3DUHA

Structure of interleukin-23
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
307
structure length
300
Chain Sequence
EIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAEEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/cytokine
molecule keywords Interleukin-12 subunit beta
publication title The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 300
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA03
2ICWB 5I1KL 3DYOA 5EBMB 5DMIH 3BKJH 4YGAB 4R3SA 3ROLB 2B4CH 5H8DA 4AH2B 4XNZC 4HUUA 1MCHA 5KSAC 4OZIB 4F37K 3E6FB 5LGHL 5CEZE 3H7BB 1JYVA 4K2UL 3O2VL 1KXVC 4Z7VB 4ZUVA 3A6CL 3MYJB 2YZ8A 1NC4A 4M7LH 5D71H 2EDBA 1JFQH 3SKOB 4MD5A 1B4JL 3QIUD 1GZQB 3IDXH 5MERA 4HLZH 3UJJH 2EXYD 1A9EB 1I1RA 2F5BH 4LFHG 5DJZB 3SDYL 4CDGC 2GK0A 3K74B 3X13A 4NRYA 5T3ZD 1FNHA 4P99A 5K9JH 1OTUD 2X5PA 2VZVA 5SWZE 3MJ7A 1I4FB 4FG6C 1TQCC 2QKIA 2MKWA 3NZ8B 5A40E 4JR9L 3EHBC 4X8JA 1A6WH 2HRPH 3VWKA 4BFEA 3RVWD 5AG8A 4LAQH 2FX8H 4ZPTA 1BWMA 5BRZE 1IKNA 2G5BA 3BFOA 4APQA 1CICD 4HK3N 3MYZA 3IDIA 1T2JA 5JR1H 5EBLB 3WEXB 3FFCB 4JFZH 4KQ4H 1PBYA 2ZWLT 4UOW0 1QLEL 4DCQB 1T4KA 5IQ9A 1IGIH 2EDNA 2XACC 1LP9B 3MLXH 3AXLB 1MJJB 3QIBC 2EYTA 4JY6A 4F15B 1P7QB 4U6YB 5DHXB 4LSTH 5IW6B 3U46B 3D87B 3MOBH 5E95B 5HGAA 3TO2A 2QHRL 1CE6B 1INQB 2K9UA 4JO2H 5IMKB 2CRYA 2UWEB 5CGTA 1JNNH 2FNBA 4X7SH 3VGEA 5KVDH 3QUZA 1C12A 4H1LA 2NNAB 3ARSA 1JPSH 1NCAL 1ORQA 1QSED 2AV1B 3S37H 3VI4F 5FCUH 3CMGA 4OF3A 4K23H 3SQOH 4EZMA 2HVJA 4WW1B 3RPIB 3SHSA 2WUCL 3EDKA 4Z8FH 1U95B 5GRUH 5IMMA 5C07A 4XI5C 3IKCB 4XP6H 5FYLH 4BH7B 4EI6B 3SQBA 3T4AB 3HG1B 2ZOKB 4OQ1A 4Z9KB 2VL5A 5J06A 2ORBL 3IFPB 2ZZUT 4PRNA 2Q7YB 2O5YH 4L8SC 3W5NA 1N0XH 4YHPB 1F11A 9CGTA 3PP3H 2H2SD 3RGHA 2XICA 3QEGH 3MBED 4UT6H 4NRZA 5TE6H 5L2KD 1OGAB 4MQ7A 3L3OB 4P2CG 4S1RH 5AWNL 3QUXC 4H1LG 2J6EL 4IRJC 1CFNA 3QH3A 3QFJB 4GMTL 3BPOB 2FWOB 4N90D 5HHQB 2R2HB 2YD4A 5I76A 1AGBA 1LD9B 4NNXB 4HKJB 4PJ7E 2EC9T 1NSNL 1KIQB 2YWYA 4B7LA 5KW9H 2H9GB 3OAZK 3REWB 4NWUL 3D85D 5CGYC 6FABL 1FNEA 3BPCA 5I2IA 3OGOE 5D7LB 1IFHL 1UB6B 1RUKH 4YH6A 3CK0L 4R2GC 2HT2D 1T0NB 1K5NA 2XKSA 5F89A 5IB2B 2ZUQC 5C0CE 4NZDA 3GSQB 5ADPL 1M1SA 5IMLA 1VFBB 4A2LA 2UUDH 1XGYL 1DR9A 1SBBA 2CLZA 4MX7B 4XP5L 3SOBH 1SJXA 5EWIH 1A14L 1HWHB 1MCCA 1D5ZA 1VGEL 5DHYA 4GSDH 1F4WH 4JPVL 2ARWA 5FOBA 1MHHB 1XGUB 3RBSA 1RZ8B 1J8HD 3Q6FA 1MHCB 4GS7C 5KOVC 5LAXA 2XTJC 4UUJA 4HLZG 4HEPG 3RI5K 4EXPX 1BEYL 3CLEL 3R1GL 5CBEA 2LVEA 5DD1H 1OP5K 2Y06L 1HHKA 4JFPA 3P11L 3QDGB 1IEBB 4R7DA 2DWEB 1Q9KA 5J6HA 5KS9B 3TYFB 5IHZB 1OT1A 2XXMB 4DTGH 3O4LB 2VQUA 1UQSB 1UYWH 1HXYB 2C5DC 2OLDA 4GUPA 1K8DB 4JY5L 5CJQH 2L0DA 35C8L 4PRHD 3H9HA 3G6JB 2VLRA 1W2KT 3BQUD 2NX5B 3IRZA 1WAAF 4ZYKB 3PL6A 3SCMD 4AEHH 4PJBA 3HMWL 3L3KB 3GI9L 4PY7B 4WTZA 2PTVA 1DBMH 1T0MB 1TCRB 5C0DA 1KCLA 3STLB 3HFMH 2DIBA 3IDYB 3QB7C 1RJLB 4GXVL 2MQ0A 1SYSA 2EKJA 1JIBA 3GNML 4IBLT 2IANE 3NCEB 2F54E 5I17A 1I9IL 5HHNA 1MJ7L 3MFFB 1NLDL 1AHWA 4M6MH 4RAUB 2HT3D 4HQQH 3WO4C 1D9KC 1NC2D 3QIUA 3GSXA 3RWDA 3VFMA 1CS6A 4QNPF 1JZ3A 4JHWL 3I2CH 3BVNA 4HWZA 4X0KA 3B2VL 4DN3L 4XH2A 4N0YL 4M3JA 4LK4A 2E9BA 1PG7L 3MRJA 5HHOB 1HDMB 3LDBC 3ARFB 4NZUL 2HFGH 1LO0L 3HNTL 4WTWA 1MFAL 3MC0A 1IGJB 1U8KA 4QXGH 4WTZG 3AB0B 1GPOL 5DO2C 1QFUH 1ZHLB 2VQTA 2MFNA 4XC3L 3DO7A 4P2YA 2G2RB 1EFXD 1RZGA 4UTBL 3VA6A 2NXYC 2Q3AA 3G6AB 1Z5LA 5TE7L 1S3KH 2R56L 1HXMA 4NM8H 5HVHB 4LLVA 1MJ8L 1YMMB 3ORJA 4TRPH 4DKEH 2EC8A 5JUEH 4TSAL 5E6IB 1U8IB 4OSUH 1FORH 3FQTB 4YHOH 5D96C 4ZS6C 1CXHA 3LB6D 4OM1L 5B38A 2YSSB 5ESVB 4KRPC 4UTAH 3RAJH 2JTDA 3MACL 4J6RH 5IEKB 1RUMH 1QSEA 1OWRM 5CP7A 2Y7QB 3MLVL 4AM0B 4XCEA 5DVOA 3TPUA 1I7TA 4OCXL 5CSZA 5TQ0H 1ZANL 1I1AB 4FQ1H 3BKYH 4L4VD 1A3LH 3RWHB 1X5FA 5ESAA 1I7ZA 1OAXH 1OTSC 1IE5A 1QYGL 4AIZA 1ADQL 3UYOD 4PGEA 3B6SA 3R4DA 4G8GD 4OGAC 2NY3C 3GHEH 1TJGH 2D03L 4KTDH 1MVUB 1YEFL 1ZK9A 3ME0A 4LKXB 3BGAA 4PGDA 1I1FB 5GGVY 3GSWA 2XWBB 4M00A 1X9QA 5B38G 1QR1B 1N4XH 1LDSA 1Q1JH 2WNGA 3MBEA 2JIXB 2RFXB 1OCWL 4OKVA 5GGTL 5L2KA 3JV4A 4JGJA 2DLGA 5GJSL 1LK3L 2NTFB 4K7PX 5KVEH 4DKAA 2B8OT 2R0KH 4F7CB 3NIDF 3IJHB 5D7KE 3OAUL 2NY6B 2GJJA 2NY0B 4MSWA 1SYVA 1YDPB 2EDHA 8CGTA 4Y2OA 3DMMA 4LIQL 2N1KA 2DQFB 4XPGL 1R3HA 5DMKB 4EDWL 4PGJA 1QLFB 1ZA3B 4KDTC 2D2OA 4P2OD 2YC1A 2ZKHL 3PGFL 4JRWA 2BNQB 3D9AH 1KLGB 3BH9A 4TVPE 1MEXL 1K2DA 4PJHF 5GRJL 2H8PB 2Y9RT 3GMRB 3DSNA 3M1BA 5ITFA 3Q2CA 3CUPB 2YBRA 3BPLB 3GSVB 2NMSA 2X4TA 4PRBA 2P5WD 4ZDHA 5FDWA 1P4IH 4Y16D 2BVPB 1RULL 3QJHB 5I16B 1S9VB 3EUUA 1KT2B 3BP4B 5CCKL 1G9MC 4GO6B 4GAFB 2DIJA 1FGNL 3TBWB 3UTTD 4HKXB 1S9WB 5GZNC 4XAWH 1AO7D 5JOPE 3LKNB 4H20L 1FCCA 4CMHC 4GKZB 1I8MB 1R0AH 4OLZH 2FJHB 3G08B 2OJEA 2VLKD 3C60B 1I85A 3GSNH 1DUZB 3DV4B 1W8OA 3MLRL 2R0LH 5JO5A 3QDMB 1HKFA 3O3AB 4PRHA 4WI4A 3RJDA 1IM9B 2CKNA 3BQUA 4HHAA 2XN9E 1FZMB 3EZJB 1CFSB 5TE4L 4FP8H 4N8PA 1KELL 4WWID 3DECA 1JV5B 3ZYZA 1JNHB 4H8WC 5T3XD 1HNGA 5DJ6B 4XBPA 5F1SA 4WUUA 4ZUSB 4KJWD 1IMHC 3DHMA 1XZ0A 4N1EA 1QPPA 1JCKA 3K1KC 4YDJB 2FCBA 1EHLL 3DX9B 5MEQB 3L95B 5C7XH 2WSKA 5DMGC 4KRMB 3QA3A 1RUPL 3RVXC 4AENA 5MEOA 2ICES 4P9ML 2Q86A 4ODWB 1X44A 3TIEA 5HPMA 2IBBA 3B2UC 4G8EA 1AD0B 1MREH 1U8MB 2AXGA 3RZWA 3PDOA 2EEAA 3GIVB 1IKNC 3U30B 3RL2B 4APQC 4BQBA 1N7MH 1T7WA 2DQCL 3WBDA 2DLEA 2CGRL 4FQQB 3HZYB 2EKSB 3TBVB 1AI1L 3D3VB 1BWWA 5I1HH 3I9GL 3RY4A 1K6QH 3I02B 1HHHA 4FNLL 3RU8L 1NJ9B 3QT2A 4R6UA 4HUXA 4NQVA 3VW3L 1PLGH 1UB5B 1VGKB 1A6VH 3JWOC 4Q97A 1EIBA 1EFXA 1RZFH 2BERA 3VFUA 3NAAH 3OJVC 5HI5D 4LRNL 2VDLL 4ZSOE 4Q9QL 1U3HD 3E6HB 4JM4H 3Q5TA 4CJ0A 2FATL 5JXED 1A21A 2GCYB 3QUZC 3HNSH 4V2BA 2A6DB 1OSPH 4QTHA 4DOHE 5C0JB 2H2PC 4N8CL 5EIIA 4L5FL 4M93B 3F6IA 5L7XL 2FJFB 2C3HA 4MQXD 3UTSE 1ZVYA 2AS5M 3FQWA 2IEPA 1PZ5B 3OB0K 3U82B 4HWUA 4ONHB 4ORGA 1F02I 4P3CL 2YMXL 3MROA 5DJAA 4EUPB 5L2JB 5D1ZD 5JHDD 5D1QD 2LTQB 4KUCD 4I9WE 4QRQB 1A1OB 4QT5B 3LKPB 4RNRB 1G7IA 1KCRL 2J12B 1SM3H 3D25B 3L9RA 5E0QA 4K7PY 1IM3B 1IC5L 1YEEL 2B4CC 3GSNA 1YPZA 3WXVH 1ZHKB 4JPWL 5HYSG 2V17H 4X4YA 5JQ6L 2V7HB 5JW3L 1ZMYA 3HE7B 2ID5A 3BW9B 3QXAA 1ZGLM 4L4VA 4UNTA 2XOTA 3PHOA 2A1WH 2JCCA 1Q72H 4G8GA 1N6VA 5HTSA 4X7CC 4RX4A 5SWZB 2BSTA 4Z7OF 4HG4J 3W9EB 5J11B 3W82A 4I77L 4IHOA 5GS3A 3MRRB 4R0LB 1A4KA 2BZDA 3CPLB 2I9LA 3OKKB 3LRSA 3UDWA 2YUXA 1E27A 3PHQB 3C5ZB 4U33A 1JMZA 2OTUB 4IIQB 5BRZB 4LEXH 5E9DE 1NMCB 4NO0D 4O9HH 2IALB 2OX5A 3ZLQC 3TT1H 1V3JA 1JWUA 3HRPA 1Q9WB 4G42B 1FL5A 4JN1H 3I6GA 4IM8A 1INEL 4RRPA 1CFBA 2CO6B 4M6OH 1N3NB 5BO1H 4PJFA 3NOIA 3MRIA 1NL0H 1FV1B 5ERWB 4WJ5A 5DFVD 5BJTA 4MJ5B 4PPTA 4KK5D 3WV0A 1HOCB 3L3GA 4NQCD 4PTUB 4FQIH 2Q6WB 4HZLB 4EI5D 4YR6B 5TH2B 1TVBA 4HUMB 4OCSH 2QQKH 2J8UA 1FFOA 4QHLB 2P5WA 1FJ1B 4Y16A 2DQHL 4PJ9D 4XMLH 3SDDB 2R1WB 5EUOF 4R96B 5DD3L 4GAYB 5EBWB 2ADGA 1V3LA 4XHJD 4NQDD 5IB1B 1ZGLP 1A7RH 3EYSH 3DUUA 4HGWA 3KPMB 4LSVH 4RRPG 4FN0A 5I1EH 1AO7A 5KVGL 2A9NL 3PL6C 1F3JB 2OBGA 1JWSB 3QPXH 1RZIA 4GRMB 3S96B 2BCKB 5GS0D 2BVQB 4KKCC 5C2UB 2FBOJ 2FO4A 4P9HH 4MJ6B 3QYCA 4FFVC 1A2YA 4KWUA 3FN3A 2H3NB 1ZV5A 1AJ7H 1AHWC 3KPLA 3OHXB 5EO9B 1CDCA 1BOYA 4XNXH 3QIUC 4PJ7B 5IK3B 4PJXF 4JLRA 1L6XA 2KH2B 2LU4A 1CBVL 1MCSA 3IDUA 3SDAD 3EYOA 1D6VL 1QBBA 2VAAB 2FGWL 2ERJC 3VXRD 3MRMB 3MMEA 1LQSR 1G1YA 3ES6B 5DDHA 4XNYH 1HYRC 2A6IA 3GKWH 1OTUC 4P3DB 1C1EL 3VJ6B 5I73B 2H32H 1MCNA 1DBKH 3NFSH 1MCIA 1ZT1B 3UP1A 5SWSE 5C0CB 4RISL 2OTWB 4BQ8A 1JPTH 2ARJQ 4ZUWA 2D4DA 5CAYB 2F19L 1LK2A 1CQYA 2NW2A 3HKFA 2HWZH 1HH6B 2Z31D 4OCRL 4ONGH 2AJXH 2WP3T 3ARZA 5TFSL 1BAFL 5E4EC 5IB3B 1IQDB 1U3ZA 2BY0A 5F9DC 2E27L 2XPGA 4PJ5E 1M05A 3CZJA 2A83A 3DIFA 5GS1A 4IS6A 4NKDB 3B9AA 3PNWA 3QO1B 3LV3A 4Q7DA 1G7QB 4MWFA 5I1KH 3MNVB 2DM3A 4HWBL 1G7LB 3GSUB 1WITA 4W6YB 4XCYA 4XX1E 4U1JA 3VFTA 3D5OF 1MWAL 4L8BB 5DXWA 1R3KA 3C5JB 4EDXB 5IV2A 3AS2A 4ZOBA 3DXAA 1X5HA 3LN4B 3S97C 3O2VH 1YY8A 4M7LT 3DTXB 4RFOL 1OL0A 3A6CH 3VRLF 4NSKB 5BV7H 1PAMA 2A9ML 2JJSA 4NN5B 2I9TB 3X3FL 3QPQD 3WS6A 3ZE2E 1DQTA 4U2ZA 1WCBB 4G6JH 2D31A 5GS0H 5K59E 2XTJE 4BFGA 4GRLB 5K93A 3LAFA 3MRGB 5C0BD 3CCHB 5D1ZA 5JHDA 4YGVB 1NBQA 5D1QA 5I8EA 3GMLA 5IWLC 2IANB 3O9WA 2F54B 3O3BB 4LHQB 3TBYB 4JR9H 1NGWA 3FO2B 3VFWB 5ACZB 3F7VB 4G7YL 3CSBA 2L7JA 2O5ZL 2WUBL 1XF3A 3MRQA 5SX4I 3MBEC 4Z7UF 5ALCH 4N9GA 2X9XA 4LPYA 3C5SA 4JFEE 4OD3L 3P73B 4OF8A 4TULL 3WIIH 2EDKA 3I6KA 1G6RB 4EOWL 3VXQA 3ZKMD 4WWKD 4X4XA 3QI9D 5E2VH 4W4NA 2EO1A 2XV6B 1F8TL 1NDGB 3DMMC 4GKNA 5T1MA 1F2XK 2OXHA 2OL3H 5IKCA 5JOFA 2Q76A 3EYFA 4TNVK 1KJVA 2V5MA 1FG9C 4HIXH 3W9DB 2HT2C 4ORZC 3PV6A 1JPST 5DHVH 1D5MA 4NO0A 4YWGL 5JLZA 5FO7B 1BZ9A 5JORA 2FRGP 3JWNC 2FIKB 4FABL 3FO9B 3QJFA 3QEQD 1WZLA 1NCBL 5EUKA 5EZLA 3U6RA 1I1CA 3EO9L 4ZNEA 4R90L 5D1XB 2WUCH 5EU5A 5F9JA 3HZKB 1IL1A 3WFHA 4MCZA 1T03L 4JZOA 1UM6H 4ZUUA 4L8DA 4NQCA 5DUBB 4EI5A 4PD4K 2MHAB 3MLZH 3ZTJG 4XGZA 2CLVA 2DJ4A 3VG9C 1MVFA 4NC2B 3FMGL 2ORBH 1U8QB 1CG9B 1N6UA 3DYMA 3B8YA 1Q9OA 1I85C 3QZWB 5GGRY 4PJ9A 4KJPD 4ERSL 3D1MC 3QQ3B 4OLXH 3TNMB 1BVLA 4YO0A 2VR4A 2W1NA 5BCAA 5AWNH 5HGHB 4NQDA 2V2WA 3TNNB 4GMTH 5FKAB 2IPUG 1JTTA 3BQUC 1X7QB 4U7MA 1T7ZA 1AKJD 3NFPB 1BECA 1H3TA 4GRWE 4D9RE 3C6SB 4D0DA 2CDGB 3NCCB 3BRDA 1YNKH 1AGCB 4NWUH 6FABH 2P8MB 4TTDD 2DYPD 1G0YR 3KAAA 1IFHH 3BJ91 1CDJA 2E9WA 2WWKO 5DRWA 5DI8B 5DRNB 1FG2B 1PQZB 1QLRA 2P24A 5ADPH 1JGLL 3L3JB 3ZKSD 3KYKL 2HT3C 5JHLL 5B8CB 3QRGL 5C6TH 1QTYT 3FQNB 3ESUF 5DD0L 1BREA 1DQLL 3MLWL 4KXZI 4WENB 3SDAA 3ECBA 4LMQI 3UTQB 1NFIA 1CT8B 4LCCA 1ZSDB 3VXRA 2CIKA 4QRRD 4OBSA 2R4RL 3I75B 3BIBX 1IAKA 3ZKND 1XF2B 2FGZA 1MAML 4EN3B 4OZFB 5M94B 4O51A 5I6XB 2GJ6D 1BEYH 1MIML 3CLEH 1TJIL 4FQHB 2VKWA 4CVZA 5AD0B 2OL3A 2C3VA 1IC1A 2Y06H 4OUOA 3P11H 3FTGB 1PKOA 2QSCH 2Z31A 3RBGA 3L1OL 4O5LH 1ZT7B 4P49A 5EBGA 4DFHA 2YD7A 4O2CB 1PDKA 1TNMA 3FN0L 3RNKB 5HI3D 4DKDC 2VDPL 5K9QI 3QNZB 2RIKA 4ZFOL 1X4XA 2FL5B 35C8H 4LNRB 5E00B 4OB5L 3IETA 5D7JB 2HTLD 2PNDA 1MCOL 4Y2DA 3VDCA 5E8EA 3S35L 3VI4E 1OSZA 1LGVA 3MLUL 5H2BB 5ICXB 4BH8B 2Y1VA 2YD5A 3HMXH 5HGGS 1QSZA 5LWYH 2BVOA 2B0SH 1OAKH 5IQ7L 1PZUB 1DBJL 1HK6A 3LB6C 2YRZA 2W07A 2VIRB 1JYXA 1JHLL 4GXVH 4AQOA 5HVWA 4ESKA 3GNMH 2UVFA 3DRTB 4NNYA 2V2TB 1JZ4A 1I9IH 4WU7B 4DZBA 1E4WL 2YA2A 3SKMA 4QRPD 4F8QA 1MCLA 2XN9B 4P5MB 3L7FB 1Q0YH 5TQ2L 1QSFE 2MKLC 3DURA 4RBPH 4N8VB 4OI7A 3FB6A 1GH7A 3ZZ1A 1G7HA 4DN3H 5GGUB 4GH7B 1F4YL 4N0YH 2AJ3A 4XPFL 3QWRD 2X70B 1PG7H 3INUL 1Y6MR 2IPTL 1LO0H 3TBTB 5AYUL 1MFAH 2R69L 7FABH 1FP5A 4MGXA 1B2WL 2ED9A 2NZ9C 1KJ2L 4ZFZA 4Q0XL 1MAKA 4AEIH 2XZQL 3UDWC 4OLEA 5ESQB 3DVIA 2MTPA 1WK0A 3OAYH 2GJZA 2PF6A 4LKCA 1CIDA 2FBJL 2R56H 4L1HA 4DAGL 5L0QB 3EOYG 1FZOB 4MXWL 4WWKA 3QI9A 4ZOEA 1ZA6B 1AFVL 3CXHJ 1EMTL 4XRCB 4PJDA 1DLFL 5I1GH 3FOMB 4DGVL 1Z9SA 1P7HL 2CPCA 2AQ1A 4TUOA 3CH1A 4L3AA 3ZE0F 3KPNB 1NLBL 4ZSOB 1BVZA 4QLRA 2YD3A 5GGRB 2EEDA 3QEQA 3BHBB 4DOHB 2A2QT 1TETL 3GHBH 4MXQD 4AK1A 1QA9A 4W4OA 3P3YA 4LVEA 1NGQH 2ZG3A 3GJEA 1HCVA 4Y5VA 4Y16C 4PJIA 4M3KB 5F7YC 1GZPA 3UTSB 1FO0L 5EG6C 4D0CB 3IVKA 2UVEA 3DI3B 3ARDB 3KYNB 2I07B 5DYOB 1GAFL 3CDCA 4LSRL 1J88A 2BHZA 4U1GC 3MGTA 2DBLL 3T3PF 3THMH 3WE6B 4CVUA 4I0PB 5IIEA 1I8KB 3T8XA 4DGIL 4V2CB 3HMXA 3OG6B 1IGFL 4X80L 2X4RB 4JVUA 5DQJB 2A6KA 4Y4HB 4JG0H 3B3IB 3DX8B 4J3TA 3RWJA 4D9LH 1B90A 3DVNB 1RUQL 1FHGA 5I66B 5BVPL 3P9MA 1O7SA 3V4UL 1XF4B 2X4UA 3FO0H 4B5EA 1AKJA 5C09D 5C07E 3IXTA 4KRLB 3GSOB 1TENA 1B0RB 4XNZB 4CU7A 2VISA 4UIKH 1C7SA 5KSAB 4NQED 3DSFH 3ZT7A 4C58B 1T21A 2ZKHH 4XMKL 3PGFH 1NGPL 1HYSC 2R1XB 4LCUB 4FZEL 3ARPA 4LSQH 1MEXH 4GQ9L 2DQJL 1T1XB 2FH6A 3TJHD 5E9DB 2CSPA 2FZ3B 5KJRL 4FS0A 3S3JA 3X12B 1NMAL 1WZMA 2NYYD 4XNMA 5ALBL 3WHE1 4U2YA 5DZLA 1Q94A 2VXSL 5MENA 3X14A 1RULH 3PABA 3O3UN 2ITCA 4QOKA 1TQCB 5HHVL 5EOQL 2V5RA 1RU9L 1UWEH 4JDTL 4W70A 5CCKH 3JTTB 3V5KB 5GS1C 4L8CA 5DTFA 5F7FA 2GJ6A 3L5HA 4H20H 4DFIA 3CSYA 3I6LD 1HKLL 1KIUA 3OR7B 2E5EA 1DL7L 4X99B 3H2WA 4U7KA 2MNUA 5H94B 4JB9H 3QXWA 2CDFA 2X2YA 1XGQB 3RKPA 2AXFB 4PJDF 5HI5C 1OGAD 3NMEA 3MLRH 4UZGA 3HC0B 5C08D 5K9KA 2BSED 1CLYL 4I8DA 1EEYB 2O26U 4UNVA 4D0BA 1MLCB 5T5FH 5TE4H 4EXKA 2ZUUA 2JJSC 2I24N 3GRWL 2DRUA 3WS6C 4MQXC 1MCJA 1I9RL 1IBGL 1AIFA 5KOMC 4KGJA 2IBGA 3KPOA 5D1ZC 5E94A 5JPMB 5D1QC 1AGEA 4UDTB 4XNQB 1XF5A 3O9WC 4G6KL 3PWVB 4QRPA 4GMSH 3SKJL 3VU2A 4HGKC 5SX4H 5F9WC 2NR6D 1KPVA 4P9HC 1J1PL 2YK1L 3LQZA 2VLRE 3FO1A 2D4FA 4I18A 5C0IB 5HSFA 3QWRA 1BOGA 2DQCH 4PJBE 1U8LA 3NIDE 3HA0A 2PYFB 3I9GH 5L9DH 1GC1H 5EZJA 4FNLH 1YNLL 5H35A 5SWSB 1A7NL 2OZ4H 5EOCJ 3PV7A 4AEEA 4MVBC 3QUXB 3U9PL 4UBDD 4IRJB 5IJVB 4LPCA 2VDLH 5F6HJ 5DLMH 3S4SB 3DVGB 4KMTH 2OR9H 3JUYA 4PJ5B 3CVHL 3VXOB 5J13C 4N8CH 4YPGA 1FIEA 2NX5D 3MREA 3P9WB 3QXTA 5L7XH 5T3ZE 3JV6B 4R2GB 4PB9L 1TJHL 4L4TA 3QG6A 4LBEB 1K8IA 4OIIL 3R8BB 3C8KA 1WT5A 4KK5C 4P3CH 2YMXH 2LAAA 4QHMA 4EI5C 1S7WB 3X3GL 3MJ9A 3ZDZE 5T5NF 5INCA 4QYOB 1MELA 1RPQA 3ROOB 4Z7QE 4J3XA 1YEEH 3BEVA 4DUWA 1XGRB 1NCCL 1J0HA 4CW1A 4JPWH 4PJ9C 5JW3H 3T2OA 3UTZB 3I3EA 4Y4FD 1UENA 5F7DB 4GS7B 1L7TL 1A3RL 1FL6A 2XTJB 5I75C 1J11A 1C7TA 3OKEB 1KEGL 2SEBA 4Z5RA 3V5HB 2VE6A 1WUNT 3ARFD 1QVOB 5BV7C 1Y0LB 4FXKB 3AU1A 2ZJSL 4ONOA 3GMNA 3IDJA 3MO1B 1LEGB 1DEEA 2EH7L 5GS0C 4JFYA 2O61A 4IJ3C 1IAOA 5EU4B 1QSEE 4OZ4A 1ZXQA 4CBPA 1I7RB 5B39B 3UO1L 1KN2L 4X6FA 1AGFA 1MAJA 5C6PB 4UU9A 4XP1L 4YUEL 4JFEB 4CVXA 4KI5F 3QXDA 4QEGA 4G9FD 3Q5YA 1C5DA 4XVUC 5C09A 4DWHA 3MCG1 2Y23A 1V3MA 4M48L 5F1OB 3FCTB 1ZS8A 3UBXB 15C8H 4YAQA 1J7VR 5A16B 2BSSB 3BPNC 3SDAC 4GT7A 2OS7A 1YC7A 4NQEA 4LCCC 1U92B 1QBML 5AUMA 3ULSA 1HSBB 4IRSD 4HH8A 4C83A 1A6PA 4C56D 2BXYA 3WO4B 1D9KB 3ZE1F 2XA8L 2FJGA 5L2KE 3TCLB 2OZ4A 1MFDH 1JHTB 4UQ2A 4QWWD 3OZ9L 2NY7L 4RMSA 2Z31C 1RHHA 4JE4B 3CDGB 3FQXA 4N90E 4PJEA 5GIRB 2DQHH 3S37X 1IAIL 2ICEA 2Y5TA 5HYIA 5DD3H 5IBTL 1BJ1J 3WFBH 3FB8A 3NCFB 4PRAB 3CFKB 4AG4H 4NHCL 4Y2DC 4RMVA 5CD5C 5E8DH 3OG4B 2FECL 2WV3A 3U83A 1CDBA 1HINH 2NXYB 4IOSD 1T1WB 1WBYA 1CCZA 1MCBA 1UXWA 2KL6A 2DDQL 5CHNB 5FYJL 3DX7A 4QF1B 5I1LA 2R15A 5GISH 5FXCH 3HB3D 3KS0J 3WKML 1JWMB 4HGMA 5C08A 4H5SB 4U6XA 1S5HA 4L4JA 1B0GB 5D96B 3DBXB 2KBGA 1VSCA 1ZVSA 3PWPD 1KCUL 3LKQB 3QPQC 4GRWB 1RFDL 2ICWJ 4KRPB 1KLFA 1D6VH 2VDOL 2JJUA 5KSBA 4YFEA 1C1EH 2PTTA 1TTUA 5K9OB 5DZOA 4GBXA 3GMPA 5FHBH 1ETZA 1A7PL 2DTML 2EIEA 4Z7OE 1Q0XL 2VOTA 4HFUH 2XZZA 4NPYA 1MFBH 4PRHE 1KF9B 4OCRH 3BO8A 5TFSH 1BFOA 4DQOL 1BAFH 5KANI 3SPVB 4QKXB 5E2TL 1G84A 2X4SA 2NY3B 2E27H 4WFFD 2X1WL 5FA3A 4PG2A 3U1SL 4NKOB 4U1KB 2N56A 1ZHNB 3ZKMC 3G5XA 4WWKC 1T80A 3QI9C 4WUUE 4NRXB 2XQYG 3CFJA 3KPSA 4R26L 4F2MA 2HJFB 2E3VA 4P2RD 2X9YA 1RVFL 2AERT 1LO4L 4NO3B 1FGVL 1PSKL 3MR9A 4X7TB 1MWAH 1U58B 4NWTH 3U0WH 3QFDB 1WV7T 3QDMD 4FHBD 3ALXA 4L3CA 3Q3GB 5GRYA 2HLAA 4U1LB 4RFOH 1MF2L 1KEML 4P4KD 3SKUD 4W4OC 3RPKA 1FNAA 4YBQC 1TCMA 4Y5VC 5KTEH 4S1DD 3T0BA 1EZVX 5FYKU 25C8L 4Q9RL 4OV5A 1OF2A 2JF1A 5E8NA 3ARGD 2WQRA 1NDMB 3BP6B 5DA4A 4ZXBD 4MAUL 2A73B 5FA4B 3AAZB 5J1SC 3AM8A 2DL2A 2OK0L 3FT2A 3PWJA 2EDQA 3X17A 2J3SA 3VH8G 4QHUB 4Q9CA 4G7YH 1SJHA 1SBSL 4QGYA 1J12A 4M8QB 4NP4L 5KVFL 4KJPC 2WUBH 1R3LB 3SKNA 4Y4FA 1QSFB 1A02N 5CILL 1T22A 3PGCB 4P3WA 3MOAL 4TULH 4CMHB 5ICYA 3D3VD 3U4EA 5ACLA 5C9KA 4R3SB 1N2RA 4S2SA 1F8TH 3WLBA 4H88L 3TP4A 3DGGA 3VFVA 4HUUB 5K9QG 2FHFA 1VFMA 5DD5H 4GAGL 2YN5A 2OM5A 2NW3A 4K7FA 4ZUVB 1EXUA 2YR3A 1NC4B 1HILA 3CSPA 4G9FA 1YPZE 4MD5B 5FO9A 1J1OH 5MERB 1YYMH 2HAZA 5EZOH 1SJVA 3C6LA 4GW4A 2K3TA 2P8PA 4L4VE 1XF1A 3P4NA 2GK0B 2JCCE 2QL1A 4G8GE 3X13B 4NRYB 2EC9U 3HZVA 4JVPA 3MJ7B 3ZKNC 2QKIB 1GOFA 1M71A 2L7UA 4C56A 4X8JB 4KQ3H 1ED3A 3VWKB 1K9TA 1G0XA 5DEFA 4ZD3L 4HIIA 3CH8A 4ZPTB 1SEQL 2JJTA 2G5BB 5CIPH 4APQB 1LNUA 3WSQH 5D5MF 4ERSH 4LARL 4RZCA 4U3HA 3PWLA 4PJAF 5IGXL 4J3UA 1T4KB 3VGGA 5IQ9B 3KLHC 4PJFE 1FZJA 3DV6A 2HTLC 4XTRD 1OAYL 2EYTB 1VACA 3NACH 4JY6B 4X83A 1K4DA 4Z78A 3TO2B 5HGAB 5J1TC 5IW1B 4B0MM 3B9KD 4KI5C 4WY7L 1RIVL 3QUZB 1C12B 4H1LB 4M1CC 1AXTL 1ORQB 3AREC 3MLYL 3P2TA 3HRZA 2J8UE 4HT1L 2P5WE 2HVJB 1JGLH 3U4BH 3KYKH 6CGTA 3CFIC 3PWPA 5IMMB 1DQMH 5C07B 5F6HI 3FQUA 5KN5A 3MLWH 5EOTA 4LVHC 3UTTE 4LP5A 3MV7D 5E2WH 4JPIA 3NGBB 1AO7E 5D2LA 4I18C 5F96L 2VL5B 1MAMH 4WEMB 4MXVF 1V3KA 4PRNB 3UPRA 2VLJD 5C0RL 2P7TA 2OQJA 3KDMA 5HVGB 1F11B 1MIMH 1N5AA 4F7TA 5EZIL 4NRZB 4ALAH 1U8JA 4MQ7B 1CR9L 3MBXL 1CFNB 2A0LD 2VH5L 1OQXA 1NBVL 5F72S 3FN0H 1IAII 3EYUH 5I76B 1AGBB 4NHUA 5T3XE 1IT9H 4KC3B 4OB5H 3LHPL 2HP4A 1F3DJ 3S35H 1FNEB 3BPCB 4JG1L 4P2RA 3HS0A 5I2IB 4PGBA 3MLUH 1G7JA 2FECI 3IDMA 4KTYA 12E8L 5F3BA 1K5NB 2A77H 1GGYA 1DBJH 5F89B 1URLA 3O6KL 4KKLD 2W92A 5JPNA 5CJXA 1WT5C 5IMLB 5ADOL 2CLZB 4HC1L 1LO3L 1H3XA 3RWGA 4P46D 4P4KA 1D5ZB 4MXQC 3IDNB 5CIPA 5DHYB 4EIGB 5FOBB 4ENED 3P9LA 2VMFA 4FXLA 1U8NA 3Q6FB 4HS6A 1NGZA 1LE9A 4AEFA 3V4VH 3MRCB 4LVNC 5LAXB 1F4YH 1TXKA 4UUJB 4HV8A 4ZXBA 1AY1L 1GOHA 4KHXL 5CBEB 1HHKB 4JFPB 4BK5A 2IPTH 5F88A 4R7DB 4NNPL 1Q9KB 5J6HB 3BESR 1B2WH 2D9CA 4Q0XH 3DXAE 3EOBA 1W72H 2CDEA 4ODXA 4GUPB 3HUJA 2VXTL 1ZLUK 4KDWA 1HCFX 2ZP0T 3BE1H 4GG6A 3MLPA 3H9HB 1F4AA 2VLRB 4R7NA 2J8HA 2FBJH 2MQ3A 4DAGH 3RWEA 1G9NH 4MXWH 4P2QD 1WWAX 1MFEL 4PJBB 1AFVH 1YEDA 3B9VA 5JIIA 2VDRL 3MSPA 1J1XL 2APXA 5C0DB 2Z0BA 3KVQA 3IFLH 4FA8A 4DGVH 5JHDE 3BD5A 1SYSB 4XVTL 2P5ED 1AR1C 5CUSL 1U8PA 2BRRL 5I17B 2VZ3A 5HHNB 1INDL 1AHWB 3E1F1 3CVIL 3TJHC 1GC1C 3QIUB 3GSXB 3RWDB 3VFMB 3S6CA 3NCYS 1OP3H 5GJTH 3BVNB 1TETH 2IH3A 1IZJA 4MQSB 2DQGH 1YEHH 4HWZB 4X0KB 4EQ2A 2AQ2A 4XH2B 2NYYC 4HUWA 3S3PA 1I8LA 1A3QA 3CFBA 3MRJB 1CU4L 1CVRA 1ZTXH 1U8KB 3O2WL 1G1CA 2ICWI 1U8OA 2DBLH 4F7EA 4M1GH 3DO7B 3HAEH 3I84A 3ZDXE 3LKOA 3VE0A 1RZGB 4UILL 4DGIH 5E4EB 5I1JL 1Z5LB 1A0QH 4NO2A 1JMXA 4UV4L 3QWOA 3G5YA 1HXMB 4MMZC 5I8OL 4LLVB 4Z7WF 4R4FL 2Z4QA 3SN6N 1RUQH 4ZNEE 5BVPH 5DFWH 1FRGL 2X10A 1EH9A 5B38B 3B9KA 4NQCE 3GK8H 5DURD 2HLFC 3G5VA 4M7KL 4NOBA 3LKRA 3EOTH 4BZ2L 1DBAH 4FFZL 4KV5F 4OLWL 1NGPH 1QSEB 5HHPA 4FZEH 2AK4D 3R06A 1YJDH 4N0UA 2I26N 3V0WL 5CP7B 1DDHA 3MV8D 4GBXC 3ULVL 4XCEB 5KJRH 2DI9A 1I7TB 5CSZB 1W72A 3RA7L 1QRND 4NQDE 5ESAB 1I7ZB 1I1YA 1NMAH 4AIZB 3MV7A 3HI6L 4PGEB 3B6SB 2W60A 2Z93A 1EJ6A 2Z8RA 1DJSA 4I3GA 1R5WA 5IUSA 4LSSL 4PG2C 5HHVH 1PY4A 5EOQH 2ZCHL 1QFPA 5H37H 1A6ZA 4MZ2A 4K9EL 1VADA 2VLJA 4GG6F 2OJZL 2VZUA 3QO0A 3GSWB 3MBEB 2EDOA 1DL7H 2FEDD 4OKVB 5L2KB 3JV4B 3MRKA 3OGCA 2JK5A 3P0VL 2IQAA 3DVFA 4UBDC 4NZJA 4S1SL 1PG7W 4WI5A 3P0GB 1N6QH 1KCVH 1CXEA 2EDXA 1OLZA 3ZE0E 4WFGD 3DMMB 3VFRA 3ARUA 3N1PC 1KFAL 3VXRE 4ELMA 3D85B 1KB5H 1ZT4A 2I5YH 3VXNA 1U3JA 3GDBA 3H9ZA 3N0PB 1IGCL 2YC1B 4K3DL 5E5MA 5BW7A 3GRWH 3EYVA 3BH9B 5FM5M 1K2DB 2R2BA 4U6VH 4R4ND 1IBGH 4UINH 5HDLA 5ITFB 3M1BB 3WD5L 1SJEA 2YBRB 3AM8C 3P30H 2X4TB 4PRBB 1T0PB 4V1DD 4ZDHB 5FDWB 3D69A 5D93C 2F8OA 3SKJH 3VD3A 2FB4H 2QQNL 5BZDA 4PR5A 1TQBC 2FH8A 4Y4FC 4WHDA 4JZJA 3QQ4A 2NXZD 2YS4A 3UJIL 3VG9B 4YXHH 3DHJA 1L7IL 1RK1A 2OJEB 1DFBH 3GSRA 4OTXH 4GW5A 5CWSA 1DQQA 1A7NH 3E2HC 3VXUA 3H9SA 1CGSL 3IDGA 5IFJA 5JO5B 2GSGA 1MSPA 3VD9A 5CS7A 4PRHB 4P23D 2IBZX 5B4MC 1B3JA 5I8CA 3BQUB 4HHAB 3U2SA 4BJLA 3QRFM 2AEQL 4LLAA 2DI8A 5BVJA 1CF8H 2ESVA 2AI0L 3MCLH 4XBPB 3C6LC 4WUUB 3TJEL 4PP1C 5EORL 2QR0A 1XZ0B 3VGHA 3AS0A 1FDLL 2P5EA 3QA3B 4FQCH 4UIMA 4WEUD 1NC2B 2Q86B 2VUYA 3ULUL 3TIEB 3WNNA 5GZOC 5HPMB 1CD8A 1QP1A 3X3GH 3PP3K 1F6AA 1UEYA 4G8EB 3VDAA 2AXGB 2XN9D 4QWWC 3RX5A 4B53A 3DI2B 5B3NA 3PDOB 2JJTC 3TV3L 4L1DA 2VQ1A 4UDUB 4TQEL 4KTEL 1NCCH 4PJ8A 2H6PA 1CDHA 4KI1A 3VMPA 3UPCA 3QIWD 4PJDE 4YHIA 1L7TH 1A3RH 1S7VA 3LD8C 1HHHB 1CIUA 4HUXB 4NQVB 2ZCLL 4U1SA 5FYKD 1GGBL 1KB5A 4RMTA 2VLME 1EFXB 2XQBL 3VFUB 1YECL 5FV1L 5F1NA 5HYSB 2MCG1 3T65A 2EH7H 4E5XA 1CDUA 1T04A 3U7WH 5DVNA 2CH8A 3HB3C 3BKML 3QEQE 5H37G 4QTHB 5CEZL 2UUDK 5EIIB 1PX4A 1KN2H 5EOCH 4XP1H 3S9DB 2WLYA 4U1NB 1X5AA 3D2UD 2XY2A 1RURL 4YXKL 1AH1A 4BSVA 1OTTC 3BH8A 4PJIE 3NABH 4M48H 4WHTA 3FQWB 5CEYA 3WFCL 1EAPA 4ORGB 2DM2A 5DJAB 3MROB 1ES0A 3B43A 1YA5A 1QBMH 5IM7A 3RVUC 2AK4A 1KC5L 1VEOA 5JZ7C 5DT1H 3MXVL 1G7IB 3L9RB 4ZAKD 3MV8A 3TYGL 1OAUL 5D72L 5L6YH 3GSNB 1YPZB 2CR3A 4X4YB 2AQ3A 1L0YA 3MV01 2BP3A 3QXAB 2JJWA 3WLWC 4NQXA 4L4VB 3OZ9H 2DM7A 4U1HA 1J9CT 2ADFL 5IW3A 2Y5EA 3PHOB 2JCCB 4KVCL 4G8GB 2BVYA 1IAIH 3OXSA 5ENWA 1X4YA 1T20A 5F7KC 4JZNA 2BSTB 2WQ8A 1NAKL 4LQFL 3ARDD 4IHOB 4WEBL 3ZHKA 2I9LB 4HKZA 1YEGL 5BMFH 3LRSB 1WGOA 1E27B 4K94H 2DDQH 4OCYL 4XNUH 2HMID 3MJ6A 4LASL 4ONFH 4NGHL 5CJXC 4NJ9L 1JWUB 1FL5B 3I6GB 4O58H 3ZDYF 3UTPD 4IMLA 5F7HA 3V8OA 1IC4H 4PJFB 5FYKH 2J2ZA 4P4KC 5DJXA 4F57L 3MRIB 3IS1X 5MENE 5AZEL 5GS2D 3ZTNL 4QOKE 4WJ5B 1KCUH 4HEME 5BJTB 1RFDH 2AJUL 2VITA 4S1DC 5B21A 3L3GB 4TSCL 5FUZH 3O41A 2BY3A 2GJ6E 3TESA 1TVBB 4MA7L 2C1PA 3TVMD 4L3ED 2J8UB 3RWFA 1FFOB 4V1DA 2P5WB 2X1XR 1SMAA 4Y16B 2IBZY 1YEKL 1YN6A 4OD1L 3BEWA 1Q0XH 3RIAF 4JPKH 2I60L 1I75A 2R39A 5A2KH 2ADGB 4P0DA 3MCKA 4MB4A 4DQOH 5DR5L 3UTTB 4YHML 3DUUB 4OGYL 4HGWB 1ZLVK 1FFNA 1YEIL 4FG6D 4U1GB 3BT2H 1AO7B 3U1SH 2DD8L 5MHSD 4CADA 1WTLA 2VZSA 4KI5E 2CK2A 1RZIB 3Q0HA 1A5FL 3BUYA 3QDAA 4JFDA 4NT6A 4R26H 1BJ1H 2FO4B 4Y8AA 1LO4H 4X9BA 4MDJA 5ITBL 3HTLX 2RCSH 4G8IB 4UT7L 4QCIA 3P77B 1PSKH 5E8OA 4P23A 3OX8A 1A2YB 4KHTL 4QRPE 4WO4D 4U1MA 3BZEA 1N5YH 3KPLB 3LQAL 2VXVH 4Q6IA 5DC9B 4X9HA 3VFSA 4X6CF 2I27N 3QIBD 4JLRB 3IF1A 3KS0H 4P5TD 1KEMH 4M1DL 1GGUA 3EYOB 3MZGB 3L5XH 2YPKA 3GMMA 3MMEB 3RX7A 5DDHB 4F58H 4Z95H 2R8SL 2A6IB 1I8LC 3QUMH 5CZVL 25C8H 3B5GA 4XP9H 3I3DA 2FEEI 4EBQH 3SE8L 2AABH 2ZCKH 4MAUH 2D7OA 2HVKA 1IAIM 4MZ3A 3NIFE 1FBIL 1CE1H 1LK2B 2NW2B 2N7BA 1I9JL 4K8RL 4NQTA 5F8RC 5GS2H 3B9DA 4OBRA 4XI5D 4TOYL 1DSFH 1CYGA 1SBSH 2XPGB 1M05B 2X4QA 3WFDL 1S5IL 2A83B 5EN2A 4K7PL 3DIFB 1WFTA 5GS1B 3L3IA 3QIWA 4IS6B 3T1WA 1S7RA 3PNWB 5CSBA 4MWFB 4HJGA 4Y0GA 4XTRC 4L4TE 4CU6A 4XBEH 5SWSD 4H88H 1KB9K 1PG7X 4XCYB 4U1JB 3VFTB 3RWCA 1VCAA 2IFGA 3B9KC 1U3HB 4NKIH 3OMZA 1R3KB 5IV2B 5I71C 3DXAB 3T2PA 3C09C 5J8OA 4X5WB 5E24E 1CXFA 1YY8B 4GAGH 4DK3A 3ZYOA 5HHXL 3DLQR 4F37F 1OAQL 4K07A 3D2UA 1UGNA 4PJ5D 1NANH 2P4AB 2FSEA 3MUJA 3RNQB 5GSRA 1T2QL 4OF5A 2VDKL 2D31B 5ANMA 3WKNA 4S0TD 3DUSA 1LWRA 3SGEI 2HTKD 5D1ZB 1G6RL 5JHDB 5D1QB 5I8EB 3GMLB 5DWUH 1G9NC 2VUOA 3K4AA 1NGWB 4ZAKA 1G9EA 4GQPH 5F9WB 4ODHH 1XF3B 3D48R 3MRQB 3EFDL 5A3ID 5I8KL 1JTOA 3FONA 4N9GB 1SY6L 4CN6A 3C5SB 5DQDL 2A0LC 5F9OH 3I6KB 2EE3A 4CJ1A 3VXQB 3ZMRA 5C09E 1DE4A 4X4XB 2ZUVA 3FOLA 1W0VA 4JCMA 4MJID 4GKNB 5T1MB 4M7JL 4NQEE 1OAYH 1ND0A 1DVFD 5IKCB 2BNRD 3EGSA 5JOFB 3EYQC 2Q76B 3GO1L 1T66D 1FN4A 3N1GC 4OFIA 3N85L 2H41A 3QUMA 4Q9BA 4WY7H 5I30H 3PV6B 5SWQB 4I3RH 1GGIH 2JE8A 1S7TA 3PF2A 4KKLC 4NO0B 4QXTA 5JLZB 4M62L 1BZ9B 1NCWH 5J13B 1T1ZA 1AXTH 1RZJL 1Z9MA 5JORB 2ICWA 3LSOA 3QJFB 4OCMC 5EUKB 4IDJL 4CNIA 3LY6A 3U6RB 4HT1H 4X4ZA 4PJEE 3O0RH 5F9JB 4AH2A 3WFHB 1IL1B 1FLTX 2X1PA 4MCZB 1ITCA 3HCVA 4JZOB 4ENEC 4OZIA 4ZUUB 1UWGL 1CGTA 3D0VA 4L8DB 4NQCB 2BVUA 5E2UL 4EI5B 1WJ3A 3LEYL 1FC1A 2EYRA 4G7VH 1P4BL 3I6LE 2ZUTA 2G60L 4XGZB 2CLVB 3HLAB 5F96H 5GSVA 3O45B 2XXCB 5F7MC 3TVMA 3G04A 3QCVL 4L3EA 4QTIL 4E0RA 3RIFF 2VN4A 5C0RH 5FV2A 2G9HA 1Q9OB 1PEZA 2C3WA 4PJ9B 4FMKA 2EZ0D 3RHWF 1BVLB 4YO0B 4BQ9A 1SVZA 2ADJA 1HSAA 5C08E 5E08L 2YA1A 3BZ4A 5KG9A 4NQDB 2V2WB 2AJSH 2VH5H 1WVZA 4NFCA 5SV3A 1YJDC 5A1AA 5BV7B 1F90H 3I50L 3RWIA 3AMKA 4FOMA 4OLYL 4JHZA 2MSPA 4OLUH 1QEWA 1YYLL 2B2XL 4IJ3B 1QRKA 1N8ZA 2KDGA 5KSBE 2O5XL 5DRWB 1W8NA 2IGFL 3IU4H 1T5XA 2B39A 1RMFL 3FAWA 3IAPA 3O6KH 4TVPL 4WO4A 1QLRB 2P24B 2IH1A 5ADOH 4HC1H 4JVWA 3QIBA 3ZL4L 2AV7A 1IILE 2BFVL 4P5TA 3S34H 3BPNB 3SDAB 3ECBB 1DQDH 3UZQA 1AR2A 1NFIB 4LCCB 4U1IA 3VXRB 2CIKB 4ZS6D 4LLMA 3K8LA 1XT5A 3MLSL 5CJ5A 5EULV 2A6JA 3HR5A 4PJ8C 4XPBL 2AV1A 3KPSE 4O51B 2EDEA 1AY1H 4LLYA 4YNYB 4JFQA 4KHXH 2DQDL 2OL3B 2C3VB 1CK0H 4NNPH 2Z31B 4N0FA 5E7BA 2GI7A 4HIJA 1F6FB 1U41A 5SX5H 5TDNA 1GYAA 1OTSD 2J8OA 3HC3L 1VA9A 2VXTH 2VDNL 3HG1A 3F7YB 3FRPA 2GSIA 3IETB 1H3GA 1RJZA 2CUHA 4Y2DB 4JO3L 4XXDA 5E8EB 1C16B 1QACA 1MFEH 1OSZB 1CXLA 5DVLA 5DJYA 2E7LA 2WWKT 2CKBH 1KYOJ 4HBCH 4KZEL 3ISWA 2BVOB 1JGUL 1J1XH 2VDRH 2YN3A 3C9NA 4XVSL 3PP4L 2D7PA 4G5ZL 1F3DH 4XVTH 1FFRA 5T1DL 3GIZL 5CUSH 4NNYB 4OZIF 3K8KA 1INDH 3SKMB 1IRAY 3CVIH 4Z7VF 1EPFA 2QEJA 1KCKA 3DURB 4UMGA 1UB6A 3FB6B 1UZ6F 1G7HB 4PV9A 2AJ3B 4HF5H 3FRPG 1P2CA 2F5AH 1N64H 2FYYA 5BOZG 2EIZA 4HIEA 1MRFL 3VXPA 3W0WD 1QSVA 3T1FA 3O6FD 2VC2L 4ZFZB 1T7VA 1UACL 2RAMA 2QV2A 5I1JH 5L8KB 1O0VA 1EBAA 4LKCB 2GJZB 4JAMA 2CD0A 4G9FE 5D6CA 4LPUA 4IOIA 1X5JA 1E6JL 4HMCA 4WWKB 4KY1L 3QI9B 1TDQA 5GZND 2EO9A 1L4IA 4R4FH 4PJDB 1ITBB 2KQNA 4FZ8L 4M5ZL 1C5BH 4MJIA 2C4FU 3JV0A 1DVFA 2J88L 5IHZA 5JQHC 2BNRA 1FRGH 2X7LB 1MQKL 3TA3A 3O4LA 3Q6GL 4J2XA 1S9YA 4TUOB 3CH1B 4Z0XA 4C56E 4OQTL 2CXGA 4M7KH 4NQSA 4BZ2H 5EO1A 4OLWH 4M7ZB 1CWVA 3QEQB 2IPUK 5FB8A 1ZVHA 4Y1AD 1QA9B 4HSQA 3F7QA 3MNZA 3BP7A 3GJEB 4Y5VB 4EVNA 4PJGA 4PJIB 1GZPB 4H0GA 3H3BC 3IVKB 3DX6A 4YJZL 3U7YL 4E42A 3JTSA 1JGVL 2EE9A 4LCIL 1HWGB 1OQOA 4ZS7H 3MGTB 4KAQL 1BIIA 5IIEB 3T8XB 1QFWL 1NCDH 4Y5XA 4DVBA 2CKBA 4K9EH 5ISZD 4LLQA 1IQWL 1QNZL 2A6KB 1FPTL 4LSUL 4XMPL 3G6DL 2YD9A 3RWJB 3P0VH 3BI9X 3BISA 4S1SH 4RGND 4P23C 3P9MB 3UZVB 2X4UB 1AKJB 5IOPA 3PWPE 3IXTB 4I48A 4Q6IC 3ZSTA 1UA6L 3BIAX 2VISB 3STZA 4RFNC 1KFAH 1XCTA 3BWUC 1LE5B 5D2LE 3KR3L 2OTPA 2EEBA 1T21B 4K3DH 4JFHE 4RQQA 4G6ML 5TPWH 4S1QH 4GJTB 4EJ1C 3TCXA 2X4OA 1AE6L 1YMMA 3WIHL 5IB5A 4CL7A 3WD5H 4FXGA 2JB5L 3EZ8A 3GGWA 4D9QD 4XNMB 1KBGL 2CLRA 2AEPH 4Y19D 1Q94B 4K94C 5FCSH 2QQNH 5C07D 5MENB 3EDEA 3LCYA 3X14B 3PABB 4XCNA 2ITCB 5CINH 4QOKB 3NH7H 3N1MC 3KLSA 3EO0A 5FF6A 5IBUG 2Y07L 3QIWC 4L8CB 3T0AA 3UJTL 1MCDA 1RQ5A 4P2RE 5DTFB 4OD2A 1MJUL 2GJ6B 3UJIH 4OUUA 5EU6D 4F3FA 3TH3T 3CSYB 4MHHI 4ZMAT 1R3JA 2CDFB 1L7IH 4OZHA 5LG1A 1P84J 5DJ2A 1BHGA 2DQIL 1CGSH 1H3VA 2YPVL 5KS9F 4N1HB 2G75A 1NQBA 2DLTA 2YUVA 2D7TH 1OVZA 1BM3L 5J0BA 3FT3A 4HPOL 4D0BB 1EA9C 1KTRL 3V6OA 2D7NA 2AEQH 5I1CL 5LGJA 2IG2L 3W5MA 1HI6A 2AI0H 3TM6A 1GHFL 3G6JF 5JA8B 1QR1A 2RFXA 2BMKA 1NUNB 1IKFH 1ZOXA 3SGEH 1L9NA 2AXHA 1AIFB 4MQTB 3N9GL 2QQQA 3KPOB 1FDLH 1MHEA 5E94B 1AGEB 3QXVA 1XF5B 5C9JA 1B9ZA 4MNQD 4QRPB 3VGFA 4ZAKC 3ULUH 4XT1C 4ZFGL 5EB9A 4OGXH 1X5XA 3BN9D 3JSSA 3HUJE 4XCCH 1KPVB 4LVHB 4GG6E 2AJYL 3LQZB 4ZO8A 3FO1B 3S5LA 3U48A 1KLGA 4I18B 5CLWA 3K80A 4KTEH 3UXFA 1BOGB 1F6LL 4OZGA 5C8JB 1GXEA 4HX1A 5C2BL 1U8LB 2ATKA 5I18L 1FFQA 4Y7MA 5EZJB 3W0WA 3KJ6L 3GSVA 5H35B 3O6FA 3A0OA 1OOAA 5A2LH 4ZOAA 5C0GA 2P8LA 2UZYB 5JW4R 1KJMA 3WFEH 3H6JA 1S9VA 3N06B 1KCSL 4R8WH 1QQDA 4YQXL 2FO1A 1GGTA 3NCYP 2HMIC 4YHNA 2F74A 4AL8L 3BKMH 4YPGB 2VLRD 3TF7C 3MREB 4LPTA 1D7FA 3PL6D 4Y88A 5B22A 1OT2A 3S5LG 2BJML 2K1MA 4KKCD 4L4TB 4H26A 4AIOA 3QG6B 5FYLD 1CLOH 4OJFL 4N5UA 3WFCH 1K8IB 3Q5OA 3O6ML 3C8KB 4NC1C 3O3AA 5M7QA 2IMMA 3PDDA 1BFVL 4U6HA 4FFVD 4XP4L 5HHME 4QHMB 4QXUH 1FZMA 3T3MF 3SGDI 3TZVD 1HEZA 4HXAL 5INCB 4Y1AA 1JNHA 3MXVH 4FQLH 4MDIA 3TVMC 3ZT6A 1CQKA 3TYGH 2Q3ZA 3BEVB 5D72H 4DKFL 1WWWX 4CW1B 1QBLH 4UV7L 2ADFH 1CI5A 4LVNB 2XKNA 2R0ZH 4KVCH 3GFUA 4OZHF 4LCWD 2SEBB 4Z5RB 5GGQL 2VE6B 1MIEL 1B4RA 1M7DA 4LQFH 3AU1B 3B9EA 3GMNB 4WEBH 3CX5J 1TMCB 3IDJB 5ISZA 1DEEB 2O61B 4JFYB 1IAOB 4OZ4B 4OFPA 1FSKC 1DN0A 3RGVA 4N0UE 1ACZA 4X6FB 1AGFB 4UU9B 2XFXA 4CVXB 3LIZL 3RVVC 3QXDB 1KTLA 4WO4C 4NGHH 4NJ9H 4HS8H 4YDLC 5E03A 5A2JH 1C5DB 5FGCE 5C09B 3V7MA 1ZS8B 1QHOA 4YAQB 4WCYL 3MV7E 4RBPK 4P5TC 5F9AC 3S36H 2DMKA 4NQEB 4AJ0A 3BWAA 1H3WM 1GOGA 5JXAH 5AZEH 4P59L 3ZTNH 1A7QL 5AUMB 3ULSB 4YEFA 5B3JE 2H1PL 1WAAA 1NKRA 5D8JL 4C83B 1A1MA 1YN7A 1XIWD 2VLJE 3MRPA 4M61A 3B8SA 3O6LL 2CJUL 4YDKH 3EJYC 2FJGB 4BFIA 2VDML 3A67L 4MA7H 2FJFA 3FKUS 4OZGF 4UQ2B 5IVZA 4K3JL 1RHHB 3QP3A 4Y19A 1DN2A 3FQXB 4P57A 4ODVL 1BBDL 3BMWA 4PJEB 4XCFL 5HYQA 1I3GH 4OD1H 2ICEB 3OAYK 2Y5TB 5A43C 3VG0L 4BQ6A 2LABA 3FB8B 4YE4L 4YHMH 5KVMC 5JIPA 4ELME 3F58L 4OGYH 5EU6A 1IGTA 4ZTPH 1V7NL 1FNLA 2E7LC 1QFWI 3OPZL 1WBYB 1FIGL 1UXWB 3KHOA 3IT8D 2WK2A 3DX7B 5F44A 5I1LB 4ODUA 3LZFL 3UC0H 1T3FA 4PLKD 1BZQK 5ITBH 1FNGA 4UT7H 1EEQA 1S78C 2YKLL 5C08B 2GAZA 4U6XB 1S5HB 1XGPB 5E2JA 1YNTA 4PIRF 1ZVSB 3DMMD 4NYLA 5LBSL 4NN7C 1OWWA 4M5YH 1J5OL 4M1DH 3CC5A 2NTSP 3DPBA 3JWDC 2DWDA 3MLTA 2HTKC 2R8SH 5KSBB 2PTTB 2BX5A 4EIZC 3S35X 1MLBA 4YZFE 1X5LA 3UMTA 5D2NA 4MNQA 4GBXB 4WGWB 3GMPB 3Q1SL 3VXUE 1ETZB 2VXQL 2W91A 3RTQD 2AGJL 2BDNL 1U6AL 3A6OA 4LCYA 4ZG1A 2X6MA 1FBIH 4NPYB 2Z8SA 3V6BR 5A3IC 4K8RH 2M1KA 4TTGA 3BO8B 1BFOB 3K2MC 5JNYA 3EW3B 2Q8BH 4TOYH 2X4SB 4P2QE 1IAMA 4WUKH 5FA3B 3WFDH 2ESVE 1S5IH 3BD3A 3P4OA 2Q6WA 4KK8C 3G5XB 5FUOL 3KPSB 3CFJB 4F2MB 5HGDA 2V6HA 1DVFC 3VH8B 2P5EE 3TH2T 5FO8A 2R29H 8FABB 3TA3C 3UPAA 1T66C 2LVCA 3QR2A 3ULUF 1VFUA 2NY2D 3MR9B 5IR1A 3LMJH 3MV9D 4L3CB 2WP3O 3OKLA 3ARBA 2J4WL 2A38A 1YQVH 3LOWA 3C08L 3T0VA 1OP9A 1OAQH 4A6YH 2XYCA 1BQUA 3LPGA 1ORSA 2CUIA 4J3VA 1FNSL 1J0JA 1G9ML 1U93A 4WUUD 4MJ6A 5FEBA 4OV5B 1OF2B 5E8NB 1B6UA 2B1HL 4PREA 3VWJA 4XPHL 3ARRA 2EE2A 3TZVA 3FT2B 3PWJB 2AJVL 3GBNL 5JIKA 4PLJC 1T7XA 5TDOA 4Y5XC 5D93B 1G0DA 1SJHB 4MS8C 5IROA 2V5SA 1TQBB 4FQ2L 3SDXE 2EZ0C 4PJHA 3TWCH 4JO4L 4Y4FB 3A6BH 5I8KH 1SY6H 1T22B 2X4NA 1NFDA 1MY5A 5FKPA 3WCYA 2DF3A 3B5TA 4LCWA 3GMQA 5L88L 5EU7C 4GFTB 5CP3H 3U4EB 5C0CA 4H8WL 1N2RB 4S2SB 3WLBB 3HI5L 3E2HB 3DGGB 3VFVB 1C5CL 1T5WA 4HD9A 4PJCE 3GO1H 2AK4E 3N85H 2OR7A 2NW3B 4IRZL 4K7FB 1EXUB 2CRIA 3ALWA 3MV8E 1HILB 4XB7A 4IDLA 4G9FB 5FO9B 2PTUA 3Q48A 1I3RA 1ZLVH 4JFXA 3C6LB 4GW4B 4YDIH 2P8PB 1QRNE 5IHLB 3P4NB 5DMJB 2V2XA 5GHWL 1JF1A 1CGUA 4PS4L 4KJQC 3HZVB 4CVWA 4DW2L 4URTB 4IRSB 1UWGH 2LU3A 4POYA 2HH0L 1M71B 4C56B 1XIWA 4XPAH 1ED3B 4DGYL 3VFNA 3ARVA 1AQDA 5DEFB 4HIIB 3QCVH 4QTIH 2BC4A 1LNUB 2LAGB 3KNBA 2RBLA 5DUPL 4RZCB 1VDGA 1A9BA 3MODH 3PWLB 3CX2A 1MHPL 1CGXA 3CXDL 4WFGE 5E08H 3CCHA 3LD8B 3P0YL 5FFLA 4LHUA 5E5RB 3CFCH 2EH8L 1FZJB 1PX3A 3DV6B 1TZGL 1VACB 4RX4D 3MX0A 4A6YA 4HW6A 1K4DB 3V6OC 3VFWA 5ACZA 4Z78B 1JPFA 3NFNA 2F58L 2NZ9D 4OLYH 4DK6A 3T0DA 1TZIA 4J8RA 2IAMD 1YYLH 4M43L 5TF1L 1X4ZA 4JKPH 4YHZL 3HRZB 4NZTL 3LEXA 2NY0C 4H25A 4OZFH 1RMFH 3QULA 4V1DE 2W9EL 1A4JA 1H3PH 3QCTL 3T0WA 3PWPB 2XQYK 1QKZH 5AAWA 4BSWA 3ZL4H 2DLIA 5EOTB 1NAMH 4HS3A 1MRCL 3ETBF 3WDIA 4JPIB 4PJ7F 4K71C 5D2LB 1OPGL 3LEVH 4HH9A 4LHUG 3TFKC 2JJVA 4L9DA 3HPJA 5CP3A 5FO7A 3IDXL 3UJJL 1JK8A 3UPRB 2NZIA 1WEJH 4JFDE 1NFDF 4KVNL 2P7TB 2OQJB 1KIPA 3KDMB 4WI6A 3RTQA 3O6FC 5FGRA 4F7TB 1N5AB 3HR6A 5J9PA 2ZSWA 2GYSA 1HH9A 1U8JB 4MA1C 5K9JL 1NCNA 3TPKA 2O93L 4J7RA 1A7BA 2L4OA 5DGQA 4NHUB 3HC3H 2HRPL 5LQBL 2VDNH 1FAIH 3IFOA 2FX8L 4JO3H 1OY3B 4P2RB 4HAGA 4PGBB 1WFNA 1G7JB 1CDYA 5IEHA 3IDMB 5JR1L 1K3ZA 5F3BB 1JGUH 5BXFA 4OKDA 4XVSH 2EDTA 5JPNB 3IGAA 4HXBL 1NPUA 5FKAA 1IEHA 3MV9A 3MLXL 3QNXA 3OJDA 5DGRA 1KLUA 3ILPA 2HJKA 3RWGB 1QO3A 4P4KB 3WDHA 3MOBL 4NJAH 5CIPB 4JO2L 4X7SL 3P9LB 1KTDA 3VXSD 4PV8A 3BZFA 1U8NB 2UYLB 1JPSL 4HS6B 5E6YA 1NGZB 1LE9B 2PKDA 5DUML 3S37L 5LXGH 3ARGB 1VFAA 3IXAA 5FCUL 1UM4H 4ZXBB 4HV8B 1HYSD 1J86A 1MUJA 4K23L 5FYKE 4KDVA 5F88B 1MRFH 1WZ1L 5GRUL 3U7AA 4XP6L 4F9LA 4JDZA 2VC2H 5AYQA 3EOBB 1CT8A 1A6UL 5IG7B 1UACH 2CDEB 4ODXB 4HG4K 1DZBA 3HUJB 1HZHL 1TZHA 4GG6B 3SY0A 3RGVC 4I5BA 1KV3A 4R7NB 4MHHG 4OZFA 4RGNC 4RMUA 3RWEB 2O5YL 1F3RB 2ZUWA 3O3EA 3IAQA 1N0XL 4KY1H 1UJ3A 2HFEA 1YEDB 4NCC2 5ANME 3QEGL 1T1YB 3M8OL 5DQ9A 5EUOA 1UCBL 1NAMA 5CMAA 5KSUA 1FQ9C 3GMOA 5T3ZL 1VESA 3VCLA 2B7DT 4MNGA 3Q6GH 1U8PB 4OQTH 1JUFA 3DXAD 4PRID 4PFEA 2IH3B 1RUKL 3DETD 5EU3A 1IJ9A 4HUWB 4OM0H 4KZDL 1JZ5A 3CFBB 4S10A 5I1DA 4PB0L 3SOBL 3VFOA 1JGVH 4PJXA 4ZTOL 4KUZH 3P40A 2XRAH 1U8OB 5HHMB 4F7EB 3O9WD 1ZGLA 4GOSA 4GSDL 1F4WL 1QFWH 3U0PA 3LKOB 3E8UL 3VE0B 4HMDA 3LS4H 1RUAL 4FQJL 4NO2B 1IQWH 1QNZH 3QWOB 5KSVA 3G5YB 1FPTH 1CLZL 2F9BT 4XMPH 5I19L 3PGDA 1CN4A 2X70A 3NIGF 1E4JA 4LPWA 5IVXA 3UTPE 2Z4QB 1LO2L 5DD1L 4S11A 4X6EA 2D9QB 4G43A 1UWXH 3GUTA 4R0LC 4DTGL 4X6DA 1JHKL 2P46B 2XZCH 1UYWL 2ILLA 4G9DB 4NC1E 3B9KB 3G5VB 4MVBD 2IAMA 3AY4A 3KR3H 5I71B 3LKRB 3PUCA 2XI9A 4IIQC 2NCMA 1AQKH 1UZ6E 1FNFA 1CDIA 5HHPB 4L3EE 3MRBA 1S9KC 4N0UB 1ACYH 2EDJA 2EDYA 5D2NC 1DDHB 2R1YA 3WIHH 2WW8A 2DLFL 5FGCB 2MOVA 1W72B 4RAVA 3BN9C 1BZ7A 2ZPKH 2J1KA 1I1YB 1KPRA 4YXLH 3MV7B 2W60B 2Z93B 2UZIH 4NN6C 1YMHA 2IPKA 4M6ML 4HQQL 5HYJD 5MHSE 1A6ZB 3EOAA 4LLUA 4R4BA 3UJTH 4FFYL 3I2CL 4LAJH 2VLJB 3QO0B 1MFCL 5DMYA 1UFUA 1OHQA 3MRKB 3OGCB 2JK5B 1DCLA 2IQAB 1BJMA 5FGSA 4D0CA 2DQIH 4ZOCA 5DK2A 1BQLL 2YPVH 4QXGL 3AS1A 1X6LA 1QFUL 3ARBC 3VFRB 3QDHA 4NC0B 5FK9A 3ARWA 2ZNXA 4PRDA 3CDYA 4Z7UA 3X11A 1RSFA 4ELMB 3H9YA 5AZ2L 3VXNB 1VPOH 4RDQF 1GHFH 5E5MB 2OR8A 5J7CC 1VKXA 1NGXA 3EYVB 1H5BA 1KPUA 1BD2D 3RJQB 2R2BB 4Z7NE 1JNJA 4TRPL 4DKEL 3R0MA 4LSDA 5JUEL 4JKMA 3N9GH 3VWJC 1SJEB 1FORL 4OSUL 4RA3A 4YHOL 5E4IA 3BMVA 3TZVC 3FQRA 4P46B 2APWA 3IFNL 4XVUD 5DEGA 1LEKA 3D69B 2JKXA 3VI3E 5DVMA 2QHLA 4J3OC 4ZFGH 4UTAL 1D5XA 3RAJL 5BZDB 4PR5B 2Y25A 5IROC 1HQ4A 3VXSA 5I1IL 2AJYH 1QFWM 4W81A 2NY1C 4JZJB 4NCC1 1MCPH 5I73C 3QQ4B 4C55A 5IHUH 1AXSA 1T1XA 1BX2A 3BSZL 5I18H 5JW5A 1RK1B 4C59B 3GSRB 5IVXF 4GW5B 3NPSC 1WBXA 3BKYL 1TTFA 5JTWA 1DQQB 2CK0H 3O3DA 3NN8B 1IC7L 3VXUB 1MRDH 4M9OA 3IDGB 5IFJB 3FHQA 2GSGB 3KYAA 1SMOA 4X98A 4L29A 1LMKA 3GHEL 4X6DF 1KCSH 3PE9A 4P48A 5I8CB 3U2SB 4RMWA 3OR6A 5E1AA 4I3SH 2PN5A 4P2QB 3WIHA 5BVJB 2ESVB 4RIRA 4Z0BL 3MA7A 4Y2DD 2YPLD 5CD5D 2E9IA 3MXWL 5HYEA 3FHAA 2QR0B 4K8RC 3OKNA 2BJMH 2P5EB 1DUYA 3O6MH 4UIMB 1J0YA 1RV6X 3TGXA 1BFVH 1XIWC 5LGHH 4PRIA 5JMRA 2PW1A 5BOPA 4XP4H 4KPHL 1AD9A 4K2UH 1EHAA 2E7MA 3EIFA 2QJDA 1A64A 4HXAH 4YBHA 2XT1B 1S7SA 2LFGA 1B4JH 2VQ1B 1WICA 3BDBA 4DKFH 1CFTA 5HDBF 3SDYH 4MAYD 2H6PB 5ID0A 4MYWB 2E7HA 1KULA 4YHIB 1S7VB 1J8KA 2ZG1A 4MJIE 3WHXA 4UDTA 2P1YA 2VABA 4U1SB 3UYRL 2AEIT 2BNRE 4MA8L 1KB5B 3WYRA 3GEWB 5CLTA 2PO6D 5F1NB 3WO3B 4PLOB 3T65B 4E5XB 1T04B 3IS0X 1J10A 3SDXB 3OF6D 4XAWL 2ATPA 4PLKC 4E9LA 3W39A 2BOBA 1D6EA 3FT4A 1RI8A 3M17A 1R0AL 4OLZL 3LIZH 4PJGE 4BSVB 1QLEH 3BH8B 3GSNL 2RQ8A 3MUGA 4FTVA 4WHTB 3IYLW 5CEYB 4WCYH 5DURB 5KZCD 1EAPB 1ES0B 2VLMD 4P59H 3WJLC 4PJCB 2QHRH 5IM7B 1S8DB 2AK4B 2H32A 5D8JH 4OFYD 1RHFA 2JELL 3O6LH 3VXTA 1NCAH 3MV8B 5L8JB 3TBSA 3RTQC 4NM4L 1HQRA 1MPAL 2VRAA 3HC4L 3KWWA 4J1UB 4NQXB 4U1HB 1QRNB 4YBQD 4K3JH 5EU7E 5HDQL 4XCFH 1BBDH 4QXWA 3UCRA 5EO0A 2WIIA 3DRQA 5GQBA 1TVDA 3VG0H 5CD3A 5HYJA 1JBJA 5ENWB 1T20B 3U9UA 4JZNB 5DVKA 1JNLL 2AXJA 3V0VA 5F1KC 3F58H 1J0ZA 3NA4A 4QYOA 1MREL 4TUJA 4DUXA 1AGDB 2GFBB 1BBJA 4HKZB 43C9A 1V7NH 5F8QC 3WNKA 2C26A 3VRJA 4QO1A 3OPZH 4K3GA 1FIGH 5DK0A 3D0LA 4HWEL 5IVNA 4F7PA 2NY2C 1H0DA 2R2CA 4F8TA 1BQHA 1PLGL 2J6EH 4ODTL 5FM4A 4UNUA 4IMLB 2C9AA 4RFEA 2QTEA 1OP3K 5FM8A 4X5XA 5DJXB 4J3SA 1NSNH 1KSRA 3FRUA 4JM4L 1MCRA 3F62A 2WBJD 3W11D 4DZ8A 4TUKL 1DQJA 1QBAA 1BD2A 2VITB 3ILQD 1OSPL 4X9IA 1RD6A 3OKYA 3O41B 4HLJA 4LGSB 4Y4KD 3EFFA 3CK0H 4QRSA 3MJ8A 2E8YA 2PXYD 4UQ3A 4OZHE 2C1PB 2EDWA 3RWFB 5F93C 4V1DB 3Q1SH 1XGYH 2AGJH 2BDNH 3SBWA 1YN6B 4XP5H 4F9LC 3BEWB 4C4KO 5CKGA 2F53D 1ONQA 2R23A 1A14H 2GUOA 3KXFD 1HSBA 4LU5L 4O2FA 1VGEH 3MCKB 1BQHG 3OWEA 32C2A 4JPVH 5MEND 3V79C 1LHZA 1FFNB 3V6OE 4QOKD 2NXZB 3PIQA 1P4LA 5D7IA 1RAMA 5DJ8A 5FUOH 5T3XL 1NGYA 4CADB 1UJ3C 2D0HA 2V17L 3KLAA 5CJ8A 2X44D 3BUYB 4JFDB 4NT6B 3R1GH 5EA0L 3VGAC 1A47A 2A1WL 3CXHK 4MDJB 4QCIB 5E8OB 4P23B 3OX8B 3MRNA 5DHVA 3BZEB 4JY5H 4YHYC 5D7JC 1VHPA 3V6ZA 1QZ1A 4Q6IB 2J4WH 1DANT 3MUZ1 3KLHD 3VFSB 2VNCA 3IF1B 3EJJX 2WMPA 3IB4A 4RFNB 2YPLA 1Y18A 5GRXG 3HMWH 2YPKB 3GMMB 1P53A 5I0ZA 5JA9A 4OZGE 3GI9H 1F00I 1FNSH 3JVGA 4KI5D 1XR8A 4O9HL 1V7ML 1Z0NA 1EO7A 4PY8I 3TT1L 3W0WE 4YPJA 2RR3A 3ZO0A 4M1CD 1RIHL 3ARED 3FL7A 4M6OL 2HVKB 4PTTA 1MJ7H 2P44B 3BGFC 1NLDH 3GBNH 1ZLWH 3OV6A 4JHWH 2X4QB 4FQIL 3PWUA 4MAYA 2VERN 3V6FA 2GITA 4JO4H 5K33A 2FHBA 3B2VH 3L3IB 3QIWB 2J6EA 1S7RB 1LILA 2QQKL 4F33A 4ZNCD 3RIAK 4HJGB 4H8WH 5K59F 4NZUH 4LDOB 1QG3A 1N0LA 1WIPA 3HNTH 5LJYH 4QY8A 2PO6A 3HI5H 4N9OB 1Z0MA 5J6GA 1GPOH 4PGCA 3RWCB 1C5CH 4WDIA 4XC3H 2W0FA 2IAMC 3AY4C 3EYSL 3OF6A 4UTBH 4LSVL 5I1EL 5TE7H 4Y1AE 4IRZH 1X5GA 4RGMB 4POZC 4CUCA 2B20A 3QPXL 3D2UB 3MJGX 4KKNA 1MJ8H 4XWOC 1VFOA 2FSEB 5GSRB 4TSAH 5ANMB 2Z8WC 2HFFA 2XG5A 3QCUL 3DUSB 4JFFD 5GHWH 3CFEA 1ZHBA 3H3PL 4PS4H 1AJ7L 4L4TD 4DW2H 5T1KD 4OM1H 1HHGB 4HPYL 1UEMA 3MACH 4OFYA 5ISZE 2YD1A 4C54A 1VEMA 4ZAKB 1JN6A 3SE9L 1KG0A 3OKOA 1CTNA 5D7IF 1U36A 3FONB 3MLVH 4ZFFA 4U3CA 4RGNE 3GKWL 4X4MA 2YWZA 1U91A 5DUPH 4NDMA 4OCXH 5LVEA 1ZANH 3BP6A 5HGBA 2EIDA 1DE4B 2WINB 1CVSC 5HJ3A 1MHPH 3CXDH 3RX8A 3FB5A 1QYGH 3FOLB 2A73A 5E99L 1ADQH 1IEAB 1CTOA 1W0VB 4LP4A 1PYWB 4QRTA 2EH8H 3SDCD 1PVHA 2D03H 4ONGL 2K7QA 4BK4A 3EGSB 1YEFH 2W0LA 1E28A 1WAAE 3WN5A 2F58H 1FN4B 2YXFA 1T6VN 1E4KA 3QBTB 4HK0A 1H5BC 3QUMB 1KGCE 5GGTH 1OCWH 1S7TB 2IC2A 4M43H 4QXTB 5TF1H 2B5IB 5GJSH 1T1ZB 3NZHL 1LK3H 3LSOB 4OT1L 4YHZH 1FC2D 4NZTH 2VTFA 4CNIB 1WISA 3OAUH 1JZ6A 4D9QE 2W9EH 5I1AA 4Y19E 4ZO9A 3QCTH 4LIQH 1H8NA 4AY0A 5BZWA 2WBJA 3HCVB 3HNVL 4XPGH 2Q1EA 3WIFA 4EDWH 4QNPE 1MRCH 3CAFA 4O02L 3D0VB 4TVSa 4PUBL 2DAVA 4Y4KA 4GRWF 1AR1D 1OPGH 2EYRB 5EU6E 5BV7L 2BVTA 4DJMA 2PXYA 5GSVB 3EDFA 4PG9A 5IBLD 2E8ZA 4OCLC 5GRJH 1DTUA 4NQUA 2AJZA 3TVMB 3G04B 4L3EB 5IF0A 1BP3B 5EPMA 3T0ED 4E0RB 2KQMA 1IGYA 4G6JL 4KVNH 5IESL 2G9HB 5GS0L 5C92A 1MCFA 2F53A 2ADJB 1HSAB 5F7EL 3BZ4B 3KXFA 5KG9B 1LEIA 5F6IC 2C4FT 3GB7A 5DJDA 4N68A 4BKLA 3MQIA 3V4PL 4Z77A 2AAVA 3RWIB 5LQBH 1FGNH 1YUHA 3ESVF 4OF7A 1C08A 3FB7A 5ALCL 3LKSA 1QEWB 5JMOC 1H15A 1N8ZB 1FSKB 3WIIL 4Q6YA 2VKXA 3EKCA 1T5XB 5D2NE 4MNQE 2EYSA 5E2VL 1WFUA 4WO4B 4WU5A 4YDLB 2IH1B 3OKDA 4HXBH 4OIAA 4QRUA 3HPLA 3ZYIA 4CN1A 1BQSA 2OL3L 1XAUA 3QIBB 2AV7B 1NCUA 4P5TB 2VYRE 4U1IB 1KELH 1D5BA 3DETC 4H0IA 4HIXL 3SGKA 5IW1A 4LLMB 4NUJA 3L5WA 2A6JB 1EJOL 2HLFD 3HR5B 3RP1A 1MI5A 5T5NG 4MB5A 5DUMH 2HYMA 1F5WA 1ADQA 3AREA 1NBZA 4LLYB 2Z9TA 1EHLH 4JFQB 2HG5A 3BUTA 4QHKJ 1RUPH 2V9TA 4GBXD 4P9MH 1WZ1H 3MGOA 4N0FB 4HIJB 4X7FC 5EIVA 5F1IA 4WNQA 1UM6L 3T08A 3WJJA 5C1MB 1A6UH 5TDNB 4JREC 5GGTA 1ZWIA 2JB6A 1HZHH 3MLZL 1OLLA 3ET9F 2YRPA 3RIFK 2GSIB 1RJZB 2DQTL 2VLLA 3RHWK 2BK8A 4XXDB 2CGRH 1AI1H 4HKBA 1FZKA 4JM2D 5DJYB 5HD8D 4L8SB 1BLNA 3KPQA 4MNHA 3RU8H 3FJTA 3KPSD 4OLXL 5FYLE 4D8PA 4NO5A 3VW3H 3C9NB 3M8OH 2VSCA 1UCBH 4TPRL 1JF5A 4OF0A 1PJ9A 5T3ZH 3RDTD 3SO3C 3TN0A 4LRNH 1TVHA 1S7XA 4Q9QH 1N59A 3BJLA 2FATH 5J57B 1GJIA 3DROA 4HIHA 1YNKL 4NN7B 4NUGL 4PJHE 4L5FH 1NFDE 1BVKA 1FVDA 5AAMA 1JVKA 4JFFA 1EV2E 4ZQKA 3NCMA 4LCWE 4PV9B 5CBAA 3RY6C 1P2CB 2UY6A 4ACPA 4KZDH 2FYYB 5T1KA 3WUZA 1R5VB 2ZUQB 2EIZB 4OIBA 2DBJA 4HIEB 3VXPB 5C6TL 2W9LA 4PB0H 4R97C 2D0GA 3T1FB 4ZTOH 4YC2C 2C7UA 3IDNA 1WBZA 4OAWA 1Z9OA 1QD0A 5I74C 1KCRH 3E8UH 4RWHA 5C6WH 3ELAT 4LL9A 3VMNA 1IC5H 2PYED 1RUAH 4FQJH 3QQ9D 4JAMB 4U0RC 5D6CB 5JQ6H 3MRCA 4NCDA 1UVQA 4IOIB 3QUKA 1CLZH 5I19H 5IFHL 2IF7A 4LLWA 1RZKL 1LO2H 4MJIB 2QSCL 2WLZA 3SDCA 4O5LL 1DVFB 2BNRB 2HJLA 3TA3B 1JHKH 4I77H 4BYHA 1FYTD 3QEHA 3QHFL 1S9YB 4Z0XB 3AMLA 2AVGA 4N5ED 1F2QA 4NQSB 5EO1B 5B4MD 1EDQA 5FB8B 1D5IL 2CIIA 3CMOL 3HMXL 3MUY1 3MNZB 5LWYL 3BP7B 2B0SL 1OAKL 4WHYH 4EVNB 2ZNWA 2DLFH 4PJGB 1INEH 3TO4D 3C6LD 3LRGA 5FAAA 3SBWC 4RMRA 4KXZH 2J5LC 3OJMB 1F4HA 4PP1D 3SO5A 3DX6B 4E42B 3L3DA 3JTSB 1J05A 1L9MA 1MH5A 2X1OA 3WUWA 1FVEA 1W0WA 4HDIA 5IB4A 2XNAA 3M07A 1BIIB 3S36X 4U05A 1S7UA 1Q0YL 4Y5XB 4AYFA 2CKBB 4DVBB 3T0EA 3V8CA 1WC7A 4FFYH 5GZOD 3JV5A 1XGTA 2X4PA 4LLQB 1MFCH 3CIQA 1GVIA 1A6AA 4YX2L 2ZUYA 1G7PA 1KNOA 2IFFL 1IARB 4YIQA 1BQLH 3LDBB 7FABL 5IBUB 3OB8A 5IOPB 4ELKA 4I48B 2YD8A 3QNYA 4AEIL 3IJSA 5J3HD 3STZB 1XCTB 5KVGH 2A9NH 5AZ2H 2IADA 1CICA 3RL1A 2CQVA 4RQQB 3WUWG 3JVGC 5HY9A 2X4OB 3KLDA 1F42A 5IB5B 4FXGB 3NA9L 2YEZA 4U7SA 5I1GL 1YZZA 4XBGA 5CFHA 1OTTD 3IFNH 3GGWB 2P42B 2CLRB 5CEXA 5I9QC 2DMCA 4WV1A 4XCNB 1CBVH 3V52L 5I1IH 1RZ7L 2HN7A 4MAYC 3EO0B 2EIBA 2FGWH 5FF6B 2F8XC 3O81A 4MCYB 1UH4A 3SE3A 3K3QA 3KGRA 3RZCD 3RVUD 2MCPL 1UKSA 3GHBL 4OD2B 3NIGE 4OUUB 2W0PA 4JFHD 2AP2A 4F3FB 5JZ7D 1NGQL 3BSZH 1R3JB 1JE6A 2VN7A 3SE4A 4OZHB 1MCKA 4RISH 2PO6C 2ENSA 5DJ2B 1IC7H 3WLWD 1NEZA 3MV9E 1FVCA 2F19H 2OXGA 1Q9LA 5DRZA 1BF8A 3VMOA 1U8HA 2G75B 3BZDA 3THML 4N1CA 5C0FA 4HBQA 3FT3B 3GJFH 5LGJB 2OMBA 1JJUA 1HI6B 3SJVD 4JM2A 2ZOLA 2MMXA 5D5MA 2OYPA 4JG0L 4Z0BH 4LF3A 2BMKB 3VGBA 3MXWH 4PJAA 4HWBH 4D9LL 4PJBF 5GXBB 2W0KA 5BQ7A 1PW3A 1MHEB 3MRFA 3CZFA 3RDTA 3S3SA 3FO0L 3LPWA 2GEEA 5C9JB 4JCLA 2XY1A 3P4MA 3BP5A 5IFAL 4JKKA 4KPHH 5FYJU 4G3YL 4W68A 4UIKL 3D85A 1AC0A 3DSFL 4M6AA 4JJ5A 3IU3A 1NEZG 3BYTA 2A9MH 3S5LB 4K71B 3X3FH 4LSQL 4OZGB 5TGBA 1WIUA 1NBYA 2P43B 1MCWM 4HX1B 4GKOA 1K4CA 2ATKB 3TLRA 3W0WB 5EUOE 4WHYG 1CFQA 3O6FB 2X9WA 1EERB 4G8FA 3UYRH 4EQ3A 2PW2A 4MA8H 4MA1B 5C0GB 5ACMA 4MNGE 2P8LB 3O2DL 1KJMB 3WN5C 1QQDB 2PYEA 1IZKA 5DA0B 1E4KC 1UWEL 1J8HA 2AKRA 2KKQA 1XH3A 2O5ZH 4E41D 5IHBA 3VXMD 1UZ8A 4YHNB 3NPZB 2F74B 4YEEA 3ZDZF 2R2EA 3AFLA 2ZSVA 2ARJA 4OD3H 4Z7QF 4G6AD 3MJ9L 1HHIA 5JW4Q 4JB9L 4EOWH 3T2QA 1S7QA 3REVA 1B6DA 1FYTA 2DKMA 4H26B <