3DUHA

Structure of interleukin-23
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
307
structure length
300
Chain Sequence
EIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAEEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of interleukin-23 reveals the molecular basis of p40 subunit sharing with interleukin-12.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/cytokine
molecule keywords Interleukin-12 subunit beta
total genus 56
structure length 300
sequence length 307
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10420 IL12p40_C Cytokine interleukin-12p40 C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3duhA03
1CDIA 4NBXB 5GGRA 5DI8B 5E8DH 2V5MA 1DLFH 3FAWA 2BFVL 3O6LL 4MAUL 5DRZA 1PEZA 3LIZH 2JJUA 3VFWA 4E0RB 3R8BB 3BO8B 4BSVA 4EUPH 3N06B 4QHUA 1Z9LA 2VERN 2ZCKL 1ZWIA 3TZVD 5B39A 4O9HL 4POZC 4LPCA 4ONFL 2XPGB 1FLRH 1NDGA 4NRYB 3MBEA 3AS0A 1JPFA 2NXZC 3ZE2F 5JOEA 5E2WH 3QUYA 3MX0A 1D9KC 1JHTA 1Q0YH 4MAYB 2IPUK 1WV7T 4M6OL 3QWRA 4JGMA 2J8HA 4CRPA 3Q5YA 3EUUA 3AREB 1X5ZA 4UNTA 1X5JA 3QSKB 4R9HA 4S1QH 2VLRE 3CH8A 5C0FB 3WFEL 3WDHA 3C60C 5I74B 1OSPH 4DGVL 1U3YA 4WEBL 4U3XA 4ZUWB 3D39A 1FE8H 1BQHG 4XP9H 2D03L 4J3UA 5GZOC 2VDKL 4H26B 3RVXC 2PR4H 3PABB 1QFWI 3RIFK 2RB8A 5T1KA 2EH7H 3HG1B 3D69B 4J3VA 3MBEC 5DEFA 4ZNEA 5DK0B 3SGEH 3L5JA 4CVXA 3MGTB 4GXVH 3QUML 1U6AH 5JQHC 3W5NA 4DUVA 1R3JB 5EIQA 3GMNA 2AV7A 3IXTB 3L3JA 3C6SB 3VGFA 3V79C 4J1UB 4KWUA 4YBHA 2GK0A 2QSQA 5D1ZD 4ALAH 2VE6A 3O6FC 3U0PB 3A6CL 5IP4A 3ME0A 5E9DE 4O2EA 3ARZA 1BAFH 2IADB 5KW9L 3O2DH 2GY5A 3E0GA 2YN3A 3HLAA 5JORB 3SGEI 1J87A 43C9A 2ZCLL 3SDAA 3QIWA 4QGTA 5DJAA 2OK0H 3LCYA 1G6VK 3K81A 1RFDH 2OTWA 4S0SD 4M8QB 2PYEE 3EDKA 5CWSA 2BNQD 1XZ0B 5JNYB 4DQOL 5C0RH 2VXVH 1NMCC 3MRHA 2GJ6B 3RAJL 3REWB 3I6GB 4RDQG 2DQDL 3O8XB 4R7DA 4HX1A 4I5BB 4WU5B 1JK8A 2ZSVA 4XCNB 1X5GA 3WFBL 2RHEA 1RPQA 3MA7A 4O5LL 1NGQL 4FQIH 1IAIL 2BCKB 5JQ6H 4YPJA 1KN4L 2Y36H 4KJPC 5L0QB 1OF2A 5CKGA 5JOFA 1R3IL 4DGYH 4M62L 1LEKA 5L8KB 3P0VL 1R3LB 1RJYA 4NQCA 5FDYA 4LFHG 1S7WB 3DIFB 1S9XA 4KMQA 4PGJA 1UZ8A 1B4JH 3RWCA 4KI5F 1IAII 4N0UE 2X5PA 2DQFB 2HAZA 3P4OB 2J6EA 4KZDL 4DN3H 5MEOB 3UJTH 3IDMA 1OTUC 3NZHL 1UVQB 2Q86B 1Q9KA 3RWCB 1OM3H 3VFUA 4WUUE 4LVEA 3FTGB 2EXWC 1U3JA 3D5OF 5EBMB 4R26L 3RX8A 1IQDB 2KKQA 1RUML 1F3RB 4LSQH 4K9EH 3WEXB 5FUOH 2GSGB 3DUUB 4N90D 1OWRM 3TYFA 1NAML 1Q38A 2PKDA 4ODXA 2E7BA 2WQ8A 4CNIB 5BRZE 4FQIL 4OFVA 1UH2A 5E2TH 3RQ3A 3IFPB 2J8OA 1FAIL 4J4PC 4CADB 2Y7QA 4XVJL 1T0NA 1CFTA 3OF6D 4XI5D 3U4AA 3I85A 1JWSB 2P46B 3ZSTA 1GIGL 4UT6L 3D2UA 4KGJA 1SVZA 3BPLB 3L3GA 1FBIL 3CVHB 3IDXH 3I6GA 5F96L 3QR2A 5ADOL 2NY1D 2DOCA 3ZYIA 5IKCB 3HC4L 5HYSG 2G75A 3O11A 4YHZH 3C08H 5F7NC 1IQWL 5L6YL 3SDAB 3RHWK 5I73B 3EO1A 1DE4B 4G6KL 5D1XD 4P2RA 3VXME 3ULVE 4RBPK 5D93C 3TLRA 5D6CA 1CICA 4K23L 4MD5A 1BQLH 4M00A 3U1SH 2V2TA 1LP9E 2F8VA 1GAFH 4OGAC 3MO1B 4LEOA 3LRHA 4F9LA 1FYTD 4JKKA 1YQVH 5IV2B 3LVEA 2GTZB 1QR1B 5FOBA 2W60A 4KROC 5I8OL 1M7IB 1S9VB 2FWOB 1J10A 1OP9A 3WNPA 3IXAB 3E6HA 3MV7B 3B6SA 5KJRH 5CZVH 1JZ4A 3QHTC 4JZOA 1BZ9B 3C8HA 2UVFA 5FYKU 3NMEA 5KVGL 5INCB 4DN4H 1A7RH 1I7ZA 4OCXL 1GC1H 2JLLA 1PG7X 3NH7H 2HJKA 3LN4B 1J8KA 4CADA 1RULH 2P5ED 1GZQB 1KXTB 1B9ZA 4DVRL 3B5HA 4S10A 4BQ9A 1N59A 4JO1H 3TV3H 3DMMA 2N1KA 3GHEL 1W0YT 1MPAL 1EHXA 4ODSH 5ESVA 1EGJH 2VLKE 1FO0A 3P9MB 3KPMA 3R06B 4XTRD 3T1FA 4OIBA 3L3HA 3EJJX 3OKNA 2EYRA 1KPUA 1FFOA 1MOEA 1TQBB 1KCUL 2BMKB 4P2YA 4DUWA 4I3RL 4N0YH 2B5IB 5DD1H 2LV4A 1J86A 1JTPA 3LD8C 1KPRB 5JW4N 3QEQA 4PB9H 5A16B 1DEEA 4UOJA 2ZUVA 1RVFH 3KPRE 1W8OA 1EX0A 3EOTH 2PO6B 1NAKH 3L5HA 2A6KB 5C3TA 4L3EE 2OR7A 4U4BA 4L4TD 1P6FA 3BZFB 1KN2L 4L8BA 4J6RH 4QGYA 5GRZA 1LO3L 2ZKHH 3BKJH 1KYOJ 1N8ZA 1S7QB 4P5KB 5EU4B 3U7WH 8CGTA 5F1IB 3UAJC 1W8NA 3ZDYF 3WIHH 4G9DA 1SVCP 3N85H 2BVPA 4M7JH 2V2WB 3BW9A 1HHGA 5H37G 1CR9H 5DMGC 3ZDZF 3VRLF 1EV2E 2A9NL 5GISH 4XRCB 3H9ZA 4LMQE 4OGAD 5DFTA 4F7PA 3WJLA 3RNKB 4HKBA 4QHLB 1IBGH 4NKMB 1YC7A 3D9AL 3MV9E 5IK3A 4X9GA 1MJUL 4JKPH 3UDWA 5HI5C 1W0WB 1TNMA 1WWBX 2VDNH 2R2HA 3LHPH 1YY9C 2AKRA 2OTUA 3IFNL 3T0BA 1NGXA 1O7VA 4APQC 5CGMA 1DJSA 2GTWB 1FDLH 1JWMB 3C6LA 4LCYA 4NHCL 1GHFL 5MEPB 2ZNWA 5C07A 1T2QH 2VXQL 4NZRL 4K3DL 2IMMA 3HAEA 3VFOB 4G6AC 5DJ0A 1LVEA 2GT9B 4DZBA 1XF5B 5FKAA 4JO2L 1MFDL 2PTVA 4WJ5A 1N6QL 2R69H 3ULUC 2OI9C 1IE5A 5C07D 4WWKC 12E8L 2X4OA 1PKQE 4HUXA 3L3GB 5BV7L 1LWRA 2H26B 4ZFOB 4LRNL 3JBG7 2QHLA 2R0ZH 3D87B 4X7DC 3RWGA 4QXWA 3NPSC 2VUOA 4HWEL 3F7PC 3RWIB 3MRQA 5F1NB 4ZD3H 4MJIE 2Z31A 5BJTB 4ZAKD 5C6PB 4P59H 4M9OA 1T1ZB 1RK1A 5ANMB 1LP9F 3K2MC 5IT2L 2IANA 1F97A 1PKOA 1AI1L 5D7JA 4PJHA 4OZHE 4ZUWA 3UYRH 5C70A 4JQIH 4Z8FL 2EEBA 1FL5A 4HUUB 5GGQH 2NY6D 2AJVH 4L3AA 1AH1A 4OZ4A 5B38B 3STZA 4MNQE 3PHSA 4NSKA 3QCVH 3UTZB 5EIIB 3GGWB 4H0GA 4YHPB 1ED3B 2IFFL 1OTSD 3JUYA 4JKMA 3UEZA 3TNMB 3R0MA 3MR9B 3RBGA 3AREC 4C59B 4U0QB 1ZANL 5DD5H 4OT1L 1A47A 2IPKA 1JNLL 3DGCR 5CMAB 4JJ5A 3UTSB 2OR8A 1XGPB 3DVFA 1X5KA 5D71L 1T66C 1MAKA 2WV3A 1QPXA 5FYJE 2GJ6D 1VSCA 1JGUH 1NLBH 5L88L 5HGBB 3SGKA 3HUJE 1CXFA 2R2HB 1QLEL 5CILL 1J1OL 5E8NB 1HSBA 3VFMB 3TJHD 4UINL 4RGOH 3F7YB 3QT2A 4FMFA 2FGWL 4ZPVB 1RZKL 4LBEA 1Z9MA 3ULSB 5LKNA 5AZ2L 3ARXA 4HIXH 1EK3A 5DJXB 2EIZB 4Z7WF 2NYYC 1KENL 2D31A 1S3KH 5DRNB 5CLWA 2P24B 4E41A 4QRPB 5FK9A 3MV11 5K59F 1T22A 4HLZG 3BZ4A 3QUMB 1E6JH 3L9RA 1KJ3L 4YC2B 1B88A 2WP3T 4JLRB 3KYOA 5B22A 1BECA 4ODWB 5HYJE 1F4HA 3PUCA 4KC3B 1N8ZB 4PRAB 4PRHB 4K3JH 5CD3A 1DCLA 4K7PX 1N64L 4ZUVA 1DLHA 4JHWL 4N9OB 4KPHL 2BY2A 2VKWA 3IU4H 4X4XA 1QSFB 2BOCA 5HI5D 4PJGA 4ZUVB 2LQRA 4DKFL 3BX7C 1KB9J 5DJZA 2DQFA 3WN5B 2NY3C 4K9EC 2R0LL 4LU5L 3FQUB 4JKWA 4LGPB 3VRJA 5C08E 1K6QL 43CAA 1QNZL 3IGAA 1EFQA 5IFAL 4R96B 4D9LL 1YNTA 3H7BA 1RIUH 3G5XA 2I27N 4WWKD 4GSDL 3ABZA 1S7TA 4GH7B 2BVYA 1U8IA 5J6GA 5KN5B 4KI5D 1AFVL 2MCPL 4YAQA 3WS6C 3MRMA 5DR5H 4KY1H 3M17A 5C0GB 2R39A 1TJIH 3U46B 4IRJD 3RIAK 3FCTA 2Y1VA 5D70H 2YWYA 2P8PA 5D7LA 1PQZB 4HS3A 4RA0C 2F53B 5EUKB 2JF1A 2XV6B 3MZGB 1HHIA 4NN7B 3L5WB 5E9DB 2CMRH 5EO9A 5ID1A 1EH9A 1DQMH 3WSQL 4NPYB 1K85A 4FABH 5F9AC 2ZOKB 5HYIA 3ARBC 1ZS8B 3RWGB 5CEZD 3LEVL 3FQXA 1FG9C 3HE6B 3QCTH 3AMLA 1REIA 4KK5D 1ADQL 4HIEA 1J5OL 3HR5A 2UV3A 5IVXA 2UZYB 2XQYG 2YUZA 4OD3L 2CPCA 3S6CA 1XR9B 4D2NA 3QPQD 1IM3B 2XA8H 3SJVD 3CMOH 4HV8A 1JZ2A 3QO0B 4YHKL 5A2JH 4F9PA 1QYGH 2OJZL 3TJEH 4W6XB 4X9FA 5JA8B 3MBXL 3GB7A 3S96B 4BFGA 1MHCB 1A8JH 1UXSA 4XNYL 5TPWL 1CICB 2FIKA 2I9LA 2OTPA 4Y4FD 4CMMA 1UM5L 3NAAL 5EIVA 4RWYL 1D6EA 4FQHB 3IU3B 1I8KA 4JRYE 1KCRH 5ITBL 3KPSB 3ARQA 1UM4L 4BSWB 5FF6B 1IC5L 3AAZA 3S5LG 5BVPH 1CTOA 4EKXA 2LTQC 5HI4C 2VAAA 4ZFGH 3ZYOA 4UV4H 4GRLD 2BZDA 3E3QE 3ZTNL 1IM9A 2F58L 3DV6A 5FYJU 3WUWG 2E9JA 4GRMB 1F58L 5FF6A 5CINL 1MAMH 3T0WA 4LSTH 4Q2ZB 3ZT6A 3PF2A 5JA9A 4HAGA 1MFAL 3PGFL 1TCRB 2NNAB 3TH4T 3AVEA 1I1AD 4MJID 1YN6B 4MHHI 1V3JA 4PBXA 4MB3A 2MQ0A 4HW6A 3D48R 3QIUA 4MD0B 4QO1A 4OM0L 1XGRA 3EKCA 4M6OH 1J1XL 5TGBA 5BRZB 5DJ8B 1OAUH 3V2AR 2QJDA 4NJAL 2W9DL 5GSRA 2PNDA 3VXOB 2WLZA 2OQJA 4TSCH 4Y16D 1A5FH 4JG0H 2FJGA 1Q9KB 4ZAKA 5ITFA 4U33A 4YDJA 3GI9L 1MIMH 4WFGD 1EO8H 2WUCL 3TZVA 4HV8B 2NQCA 3ARFA 1KTLB 4JFXA 4Y2DA 2UWEA 4O58H 5SX5H 1Q9OA 2P8LA 1SY6H 3TBWB 4I9WD 3HE7A 1KTDA 5IHBA 1CDCA 1P4BL 3ZHDA 4OLYH 3D18B 1EMTH 4G8GD 4KXZH 4WO4A 4XWOD 3HE7D 2ENYA 5C08A 2APWA 1UWGH 5FUCE 4FQCL 3LN5A 4PV8B 3WXVL 4QOKD 4GAYA 5HYJD 1UCTA 1E4JA 5M95B 1NANH 2DJSA 3GO1H 4B0MM 1TQCC 3VCLA 4I5BA 1CIDA 2BRQA 4R90H 1EHLH 4E41D 5DHXB 1A14H 1KELL 3OQ3B 1MCJA 3HS0B 3QO1B 3T1WA 2NPLX 1U8LA 2EDRA 1EPFA 3O8XA 4R7DB 2C1PB 2PW2B 4TVPD 1GGBH 2GW5A 2HP4A 4Y19E 4DTGL 2ZG1A 5DHVA 4ELMB 1YEFH 1U91B 1AHWC 5D72H 4ZSOA 5DFVC 3O6FB 5E8OB 3DVNB 5IROA 2KUTA 5DC0A 3VU2A 1I1AA 4MJIA 1MCDA 4N0RA 4LP4A 4BK4A 5T33L 2OXHA 2YD2A 3MLZH 1A7OL 2AGJL 2AP2A 5F9OH 1EEUA 3DXAE 2OQJB 1B0GA 4E41E 1GGYA 1R5WB 2DQHL 4QHNB 4Y4KA 4ZAKB 5ITFB 4HPYH 4ZUSA 4X6FB 5EZLA 4AL8L 4FN0A 4XXDA 5DK0A 2G2RA 4OIAA 4RSVA 1EAJA 3PGDB 5F70A 1PBYA 1VPOH 1U93A 2GUOA 2MFNA 4U2YA 3SDCC 3LKRA 3ARFD 4IDJL 3C87A 4BH8B 1YN6A 4R90L 4CW1B 1EHLL 4HGWB 3KJ6H 3MYJA 1TJHL 1FNEA 5IVOA 1KJMA 2B2XL 1BBJA 3UBXI 4EXKA 5AAWA 4FFVC 3QB7C 4Y4FC 1I7UA 4Y4HC 3EOBA 3O45A 1PKQA 3O4OC 5F1OB 3T3PE 3ARRA 3NACH 3GRWA 3QDGE 3L3DA 4UDUA 4CJ1A 5HXMA 3S36L 1T04A 1TMCB 3QUXB 4YE4H 5H94A 4L4TA 5EOCL 3MV9A 3CUPB 4MA1B 4WNQA 2YXMA 3QUMA 1BEYL 3K2UH 5E24E 4L29B 3P0YL 2FJFA 1RJLB 3GHBH 2IQAB 1OPGH 1I7TB 4LPUA 5GHWL 1U8PA 2AJ3B 4R97C 4PJ5D 1V8HA 5DJYB 3FN0H 1XCTA 1F3DH 3B5GA 1L6XA 1HEZB 2XZCL 3TCLB 5EOQH 1ZHBB 15C8L 4Q9RH 3MLSH 3TNNB 3ZE1F 4XGZA 4FFWC 2XPGA 4S1QL 1QO3B 1T89A 3BH8B 4RAHA 2X10A 5F7MC 2J6EH 3KVQA 5D1ZB 3U9UB 1NDGB 1UKSA 1C16B 5FM5M 3T0EA 3K3QA 4KHTH 4Y4HA 5C1MB 4YUEL 1AQDB 1C5DB 5I30L 3HHRB 3IF1B 3OMZA 4OZFA 2DWDA 3C60B 3IVKA 4BZ1H 3UTOA 3MMEA 3Q3GA 1A02N 4FQ2H 1BGXL 4PRHE 5EU5A 4AIOA 3S3JA 2PTUA 3TYFB 4PJIE 1I7RB 1FNSL 1NAMB 5C6TL 3D6GA 2K9UA 4MCZB 1TVHA 4GS7B 1WAAA 4KKCD 2VWEE 1X7QA 3VWJB 3RDTB 1MLCB 1R3HA 1JYWA 4GG6B 3TVMB 3CXHJ 3NCCB 1F6FB 1M71B 3RNQA 3CC5A 4F57H 4NOBA 3PV7A 1M1SA 1VDGA 4DGVH 5I66A 3KLHC 4OKVA 2HKFH 3X3GL 2ARJA 1MJ8L 3ARED 3C5ZD 3FT3A 2IADA 1QLRB 2RCSH 2H32A 3TEUA 2R9HD 4JFEA 1T89C 4O2EB 4WHYH 1BJ8A 3QIBB 4U3HA 3BSZH 3MRNA 3UP1A 1CLYH 3LOWA 3MLPA 1KCSL 3A67L 5CZVL 1CK0L 4IRSD 5LG1A 3GMNB 3IXTA 5ADPL 1S78D 4PPTA 1LEIB 3MV8E 5JIIA 2OLDA 4TPRH 3Q2CA 2HJFA 4X4XB 1J11A 3LKSB 2VXVL 4JFOB 1PSKL 3HRZA 2FX9H 4YFDB 1UENA 1TVBB 5D7JC 3MXWL 4Q6IC 1U8NA 3O4LA 3UTTE 4QHMA 3VFTB 3E2HB 2CDFB 3NCJH 4IRSA 3RL2B 4O02L 4R3SA 4DKDC 4KJYA 3FFCA 1HHHB 5EU3B 3PWUB 2F5AL 1R0AL 5D5MB 1D6VH 4M6ML 4MDJB 3Q1SL 3BN9D 3RVUD 2ATPA 2DMCA 1DBKH 2DB8A 1LDPH 1LP9A 4P57B 9CGTA 4MA7L 5HDBE 2Z8WC 3QNYB 1LK3L 1WIPA 1I1FA 3DUHA 4MS8D 5ALBH 5CFHA 2X4SA 2BSED 2PXYB 3VXRE 2ZJSH 5HVFB 2LVEA 4XXCC 4XBGA 3QWRD 1YEJL 2BNQB 2Z93A 4X7SH 4TPRL 2AV7B 5FCSH 1OGAB 3QA3B 4APQB 3K8KA 3LRGA 3QUYC 2IFGA 3C5SB 1RUMH 2VR4A 1K8DA 4XMKH 4JN2A 5C09B 4FQXD 4OFDA 3SJVA 4KTDH 3GSUB 2PETA 3EYVB 1N2RA 1I1YB 2A6DB 3T8XA 4EN3B 1YPZB 4X6BA 4NWTH 1EUTA 4X9IA 2X1OA 4FQLH 2X4UB 3FOLB 3L3HB 4H1LB 1H3PH 2UZIH 4BKLA 3JV4B 3QFDB 3VFNA 2FB4H 1A7QL 5H2BA 3FT2B 5F7UA 2VDOL 4U1NA 4XVSL 3TN0D 4XBEL 5L2KE 2B7DT 4IIQB 2WLYA 3NA9L 1X5FA 5DT1L 4RFOH 4OSUL 4QLRA 3MRLA 3NZ8B 5I0ZA 2A73B 3D3VE 4OJFH 5HDBF 4BA8A 1DEDA 3L3DB 1EJOH 4FQ1L 2WBWB 4PJHB 3H42H 1N4XL 5EA0H 2Z31B 4XP5H 4YEEA 5BJTA 2APTA 2R2EB 1E6OH 1Z3GL 3TN0A 3DWTA 4HBCL 5ANMA 2ITDA 4OLVL 1MH5A 1KEGH 3QUMH 4FG6C 4Z0BH 5KS9E 4YQXH 2MSPA 1YNLH 4F7TA 4N0FA 4PREB 1SJXA 1MHPH 1MCIA 1T0MA 3CSBA 3L5XH 4JFFD 5BW7C 3CFBA 3EYSL 5LWYH 1CDGA 2JK5B 1JL8A 2AERT 5D1QB 5FGRA 2JELH 1DVFD 5DXWA 4JPKH 3HRPA 4MD4A 1OHQA 1QSEE 1U36A 2I25N 1U41A 5D7SH 1ULVA 2EXWD 4YHLL 4QRQB 1G9NC 4PJBE 5C9KA 1QR1A 5DJ0B 3WS6A 2RAMA 4XB7A 5A40E 3MO1A 4LEOB 1Y0LA 1SYVA 1KXVC 4Z7VF 4PLJC 4XPBH 5EWIH 1HINL 3BWUC 4HJ0D 1J8HB 3H3PL 1HHJA 4JDZB 6FABH 1U58A 1WBZB 4IEFB 4MJ4A 3OSKA 4NQDB 4S2SA 5DTFB 1W72A 5IB4A 1RU9L 1KC5L 4JY5H 3DX8A 2CLRA 3L1OH 3O41B 4CGTA 3ES6B 4M1GH 3UTPE 1T83C 4NT6B 1HH6A 4KI5C 2WSKA 2XRAL 3LS5L 5FGSA 2EIEA 2YMXL 1CDYA 2FO4A 4EQ2A 1G7LA 2DQIL 3X11A 4KKAC 5CBEB 1I8IA 4TRPH 3QUYD 1AJ7H 3HR6A 4JHZA 4JE4B 2BC4B 2JJWA 4X4YA 3D18A 4YBLB 1PG7W 1DBJH 5D93B 1IZKA 2GKIA 2AEPL 2JCCA 1QYGL 5LCVH 3ZTJH 1NBVL 4QEGA 4X6CE 5L2KA 2BRRH 2VXSH 4OGYL 1CFQB 2X4RA 1N26A 1UCBL 1P53A 4TVPL 3WUWB 1FO0L 5L7XH 2XN9B 1UG9A 3BYYA 1NMAL 5MERB 2NY7H 5C0EB 4OF3A 2GCYB 4XMLL 3MRDB 4PJFA 5DVKA 5D7IE 5EZJA 4L8DA 2VNCA 1KC5H 4JY5L 2HFFA 3RTQC 3WIHL 2FX8L 2D4FA 1UM6L 4ZQKA 2I60L 3MNVB 3ILPB 3GUTA 1ZTXH 1J88A 1TPXC 3P40A 3P0GB 2C26A 3VW3H 2XWTA 5GGVL 1HKFA 4LASH 4OFKA 1IEAB 2Z8RA 4QXTA 4Q2ZA 3RUGF 3SO3B 2E6PA 5ISZD 3BQUB 1PAMA 1MRFH 4J6RL 4OLXH 1FNGA 1U2HA 4FXKB 1CF8H 1OW0C 3LMJL 1TZGL 1CICD 4M8QA 4YHZL 4G8FA 1HH6B 2A9ML 1G7PB 4ODBD 4ZXBA 3IFOA 5E03A 4KI5E 1TTUA 4L8CB 3A6CH 2DF3A 1TLKA 3PJSB 3O6FD 1PYWA 2X4PA 3LD8B 2AJZA 1BOGB 2B1HL 3MJGX 1KT2B 1BQLL 3U1SL 3EO9L 1DDHA 3F7VA 1MCCA 4RAVA 3WL9B 2LAAA 4JPIB 3D3VA 4NC1E 1IEHA 4HSQA 4YWGL 3T0AA 4ETYA 2VE6B 4KJPD 4LSSL 5T1DL 5ECJE 2BNRE 2GK0B 5SWZB 1H5BB 5AYUL 3FB6B 2JCCB 2ZOLB 1AGCB 3VGAB 2J8UA 1QD0A 5IMLA 1RULL 1M7XA 3JWOC 1J9CT 3N1MC 4AY0A 3PDGA 3HZVA 4JO1L 1TTGA 4Z7OF 3NIGE 1A2YA 1MEXL 1QBBA 4Z5RB 3GO1L 1ZHLB 5JXAH 2VQ1A 5FO7A 3VH8G 2F8OA 3PWNB 4ZXBC 2HWZL 1S9YB 2AJVL 4OCXH 5F6IC 1S7XB 4P3DA 3KR3H 1KLUA 3NFSH 4BZ2H 3MRGA 2W0KA 5DD1L 4EUPG 2CRZA 2IH3A 5KS9F 3ZKQD 2XY1A 2G60H 4O4YL 1N5YH 2EE3A 1FNFA 2I07A 5DA4A 4ZDHA 1EEYB 2NW3B 1Z6JT 4CNIA 3EJYC 3GIZL 5K9QG 1AC6A 4IOIA 2AVGA 3VXRA 5CUSL 1FN4A 1OQOA 3D0VB 2XTLA 4YAQB 3BPOB 4UQ2B 4KZDH 3FTGA 5J6HA 4Y4KC 4PJ7F 2Q86A 5JHDA 3SCMC 1Z9OA 5E95B 5F6HI 1ZGLM 4Z0XA 1MIEH 1G7JA 1X4YA 3VFGL 4Z7QE 1LMKA 1S9XB 7CGTA 4IRZH 1PY4A 5I1GH 1NGPH 2G5BB 3O6LH 1OGAD 4HPOH 2QQLH 4LCUA 1LEKB 1BOYA 4KTEL 1IILE 3DIFA 4TSBH 4JJHA 3VWKB 4JVPA 4G3YH 5FYLD 1IM3A 4PJBA 3G08B 1DANU 4PBVC 1T5XB 5KSAB 3QHZH 2OX5A 1RURL 1D5IL 1X4ZA 1R6VA 5HHXL 4X6CF 4R26H 5DZLA 5TQ0L 3BO8A 4YE4L 2O5YH 5SWZE 1ZHNA 5C71A 4LCWE 5A43C 5FGBA 3H7LA 3V5DA 4JM2F 5LAXB 1BVZA 5DD6A 1OP3H 3OTTA 4ONGH 5J0BA 1A4JB 4BK5A 2ID5A 3NN8A 5KS9A 4JFEE 5AG9A 1GGCL 2HVJB 4PB0H 1SJEA 3N9GH 2FBOJ 3FFCB 1E27B 1S9WB 5HBBA 3QCUL 5CP7A 3O9WB 4D9QD 3KPNA 3GMOB 4AIZA 1GHFH 4QTHB 1GIGH 1OSPL 4UT6H 5TH2B 1A6VL 4A2MA 1R5VB 1T1WB 2Z4QA 5FFLA 3U4BL 2R8SH 1FGNH 2EKJA 3GBNH 3FQUA 3BAEH 4WFGE 4OFYD 4RIRB 2VDQL 4PJ7A 5LGJA 3C5SA 1D9KB 4OZGB 4NUJB 5CMAA 4HH8A 3U0PA 4FFYL 4I0PC 2V7NA 3WIFA 4XBGB 4YUEH 3LEXA 4KPHH 2ZNXA 1MWAH 3SO5A 5EC1A 3QDJA 1AGBB 1NFDF 4NHUB 5T3XL 2QLVB 1ZV5A 5D2NC 3PV6B 4HIHB 1XIWD 1BGXH 3VD5A 4DK6A 4ZMAT 1QA9A 3UDWC 2DQDH 4LPWA 4S1DD 5DEFB 1BQSA 4GBXA 3ZE0E 3WNMA 1Z0MA 2FSEA 4MQ7B 4EI6A 2IH1B 4H1LG 2O5XH 2DQEH 1EXUA 2XFXA 4XP4L 2DQUH 4OUUA 3DGGA 1LEGA 5HHNA 3FO2B 4NRZB 2B39A 1AR2A 1PW3A 4OZIA 4C4KT 2NX5D 5IESL 4MAYC 5EBWA 2ZCLH 3NCBB 1JGLH 4WWKA 3HNTH 5KBNC 2PW1A 4GRWB 4UDTA 1V7NH 3QJFB 4LCIL 5F7EL 1FH5L 4Q58C 1FP5A 3WO4C 3VG9B 5L8JB 4QRUA 1INEL 3RFZC 1WF5A 4H1LA 1MHHA 1RVFL 5E8PB 2C1OB 3AC0A 3VXSE 5SWQB 5IG7B 2X9WA 4Z7UA 2HTKC 3SBWC 4TUJA 4ZFZA 1ZANH 3MJ6A 1XMWA 4L4TE 5J9PB 3DARA 5H35A 1FL3A 3EGSB 3U6RA 1MFCL 3B9KB 4YDIH 2XNAA 5IF0A 1D9KA 4OZGA 2YXFA 2BVEA 2V9QA 2AABH 3QQ4B 5HHME 2Q87A 3FFCD 3H3PH 1IL1A 3IDJB 4WEUD 1MJ7L 2DQJL 3GSNB 3SE4C 5KTEL 5ID0A 4IRSC 1UB6B 3NACL 4HDIA 4PGZA 2XT1B 4L1DA 4PS4H 5DUBA 1N3NA 2VLRD 2NZIA 5LGKA 1E27A 1K4DA 1S9WA 4UDTB 3BD5A 1DSFL 2BDNH 1KJ2A 1YY8A 3MLUH 1FNHA 5GRXG 1NGYB 3UJTL 1WISA 1UACL 3HA0A 2I5YH 1H15A 4AH2B 1K3ZA 1QSFE 2BSSB 1KJ2B 4BH7A 4CN4A 8FABB 4LQFH 1IC4H 5ICXA 3RX7A 2X6MA 5HI3D 1HQ4A 5F7DA 3O2WL 1HHGB 3GSWB 2XN9E 3RJQB 3SDYH 4I4WB 5TQ2H 4N0UB 3SE9L 1RK1B 1DQDH 1RUKL 3OJMB 1QKZH 4JQVA 3QZWA 1JF6A 2D03H 32C2B 5FHBL 3UCRA 5K9JH 1A6TA 3ULUD 2GI7A 1Q9WA 4QRTA 2KZ1B 1G9ML 2BXYA 4EBQH 1RK0A 1CFBA 3QRFM 3TNNA 1FIGL 3MCLL 2MQ3A 2NY6B 5I1JL 3SKUD 1UB5A 5BZDA 3F5WB 3MCKA 3P3YA 1XCTB 3HC4H 1MHHB 4NQSA 1HXMA 2H8PB 3PXHA 5DGQA 1CT8B 4LASL 3UTTD 3TVMC 4FQXC 1JWUA 4FQCH 5DLMH 3VFOA 5IR1B 2WUBH 5E5MB 3CK0H 4PRPA 1OT2A 2Z9TA 3O3DB 1M6OB 3QCTL 4AG4H 1SEBA 2X4QA 3UO1H 1MLCA 3PHOB 2HTLC 3EOAA 1MVUA 3SKJL 2AKRB 2OTUB 3S34L 4CUCA 1ND0A 4OD3H 5EZOH 3PWLB 4O58L 3TN0C 1NCBL 3UYPA 3GSQA 3FMGH 4ZTPL 4DOHB 1DFBL 1X6NA 3SY0B 3ARBA 4JPVH 2DLIA 4PJ9C 5HI3C 3MRGB 1TFHA 3TA3C 1GZPA 3VCLB 1A1OB 1QACA 3RGHA 3VWJD 5C9JA 3KYNA 3QDJB 3OKLA 5FA3B 3FRPA 5CAYB 5LQBL 1RIVL 4NZDA 3QH3A 2G9HB 4Z18A 2X89D 5F8QC 3I3BA 4Z8FH 3D85B 3STLA 4Q9QH 1FZOA 2D9CA 4HC1L 3IXAA 2IAMB 5FYJD 3LN9A 4NQDE 4JFDD 4PJCA 1B0GB 4DCQB 3FT4A 3C5ZC 5J1AB 4IRJB 1A6ZB 4U0RB 4PRDB 1FPTL 4MQXD 1VEMA 3KXFB 1H3WM 4QT5A 2ZCHL 3HMXA 4ODSL 3RKDC 3Q0HA 3TZVB 4ZFGL 4F3FA 3HFML 1JZ8A 4PLNC 4OCYL 5I73C 4P4KA 1Y18A 3ECBA 2NCMA 1MAML 5T33H 2DICA 4NC0B 1CGUA 1IAKB 2AJZB 3QPXH 1BQHB 1M7DA 4PP2A 3V4UL 1I3RB 1JV5B 1PLGL 1A1MA 1RIHL 4AT6B 3K80A 2FR4B 4LSQL 4LOUD 1CL7L 1VACB 5D7JD 1IGJB 2ZPKH 4FXGA 2BSTA 1YN7B 4HJ0C 4X0KA 35C8H 1P7QD 2HVKB 2P5WE 4HKXB 1PDKA 1C12B 1LHZA 2PCPB 2Z31D 2XIDA 3UX9B 1EBAA 3HZYA 3BP5B 2CSPA 3RHWF 4WUUA 1MRDL 1ZLWH 3C5ZA 3ZZ1A 1CFVH 2AXJA 2NY4B 1NBVH 3MQIA 2A38A 2R4SL 3L7FB 5GZNC 2QKIA 3MTRA 2DIJA 1WTLA 5E1AB 1JRHL 3QXDA 1CL7I 4Y2DD 4ZQKB 4CVZA 1U3HD 1BX2A 2WINB 1JGVL 5GISL 5DS8B 4EQ3A 4QCIA 1P4BH 2KQNA 5BQ7B 5EOCJ 5IHZA 5KZCB 2PO6C 3TZVC 3C5JA 4G7VL 4JB9H 3BI9X 4XZUA 5ENWB 1BJ1H 2ZUYA 1UM6H 1YQVL 5A2FA 2ICES 1WGOA 1OT1A 1RZKC 4UT9H 4POUB 3CPLB 4X6DF 3CZJA 4C56D 1S7RA 4G6AD 1EJOL 3RPIB 4DQOH 4YPGA 2FD6H 1FGVH 1RJYB 1T1YB 1UC6A 3CFDB 2HLAA 1G7IA 5D96B 3QQ3B 4F37K 5I1LB 5D1XA 4GAJH 4U1LB 1JYVA 4JHAL 5JOFB 1AY1L 1XFPA 3TO4B 4RBPH 1PZ5A 1IZJA 3BDYL 3IJYB 4N8VB 2YPLA 5I1DA 2X1XR 1CFVL 1EZVY 4FXGB 1YYLL 1FYTA 5JDSA 2CH8A 5D7IA 1YEDA 1NMCB 2IMNA 1NJ9A 4ZSOE 4F7EA 4QWWD 4XCNA 2HT2D 2R29L 4DGYL 3LRSA 1I9EA 5FB8A 5DRWA 1BFOA 2PYFB 3V0WH 3DX8B 1I8KB 2FEEL 3TV3L 1CICC 3QAZB 4N8CH 1BZQK 2V5TA 2MOVA 4X9BA 4A6YA 1KB5L 3KPSD 4GT7A 5GGUA 4NM4L 3PQYB 5FECA 3FB7A 4WGVB 5I8CB 1RI8A 2APVA 3LH2H 5C0CB 4XAWL 4X98A 1MHCA 1MCWW 3MGAA 5AWNL 5GJSL 3OAYK 1YNTB 5D5MF 4JANB 1HINH 4JDVA 4W68A 3S88L 3CFEA 1A1NA 5I71B 2DM3A 2VLJB 4AZ8A 1AY1H 4I2XB 2NXYB 2M26A 2WIMA 2KL6A 5TGBB 1QBLH 5TF1L 3JVGA 2XRAH 4O02H 1LGVA 3EAKA 1TETL 3DETD 1I8MB 2Q8BH 3ISWA 3A6BH 5IMKB 3V8CA 1SMAA 3MGOA 3QEUB 1FSKC 4ZS7H 2ICWJ 3V0VA 4O9HH 2FLRT 1MJUH 1H0DA 2PTTA 4ODVL 5TDNA 4OM1L 1FFQA 1P6AB 5C7XL 4BFIA 4WUKH 3FO1A 3OF6A 4FMKA 2XWTB 4PJDF 1M05A 4XWGH 3MRBB 4AQ1B 2P7TA 1I1AC 5ICZA 4IMLB 3UAJD 5MHSD 4XAWH 5FYJL 5CILH 2KH2B 3BT2L 4YFLI 1EERB 3D9AH 1JE6A 1P5UA 1U8JA 3F6IA 3G5YA 2CLRB 2OMBA 1YEJH 4UOW1 5IMMB 1HILA 4MA3A 5GS1C 5F72S 1DQJB 4Y8DC 2VQUA 3RVUC 1HI6A 4LF3A 4MAYD 5LVEA 2SEBB 3JWDL 5HHPB 4QHKJ 4RAUB 3G6JB 4LL9A 3FT2A 4RNRA 2P43B 3ARDB 1RUAH 3D0LB 4O2FB 5IOPB 3CGTA 1D6VL 5DDHB 1T4KB 1MCOL 3SDCA 1OP5K 3LV3B 3EYUL 1LDPL 3C8KB 3NFPB 4PRNA 5E94A 2ADIB 2DQGL 1YPZA 3C09B 1BD2B 1D5MB 1U6AL 3LS4L 3NABH 1JPGA 1CGVA 1H8SA 4R4FL 5T1MB 2WWKT 3NFNA 5E6IB 5CIPA 3BP6A 4HF5L 5GQBA 5KVDH 4LLQA 3VGEA 4EN3C 3MLWH 1LE5B 3V6OC 4G42B 1MCBA 1T5WB 2X1QA 3VA2C 5EC2A 5AEAA 3OKYA 4F7MB 4PRAA 3VGDA 2M8XA 2UZXB 3FFCE 1YYMH 4Y5YB 3WO3B 1F6AA 2XXCB 3VXPA 3WYRA 1KB9K 3JWOL 2HFEA 3STBA 1MH5B 3LKNB 3SDYL 4NKIL 5K33A 4PJEB 1ZA6B 5DQ9B 5JMRA 4AH2A 3DXAB 1RZ8B 3HI6L 5EOTB 3CFCL 1NGYA 5HSFA 2C3WA 5AUMA 4XNZB 3TO2A 4TUKL 4U1MA 2YHGA 1LD9A 2MKLC 4QYOA 1NCCL 5IQ7H 4PJ9B 1WCBB 4YGAB 3SJVE 2CKNA 1YEEL 3ULSA 1BREA 1W72H 2ITCB 2ZSWA 3K0WA 1A6VH 4I0KA 4J23A 4JM2A 4GKSB 1VGKA 1OAYL 3QG6A 3FOMB 3U4BH 2R8SL 2QEJA 3UPRA 3ZL4L 4U1NB 3GSOA 1T80A 3E2HC 2E8YA 4K3EH 4AENA 1FJ1A 1QFUL 2OZ4L 1YDPA 3P4NB 3X14A 2ZUQC 2AQ3A 1A6WL 4XVUD 1WCQA 1CBVL 5DJ6A 3N1PC 5KZCD 5SWSB 2A1WL 4XPFH 4JN2B 2O26U 1HCFX 2FNBA 3PWJB 4Y5YC 4YGVB 4QRTB 4RGNE 3TCXA 1FFNB 2FATH 1TTFA 2ZUSA 1YEIH 4PG9A 4Q6IA 4PJXA 4NCDA 2ITDB 4M8VA 1KCVL 2F53E 4NQEB 4PTUB 1CE6A 3RZWA 5FA4B 1KJ2H 2A9NH 5E8EB 4L8SB 5HTSA 3MA9H 2DI7A 4JFQA 7FABL 4PJXE 4OUUB 3R4DA 3CZFA 1F90L 3VGGA 3U0WH 2NLJA 5DI8A 3IT8D 3IDGB 3QHFL 3P9WB 1W0WA 1KGCE 1OGAE 4FQQA 5IK3B 4UUJB 2DTSA 3OKOA 4B50A 1H9VA 3DV4B 1FAIH 3TPUA 3B3IA 3RWEB 5GS1B 2IALA 3HC0B 4GKOA 1U95B 3RWIA 4B41A 4XNXH 4PR5B 5CEYB 4LLMA 1CZ8H 2XZZA 3O3UN 4Z78A 4W70A 3B4NA 1P1ZA 4K94C 1UM4H 1T21B 3D25A 4LEXH 1J1PL 4JHWH 2B1AL 5HPMA 5J06A 4Z7WE 5IW3A 4QNPF 3VXRD 4FTVE 5TE4H 1AD0A 1LK2B 4U1IA 5ANME 2X4OB 1QO3A 1RZGB 4PY8J 3OJ2C 1ZEAL 4D0CA 3V6FA 4F7CA 1FRGH 5TDOB 3T77B 1SBSL 1RD6A 3MRKA 2CUMA 1HWHB 4AYFA 4UTAL 1T03L 3FZUD 1OTTD 4PS4L 1FDLL 3S37H 4P2QA 3LB6C 4LPYA 1C5CL 1DSFH 2BDNL 5K9OA 4CDGC 1CDBA 1UA6L 3NA9H 4Q9RL 2EZ0D 1DUZA 3PL6B 4XCEA 5DEGB 3EJZD 3V5KB 3CC5B 4M7ZC 1QSZA 2GJJA 3LEVH 2R0WH 1DQLH 4UIKL 2OZ4A 1KB5B 4XNZC 4U6XA 3QI9D 5CJXC 5I19L 4R4ND 5EORL 1QSFD 5DD0H 3RI5F 3FQNB 4RGNB 4OZFH 5TQ2L 1YA5A 3U4EB 3VWJC 3QWOB 4P23C 3B9VA 3TT3L 1MWAB 3WFCL 1X5XA 5GS3A 3VFRB 2Y07L 1D5XB 3VXMB 3LIZL 3GMQA 5B4MD 5CBAB 1YNKH 2XY2A 3VRIA 1JJUA 1ODAA 4WI6A 3ARGA 3NGBB 4ZO7A 4MGXA 3KYKH 4GAGL 4Y19A 2R4RH 3PQYD 1WVZA 3HNVH 4UAOB 2OJZH 3VDBA 5TE7H 1M7IA 1NAKL 3VXUD 3ARWA 3X3GH 5IIEA 1R5VA 1A3RH 4XPHH 3SDAC 3QCVL 5EU6A 4HWBA 4PB9L 4JFZH 5CIPH 3ARUA 2VXTH 5GGTA 5BVPL 3SQBA 5C2UB 3OKNB 5BO1L 3GMOA 1OARL 1UXWA 3VXRB 4POZD 1FG2B 3VWJA 4LIQL 1K9TA 3PQYA 5FECB 3CDGB 3QUKA 3TT3H 4Y5VA 3H0TB 3UTSD 3QDJD 3V7AG 2DM2A 3DPBA 3GIZH 5IKCA 1IGCH 3OR6A 4NM4H 5EOCH 3NAAH 2VXSL 5I1AB 1JNNL 1TJGH 2K7PA 4R8WH 1RQ5A 2W9EL 2Z8VC 2VLKB 3TESA 4Z5RA 3H9SB 1D5BA 4LDLB 3CMGA 3X12B 5BW7A 1MI5B 1SY6A 3ARGC 4LSTL 5L7XL 3D2UB 2WBJB 4V2BA 5FCUL 4L9LA 4K3JL 1GL4B 3MLRH 1AJ7L 2D7NA 4NWUH 5BMFL 2HRLA 1S7QA 4P5KA 3GSRB 1OB1B 3O3AA 3ROOA 4JO3H 2OBGA 2BNUA 2AEPH 3MPCA 1JNHA 1KENH 3RPIA 4ZFOL 5DC4B 1MQKL 3QI9B 4NHCH 1PG7H 3W39B 3FHAA 5SWZA 1IVLA 1G7IB 1RUQH 4MQSB 4YZFF 2W60B 1VERA 1KLGA 3U2SB 3RVTD 5CJOH 3VXUE 1NCDH 3V7AE 3AROA 2JJSA 1G7MB 3V7MA 5IVXF 5E2UH 3W9DA 5A1AA 2QR0A 5GIRB 4UU9A 4YNYA 5CGYC 5IJKA 3TWCH 4Y5VC 5IB3A 3B5TA 1BWWA 3UZQA 1BMGA 5EN2A 4G9FD 3NTCH 4J12A 3LQZB 3T4YB 1L0QA 2DIBA 3WJJA 5IQ9A 1ZLWK 4S11A 5HHXH 1FZMB 3PDOB 4K23H 4D9QE 3D0VA 5J3HD 4JN1L 3OKEB 3LMJH 4UV7H 1A7RL 1KIQB 5GSVB 5C09D 2VABA 3OKDA 1R3LA 4HCRL 2FZ3A 4L9LC 4CN6A 4UTBL 3IJSA 2Q6WB 1DVFC 2IQ9L 1H0DB 4HJGA 1N6QH 1QSEB 3AUVA 3BVNB 2YA0A 3BP5A 4PGEA 1JNJA 5FEBA 3O2DL 5GGVY 5JW5A 4IMLA 4TOYH 5J11B 5DRXA 1EMTL 1QNZH 3O4LE 3UTTA 2YPVL 1VCAA 2F19L 3QDMA 2UY7A 4XX1G 3EYUH 2BY1A 2VLKA 3WXVH 2EYTA 1RZJC 1A6UH 5J12B 3OXRA 4JQIL 1LO0H 1Z2KA 4RQQB 3PP4L 1I9RH 5JZ7D 3MLVL 1K4CB 1A6PA 3KPQA 1ZT1B 1VENA 3DX7B 4I8DA 3TIEB 3PIQA 2X44D 1JGDA 4KV5E 1ZA3B 1R3KB 2X09A 4YBQD 1Q94B 3W0WA 3WIHA 5DLML 1JHLH 4H8WH 3WJJC 4HUVA 2Y9RT 4HIIA 2DLFH 3GNMH 4X99B 5M94B 3HE7C 3HZKB 4I0PB 3HLAB 4WU7A 1WWCA 4LHUD 3ET9F 4ZSOB 3CFJA 2EDKA 4JFYB 3FT4B 5F3BB 3VMOA 4XX1E 2HKFL 3RIAF 2Q76A 3Q6FB 2VH5H 3LRSB 4WFHE 2BNRA 3TBSA 5DJ8A 1TDQA 3G9VA 4QWWC 4S1SH 4HCRA 4AEIL 3KHQA 4X5XA 4HPYL 3SHSA 1G9NL 4WEMB 4G8GE 4M93C 2MCG1 4U0RC 3DTXB 1WIUA 1J1OH 3L3KA 1Y6NR 1W0VA 3OKLB 3ZDXF 3CVHL 4HJGB 4Y4FA 3QI9C 2XTJB 5IVNA 3IJSB 4PLOB 2Q6WA 5E6ID 2DLEA 4JY4A 3KS0J 4KH2A 5FKPA 3MRPA 5GSVA 5FGCB 1CD9B 2GK2A 5CCKH 1FPTH 5FO8A 2LVCA 4WEBH 4LLAA 3PWPB 5HY9A 3RGVA 5KG9B 4W4OA 6CGTA 2GFBA 1BHGA 3WS3B 4RFEA 1H8OA 2F5AH 4I48A 4WFFE 1G9EA 4JFQB 3KNBA 5D9SB 2VH5L 4UNUA 3CXHK 3WN5A 4CVWA 3HMWL 3WKMH 4NWTL 1SYSB 1C1EL 3GK8H 1CFQA 1ZHKB 4MNHA 2O5YL 3I84A 3MRFA 3SDDA 1YMHA 4I18A 4R0LA 2FRGP 5I1IH 5BRZD 3T0EC 2EDFA 1J05B 4GQ9H 2W91A 2GJZA 2XZAH 4I77H 3V52L 4CL7A 1S7UB 4L3CA 1ONQA 3OHXB 3TT1H 4MLIA 5GS0L 4YDIL 3QZWB 1CFNB 4ZXBD 3S36X 4N90E 3U36A 1VEOA 5IMOA 4N0UA 1YDPB 3P4NA 3T4AA 4KMTH 5D70L 1MHEB 3UTQA 1MSPA 2X4TB 1GAFL 5KSBB 1B0RB 1IC7H 4HWBL 2VITB 1MLBA 3MRCA 1C5BL 5CSZB 1XGUA 1JGVH 3IETB 1CD1A 3EJYD 1X9QA 5AG8A 4KK5C 4RZCA 3OR7B 4LU5H 3ECBB 1NUDA 2UYLB 4I3GA 2H3NB 5EO0A 4D9LH 5GS2D 1XF4B 3IDGA 3VH8B 4NZJA 1JMXA 1A6AB 3S8WA 2W0FA 1A9BB 3BQUD 4XCYA 5C8JA 3RY5A 3HZMB 4RMUA 1WQVT 3JV6A 3P11L 1OAKL 3W9EB 1AP2B 1U2CA 2YD6A 4TQEH 3O6ML 2WZPD 1UWXH 1IFHH 3CH1B 2HKHH 3SDXE 5FM8A 3FL7A 5I15H 4Z7VE 4XCCL 3MRJA 4OBRA 1WZLA 4G9FB 4DVBA 5FGBC 1AKJB 5INDB 3QYCA 2J88H 5JPNB 5JUEL 4CVXB 3NA4A 3KPQB 4P4RA 3GMMB 4NDMA 1FNLA 4F33B 2H9GA 3GMQB 1KCRL 2DMBA 5D2LE 4GRWE 3V0WL 4D8PA 2D3VA 5IEKB 2EDTA 2QSCH 2XWJB 4WTZA 2FECL 4JFDE 1PQZA 4HS3B 4IDLA 5T3XD 2YPLE 3U82B 1K8IA 4XNMB 4YIQA 4YXHL 3HUJA 3SE3C 4MVBC 4QXGH 4YHLH 2BJMH 5C0DA 4PJ8B 2Y4SA 4LK4A 5SWSE 3SY0A 3QWOA 2CLVA 1KB5A 3OPZL 4WFEE 3ULVC 2YSSB 4U1MB 1JN6A 1OD7A 2WBJC 2X42A 3EHBC 4KKCC 2W65A 4D9RD 3AREA 4KDTC 1HXYB 4G6JH 3TA3D 5ICZB 3GSVA 1YUHB 4PGCA 3T2OA 3T8XB 4GKZA 4GLRI 3UJIL 3VXPB 5HPOA 2DM7A 3FQRA 1QQDA 4Y4FB 3S36H 1UJ3B 5BV7B 4XH2B 1U9KA 2JJTC 4NQDD 4E5XB 4PJIB 4LIQH 1YEIL 3ULUF 2A0LD 1GJIA 1ZLVK 3DECA 4LKXA 3MROA 4ODVH 5CHNB 4NO3B 4IS6B 4AIXA 4TSCL 2R0ZL 2W59A 3LKQA 3QHZL 2VIRA 2HFGL 5I66B 5I8KL 2HG5B 4LHUA 2B4CH 3MODL 1TJIL 5LGHH 2OI9B 3MUZ1 4Z76A 2VLKD 3DROB 1U92B 3NIFE 3OGCA 3VFGH 5JO5B 1U8QA 3QHFH 1JGEB 2AK4D 3ZTJG 1Z0NA 4HH9A 4KUCF 3UZEA 1GYAA 2WBJA 1AI1H 1I7RA 5CP3H 3O8XD 1ZLUH 1QHOA 4HFWA 4Z0BL 3G5ZB 4TULH 5BZWB 5I1AA 3VWKD 3BN3B 4OCRL 2L7UA 3VFSB 5CSBA 4ORGB 4TVSa 1B2WH 4X6CB 4AK1A 3V4UH 1TZHA 2ZUTA 3CDGA 5DSCB 4M62H 1RUKH 1I1RA 4M6AA 3GJEB 1XGQB 3JXAA 3QWQB 4ZD3L 2R1YB 3BSZL 3F12B 4PLKC 4LVNB 1I1CA 3H42L 3DO7B 5EO1A 3VFPA 4WW1A 5CZXC 4BJLA 4P4RB 2OS7A 4OT1H 3V4VH 3ARSA 3VGHA 3BGFB 1CXKA 3MJ8B 2NY1B 2EZ0C 4HS8L 4U1LA 1OAQL 4PIRF 5DK2A 3ZE0F 4XHQA 3S37L 5CEXB 3I02A 1T20A 1HYRC 3PP3H 4M4PA 3GSOB 4CU8A 1F3DJ 5IVXE 1QQDB 1O5DT 4M3KB 5HVHC 3DYOA 5JR1L 3EZJB 1P9MC 5GGSA 3HI6H 5I9QB 1NANI 2ARJB 3FT3B 1FZMA 3LS5H 3CLEL 1I85A 4JREB 4XCYB 3ULVH 3O4LD 3BZEB 3DNKA 3R0NA 1AIFB 3THML 3WUZA 1X3DA 4GKNA 4ZTPH 4YWGH 2FX7H 1G84A 4M1GL 3U2SA 1J0JA 2ESVE 4YK4B 4KUCD 2E6QA 3OJDB 1F13A 4K3EL 4U6XB 3EYFB 2NR6C 4NC1C 4BUGA 1XGTB 1S9YA 4NHUA 1BVLB 4HFWB 4ZPTB 2XFXB 3O9WC 3TH3T 5INCA 2B2XH 1P4LA 4Y16A 2DJUA 2XTJD 1QEWA 4OV6F 2A1WH 1XF3A 1WFOA 3KS0H 4F33A 2JIXA 1AD9B 3H6JA 1ROWA 1U92A 3GMLB 3BGMB 4QXUH 2BNRB 3TBSB 1LO3H 3JWNC 3KG5A 5DGRA 3RWHA 3BFOA 5I16B 3IFLL 4K94L 1OGTA 2Z8SA 4OZHB 2R9HC 5DHVH 4ZOAA 3PGFH 1CQYA 3HPLA 4JY6A 5HDOA 1SY6L 4MXQC 1T7ZA 4FQLL 3QEGH 4U31A 4N9GB 4ZTOH 4OB5H 4HIJA 3SCMB 3DRTA 5DEZA 4PJHE 5D1QD 1HZHH 4NKOA 4U1KB 35C8L 2E27L 3DO3A 4XAKE 4XPGL 2EH7L 4HIJB 2EICA 4JRWA 3SKNA 2EYRB 3GSVB 4BQBA 1LO5B 4NGHH 5F6IB 2A6IA 4MXVF 3X13B 2VOTA 4LARH 3TPUB 5ESVB 3L5IA 3O6KL 3ZLQC 5BS0B 4P9MH 3O45B 1HILB 1V05A 4FQQB 3LSOB 1CU4L 4DVRH 3UBXG 5C6TH 5JXEA 4K55A 4U1JA 2Q1EA 3K8MA 4U6YA 1H3PL 12E8H 4ZO8A 1P4LB 4Y16B 3KPLB 3OKKB 5C92A 1LDSA 1M05B 2VC2L 5E00B 1W0VB 2H2SC 2V9RA 3PDDA 2H2PC 2UUDH 3OJVC 2GAZA 3BH9A 1RHHB 2XA3A 1F4WH 4UTAH 1NBZA 4X5XB 2DL9A 1ZLSH 1F8TH 5C0CD 5HGHA 3QEUA 2NY3D 4OZIE 3FQWA 4X6FA 2B20A 5J57B 3EFFA 5KVDL 1XCQB 1OAXH 5EBMA 5C2BL 3BT2H 2V17H 3QDAA 1NFIA 5ISZA 4NO2B 4NNPL 3HC3H 3WSQH 3IDMB 1OY3B 1JUFA 3P30L 4KK6C 5IR1A 4E9LA 3B9DA 3BKMH 3ULUE 5JHDB 3T0VA 1OCWL 1TJHH 1NCBH 4PTTA 1IGIH 4M6NL 3MFGB 1QRNB 3VD7A 3EO0B 3WIIH 3RDTD 2RCSL 3VH8A 2ITCA 4K71B 2JELL 2WIIB 3OBAA 4O00A 3O9WD 3PQYE 4JZNA 4EXPX 3SDXA 1WTGT 1OGTB 1NMBL 4K7FB 1CYGA 4MX7A 1YNKL 4AL8H 2VAAB 4K7FA 3D2UD 4EDWH 1T3FB 4KUZH 1ZA6A 4HX1B 1MCPH 1GPOH 4QRRA 1E4KC 3S4SA 1ETZA 3LQAH 3W2DH 3IFPA 1ORQB 3T4AB 3SKJH 2I9LB 4MSWB 4I2XE 3RUGA 1KTDB 2DD8L 2KDGA 3IJYA 3HI5H 4Z7VB 3SEPA 2PXYD 1ZGLA 5FXCH 2HLFC 5I76A 1NAMH 1QBLL 4LLVB 3ZYJA 1NGZB 2R56L 5AWNH 1WFUA 3O3BA 3C9NB 4ACPA 4S1RL 1H3GA 4DAGL 4G8GB 1BLNA 1KJ3H 2Q8AL 3FQTA 4QRQA 2BVQA 2YBRA 1CG9A 3BPCB 3DVGA 1U8KB 2J6EL 1G7QA 4UB0H 1BIIA 2EKSA 1YEKH 4D3CL 1NFKA 2R1XB 4JVWA 3ILQD 4P2QD 3A6OA 3MJ7A 3QULA 3EFFB 2AK1L 3QPQC 1BWMA 4PRBB 4NN6B 1C08B 1IGCL 4JM2D 4LSUH 4WTZG 2X05A 2G75B 5LCVL 5IEHA 2ZPKL 4MWFB 3MREA 5CJBA 4KTDL 2ORBL 4XMPH 4PFEA 4E5XA 3MLYH 1TXKA 2R15A 4MNQD 2ICEB 1DBAL 2VDRH 1E4KA 2ERJB 3ETBF 4L4VD 3SKMA 1EHNA 4HD9A 1YUHA 2DBLH 4X80L 2QKIB 4XWGL 4WWID 1V7ML 2AABL 4JZJA 3X14B 3INUL 1HSAB 3MUY1 1EFXD 3TFKC 3P4MB 2E3VA 5FYJH 4P2QE 1CZ8L 1PZUB 4NFCA 1QSEA 2X1PA 3RGVC 5JHDE 4WU5A 3L7EB 2XICA 1X5AA 2XQBH 5DF0A 1GOGA 4KXZI 2RGSA 3G04B 4FRWA 4R4FH 1KCKA 1TZHB 2CIIB 4YHMH 1NGWA 3J8F7 4OLYL 5AAMA 5ALCH 2Q20A 3LKOA 1NSNL 4NP4L 2WBJD 4FP8L 5K9OB 1TNNA 4LHQB 4IOFC 3QIWD 3JVGC 3HMWH 5BVJA 2EEDA 4P4KB 2AEIT 1WC7B 5I1JH 2AK4E 3OXSA 4QY8A 3QUZB 2IBBA 2MHAA 5DR5L 5HHVL 4ZNEE 4JDTH 2OSLA 2BVOA 1HE7A 4EN3A 2X70B 5GRVK 2BVQB 2YBRB 3DRTB 3QDHA 2DKSA 1I8LC 4JGJA 5CHNA 4EEEA 4G8GA 4XP5L 3HZKA 4I0PA 5DFWH 3SE8H 4TNVK 4WI2A 3BMWA 1TENA 3DBXA 3SE9H 4LLVA 4G6ML 4HUVB 4X98B 4ZNCD 4HWZA 3LKQB 3PL6C 1V7MH 5HGDA 1YEFL 2EE6A 4OCMC 5F9WB 3MNWA 4QHUB 4OGZA 4MNGA 5EH1A 2DDQH 4ODUA 5K9KA 4JLRA 5LGJB 3G5VA 3NFSL 3MV8D 2NY2D 2VLRA 3QEHB 2VZ1A 2DQTH 1N7ML 5GS1A 3HNTL 4ODHL 4EI5D 1QFPA 1Z9SA 3FONA 1HKLL 1DBBH 5C3LD 5DJ2A 5EU3A 3QUZA 2MHAB 1C5CH 2QQKL 3E3QC 4RWYH 5IW6A 5J12C 3FQNA 3UROR 3D39D 4JHAH 3DV4A 4JM2C 1AXTL 4UINH 4YO0B 2EIBA 4R3SB 3VG0L 3G5XB 1OAKH 1RZKH 2B4CC 2IH1A 1XIWA 5JXAL 3EW3B 2YMXH 1HXMB 2H8PA 3V6OA 5JPMB 4XMKL 3VRJB 3AXLA 3P4MA 4EOWH 4K3HA 1KEMH 2DTML 4NDMB 2JK5A 3KLSA 2XQYK 2RFXA 1DFBH 3DHMA 1CFNA 4P2QB 5IIEB 3N85L 4M7JL 5I1EL 1I3VA 1VA9A 3RU8H 1MFCH 5MP6L 4OCYH 1R3JA 4F7CB 4PJAB 1KNOA 3C08L 3MBEB 5JPNA 1OTSC 3VFPB 1QBAA 5TFSH 4HT1L 5BCAA 3EDDA 2NXZB 1FZKA 2I5YL 2Q7YB 1HCVA 3TN0B 2G5BA 4QTIH 1IT9L 2AK4B 2AW2A 3ARGD 3NIGF 4GBXD 2Z4QB 3ZE1E 3SE3A 5MHSE 3KYOB 3MLTB 1JNHB 4OD2A 4J7RA 5TE7L 2A73A 1A1NB 4OLUL 3MNZA 5EU6D 5JOPD 4CDHA 5EZIH 2W07A 2YRPA 3BPCA 5EPMB 4LNRB 3VXUA 2LE9A 3PWPA 3RGVB 5HY9B 5KG9A 3W11D 2DBJA 4OV5B 4OAWA 4KDTA 1VACA 1EO8L 4KJWD 4PJXF 4LNRA 4OGXH 3SBWA 5F93C 3X13A 1FCGA 1NKOA 5LAXA 4Z7UF 2CDEB 5KSBA 4H5SB 1AQDA 1C5DA 2HFEB 4PLKD 5BOPA 1VKXB 1RURH 1E4WH 1DQQA 5CEZL 3KXFE 4Y4HD 4KRMB 3FN3A 5I1IL 4OZIF 2A9MH 2FYYA 4FQ1H 5MENA 5K9KB 4P59L 2VJXA 3SE4A 3A67H 1KPVB 1J05A 3C09C 3BP4B 4UIMA 4BYHA 4PJ8C 3KHOA 4MXWL 2BHYA 2E9WA 3HAEB 1WLHA 3ZDXE 2C3GA 1CVSC 1ZHKA 4MNHB 1A4KB 2ZG3A 1EZVX 4LHJB 4U3CA 3NCYS 4PJIA 1EHAA 5BS0E 2OCFD 3LV3A 3KAAA 4HCRH 3BGAA 4QRUB 4PRIB 3RKDD 1IAMA 5DDHA 4NSKB 2EYSA 3UTZA 4HS6B 4WI3A 2H6PA 1H3VA 1J8HD 3NCMA 2B0SL 4MNQB 2AJYL 1YEGH 2DQEL 3VXSB 5BXFB 4AQOA 4G43B 3W5MA 2YZ8A 4N5EC 4XPAL 2EIDA 4WV1C 4MXVE 1WBYB 5E6IC 4IRSB 1ORSB 3BRFA 1HI6B 4M5YL 3PIQB 3DSFH 1KIPA 5AD0B 4KRPD 4HWNA 2YZ1A 1U0QA 4MDIB 4ESKA 5CKAA 4P46C 5TPWH 3MZTA 4IHOA 5EOTA 3JWOH 1KIPB 1MI5D 3O6MH 1LEGB 4U49A 2X7LA 5E00A 3LKSA 1NLBL 5L88H 1BFVL 4L8SA 5HGAB 4FQJL 2VZSA 3HUJB 3C2AH 2ADFH 4PJ9D 3HI1A 2CXKA 1INQA 3P9LB 1N5AB 3N1GC 4B7LA 4X4ME 5FO7B 1TVBA 4PJXB 3U7YL 1L4IA 3VFVB 5CJ5A 2CRIA 4OIIL 4MLSA 3N1FC 1AKJA 2OM5A 3HNVL 3IDNB 1IGIL 3HPJB 2VB5A 4NUGL 3B8SA 4YHIA 1NC2B 4W81A 4JCLA 1OPGL 1XF5A 2HT4D 4QRPE 4Y89A 5E4IA 1YMME 3ZKMC 4XPTH 3C6LB 4LCYB 3VJ6A 3CFJB 4PJFB 5FHAL 1MIEL 3KPTA 4M1DH 2NR6D 3SPVA 3C8DA 1YECH 4U1SB 5J13B 3W82A 3BKCH 4W6YB 1SJVA 1MNUH 1NCWL 1S78C 5C7XH 4LVOC 4N8PA 4MA1C 2XI9A 4PR5A 4CU6A 1AE6H 2XTJC 2NY7L 5GXBB 1U95A 2DYPD 5C0IA 4XMLH 4HLZH 5F9JA 5C07E 5K9QI 2F54A 1E28A 1TZGH 4P2OB 5FYLH 3RDTA 5DMIL 1BM3H 3TIEA 3NN8B 2EDWA 3F65A 5D2NE 4IRZL 3KWWA 1UH3A 4JZOB 3TYGH 5TF1H 5DRXB 4HH9B 4M1CD 1BFSA 3V9FA 1T6VN 4NKDB 4JO3L 2W92A 3G6JF 2VDOH 5TDNB 4UB0L 4PJ8D 1E4XL 2HA1A 5I1CH 1H8NA 3P9LA 3BGFC 2FWOA 1ETZB 3T09A 1P7KA 2AXGB 4M61A 5IT2H 1YMHB 2WIIA 5IFJA 1ONQB 3OHXA 1T3FA 3OKMB 3HE7B 3QUXD 1A7OH 4ZAKC 3IDJA 1C08A 4P4KC 4HXBL 4IHOB 1S7UA 3TA3B 1IKNC 2VDQH 3SDDB 4KVNH 4AMKL 2E27H 3EZ8A 5DUML 2WAHA 1RZ7L 2R1XA 4RX4A 2HMID 4Y2DC 5CZKA 1Q1JH 5E9DD 1G7QB 1ORSA 4GW5A 3RPKA 3RZCC 5SV4A 4PRPB 1GGBL 3ZKSD 4N1EA 1QKZL 5DURD 3TCLA 4M93B 4Z7NF 3KNBB 5D9SA 1MWAL 1BLNB 4TSAL 1UWEH 4YHNA 2R2BB 3QULB 1U8OA 2HWZH 2DMKA 3QCUH 4IOIB 3QUXA 1ZGLB 2Q7NA 4OFIA 4LLWA 3V5HB 4N5ED 1BIIB 2EKSB 6FABL 5ICYB 2ZCKH 1ZVYA 3L6FB 3WKML 1MY5A 3MRPB 3QEQE 1NDMB 4AEHH 4NZTL 1I75A 1BBJB 3CJJA 3GK8L 2IH3B 5B21A 4J3OC 3BDYH 5FO8B 5GRJH 1NEZG 3C9NA 4L1HA 5HHNB 1OW0A 1X5HA 1YMMB 2AQ2A 3KPLA 2F19H 3LZFL 1BEYH 3K2UL 3RZCB 3UBXA 3LEYL 1WBXA 4PJFE 1SBBA 32C2A 3O8XC 5MEQA 4OLEA 1ZHLA 2PN5A 1KIRA 3WV0A 4GAGH 3KWWB 3LKNA 3PV6A 3CLFH 4OZFG 5FAAA 3UO1L 1AHWA 4KMTL 4RFNC 2VZOA 5INDA 4HEME 4JREC 5HGDB 3LAFA 1VFMA 1MCRA 1MREH 4NKDA 3KYMB 4UI2A 2UWEF 2YD4A 1DL7H 3DBXB 4CN1A 2P1YA 2CUIA 5F9JB 1ADQA 3CLEH 4HWZB 5J11C 2V5SA 4WY7L 5IMLB 4HXAH 4H25A 4LDEB 4TSBL 4RRPA 5F89A 2FDBP 5KSUB 4ETQA 4Z77A 2BVOB 1JPTH 1W72L 1AP2A 1E28B 2M1KA 4OQTL 5D1XC 3VFNB 3HZMA 3CFIC 5JTWA 4OM1H 4NYLA 1EGJA 4N9GA 5I2IB 2O61B 2IPTH 1WC7A 2DLTA 4QT5B 3GJFA 2IAMA 1KJ2L 4JY6B 2K3TA 3IU4L 3LKOB 4CVZB 1JNNH 3I75A 1NGWB 1ZT4A 1F45A 3HE6A 2KZWA 1LK2A 3PP3K 5L2JA 1AGFB 5I15L 1B6DA 3HPJA 2Y23A 5DD6B 1XF3B 2K1MA 1AXSA 1UJ3A 5EU6E 2OL3H 3V6ZB 5EG6C 1ZGLP 1WEJH 3QRGL 3HC0A 5EUKA 1JF1A 3T0EE 3I2CH 2FGZA 2VABB 1MJJB 4OSUH 1AGDB 4E42A 2FR4A 1FV1A 3WE6B 1N5AA 3UBXB 3BQUC 3QXAB 5E1HB 1OOAA 1YJDL 4JPWL 4KKAD 1H3UA 4OQTH 3L6FA 3IAPA 3U0WL 4GQ9L 3T2QA 2QQNL 1DUYB 4YNYB 1NEZA 1KSRA 2DQGH 4DEPB 5I8KH 1JYXA 4OLXL 4MJ2A 4TNVF 1LO5A 2B4CL 3MODH 3SDDC 1U3ZA 1UZ8B 2R0KH 4LPTA 3PGCA 3DVGB 3C5JB 4KDVA 3G9AB 2CK0H 4YDJB 1AXIB 3S9DB 2CIKA 4ONOA 3QI9A 4LCWB 2NY0D 3TFKD 4WVRA 3TVMD 4V2CB 4HBCH 1KLGB 4LEXL 4U1IB 2W38A 3BGMA 2XOTA 2Z92B 5HPMB 3CNKA 1A7NL 4D0CB 1RK0B 3JUZA 4OTXH 1ZLVH 3S34H 1AO7A 5IESH 1BFOB 4K8RL 1R5IA 1T22B 4NQCE 5ICXB 1V3LA 2H32B 5GPRA 4PD4J 5CBEA 1GZPB 4RMRA 2CLZB 2VDKH 5EUOB 3GKWH 4FNLL 5C0FA 2OSLB 1JHKH 2QBWA 5EO1B 4Z7WB 1RZFH 5DJXA 4K9EL 4FTVB 5E4EB 4R2GC 3X17A 3WN5C 2D31B 4H5SA 1J0HA 3CSYA 2IQ9H 3CZFB 4PJDE 5I17B 1MFNA 4WI5A 5B8CA 4FTVA 5I75C 2R23B 4KRNA 4GRWH 5DWUL 1IC5H 1CLZH 4HDIB 3KYKL 5IQ7L 2CDEA 4K7PH 4NBZB 4WDIA 1U8QB 3ZTNH 2FATL 1XGUB 2D0GA 5DD3L 2F9BT 3KYAA 1JUFB 3KPPB 4P46B 2B0SH 5E6ZA 3ZHLA 4F37F 5DJDA 5CZXD 3HAEH 1L9NA 3TPKA 2QADD 2ZCHH 4I13B 3TBYA 4LKXB 5KOVC 4M7ZB 1ES0A 1QFUH 2AXFA 1ACYL 2OZ4H 1IL1B 2J88L 3U30B 1YC8A 1DBML 1LNUA 4GBXC 4OCLC 3MLUL 1MCNA 1S5HB 2HJLB 4LHUB 1I9IL 5T3ZL 4MZ3A 5CEXA 4MCYB 4ODTL 2ESVA 3L95A 3W2DL 2UVEA 4P5TB 2UWEE 5J7CC 5D7LB 3FCTB 1OWWA 1A9EA 1FNGB 3AXLB 4XNXL 3QJHA 1PJ9A 4JFFE 1JVKA 4NPYA 5FCUH 3T04D 15C8H 1I3GH 1NGPL 1J1PH 1XIWC 4RFEB 3T0XA 5DEGA 3FQTB 5AD0A 2R1WA 1AR1D 2IGFL 3C2SA 5EUOF 5JPMA 2F5BL 1WBYA 5E08H 4L5FH 5FKPB 1J0KA 1UWXK 5H2BB 2EDJA 2RJMA 3EYSH 3UJIH 3HB3D 2I60H 2X4UA 3FOLA 4P23B 2HH0H 2QV2A 4M7KL 4Y5YA 1I3UA 1FQ9C 4KMLB 2IBZX 4M48L 2NTSP 4U1KA 5DK3A 5DMGD 4YK4C 4DFIA 3QEHA 5FUZL 5ID0B 1K2DA 4HF5H 2GHWB 4O2CA 2XZAL 2CDGA 1JCKA 1B3JA 5HVGB 3QXWA 3FO9A 4IOSD 3EBAA 2YN5A 4OLVH 2YD5A 1L7TH 5HYSB 4OZHA 4F7MA 3WIFB 2IANE 4K3GA 4C54A 3H9SD 4M7LT 3FO9B 1JYNA 1YNLL 4LLQB 5TH2A 1MQKH 1KULA 3MRIB 4X4YB 1UJTA 5HDQH 1SBSH 2CKBB 5D1QC 2C1OA 5IGXH 4NQTA 2G9HA 4EJ1C 2P5WB 3VFVA 2ATPB 1K5NB 4NQED 4YDKH 1L7IH 1I7TA 4Y0GA 1RV6X 2LU7A 5IM7B 2FYYB 2A6JA 3B9AA 4K07A 4KDWA 1SJEB 1TQBC 4HKBB 4QHLA 4QHMB 4OCWH 4HUWB 4QY8B 3NCYP 2JJTA 2CIIA 2KPNA 4PRIE 1WSST 4EIZC 4GBXB 5F9WC 4GS7C 1Q9LB 2R1WB 3QJHB 1XGPA 2R29H 4TVPH 2QQQA 4X5WB 5I1DB 2E7HA 3UTTB 2FHFA 2VDML 4JAMA 4NC2B 2V7HB 2OXGA 3M1BB 2QSTA 4NIKB 3AM8A 4WO4B 1DN2A 5I8EB 2AV1A 2XNAB 3TBVB 1P9MA 5A3ID 3QEQB 5A16A 3EGSA 3CFKB 1FFNA 3U36B 4C58B 4NO0B 1HOCB 2WMPA 3BMVA 3N50A 4DWHA 3VRIB 2J7LA 4G5ZH 3TBWA 5CD5D 3H3BC 2GJ6E 3P73B 3FOMA 3QXTA 4YHNB 3JV6B 4WV1A 3U0TB 1D7FA 2NY5L 1SEQH 3DETC 2AJUH 1S7SB 1LK3H 2V17L 1NFDB 3F6LA 3S35H 2EO9A 1R3HB 3VW3L 1FL5B 3NVQA 3THMH 1MFBL 1JHLL 3CH1A 4H8WL 1QTYT 2DN7A 4RMSA 3RL1A 5D7JB 2X1WL 1G0DA 4PJIF 3UPRB 2AQ1A 4NBYB 4M3JA 1URLA 3LQAL 5I76B 1CXLA 2IC2A 3MJ9H 3IVKB 1U8KA 3IFLH 4G3YL 4MNGE 5GRUH 5C0BB 2A6JB 1IGTA 3DVIA 2VAJA 5JHLH 1T7WA 3NIFF 1G9MC 5E56A 4YZFE 3IF1A 4KVCH 1NGZA 4HPOL 3HKFA 4NFBA 3MMEB 3KXFD 7FABH 1BZ9A 3E6HB 3MV7A 2CKBA 2XG5A 4RRPG 4ZFFB 5GGVH 4XBEH 5C08B 2NXYD 3CX5K 4I3RH 4N0YL 1NCAL 2ADGB 2VQ1B 4XC1L 2J8UB 1WBXB 3X12A 1NC4D 4M7LL 3S37X 4Z76B 1EBPA 2VLLA 4RISL 3SN6N 3OAYH 5BMFH 4NGHL 1JIBA 2BOBA 4LDOB 4WUKL 3UYRL 1JPGB 3CDCA 1IT9H 3CPLA 1UZ6F 5C07B 1S9VA 5E2WL 5E2VH 2YUVA 3EO0A 3RZCD 4C56E 3D3VB 4P49A 1OQXA 4QOKB 1Q9OB 5IJKC 4G42A 3MUGA 1HWGB 5ENWA 3FB6A 3FQRB 3D25B 5JDJA 5C0AE 1Y0LB 2BHZA 2DBLL 4X80H 2GFBB 1J0ZA 2ERJC 1DQLL 2EEAA 2DM4A 1AQKH 4PY8I 1BIHA 4FFZH 4Z77B 3LPFA 4L29A 4L4TB 5I19H 1EAPB 2VISA 5T3XE 2DAVA 3ROLA 2XACC 5AZEH 5ETUA 4OZIB 3ARGB 3OXRB 3P77A 4WHTB 5EU7E 4PRHD 4TN9A 3MXVH 4NO5B 4F58H 4EUPB 1NCCH 1MCKA 5I1CL 4Z7UE 4PP1D 4L8BB 1JPSL 4GAJL 1HSAA 2CRMA 4WW1B 5SV3A 4P9HH 4G6FD 3WE6A 4RGOL 2EDHA 5BOZG 2X7LB 1MJJA 2MPAL 3T2PA 4JQXA 4GO6B 1CVRA 4XPBL 5F7FA 3OWEA 1QRNE 3U83A 4MJ5B 2QADC 3Q6GH 4NKIH 2VLRB 3QNXA 3WHE1 3JSSA 3EDFA 2X4QB 4MNGB 1I4FA 1EAPA 2VISB 1RZIA 2C3HA 4JFZL 3U79A 4WW2F 5EZLB 1WK0A 3ULVL 5DVMA 1F00I 4UAOC 5ETUB 1RZJL 4XBPA 1S7WA 2X4RB 4KQ3L 4GKSA 5HYJB 3V95A 4IIQC 1CE1H 5T5NG 4MZ2A 2NTFB 3ARYA 5IUSA 3VJ6B 4JDTL 5GRJL 1J0IA 1GGTA 5KOMC 1F90H 2NW2A 1F3JA 3PWVA 4PJCB 4C56B 4Z7NE 1X4XA 3GJFH 2EDEA 3C60D 3RWHB 1A1OA 2CLZA 5EU5B 3U9PL 5L8LB 5B3JF 1I9JL 4M5ZH 3X11B 2LFGA 3B8YA 4URTB 4D0BB 2R4SH 4G6JL 5ESAA 5DQDH 1BP3B 2B8OT 1INQB 3UJJL 2YOCA 4YPGB 1T6WA 1KACB 3ALXA 2MCPH 2ZUQB 3KGRA 2YRLA 2N7AA 3B9KD 3ILPA 4XHJC 3GUTB 1BPVA 3IB4A 3U9UA 3NGBC 1KTLA 1BF2A 1IC4L 2W65B 5E2UL 4HULB 4PYGA 2BJML 1FVDA 1FL6B 2FZ3B 5D8JL 4XGZB 5E6YA 1AXTH 3GRWH 3MFFB 5EPMA 3L3IB 4NWUL 4RA3A 1PY9A 4ENEC 2Z91A 3MLTA 4QXUL 1MRDH 4PP1C 1NH6A 3B43A 4XVUC 5IQ9B 1NLDL 1DN0B 4PGDA 2LAGB 3M8OH 3VD4A 1T0MB 4K94H 5J1TC 1Q0XH 1FZKB 3W39A 2HRPH 1BX2B 1D3CA 4PJGB 2LU4A 1LNUB 1CG9B 5IHZB 4ONHA 2B1HH 4JZJC 4M5ZL 3TBYB 4YHIB 5T5NF 4L9LB 2F5BH 4WFHD 4YHOL 1BFTA 2BK8A 3KPPA 4J3XA 2OP4H 4MJ6B 4R2GD 4H88L 1YYML 1I9RL 4M48H 4AG4L 1BD2E 4GRMA 1EIBA 3QG6B 4HUWA 2PXYC 4ORGA 1W72B 5EZOL 2C4XA 3SQOL 3S7GA 4MX7B 1HNFA 1EDQA 4ODXB 5K93A 3TP4A 3KPSE 3VFSA 5HHVH 4LBEB 1ITBB 3IU3A 5C09E 1FC1A 2FBJH 3H9SE 3MJ9A 3QG7H 1QOKA 3DHJA 5DUPL 2DLHA 3O2VH 3VFMA 2JIXD 5JO5A 1KBGL 3GSUA 1N3NB 5LQBH 2A6IB 1RMFH 4Q9CA 1FVEB 1AO7B 3ZT5A 1F6AB 4HIIB 3D39E 1VADA 4JKLA 2IG2H 5HYFA 2H6PB 2ZP0T 1OGAA 3QA3A 4A6YH 3U6RB 4KQ4H 4PJAF 4OTXL 2LTQB 4KI1A 5D2NA 5CUSH 2ZUXA 4E0RA 4OBSA 3UPCA 1NL0L 3LEYH 2EH8H 3PE9A 2CDGB 1R24A 1O7SA 3IS0X 2W9DH 2XYCA 5SWQA 1DZBA 4PG2C 1GGIH 5HYSA 1JTTA 1NMAH 1T21A 1GPOL 2EC8A 2X70A 1VFOA 4FZ8H 3W0WD 4JG0L 2QHRL 2PXYA 1RHHA 3S88H 4EOWL 3EYOB 3GM8A 3IDNA 3HI1B 1K2DB 3O2WH 1KUMA 3B3IB 3K1KC 4UQ3B 4YDVA 4O2CB 3K8LA 5E4EC 1JZ6A 1PLGH 4P2RE 3VXMA 5KS9B 1U8IB 1DQDL 3GSQB 1QEWB 5I1HH 2Q8AH 1PX4A 2SEBA 3MRMB 3DI3B 3BISA 3ARBB 5CGTA 2W9EH 1A7QH 4K2UL 3FB5A 4MB5A 5HGAA 1NC2D 1CT8A 3OAZH 3ARBD 3MSPA 4Y7MA 1FZJA 1JF1B 4LSPL 4KK9D 2XG4A 1VFAA 1NCDL 3H7BB 4PJHF 5IBUB 3IRZA 2PTTB 5JW4M 4POYA 5J56B 1FNEB 4JFFB 3SKMB 1I1YA 2A6DA 2DD8H 1S7SA 4M1DL 4R7NB 4WENB 4G43A 4ZOBA 1HYSC 2WW8A 1KN2H 4Y8AA 1WAAE 5BRZA 5SX4I 3A0OA 3PGDA 3CXDL 2N56A 1ZT7A 3ESVF 3JWDH 3BUTA 4JEGB 5FKAB 4RGNC 4XXDB 4ZUUB 1HIML 4PRBA 3GSNH 4NJ9L 5I8EA 3V6FB 1A6TB 5IJVB 1JTOA 3EHBD 5K59E 1S5HA 2HJLA 1QPPA 3QIUD 1FVEA 1Q9WB 1FIGH 2D7PA 3MCLH 4JAMB 2YD7A 3RWEA 1I8IB 1S7VB 5D4QA 5LWYL 5C8JB 4BELD 5LGHL 5F89B 5KSUA 4PV9B 4OKDA 3MOBL 3W9EA 1XF4A 4U6VH 1VADB 2R1YA 3F12A 2Y6SC 5FYKE 4Q0XL 3DOSA 2VDRL 2F54B 1KCLA 3GSXA 3MV9D 3O41A 2IF7A 4GXVL 3VDCA 5GS0H 1CD1B 3OG4B 3RP1A 4LLUA 2R0WL 4JRXA 3OB8A 1MCLA 4MMZC 3CSYB 5DMKB 2VITA 2UY6A 2PUQT 1MHEA 5CSZA 1UXSB 5FDWA 1MLBB 4LVHB 4JO4H 1MFDH 4OV5A 4RZCB 3B2VL 4JFDB 4TNWK 3AS1A 2VDPL 1YEGL 5ESQB 5F88B 3MOAH 3DXAA 4GG8A 5IMOB 4P2OD 3BKYL 5J1AA 1QFWL 4XPAH 3AGVA 5C0BD 5DYOA 1WZKA 3GM0A 1FIEA 5GJTH 3BJ91 1YEEH 2VC2H 4KTYA 5D1QA 1NDMA 4FQXA 4L3ED 3VD9A 2YD3A 2AEQL 3QDGA 3AB0C 2H41A 4U1GB 3QPXL 2FL5A 5M7QA 2F74A 3BXNB 4Q9QL 3P11H 2R2BA 4AEIH 1RJLA 4G8EB 1VGEL 1IFHL 1MWAA 4R7NA 1FJ1B 3M07A 5J3HC 1OAZH 4AENB 4P23A 4P2CG 3CSGA 1D5XA 1F4YL 4XCCH 3HG1D 4PJ9A 3BHBA 1F42A 2VXTL 1MCPL 4KJWC 3TA3A 1E4XI 2RFXB 4R2GB 1VFAB 3HFMH 2FSEB 2Y6SD 4MCZA 4J8RA 1HXYA 3W11C 5IVZB 4Y16C 4PJ8A 5HHMB 3OAUL 1C7TA 1EEQA 3FO2A 3OZ9H 5IW6B 1KTRL 4Q7DA 2VLME 5DJ2B 4EVNA 3RRQA 1CGWA 1HHKA 5CJ8A 4LSRH 4MQXC 5KSBE 3HRZB 1QLFA 1RHFA 2C7UB 4U1JB 1SM3H 1N6VA 4ZFOA 3OGCB 4HT1H 2D7TL 1YN7A 4X0KB 1LEIA 5ESAB 1F3JB 3PWVB 4C56A 5EDXA 1I85C 3KPSA 4P0DA 2VIRB 4DGIL 5L2JB 1GC1C 5F3BA 5E99L 5I6XC 2O5ZL 4RIRA 1FGVL 3H0TA 1ZT4B 4MWFA 5D2NB 4NYLB 3OG6B 4BM7A 2O61A 3FHQA 3LB6D 4YDLB 3BKCL 2CRYA 3TT1L 3MLXH 4U7MA 2NY2C 2P5WD 2FO1A 4LLMB 3TO4C 2J5LC 1CIUA 4DZ8B 3FAXA 1P1ZB 1VKXA 3O9WA 2VTFA 1B0WA 3INUH 1CLYL 5F1KC 1L0XA 4CKVX 2NTFA 4Z7QF 4TUOA 3LQMA 1ZA3A 1I4FB 4H20L 3BIBX 4F80A 2EXYD 4C4KO 3IDXL 4HK0A 3WNOA 4G9DB 1E6JL 4LSVL 2F53D 4X99A 1T03H 3HN3A 2P8MB 5H37H 3KYMA 3VXUB 4MXQD 4BFIB 1YEDB 1JWSA 1W2KT 4JFED 4FHBD 1UA6H 5ERWA 1N64H 5KSAD 1HK6A 4Y1AA 3RJDA 4HG4J 4HGWA 4MXWH 5CBAA 4N8VA 1CGSL 4JZJB 2JJSC 1J0YA 3GJFK 4NFDA 5C0AA 5C0NC 5HGBA 2PO6A 1MELA 2Z0BA 3EOYG 5JIPA 2H2SD 1V3MA 1XR8B 2JKXA 3O3EB 4KVNL 4AMKH 1FYTB 5JDSB 1G7JB 5CLTA 4WTWA 1E4WL 2RIKA 5J9PA 3MRFB 3TO4A 1JZ5A 5DJAB 4OLZL 3K4DA 2AJYH 3ZL4H 5J6GB 1FFOB 1GOFA 4Y1AD 4NO5A 4ONHB 3CDFA 2WWKO 2XXMB 5JORA 2YPKA 4WUUD 3UTPD 1WZMA 4XCEB 2C4FU 4PGDB 4Z9KB 1A64A 2WK2A 5J6HB 1KV3A 4EDWL 5JXEC 4LGRB 4PRIA 1VHPA 4HGKC 2IWGA 3AY4A 3I02B 4GAFB 5GS0D 1WIOA 5I17A 1FL6A 4OF6A 2ADJA 4I48B 4R8WL 2B5IC 4Q74A 4QXGL 2DJ4A 2V6HA 1G7MA 3SGJA 3RKPA 2V9TA 5KSVB 3HZYB 1YPZE 2H1PH 4XPFL 5IHUL 1RZ8A 1UEMA 5TDPA 1RY7B 5CEZE 2DKUA 4LCCC 5F3HA 1R5IB 3L7FA 1DQTA 5GGRY 1E0OB 4PLJD 2FEEI 3Q6GL 1KEML 2DTMH 4ZS7L 2BNUB 4GUPB 4L4VE 2GJ6A 5HD8D 3REWA 1T1XA 1PVHA 2VXUH 3VI3E 5EULV 5EC2B 4WI4A 1XGTA 5J13C 2H26A 5E5RB 4JR9H 4J4PA 3OJDA