1MHHB

Structure of p. magnus protein l mutant bound to a mouse fab
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
215
Chain Sequence
QIQLVQSGPELKKPGETVKISCKASGYTFTDFSMHWVNQAPGKGLNWMGWVNTETGEPTYADDFKGRFAFSLETSASTAYLQINSLKNEDTATYFCARFLLRQYFDVWGAGTTVTVSSAKTTPPSVYPLAPGSAAQSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab, light chain
publication title Evidence for plasticity and structural mimicry at the immunoglobulin light chain-protein L interface
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Immune system
total genus 42
structure length 215
sequence length 217
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-08-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1mhhB02
1CK0L 3CAFA 5K9KB 2VDLH 4WO4D 4K3JL 1NFIB 3MV8A 1KGCD 4I13B 5D71H 2M2DA 3KLSA 4YBQD 2DICA 4BFBD 1J10A 4N9GB 4K3DH 5FOBB 1KG0A 3LKSB 4I2XA 2VDNL 2Y7QB 3EUUA 2P8MB 4KUCF 5IR1B 1XGTA 4L5FH 2FBOJ 4V1DD 4ZDHA 5F88B 1VACB 2FL5B 4NHUB 4PTUB 5FHAL 1MF2H 3VE0A 3WFDH 2LVEA 5LWYL 4XCNA 2CR6A 5DQDH 4J3OC 3QQNA 4LLDA 4N90D 4UTBL 2VQ1A 4YUEL 5F7MC 1IKNC 4PTTB 5DJXA 4K7FA 4UAOB 5C6TL 1CFNB 4ZD3H 3WFCH 3SGJC 4NRXB 4ZXBB 1DE4B 1YEHL 5M94B 5BMFL 4PV8A 1CTNA 1LDPH 1I8IA 5B39A 4KMTH 3QPXH 4PJDB 4AMKL 3ULSB 3T65B 3MNZA 3O6MH 5I71B 3BDYL 3IRZA 1JHKH 3BGMA 4RAVB 5DZOA 5KVGL 4K23L 1S9XB 2PF6A 3MLZL 1KB5H 3VWJA 1GIGL 4F37F 4JQIH 5AZEH 3QIBC 1GOGA 2B2XH 3HMWL 4X99B 2OJZH 3TN0B 4U6YA 1NKOA 1QFHA 3TF7C 4PR5A 1MWAA 1Q72H 3CFDA 3JV6A 3MLPA 1VGEL 1J0JA 3I3BA 3U4BL 1ZT4A 1K2DA 1BFOB 3CUPB 3M8OL 5LAXA 3PWLA 5MEPB 2EDJA 1MWAL 3KYAA 5KZCD 4X98A 4TTDD 4NN6C 4NWUH 4LP4A 1ZS8A 3GNMH 4WI5A 2AP2A 4PJCE 3WFEH 5L88H 5I16A 5ILTH 1IGMH 1CDUA 3QNYA 4PJ8D 1ZLSL 1DQJB 2QLVB 1JK8B 1RAMA 1RVFH 3HZVB 4KKAC 5IFJA 3D9AL 4LL9A 3H9HA 3MGAA 3HG1A 4EVNB 3QR2A 3NFPB 4Q9QH 2ZJSH 1FE8H 3V6OA 1VERA 5I0DA 2DLGA 2R1XA 1U8IB 2WUBH 3L95A 1C1EH 3FRPA 4TSBL 3QNZA 1II4E 4KDTC 2Q8BL 5HHOA 2F74A 1UZ6E 3BT2L 3V4VH 2R8SL 2CKNA 3RI5F 4U0RC 3FB7B 1JGUL 4QRPB 3DROB 4KV5E 1PSKL 5FM5M 3SOBL 4PGZA 1H15B 4HJ0D 2APVA 3ZE1E 3OKEA 3MRGA 1UCBL 1MFEL 4APQA 4KJYB 5IM7B 1ZHNA 4KKCD 4P23D 5CD5C 4JKPH 2WBJC 5JHDD 2ADGA 4EI5B 1ZANL 3M17B 3GSOB 3BYTA 2KUTA 1SYVA 3KLAB 3CU7A 3DBXA 1MFDH 2R2HB 3IU4H 4FABH 3MRLB 5C0AD 2O5ZL 3B2VH 4JGMA 2OLDA 2K3TA 1B0RA 4L1DA 1PZUB 4X8JA 2HFFB 3TLRA 4NUJB 4XNZC 3QI9B 2EDKA 5DHVA 4HFWB 4ZO8A 5D7JB 5C0BE 4DGIH 1AJ7L 2FEEI 1MJUL 4KVCL 5TFSH 1G6RA 2RFXA 3I6GB 1CXHA 1HHHB 2NY7H 3Q6FB 5EU4A 1L6ZA 1LK2B 3HAEB 3K46A 5FO7B 3U7YL 1NGQL 4HBCL 5A2JH 3C8HA 4OCSH 5JLZB 3TNMB 3K2UL 4XVUC 2AXFB 2QQQA 2V9RA 2M1KA 3V6FA 3MODH 1MCOH 1RZGA 2XWBA 4WV1C 3N0PB 1T2QL 5CBEA 1BHGA 5C0CB 3WSQH 2IQAA 3L7FB 4LCCA 4ZXBD 4WJ5A 3VRJA 1EH9A 1I1YB 3GSXB 4UOW0 3LEVH 4TNWK 4WFGD 1E4KA 4MGXA 1F4WL 2XI9A 2IPUG 2R23A 1RIUL 2NY6D 1WTLA 1X5YA 4KPHL 4Y4KA 4G9FA 4R26H 5T1KD 1EZVX 1RZJC 3GKZA 4GLRH 1X3DA 1KJVB 2ARWA 5DJYA 5ITFB 2BP3A 3WIHH 1CQKA 4JN1H 3KS0H 3CVHA 1HNFA 4RQQB 1A14H 2XN9E 4YGVA 4HKZB 4NNPH 4KRPC 3TV3H 1V7MH 1JGDB 3ZT5A 4QF1B 3TBYA 2Q87A 3BH9A 3MBEB 4LSQL 3O9WD 5BV7C 4YHPA 2P42B 2APFA 2ZPKL 3WDHA 1YDPA 1WCQA 2CK0H 5J7CC 1U2CA 2IEPA 3HLAA 4Y19E 5CZXD 4CUCA 2DQUL 3NIFE 3MCKA 3P40A 2FWOB 5E2VH 4XPBH 4I5BA 5JW4N 3G5XB 4RISH 5SWQB 3ULVD 2AEIT 5FYKL 5D2LF 4EUPB 1RUQH 4QTHA 1YEKL 5EFIB 1I3RA 4HJGB 1JNJA 1J12A 3MUHL 4GLRI 1K6QL 1NMBH 3O2VL 4KTEH 1N0XL 3SPVA 3UROR 1OB1A 2ATPA 4S1SL 2FR4B 4D9LH 3AU1B 5D1XC 3HUJE 5C0RH 3BI9X 3JWOH 3U4EB 4OBRA 3JWDH 4JFQA 3AVEA 1OP5K 2X5PA 4RIRB 3QB7C 3VXQB 2A6JB 5F7NC 1Q0XH 4MA7L 4ZUUA 1C5BH 1A64A 1FORH 2V5TA 1HN1A 2E9BA 3HCVA 2X70A 4ZSOE 4UNUA 1NCWL 3MO1B 3P9MA 2GITA 2Z91A 4HWBH 1MCRA 3NABH 5EZIL 1JE6A 1F90H 1OAKL 3V5HA 5ADPH 4PY8I 4NKIL 4EI5D 4HKXA 2DTSA 4YWGL 4JRXA 1DQDH 5E00A 2EZ0C 1NGPL 3LVEA 3VI4F 4OUOA 4GG6F 4ORGB 1OAQL 5D9SB 5LXGL 1CK0H 3MRMB 4J7RA 4QRUB 3ARFA 5EC1B 4I48A 1GVIA 4JG1L 1AO7B 1OAUL 3KAAA 4LDLB 4OGZA 3QCVL 3V52L 5GZOD 3MCLL 3I6LD 4MX7B 3P9LB 1NUNB 2EE2A 5H37G 1HYRC 3S96A 2E9WA 4F15C 2VDNH 2YZ1A 3MYJB 1WAAA 1MRDH 3FO9A 3KYNB 3QUYA 3MRFA 2Y4SA 1NBQA 4XMLL 1LE9A 3P4NB 5D6DC 4HEME 3TBWA 1X4ZA 1DBBL 1UM6H 4GOSA 5FYJH 2AQ3A 5GGSY 3ES6A 2APXA 2YRZA 2Z92B 4LVEA 4Q6IC 5CWSB 5LWYH 1F6AB 3I3DA 4TVPL 2VLLB 4ONHA 3LH2H 5TF0A 1WTGT 1RK1A 1I3VA 5C6TH 5C0CD 5IJVA 3RWIB 4R6UA 1UGNA 4XTRD 2RCSL 3RPIB 4BKLB 2QKIB 4KHXL 5JR1L 4X7EC 2GK0B 4LRNH 2LVCA 4M7KL 4NWTH 4BUGA 5C0GB 3H6JA 4AMKH 1ZEAL 3BDYH 4KH2A 4X6BB 2A83A 2ZG3A 4P5TA 1INQA 2D9QB 4Y5YA 3MLZH 3P77B 2ERJC 2W07A 1RJCA 4KI5D 5DD6A 3IETA 3BPLB 1PX3A 4N1CA 3EJZD 3HMWH 5GIRA 1CXFA 3EJYD 1FZKB 1JYVA 1DUZA 1D6EB 2R1YB 3MBXL 3UYPA 1U8LB 4OGAC 4KDTA 1FC1A 1A2YA 5I0ZA 2NX5E 1IAKA 2J8OA 5IK3B 3RDTD 1J0YA 3KLHD 5TGBA 3QDJA 4GRWE 3AUVA 4HUUA 3DYMA 3G04B 4X9FA 3FCTB 5D2NA 3D9AH 3DPBA 3NZ8A 4EEEA 4F3FB 2GHWB 4OGYH 5E0QA 1RZKC 4I4WB 3QIWD 3IDXH 3LZFH 2XV6B 4ZYKA 2IG2H 1EIBA 3GO1H 4M5YL 5GS2H 3KYMA 2W9EL 4R90L 4TSBH 4U05A 1FZJA 2DIAA 3NIDE 2Q8BH 43CAB 4J12A 2A6DB 1IM9B 1NFDE 1UADC 2EE6A 2AJXH 4WCYL 3NCBB 4YPGA 8FABB 4YE4L 1G7JB 1B0WA 2H26B 4PJHA 5TDPB 3UO1H 4L9LC 4X6EB 1YJDC 1WZMA 3CCHB 3QUKA 5GGVL 1UCBH 1UWXK 3HFML 3BPOC 3ARQA 4TUOA 1KPVB 2JCCE 4NN7B 3U46B 3NIFF 4TRPL 2UY7A 1T2JA 3GSNB 5H2BB 1MVFA 2PUQT 4F57L 1KCRH 2C1PB 1T83A 2QQNL 2EXYD 5FA3A 5HVHB 2X9XA 1JNHA 2Y5TB 1G9NC 1LEIB 5CZKA 3MLTB 1L7IL 2YXFA 1DQQA 3NCYP 1YMMD 4PJXE 5TH2A 3H7BA 3QXDA 4QGTA 4Y4FB 5I73B 2VDRH 4GRMB 3SJVE 1IGCH 4J3UA 1F2XK 1IC5L 4KHTL 3X11B 4YJZL 2IBZX 4AT6B 5F6HJ 1I7ZB 2ZSVA 5ICYA 3T09A 4MB3A 3C5ZC 2ESVD 1S9VB 4GG8A 3U7YH 1LEKB 3IJYA 3UJJL 5DUPH 5E6IC 3DRTB 1B4RA 4NZRL 1OP3K 1MHHA 3EGSB 2V7HA 5GS1B 1RIVH 1A4KB 2B1AH 2CRMA 5GSVB 2ZNXA 3T3PF 3FQNB 2UWEF 1RZJL 4NOBA 3MV7E 3C2AH 5K93A 4M8QB 1CFSB 2X42A 3VFMA 3BEWB 3QO1B 5EUOB 4Z7UA 2ZUSA 1F4WH 1X5LA 1RIUH 4POUB 2Z8VC 3PGCB 3OBAA 3VFUB 5CJOL 4KAQL 5F71A 2DQIL 1A0QL 1OGAA 4JM2D 5JORA 1SEBB 4CVXB 5KVFH 2XWTA 3D1MC 5M95B 4NO3A 5BV7L 3BPCB 1JPST 1LD9B 5F6IB 2C7UA 4PV9A 3MRPB 5FUCC 3E3QC 1P7QB 4YR6B 4DGYL 4Z7OE 3QNXA 1LP9B 4ODUA 4R96A 2OBGA 3O41A 4G80B 4UT9H 3NN8A 5DURD 3O3UN 3CMOL 2BSSA 3OJDB 5GRUH 2AEWA 2XKSA 5E70A 5FA4B 2X4NB 4G6FD 3STBA 5GISL 3HHRB 4JGJA 5DEFB 1QRNA 2G75A 4PRPA 2YUXA 4PJEF 2NXYC 2MCPL 5F7EH 4WI2A 5E4IA 3VG9C 3SQOL 4EOWH 1QNZL 4LAQL 3B9EA 2J6EA 3TH3T 3O2VH 4HZAA 4LPXA 3UTSA 5KTEL 1AGBA 1O5DT 2VXSL 4S1SH 4GW1A 3X3FH 4HHAB 1T20B 4PJIA 1FVDB 5E8OA 1FYHB 4ZAKD 4EI6A 4O51A 3CLFL 4XBGA 1P84K 5GRJH 3VXMB 4X0KB 4ODXB 1JPTL 2VLRA 4UU9B 1NCCL 1SJEB 3OZ9H 1S7RA 1O7SA 3WE6B 5JXEA 2YSSA 4WNQB 3PWJB 1EHNA 4YNYA 4OFIA 1S7VA 1TVHB 1NCWH 5DJDA 5EZIH 3QCTH 1OAKH 1A6AA 3QDMA 4NCDA 4Z7WA 1QTYT 4JREC 4R4NC 4Z18A 4JZOA 1DEEA 1NGPH 1FDLL 4GXUM 3ALXA 1OAQH 1W0WA 1N3NB 3VMNA 3VXRB 1Z9LA 3O8XD 4EDWL 4ONGL 2VISA 4IRJA 3UTTE 3QCVH 1JV5A 5T3XL 1HYSD 4Y4FD 4P2CG 1WBXA 2P5EB 2YPLE 1IM3A 2W92A 3BZFB 1DBJL 4H26A 2BSTB 3D18A 4DKEL 2ORBH 4MJ5B 4QOKD 2GY5A 1YEJH 2PCPB 3O6LL 2X10A 1UQSB 4AY0A 1TTGA 3V7AE 5ERWB 3KXFE 3DMMB 3BGFB 1FJ1A 3Q3GA 1DVFB 4U3CA 1FRGL 1U8JB 1TPXB 4JVWA 3W11C 4MWFA 1VFBB 1J8HB 4H25A 4MXVE 1A6TA 2GYSA 4CNIA 5GS0L 1ZGLM 4OLZL 1EO5A 1NGZA 2PNDA 3OMZA 2N56A 2E8YA 3QWRA 2P4AB 3F12B 2UZIL 3ZKMC 4M7KH 1HXMA 3MOBL 4X6CE 4JFPB 4UNVA 3EYUH 1FL3B 1BD2B 5IV2A 4NQCA 1HSAB 4JLRB 2LABA 3I9GL 4G9DB 3CSBA 4YDJB 5IVZA 1WK0A 4K3HA 1WJ3A 1U8PA 1P7QD 5ISZA 2AXJA 3P73B 1FSKC 1GHFH 1U42A 4F33A 5HD8C 3FMGH 1MEXL 2MPAH 5HGGS 4NO0D 4OZHA 3MBXH 1HIMH 2D7PA 2IWGA 4RFEB 1RZKL 1NC2D 2WK2A 3GUTB 1A7PH 3TGXA 4ODHH 3B9DA 3FFCA 4JPKL 2YKLH 4WFFD 4U1IA 4NQED 4QHNA 1DLHA 2VXQL 3GMNA 4ETQA 1F8TL 2RAMA 4ZNCD 4HMEA 4X5WA 4ZO7A 4XBPB 5A2LH 1YJDL 3PHQB 1XF3B 4HPOL 1F97A 3IFPB 1ZK9A 1I3GH 2W9EH 4P2QB 2Z31D 3L1OH 4C56E 3SDDB 4BH7B 5HHPA 3KPRA 4MJIA 5EO9B 4XHJD 4OF0A 4NUGL 4WCYH 3HB3C 4I3SL 5LCVL 4NNYB 4YE4H 4Y2DD 3MJ6A 2R0LL 1E4WL 3VXMD 3E3QE 2YPVL 5EOCJ 4RRPA 3Q5YA 4LGSB 3E2HC 1T03L 5MENE 5SWZE 4YO0B 3VXOA 1G9NL 4NJAL 2DLEA 2P5WD 5I1DB 1TZIB 4ZS6C 2Y5EA 3VWKD 3WFBH 2DQTH 2GTWA 2NYYD 4FQQA 4GKNA 4R7NB 1OHQA 1DFBL 5C0NC 3Q6GL 1DANT 1XZ0A 1E6OH 4FP8L 1EEZA 2CLRB 3AMLA 1PKQA 4BSWA 5DUML 3SDXE 3VDAA 1D9KB 1MJJB 2FJHA 2DM3A 4R4BB 5E6IA 3UPCA 1MI5D 5F96H 2BNRB 5AUMB 5IROC 3BN3B 5HYJD 2GJ6B 5F7YC 2V2TA 1GZQB 5CBAB 4Y1AB 4U7MA 2NW3A 3RPKA 4LHUD 3GMPA 1AGFB 4GRWH 2ZZUT 4DEPC 4JGUA 3FB6A 1CF8L 4DUVA 3O6FA 5I15L 3DX6B 4LSTH 4OLUL 3DMMD 3S7GA 1T89A 1A1OB 3BN9D 4BH8A 3UJJH 3EOAB 1I85C 3MUZ1 4BFEA 2C9AA 5IEHB 2XZAL 4NZRH 5K9OB 4L9DA 1J8HD 1YNTA 3HTLX 4A6YB 2V2XB 2G2RB 5E9DA 1JI2A 5IFAL 3D0LA 1J7VR 1NLBH 2AGJH 2DM2A 4HWEL 4PGEB 3K8LA 3FB8B 4EIZC 3MA9H 3ZDYE 1FGNH 4QRRE 4LRIC 3KNBB 4PJ8C 3P30L 1S5IH 4Y5XC 4QGYA 4OZHF 4Y88A 3H42H 4CVZA 1DQMH 4AEEA 1CZ8L 2F9BT 1HHJB 1KXQE 2ZCHL 3E6HB 2DQIH 1K4DA 5KOMC 3UYRL 3BW9A 2RHEA 5GGVY 4G8GB 1N6UA 5TQ0L 4Z7VE 1M6OB 2FO4A 3UX9B 1N64L 4BQ9A 1VFUA 5EU6D 3ARUA 3H7LA 4CMHB 3VFVA 5ALBH 5DVOA 3VXTB 3EJJX 3VCLB 2VLKE 4MAYC 4HF5L 2AERT 2HLFD 1MRCL 2OP4L 2NNAB 4G6KL 4OCNC 1IGTB 1C5DA 1TJIH 3LDBC 1MCCA 3W39B 4J6RL 1YNKH 3IAQA 5C0FB 4GBXB 1U8KA 1VEOA 4P5MA 3S37H 5DA4A 3TVMC 1QNZH 1X5ZA 4OFDA 4LMQE 4U6VH 2VN7A 3SE3C 4ZUTB 5DEGB 2XZZA 2IANE 4L8SC 3RHWK 3ISWA 5F7DA 2ZOKA 2GUOA 3IFOB 4LPCA 3W9DB 4X5LA 5KTEH 5F7WC 5GQBA 3SDDD 2DQEH 5JW3L 5LBSL 1XMWA 1HDMA 5E2JA 2L0DA 1T4KB 1KENH 2DWDB 5E5MA 1A5FL 1GYAA 1JPTH 1NCCH 4FQCL 2RIKA 4M6MH 2OL3B 2BJMH 2DQCL 4JPVH 3GMMB 1H3VA 1JPSL 5HPMA 1TZHB 1AGCA 5E94B 5F9OH 2HVKB 5DFVD 2YD7A 4MNGB 1DDHA 4HCRL 2CXKA 2VDPH 1N2RB 4X9HA 3F7RA 3N85L 1ZVSB 3C5JA 1H3GA 5J6HB 1AH1A 4BQ8A 1VADB 1L9MA 2P48B 4LSSH 1YN7B 1DQTA 2VERN 2BNRD 2X89A 3FO0L 4XP5H 3MUJA 4MDJA 1NL0H 3G5YA 4QTIH 3V7AG 4C59B 4GAFB 4AEIL 4PJGA 4CW1A 2AJ3B 5HGAA 1D5ZB 1DBJH 1A1MB 1KGCE 5I71C 2VE6B 3EOBB 4DKEH 1SBSH 5FYLD 2PTTB 4WVRA 3BIBX 3JV0A 3WNPA 1HQ4A 4J3VA 4YAQB 3ARBA 3TN0C 3QXAB 1HZHH 3SY0A 4V1DE 4F37K 1VFOA 1Z2KA 5I1EL 3RVXC 1PJ9A 1RQ5A 2NW2B 1BVLB 1GZPB 3D69A 2Z93B 4MCYB 1P4BH 3WIIL 1OAZL 3SBWC 5IHZA 1QBLL 4N0UE 4C83B 2F8XC 1H5BB 3CXDL 4I3GA 3DXAB 5IGXH 4OLZH 5EOQH 1MH5B 3GSQB 5CZXC 4N90E 5FGCB 5HI4C 4UV7L 1NAMH 5TDOA 4NJ9H 2MJWA 5F9DC 4ZOEA 4U6XA 4PG2A 1AFVH 1QFWM 1R5WA 2EDDA 3VU2A 1I1AD 5DUBB 1ADQH 1N8ZA 3BKJL 3RNQB 3PL6B 4DQOH 4B50A 1D3CA 3ZTNL 1M7IA 4Q2ZA 1AI1H 3G08B 1QKZH 4JHWH 5L2KB 1MEXH 3QUMB 5DT1L 1QP1A 4EN3D 4PJ5A 3RI5K 4M7ZB 3FB5B 5H35B 3ZE0E 4QNPE 2ZOLA 5IMOA 3ZDYF 1PG7X 2J88L 2X4OB 2VDQL 4P5KB 1MCSA 5CGTA 4GXVL 4JDVA 4FQJH 1IL1A 3DUUA 4EI5C 3HNVL 3QUXB 1FNAA 3TP4A 3VD3A 1J18A 4OLYL 4KROD 1NCUA 3OF6D 4UUJB 4HPOH 3QH3B 4RSVA 4W6WB 1IAMA 1JPFB 1QPXA 3WIFA 3DUSA 3QI9C 4HUMB 1CR9L 3HE7A 5DVLA 1BBDH 4C55A 2UUDH 5D7JC 1VSCA 4HS8L 1VFAB 1TDQA 5GGRB 3QJFA 3Q2CA 4Q0XH 4G8EB 2ED8A 2DL2A 2YPVH 2Q7YA 5DWUL 2EYRA 1T03H 3UBXG 2Z8RA 3D25A 1A3QA 4X4MA 1G9NH 3VFOA 5B4MC 3U7AA 3LD8B 4JPWH 1DBML 1HQRA 3BWAA 3MNVB 3VXNB 1AGEA 3RGVB 4NHCL 2HYMA 3BIKB 1EJ6A 3VA6A 3ROLB 5KSAB 4DZBA 1C16A 1DFBH 4GMSL 1I4FB 4F58H 3S35H 2AEPH 2DQJL 4TQEH 3M1BA 5JHDE 1M71B 4NRYB 4OZIF 3UPRA 3D3VD 3O4LA 4OV5A 1X44A 4BELD 3V79C 1SVZA 3GI9L 4LASL 5C0AE 1Z0NA 1RUAH 3QQ4B 4PJ7F 2Z4QB 3LKNB 3QBTB 1NMAL 2V7NA 4IRZH 3C60B 4KK9D 5ESQA 2GT9B 4M1DL 4JFXB 4LRIA 5DJAB 4JFDD 5I2IA 1CF8H 1QFUH 2UYLB 3EJZC 3CFEB 4FQXB 2BVQA 3CFCL 1C08A 3PDGA 2DQGL 5D8JL 4LDOB 4N8CH 4KJWC 3L3KA 2QHLA 4FTVB 1I1FB 5I1AA 4G7VL 3MBEC 1HKFA 5IB4B 2EYSB 4HWEH 4NBXB 1ERNA 4TUKL 4W6XB 3RUGB 3C6SB 4OJFL 3P30H 3O2WL 4X7SL 5GRWA 3REWA 1XGYH 3CFBB 3IU3A 5J3HD 3B9VA 2JJSC 2VTFA 1CZ8H 2FSEA 4KQ3H 4WW2A 1QRKA 4U1KB 5CLWA 1AE6H 4WFGE 1G7MB 3DSFL 5HHQA 2EC9T 2IH3A 3PQYD 1I8KA 4LCIH 4OI9A 1CICB 2X1QA 1HXYB 4BSVA 1LNUB 3PL6D 3QULB 4K55A 2WINA 3JTSB 1N64H 2JB6B 3KVQA 5CJ8A 3B3IA 2NXZD 4NBZB 1D5BA 4JB9L 4TSAL 4R0LB 1FL5B 1FIGL 3H2WA 4L8SA 5L2KD 32C2A 1URLA 2GTZA 3BP6A 3EOTL 5DJ8A 4YEFA 1C12A 4XCEA 1G7HB 4WUKL 1XF1A 4HAFA 5DQ9B 1NFKA 4OZFB 4NSKB 2WIIB 5C9JA 4FZEL 1YEGH 4OCXL 3T04D 2WWKT 4BJLA 4LF3A 5DRNA 2ARJA 2YD5A 4NRZB 3QUXD 3LKOB 4MAUL 4J2XA 5GRZA 4U0QB 4QKXB 4CKVX 2A74B 1KJ3L 5EG6C 3ULVE 1KN2H 1CGSL 3SE4C 4Q58C 5ICXA 1MREL 3EFDH 2IBBA 4JDZB 5A40E 1U8NB 1YN6A 3PWPB 35C8L 4PJCA 3UBXI 4HIEB 2YC1B 5DRXA 1MQ8A 2DWEA 4G6MH 4PG9A 4P2YA 2VQUA 5L8KB 3DVGA 4HJJL 1RV6X 3B6SA 1NCAH 1IEBB 1BZ7A 4XNYH 1XIWA 2DQCH 3TJEL 2OJEB 2AI0H 3QQ3B 4R4FL 3FZUD 2BNQB 2I9TB 1JFQL 3RL2A 5KSAD 3K81A 2ENYA 3MLSL 2HJLA 1KJMB 1XF2B 1EZVY 4HCRH 2BOBB 1U92B 3RZCB 1ZLVH 3W2DH 2OR7A 3KHOA 3AXLA 4JFOB 1KYOJ 2AJZB 5JO5B 3BE1H 3WKNA 2QTEA 5INCA 2XQBL 5EO1A 5CCKH 3RY4A 1WIUA 3TJHC 1FVCB 2YPKB 2W65A 4PJBA 4AEIH 4JY6A 1YEIL 3AFLA 3BQUB 4M93B 3I6LE 1R3HB 4OLVL 5GGUA 4ONFL 4PB9L 1XR8B 5C0EA 1EK3A 3JUYA 4CADB 3B2UC 3BPLC 5TJWK 5TE6H 5L2JB 2OMNA 2W0FA 3AAZA 1A7QL 2Y07L 5F89A 3FQTA 4FTVD 5DYOB 4ODSH 5J12B 4WEUD 4J8RB 3L3DB 4L4VB 1SJVA 4X6DA 3WIIH 5C0BA 3LOWA 3MLRL 3OX8A 2GI7A 3RKPA 4JEGB 3IDMB 4RFNB 3CXDH 4XCYB 3X14B 3IAPA 2DQFA 4J4PA 5C0IA 2BC4A 2CO7B 5C0CE 3DV4B 1FNEA 1XGQA 4JO2L 5DS8A 1XCTB 3CPLA 5D1ZA 1I7UA 2BFVL 3SDCD 4IS6A 5JNYA 1OWRM 5EIIB 1V05A 3HMXH 4P57B 1I8MA 1FGVH 1EX0A 1UXWA 5IEKB 4K8RH 2NY4D 5DMKA 4R3SB 1Q9OA 4L3AA 3MFFA 4OM1L 5IVXE 3ZTNH 4KI5E 2V17H 1QLRA 4W4OC 5DT1H 4LMQI 3STLB 4CDGC 2QSVA 3QJHB 4YHML 1ROWA 4NQUA 2PYEB 3ILQC 2G60L 5ETUA 1K8IB 2H32H 4MD0A 5C0JA 2ZG2A 4NN7C 3A6CH 5I75B 1S9YB 2VDQH 2VB5A 2X9YA 1D5MA 2AKRB 3C8DA 5BS0B 5KG9B 2EH7H 5HYIA 3CMGA 3FQRB 4EKXA 1W8OA 5HVHC 5F3HB 1GOFA 1L0YA 1A7NL 2VSDA 4X7CC 2FBJL 4PJDF 4EBQL 3HR5B 1OTTC 2Y06L 1LE5A 1F11A 4O02L 2BVPA 1IC4H 4J3SA 2FLBT 4BZ1L 4HS3A 2AJUH 1JMZA 4Y4FC 5I73C 3PGFL 3X13B 4UMGA 4Y19A 5INDA 3C5SA 1SQ2N 3REVB 4L8CA 2H9GB 1YUHA 4NNXB 3UP1A 1ITBB 5HPOA 4JRYD 4XB8A 3TCLB 5HYSB 3WS6C 2BMKB 4FQ2L 1A3LL 1NLDL 2W60B 2Z35A 1I7TB 4ZFOA 3ARDA 5JZ7C 1U95B 3N06B 2E9IA 1LO4L 1P6AB 4NHCH 1QFOA 3F7PC 5GS1C 5C09B 4PB0L 2VUYA 1YEEL 3HUJA 4HKBB 4ZFOL 3IDUA 3RZCD 4JO4H 2A1WL 2QADB 5HJ3B 3IT8D 1S7TA 4ZFGH 4P48A 4PP2B 5I6XB 5IHBA 1RPQA 3GI9H 3QUZB 5DFWH 4O58L 3V6ZA 1P7KA 5AEAA 3IXAB 1NMAH 4ZSOA 3ZYOA 1YMME 3BRDA 1HEZB 2HRLA 2FJGA 2LAAA 4M1DH 1UYWL 4M62L 1B0GB 5J4MA 5CSZB 1KC5L 3F8UB 4H8WC 2QSCL 3HZMA 5F6IC 5GGSB 3U0WH 2VIRA 4X6FA 2JJSA 3CFKB 1HHKA 4MJ6A 3CFCH 5FYJU 2DQGH 5ICZB 3QO0A 1Q9LA 1UC6A 2ESVE 1BQLL 5FHBH 5JQ6L 1X9QA 1I8LC 5T3ZL 3MJ8B 3RY5A 1FZOA 3WXWH 2FX8H 1ZLUK 4PLOB 1MCIA 2EYTA 3ZDXF 4TUKH 2O61B 3ZE2E 1XR9A 1U8HA 1B2WL 5F7LB 3WL9A 4P2RB 1ZGLB 4CU8A 4S1RL 4IDJL 3BSZH 2YEZB 3DSFH 1IAIH 1C5CH 2SEBB 4LARL 1U93A 1XF4A 2FRGP 1BAFH 1LO3L 3CDFA 3I75B 3MRJB 3QEGL 3MRKA 2V2WA 4MJ4A 2IGFL 4P2OB 4JB9H 4TSAH 3JUZA 5E4EB 4ZUVB 1F4HA 4AZ8A 3L3OB 5J1AB 3T8XB 1P2CA 3WKML 2F58L 4QXUL 1CFTB 1J0IA 3EOTH 3DSNA 4B7IA 1EVUA 2MHAB 1MCBA 3N1GC 3VFNB 4Q74A 1QEWB 2A9ML 3RWJA 3VD7A 1CLYL 2ARJQ 2EEDA 3RWEA 1W72H 4LSUL 3MV8B 4FZEH 5HDBF 3A6BH 1U8MA 5EORH 1WCBA 4C54A 1NC4D 1W0YT 1FFNA 1KG0B 3KYOA 5E6ZA 4ELME 5J6GA 1JUFA 4I2XB 4IM8A 4OLWL 5T1DH 3HZYA 4Z7QE 5JPNA 3NCMA 1KJ3H 1ZT7A 1XGTB 2C3VA 4D3CH 4NYLA 5J13B 1IAII 4ZDHB 2GCYA 2B8OT 1OAXL 2X4SA 3IJSA 4RFOL 2NX5A 1NMCB 35C8H 3TYGH 2WV3A 3U2SA 1XCQA 3VE0B 4YFLI 1FBIH 4HJJH 5HVFB 4XCNB 2Q7NA 3VFWA 4LLDB 1ES0A 4LPTA 3RWFA 2VQ1B 3DMMC 2VXUH 3BGFC 25C8L 1PYWA 4KUCD 4K7FB 5DJXB 1EAPA 3MRCA 1DVFC 1DLFH 1NEUA 4K7PX 4PV8B 1I8IB 4R9HA 5B39B 1CDHA 4M43L 1JN6A 3HE6A 1NFDA 12E8L 3MNZB 3W0WA 5GRVK 2X4PA 4MHHG 3BGMB 4JPIA 5IP4A 4JFFD 1VKXA 3VWJB 1G6VK 2YD9A 5L7XL 3NCJL 1MHPH 5DD0L 4F9PC 3OG6B 2JCCA 1JNNL 4U6YB 2E27L 4HIIA 1MWAB 3CFDB 3JV6B 4PR5B 1ZT4B 1K2DB 5LAXB 3AGVA 3PWLB 5CLTA 1YQ2A 4PB9H 2D7TL 4X98B 4HSQA 4OFYA 2NZ9D 1ZS8B 4QOKE 5D93B 5HI5D 1OP9A 5I16B 4LKXA 3QNYB 3GMLA 4PJXA 4YHLL 4TULL 5ELIA 3T0DA 3ULVH 5IFJB 3H9HB 3HG1B 2HH0L 2QQKL 3SJVA 1IT9L 5I19L 5DD1H 3AB0B 2CJUL 2FB4H 4OCRH 5GPRA 2MQ3A 4F7EA 2R1XB 4B53A 5KW9L 5AYUL 3EYFA 3RRQA 3TZVD 3L95B 5DXWA 2DI9A 1CGUA 1UM4L 1HSBA 3UXFA 2DMBA 5DD3L 3RP1A 3QNZB 1ZXQA 1R3LA 4P2RD 5HHOB 4X9GA 1WWCA 2F74B 5EUOE 4FNLH 2AXGA 5HHXL 1T1XA 3VXUA 1YEFH 3OAYH 5D7IA 1G9EA 3OJVC 1XF5A 2BFVH 3PP4H 1LO5A 4XNUL 3OKEB 3MRGB 1OSZA 4APQB 3MV7A 2P1YA 3SDDC 4UBDC 4P2OD 3GSNL 1ZHNB 2B1HL 3WO4B 4MS8C 5C70A 4DZ8A 3V0VA 2ADGB 3MRQA 1SMAA 1SYVB 2ZKHL 4YHMH 3DBXB 5AAMA 5J9PA 3DYPA 1NBZA 1PG7L 1FCCA 1ZVHA 1B0RB 5EULV 2M8XA 4X8JB 2HFGH 3VXSD 3S36H 3PP3K 4IOFD 5EBMA 1UWEH 4WFFE 4EUPG 4I77L 4XAWL 2VR4A 4X7TA 5DHVB 4NQEE 2J5LB 2VDOL 4POZD 1A7NH 2FBJH 4CN6A 4EBQH 5I76A 4O2FA 1D9KC 4RMUA 2FECI 3RIAF 3D39D 4XP9H 3NGBB 3R0NA 1AXTH 4BZ1H 1G6RB 1MCWM 2RFXB 2YA2A 4Y16D 4JDTH 4PP1D 3U9PL 2DM4A 5EU4B 2PXYD 1HHGA 4PGDA 3HZKA 1GGIL 1EA9C 4KGJA 3RQ3A 2MKLC 1U9KA 4KTDL 3OPZL 2DTML 4S10A 1I1CA 3V6FB 3UJTL 3QFJD 1RZGB 2FGWH 2XWBB 3KDMA 4PUBH 1EJOH 3VXME 1UACL 3IKCA 5CBEB 1T1YA 4FQ2H 2IQAB 1J88A 3MRHA 1QBML 4LCCB 5FKAA 1HKLL 4WJ5B 3VRJB 5J1SC 4MHHI 5CS7A 3QXVA 2OK0L 2P5WE 4IIQA 2R23B 1UWGL 2OXHA 3GJFA 4XP1L 4P4KD 4Y4KB 2O5XL 5H94A 4G9FB 4GXUN 3EYOA 5I1LA 3VWJD 5DJYB 4H8WL 3QG7L 3WJJA 2VOTA 3IDGA 4MNQA 3AREA 4J3XA 2ICCA 3S34L 3CVHB 5ALCH 2QR0A 1YPZE 1EO8H 4YGVB 2HT2D 1MI5E 5DI8A 1HWHB 4S11A 3O2DH 5HYJE 4KMQA 1MY7A 2C4FT 4P59L 4MMXC 3TBYB 3BH9B 5IW3A 1A7OL 5DMGC 4LVNB 4YHPB 4EXPX 1C7SA 1LO0H 1UFUA 1YDPB 3BKCH 2P24A 4QXGH 4CMHC 3C09B 3HLAB 3LEXA 3H3PH 5D7IF 2BVTA 1BQLH 5CJBA 3RTQA 3UTTA 5GGTA 3MCKB 5JQ6H 3HC4L 4HGWA 3HG1D 4I5BB 5GS2D 5T3ZH 2YPLA 4EUPH 4J23A 3QHZL 4L1HA 1KIUA 3DETD 2UUDK 5GGTL 3WN5A 4E9LA 4QTHB 1J8HE 4U1MA 5GRXG 3T0ED 2VAJA 3IF1A 1BLNA 1I3RB 1Z0MA 3CSGA 3R8BB 4GW4B 3OV6A 5CIPA 3SPVB 4GBXC 1OB1B 2ATPB 3L5XL 3EBAA 4IDJH 2CXGA 3ARWA 4PRHD 4JFQB 4AL8L 3JVGC 4UDUA 4PIRF 4MQSB 4N1HB 1MY5A 2VR9A 3F5WA 5F7FA 4ZUUB 1LO3H 3FQUA 4GRLA 4ALAH 1OQOA 3RY6A 4OZ4A 5D5MA 2GIYA 3HCVB 2X70B 4U49A 4XH2A 3P9MB 3DWTA 2GITB 2Z91B 3S5LA 4Y5VA 3V5HB 5I1IL 2F58H 5EU6E 4QXUH 1GGBL 5A43C 2AQ1A 1OTSD 1D7FA 4HKXB 4JRXB 4K94L 4TSCL 4WI8A 5HI3C 3HC3L 5E00B 4X6CA 3KPQA 2WUCL 2H6PA 4NQVA 1CLYH 2AJVH 3LN5A 4P4RA 3V4PL 3ARFB 4I48B 4NO2A 2YD2A 4LSUH 5KVDL 1H3UA 1KIQA 4B0MM 1MPAH 4H88L 3BVNA 4IMKA 3D85D 5TE7H 1YY9C 4JFYA 3PWNA 4OD3L 3S96B 3RJQB 5E5RB 1KTRL 1ND0A 3QUYB 3FO9B 2DBLH 3MRFB 4ODTL 3QPQC 4RFOH 1LE9B 1I1RA 3TBWB 1U8QA 2YUWA 3ES6B 4KK9C 2QHRH 5GJSL 4ZTOL 4R2GB 1LP9F 3UTQA 3OAUH 3QSKB 4DN4H 5C1MB 4ONHB 4F9PA 2FYYA 1AD0A 1RK1B 3GMOA 5IJVB 3E0GA 4FFWD 2Q86A 4C56A 2F53D 1NAKH 4M43H 4NN6B 12E8H 1H5BC 4JFED 1DBAH 2A83B 4P5TB 3MJ7A 1OSPH 1INQB 4Y5YB 2EDBA 4U31A 5SWZA 5L7XH 2AJYL 5DD6B 3IETB 5DD0H 1MLBA 1RZFL 5GIRB 1KEML 4KJQD 4HXBL 8CGTA 4RA3A 2E27H 3EAKA 4EJ1C 3TPKA 3KPOA 4F2MA 2BNRE 2V5SA 2X6MA 1DUZB 4H20H 3MRDA 2X4TA 2ZUUA 3BDBA 4MZ3A 1A2YB 3V5DA 3D2UD 2D7TH 1IAKB 5E8PB 1CQYA 3MXVH 5FYLE 3SDXA 1SM3L 5TGBB 2FEDD 3QDJB 5FYKD 4HUUB 4YHLH 4RZCA 4OD1L 3BEVA 2B7DT 2AW2A 5D2NB 1CN4A 5C8JA 1NANH 4PFEA 5KS9A 3NZ8B 5DMYA 1FH5H 4MXQC 3U1SL 1BQSA 1OARH 1IT9H 5GZNC 5I19H 5TDNA 4KDWA 5D7KD 5ESAA 4YX2L 5D5MF 5AYUH 1BQHA 4ZYKB 1RULL 3KYMB 2VLJD 3NCYS 3VFSA 2HJFA 3RVUC 3QRGL 1FZJB 1KJ2A 2BSRA 4NC1C 3KYKH 3QUXC 2I24N 5DA0B 3EO0A 3VD5A 1G0DA 5IHUH 4YPGB 5JHLL 1KJ2L 4PJHB 5JA8B 1IC1A 1YYLH 2X41A 1QD0A 4XNXL 5DTFA 1A1NA 4NKOA 1T3FA 3QUKB 3TNNA 4RBPH 5M7QA 5F8RC 3MLWL 4TUOB 3GSNH 4IDLA 2W9DH 1ZLVK 4X5XA 1A6ZA 2MQCA 1H3PH 3GHEL 1RMFL 2HRPH 3ALWA 3BDXA 3IRPX 2VNCA 4JRXD 1HK6A 2ZKHH 3VI3F 2BOCA 1ZGLP 3LRSA 4LLVA 3T2NH 1JTOA 4AIOA 5FA3B 5F1IA 4C4KT 1JNHB 2CIKA 5EOCL 2I07A 1VFMA 2WLYA 4UZGA 1KCLA 5BZDA 1QBAA 4E42A 2FDBP 5KSVA 3B9KA 3OAZK 1FNGA 1DQQB 5I66A 1G7IA 3RGVC 4Z7VA 5TH2B 4B5EA 3H7BB 1A8JH 3EO1A 3QXDB 3ULUC 5KSAC 4I77H 4PJ9C 4UILH 1CS6A 1EGJH 2MWCA 1JZ4A 4Y2OA 1Y6KR 5F3BA 3L3HA 4RCAA 3MRIA 2VLKA 2VC2H 1ETZA 5E95B 4YXHL 4HQQL 2ZSVB 1CLZH 5ICYB 5BZWA 4PD4J 3BKML 3T1FA 4GG8B 4UT7L 3NA4A 4TVPD 1U6AH 4XWGL 5C07D 3IJYB 3C60C 4KTDH 4RGOL 4A6YL 1MHHB 2V7HB 2EDXA 4FXGA 3QIBD 1S5HA 5I30H 1WFUA 4XC1L 1RJYA 5E7FA 4FQXC 4WI4A 1KPRA 3VFMB 5K9QI 4Z7UB 2H1PH 5L9DL 3OXSA 1FN4A 2OK0H 4HUXA 2CK2A 2I27N 4NPYA 1JZ2A 4XP1H 4HXAL 1GAFL 4HFUH 1OGAB 5JORB 1TJHH 4LQ1A 2XWTB 4DTGH 3QG7H 4KKAD 4NO3B 4OQ1A 4N68A 4YLQT 4NFCA 1TVBA 2C7UB 4PV9B 1IGJA 5KS9F 3D3VE 3S4SA 3R06A 1P4IH 1NBYA 2XTJB 1I9JL 3QNXB 5B8CA 4ODUB 4LCWA 1CICC 4R96B 3O41B 3NN8B 1U3HC 3PDDA 2BSSB 1NDGA 1A7OH 4LCUA 4XPTH 5JUEL 2V5YA 4AYFA 3NTCL 5I1CL 2XTLA 3QDJD 4JFDE 4PRIA 1T04A 2R2BA 1WEJL 3T2OA 1AHWA 1MJ7L 3HC4H 1QRNB 2G75B 5CJXC 4PRPB 2WW8A 4WO4A 3NACL 5F9JA 3VRLE 5FO8A 3F7YA 1ZT1A 3LIZL 1T6WA 5CD5D 5ID1A 1IKFL 4K07A 15C8H 5FGRA 5CZVL 5EU5A 2FHCA 3UTSB 1AGBB 5E99L 1N6QH 2AJSL 4GW1B 4PJIB 5E8OB 2D0HA 5FGCE 3EYVA 3CDGA 4DVRL 3CLEL 4XNQA 3HI5L 4EI6B 4O51B 4XBGB 4E41D 2VLRB 1MELA 1S7RB 1A6UL 2DMKA 2RGSA 4CN4A 4NZTH 4N0UA 3PE9A 2YSSB 3PQYE 2DKUA 1BVZA 4YNYB 3MV9D 4NQDA 1S7VB 4TNVF 4FQ1L 1FVEA 5DJDB 1QSVA 3LN9A 3QDMB 3GBNL 1A6AB 4XX1G 4Z7WB 5KSBA 2BDNH 1E6JL 4DWHA 3VFGH 4JZOB 1DEEB 2OQJA 5L2KE 4JRWA 1W0WB 3O6KL 1OT2A 3CZFA 3CH1A 5CEYA 3SKUD 3V4PH 2JE8A 4YDKH 1T0PB 1DL7L 4Y7MA 2WWMD 5IIEA 4MXWL 4XVUD 3PV6A 2VISB 4L3ED 4IRJB 1JV5B 5B3JE 1P69B 1WBXB 1J05A 2H2PC 4BA8A 1IM3B 4ZFFA 4YH6A 1GC1C 2EH8H 4H26B 3UEZA 1MCHA 3D18B 1N5AA 1AC6A 3BO8A 2X4UB 1X5FA 1MHCA 2B4CC 4RMTA 3TO2A 1MRFH 4QCIA 1FJ1B 3Q3GB 2YUZA 4AG4L 3BQUC 4M93C 4XMPL 4CAGA 3G9AB 4MWFB 4ZTOH 3TBSA 4NFDA 3TCXA 3WNLA 1OF2A 3MJGX 5DQJA 5A2IH 4H25B 3IGAA 3NCCB 1A6TB 3ZSSA 4KRPD 5JDJA 4CNIB 5TPWH 2F5AH 1NGZB 1A4JA 1BPVA 2EDYA 4K7PL 2VUOA 3GHBL 5J12C 1HXMB 4P99A 5GXBB 1EFXA 1LILA 2F8OA 1RJLA 1T80A 1WFOA 2X44D 4NQCB 5IV2B 3EDDA 2EO9A 1OGAD 3RX8A 3GK8L 3LS5H 3B43A 1L7TH 1ZKAA 2EEAA 1BGXL 2AJYH 3CFIC 5IVZB 4JO1H 4M6NH 1U8PB 3WDIA 5IF0A 5FUOH 5ISZB 1SY6A 3QUML 4F33B 3QYCA 4OZHB 5F1KC 5CFHA 1CIDA 2LU4A 4P23A 2KPNA 2BVEA 1SY6L 4DJMA 2OYPA 3MJ9A 3THML 3G6DL 3FFCB 5FUZH 1F4XL 1H8OA 2A6KA 4G6JH 4U1IB 4JY5L 5C0AA 4QHNB 3MJ9L 4FG6C 1DLHB 3GMNB 4ETQB 2WQRA 3AS3A 4F8TA 4I18A 2G5RA 4Z76A 1E0OB 1SEQL 5F7HA 1W72A 4X5WB 1VDGA 4S0SD 4FTVE 4YX2H 5I75C 2R0ZL 1K8DA 3U36A 4TOYH 5KAQG 5D96B 1BQUA 5E1AA 4KKLC 4XPGL 3SE9H 2DIJA 2EZ0D 2QSTA 3WEXA 3WUZA 5HHPB 3EDKA 3KPRB 4MJIB 3QDGD 4KUZH 4MA3A 1H0DA 3TEUA 4E5XA 4FHBD 3ZKSD 1CXKA 1DN0A 4PY7A 5JHLH 3GDBA 1UKQA 2D03L 1EBPA 2VLRD 3BP7A 4XNXH 2O5YL 3VXOB 4PJ9A 1RK0A 4KZDL 2YK1H 5BXFA 4HC1H 3EDFA 3MROA 2CLZA 4DKFL 3GHEH 3ULUL 3GSWA 1RMFH 2GTWB 1CD8A 4I0CC 4FQQB 3K8MA 2DQHL 4GKNB 1JHTA 3GGWA 1G9MC 1CLOL 4QWWD 3VDCA 4LSRL 1XZ0B 5HHVL 1EEZB 1G84A 1PKQB 4BSWB 1FPTH 4CMMA 3H8NA 3IAGC 1QVOA 3LQZA 1G7LA 1P5UA 2FJHB 2XICA 5E6IB 5HYQA 1CXIA 5T1KA 4ISVA 2DD8H 4KU1A 2V2TB 1AR1C 2QADC 2NW3B 1I9IH 3O4OC 3A0OA 3GMPB 2CDFA 2NY0B 4HQQH 5I6XC 3FB6B 1ODAA 3QUZC 4D2NA 3O6FB 1YYMH 3C8KA 3BKMH 3MLVL 5DK2A 2BRRL 4MCZA 5C2BL 3RGHA 3V7MA 2VL5A 5J57B 4BH8B 4I1NB 4OLEA 3O9WA 4RGOH 4A6YH 4MMZC 4BZ2L 5GS0D 3ZHKA 1YNTB 3DECA 4GAJL 3K4AA 3L5HA 1VEMA 1FG2A 5E9DB 2F54D 4XC1H 5BJTA 3D0LB 1TCMA 2CDGA 4S1QH 3VFPA 4JRYE 1RFDH 3U4AA 1OD7A 4AIXA 2HAZA 5DR5L 1U3HA 3FRUA 4OGAD 3MLXL 1GGUA 4CVZB 3VG0L 4WI3A 4ACPA 2ZCLL 1CU4L 4NQCD 1K4DB 1GAFH 1KFAL 3BW9B 3U9UA 3GIVA 1BF2A 3P11L 1TQCC 4HIHA 2FO4B 2EO1A 4RAHA 4Z0XA 2QV2A 4DGVL 4G5ZL 4Y89A 1OCWL 3VFVB 1I9JH 2BHUA 4DAGL 5JXAL 4HPYH 1CGYA 2A77H 2HJKA 1WICA 3PABA 5I8EA 3LQAC 3EHBC 3N1QC 4K9EC 4P2OC 1C5DB 2ITCA 3NTCH 5I1CH 3DURA 2EKJA 5E4EC 2YD4A 3L9RA 4UB0L 3TO4C 2N7AA 5I1JL 1A47A 4QXTA 1U8KB 4O9HH 4P5MB 3GFUA 3NACH 1X5KA 3ULUF 2F19L 5E08L 3GI8H 3O3AA 7CGTA 2P45B 1IZKA 1PEWA 5F7DB 2ZOKB 2GUOB 1CL7H 2Y6SC 3NZHH 2FIKA 5E99H 3CSYA 2X1OA 1IQWH 3JXAA 3KPRD 5D70L 1HDMB 1M4KA 5HGDA 4KKBC 4W68A 4DVRH 4O4YL 3HI5H 4IHOA 1BECA 4CVUA 5E5MB 3BD3A 5J13C 1UT9A 1JBJA 3QXTA 1UWXH 2OL3H 1NMCC 4S1DC 4LCYA 4RNRA 5KVEH 2R56L 5IESL 1G1YA 4ZUSA 4HT1L 4WEBH 4DFHA 5IW1A 5HPMB 3SDYL 2Q20A 2FATL 2V9TA 1JGLH 1AGCB 1E6JH 3TFKC 1J1XL 3C5ZD 1GC1L 1V3LA 5TF1L 1DDHB 4HD9A 3VJ6A 3O45A 4U7SA 3C5JB 4YDIL 5J1TC 2B4CL 5E6ID 5ADOH 2IPTH 4ZMAT 4MXWH 4CU6A 3RUGF 5DD5L 1CL7I 4KTYA 4NQXA 4MDJB 3G5YB 1OT1A 4PJGB 4CW1B 5IVXA 3W5MA 3LPFA 4LIQE 5HGAB 5DLMH 2D0FA 2H45A 1X4YA 2Y23A 3RWGA 5F70A 2GY7B 1BX2A 4ELKA 4IRSA 2FX7L 4JY4A 1Z3GH 4KMLB 1HQ4B 2IADA 5JPMA 4ZUWA 2D31A 3ARBB 4NC0B 3SY0B 3TPUA 3L3GA 2BSED 4AG4H 4GO6B 3P4MA 4ODWA 4MSWA 3RDTA 3K8KA 4XCFH 3ARVA 3MXWH 4XMPH 3SKJH 4LNRA 5EWIL 3D69B 5E9DD 5B3NA 1ACYL 3TT3H 3EYSL 5IHZB 5HHMB 3VFRA 4UOJA 1R3KA 4JHZA 5D93C 5C71A 1X5GA 5L6YH 1QG3A 3QIWA 1J1PL 5TDOB 5FGBA 1TTUA 2C3XA 1RZIA 2EIEA 3AB0C 1HWGB 4U6XB 4M8VA 3V6OC 1LO2L 3BH8A 4QXWA 4QRQA 2ZSWA 2GKIA 4AEHH 1S8DA 1R5WB 4GQ9H 3O0RH 1N8ZB 2PTUA 1RUKH 5IFHL 5EZLA 2NXYD 4JFFE 4MDIB 3X12A 2HKFH 2Y36L 2HT4C 3VH8A 3QUMH 1M7IB 5I18H 4Q2ZB 2IJ0C 1INEL 3ZYJA 4U1LA 3BXNA 2XRAH 4PJ5B 1ZVYA 5IMMA 1ONQA 5CILL 4APQC 1QYGL 2ZOLB 1HINH 3G6DH 5IMOB 5GGQH 1KTDA 3L5JA 4OFKA 4XPFL 5EN2A 1CE6A 5CEXA 3V8OA 3WO4C 3V4UH 4JDVB 4UNTA 1IL1B 3DUUB 3QCUH 4GSDL 2ZCKH 1YMMA 5DVKA 2DM7A 3SKMA 2BVUA 2R0ZH 4NCC1 4WRLA 1V3JA 3V95A 2JF1A 4R4ND 3DUSB 3WIFB 4D0CA 1IFHH 5T1LD 1FZMA 3HE7B 1X6LA 2HG5A 3ARTA 2J5LC 1B4JH 1D6VH 3TIDA 3QJFB 3SQBA 2ESVA 1G9ML 4P2RE 1G7PA 1F4YL 2VZUA 2D7OA 2EYRB 2Q7YB 3BAEH 4NZUH 4NM8L 3D25B 2PETA 3VFOB 3RIAK 4UT6L 1HQRB 3BWAB 2QQLL 1WSST 4P9ML 1AGEB 4K7PY 1BZ9A 3RVTC 5DGRA 1JPGA 4RMVA 3HS0A 1CLOH 4TVSa 4DZBB 1C16B 4OZFG 2DRUA 4LSRH 1R5VA 1OTUC 4MD5A 5ANME 4D9RD 3UPRB 3O4LB 1KBGH 4OV5B 2NLJA 4LCCC 4ZPVA 3ZDZF 3CK0L 4M6OL 4PBWD 3W11D 1T7ZA 4ZG1A 2X89D 1E4KC 5CSZA 1MNUL 3HPLA 4JCLA 4JM2A 5IJKA 2R0KL 4DK6A 2V7NB 3RBSA 2Q6WA 3VXSE 3VMPA 4Y4KC 2NY1B 1R5IA 5IB1A 1NCDH 1RU9L 5ESQB 1CE1L 5IOPA 2ICWI 4V2CB 3FJTA 4I2XE 5I2IB 1KCVH 3ZKMD 5EZJA 3D39E 1NUDA 4PJAA 2BRRH 2BVQB 1TZGL 5LGHL 1C08B 4XPHL 5FB8A 5FFLA 3L3KB 3SKOA 1OAYH 4BZ2H 3GSUA 4GAJH 5I1AB 1BWWA 4ELMA 2D3VA 5JOPD 2XQYG 3BYYA 3WXVL 5DJ0A 4LVNC 5HD8D 3NA9L 4KJPC 5KN5A 3QQ9C 2NY3B 3H0TA 3QFJE 2ICEA 5CUSH 5EBWA 1H9VA 5MP6L 5GGRY 3LEYL 5F1NA 5EU7E 3REWB 2D4FA 2L7JA 3MLXH 3IU3B 3DLQR 3VG0H 4RBPK 2FSEB 4IJ3B 4WW2B 4XPAL 2AEQH 5HHQB 5C08D 3RAJL 1I8KB 4U33A 2H2SD 4NCC2 3ILPA 2PO6C 5F9WB 3TO4A 4BSVB 3GSVA 4ZAKA 2WINB 4K9EL 3TBTA 1KCSL 4M61A 1A3RL 1FO0A 1MJ8L 3B3IB 1D5BB 1OPGL 5ACZA 4M9PA 1KNOA 4L8SB 1CWVA 32C2B 2VABA 2O93L 1P5VA 5JXAH 5FAAA 2GTZB 3BP6B 5DK0A 3ZHLA 5DJ8B 3BPNB 1C12B 4XCEB 3BRGC 5C86A 1NUGA 3ESUF 4P3CL 4OZFH 5B22A 2KQMA 1ED3A 3ZHDA 4OD2A 2LV4A 3HB3D 3FN0H 3LMJL 1VHPA 5C9JB 3O3BA 4XNMA 5I1JH 4LF3B 5DRNB 4CJ0A 2ARJB 4XRCA 3QAZC 3O8XA 3FOMA 1CD1A 2F19H 4OM0L 5BVPL 5E08H 4WY7H 1YMHA 2VAAA 1JF1A 4NT6A 3PWUA 3ARFC 4ZS6D 3HG1E 3SKNA 3DV6A 3PJSA 4ZQKA 3EW3B 5ICXB 1S7UA 3H9ZA 1EHAA 2VKWA 2H8PA 3GRWA 2OM5A 3T0EE 5C0ND 1YN6B 4QOKA 1FNSH 4HZLA 1EFQA 4PJCB 2I9LA 5DRXB 1T0MA 1U8OA 2DWEB 2ZG1A 4PG9B 3QUYC 3GRWL 3DVGB 3LQMA 1PD6A 4O2EA 3FTGA 2MFNA 1FLRH 1WZ1L 1HNGA 1VGKA 3B6SB 1YNLH 4PRHE 2UY6A 1BZ7B 5AAWA 2VZ3A 1XIWB 5IESH 1FYTD 3W9EA 5BQ7A 3FHAA 4MZ2A 4R97B 3ZT7A 3SDYH 2FATH 5D2LE 3MUGA 4R2GC 2XNAA 3RL2B 2HKHL 2E6QA 2HJLB 4DK3A 5C6PB 4F80A 2D7QA 3FONA 3P0GB 1P7HL 2CKBA 4R7DA 4PJAF 1OD9A 4YDIH 3AXLB 2B4CH 1S7QA 2KKQA 5INCB 2APTA 5EO1B 3NOIA 4M00A 4ERSL 3UAJC 5CAYB 5DD5H 4DN3L 2CKBL 2DDQL 2W65B 2P7TA 4PJBB 2J1KA 5DRWA 3L7EA 1W8NA 4KVNL 4JY6B 5ECJE 3PV7A 1F6LL 2YN5A 5IQ9A 1U91A 2EKSA 3MRBA 4KFZC 4P5TC 4Y5YC 1Y0LA 5GGUB 1TJGH 5C0EB 5K59F 3FO2A 4NO0A 2Q76A 5HGBA 2W0FB 3AAZB 3VI4E 1NC2A 3CFJA 4GG6E 3DJ9A 1BOGA 5F89B 3FQTB 1YQVL 5HYSG 3CJJA 2JB5H 4HS6A 4NQEA 4X6DB 1ACYH 5C0BB 3EYSH 3O3EA 3OX8B 4Y8DC 5BRZD 1HH6A 1F45A 1JYXA 2DQFB 1S3KL 1LQSR 1MAML 3T4YA 4MAYD 5C0IB 2J8UA 5D2NC 1IGYA 2BC4B 3VW3L 4HUWA 1FNEB 3AY4A 1XGQB 3MFGB 1LO2H 1J1OL 4YHYB 3K7UA 5DS8B 2Z31A 4UIKH 3OKOA 2F53E 3CPLB 5D1ZB 3IJHA 1I7UB 5C9KA 3QWOA 4IS6B 5JNYB 1PFCA 4PYGA 5SWSD 1I8MB 1P9MA 5IFHH 1UXWB 4Y2DA 1A6WL 4JFEE 5I74B 3RVWC 1QSZA 1JGVH 5JIKA 1MCPL 2Y36H 3TVMD 2FX9H 5DMKB 1Q9OB 3MFFB 4OCYL 2CQVA 4D0DA 1E28A 4OV6F 4OLXH 1QLRB 3Q1SH 4XP6H 3I85A 3BGAA 2P5WA 1TVDA 4U1GB 4DOHB 1JHLL 3LB6D 5ETUB 3HNSL 3VWKA 1UCTA 4YZFF 1QYGH 4MD0B 5C0JB 1Y6NR 1UH2A 4XPFH 1ZTXH 3LCYA 1D5MB 4LIQH 1CBVL 3OGOE 3P4OA 3GMRA 3LSOA 3UC0H 1T83C 1T5WA 2DI7A 5EDXA 3OB0K 1YPZA 2W59A 1BEYL 1KF9B 5I8KH 5FYKE 1MI5A 5A1AA 2YD1A 4GW5A 3N9GH 1LE5B 1F11B 1G6RL 5HYJA 4QY8A 4RGMC 4LSVH 2BVPB 2WWMC 4HS3B 3KHQA 5D7KE 4LHUA 3T0WA 1DZBA 5DVNA 3HRPA 5D72L 2VLJE 4UQ2A 4Y19B 9CGTA 3C5SB 4EQ3A 5INDB 2J2ZA 4L8CB 1G9MH 4OSUH 2M26A 5D6CA 3RWHA 1YUHB 1AIFA 2OZ4H 2P8PA 1KOAA 1XIWD 1RZ7L 2QQLH 2Z35B 4ZFOB 3TBVA 4Q9RH 4P9MH 3ARDB 2KBGA 4M1GL 2VITA 1JRHL 5GJTL 2FHBA 4UV4H 1NCBH 1PVHA 3U0TA 4YIQA 1UG9A 1MOEA 2FH6A 3HUJB 3TN0D 2HMIC 4XCCL 4JRXE 4EIGB 1S7TB 3RVXD 2E7BA 5I1KL 1IAIM 3CVHL 1EO7A 5KOVC 4UIMA 4XVJL 1FQ9C 3B4NA 3V6ZB 1P7KB 4M7LT 4MQTB 4ZSOB 1GPOL 4M4PA 4HX1A 1EEYA 4NKDA 3WCYA 2FJGB 1RU9H 4XP4H 5CP3H 5EU6A 5HI4D 5JW4R 2J8UF 2BNUA 2DYPA 1MCDA 2A0LC 3FT3A 3HZMB 5EA0L 2VIRB 4X6FB 4QHUA 4OKVA 2G9HA 2PR4H 1UA6L 1HHKB 3CU1A 4MJ6B 2IH1A 4NBYB 1BFVL 2XTJC 3QO0B 4XPHH 1Q9LB 2I60H 5FF6A 4GW4A 2VMFA 1Y6MR 2PO6A 4TVPE 3KG5A 5C07E 1FZOB 1E4XH 1XGUA 4AENA 1T5XA 1QACA 3OKMA 1QOKA 4G6AC 4QRPD 2EYTB 4HV8A 5B39G 1XR9B 1U8HB 1O7VA 3X17A 1X6NA 2Y9RT 3LEYH 4JCMA 1G7QA 3WL9B 2CPCA 5C7XL 3ELAT 3DX7A 3A67L 4XPAH 3AC0A 5FO9A 1N6VA 4U3XA 2EDRA 2Y1VA 1U93B 3LQAH 4NQSA 3KJ6L 4F7TA 1XF4B 5IQ7H 1QFWL 4K9EH 1NSNL 2R69L 3GSRA 1B88A 2V2WB 3MRKB 1TFHA 4P9HH 2NR6C 3WD5H 3T3PE 2UWEE 4HWUA 3QIUB 2Z8SA 1WVZA 1P2CB 3BESR 4K3JH 2VO5A 1DQLL 2B5IB 4HH9A 5CEZL 2Z0BA 3QI9D 1CFVL 5JXEC 2EDNA 3BMVA 3RWJB 1CXLA 3MRRA 5D7JD 2ZUYA 2HT3C 1E4XI 3WFHA 2R9HC 2HTLC 3RWEB 4TN9A 1U8MB 4LLMA 5IWLA 1N5YL 1WCBB 4QWWC 3HI6L 3KLDA 1FFNB 3QDJE 4TNVK 5B4MD 3KYOB 1T0NA 2EXWC 5J6GB 3C9NA 3QWQB 3FRPG 3U6RA 1JUFB 5BVPH 3HZYB 5JPNB 3O3DA 4E0RA 4JM4L 2WMPA 3EOYG 1ZT7B 2C3VB 5FHAH 2APWA 2YA1A 4NYLB 4XAKD 2GCYB 1U36A 2X4SB 3IJSB 3OKNA 4IRJC 2NX5B 5F1SA 1MAKA 2XWJA 4HG4J 4UTBH 2X1WL 4YUEH 3ZKQD 2W0KA 3U2SB 4GRWB 1XCQB 5FYLL 5SX4H 3VFWB 1YEHH 5BMFH 2C1OA 1VA9A 4OT1L 5EPMA 3H9SA 3GBML 2ZP0T 1ES0B 1QSEA 3RWFB 2P47B 4E41E 1X5XA 1KB9J 3GEWB 1PYWB 4G3YL 1EAPB 5HY9A 4F7PA 3MRCB 4PJEE 1F02I 2J8HA 5KVGH 2IAMC 5IVOA 4K23H 5KSUA 1GIGH 5GS0C 3MV9E 3NFSL 4BQ6A 1JN6B 3HE6B 2NY5C 5FGSA 1NFDB 4OI7A 1TCRA 3W0WB 2X4PB 3NPZB 4JPIB 3AS1A 4O2CA 3AM8A 2FO1A 1VKXB 1VGEH 3U4BH 1PZ5A 4KJWD 3M8OH 4X8XA 3MLYL 4DN3H 1MWAH 2DDQH 2JCCB 3MBED 5E8PA 1I1AA 5LG1A 4HIIB 3IDJA 4L3EE 4PRAA 1ZLSH 1KIRA 2X40A 5SX4I 1IEAA 5AWNL 4EN3A 1TETL 4TUJA 5T3ZD 5FECA 1W0VA 2ADJA 4LKXB 3GMLB 3OR7A 4PJXB 4AEFA 1UH4A 5LQBL 2W1NA 2XA8L 3SJVB 1LDSA 1OM3L 3NH7L 3BT2H 2R8SH 1B9ZA 3W82A 1Z6JT 1IJ9A 4F7EB 4YHNA 1JGUH 3EYFB 2D7MA 5IMLA 5IMKA 1PSKH 1S3KH 3SOBH 1MAMH 1HSBB 2VZOA 3BZ4A 4L8DA 5D7LA 5D7SL 1WF5A 1R3LB 1MFEH 4H1LA 2AXGB 1T1XB 3VXUB 4L3CA 5ACMA 5IKCA 1J1OH 5D7IB 3P3YA 3EZ8A 1XF5B 1UB6A 5D96C 1LO5B 1WAAF 4MD4A 2JIXA 2UV3A 1ZANH 3QFDA 2OI9C 4HGKC 5CGMA 1OSZB 3QXWA 1OGAE 3MV7B 4OTXL 4YBHA 4M02A 3KWWA 2O5ZH 5F93C 1NGXA 4DZ8B 2GEEA 3V0VB 3MRQB 5T33L 1AO7D 5GHWL 2DJSA 1LEGA 3GZKA 1AGDA 1FIEA 2R4RL 2VH5L 4XGZA 5J9PB 3TIEA 1NBZB 1AJ7H 1J5OL 3UZQA 4WUUA 4PLJD 4RMWA 4LLYA 3QP3A 3QZWA 1MJUH 2X4RA 4KVCH 2YWZA 5DHVH 5EBMB 4NO5A 4QYOA 3G6JA 1BEYH 4X7TB 4WWKA 2XA3A 4A2LA 1B6UA 5I76B 4O2FB 1NGQH 1G6RH 4BQCA 4HIJA 4HBCH 3ARRA 1P1ZA 3MNWA 1YECL 4LKCA 3DNKA 3K2UH 2BXZA 1HHGB 4PGDB 5EC2A 3HZKB 5D72H 3F6IA 4JFDA 1T2QH 2ADFL 4ZFZA 2AK4A 3C6LA 4PRDA 4NGHL 1JTPA 4OQTA 3VD4A 2NY0C 3QDGE 2E7HA 1GCFA 3TJHD 2AAVA 3O6FC 4N8VA 1D5IL 4PS4L 3KDMB 1B6DA 3IKCB 3U7WL 1T1YB 2VLRE 1T89C 4OQTL 4KPHH 3MRHB 5FKAB 1ORSA 3GJEA 4M1GH 1JRHH 5E56A 2DAVA 3CX5J 4IIQB 4FQLL 5EH1A 3GJFB 5EUKA 3B2UD 3HE6D 5H94B 4X4ZA 3W0WD 3EYOB 2PYFA 2VZTA 2YHGA 5I1LB 1EVTC 1OL0A 3K1KC 1K3IA 4N0CD 5I1KH 4AIZA 2BERA 4FXLA 4PLKC 3IDGB 4MNQB 4XVJH 4XXDA 3AREB 3CXHJ 2CLVA 1F58L 3PQYA 1AY1L 2QR0B 4LSQH 1GPOH 2ZPKH 5DI8B 4JZNA 4WFED 1K9TA 3T4AA 3WUWA 2DQUH 2FCBA 4PJHF 4U2ZA 2GJZA 4J1UA 3T3MF 3NAAL 5IT2L 3CVIL 5EA0H 1T7VA 3DGGA 1ZA6A 3T0BA 5HXMA 1UA6H 5FYKH 4UDTA 2P24B 3LEXB 5T5FL 2OXGA 4FRWA 1YEKH 3RTQB 3UTTB 2LFGA 4GMTL 5IBUB 1K6QH 4HGWB 5SV4A 1K4CA 1N0XH 2YPLB 2YWYA 1VB9A 3VXPA 3E8UL 4N5UA 5TQ2L 2EIZA 2J6EL 1IM9D 5EIVA 3WN5B 4ZS7L 4U1MB 2EDHA 3INUL 3IF1B 1BLNB 3DO7A 4Z77A 4QHMA 4H0IA 3VFTA 2F54E 3FHQA 2CRZA 4EQ2A 5CIPB 5C6WH 3ILQD 2MNUA 4MA7H 4M48L 3A67H 3VXUD 5D4QA 5E2TL 4NQTA 1RI8A 4UDUB 1T66C 4NKIH 4NQCE 3KJ6H 3F5WB 4YWGH 2R69H 3FQUB 4GRLB 5E8NA 2YRLA 4JZJA 2FJFA 4OZ4B 3ARZA 5D5MB 2ICWA 4DCQA 5LXGH 4XH2B 1OTTD 3S5LB 4Y5VB 4M7LL 3WNMA 1LGVA 1QSFA 4JG1H 3BMWA 2E7CA 1BREA 1OAUH 1PG7W 4X6CB 3KPQB 3V52H 2GSGA 2H6PB 3MCLH 1TNNA 4NQVB 1KLUA 3IXTA 4OZHE 3LN5B 4P4RB 4FFYL 1GGCL 1SJHA 4NO2B 1KIQB 4PRNA 2DLFL 4Z7UF 2X4UA 3OG4B 3BVNB 4XMLH 4KRLB 1YY8A 2J12B 4JFYB 1DBBH 2GJJA 3PWNB 1UM5L 1WT5A 1ND0B 4JM4H 1PY9A 2IAMA 5JZ7D 2N7BA 3WS3A 4TVPH 1U8QB 1RJZA 4MVBC 4X4XA 1MLCA 4W4NA 4JKMA 3UMTA 4X83A 4RMRA 5T5NF 4LEOA 2RCSH 3KPRE 2NY5L 1M7DA 3FQWA 3L5WA 3UTQB 1B3JA 4KHXH 2DQDL 5JR1H 5CHNA 2FYYB 1AD0B 3ARBC 4YEEA 3GMOB 4XWOC 3ZO0A 1ZEAH 4MNHA 3ZL4L 3PHSA 5B38A 4X7FC 5CMAA 2Q86B 4C56B 3SGKA 2VDKL 2HTKC 2KZWA 2YOCA 1SBBA 2AS5M 3MJ7B 2ZUXA 1BZQK 4Z7NE 5E2UL 5SWZB 1PKQE 4MNQD 3MLYH 1MLBB 2IBGA 4PGCA 1DBKL 5FM4A 3SDCA 3KPTA 4XBEL 2XYCA 3V8CA 4G7YL 3KPOB 4F2MB 3DGCR 4DKDC 4PG2C 3QEUA 4OCWL 4PJIF 2A73B 5E24E 1ZE3C 3MRDB 3QA3A 2X4TB 2H2SC 2RBLA 1PY4A 5JW5A 3V5DB 1FAKT 3JWOC 1J87A 2QL1A 3JWDC 1TETH 3SDXB 1KN4L 1KEGL 1FNHA 5BW7A 1U58A 4Q6YA 4RZCB 2R29L 4M5YH 3BEVB 4R90H 5C8JB 5LQBH 5KS9B 1XT5A 2VDLL 4Z7WF 2YD3A 3EDEA 4LSDA 5TDNB 3NH7H 1ZLUH 5D71L 5KANG 2ATKA 2PTVA 5ESAB 1BQHB 2F8VA 5FV2A 5E9DE 5FUCE 3VFSB 1T7YA 1EEUA 2HJFB 1KJ2B 2BSRB 4L5FL 5GGVH 1GOHA 1OQXA 1H3WM 3HFMH 3OB8A 3EO0B 4L4TA 3BD5A 4MB4A 3VDBA 2X4QA 2Q3AA 2XQYK 4YDVA 4TRPH 2H41A 2Q1EA 1F13A 2HLAA 4F57H 4YHKL 5DTFB 1A1NB 4NKOB 1T3FB 5C0DA 5T5NG 1MF2L 3TNNB 3WFDL 5F7UA 2PW1A 2QQNH 3HE7C 3KPSA 5DQDL 4WU5A 4JRYA 5JIPA 4X5XB 1A6ZB 3G9VA 1L7IH 3VXRD 4K2UL 1U0QA 4AM0A 4ZD3L 1T22A 4LQFL 2BOCB 3UDWA 3LRSB 3MA7A 4LLVB 5F1IB 2P5ED 2CIKB 5DC9B 2I07B 1CGVA 1LDPL 1TQBB 3KPLA 1J5OH 5BZDB 3HPJA 1IC5H 1KB5A 4KMTL 4KHTH 4M7JL 4E42B 3B9KB 5KSVB 1FNGB 3DX8A 3QPXL 5I66B 1G7IB 3O6ML 4Z7VB 3MC0A 1JHKL 3EO1B 1RZ8A 2IALA 1UZ8A 3SCMA 3SGEH 4OZGA 4BFIA 1KYOK 2BY0A 4JQIL 5F3BB 5AZEL 3L3HB 1GXEA 5FK9A 3MRIB 1PLGL 5DJ2A 1DVFD 1DCLA 5ENWA 2VLKB 1ETZB 2ZUVA 2VSCA 1Q72L 3BP4A 4YHOL 5BZWB 1NCTA 2CSPA 2UZYB 1RZJH 3T1FB 2NY1C 4NWUL 4W70A 4PJFA 3WFEL 4LBEA 4FXGB 1IGML 2CRIA 4RX4A 5ILTL 4H0GA 2EDTA 1S5HB 4PGBA 1D5IH 1RVFL 1RJYB 1BD2D 2OX5A 4KAQH 5CJOH 3ORJA 1KPRB 1A0QH 1AXIB 4HGMA 3ZKNC 1FE8L 1EAJA 3OXSB 1FN4B 2WUBL 4HUXB 4LLQA 5BV7H 4FQLH 1PQZA 4OIIL 1JWMA 4NPYB 3SGEI 1BVKA 1MIML 4NC2B 5E03A 4DGYH 2NY3C 4ONOA 1E27A 1FV1A 4D9RE 1I9EA 1TVBB 1C8PA 1IGJB 3MCG1 2LTQC 3CMOH 3R06B 3S4SB 1AY1H 1A7BA 4LLAA 3L3IA 5JOFA 2XKNA 4IJ3C 4WW2C 1NBYB 2W0LA 4I3RL 1ZHBA 3S9DB 5B8CB 4LCWB 2WBKA 3OSKA 4JKPL 5F9WC 5GISH 5IT2H 1HOCA 3CVIH 4BK5A 1NDGB 2MCPH 4LCUB 3VMOA 3SQOH 4LAQH 2R0WL 4FABL 4PRIB 1T04B 2R2BB 2R1WA 5KANI 3B2VL 1AHWB 4OZIE 4GMTH 1P53A 2EDLA 4P2QD 2FHFA 3BPNC 3LB6C 4WO4B 5F9JB 3IS1X 2VXSH 4UBDD 4J3TA 5FO8B 4MJ2A 1R0AL 5FM8A 5TQ2H 3F7YB 3F58L 1ZT1B 4Z7NF 4PJ7E 1NC4A 5ID1B 5JTWA 3D87B 3INUH 2EDFA 4MS8D 3KGRA 3CLFH 2K1MA 5JOPE 4IBLT 1QQDA 1VESA 5EU5B 3KPPA 3PHOA 4WI6A 3EYVB 3U82B 3CDGB 4G8IA 2NY7L 2D9CA 4XNQB 5DEZA 3WNKA 1M1SA 1ORQA 5C08E 4OCSL 4N0UB 1FDLH 3CDYA 1N59A 4OZGF 3GB7A 4NQDB 1FVEB 1MCOL 2OSLA 1D9KD 2V5RA 1MFCL 2D0GA 2EE9A 4JKLA 4LHQB 5KSBB 4MA1B 1UH3A 3WSQL 1NGWA 4ONGH 4EDWH 2EICA 2C26A 2MSPA 2OQJB 5T3XH 5BVJA 3LEVL 2GJ6D 4EDXA 1J9CT 5BCAA 1XIWC 5CEYB 3CZFB 3CH1B 3LHPL 4Y1AD 3B9KD 3WIHA 4R97C 1XEDA 5IIEB 4R26L 3PP3H 3PV6B 2DLFH 3O6LH 4PJFF 4JFFA 3NIGF 3IDYB 1J05B 1WWBX 3WIHL 4ZFFB 3Q5OA 4JN1L 2H3NA 2ZNWA 1AQDA 1KT2A 1N5AB 1A14L 3O81A 3BO8B 1FRGH 2VXTL 3TV3L 4NZDA 1MHCB 3BIAX 4HWZA 4NKMA 2LU3A 2A6IA 3WHXA 4RDQF 1HCVA 3F62A 3TO2B 1LVEA 4QCIB 4ZTPL 3DOSA 5I1HL 2FIRT 3LV3A 3TH2T 3TESA 4H5SA 3LKQA 2IC2A 5GS0H 2DF3A 3TBSB 2CK0L 2NY5H 1KIPA 3DIFA 1OF2B 2DQDH 5DQJB 2UZIH 3IGAB 3MOBH 4GUPA 4YXKL 5E2VL 4XPBL 4ZO6A 5EOTA 3S37X 2JJTA 1A4JB 1FFOA 3ZL4H 4OFPA 3TA3C 3S8WA 1N0LA 4G8GD 3I9GH 1F00I 1RUQL 1FYTE 3RKDD 3TZVA 1EFXB 5DMGD 1RJLB 2VDKH 4KTEL 4MDIA 3CH8A 4D9LL 1ZMYA 5C0RL 3JWOL 1ZHKA 4J4PC 5BOZG 3JWDL 1PAMA 3ZSTA 1RZKH 5IF0B 4HWBA 2NY2B 4JPKH 4YHYC 1Q38A 3STZA 1C5BL 1FORL 4LCWD 5D1ZC 4P23B 4GKSA 3NFNA 4HWBL 2VXQH 4GBXD 3NABL 1F8TH 1MAJA 5I74C 5ADPL 5ANMA 2GSIA 1DQDL 4GT7A 1OY3B 4FFVC 1RUPL 1UEMA 2A6KB 4PRID 1YJDH 5AD0A 5C0AB 4U1GC 4I18B 3VXSA 3GIZL 4Z76B 4Z6AT 2DKSA 3QEQA 1W72B 3Q48A 1K8DB 1ZAGA 1FC2D 4NUGH 4LHJB 3U36B 4BK4A 4I3SH 5LCVH 5IW6A 4OCLC 5HGHA 2R0LH 1E4WH 1PKOA 5E1AB 5HI3D 5BRZE 5JIHA 1O0VA 1MRDL 3WEXB 3D39A 4WDIA 1WC7A 4MA3B 4RDQG 1H0DB 2A38A 4NJAH 1JGEA 4Y16A 1SJXA 5DDHA 5IUSA 4E5XB 1MVUA 4PJGF 2PXYA 1DN0B 3FL7A 2ZUWA 1FNFA 1UM6L 4PY7B 1ZSDA 1NPUA 3Q0HA 5FYJL 4HULB 3BP7B 2YZ8A 4YHKH 3WNOA 4PJ9B 4G43A 1RK0B 1Q94A 3Q6GH 5J89A 1KLGA 1YY9D 4FP8H 4NQDD 5SWSE 5BXFB 3G5ZA 5DUMH 4NZJA 5DJZA 4HMCA 3QFJA 3MROB 2CLZB 3LH2L 3HN3A 4HMDA 1UVQA 3GSWB 4K2UH 5DJ6A 2HA1A 1JHTB 3GGWB 2I26N 3QPQD 4LQFH 5DZNA 3E6FA 1XAUA 1EHLL 3ECBA 4JQXA 3OWEA 4WFHD 1SYSA 3AS0A 2BVOA 4LRNL 4OFVA 3FAXA 4CMMB 1QVOB 4M7JH 2NY6B 1G7LB 3LQZB 4NWTL 3ARDC 3RNKA 5HYQB 3EDJA 4POYA 4P4KA 5IG7A 3MRNA 5T1KB 4ISVB 2KH2B 4RMQA 2X1PA 4WHYG 2VL4A 5IB3A 5I15H 5HHNA 4OLUH 3S3JA 2MTPA 1PLGH 1R6VA 3QG6A 2CDFB 4CJ1A 4YHOH 3DTXA 1R3JA 2XZAH 4WHTA 1OGTA 1S7XA 3C8KB 1HH9A 1KELL 2EIBA 4MCZB 4O5LL 5DK2B 5IFAH 2VL5B 3DXAD 1C7TA 3O9WB 1J11A 1AD9A 3SE8L 2XFXA 1FG2B 3BWUC 1OW0A 3VGDA 5BJTB 4JQVA 2ZCHH 2CDGB 3VFPB 4JN2A 1RURL 4OGYL 3UYRH 4Z0BL 4EXKA 4YDLB 2CDEA 3OJ2C 4PJDE 5CGYC 3IDXL 1U3HB 3LZFL 3FRUB 5DO2C 1I9RL 3T0EA 5T1MA 5TQ0H 2IG2L 1S7WA 1EFXD 1BM3L 3GO1L 1MFBL 3BOVA 4OIIH 4HIXL 1MIMH 3HNTL 3U9UB 3V0AC 3GIVB 3TYFA 4YHIA 2AJXL 4HIHB 1XFPA 4HF5H 4PRHA 4MXQD 1MRCH 5GZND 3UO1L 3EYQC 4Z0XB 5MEOA 3GM8A 2OP4H 4U1NA 4G6KH 2NY2D 4I3RH 2LU7A 1OOAA 4M4RA 4PJBE 5D2LA 2XY2A 4UI2A 2HJKB 4J6RH 1KTLA 3OKDA 3RVUD 3PABB 1A9BA 3RVVC 5I8EB 43C9A 1KCRL 2ITCB 3DURB 1VEPA 2R0WH 3QIUC 3L9RB 4WW1A 3S35X 3BHBA 5L0QB 2B5IC 4QXTB 1T6VN 2FLRT 5DVMA 4WHYH 3F7VA 1INDL 3I6KA 5JW3H 5LBSH 1R0AH 3F58H 3O3AB 3UZVB 2FGZA 3D85A 5E5UB 4U6TA 2VDRL 4PLJC 1M05A 1IGCL 4X6DE 1A5FH 4JANA 4Y4HA 2FIKB 4I0KA 4FQCH 4QRPE 2GAZA 3OKKA 3CSYB 3BZEA 5HGDB 1FP5A 2FD6L 4GG6A 2VLMD 2J3SA 4IHOB 1CT8A 1WZKA 1JPSH 3HC0A 2BCKA 3RGVD 2P46B 1QA9A 1U41A 3ULUD 4WHDA 4CU7A 1NEZG 4PJ9D 5DUPL 3DYOA 4LCYB 3NCEB 4RNRB 1RIVL 3R4DA 5CSGA 4ZUSB 2B1AL 3P4LA 3N85H 5IW1B 1MFCH 2JJUA 3C2AL 4FQHA 3U30C 1MSPA 1JZ8A 4H0HB 3ZDXE 1YEDA 3FO0H 3TH4T 4X4YA 4M9OA 3JV5A 3VJ6B 3O45B 2OTWA 1QR4A 3LHPH 4DOHE 2F53A 3OAZH 3K1DA 3SN6N 5CD3A 3C60D 3L3JA 3I02A 2C3HA 4PRBA 1DSFL 4U1SA 4JFEA 4NQXB 5KVFL 3MLUL 4KK6C 2CRYA 3HE6C 5IVXB 4FQXD 4WW2F 3SEPA 5I1EH 3RWGB 1BX2B 4ELKB 2VXTH 4IRSB 4N0CC 3TA3A 4JR9L 4JY4B 3FAWA 2IADB 5JPMB 4ZUWB 2D31B 1OAZH 1QBLH 4UT9L 4ZTPH 1CDIA 3TPUB 1LK3L 4XAKE 5I1HH 1Q9KA 3L3GB 3D2UA 5GRUL 3P4MB 4ODWB 4MSWB 3RDTB 2WM0A 2X7LA 1F6FB 1KLFA 4QHKJ 2YUVA 3RX7A 4UV7H 4LNRB 5HDBE 5IVNA 5F44A 3KPMA 3VFRB 1R3KB 4KY1L 4N0YL 4YXKH 4LGRB 4ORZC 4XXCA 1FFPA 5F7EL 4EOWL 4QRTA 4LP5A 1CICD 3QIWB 1U3HD 3BKJH 1RZIB 2HWZL 3DVNA 1UJ3C 2VLJA 4Q9BA 3ARPA 3BH8B 3U48A 4QRQB 2ZSWB 1A6PA 3X3FL 4KC3B 1S8DB 1WISA 3LN4A 5E8EA 3FOLA 4D9QD 1T1WA 5EZLB 1PGRB 5GRJL 2JKXA 2R2CA 2JELL 3X12B 3VH8B 3OZ9L 3SHSA 3BP5A 4PJCF 4LPYA 1T1ZA 2J88H 3FFDA 4U6HA 4CDHA 1QBBA 4U1LB 3BXNB 4GXVH 1S9KC 2QSQA 2GFBA 3QDAA 3DVFA 5IMMB 1ONQB 3HNVH 3QCTL 2XN9A 3ESVF 2NMSA 1KTDB 4OLYH 5EN2B 3P0YL 3F65A 1CE6B 1S7SA 5CEXB 1RUPH 3G6AA 1T7WA 3F7QA 3Q5TA 4WENB 5T3ZE 1RHFA 3VA2C 1UKTA 5KVMC 4ZNEE 3ME0A 1YMMB 3GIZH 2AQ2A 3PWPD 1UZ6F 1CR9H 3SKMB 1BJ1J 4HBQA 4HS8H 2HVJA 4U1HA 4KV5F 1FAIL 2VZSA 3IB4A 5EIQA 1IKNA 4U1JA 5DWUH 2VZVA 3RWCA 3ZE1F 4D0CB 3SGJA 2ORBL 1FZMB 1YEJL 2HG5B 3K74B 1IRAY 2Y25A 4M1CD 4PJBF 3TIDB 1DBMH 1NKRA 2LE9A 2ESVB 1XGRA 1G7PB 2E6JA 2KL6A 1CCZA 2BNQD 4MQXC 5C07A 4OGXL 1TMCB 4I0PC 1HHIA 1H8NA 4KK5C 1Q0YL 2JJWA 2H2PD 4GMSH 2AV7A 2DQJH 2EIDA 1MFAL 3QIBA 3O4OB 3QISA 2FZ3A 1BZ9B 1JPGB 1XH3A 4P46C 1A21A 3HS0B 4LASH 1R5VB 3V9FA 1EHLH 3R1GL 4MD5B 1SMOA 4X6DF 2E9JA 4KDVA 1AO7E 2NLJB 2ADIA 5DC0A 3EYUL 4HH8A 1G0XA 3BQUD 4ZPVB 5E2WL 3JTTA 3HPLB 4IIQC 4JM2B 4OF5A 3ZT6A 1T2XA 3FKUS 2Q6WB 2UWEA 3IVKA 3GMQA 1R5IB 2IPKA 3V2AR 5IB1B 2X2YA 2WWKO 4XC3L 2DOCA 5D8JH 5IOPB 4IRSD 1GHFL 3WJJC 3C08L 3JV4A 3AREC 3FMGL 2MPAL 5EZJB 2JTDA 4L4VD 4G7VH 1KELH 3BJ91 4PJAB 1HIML 4O5LH 3UTZA 5DURB 1A7PL 5FB8B 4ODHL 4WTWA 3SKOB 3MOQA 2YKLL 1TQCB 3GSUB 4OJFH 1J0ZA 1TTFA 3O2WH 4X7SH 3SE8H 4JJ5A 4ELMB 4G6FB 5DJ0B 1MHEA 3TWCL 1GH7A 5KN5B 1L0QA 1RURH 1X7QA 3H0TB 5JDSA 2ICEB 5EBWB 4Z0BH 3RTQC 5F1NB 5H37H 1I9RH 2WBJA 1BM3H 1MFBH 1I3GL 2BRQA 5ESVA 4HKJA 5ABDE 4JFHD 4NDMA 4HIXH 3IDIA 3WN5C 3L1OL 5FOJA 3HNTH 1FIGH 3T0VA 3QIUA 3PNWA 3ILPB 4X9BA 3TO4B 3MYZA 4FG6D 3GSVB 3OGCA 4ZAKB 3W0WE