 3P4LA 3FFDA 1G0DA 1CGWA 3WFCH 2VLKE 4KQ3H 4X6FA 4JKLA 5E8PB 5J3HD 1FIEA 3GSWB 4WDIA 3VGAC 3BO8A 2IH1A 1UWGH 3KLSA 1CLZH 2A77L 4PJ8A 3PP4L 3MOBH 2ZCHH 5DRXA 4JLRB 4Y4FA 1NBZA 1UM4L 3G5VB 4P3CH 5DJ6A 2A1WL 4WUKL 5CJXC 2XN9B 2H2PD 1P4BL 5EOCL 3ZKNC 1L7TH 2XQBL 3O0RL 1I1FB 1BBDL 2F54A 4M7KL 4PJHB 1WISA 1DQJB 5I8EA 4R3SA 4JZJB 5JXED 4M5YL 2FEEL 1N5AA 1UKTA 1U2CA 5E8NA 4UINH 1T03L 1J8HD 3H9SB 3I84A 4X4YB 5DZOA 2H2SC 4Q2ZA 5IV2B 4JO1H 2D4FA 1OLZA 1I7RA 1RK1B 1I8KA 1G7QB 1JPFA 5SV4A 4YHZH 1X5LA 4OZHB 2KBGA 4U1GB 1OLLA 1XGQA 3ULVC 4C56E 2V5RA 3KPMB 1VADB 1VFMA 4UQ3B 3SKJL 3QEQB 3P40A 4NQXA 2G75A 2ID5A 5E6IA 3SEPA 4DFIA 4BJLA 3FB8A 3TCLA 2ED8A 5BV7H 3SE4A 1OHQA 1G6RL 1MHCB 1H3TA 5JHDA 4U1NA 4IMKA 1BLNA 3CZFB 4YBQD 4Y5VC 2B20A 3MLVH 1RU9L 3GB7A 4KVNL 4YDIL 2H26A 1L9MA 1UADC 2BX5A 3KPSB 3FQXB 3LHPH 4XZUB 4HW6A 4JY5H 3LQAC 4FHBD 4RQQA 1F58L 1NGQH 2NYYC 3O8XC 3PWPB 4K3JL 1BQLL 3FOMB 2VQUA 4XNMB 4D0BA 4OLZH 1E27A 3GSRA 4XGZA 4K23L 4G80A 4S1DD 5GIRA 4DN3H 1LDSA 4XB7A 2EE3A 4LARH 3QO1A 4NN6B 3OAZH 1NMBH 5I18L 2CUIA 4NUJB 3R06B 5ESAA 4XPBH 4U1IA 4XXCA 4JRYA 1U0QA 2ZCLL 2DWEA 5D2LB 4JKKA 1CGSH 1HZHL 4WNQA 5GGRB 1RVFL 1GXEA 3KS0J 4JFFB 5D5MF 1RK0A 4C59B 1MRDH 1VGKB 1ZE3C 4DWHA 1KG0A 1SQ2N 5DD1L 5C08A 4ONGH 1CR9H 1FNGA 4OB5L 4AEIL 5JDJA 3ZTNH 4M02A 4O00A 2IPKA 4J3TA 3WFHA 1ZV5A 2X09A 4YJZL 4JO4H 3TF7C 1ZLVK 4XNYH 2PKDA 5HDQL 1FP5A 5GRUL 3W81A 5KSBE 4RFNB 1NDGB 4X6BA 4XBPA 1FO0B 4X5XB 2D3VA 2JIXA 4I4WA 3WL9A 3TO4A 4Y5YC 1CT8B 5CWSB 3B2VL 3P4NA 1M7IB 2COQA 1IARB 2Z4QA 5JO5A 3O3DA 4LCCA 3GHBL 4OZGE 2ATPA 4L9DA 3S36L 1FAIH 3W0WA 1K6QL 4FXKB 3SO3C 3P2TA 4ZD3L 5C0AE 4AIZA 2RCSL 1ZVYA 5HYQA 5F70A 5EA0H 3ZKMD 3KYKL 2W9LA 4N90E 2GCYA 3C5SB 4TVPH 3BDYL 4PJFB 1IMHC 1T20A 4OUUA 1U8NB 2BXYA 2FO1A 2VC2L 2HJFA 3A6BL 4RMRA 4Y1AD 2GSGA 5FYLE 3BUTA 1QLEL 3MCLL 2G9HA 4LCIL 3B6SA 1NEZB 4ZAKB 4GO6B 4P2OC 3QUXB 4OF7A 3T4AA 2JB6A 2OTWB 2X10A 4UV7H 2FGZA 5I9QC 3F7VA 4WW1A 5KS9E 4HV8B 1JNHA 4HWEL 5JR1H 2ILLA 3NZHL 3MRJA 4HFWB 1ADQA 5DYOA 5GGRY 4KKBC 4PJGF 5CSZB 3HRPA 5CMAA 4EI6B 1UCBL 1A6VL 1QTYT 5IB4B 4OFYA 2A77H 3KYMA 1B88A 2DMBA 1IC4L 3S5LA 2HLAA 5FM8A 4DOHE 4HJGB 2XNAB 5E94A 1A4JA 3MNWB 4L8SC 1UM4H 3DVNA 2A1WH 4WUKH 1R5VB 4JY4B 1R5IB 5D96C 3DGGB 4R0LA 1CICD 1P4BH 5EOCH 1ORQA 2DQJL 3R0MA 4WI4A 5J3HC 2XQBH 3V4UL 1CLCA 3O0RH 3U9UB 3ZKQD 1BBDH 2XPGA 1U8KB 4FG6D 4GAFB 5HVHB 5L6YL 3W9DA 4M5YH 3GSNL 2B8OT 3D2UB 4FFVD 1BD2E 1T03H 3QQ9D 1S78D 2LQRA 4CL7A 5IGXL 3NACL 5K9JL 5JW4N 2H2PC 3SE8L 4RDQG 5T3ZD 5DHYB 4HIEA 4WHYG 4Q6IA 3WIFA 2AERT 2ZSWB 2GTWA 5EBMA 3PWNB 3VXOA 2IFFL 3EYFA 2VLRE 1NUNB 3ROOA 1KACB 3SKJH 5CZXC 1EFQA 1RZ8B 1HH6B 2QQQA 3JTSA 3SGKA 5K93A 1NSNH 4GKNB 3MXVH 5DHVH 1CFTA 1OT2A 3AS2A 1MREL 1MWAL 3QFJD 4P46D 4RBPK 5HVGB 3TN0A 5BQ7B 5FKPB 1SY6L 1BJMA 4RMUA 4U6TA 1RU9H 4KVNH 4XX1G 1TQCC 1G1CA 2Y36L 4OI7A 2F53A 4QNPF 4YDIH 2V2XA 2NXZD 2VAJA 4YC2C 1FL5A 4GMTL 4R96B 3QUYA 1F58H 3O4LD 4PG2A 3HZMA 3RWIA 2HLFC 4K3JH 1BQLH 3RVTD 3HPLA 4G8GD 1BEYL 2GJ6D 3ZE1F 4WFFE 3GKWL 1PY9A 4YBQC 5H35B 3ZDYE 4NCC2 2AJXH 4HXAL 4X6CE 1DZBA 3CCHA 4OLEA 4DK6A 2CXKA 5I18H 4LSRL 1CVRA 5HGDA 5JIKA 4KUCF 3GMQA 3NPZB 2ZCLH 3B5TA 3QT2A 1JPGB 1NGYB 1HZHH 4UT6L 3UZVB 3OXRA 1RVFH 5KSUA 4CVZB 2Z9TA 4IRJA 4S1DC 4MZ2A 1BECA 4MNHA 1HQ4A 3P30H 5GGVL 5I0DA 1AQKL 1FZKB 1UKQA 3MLTA 4QRRE 1A64A 4LCWE 2Y1VA 1P84J 4OB5H 4AEIH 4D9QE 3DHMA 4PRIE 4PRNB 1OAYL 2NW2B 2YZ1A 2HVJB 3T1FB 5HDQH 5KSVB 3OJ2C 3U30B 4MNGB 4K9EL 5GRUH 4JDVB 4BA8A 5BRZB 2F5AL 5KN5A 4NNYA 4X4XB 2IGFL 1BF8A 4FN0A 3IDIA 4FTVB 2UY6A 3B2VH 2QSVA 1U3JA 2VZOA 4PJCE 3GHBH 3VA6A 4Y8DC 2R9HD 1GGBL 2FO4A 3NFSL 4KTDL 4NKQB 1Q8MA 3S36H 1K6QH 3DUUA 1OSPL 4DCQA 4ZD3H 4N8VB 2RCSH 3KLAB 4IJ3B 4PJBB 4UZGA 5F7EL 3KYKH 2A74A 3VGDA 3BDYH 1FYTA 4O2CB 4Y2DA 1CD1B 1NGWA 4JRXB 1HXMA 2VC2H 1YJDC 4NFCA 4PJEF 4UIMA 4YK4B 25C8L 3V5HB 1QLEH 3ES6B 3MCLH 4LHUB 4LCIH 3FB5B 4NQDB 3CC5A 3S6CA 2H45A 1Q94B 4LQFL 4D9LL 5IMLB 4J4PA 3GMRB 2VLJE 4HWEH 1CVSC 1EERB 4ODXA 4EN3B 3NZHH 5D6CA 1ZT4B 3PG2A 4X0KB 5B8CC 5IMMA 1BF2A 1FIGL 3NCCB 3Q48A 3NGBB 3ZTJH 1UCBH 2NPLX 1A6VH 3MRDA 1YY8A 4OD2B 1KPVB 3QI9A 1RI8A 2FL5A 3QB7C 4P5KB 2EYSB 4IEFB 5LXGL 4YAQB 4N1CA 3SDCC 1IC4H 3D3VA 5T1LA 1AHWA 4E41B 5EZJB 1NAMA 2KPNA 3OF6A 4NRYA 3QEGL 1UQSA 3NBNA 3BPNC 1Y0LB 4ZPTA 3TVMC 2DQJH 2CQVA 4Y4HC 3MV8D 3VJ6A 4Z5RB 4LHJB 3VD7A 1NANI 2V5TA 2PUQT 4F3FA 4Q9RL 1BIIB 1FSKC 3GSNH 1JZ4A 1FYHB 2D7TH 1G7MB 3L3KA 5CEXA 3GI8L 1UVQB 3FB7B 3NACH 4KV5E 5GJSL 5IGXH 5K9JH 4QY8A 4LGRB 4XWOD 3SE8H 2VWEC 4JFOA 3DETD 4L8DA 3OR6A 2G2RA 2QHRL 1GZPA 1I1CA 1F00I 1KGCD 1SJEB 2EE2A 4FFVC 3W39B 43C9A 3QQ9C 3MR9B 4GKZA 1HYRC 4XPGL 3U0TA 1S78C 3MV7D 1FRGL 2CR6A 1I3RA 3ARYA 1ZMYA 2AJVL 2DTSA 3TWCL 3B9AA 2APWA 1MREH 1MWAH 2P44B 5E2UL 4EIGB 1O0VA 1SY6H 5E08H 2Y36H 4JPVL 2Z31A 4M9PA 3I75B 3IDNA 5DMJB 1A6AA 1T5XA 1VFAA 2C7UB 4GMTH 5BZWA 1EBAA 3MGOB 1E28B 3DI3B 3U36A 3C5ZA 1EHXA 4KRPD 5FAAA 1T7WA 1BEYH 3I3BA 4P46C 2ARJA 3GKWH 5GRVK 3WNLA 1NCTA 3EZ8A 3WHE0 1PW3A 4LSUL 1REIA 4HXAH 2NXZC 4JHAL 4LSRH 5GRYA 3ULVE 5F3BA 3GSXB 3ARBB 3CZJA 4P4RA 1AKJD 3DX8B 4W4OC 3TBTB 4UT6H 1W72A 2HJKA 3ZYIA 3RRQA 3QNZA 4N9OB 3BDXA 3X3GL 4MNQB 4P2QD 5GGVH 1AQKH 1AD9A 4LKXB 2NX5B 3X14B 5HYEA 1FBIL 2IMMA 3VXRB 3ILPA 4UTAL 1OAYH 1JF1B 1ED3B 5C8JA 1S7TB 2IADA 1AC0A 4Z7UA 1JUFB 1QG3A 2KL6A 4IRSB 1G7JB 3T0ED 4R6UA 4LP4A 2R1XA 4KI5D 5D7JA 2AV7B 4K9EH 4PBVC 5F9OL 1T0NA 3CFKB 4ZNCD 3MOAL 3PWJA 5DZLA 5F1NA 3GIVB 4XAKE 2F5AH 4U1KA 3MX0A 3SDAD 4AENA 1VACA 1AXTL 2IGFH 4FFZL 2Y7QB 1ES0A 1FZOB 2VXUL 1I9EA 1HXYB 2DJSA 1GGBH 3NFSH 2ITDA 1MEXL 3PQYA 4KTDH 4QRPA 3X11A 1OSPH 5DJCA 5AZEL 3TZVB 3CPLA 3L5IA 5ID1A 4JFEE 5F7EH 1WZKA 4Y19A 5GGUA 5EULV 2DQEL 1JPTL 4KJYA 4OQ1A 1RIVL 3HS0B 3JUYA 3RVXD 1JF6A 1KC5L 4JGMA 3DXAB 1F3DH 25C8H 2RQ8A 1E4XL 1I4FB 4P4KD 3UDWC 2R9HC 3KR3H 1NDMB 2ENYA 4Z7QF 4NT6A 3BSZL 3HUJF 2O5ZL 3BX7C 4Y0GA 1YNKL 4LQFH 4D9LH 2FHCA 3IF1A 2BVQB 2ICWI 15C8L 4MAYC 4HK0B 3V0WL 5HBBA 2PW1B 2UWEE 1WFUA 3RVVD 5F9DC 3TIEA 2ZOKB 3WYRA 3QSKB 2ZG1A 3VXQA 1FNEB 2O61A 1YN6B 2GYSA 2MQ3A 3U6RB 3RVWD 3T8XB 3ZT6A 5LXGH 3WJJA 4OF6A 3VFOB 43CAA 2ADJB 3EDFA 5TFSL 3CUPA 2G5BB 1G7HB 2E7MA 2F58L 2R1YB 3IETA 2BVUA 3QEGH 2QR0B 4WI6A 3N9GL 3U48A 4LNRA 4CVXA 3S9DB 3U9PL 4NKIH 2XZCL 1XGRB 1OAQL 3UTSA 3QIWA 5BZDA 4XP6L 4MD4B 2K9UA 1MHHA 3I02B 4RX4A 2VYRE 4ALAL 1CXFA 3GI8H 5GJSH 4KQ4L 4MJ6A 4OZIA 5SWSB 5GS1B 2BRRL 2E27L 4L3EB 3RL2B 2P4AB 4QOKA 4FQHB 4YXLH 4DZBB 2P7TA 4Z77A 3O9WA 3GJFA 2QHRH 5IVOA 3O45A 4GRLA 1MJJA 4FA8A 4XPGH 5EC1A 3HCVB 4URTB 1FRGH 2Y06L 5IJVB 4PJXA 1NC2B 4LEXL 4XWOC 5I75C 3EYVA 3DETC 5F88A 3IDJB 2AJVH 3BGFB 4NM4L 2MHAA 1T7ZA 4PLJD 5B39B 4OCLC 4GSDL 5E2UH 4JPVH 5LGJA 2ICES 3KWWB 4BQ6A 2KZWA 1CF8L 4Y89A 5F1IB 2VL5A 1LE9A 3SKUD 2NNAB 1YPZA 1CIUA 3NIFF 1X6LA 4NSKB 3F6LA 3MREB 5JW4M 4D9RD 1KYOK 3DIFB 4JEGB 1A6UL 4XX1E 3T2QA 3VFNB 5CLTA 5E4IA 4AQ1B 5BS0B 3O6FC 3ZDXF 1JWSA 1JE6A 1MY7A 3U83A 4GG6A 5C0IB 5I71C 4HEME 1FNFA 2J88L 4AIOA 3V9FA 3VH8G 3MROA 3K74B 1C1EL 4BFBD 4GAYB 2V17L 4KRPC 4WO4A 2OQJB 3BRGC 1NFDF 1T4KB 3S3PA 5IW1B 1I85A 3AC0A 3OHXB 1KJVB 1M05A 4L9LA 3X3GH 2E6JA 3UC0L 3TYGL 4LLUA 3RWJB 3VD4A 2XFXB 1RZGB 4GKOA 3BXNA 1FBIH 2VR9A 4ZSOE 1HHKB 3STZB 4UTAH 3QQ3B 1H3WM 4NCC1 4NO2B 2XZZA 1A6ZA 3C60A 4HKZA 4NO5A 4YHLH 3LAFA 1H5BB 1N8ZB 5F9OH 1KCSL 2FGWH 5JIIA 3MOAH 2WZPD 2WK2A 3QIBA 5C0GA 4KK6C 4JKPL 3ARVA 1AXTH 2X5PA 1A6WH 3LKPA 4KI5F 4PJ7F 1SJHA 2LTQB 1I8LA 4FFZH 2BC4B 4MWFA 4OZ4A 5FO9A 1CZ8L 2VXUH 2ADGB 1QFOA 4ZUVA 1ZHKA 1MEXH 3T0EC 5IBLD 4Z7VF 5AZEH 3IGAB 1QFWM 1KEML 3WKML 3ARFD 2AJUL 3SDAC 1ZWIB 2DQEH 1JPTH 4FQXA 3C5JB 1RIVH 2Q6WB 1KC5H 2MCG1 3RZWA 3DV6A 4MJ5A 1W0YT 3QWRD 1NBYA 1E4XH 2P8PB 2PXYC 3QUZA 4JRWA 2WWMD 5DD5L 3BSZH 1XIWB 2O5ZH 1VFUA 1U95B 1YNKH 1WFOA 3MOQA 2D9CA 4M5ZL 3PGCA 3FZUD 4YHKL 5IQ9B 4MJIA 4TSCL 4KXZH 1KJ2A 15C8H 2P46B 3DO7A 3AS1A 1PKQE 3RVXC 5CGMA 3FO0H 3WJLA 5IVXA 1X4XA 3V0WH 4NGHL 1G9NC 2A38A 4P4KC 2NTFB 3C6SB 1C5BL 1NFIA 2XN9D 5HHOB 3KJ4B 1PJ9A 1HHIA 1P2CA 2QBWA 2I25N 4HGWA 2IANA 5F7UA 4RZCB 4X98A 2ZPKH 3QG6B 4GBXA 5TFSH 3H2WA 2F58H 3RVVC 3FT3A 3BD4A 3TBSB 1DEDA 1FDLL 3H9SD 3H8NA 1U36A 3C8KA 3UJJL 1B0GA 3V95A 2BVPA 3N9GH 2APXA 4LPWA 4E42A 4GRWH 3U9PH 3QDGA 2XZCH 2GTZA 1OAQH 4UI2A 3RVWC 1JMXA 3D18A 4PJIB 4XP6H 1JNLL 1ZHLB 4PJEE 4KHTL 4N0FB 1HSBB 4ALAH 5CJ8A 2BHUA 5I0ZA 3AREA 3QEQD 3GO1L 4KQ4H 4HCRL 1L0YA 3AGVA 2BRRH 2E27H 5HDBE 4Y1AE 1BX2A 1AXIB 5TDPB 5GJTL 1QKZL 3QNXB 3CVIL 4P2YA 4WWKA 4IBLT 1ZVSB 4MD5A 5EOCJ 3C87A 1UWXH 1XF5A 4JDZB 4YHIB 3UJTL 3VMOA 4DVBA 2XWBA 2Y06H 1YMMB 3KPSD 4LEXH 2DL2A 2YXFA 4ZTPH 2AGJL 4RAVA 3W82A 4I0PA 4ZYKB 2BVEA 4GQ9L 5FV2A 4MB5A 3PWPD 1HWHB 4GG8A 4HKBA 3G08A 4NYLB 3LOWA 4GSDH 5CILL 1TVDA 4JFQA 4XI5C 2GAZB 1ZT7B 3CX2A 2NY2B 4IS6B 2DN7A 1GIGH 1CF8H 2ZUUA 4MSWB 2IPTL 3I50L 2W9EH 1BJ8A 4Y4KB 4EBQL 1Y6MR 4EXKA 2VISA 1A6UH 2EC9T 4GW1B 3Q6FB 4PLJC 2VWEE 1N2RA 1JN6A 5DI8B 5K59E 1IEHA 3H9HB 4JFFD 4XWGL 2IQAB 4YGVB 2BHYA 2J88H 3RGVA 4LGSB 3SY0B 3VRJA 1C1EH 4GW5A 2V17H 5AUMB 4XMKL 5HPMB 1OP3H 4U0RC 3V6BR 3TESA 1XR8A 2CDGA 4NBYB 3RY5A 2H8PA 3TYGH 4GJTB 3ALXA 1D5MA 4JHBA 5EIQA 4NQCA 5SWZE 2DKMA 2VKWA 3HZYA 5DFWH 3BZEA 3HN3A 4M1CD 4D0CB 2D7PA 2NLJB 2VZ1A 3D0LA 1XCTA 3BP7B 1WF5A 2OTPA 2MOVA 3NIGF 3ROLB 2ZWLT 4YHML 5HHXL 2Q87A 3VFSA 2YN3A 2Y4SA 3QEHB 4QF1B 4C58B 3DRTA 3FQTB 1KCSH 1S3KL 1N7ML 4JKPH 3FQRA 1A14L 4QRTB 3D39B 1CZ8H 4RGMB 4IM8A 4G8GE 4AM0A 4ZAKD 1ZHNA 4ODWB 3WKMH 1KV3A 3PGDB 2DQFB 3QUXD 2AJUH 3LPWA 4OIIL 3WUWB 3KPQB 4F7CB 1QVOB 5ERWA 1A7PL 1PVHA 4WEMB 1CE6A 3TGXA 1QR1B 2EIZB 1V8HA 5HJ3B 1X5AA 1QQDA 4X8JB 2CMRL 5DGRA 3UTZA 2NY1B 4JY6A 1GHFH 2G5RA 1ZHBB 2PTVA 1ZEAL 5IBLC 1FHGA 3NCYP 3ARFC 3GJEA 3I9GH 3IJSB 3VFVA 4M5ZH 4YHKH 3QDMB 4TSCH 1ZOXA 5BVPL 3OKYA 2VZTA 2UUDH 4NGHH 1YN7B 4XCFL 3DX9B 5T3XD 4FQQA 5CJBA 1T83A 1NJ9B 1XF1A 3QDJA 1C5BH 2E7HA 4ORZC 1RPQA 3LPGA 4XT1C 3ZSTA 5ID0A 5D71L 5HI5D 2ZOLA 4LPXA 1GZQA 3FZUC 4Z7OE 2UYLA 1RV6X 4LLVB 4MX7A 4UB0L 4H0GA 4O9HL 5MEQA 4ZOBA 1S7SA 4U6VH 1DVFC 1HCVA 5F96L 3D2UD 4BQBA 5K9OA 3IRZA 2R56L 1W8OA 1FDLH 1XH3A 3DARA 3IDXH 4X6DB 2OMNA 4HUXB 3UJJH 3BMVA 4H8WL 4OIBA 5CSGA 4K94C 3S8WA 4EVNB 1JNLH 4OGZA 4DZ8B 2JJVA 4KHTH 4J3UA 4JZJC 2X9WA 3PHOA 1FCGA 4WW2A 3T2PA 2X2YA 1RHHB 1ODAA 3HC3L 4JHZA 1T1XA 3EGSB 3GO1H 3CU7A 4HCRH 2FLBT 3PXHA 2BNRE 4JQXC 4OZHF 4AK1A 2ITCB 3VI4F 4PJ9A 2UZXB 3UBXB 2XTJB 3OKOA 3LKSA 4ZO6A 1QKZH 3CVIH 2JKXA 1QRNA 2VZVA 1N6UA 3AM8C 1KB5L 3ZKXC 1F6LL 3ME0A 4U1GC 1A3LL 3UJTH 3HAEH 3A6OA 3BN9D 1YZZA 1H8SA 1OW0C 1P9MA 4IOIA 4ZUTB 1I3UA 2AK4A 3OB8A 2AGJH 2C9AA 5FYJL 2EKSA 5IK3A 4GQ9H 2VE6B 3Q1SL 3QZWB 3V6FA 4G43A 5CILH 4Z7WE 5F71A 3PJSB 4Y4FB 5MENE 5AAWA 1NBZB 3FO2A 2IPTH 2P5EB 3K80A 3PHQB 4UBDD 3I50H 2X7LB 3RL1B 4G8EA 4NNPL 3FO1A 4EBQH 3TV3L 1T6WA 1DANU 5L8JB 1V3KA 2F54B 3AY4C 4ZFZA 4Y7MA 5D6DC 1QFWL 2P8MB 2FNBA 3PWVB 5E8NB 3MJ7B 5DS8B 2DLHA 1SEBB 4XWGH 3LEVL 3ALPA 4HS3A 2GKIA 1K4DA 4RIRA 4HGMA 5D7IB 3T65A 3H6JA 4HPOL 4NN6C 1EEQA 1T1YA 1A7NL 4Y16A 1EHAA 1J05A 2RFXA 1CD9B 2ICWJ 3P73A 1I7RB 3VRLF 1I8KB 2WIIA 4FNLL 5DEFB 1LK3L 1DQQB 3G6JB 2Z8VC 3UYOD 3G5XA 3OZ9L 1FFNB 3P9WB 5CHNB 2VXSH 4N8PA 1S5IL 5BRZD 5MHSD 3TCLB 4LL9A 5IOPA 2A83B 3MV7E 3NA4A 4FTVD 4YHMH 2AK1L 5GISH 3P4OA 5HHXH 4CN6A 3C09C 3HG1B 5F7DA 4R7NA 2F8OA 1S3KH 4RFNC 2OJZL 3GHEL 1N7MH 3O2DL 4XNQA 4S1QL 4M1CC 4RQQB 1A14H 1X7QA 4HH8A 4JRXD 2VZ3A 3BN3B 4J3XA 4D0BB 4XGZB 3W9EB 1IGJA 3DBXA 2NXYB 2V9TA 2EXWD 4LHUD 5GIRB 1DE4B 4OIIH 4YR6A 4I2XA 3CDCA 2JCCE 2QLVB 5EZIL 1A7PH 1XAUA 1G84A 4WEBL 4F9LC 5EOQL 1ZLVH 1JYXA 3ARQA 2CMRH 3GMLB 2MQCA 4HUUB 1ZEAH 3MZTA 4ZAKC 3QUXC 1NBVL 1F4WL 5BVPH 4XPAL 2H3NA 3WFHB 4LCYA 1PQZA 1B0RA 4XCFH 4E41D 1LWRA 2W1NA 2EH8L 1QD0A 4NWUL 3SKMA 4BH8A 5CD3B 4OSUH 5D71H 3FOLB 1OD7A 1F3DJ 4K3DL 4XBPB 4XPFL 5ISZA 5KSAA 5DQ9A 4ZFOB 3DX7A 3WL9B 3TO4B 5HHPB 4UB0H 3P4NB 4O9HH 1QBAA 4QHMB 5F96H 3TA3C 3E6HA 1K5NA 2R56H 1CGVA 1P7HL 3NCFB 3S5LG 3O11A 5IB5A 1ETZB 4OF5A 4H8WH 3Q2CA 5F9JB 3BAEL 4OUUB 1BVKA 5HVHC 4WFGD 4O2FA 3K2MC 2GSGB 5E9DA 1MH5A 3HC3H 5C1MB 3DVIA 1Q9LB 5EO0B 1QLFA 1V5JA 5J9PA 2JB6B 3K0WA 3D85A 1LVEA 2DWDA 1G7PA 2VLLA 4HT1L 1I8MA 2C1PB 1KB5H 5TGBA 3BGMB 4KKLD 3TT1L 3OKMB 1A3LH 1QBLL 2UZIL 5DYOB 2V7HA 2GY7B 5AWNL 3M07A 4AG4L 3MJ6A 1X5KA 5CMAB 4KDWA 1OGAE 5FYJH 4U1SB 3KPTA 4HGKC 2YBRA 1RURL 3Q1SH 3KYMB 4J8RA 5E5MB 3QULB 1QR4A 5INDA 5IBTL 3DTXA 1JTPA 4NNPH 4M7JL 1MCBA 5D7LE 2F19L 1N26A 3TV3H 5HYFA 3SGEI 2AXFA 5JQ6L 4ZO9A 1TCMA 3ARBD 3BH9A 2WIMA 1QFWH 3SKNB 4IOSD 2CKNA 2P42B 1T7YA 3LEVH 2ATKB 5EUOF 4MNQD 4UBDC 4HPOH 4QHLB 4WHDA 4N0YL 1A7NH 1Y6NR 4GUPA 5D7KD 4JGJA 7FABH 4PYGA 3VXRD 4PG9A 2GTWB 3MNZA 4FNLH 4MGXA 3RQ3A 1EUUA 1LK3H 1Z9LA 5DJ8A 4FMKA 3FFCA 5E56A 1O7VA 4IRSD 4PGEA 2E7LA 3ROOB 3OZ9H 4HUWA 1N3NB 1QSFE 4V1DA 5FOBA 1JV5B 5I1EL 3JV4A 1S5IH 4LLAA 1FL3B 3RZCA 4HC1L 3OV6A 5C0CB 3X13A 1DUYA 1T22B 4MDJB 2NY3B 2AK1H 3A6CL 3LN4A 5CEYA 3P4MA 3LCYA 3RKPA 2I07A 1F6AB 3U30C 2FDBP 1CXHA 2E3VA 1FL5B 2OJZH 3TZVD 3GHEH 3O2DH 1YEKL 4NP4H 4S1QH 3NOIA 2BMKA 3RWIB 2ZUQB 2X4PA 3EOBA 3H3PL 4M8VA 2XZAL 3ZHLA 3DXAD 3WUZA 3BEWB 5DJ2A 1AH1A 3SDYL 4D9RE 4O02L 4HXBL 1LO5B 5E8OA 5F89A 1S7UB 4K3HA 4EDXA 3V4VL 3KPRB 1YEGL 4IJ3C 5EU6B 3WLBA 5EZIH 4WEBH 4OQTL 5CCKL 1S7XA 3B9KA 3EIFA 1U6AH 5EOQH 1K3ZA 1DBBL 4MXQC 4YXHL 4YK4C 4HULB 4FP8L 1IGML 4AT6A 2AABL 4QLRA 4M00A 5FECA 4IRJB 1HDMB 3SGDH 2EXWC 3FTGA 4MNHB 1HQ4B 3QXDB 1NBVH 3TJHD 4DGYL 2VITB 4ETQB 3MLUL 3OKKA 4XPAH 5C86A 4PD4J 5E7BA 1I8IA 4X5WB 2X89A 4EN3C 5JW5A 3BOVA 5FGRA 1JZ7A 4HKXB 1F13A 1T89C 5DK2B 4NWUH 5DMGD 3T0AA 3EDEA 1Z9SA 3FO9A 4YDVA 2EDTA 4K3DH 3NGBC 2D0GA 1QFWI 3K1KC 4BFGA 1QLRA 3IDIB 1AP2B 4Z8FH 3U46B 1EEZB 2NR6D 1E6JL 3P9LB 1EA9C 3BISA 1MVUA 1II4E 3VFWA 4LF3B 4LDEB 2Q20A 4O5LL 5SWSD 1T21A 4L3ED 2NY7L 2A74B 3KYOA 3U4AA 3BPCA 3OGCA 1NGWB 4P5MB 2YWYA 4Z18A 3D48R 2DM7A 4F7MA 2X4RB 1HOCB 1AGFA 2ADIA 2X4SB 3F7RA 1XZ0B 3FONA 4NWTH 1F3JA 2DDQL 5BV7B 2BK8A 1RMFL 3T0VA 4LCUA 3VG9B 1NC2D 4JFYA 4OV5A 1D5XA 3BH8A 3KHOA 5FDWB 2FJGB 3TT1H 2Q76A 4MA3B 1FJ1B 2BHZA 1QBLH 2DD8L 4N5ED 2UZIH 5ACZB 2HVKB 4ZG1A 5AWNH 5IEKB 4WJ5B 4AG4H 1DLFL 3HR6A 1JGEA 3ARUA 4KDVA 3BESR 3ISWA 1RURH 3QI9B 2BNUB 5T1KA 4U1JA 3ULSA 4KKLC 2GJZB 3D3VB 1YY9D 4WI8A 4FZEL 3QWOA 4PJHE 5BS0D 5IBTH 5KSBA 4QRSB 4R4BA 3RNKA 4NRYB 3KPOA 3IFNL 4M7JH 2F19H 1DN0A 4ODUB 1H15B 4GLRH 3DROA 3H9SE 5JQ6H 4CU8A 1EBPA 2P5WB 4PTTB 3SGDI 4F3FB 4OZGA 2OK0L 5DHXB 2F8VA 5EIIA 4WWID 1QOKA 4YUEL 5EZLA 5C0AA 3VXUB 4PYHA 2KQMA 3BJ91 2X4QB 3MA7A 3MV9A 2O5YL 5EO1A 1TTGA 4L8DB 4HWBL 1S8DA 3QEQE 4KDTA 3UPRA 3ARBC 4N1EA 3IJYB 4LMQI 1AGBA 5EB9A 5DT1L 3RWDB 4BSVA 1U3HC 1OSZA 5MEPA 5E1AB 1FLRL 1YEDA 1F45A 1JWMA 2K7QA 3PL6A 4HC1H 4HZLA 4L3CA 4C83A 2VDLL 5KS9A 1A9EB 2I26N 4GKSA 5IB3B 1BGXL 1TJHL 1TITA 3A6CH 2IAMB 1MCWM 3HRZA 4S1SL 1X5ZA 4IRSC 3PWPE 1T04A 4Z76B 3IRPX 5L9DL 4OZFA 3QO0B 1JTTA 2EDFA 1YEKH 4PJDB 4MD0A 4NDMB 2XZAH 4LPYA 2UVEA 2IBGA 3NA9L 2CRIA 3MXWL 3RY6C 4PJAE 1HHHB 1T1WA 3SDYH 3Q5YA 2VN4A 2WSKA 4O02H 4HXBH 1IAMA 2A9NL 3V4VH 1XIWD 5D2LE 4NQEB 3TZVC 2RBLA 4JAMA 1FPTH 1KLGA 3O3UN 5DQDL 4JJ5A 4LLMB 1DDHA 1PEWA 4OQTH 5CCKH 2WW8A 5IB2A 4ZDHB 4XAWL 1DBBH 4YXHH 4FP8H 1BD2A 1IGMH 2AABH 3DECA 5DTFA 3VWKA 3DYMA 2XY1A 3VGFA 3QNZB 4HG4K 1CFSA 1KCVL 3BP6B 1NLDL 2PW2B 4YDJB 1K2DB 3W0WE 1AD9B 5HHOD 3S4SG 2DL9A 4DGYH 3BQUB 2WP3O 4OJFH 3MLUH 3ILPB 4JKMA 1SM3H 1WK0A 2QSTA 2VLRA 4R2GB 3EKCA 4S2SB 4MAUL 3GSVA 5EU3A 1BQHA 4W68A 4DJMA 5D7JB 5IB1A 1P7QD 3REWA 4Y5XA 1IGTA 3TJHC 5F1NB 1CN4A 1XF3B 1I7ZA 3G6AB 1OTSD 3QHZL 1AGEB 1ZGLM 2DBLL 4QGTA 4L1DA 1E6JH 3RUGB 5JOFB 4PJFE 3X11B 2ITDB 4QRPB 3PQYB 4YE4L 5DJCB 4O5LH 3WIHL 4L29B 1NQBA 2NY7H 4TPRL 5GGUB 2R15A 1IAII 5CIPA 1FE8L 4KJYB 4TUKL 3WV0A 1A6TA 1DCLA 1UZ6E 2YHGA 4U49A 5FUZL 5DHVB 4EUPA 4NQVB 2DDQH 3AAZA 3TH4T 1RMFH 3THML 2B39A 5C0BB 5GS1C 4LP5A 4ODTL 5I8OL 1H9VA 1S9WB 3MJ9L 1ORSB 4PV8B 4B0MM 5B3JF 3F7YB 3MRPB 3MSPA 5JLZB 2NY2D 1HH9B 4CJ1A 1KCKA 5JPMA 4ZXBA 1MFEL 4LCWA 1DLFH 4I3SL 4Y4KD 4ONFL 5DRWB 4HIIA 3BGFC 4PRIA 1A4KA 3KXFA 4WVRA 1MCPL 4RGNB 4LK4A 4YHNA 4D3CL 4N5EC 4FZEH 1HN1A 3IFNH 4LSDA 4YHYB 4LNRB 4CVXB 3L3IB 4NN7B 1R6VA 1M71B 1MHPL 5BZDB 2XWJA 3OAUL 3RWCB 5ESVB 2O26U 1I7TB 2OK0H 1MHHB 1YY9C 4P9HC 2BSSA 4WUUB 1VGEL 2V2TB 2IALA 4PREB 5EU5B 2YS4A 2O5YH 4IIQB 4B7LA 3OKDB 4QOKB 3U4BL 4HWBH 4U1LA 2P7TB 1C08A 4Z77B 4YHPA 3HI1A 5DD6A 3BGAA 2HKHL 1IFHL 1DFBL 1S9XB 3RWFB 2R2EB 1G7LA 3DUSB 4H1LH 4LIQE 3MRLB 3KYNA 4RNRA 4KJPD 3P11L 4PV9A 2FHFA 4HJ0D 5CZKA 3RGHA 2CDEA 2VLJA 2VDLH 4KI1A 2MHAB 1MLCA 1I1RA 3T0DA 1BGXH 1TJHH 3D39D 3GUTA 3ESUF 4QYOB 2CLZA 5C6TL 3BZDA 4S1SH 4X7DC 3HE7A 4OGYL 1CBVL 3IS0X 1H5BC 1FFRA 3E8UL 4KU1A 3WIIL 1MCRA 4YDKL 4XCNA 2LTQC 4APQA 3NA9H 1UB6A 1XGTA 2BSRB 3MXWH 4G9FE 5L2JB 4PJ5A 3PABA 5I66A 2NY1D 3WBDA 1JWSB 5EIVA 2A9NH 2HT4D 4ELKA 2VJXA 1QSEB 3BP4B 3QDMD 5DQDH 5KBNC 3MTRA 1YECL 4WO4B 4XAWH 4XCEA 1MLBA 3MUGA 1C8PA 3VFPA 4AJ0A 1M05B 1TVBB 5TQ2L 4EQ2A 4ELMA 1KCVH 4LLUB 1NLDH 4NZDA 1XIWC 3NN8A 5DVNA 4OD3L 2CIIA 1MI5E 2Q3ZA 4MAUH 3SDXF 3DO3A 1INQA 5J56B 3VG0L 4G6FB 3QXAA 3BD3A 1FVDB 3IU3B 1N64L 4L8BA 1CXKA 5T1MA 4YO0A 4AY0A 5L8KB 2EIEA 3ELAT 4QRQA 2EE9A 3QIBB 3KJ4C 3GSNB 4WI2A 5GGSB 3OG4B 5I1CL 3QFDA 2DBLH 5DA4A 4MWFB 5F44A 4PJBE 4HDIA 4N5UA 2MPAL 1A8JH 3ET9F 4PJIF 5ANMB 4YE4H 5IP4A 3BUYA 3WIHH 4F7EA 4XHQA 4XC1L 2BP3A 4Z0XA 3M17B 3S35X 4JPIA 4TPRH 3B3IB 2XTJD 1FE8H 1OTSC 4NQDE 4TUKH 4F7TA 3P77B 5F6IB 4PGCA 3DV6B 1CFVL 3MNVA 4MS8D 5FUZH 4PRBB 3WHXA 3VFUB 5D72L 2X4OA 1F4XL 2ZNXA 2HFGL 2N56A 3THMH 4K8RC 5DVOA 1R24A 1PZ5B 1MWAB 3PGCB 5D1XA 1KB9K 3KDMA 4ODTH 5I8OH 2ICWB 2A6DB 2YD7A 3MJ9H 5HY9B 3OJVC 1NLBH 3OXSB 3SKOB 1YNLL 4LVNB 2EDYA 4Y4FD 2AS5M 4Y5VA 4HS6A 2VQ1A 5FM5O 2P5ED 4PLNC 1AGCB 1EFXA 4H26B 4I3SH 4QEGA 4E41E 5DJZB 1HHIB 2HG5B 4ONFH 3BZFA 1DP0A 4OGAC 1KJ3L 2F54D 1R3JB 3IDUA 2BSTB 2IANB 1MCPH 2FSEA 4XMLL 2XI9A 1OB1A 3O8XA 4LU5L 4D3CH 1KXVC 5FO8B 4KMTL 1BVLB 4JFHE 3QUMA 3IKCA 2E8ZA 4Y4KC 2GTZB 4U3CA 5EG6C 1MHPH 3OR7A 5EUKA 5FM4A 3D18B 5H37H 5D5MB 3OAUH 1CG9A 2NY5C 1SMAA 4Z78B 2VIRB 5JNYA 1QZ1A 1VGEH 3AREB 4WFGE 3O2VL 4P9ML 2QJDA 3QQNA 3U4BH 3L7FA 2F15A 3REVA 5DZNA 2PNDA 4WWKB 2ESVA 2HKHH 1DFBH 1W0VA 1U91B 1KOAA 5FXCH 3HG1D 4DVBB 2X9XA 5I6XB 4PRPA 3P11H 3TBVA 3AXLB 4RAVB 1ULVA 3L5WA 4G8IA 4GG8B 1YUHA 2UWEA 4N0CD 4JFQB 5C6TH 1IAKA 1S7WB 4OGYH 2NXYD 3OKNA 1CBVH 4WU7A 1Q9KB 5A43C 3E8UH 4KJPC 1HEZB 3QQ4B 3RWHA 1D5BB 3KG5A 3WIIH 1JCKA 1KLFA 4YDKH 2V2WA 4I5BB 2SEBB 3LQZB 5MEOA 2EICA 2VISB 2QL1A 2I5YL 5JUEL 1JN6B 3NFNA 4BKLA 3BDBA 4HHAA 1LNUB 5E6YA 5DJXB 5JW4Q 3SDDB 1R3LA 3L9RA 5JPNA 3RNQA 4GAJL 3S3SA 4P2OA 4I3RL 5EU4B 1YECH 4X6EA 1CFNA 4HMCA 2NX5E 2P24A 4PP2B 1XR8B 4WHCA 2CDGB 5TQ2H 3HE6C 3OGOE 2NY1C 5I16A 2H8PB 1FV1A 3DVFA 2YA2A 2GFBA 2HT4C 4NQCB 5FOJA 3R8BB 2EXYD 4HX1B 4WFHE 4ZUWB 2X44D 3CX5J 5CKAA 5MP6H 4NRXA 3ZDZE 3TO4D 3V6ZB 2Y5TB 1FN4B 5JHLL 4LVHB 3LKRA 3Q0HA 4M3KB 3VG0H 3VFSB 3WUWG 2VDPL 1N64H 1WICA 1OAKL 5HHNB 3OX8A 3N50A 3L3JB 4L8SA 1TTUA 2WBJB 3FQRB 2NY0B 4X6DF 5I1CH 3EJYC 3J8F7 1FC1A 4CAGA 2MPAH 3EDJA 3GDBA 2X1XR 3UTOA 4FFWD 2EDWA 4XH2A 4B41A 3DXAE 1RD6A 4XC1H 1DUZA 3PDGA 4PRHB 5AZ2L 3EO1B 5IF0A 3S35L 1CFVH 4MXVE 2APFA 5C9KA 3MRQB 1MRFL 3FQNB 2DQDL 3TFKC 3K4DA 1P4LA 1F4XH 4G8FB 2HFGH 4G6ML 5TDNA 1J8HA 4WHTB 1UXWA 4G3YL 5F7HA 2XTJC 4YIQA 3V52L 3EOAA 5ICXA 3UTSE 1T0MA 3MFFB 1F3RB 1YNLH 4NQUA 4MS8C 3TNNB 2YD8A 4FQQB 4OF8A 3U4EA 2CK2A 4OAWA 4ZSOA 2AJSL 3ULUD 1A2YB 1TZHB 5B3NA 4MMXC 2WWKT 3H3BC 2ZP0T 1KJ3H 3RDTB 4A6YA 4XMLH 3FT2B 4K07A 4LU5H 1I1YA 4XTRD 5C7XL 1L9NA 2YN5A 1RZKC 3QNYA 4KMTH 3S3JA 1D5IH 4J3WA 3X12A 4JFDB 5L2KB 5C07E 1MFNA 3MRIB 1IEAA 2XV6B 1GVIA 4WI7A 3D69A 3MRCB 7CGTA 1U3YA 1CGXA 5SWSE 3VWJB 3PHOB 1XF4B 4NZTL 2V5SA 3QDAA 4WW2B 3F12B 5IEHB 1T1XB 2P8LA 3O2VH 4P9MH 1IL1B 4UAOB 5C09B 5C0CD 1RFDL 3VFMB 2D0FA 5FFLA 1KIRB 2EYTA 5C0ND 4QGYA 1G9MC 5FA3A 3EFFB 1HWGB 3TYFA 3VGHA 1AD0B 1JHTA 4NO0A 4XPHL 4BFIB 3WLWD 2AK4B 1PKQA 2LU4A 2QQLL 1DN2A 5IK3B 5D2NB 3GZKA 1XF2A 4G43B 2J8UE 1JHKL 4KK9D 2EEDA 3QH3A 3CVHL 2DLFL 1X5JA 4M6NL 2OZ4A 3FO2B 2LV4A 4EI5B 2DQIL 2W0FB 1RUQL 2J8HA 3KPRD 5JDSA 5I1DA 2YA1A 5EU6D 2PCPB 4ZQKA 5BS0E 1QACA 5A2FA 3DRQB 2VNCA 4CNIA 5IM7A 5JUEH 4N0CC 3T3ME 2NXYC 4IRJD 4I3GA 1X9QA 3VI3E 1T1YB 5EZOL 1J05B 4GAJH 1G7IA 1OGTB 4I3RH 4PJEA 3V6OC 3W5NA 1CCZA 1S9YB 2WANA 4KK8D 5HTSA 1B0WA 5F9WB 4RWYL 4PB0L 2EC9U 4NPYA 4WGVB 1RJLA 1T7VA 1PYWB 4Y1AA 4O51A 5KZCB 2VUYA 4PGDA 3ZE0F 4AH2B 4LLYA 5JHLH 1J1OL 1MCWW 2OTUA 4JPKL 1XR9B 4KHXL 2VDPH 3SDCA 4LRIC 4GRWB 4KMQA 4F57L 1OAKH 2VR4A 4R7NB 4U6YA 3B5GA 4QHKI 2EXYC 1BIHA 4HH9A 5CP3A 3TVMA 4XP1L 1HILA 4Y2DD 4Y4HA 4LFHD 4NHUB 5IVXE 3DBXB 3KPPA 2YD6A 5ENWB 1UXSA 2VDOL 3E6FA 2CKBA 4JN2A 5DGQA 5AZ2H 3WS6C 4QHUA 1FFOA 2QTEA 2OYPA 3UMTA 4J4PD 3S35H 1CGTA 2C1OB 1MRFH 2DQDH 4U1MA 2IH3A 1A1MB 3FB6A 4FFWC 1BBJB 1AIFA 5CKGA 2YXMA 2HFEA 4HWNA 1S7QB 1UZ8A 4RMSA 1AQDB 5HGBA 3N1MC 3V52H 3QI9D 3I6KB 3ZHKA 1EZVY 3QFJB 1TNNA 1OQXA 5E70A 4YFEA 3BMWA 1B0RB 3D3VD 5I1KL 1S5HA 4ZUUB 1BAFL 3NVQA 1HI6A 2MTPA 4FOMA 5ISZB 3CSYB 4UDUB 4YNYA 1F97A 4ZS7L 4XCYA 5C0DA 3ULUF 3WN5B 2P5WD 1Q1JL 2H9GA 4JFPA 5C7XH 1JGDB 2H41A 1NGZA 3FQWB 5J11B 4P46A 1K5NB 4B7IA 5E03A 4LGPB 3GMNA 5ESQB 3VXUD 2P49B 1KIUA 4HKJB 2B0SL 4X99A 1JNNL 4KROB 3IFOB 3F5WA 1FZJA 1QYGL 3O3BA 1VPOL 3O4LA 4QO1A 4NZTH 1JBJA 4HWZB 4G8GA 4O2FB 4W4OA 5TDOA 3IFPA 5EDXA 2A2QT 1KSRA 5J9PB 1MFCL 3KNBB 1LP9B 1RZIB 3I6LE 3MLZL 3ARGB 4JM2B 2VLLB 3KPLB 3IDMB 1YMME 1I8MB 1X4ZA 4WI5A 1EXUB 1LE5A 2IAMD 1SBSL 5ITBL 1INEL 5AYUH 2C26A 5D1ZB 1HQRB 4TVPD 5F93C 2DQGL 3L5XL 3FQUA 2VB5A 2QQLH 4YH6A 1VEMA 3V0VA 3C5ZD 4JJHA 2I9TB 4G7YL 3MRKA 5GS0C 5EPMB 5FGBC 5C0NC 2XKUA 2NY3C 1JHKH 5F3HB 3CVHH 1YQVL 4M7LT 2DLFH 5DJYA 2H32A 2DQIH 4U1HB 5FF6A 1RUQH 1KN2L 2AVGA 4E0RA 2R8SL 1R3HA 3GM0A 4NQED 5DDHA 1PG7L 4X7TB 5FK9B 1OM3L 1VCAA 5I19L 2WNGA 2ZUQC 2YPLB 2W60A 3TLRA 5GSRA 1G0XA 1VFBA 1KYOJ 2NTSP 2LAGB 1H0DB 4J6RL 2AEPL 5GRWA 3UDWA 3N1GC 1LO0L 5EZOH 3BQUD 1H3PL 5ICYA 5I1AA 2CIKA 4CW1B 1SYVA 4M6AA 1LEKB 3RY4A 4PG9B 2C3XA 3DSFH 3MNZB 1T1ZA 5DJ8B 4R2GD 4RWYH 4MAYA 5IHZB 4PB0H 2MWCA 3PV6A 1UT9A 4IRJC 5INCA 5D7JD 3P9MA 2BCKB 2IPUK 3EYQD 3A0OA 2JB5L 3PNWA 1WFNA 3RZCB 3IDGA 3W5MA 1HHGB 4L4TB 3QCVL 3BEVA 1J1OH 4JPKH 1KLUA 4KK8C 1CQKA 4KHXH 5DQJA 2E6QA 2L7UA 2VLKB 3PQYD 4HZAA 4QRPD 4ORGB 4F57H 2GHWB 5C2UB 4X9GA 3ZE2F 1UG9A 5F7WC 3IXTA 4XP1H 4Y19D 2X4PB 2FWOB 1A7OL 3FRPG 4Z7WA 3L3HA 2HTLD 5MENA 4XNXL 1BZ9B 1TQBC 4MDIA 2W59A 2MSPA 5FUCC 2AEIT 1A1OA 2R2HA 2VDOH 4H0HB 4LSQL 1C5DA 2J5LB 2N1KA 3C8DA 4DUWA 5C0BD 3AB0B 2HN7A 5IBUB 1RJYA 2YEZB 3VXNA 2ADFL 1S7XB 2GEEA 3MV8A 1Q9WA 3ILQC 5IIEA 3I3EA 1INDL 4J1UA 3B83A 4KC3B 1MCNA 3HLAA 3TPUB 3EYOB 4KH2A 4R90L 2VMFA 4KK5C 5BV7C 4WTWA