4OD3L

Crystal structure of human fab cap256-vrc26.07, a potent v1v2-directed hiv-1 neutralizing antibody
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
213
structure length
213
Chain Sequence
AVLTQPPSVSAAPGQNVTISCSGSGSNIGNNFVSWYQQRPGTAPKLLIYESNKRPSGIPDRFSGSKSGTSATLAITGLQTGDEAYYYCATWAARLNSARVFGTGTMVTVLGQPKANPTVTLYPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CAP256-VRC26.07 light chain
publication title Developmental pathway for potent V1V2-directed HIV-neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2014-01-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od3L02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4od3L01
3ARGD 4PJXE 1F4WL 4R4BB 3G9VA 4M5YL 1MVFA 5DD1L 4HKZB 4I0CC 4NN7B 5I8KH 5IW3A 1SYSB 2X44D 4QRPD 4YFLI 2HVJB 1G9MH 4HWBH 3GSNB 5TF0A 4OD1L 3RY5A 4LK4A 1AP2A 1MQ8A 4FQHA 4R4BA 1HKLL 5HGAA 4N8VB 5EN2B 2DL2A 3MOBL 2NZ9D 3WHXB 4P5MA 5FO9A 1MF2L 2AK4E 1SJXA 5J1TC 4ETQB 5FFLA 1CFVH 1A7QL 5DRZB 2IMMA 4ODVH 4QWWD 1SYSA 2A6KB 5DT1L 5GHWH 5F1KC 4S1DD 3PJSA 3R0MA 2WUBH 3GSNA 2BY2A 3W9DB 1ZA6A 5HSFA 1U58A 3ESUF 2FGWL 2Q20A 4N8VA 1V3KA 4UQ3B 4MDIA 3WHXA 4N90E 5IMMB 1HKFA 4F9PA 1AO7B 2O5YL 4G80B 4G8GE 4ETQA 3JTTB 5IIEB 4ZPVB 1DQQA 5TE4H 1H0DA 1NUDA 4LCWD 3WIHL 3LQAC 2W9DL 4Z95L 3VXME 1KEGH 2PTUA 1G7HA 1YECH 2JB6A 5HHVH 3W9DA 2HTKD 1OAKH 5KVEH 1D5ZB 4GW4B 4XGZB 5I17B 5BRZD 3RNKA 1A47A 2ESVA 2P4AB 4YEEA 2MCPL 5FECB 1DVFD 3JXAA 4J3SA 1LHZA 4PG9B 4UNVA 4H5SA 3T8XB 5KN5A 3INUL 3WN5A 3EJYC 3D3VE 4WFGD 4EI6B 2B0SL 5ADOL 1JN6B 1JF1B 4GG6E 2FX9H 1JUFA 1NLDH 5ESAB 3EYOB 1PQZB 1TVHB 2AQ2A 3QUML 4WEBL 4L4VD 1D5ZA 4GW4A 1X5XA 4X80H 4FQ1L 5T1DL 1I7UA 4K55A 2YRZA 1T66C 4PG9A 3T8XA 3TVMA 3VWKA 4WUUD 4WFHE 4LFHD 4EI6A 3AC0A 1YEKH 4PJ9A 1S9XB 5I16B 3V7AE 5AYUL 3QUZA 2XQYK 1TVHA 1AR2A 5C9JB 1ZGLP 4QXWA 1HCFX 4YFEA 1S7WB 1SY6A 3LSOB 4Y7MA 4U6HB 1ODAA 2F54B 4U1SA 3RVUC 5GJSL 2FR4A 1ZT4B 3F7VA 2GFBB 1S9XA 2BVEA 2BMKB 2P5EA 4KTEL 1BM3L 1S7VB 3OMZA 1OP5K 5ERWA 2PYEB 3LSOA 4U6HA 3BKJL 3QIUD 2J4WH 5TE6H 2F54A 3AAZA 1KC5L 3BXNA 4K9EC 5I76B 4FHBD 5E8PA 5I15L 1CL7H 1OF2B 4KQ4L 1KTRL 5TE7H 3T0XA 3LN5B 4MVBD 2MKLC 1AQKL 2ED9A 2YBRA 4AEHL 5JDSA 4E42B 4Z0BH 4KC3B 2I9LB 3THML 3B9KD 2VE6B 3F7YB 1CYGA 2EDXA 2AJYL 2K1MA 4NHCH 1F8TL 5K9JH 4AIZB 5CZXC 2R1WB 3CXHJ 1U8JA 2ERJC 3EO0A 1XGTB 4MNHA 5GS0L 2I9LA 1U9KA 5ALCL 3UYOD 2IMNA 3MQIA 4DVRH 1RUML 1H3WM 3TN0D 3F7YA 2APTA 2HVKB 1DN0B 5D1XD 4HBCL 2PF6A 5LQBH 3KVQA 4AIZA 2J88H 4NKQB 5I1CL 5KBNC 1SJHA 1WBYB 1KJ2B 4L9LA 3U46A 5HDQL 1JPST 4GS7B 3UDWC 4DK6A 2VLJB 4JRYD 3SBWA 5FUCE 4OLZL 1IFHH 2QQNH 3QSKB 2DI7A 2UWEF 1BZQK 5FXCH 5LGJB 1DUZB 1CDHA 2NY2B 2EXYC 1QFUH 5C0JB 4MJ2A 1WBYA 1S7XB 4K3JH 5IB1B 2JIXD 3BEWB 4OJFL 2WNGA 4PJHA 3NIDE 1I3GL 1B2WH 2Y25A 3IDXH 1A0QH 4XXCA 3HNTL 5LGJA 1DUZA 4NOBA 4QY8B 2L0DA 3FHQA 1YN6B 4Z7UE 3P4NB 3FN3A 3SDAA 3B5GA 2D7OA 5C0JA 4FTVE 2XNAA 3QDMD 1VGEH 1QKZH 1T22B 1ZHKB 4UT6H 4LRNL 3ALPA 5F1IB 5I6XB 4PJFF 3HAEB 4PJDF 2XTJD 2X4TB 1CE1L 3PP4L 2P43B 4TUJA 2XQBH 4QY8A 1ZHNB 2OS7A 5JA9A 3CZJA 4JRXE 4P46D 5SWSB 3TNNB 3ZYOA 4PUBL 3KYKH 2AJUL 1IGMH 1R3KB 3ARQA 1F3DJ 1T22A 4NWUL 5F1IA 4YXLH 5GRYA 1R3LB 3L5IA 2C5DC 2F19H 3MA9L 2XZCL 1CR9L 2ED7A 5F9JB 4XPAL 5GRUL 1FDLL 2DS4A 1M05B 5CLTA 2AJSL 5SX4H 1E4XI 3TNNA 1JWSA 4CN6A 2ILLA 1Q72L 2HTLD 2DLFH 3DO7B 5F6IB 4X5XB 2YSSB 3BX7C 5GGVY 4RGNE 5F7UA 1TCRB 4PR5A 2EIZB 4E41B 1RJLA 4DCQA 4P5TA 4KMTH 4EZMA 3MRFA 1GIGL 2Q8BL 4HULB 4WHTB 4HH8A 4LHUD 3DO7A 1J1PL 1RK0B 5CGTA 2EYTB 5I1DB 3PHSA 4XNZB 2H2SD 4H20L 3I2CL 3QFJB 2O61B 2IH1B 1FNEB 1J87A 5AAWA 4Y5YC 2EIZA 5C08D 4BZYA 4E41A 4YBLB 1J5OH 5CLWA 1A8JH 2QLVB 4M8QB 3T3PF 4M7ZC 4N0UE 4I3RL 4OKVB 1HHHB 5H2BA 2V7HB 1DLFL 4O2EB 2QADC 3VDBA 4MLIA 2IH1A 1FNEA 4ZFOL 2PN5A 3ULUH 1FC2D 2D0HA 3QWOB 5JUEH 3LKRB 1LEKA 4M8QA 1CIUA 2E27L 1JZ4A 3VW3L 5FA4A 1U95B 3LKOB 1ZLUH 1K5NB 2AAVA 4X6EB 2E7BA 4CMHB 5FKPB 1EMTH 5CEZH 3FMGL 3GMOB 4HS6B 5I66B 4FRWA 3FT4B 4JLRA 1Y18B 4M5ZL 1I3RA 1BBJB 1BZ7B 1R24A 1QRNA 1T4KB 2V6HA 5ANMB 2P8LB 4NN5C 4ZAKD 3LKOA 4X6EA 2DMCA 3MA7A 1OL0A 4XMLL 1ZKAA 5JMOC 4PJIF 1JPFB 4WI6A 5TF1L 3GMOA 4KROD 4NRZB 4UILH 5I66A 1A6UH 1UM5H 3P30H 3WFBL 3KJ6L 4YHZH 5EORH 4JAMA 1U42A 4PIRF 4FFVD 5FYKD 3RWIB 5H94A 3BT2H 4GJTB 1MFEH 5ESQB 2IBZY 2CUHA 3WO3B 4Y4FD 5TQ0H 2VXTH 1G9NH 4JFPB 4G6ML 4Y2OA 1EZVY 4PRID 2EKJA 3ZTNH 4YH6A 1J1XH 3SO3C 3FT3B 5BVPL 4WW2C 3MREA 5I18H 3BN9D 4RGNC 3RWIA 3ZE2E 2AXFB 3EFDH 2HMIC 3QEQD 4G8GA 1FYHB 5M94B 3ROOB 3BN3B 5HD8C 3FN0L 2YPLB 2BRRL 3DSFL 3RPIB 3VXMA 4NZTH 3FT3A 2A6JB 4FZEL 2UYLB 4DUXA 1CI5A 2VR9A 4HS8H 3JWDH 4U1KB 5I73B 4XX1E 1TZIB 5F9OL 1XCTB 2AXFA 3DI3B 4HIIB 4X7TB 5F7DA 5B22A 1FL3B 1HQ4A 3D3VA 3T0ED 5CGYC 2A6JA 2ZWLT 4GG6A 2NY5L 1CL7I 3KPNA 2PTTB 4W68A 1UEYA 4BFGA 3BW9B 4F7EA 1PY9A 3PWPA 1UKTA 1MIEL 4QRRE 5IESL 5C0CB 4HIIA 1WC7B 3UDWA 3OX8A 4ZD3H 1TTUA 1S78D 2E7HA 1HOCB 5FO7A 2I60H 1U8LB 1OGAB 5DA4A 5E2TL 4LCWE 2GAZA 4EIZC 1NGYB 2YXFA 5IQ9B 5K9OB 5GGTH 1J12A 2IGFH 4QF1B 1WC7A 4GT7A 1ZGLM 4LDOB 1KB5B 5F1SA 5BRZE 4H0HB 3R8BB 2NR6D 3MCKB 2FDBP 1U8LA 1F97A 4OF3A 1OGAA 2WBJC 2VITB 5CJOL 3MRPB 3U4EA 4WFGE 4OUOA 1TTGA 3MGTA 1NGYA 5IHLB 4ZTOH 4WU5A 5CGMA 3D6GA 2N7BA 4IRJB 4HIHB 4OQTL 1WAAE 4DKEL 1Q8MA 4QF1A 2D31B 4Y4HC 5IKCB 1EH9A 4XPTH 4HJGB 3MLYH 5L6YH 1I7RA 5DWUH 1MCDA 3AS3A 4P59H 2BFVH 4WWKB 5AD0B 1G1CA 3CH1B 4WUUE 3MRPA 2ICWI 1HILA 3NCEB 3ARGC 3FQXA 3KPRB 5C9KA 2G5BB 3B83A 4LCIL 4L8SB 1JRHH 1RZ7L 4MQ7A 3O4LA 2D31A 4Y0GA 1Q0YH 4O5LL 5KTEH 5D6DA 3Q5TA 2DQUH 5CWSB 3W11D 3Q48A 4WWKA 2A38A 1QVOA 3VXRA 2V5TA 3GK8L 4KJYB 5F7HA 1IRAY 4N8CH 4L4TA 1B6DA 3PV6B 1ZLSH 2Q8AH 4L8SA 1P69B 3ZYZA 1RZGB 3LEVL 1AC6A 5J12C 5KVFL 4HF5H 1LQSR 1LO5B 1MHEB 1FO0B 5FHBL 4QWWC 5BCAA 3QWQB 4Y19A 3K1DA 1Q0XH 4S1DC 2JE8A 1NC4B 3C08L 1XGUB 4WW1B 1UXSA 5ACLA 3IDJB 4ZO7A 4JHWL 5HGHB 3BH9B 2D9CA 5F88B 1RZGA 3QNXB 5HHMD 5E08L 3F65A 4RMWA 8FABB 2YPVL 3I3EA 4P2OD 1N6QL 1FO0A 3QQNA 1IT9H 2X1OA 5SV4A 3O8XD 1FFOB 4TQEH 3ARPA 5I19H 5SX4I 3IDJA 5HGHA 1BWWA 4HK0A 3RVVD 4KVNL 1DVFC 3BGAA 3DUSA 4OV6F 4AK1A 5IJKA 3OKMB 4Z7UA 2JTDA 4L1HA 3L3KB 4RFEA 2X4PA 2G5RA 5A2LH 4FTVA 2GQHA 4RRPG 1H3XA 3WXVH 5C0AB 4F37K 2P5WB 1D9KB 1MFDH 5D5MF 4EN3B 4NC2B 3I02A 4ELKA 5B39A 3QWRA 3FRUB 4ORZC 1JTOA 2LE9A 4JRYE 3OPZH 1I9IL 3LH2H 3OKMA 4Z7OE 4CMMB 3QXWA 3QXTA 4KRNA 5D1ZA 4I48B 3K8LA 5HVHC 5FUOH 5IT2H 4ZOEA 1QSFD 1KTKE 5H35A 4GAFB 3TYFA 2YK1H 4U1IB 4U1LA 5EU4B 3IXTB 3L5XH 3BKCH 1IVLA 2VLLA 3PGFL 4BFEA 3BIKB 4JQVC 3EO1A 5B38G 1A1MB 2CKBH 2J5LB 1CFTA 2FSEB 1QTYT 5AG8A 5GS3A 1MFBL 1QYGL 2C7UA 2AKRB 2ZOKB 3V6FA 4BQCA 2FL5A 4M6MH 4B50A 3JBG7 4WW2A 2W65A 3TJEL 5IWLA 2XYCA 1MCJA 3MBXH 3QDME 1UZ6E 4D9LL 3QFDA 5I75B 4EOWH 3QIUC 5EBLA 5ESVA 2I9TA 4Z0XA 5EIIA 2ZOKA 1M6OB 2XTJE 3LRSA 1EJOH 1FNLA 3S37H 4MVBC 3IETB 4MX7A 2Y06H 4U6VL 4U6TA 1FGVH 4XPFL 3AS0A 3B9KC 1X4ZA 2GITA 1LILA 4M00A 1IM9B 3W5NA 3GNML 1DSFH 1I1AC 2HT4D 1YEIL 3CVIH 4N0UA 5B3JE 1WFOA 3EOTL 5C0EA 3AM8C 1AXSA 1GZQA 4YDJA 2ATPB 1BP3B 4J2XA 4OKDA 2KZ1B 2UUDH 3B2VL 4PY7B 3STLB 3R06A 2XN9B 2LU7A 3TN0C 1H15A 4KVCH 4PD4J 1FSKC 5D1XC 2XIDA 1QR4A 1E4JA 1FIGH 3MRMB 4HKJA 4Z7WF 1RJYA 4NQSB 2W0FA 5KVGL 1JK8A 2ZUSA 3KR3L 4LARH 1UM6H 2Q3ZA 2NY1D 5IFJA 4PY7A 3K74B 1GGIL 1DEEB 3J7HA 1MVUB 5C08E 3WS6C 4MJ6B 3GHBL 1JP5A 2Z35B 2BOCB 5T1KA 4FS0A 3TBVA 3HG1D 3MLZL 5INDB 4AH2A 4L3AA 5T33L 4AYFA 4WHCA 2B4CC 4JHAL 1R0AH 4S11A 4NZDA 4N0YL 4MD5B 3QDGA 3RX7A 5E2WH 1OT1A 2J6EH 5FO8B 1DEEA 3BIBX 4UT7H 5KS9B 5DUBB 4Y4HA 1MVUA 2B1HH 4S1QL 4D9QD 3KLSA 4P23D 5JZ7D 4G9FB 2NY6B 4OCLC 2EYRA 4G6KL 2DQFA 5IOPA 1MHPH 4J1UB 4UT9H 1U8PA 3TWCH 3L95A 3ARGA 3DGCR 5SWZD 1HZHH 3T0AA 1IZJA 3G04A 3IAGC 5DUBA 5D1QD 3VMNA 2XTJC 2P42B 5GRXG 3K80A 1X3DA 5GS0D 4P46C 4KKAD 4QRPA 2HT2D 3I6KB 4G9FA 4O58L 3QNYB 2HJFA 4YNYB 2ORBH 1TITA 2JJUA 1MQKL 5GGSA 4F58L 4XBPA 1AJ7L 5DJCB 2FYYB 4JZNA 5BV7C 4OD2B 4CVZB 1X6LA 3L9RA 2OX5A 3SKUD 1JGEB 1MRCH 5FYKE 2P8PA 5FYKU 1QD0A 4LSRH 4OFYD 3MJ9H 1U92B 5F97E 2P7TA 4R3SB 5CSGA 3I6KA 1ACZA 4PRIE 3QNYA 2OP4L 4XNUL 3QXDA 5D7IE 4YPJA 4APQB 2HTLC 3GJEB 3BI9X 2EDJA 4TNVK 4HS3B 2XRAL 3PL6D 4HWUA 4MQTB 3K2UL 4RDQG 5I74B 4OD2A 1HXYB 2Z93A 4CVZA 1QG3A 3PWVA 4LCUB 1EX0A 4KI5F 1JRHI 2NX5D 4JKLA 3QEQE 4CU7A 3AY4C 2MKWA 3R4DA 5A2FA 3MRQB 4M61A 4R7NB 3MOAH 4APQA 5BVJB 2PCPB 2YA2A 4HCRH 4HS3A 4P3DB 3H6JA 4NFDA 1RURH 2IQ9L 4P2RB 1JYXA 4MNGE 1MNUH 4M62H 3ABZA 1N0XL 1VERA 4G42B 1A6PA 3FOMB 4Y8DC 4ZTPL 4RZCA 5JR1L 1Q9KB 3QISA 4LU5L 4JO1H 4R7NA 3T0EE 3UO1L 3N1GC 3L3IA 4OBRA 4I9WD 1S5HB 4P3DA 1YY9D 1WAAA 3Q3GB 1ZANL 4XMKH 3TCLA 4L4VA 5IM7B 2EDEA 4HLZH 4GMSH 4LGPB 1CXFA 4WUUA 4TRPH 1AI1H 2V9TA 4O2CB 3ARSA 3UX9B 4EXPX 1WZ1H 4DGVL 4IIQB 2OR7A 3RWEA 2FZ3B 1HWGB 2FIKB 5IM7A 4UV4H 5EOCL 1L0QA 3LZFL 5EA0H 5B8CB 4JQVA 3L3DB 1VEPA 2AEWA 3IDNB 4ZAKC 1N59A 2KZWA 3A6BL 4KROC 3ECBB 4X8JA 5DD5H 3MRNB 2AV7A 4FFVC 1INQA 2L7UA 2FIKA 1MEXH 3NAAH 4OAWA 5B8CA 1F11B 2VLKD 3L3DA 1DLHB 3QIUA 2BNUA 2D3VA 2W91A 1W0WA 2F8VA 2Y9RT 1R3IL 4OZHB 2PO6B 1AY1H 3KPMB 2DQIH 3O11B 2DF3A 2IPUG 4OSUL 1KEML 3MV01 2R1XB 5KSAD 1U91B 4NN6B 1NBZA 4HUXB 3B9KA 5IFAH 1YJDH 4N9OB 1F11A 4YWGH 1XR8B 2UVEA 3LEXA 5DJ6B 1DLHA 3O3BA 4LQFL 5IW1B 2DI8A 3WD5H 5EIVA 2MNUA 4RAHA 3OAZH 3KPQB 2X6MA 3IKKA 1KIPA 3KPMA 1WF5A 4XPGL 4NN7C 3MFFA 3NCCB 4HUUA 3GSVB 5IBUG 1RQ5A 4UAOB 2R1XA 3UTTB 4ELMF 3LAFA 5AEAA 4E0RB 1OCWH 4I18C 3RL2A 2ZUWA 3BKMH 1XR8A 3T0EC 1NMBL 2R15A 3TN0A 4LIQH 3UCRA 5I8CA 1I8KA 2ZUVA 2IWGA 1NCBL 4NBYB 3SOBL 4HQQL 1FORH 3TPUB 1LE9A 3KPQA 1NL0L 1DQML 3X3FH 1BGXH 3VD9A 3GKWL 3DVFA 1JYWA 3NZHH 2PYEE 3GSNH 5GGRY 5A2IH 5EC2B 5HPMB 3CX5J 2YKLH 4H26B 4X7FC 4JRYA 4TNWK 3MV7B 1NBVH 5D7KD 5EUKB 4U31A 1MJJB 1BWMA 4KJWD 3V2AR 4U3XA 1J88A 3MCG1 3PWJA 4PRHB 2JIXA 2O5ZL 1YNTA 3V6OA 5D7LD 1IGYB 5ENWB 1LEIA 2GHWB 4H26A 4U0RC 3ZDZF 4JG1L 3D48R 2NR6C 3BZFB 3NCMA 3MV7A 1TIUA 3QO1A 4GRWB 5EUKA 4ZG1A 1YDPB 1O0VA 2FX7L 1K3IA 5D7JB 5C0BB 4FFWD 2BY3A 2H6PB 4WHYH 2AJVL 3BP4A 3NA9L 1B4JL 2G60H 1FV1B 1A3RH 4PRHA 5LAXB 4Y5VC 3B4NA 3WFHA 4JKWA 5ENWA 2ID5A 3T08A 1FG2B 2XXCB 5CUSL 3BZFA 1A6TB 3EZJB 2X89D 4BQ8A 1YDPA 1BAFH 4P3WA 4YGVA 2YZ8A 4TSCH 1F3DH 2H6PA 3UYRL 3VCLA 1OGTA 4NP4L 2VLJE 1QSFE 4FQIL 5LAXA 3B9DA 3HZYA 1FG2A 4DK3A 3T77B 3W11C 7FABL 5EPMB 1E4KC 2VDQH 3GSWA 4W81A 4PJ5D 3ZKQD 5DJXA 3IFOA 1NCCL 5T3ZL 2VTFA 5MEOA 4XP5H 5E6IB 3BQUD 3TH3T 1YN7A 4JFEA 3WUZA 2V17H 3AY4A 3OV6A 4LHUA 3CSYB 3QJFB 1H5BA 5F72S 3VXUA 4X9HA 3LMJH 3JTSA 3V0WH 1G0XA 2DWEA 4S2SB 4H1LB 2J12B 4P2OC 5EZIH 5SWSE 5C08A 3O8XC 2VH5H 1WWCA 1AFVL 4M93B 3ULSA 5FK9A 1FVDA 2XKNB 4L29B 1WIPA 4F7TB 3KYMB 3RDTD 1T2JA 4XAWL 3QR2A 3RVVC 2YUZA 4S2SA 4XNMA 4H8WC 1T2QL 4Y89A 2VIRB 4B7IA 2JCCA 4GRMB 3V4UL 2D7TH 4DOHB 2IAND 3WNKA 1R3HA 1RMFL 3DWTA 5DQDL 3MRKB 5F7KC 2APWA 3O2DA 2ZNWA 2EIEA 1TJGH 4NT6A 3LHPH 2Q6WB 4QXTB 2ZUQB 1I8IB 3FOLB 1IMHC 3VI3E 1XCQB 2VIRA 1FFPA 1MFNA 3PNWA 4GRMA 1MPAL 1D6EB 2HJLA 3IFLH 5T5NF 5C0ND 4LLVB 3P73B 5L0QB 3P40A 3QFJE 1D5XB 3HG1E 3GO1H 2GTZB 1I8IA 1FNSH 3C6SB 1XCQA 5FHAL 5C0RH 3N1FC 1CDUA 4P2QD 4Y4FA 1J8HB 3U0WL 3HUJF 2QSCH 5D7IA 5I8EA 4LLVA 4RA3A 4DW2L 3P73A 5BJTB 3LV3B 3MUY1 2FEEI 3ZYJA 3ZTJH 4EKXA 32C2A 1F4XL 1SEBA 2V5SA 3SEPA 3S7GA 2WBWB 3C6SA 1OQXA 2MTPA 3EJJX 3MLUH 3ILPA 4ALAH 3GSUA 3QEQA 2EEAA 4HEME 5GRJL 2VZTA 3DVGA 1J8HA 5DJZA 2FWOA 3MRHB 4NM4L 2VXUH 4I3SH 1WFTA 3U9PL 1YEHH 1EBPA 4MNGA 5IQ7H 4XAKD 1A3LH 1FN4B 1EFXD 2HT4C 4JPWL 2V7NB 5CINL 1N3NB 3HPLB 3SQOL 4JCMA 2H26A 3HFMH 1I8MA 4D0DA 4BUHA 1IAKB 4EDWH 1D5BA 3D25B 1CN4A 3TIEA 4OB5L 3GMPA 5I1JL 1N8ZB 3DX8B 3CSBA 5MHSD 3MXWL 2R2EB 3BP5A 2JKXA 3U0PA 3GMMB 3Q6FA 4XNYH 2KDGA 2P8MA 4M4PA 5AZEL 1EERB 2DBLH 1N3NA 3IDUA 4RGMC 4KMQA 4ODTH 2DD8H 5LCVL 5EZOH 3MUGA 5D70L 2FHCA 5FM4A 4F37F 3V5DB 3D25A 2NY1C 2PETA 4HH9B 1AXTH 1UXWB 3L6FB 1G7MB 2QHRL 2R2EA 2VDMH 2EIDA 3O2WH 4X0KA 2DOCA 4ZO6A 1PKQA 1SQ2N 4XNZC 3IVKA 3GRWA 2YXMA 4LSTL 3CDYA 2Y4SA 3TV3H 3MV9A 5DJ0A 5HVFB 3KAAA 4BQ6A 3H3BC 1BLNA 3C5ZD 4P2YA 4U1MB 2GK2A 4Q9RH 4LLYB 5DJDB 1G7MA 4Y5VA 4QRSB 1YYLH 3BWUC 3MGOA 4MMXC 2OZ4A 4QHUA 2CSPA 4PRAA 4F7PA 5A40E 4P23C 5JZ7C 1RVFL 1MAML 4XC1L 2F15A 1MCIA 3LD8C 2Z8WC 3JWOC 4NQDB 3D69B 4LLWB 5HYSA 2H2PD 2LAAA 1BQLH 4HKBA 5INCA 2CXKA 2M2DA 4QYOB 1NAMA 1A6ZA 4ZS7L 4YFLF 2A1WH 5EU6B 4RWYL 4GRLD 4KKAC 2HT2C 2VLRD 1W8OA 2Y6SD 1ZLUK 2R0WL 3UTQB 4NQDA 1YMMD 3G5ZA 3KS0J 4YE4H 4OCMC 3ZKXB 43C9B 1QFHA 5ACZB 4OLXH 4JFYB 4JDZB 4XBEH 5EZJA 5LWYH 2NY4B 3U7WH 3K8KA 3BGMB 3C6LB 4JDVA 2P46B 2VLKE 1G7PB 4YK4C 3ARXA 4QHMA 1HHJB 2GSIA 1ADQA 3LRGA 3PL6C 3TT1H 5JHLH 1AQDB 2NTFA 3FO1B 5DEGA 3MUJA 1J0KA 4UQ2A 1T1ZA 4JZJC 1PFCA 4UV7H 4JDZA 1P7QD 4YLQT 4NPYA 1CD8A 5GJTL 4P2OA 3ZSTA 1T0NA 3KPRE 1G7PA 3O8XA 2B5IB 3W5MA 2DJSA 4NQVA 2XWTB 2A74A 2L4OA 3BPLB 4YZFE 3JVGA 3RX8A 3ULVH 3QG7L 4GBXB 3FO1A 3QRFM 4S1SH 4XI5D 1K8IB 5CBAA 3LY6A 5D7SL 1X5KA 4PYGA 4LSUH 5JXAH 4RFNB 1A14H 2HN7B 3MYJA 4O51A 2OTWA 3ARWA 4WTXA 1JNHA 1H8OA 2XWTA 3VG9C 4WHYG 4P9HL 4IOIB 2J8UE 1YY9C 5DF0A 5IROC 1VFUA 4G5ZH 1EO8H 1OARH 5J13C 5GRVK 3LS4L 1NAKL 4U6XB 4NUGL 1CXKA 1TXKA 4S0SD 3C9NB 3VJ6B 4O4YH 2VXVH 1Q38A 2GEEA 2HN7A 1JZ5A 4KHTH 1HH6A 2UV3A 3RIAF 3PF2A 4LHQB 1I9JH 4WUKH 4GKZB 2X1PA 3VH8B 1QSFA 15C8H 2QSVA 1T5WA 1W72L 2BY1A 3SE3C 2YEZA 4X4ME 3SJVB 4U6XA 4MYWB 4FFYH 1GCFA 3C9NA 1WV7T 5D7LE 1YEEL 2ZKHH 3BPNB 4YJZL 4L3EB 5EBWA 2BDNH 3QCUL 2E6QA 1ITBB 1QNZH 3GUTA 4M6OH 4C83A 4GKZA 5FM8A 3U2SB 4TPRL 2DM3A 4Y88A 5IMOB 3WIHA 4U6YB 1JPGB 1ND0A 3KPTA 5F7EH 4OCRH 35C8L 4WJ5A 4IRJC 1KJ3L 4JFFB 2R8SL 3OKEB 1PG7W 1BD2B 2VYRE 4TNVF 3B8YA 3WYRA 4MD0B 1MCQA 3TH4T 4C57C 3H2WA 1JV5A 5KSAC 2FBJH 4AMKL 3GSQB 1J11A 2XG4A 4CNIA 3MBED 3MNWB 3UMTA 2NNAA 3BGFC 4TUOB 5GIRA 1QACA 3O4OB 2E7MA 3N85H 3QUMA 4XVSL 4JFFA 4NNXB 3I84A 3MLXH 2GY5A 3ROLB 1U36A 3GSQA 3QIBD 5C8JA 3RUGF 2WW8A 3MACL 3Q6GL 1ORQA 5F3HB 1F13A 2WLYA 4FQCL 4Z7VF 4YIQB 3X13B 3NOIA 4NNXA 5ITBL 3JWNC 5EO9A 2H1PL 3SY0B 4ZO8A 3CFDA 2Y1VA 4BUGA 4LAQL 3ROLA 3N50A 2ATKA 2VC2H 1EHNA 1SEQL 4JFHD 3HPJA 5F3HA 1CTNA 3RIFF 3PG2A 4YIQA 3PIQB 2XICA 2AI0H 1GAFL 1NDGA 1FO0H 2F74A 4GAGH 3OZ9H 4PJFE 3IFPB 3HG1A 4NBXB 4M7LT 3HZVA 3O0RL 4PJDE 5GGVL 4UINH 5C09B 2FB4L 4JGJA 4HFWB 1UCBL 1NDMB 2X70A 5DURB 4ZUVB 3PIQA 3VFMA 2BSTA 2XPGB 3KHQA 2IANE 4OZFB 1DBMH 5C3TA 3AVEA 2FO1A 5K9QI 2XN9E 4L1DA 3PHOA 3ZTJG 1NEUA 1L0YA 1XR9B 5SWZA 4X9IA 1LK3H 2Y07H 2ADFH 4KKLD 1D9KC 4MJ4A 5D1QA 3B9VA 2R2HA 1K6QH 2QV2A 4V2BA 3JUYA 5DK0B 2APFA 2Z31D 5KSBA 2A6IA 3EYVB 3MRJA 5CEYB 5LGHH 3T4AB 3E8UL 5J8OA 2VJXA 1L7IH 1AHWB 1AD9B 1ZVYA 1K4CB 5E2JA 3G5YB 2NY5C 2NCMA 2OL3B 1UZ8B 2XG5A 2OR8A 1F00I 5AZ2H 3RGVD 4OFYA 4P2QE 5F9AC 5DJ2B 1EAJA 4G6JH 2WIIA 2A9MH 5CEYA 4XCCL 1SMOA 3B43A 1XF4B 2UY6A 2AABL 3T4AA 4TN9A 4JR9L 1AHWA 1AD9A 3PL6A 5KS9E 1RUKL 5HHXH 1FLRL 3G5YA 3QH3A 3BQUC 4KI1A 3FO0L 4JZJA 4EI5B 2ZUTA 2DB8A 2NX5A 1JMZA 4OZGB 2DTSA 2GIYA 3GI8H 4KTDL 4JQIL 1CLOL 2AJZB 2DYPB 1CLYH 4ODHL 3KWWA 4JO2L 5DHVB 4PJBB 5GZND 1YPZF 4XAKE 5FCUH 3L5WB 4MHHI 4G8EB 3CFKA 3U9UB 1UYWL 1WCBB 2VXQL 4QCIB 2DIBA 1NUNB 3RHWF 5DR5L 5ICYB 1G1YA 2CK0H 3P11H 2W0KA 2XZQH 4PP1D 3RDTC 4POZD 5IROA 3OHXA 2NW3B 1NCUA 5MHSE 4IS6A 1FZOB 3RWFB 6CGTA 4NZUL 4DFHA 1K85A 2VZVA 4CJ0A 3U9UA 5L2KB 3WFDL 4XP4L 5J9PA 2DQGH 1QR1B 4K8RH 1B0RB 5ICYA 1ZGLB 2KH2B 1C12B 1MJUL 4X4XB 4YHLH 2UUDK 4NCDA 2NW3A 3C5JA 3BZ4B 5E7BA 3MNVB 4K2UH 3OB8A 2O93L 5DRXA 5T3ZD 1J18A 5DC0A 2ZJSL 1BFVH 4BZ2L 5C0NC 5L2KA 1U8MA 1N5AA 1UC6A 2JJTC 4OF6A 1XF5A 1FL5B 4XPBL 1OP3K 3HB3D 2HG5B 2ZPKL 4XVJH 5A2KH 3BZ4A 4MHHG 4YDKH 1MFCH 1AH1A 1FZKB 4IHOB 4R2GD 5JIKA 3QDAA 5C7XL 3BZEB 3HC3H 3L5JA 3BYTA 4P4KB 2HG5A 5DDHA 5I1EH 1KJMA 4JN2B 5HI4D 1QPPA 5EO1B 4PJXF 1QSEB 4BJLA 1NKOA 3CC5B 4RAUB 4KK8D 4ZFOA 3MR9A 3EOYG 3DRQA 2VLRE 2CDFA 1BJ1J 2NTSP 3QCTL 1DR9A 3LB6C 4PGBB 5E9DD 3O2VH 2CRMA 1YMME 2VN4A 1DANU 4NKMA 4F2MB 5F1NB 4HZLB 3MLSH 4RMVA 3VFWB 2XTLA 2YUXA 4GH7B 5ADPH 2CMRH 5EO1A 5E56A 1QOKA 3HI1B 1KXQE 2ZCHH 1N7MH 4YDVB 1S7QB 4PJEF 3VI4E 3BRFA 4PGBA 5GGQL 5DJYB 4M3KB 1EUUA 4RA0C 4GKOA 1BECA 2VZ3A 1OAYH 4NIKB 4OCXH 3MO1A 1OM3L 3QAZB 3EO9H 3V52H 5I74C 3WUWA 1Y0LB 5LBSH 5FYLL 4YDVA 1UWEL 3JSSA 5C07B 25C8L 1U8HA 2GT9B 2VSDA 4KUZH 3GIZH 4PLNC 2YD2A 5DJYA 3OKOB 3V7AG 4ZUUA 5HGBB 1V3JA 1T83A 2ITCB 4EQ2A 2Z8RA 1DBJH 1OVZA 1F02I 3MMEB 1I3VA 4PREB 3FQWB 5E8OB 1E6JH 3BKYH 1P5VA 4WEUD 3OKOA 5DGQA 1CU4H 3CUPB 5HGBA 4FQQA 5EOTB 1IM3B 4OLWL 3MLRH 2VDNH 1QPXA 2NXZD 4RFOH 1K8DB 2EE3A 4XHQA 1KN4L 5E8OA 1P4BL 2Z4QB 5EU5B 5A43C 3O3AB 4NKIL 2UWEB 5I8OL 4XPHL 4HWEH 1M7IA 3ISWA 2OXHA 2Z92A 3REWA 3NFSH 3GBLA 4ZOBA 3KNBB 1CDBA 1IM3A 5FYJH 4EUPA 4GRLC 2BVYA 1IQWL 1DBKH 1IGTA 2Y6SC 4PTTB 3SKJL 5EU5A 3WJLA 3OKYA 4UUJA 4NKOB 5KANI 3O3AA 4PJ5A 1J05A 2UWEA 1U8NA 4OTXH 2IBBA 2VZUA 3CLFL 1A6AB 3OGOE 1IEBB 3SKMA 3D1MC 4F33B 4M7KH 3BEVA 5C0BE 4UIMB 4KAQH 4S10A 1Q9OA 1KLGA 5C3LD 4UDTB 3JV4B 3MJGX 4XVTH 2F9BT 5HI5D 1NCNA 1UWGL 1EHXA 4LOUD 4UNTA 4XP6L 3WFCH 2XOTA 4F33A 3X14B 1A7PH 1WISA 5CZVH 3LPGA 4GAYB 4UIMA 4NGHL 4ODVL 2HFFB 5D5ME 5GHWL 5IB3B 4OQTA 2UZIL 4NN6C 3D0LA 3CD4A 4PJFA 1HYSD 1RUQH 1JGDB 2VR5A 4L8BB 4OIBA 1N4XH 3FB8B 3RDTA 1P7KB 1MCBA 2OJEB 3MRRA 4Q0XL 1BFTA 3EYUL 3NH7L 5TE4L 4UAOC 3RZCB 5IB3A 2GTWB 4CW1B 2IANA 5ISZB 2NXYB 5DD0H 2BOBA 3CXHK 1U8QB 4MXVF 4X5LA 4F9LA 1RZJC 3Q1SL 3OAZK 3UTPD 1OAKL 1XIWD 4L8BA 4XB7A 3V6ZA 1F90H 1P7KA 1C7SA 4N5ED 1RHFA 4NO5B 1JZ7A 4P4RB 4E9LA 3VU2A 3LQAL 1CD1B 1RIHH 4PV9B 1PZUB 4HAFA 5B39G 3DBXA 2FD6L 5DRWA 4JY6A 3FRPG 2JJTA 4OBSA 2H9GB 3MJ8B 3OJ2C 2G9HB 5DK3A 4O02L 3ULUF 4HIEB 4QXGL 1CD1A 2CUIA 2X9WA 3E1F1 3MV8D 4NM8L 4PV9A 3VD7A 3WEXA 1KGCD 4X99B 4YX2H 1X5JA 2PR4H 3NIDF 3NFNB 4HXBH 1IC4H 1OT2A 3TO4D 2C3GA 5IBLD 1R5VB 4W70A 2DDQH 2J3SA 1T03H 2YWYA 3QJHB 1PX4A 1UADC 3L3OA 4HBQA 1DQLL 4WRLA 1TZHB 5TQ2L 3HNVH 1S7UA 5CAYB 5HYEA 5JQ6L 2B20A 5CJXC 4GRWH 2MPAL 2PUQT 4WY7L 5F7LB 4DAGL 4JANA 1Y6MR 1GYAA 4YHPB 3GB7A 5E8EB 3RVXC 2OR9H 3MBEC 2R1YB 4LP5A 1RK1B 4M7JL 4Z7WE 5BO1H 3HZKB 1CK0H 2DKUA 3W39A 2V2TB 1EFXA 1Q9WB 4XMPH 1CL7L 5DMGD 2XT1B 3TO2B 1M71B 5TE7L 1FE8H 1DE4B 3VFOA 5MENB 1EEZB 3G5XB 1U8KA 1N26A 3K46A 3MLTA 1PYWA 1KCSH 5TDNB 1A7NH 1AKJD 5FDWB 3PQYD 4XRCB 2IFFL 2R1YA 4RMTA 1RK1A 1CXIA 4Q2ZB 4IRSB 3HZKA 4X6DF 4K9EL 4PJIA 3WFEL 4LSQH 1P53A 4K3HA 4RGOL 4KGJA 1XEDA 3CDCA 5E8NA 2V2XB 2BC4B 2XFXA 3T0DA 5DO2D 3G6AB 1AGCB 4JM4H 5IHUH 3WJJC 4RIRA 4R7DA 2NYYC 4XRCA 4ZFGL 4UTAH 4CDGC 3C8KB 3QEHB 5C6TH 4JDTL 4HJJH 3S96B 4G7YH 2W9LA 4ZDHB 3PWLB 3KXFB 2FATH 3C5ZA 3VA6A 4ZUWB 2AV1A 4ODWA 4OI7A 4M93C 4Q97A 4K71C 4JZOA 1J86A 1HINL 1YMHA 2AXHA 4DVBA 4IJ3C 5IJVB 5GS2D 3WXWH 3HS0B 5JNYB 1OPGH 1IFHL 1CT8B 5E5RB 2B1AH 1KPVB 2ZCLH 2EC9T 1ZOXA 3OR6B 2E3VA 3ARVA 4U3HA 3PWLA 3DRTB 2X9XA 3JV6B 3O2DH 2C4XA 4ZUWA 4HGMA 3GM0A 2EE9A 3CXDL 1JGUH 4G8FB 1B2WL 5HGGS 5T1MA 3HS0A 3QDHA 4KKLC 4LKCA 4Y4KD 5JNYA 4ZYKA 2F58H 1UGNA 1HSBA 3W0WB 2ZUQC 4EBQH 5T3ZE 2Z31C 1DP0A 4KQ3L 5E95B 3U1SH 2FNBA 3KS0H 4I4WB 1JWUB 2JJVA 3JV6A 2YD4A 2ADGA 1YMMA 4NJ9L 5IUSA 4HIXL 5DHXB 4ZNEE 4XX1G 3Q0HA 4ONHA 4BKLA 1JE6A 1JPSH 3QIWD 1JI1A 5EULV 3PXHA 3RGVC 2R4SH 3PV7A 3E6HB 2EXWD 5M95B 1ETZB 1DBAL 1JWUA 4XH2A 3KYKL 2N56A 3U4AA 4ONFL 3VGAB 3MTRA 2A6DB 5MP6H 3DMMD 4JPVH 4NQED 2IPKA 2OQJA 3SDXB 1P7QA 1UVQB 3QP3A 3E6HA 3WLBA 4F7MA 3DIFB 4PP2A 1PVHA 1ETZA 4PRPB 4RMRA 5BZWB 1FH5L 1CF8H 3ZE2F 4D8PB 1QLEL 2Z91A 1JJUA 4BELD 4LQ1A 1TQCB 1INDL 1LWRA 3EOAA 4NRYA 5KW9H 5EU6E 2A6DA 5GZNC 4PJGE 3R0NA 2XWJA 43CAB 3QULB 4MJID 2PW2A 1WWBX 4MA3B 3D39D 4PRPA 2WWKO 3SDYH 5D93B 4D8PA 4N9GB 2IPTH 1GL4B 4GW5A 1D5MB 4NO2A 1NFIA 4NC0B 3VGDA 4POZC 3ARDB 3KPOB 1EUTA 4U2ZA 3SKNB 1F4YH 3HE7D 2A77L 3FB5B 4OLUH 5I1LB 3VFVB 2YZ1A 4LEXH 1J5OL 1LO4H 3UROR 3ALXA 5JW4M 3NCYS 2AEPL 2LTQC 3L7FA 2R0ZH 2EDBA 4FMFA 3RWCB 3ES6A 2X4UA 3OR7B 4LFHG 2YRPA 2FX8H 3KPOA 4R4ND 1A2YA 2E9BA 3E6FB 1IBGL 1QBBA 1CLZL 1KLUB 3ULUL 4OZ4B 4X5WB 2DM2A 3CZFB 3O81A 5H37H 2NY0B 5JOFB 5ILTH 1JGVH 2JLLA 2FH6A 4LBEB 5A16A 4ZPTB 3GRWH 3KLAB 4U1HB 2C3VB 3B3IB 3HB3C 1LO0H 1OD7A 1Q1JL 5EZLA 2DQHH 3I6LD 5DJ8A 3E2HB 4YO0A 1LO3H 3OXSA 4OZ4A 5JOFA 4QOKD 1N5YL 4MXWL 1IEHA 2XA8H 3GSRB 2GJ6B 3N9GH 4YDLC 4DQOL 1HEZA 2OZ4H 1WT5C 3NIFE 1ZMYA 3QO0B 4JFXA 4QRTA 3KLAA 4U1HA 1CE6A 5DD6B 4PRNB 3QXVA 4UILL 4P2CG 4FABH 3ARBB 2FGZA 4M43H 3CVHL 4NRXA 2Z8SA 3MBEA 2IALB 5HI4C 3FB7A 1OTSD 12E8H 5D5MA 1P7HL 1ZWIB 2ICWB 4A2LA 1NAMH 1MREL 4D9RD 4RCAA 1WWAX 1YUHB 3C09C 4OZIB 3BO8B 3WE6A 3DARA 3QO0A 1BX2B 2K3TA 3AS2A 3RA7H 1VEOA 3DGGB 1BIIB 5L8LB 5I71B 3ARBA 3CFCH 2FLBT 5IVZB 3QIBA 2X2YA 3P0YH 4PJ7B 1MI5D 4PJCB 1ZWIA 3OF6D 4MNQB 1AE6H 2H8PB 3V0VB 3BUTA 5JOPD 1BX2A 3ARTA 4HS8L 3ZDZE 1BIIA 3SGJC 2FBOJ 5GRVL 3C6LC 4AEIL 1ADQH 5IVZA 3WJJA 1S3KH 4OGYL 2VZ1A 4PBXA 1OW0C 4YHYB 1GPOL 4AG4H 4K94H 4J3VA 1VFBB 5ALBL 3V0VA 2I27N 4I5BB 3EYSH 4S1RL 1OAQH 1J0YA 1FNGB 5HHQB 4HC1L 3S6CA 1QQDA 4HHAB 3T1FB 3MNZB 1PJ9A 4Z76A 2Y7QA 3GBNH 5B38B 2R23B 4O9HH 2HFEB 1A1NA 1BBDL 4GBXC 4J8RB 3DX7A 4I0PD 3SPVA 4X6BB 3SDDD 1F4WH 3QHFL 5GGTL 3VXOB 4HHAA 3UTPE 2IGFL 4W6XB 5IG7B 1M7DB 1T04A 4YR6B 1AD0B 5GPRA 3GJFB 3MRLA 4GKNB 2QSQA 1IC1A 4OD1H 3VFPB 1BQHA 2EECA 1HKLH 1NFDF 4ODSL 2Z31A 3AS1A 2D4FA 3MOBH 3BD4A 3HNSL 4MAYD 3BE1L 1QLFB 4Z7OF 4NQCB 4Z7WA 1A7QH 1X4XA 2Q7NA 3PDGA 4C56B 4YR6A 3DVNA 3GJFA 3MLYL 1NGWB 3MV8E 2BFVL 4M6NH 2OI9C 1KIQB 3RGVA 3HN3A 1NGXB 2FGWH 3D85B 3KYNA 3BPNC 4WTZA 5HPOA 2FRGP 5EC1A 1MRDH 1QHPA 4HIJB 4U7KA 5FYLD 3VGHA 3GMLB 4CN4A 3O9WB 1Q0YL 4X8XA 2W9DH 4Z95H 2VQ1A 2ITDA 5D72H 2BSRB 3DVIA 2AEIT 3SGEH 2ZUUA 4OV5A 3RTQD 1UZ6F 3HLAA 4TUKL 4MDJA 5HI5C 3M1BA 2DLTA 3DYPA 4LOUC 4J7RA 2Q8AL 1JWMA 2MCPH 3BHBA 3X11B 4HIJA 4LHUG 4MD4A 3H9SD 4JO3H 2A9NH 2B0SH 5FB8B 5ADOH 2BSRA 2ZUXA 3FQRB 2PXYB 4G9DA 4WEBH 3QUMH 1PD6A 2WINB 3O4OC 4OCSL 4FQ1H 4LKXA 3BP7B 3QYCA 5T1DH 3WO4B 4YHML 3IU4L 2YUWA 3OG6B 3V6BR 3WNOA 1CZ8L 4G8IA 4WO4B 4Z6AT 3FQRA 2FO4A 4TQEL 4QHLA 1S9YB 3EGSA 4JFZL 5I19L 1XIWC 2R0LL 3R1GL 2WINA 4R0LB 4U7SA 2EYSB 1CQKA 1VACA 3O6FB 2DICA 3HUJE 4N5EC 2OTPA 3I6GA 5DS8B 1ZLVH 4OZGE 4PD4K 3ZMRA 3QQ3A 3IYLW 2ARWA 5TDOB 5GJSH 5EOCJ 5ETUB 2IH3B 1ZXQA 1KCRH 3QI9B 4HJ0C 3F12B 4PJBE 1BM3H 1ZV5A 4AY0A 2AXGA 1VDGA 2VXSH 1MFDL 3PHQB 4R0LA 3O6FA 5JPNB 2H3NB 4HUVB 4UOJA 3CMOL 5E94B 3HR5A 3BKJH 5DTFA 3RAJL 1EXUB 1KC5H 4GOSA 4RQQA 3VXSB 4D0CA 2ICEA 3G5VB 2LVEA 5I15H 4KQ4H 5ETUA 3OPZL 5F8QC 2IH3A 3AREB 1JBJA 1AQKH 2W1NA 2W0LA 5AUMA 5JIPA 5C71A 5IT2L 4AEHH 3WMSA 3PGDB 1SJEB 3TO4C 4LP4A 3LEYL 4NO0D 2E9JA 3SDCB 1T1WA 1KACB 5IBLC 1T5XA 3THMH 2RR3A 1MWAL 4OFDA 4IEFB 3QG6B 3DUHA 4HUKB 5JPNA 3L5XL 3BKCL 3GM8A 5IB4B 1BHGA 3B6SA 4JB9L 1MY5A 2AJYH 1F8TH 5FOBB 2A73A 1CGSL 1HWHB 1FVCB 3DROA 5HYJD 4OCYH 3KYAA 1FYTD 5GS0H 3IDMA 5GS1C 3W9EA 5ALCH 4UI2A 5E9DA 1U8IB 1RUMH 1X5YA 4L4JA 3MUZ1 1S8DA 4P9HC 4X98A 3HRPA 5IB4A 5EBGA 4QTHA 2HP4A 2GSGB 4Y16D 4HBCH 1UJTA 5I1CH 3DSNA 5DMGC 1KIRA 4WV1B 1E0OB 3QXUA 1GGTA 4V1DB 4LF3A 3K4DA 5HDQH 2GW5A 5FV1L 1F6AB 3HC4L 4EQ3A 3SGJA 1JHTB 1ZT7A 5HGDB 1EBAA 1HCVA 4PGEB 2OL3H 4JHBA 4WWID 5HHOD 3NMEA 3UTSD 4XWGH 5F7YC 4HXAL 1OAZL 2ENYA 1NLBL 1KG0B 2VERN 4EI5C 1EDQA 2SEBA 1GGCH 1I3GH 1LO2H 3KLDA 3KPSB 4HPYL 3T0BA 4ZNCD 3BH8A 1JHTA 3GI9L 3FT2A 5HGDA 4J3TA 5K9KA 2R29L 5H37G 5EDXA 5IVXB 4HUWB 3ARFD 4MJIE 3MXVH 2FEDC 2X4QA 5JHDB 4KRPD 3D39E 3K81A 3VXNA 4MSWA 1RIUH 1UM6L 2QQKL 3NZ8B 4LRNH 4AENA 1JL8A 1CE1H 3PP4H 1KPUA 1ZT1A 5DHVH 1KBGH 4PUBH 1BF2A 4ELMA 3BSZL 2AJUH 1CBVL 5JHDA 3UJTH 4ZUSB 1IGIL 4YHKL 4R26L 4UOW0 1I4FA 1D6VL 1RV6X 2EDFA 3MA9H 4KH2A 4MZ2A 4K7FB 5DQ9B 1A02N 4YHOL 3HE6D 4P3CL 4XPAH 1FDLH 1TMCB 5GRUH 4Y4KC 3DX6B 1T2XA 2FECL 5I9QB 5HYSG 1WBZA 5H8DA 1Q72H 2B4CL 3I3DA 1V3LA 2EICA 5HVWA 4ZXBB 5IBUB 4ZUSA 1MHPL 3TWCL 4OM0L 4HKXA 4LPXA 1LEGA 4TSAL 1FBIL 4DKFH 4FQXB 1HZHL 5DQ9A 5GSRB 4WFED 2OMNA 1FZJB 3I6LE 3QIWC 1GIGH 5L88H 1EO7A 2Q8BH 1KENL 4QOKE 5F89A 5SX5H 5LXGL 3MPCA 1OSZB 2EXWC 5E5UB 1JPTH 3R8QA 3ZKMD 1J1PH 4ZFZB 1HHKA 4QXUL 3GFUA 3X3GL 4H20H 3I2CH 4UU9A 4I2XA 4FQXA 3DMMC 2OLDA 1T21B 1MRCL 2NY3B 1IILE 4I3RH 1VSCA 3IXAB 1OAUH 1N6UA 2OK0L 2YWZA 1OSZA 1DLFH 3TA3D 4R4FL 2Q76A 4QO1A 2CIKA 2YRLA 4MAUL 3BDBA 4JO4L 1LDPL 1TTFA 1H8SA 2OSLB 3IRPX 4FXKA 3NCYP 4N1HB 3DO3A 3VRJA 2AJXL 2CKBB 2E27H 3VW3H 1U0QA 1RPQA 4BQ9A 3IXAA 3IB4A 3D0VB 1MI5E 4Y5XC 1FJ1B 3FQTA 3SGEI 3FMGH 4B5EA 4QEGA 3C60D 5JOPE 1C5CL 4M5ZH 1XIWA 4DFIA 3LRHA 1RURL 3U6RA 4EVNA 3HE7C 4NUJA 4GXUM 2AS5M 3SE4C 4BSVB 1FP5A 2BSSB 2D2OA 4XMLH 4JFDB 3F5WA 2X1QA 1MCEA 1TCMA 3FO9A 5TF1H 2VN7A 3WFBH 1HYRC 5JPMB 2ZSWB 1NC2D 3CX5K 3D2UB 4ODXB 4R4NC 4XMKL 5I2IB 3ETBF 1PZ5A 1OQOA 3IDGB 4G6MH 5D2NE 1IKFL 1BZ9A 1MCSA 1YEFL 5BVPH 2BSSA 5ICZA 1J0ZA 3S3SA 3N1QC 1FFNB 5LJYH 4PBWD 3RNQA 3NCBB 4ODXA 5GZOC 2NQCA 3IDGA 1DEDA 1U8OB 3FN0H 1KN2L 2BRRH 1NSNL 5ID1B 4FZEH 2CKNA 1N2RA 4FZ8H 1FFNA 4OLVL 5F9OH 2NZIA 2CH8A 4CADA 2DM7A 4XP1L 1KELH 5GS1A 1U8OA 1C5BL 1G7LA 3ELAT 2HLAB 3BP6A 1MUJB 1OTSC 3GGWA 3REVA 4YAQB 1YNLL 3LPFA 2ENSA 4RAVB 4EUPH 5IESH 3ESVF 4CAGA 3S35L 4KFZC 3PP3H 4P5KA 2F53B 1AKJA 3NN8A 3PQYA 5FYLE 5SWQA 1MCOL 2AP2A 5E2TH 5IFAL 4I8DA 4YDIL 5E99L 4YWGL 3DURB 5JXEC 1W72A 3FFCB 1IGCH 4RAVA 5DC9B 3ULUD 4MCYB 4K3EH 4NKDA 5JORB 1X6NA 4LGSB 1ZHLB 4NDMB 3QBTB 1T1XA 2YD6A 3STZB 1X9QA 1CFNA 2NW2B 3HUJA 3I75B 3MRIB 3PDDA 4GMTH 2ZZUT 2QADD 1OCWL 5CEZD 3DURA 1T7YA 3TBYB 3DUUA 4MCYA 5JORA 4OQTH 1BGXL 4NNYA 5D2NC 3CCHB 3QCVL 3DXAD 2NW2A 1Q94B 5GSVA 1QFOA 4C54A 1TJHL 2DBJA 1NCWH 2ED8A 2YKLL 3VFSA 3F7QA 4WIQA 4L8DB 1G0YR 3FONB 2IAMB 1DBBH 3UBXA 5MENE 3TNMA 1U3ZA 3TESA 4LCIH 4R97B 1IL1A 5ICXB 4OD3L 2Q7YA 2NXYC 1PY4A 3HI5H 2GUOB 3NACH 3VWJD 3GIVB 3FONA 2PYFA 1KCUL 1ZLWH 3PWUB 1OOAA 2P24A 2M26A 3V4PL 4JGMA 3FQUA 5FGSA 3QUYB 4XT1C 5F9WB 5CIPB 2BCKB 4MJ5B 4YPGB 3VI3F 4Y1AD 1LNUB 5E2VL 4RMQA 1TZGL 3LEVH 4PV8A 1II4E 2GK0A 3BVNA 3VXTB 5KVFH 1HQRA 1HHGB 3GMRA 3NABH 5FHBH 3FO2B 1TLKA 4LLUA 1XF2B 1RZIB 4NHUB 2BNQB 3C08H 4KJQC 3QUYA 2DQCH 1BAFL 1KTLB 3QA3B 3KXFE 3PDOB 4TSCL 4JHWH 1MLBA 3QHTC 1RU9L 4QRUB 1CICB 1HHGA 1KOAA 1TPXC 2YPVH 1N6QH 3CK0L 4IDJH 4JRWA 3DMMA 1JYNA 5JW4R 4NQEA 3TYGL 1IARB 2G2RA 1XF2A 1A3QA 3H7LA 1RZIA 5ABDE 5E5MB 2R2BB 1T20B 3NPSC 3RTQC 4OFVA 4OF0A 3PDOA 4JKMA 1D3CA 1YEGH 5CGYD 3QUXD 5FCSH 3TZVB 4WI9A 5HYJE 4LCCC 3LDBC 1ZTXL 3RL1B 3QDJB 2RGSA 3EUUA 4XP5L 5J6HB 1T89A 2HFGH 2YOCA 3K8MA 2OYPA 3W0WE 4LCYA 4GO6B 3NFPA 5E5MA 5CS7A 2V17L 4MJIA 2EDWA 4QNPF 4HG4J 5F7NC 4DGIL 4Y5XA 2IC2A 3TBTA 5BXFB 1IAIL 3D39A 5HYQB 4X6CB 4PJ8D 1U6AL 1WSST 4DZ8B 1OTUC 1P5UA 5CFHA 3RL1A 3J8F7 3SCMD 3OSKA 3RY6C 5J6HA 1TVBA 1HH9B 4Z78B 3HE7A 1URLA 5EZIL 2CIIB 2DQDL 4LVHC 4TOYL 1FQ9C 1BVKB 2X40A 5HHOE 3K0WA 3UTSE 2O26U 4X6CA 3EYFA 1EA9C 4IBLT 1QLRA 2CJUL 4LVOB 4HWZB 3PGFH 4MA8H 3FAWA 1HH9A 3SDXE 3NIGE 5F1OB 4JREB 4Z78A 5F6HJ 4GKSA 1MFBH 1QYGH 1UA6L 2PKDA 4IOFD 5IMKA 4L9DA 3TJEH 1BVKA 3O41A 1Z9MA 3MOQA 1F3JA 2C26A 3DTXA 3LHPL 4XP9L 1IJ9A 3LQMA 4HWZA 4D9LH 1AP2B 2VSCA 3BFOA 4H8WL 3IJSA 4FQHB 4HUNB 5HGAB 3WKML 5JO5A 3N06B 4D0BB 1T0PB 1C08B 2IADB 1W8NA 4P5MB 5FO9B 2BNRD 3C2AH 4QOKA 4DGYL 3WDJA 3IDYB 3C87A 3GSOA 1SBSL 3PJSB 1AIFA 5BQ7A 5DJAA 4IRZL 3F7RA 1ZA6B 2JK5A 1U58B 4YQXL 3GO1L 4OF7A 3GNMH 4CU8A 5JOEA 1KJ2L 3TC9A 4D0BA 1C08A 1YEIH 4MDIB 2IADA 5C0RL 4PJEE 2RB8A 3EOTH 1DQQB 1H0DB 3RBGA 1OSPL 3UZQA 3UPRB 1XH3B 3O3EB 4PGDA 1G7HB 2JB6B 3B2VH 2FJGB 2A83B 4QRRD 1MCFA 1NCDL 4P57A 4WFEE 4Y16C 4ALAL 5KJRH 5EWIH 4BH8B 1S5IL 2ESVB 1YEDA 3RNKB 3AXLA 3V5HB 5KVGH 4H5SB 3KR3H 3WN5B 1A6WL 5KN5B 3UPRA 1XH3A 1YNKL 2VXUL 3O3EA 4OI9A 4FP8L 2FJGA 1LP9E 2A83A 5IQ7L 1JUFB 3RU8L 4CVWA 1U2HA 2GJ6E 2E7CA 1D5IL 2E9WA 5EUOE 1RIVH 1PSKL 2MHAA 4M02A 4BH8A 4J6RL 5DSCA 1YC8A 3K1KC 4LVNC 5CJQH 1I7UB 3V5HA 3VGAC 3TVMB 5T33H 3VWKB 4JHAH 2ZCKH 4N0YH 5DYOB 4NZRL 4PJ9B 2Z8VC 3WUWG 4ETYA 1AGBA 3QUZB 3VGGA 5CHNA 2BVOA 2WP3T 4Q6IC 3D18A 5C2UB 4S1QH 4ERSL 4YZFF 4OZIE 1WZKA 2IG2L 1SHMA 4XNYL 1TQCC 3NTCL 1A5FL 3RGHA 3B9EA 2DBLL 3ARFC 4Y8AA 3LQZB 2RBLA 4I0PA 1SYVA 1PX3A 4KRPC 4U1SB 2BVUA 5DYOA 3SDDA 2FR4B 4YC2C 3F7VB 4PJAE 2AQ1A 3CLEL 3CAFA 4PJ7E 2J7LA 4PJCE 2OTUA 3AGVA 2P5EB 3U79A 3ZHLA 2VWEE 3S97C 3QRGH 3O2WL 5ERWB 2J8UF 4O58H 5BS0D 1RZFL 1SM3H 5L8KB 1EPFA 3LQZA 3RUGA 3BXNB 3AAZB 4F58H 2HRPL 5E1AA 5E8PB 2E6PA 4DTGL 3H3PL 5F96H 1WEJH 1WLHA 2YBRB 4Z7VA 2DQJL 2YD9A 4MAYA 3JZ7A 5JDSB 3HE6C 4R6UA 1YYLL 3T4YA 3P0VH 1ZVSA 2OP4H 4XNUH 4KDTC 4XCYB 1HDMA 2XRAH 5I1IL 4EUPG 3K2UH 3P2TA 2NY0C 2CO6B 3TEUA 1EHAA 1U8JB 5BZDA 3EO0B 4Y2DD 2AXJA 4Q9QL 5TFSH 1O5DT 4MNHB 5AWNL 2BXZA 1L6XA 2EDOA 4U7MA 1A22B 3ZKMC 3JWOL 4XCYA 2HRLA 3RTQA 2IBGA 1I1AD 1LD9A 2IQ9H 3IRZA 4F8TA 3S8WA 1NKRA 2EH8L 1H3PL 1SJHB 3SE9H 4TVSa 4LCCA 5T3XL 4L9LB 2QL1A 4ZTPH 3U46B 5JR1H 4XCNA 1V8HA 4MXVE 3H9SA 2HAZA 4XBEL 3UO1H 5LWYL 2WSKA 3WV0A 3TA3C 1KCVL 4DEPB 1NEZB 1P4IL 1ZANH 4NQCE 1QBML 5DMIL 4KKCC 3BPCA 4PJHB 3RY6A 4F15B 4DJMA 3ZKND 1X5ZA 5I71C 4U49A 1I8LA 2FJHA 3V5KB 1JF5A 3C60C 1NEZA 3SDAB 4DGVH 2WV3A 4GXVH 3ULUE 1SVCP 2VWEC 3DV6A 2XNAB 5EOCH 3LZFH 1TQBC 2X4OA 4LLMB 2DLEA 1QFWH 2GI7A 3ILQD 4KMLB 5J0BA 1A14L 1FCCA 3SN6N 5CEZE 3V5KA 4G6FD 3A6BH 4TUJB 4LPCA 1YC7A 1TDQA 1RULL 1F2XK 1BVLB 1EO8L 1I1YA 3TPKA 3DXAE 4LLMA 4O4YL 3B8SA 1X5GA 4HMCA 1R3IH 1P1ZA 5C2BL 1NGPL 2PW1A 1YPZA 2D7PA 4WUKL 4OSUH 1JWSB 4GW1A 3UPAA 3HCVA 4NO0A 1BVLA 2KBGA 1F3RB 3G6DH 2H32A 5DFVD 1EGJH 4ZSOE 4PR5B 1JYVA 1RJLB 4DCQB 1VPOL 1RFDL 4M4RA 1VKXA 4M6OL 4P5TB 3MRFB 4CBPA 4WI8A 3NPZB 3ZDYF 4X6DE 4Y1AE 1FYTA 3FZUC 1JCKA 1CDIA 4OT1L 3CJJA 1NMBH 3TF7C 5F7EL 4OCRL 3SOBH 1NCBH 3L5HA 4HQQH 4Y16A 1NQBA 3EBAA 1KB5L 4CKVX 1NL0H 4BA8A 3I9GH 3GJFH 5MEQA 2R39A 5H2BB 1S7SA 1EO5A 4KTYA 5E8DL 1N0LA 2FBJL 3MLWL 4M03A 5FUCC 1R6VA 2BVTA 1IEAA 1A1OB 5FGCE 2BERA 1A4KA 4RX4D 5KS9F 1LEKB 2BY0A 5HHOA 3ULUC 5FA4B 3MLXL 4PJXB 2VABA 3TBSA 3ZYIA 1CGXA 1A7OH 5T1LB 4OQ1A 4JLRB 4K3DH 1A1OA 4Q6IA 2FX7H 4JJ5A 3VMPA 1I3RB 2AJVH 3AU1A 3NA9H 5CCKH 1R24B 1QRNB 3ARFA 5CP7A 1OP5H 3T2NL 3MA7B 3GBML 3WIFB 4PJXA 4ZQKB 5CUSH 5T1LA 2PXYC 1AGFA 4JAMB 2WIMA 5H94B 2AK4B 5I1HH 4JM2D 4X9GA 1JNLH 3WNNA 5HJ3B 3UYRH 2AI0L 1GOFA 4NP4H 4FQIH 2UZXB 5JIIA 3WIFA 4OIIH 3MREB 4ZQKA 7FABH 1XF3B 3VWJC 3HE6A 1U3HD 2AK4A 5D2LE 4EDXA 4G8GB 5HJ3A 5IFHL 3QNZB 2QR0A 3VXMB 1X5HA 4ZOAA 5T3ZH 4UIKL 1M1SA 2CRIA 2IQAB 1C7TA 5KVMC 4K23L 1MHCA 3X12B 3VFGL 3W2DL 1XF3A 3JWDC 2ERJB 2ICES 1ZLVK 2Y36L 5KOMC 3VFTA 5F7DB 1EK3A 1HQ4B 3QNZA 2BNRE 3D3VB 1P4LA 2X4SB 4GG6B 2DMBA 2IQAA 1P9MC 3KPNB 4F7EB 1JFQL 4K7PX 3S36L 3X12A 4M7LH 3PWPB 2IF7A 2HJKB 3U4BL 5FA3A 3SDCC 1AFVH 1CQYA 1ROWA 3OX8B 1UJ3C 4EJ1C 1ES0A 5AZ2L 5FO7B 2ZG1A 5IVNA 5IEKA 3QUXC 2X4SA 5DRNA 4FXGB 2GAZB 2COQA 4JQXC 1VA9A 1T2QH 1I7ZB 2K9UA 2P49B 2HJKA 4FMKA 5AYQA 3V4UH 1OY3B 1RMFH 5FAAA 2G75A 5KZCB 4GQ9H 3LKNA 5HI3C 1HXMA 4WI4A 1ED3A 4PJ8C 9CGTA 2DQEL 2GYSA 3U4EB 5B3NA 4FXGA 4Z8FL 3SCMC 1AO7D 1QO3B 3MGTB 1I7ZA 4MA1C 4WU5B 1L9MA 1FAIL 4HW6A 1MPAH 2MQ3A 3P4OA 5DMYA 3IJHB 3VI4F 1DL7L 4ACPA 1EJ6A 4DKAA 1I7RB 4G43A 1AC0A 4TULL 2CK0L 2XZQL 1HILB 1G6RL 1QO3A 1NC2A 3FQXB 4OZHF 5DMKA 1REIA 3MRDA 3BDXA 5FHAH 1LE5A 3W82A 1DQTA 1FG9C 1NGQH 5IEHA 3U0WH 1PKOA 4MQ7B 3O4LB 3IJHA 4IOFC 4MWFA 1QBLH 4HK3N 1QVOB 3VXRB 1XMWA 2ARJA 4L4TB 4P0DA 3U36A 1VEMA 1F5WA 3SKOB 5GRJH 2N7AA 1CGYA 4Q9BA 2A0LC 4K2UL 2F5BL 5C6PB 1NBYA 1QFWI 4NM4H 4F80A 1BFVL 1F58L 5BS0E 1WBXA 4Y19B 2AVGA 3U9PH 2EE2A 1PAMA 4KPHL 1MFAL 4WI3A 3HR6A 1UXSB 1C16A 1W0VA 1Z0MA 1GH7A 4XVJL 1WIOA 3SKOA 2F54D 4M1CD 3GMNB 1MFCL 5CINH 5KSUA 3TH2T 4PB0L 3FTGB 3CFEA 3TJHC 4Y5YB 1RUAL 1B9ZA 3SO5A 1QHOA 4LSSL 4OB5H 5I1JH 4M7ZB 1JI2A 3MXWH 2PYED 3IKCB 1IAOA 3QZWA 5DD3H 2VDPL 4HK0B 1EEYA 2ZUYA 5AZEH 3GMNA 5GGRB 5L2JB 3VD3A 5C6WH 5LCVH 3DUSB 2EO9A 3FTGA 2CDEA 4PTUB 4XNXL 5D70H 4Y5YA 3B2UD 3RWGA 4Z7UB 3DX9A 4GG8A 1X5LA 4RFEB 1FL6A 2X4PB 4Z77B 4FTVB 4C58B 3M8OL 3WDHA 4OLYL 2QHRH 3IKCA 1ZHBA 1JHLL 3S35X 3I02B 3MLSL 5L2JA 5GGRA 4R8WL 4ELKB 4LSTH 5B39B 3ZKSD 4PTUA 5IVOA 4M1DH 5SX5K 4OCNC 5E4EB 4JRXB 1N7ML 3CVHB 5D1ZB 4Z77A 5C70A 2NY3C 2C1PA 3O6LL 4PY8J 5H35B 2X4RB 5BMFL 3DXAA 3TYFB 1UM4L 3QHZL 4U1LB 2Y72A 5TPWL 1NFDE 3QPXL 1MAMH 2VLLB 1OAYL 1RZ8A 4OCXL 3EO1B 2DTMH 2OBGA 4XC1H 3WDIA 1CFTB 1JZ8A 3EO9L 1ITCA 3FRPA 3CMGA 4JRXA 5D96C 2C7UB 3BUYA 3CVHA 3V6FB 2F53E 2VLJD 2FL5B 4U1JA 3SO3B 3MROA 5I1KH 4WW2B 2W65B 2X4RA 4ZS7H 3BAEL 3FFCE 2VDOL 1NFKA 5K59E 2NY2D 1RZKL 4RGNB 3VWJA 1T7VA 3QFDB 4X4YA 3IAPA 2R0WH 1OLLA 4OCWL 1DBJL 4UOW1 1XGYL 4L3CA 1IZKA 5EBLB 5ESVB 2I9TB 5EIIB 4Z0XB 1DUYB 3LRSB 4N0FA 4P99A 4X6DA 3P9MA 3QEGL 4Y1AA 1BQHG 4MX7B 3IFNH 2DKSA 3FN9A 4U05A 2LU4A 4LNRA 3ZDXE 1VFAA 1DTUA 2GITB 4PYHA 3G08A 4HZAA 2VDNL 1IGFL 4N0UB 4RFOL 2H41A 1DUYA 3P4LA 4Z7NE 4ZUTB 4M9PA 3U30C 2DJ4A 4XCEA 3MZGB 5C0EB 4QGTA 1AXSB 4Y2DC 1GZQB 1TJIL 3P9LA 4YDJB 3T1WA 3ARUA 5SWSD 3BWAA 2WWMD 4WTZG 3R06B 4HC1A 2VQTA 1H15B 1UJ3A 1KFAL 4H0GA 3QG7H 5L8JB 4HKJB 1VCAA 4ZUTA 3QUXA 1LK2B 4UZGA 1RJYB 2W0FB 3ZL4L 1JK8B 3FQNB 5MEPA 4L5FH 1VESA 1T1YA 5JW5A 4JQXA 4LSVL 5IFJB 3CSGA 3QUKA 3KLHD 4M7KL 3IDIA 2HWZL 5GGTA 2XY1A 4MS8C 4KAQL 1ULVA 1GJIA 3Q5YA 4WVRA 3F58L 5T1KB 1LK2A 2APXA 2WBJB 3TBVB 4PJ8A 1NAKH 3FQNA 4AH2B 4NUGH 3HC0A 3AUVA 4E41D 3G6JE 5HHNB 3QDGB 1A7PL 1X7QB 1INEH 4V2CB 1FNFA 2P47B 3ZKNC 1HI6A 3UJJL 4MQXD 4Y4HB 2Q3AA 4PS4H 4Q9CA 5D8JL 3Q5OA 4TVPL 1W72H 3QFJD 2WBJA 1U3JA 1MLCA 2EYRB 2DQFB 5IOPB 1MCPL 1EHLL 1N4XL 1U8PB 1OB1A 2R2CA 3PP3K 1E4WL 1YEJL 1TNNA 3L95B 3ARGB 5DLML 4MQSB 5HHNA 3ILQC 3OXRA 1X7QA 3QCUH 3G04B 1IQDA 3M07A 1UB6B 1BJMA 4TPRH 4YXHL 4QRPB 3S5LA 2X7LA 2HJFB 3CDGB 3H9YA 2D03H 3DHJA 4LGRB 2HA1A 1P84J 5GGSB 1VFOA 4XC3L 4XBPB 4NQUA 5HY9B 1RJCA 4JZNB 1KJ3H 5C1MB 2QBWA 2R8SH 1MCRA 3L9RB 2NLJB 5T3XD 2I24N 5DEFA 2P8PB 1RZJL 1TENA 1UB6A 5GS2H 4X7SL 2P7TB 5TDPB 4AMKH 4YHNA 3CDGA 3QXDB 5EO0A 4W4OC 1A6VL 1NGZA 4IMLB 5HY9A 4HFUL 4HT1H 5DFVC 2Z93B 3ARRA 3PWVB 5D71H 2NLJA 4KXZH 3MRBA 4YX2L 4H25A 4X7DC 1ORSB 1IC4L 1F2QA 4LCWB 4M61B 5TDPA 2NY7L 3GZKA 1GHFL 3TT3L 4HGWB 3MACH 3Q6GH 3DETD 4IMLA 3S4SG 3A6CL 3ZHDA 4QRRA 1T03L 1JGLL 3LS5L 4FQCH 3EW3B 3ULVD 2R56L 2DLIA 5BRZB 3HNVL 2H1PH 3F62A 2AK1L 1ZLWK 3F6IA 1DVFB 4RZCB 2VKWA 4LAQH 1ORSA 2AEQH 4I77L 2CLVA 4LCWA 3L3IB 5CIPH 1SEQH 4HGWA 4LIQE 2YPLD 4JJHA 3TCLB 4L4VB 4FOMA 1GAFH 1Q9LB 3LN9A 5BRZA 4QRQB 3L7EA 1DVFA 1CICC 1KPRB 1T0MA 4WUUB 3O0RH 5GGVH 3UTZA 4JKPL 4UTBL 5HVHB 2FB4H 1YYMH 4E5XA 4WDIA 4A2MA 2GJZB 4U1GC 1EV2E 3QEUA 1PEZA 1EVTC 4GSDL 1Q9LA 3RWEB 4QRQA 1S9VB 4FXLA 5KAQF 1MWAA 1KPRA 2JB5L 3MJ7B 3VGBA 1KXVC 2VZSA 2VAAA 4R9HA 4PJGF 3WFZA 3H42H 4OUUA 4MGXA 1N59B 5C0CD 4XCFH 2WQ8A 4OGXH 4X8JB 2GJZA 3L3GB 2WANA 4G3YL 1AO7E 5I1GH 2AV7B 1INQB 1OGAD 4JM2C 3F8UB 5EBMA 2EDKA 3OKDA 1S9VA 4OAWB 3MRCA 5BS0A 3MJ7A 2D7MA 3E8UH 3VXPA 2AGJL 3QIUB 2BNUB 4QHNA 2WZPD 4ODUA 1W0WB 2VO5A 5C0IA 2FATL 3L3GA 2AQ3A 1U3HC 3RWHB 4LVOC 1CIDA 1CWVA 1NBZB 3B9KB 5ELIA 2VDKH 2B1AL 4XCCH 1AGDB 3HRZA 2AABH 3BYYA 3LEXB 3O3BB 4JREC 2X5PA 4IRJD 4JR9H 1YJDC 4RNRB 1RUKH 4X6FB 1KIPB 1ZE3C 3CX2A 3MCLH 3FO0H 3MFFB 4HUUB 3OL2A 3QXAA 1JGUL 1I7TB 3FB6A 4WWKD 4Y2DA 3RWHA 1U93A 1N64L 3QQ4B 4KTDH 1CLOH 4WGVB 2O5XH 5E03A 3KPRD 3RL2B 1AGDA 4JVWA 3FL7A 3TN0B 4ODHH 3U1SL 5I8CB 1I8KB 4R90L 5IBTH 1FSKB 1I1AA 4RNRA 5D1XB 1FVEA 1MJ7L 4JO2H 4PGCB 2P5EE 1LE9B 5CSZA 3U7YH 4X6FA 1K3ZA 3NIFF 3AM8A 3A0OA 1I7TA 1JPSL 1I3UA 3LIZL 1UYWH 3QQ4A 2F54E 4MMZC 2MSPA 3B5TA 5BOPA 4JRYB 2R4SL 5DR5H 3IJYA 3IS0X 3S88L 2BVQB 4KY1L 3E0GA 5D1XA 4A6YL 5J6GA 4PGCA 4LMQI 5IK3A 1UACL 3TBWA 3PWJB 2W59A 1H3VA 2X10A 2JIXB 4NZUH 1NFDA 1YNTB 1FNAA 1V7NH 3WFDH 4XP4H 1NC4D 1LEIB 2FJFA 1BVZA 2BHZA 4U0QB 3QO1B 3VD4A 2BVQA 2V5MA 1MJUH 3WS6A 1XZ0A 3BP4B 1UQSA 3KDMB 2YPKA 3QDMB 3P9WB 3WFHB 2ZJSH 3VE0B 1CFQA 1M4KA 2XWBA 5C0FA 4CDHA 2XTJB 3SDYL 4XPBH 1G84A 4YGVB 2IPTL 1BEYL 3P3YA 1T7ZA 4P46B 3VCLB 5J7CC 4LLQA 1UB5A 3KDMA 3QWRD 4DUWA 1OGTB 4Q58C 3S34L 3QDMA 1F4YL 3HZYB 1GC1H 3VE0A 5BV7B 2LVCA 1U3YA 3RRQA 5C0AD 2P5WD 1D9KD 2B2XL 1MIML 5DZNA 1B0GB 2YMXL 4EN3D 2EDRA 3GSWB 4KK5C 4P46A 4PJHE 3ZLQC 1A7BA 4W4OA 5DJXB 3IFOB 2QQLL 2QKIA 4ISVA 5F6HI 5MEOB 5IW6A 4HMDA 4BFIB 2OJZH 5HHPA 1YN7B 4JFEB 1B0GA 3QCTH 4WI7A 1SY6H 3SE8L 2EDLA 3MUHL 4LHUB 3NCJL 4HX1A 1ACYL 5EFIB 1H5BB 2E6JA 3O6ML 3DOSA 4M1CC 3VXUB 3I50H 3JTSB 4BFIA 4PB9L 1KJVB 2DWEB 2XA8L 2DWDB 2P48B 5I30L 4GAJH 1PW3A 5C08B 1QFWM 2M8XA 5GGQH 3ULSB 3C2SA 5FK9B 3UBXI 1CVSC 1FVDB 5EFIA 5A2JH 4FFZH 1OM3H 3T65A 5C0GB 1MAJA 1KJVA 4XNMB 2DWDA 5T5NG 1UWEH 2BXYA 2JCCB 3RKDD 2V5YA 3B2UC 25C8H 4RX4A 1R3HB 4KXZI 1R3JB 2ZSVA 3BESR 4YXKL 1I1RA 3KPPA 2APVA 1IM9D 4NT6B 5FGRA 5MERB 4LSPL 4B53A 5C0GA 5FKAB 2APBA 3MODL 3BDYL 5C92A 1FFPB 3PNWB 1KCKA 3ZO0A 1AE6L 2HJLB 1W2KT 1R3JA 5DZLA 4LDEB 4ZAKB 2XN9D 4RISL 5MERA 2CQVA 4OLWH 1OD9A 1DANT 1S3KL 2I07A 4KROB 3OWEA 5GQBA 3T3ME 4E41E 5FKAA 4WENB 1ZSDA 1NJ9A 2X05A 3MLVL 4XZUA 1KN4H 5GISL 4Y4FB 4NKIH 1PLGL 4GS7C 5I8OH 1ONQA 5D7IB 1U41A 5I8EB 4FQPA 3VMOA 3UBXG 4ZAKA 2BVPA 4XXCC 3GBNL 32C2B 1SEBB 1Z6JT 4HDIA 2NY2C 3CU7A 4LLDA 3ILPB 5E70A 3GSUB 2NMSA 2EH7H 2X09A 3QEQB 3SKJH 1S7RA 3V95A 2CK2A 4AEFA 1IE5A 3SGKC 3DVGB 2D0GA 5EU7E 4PRIA 5DJZB 2FWOB 1MRFL 3CLFH 4OZGF 1JNNL 3OB0H 1JNJA 1YY8A 2YUVA 1QEWB 4MNGB 5F21B 4JY4B 1QRNE 5DVKA 4QTIL 4G9FD 4PJBF 2NY6D 1L7TL 3E3QE 3EDDA 1UWGH 4Q7DA 4I18B 5T3XE 3IAQA 3T0EB 4DN3H 2D9QB 2H26B 1I8MB 4D0DB 1T7XA 4P9MH 5I6XC 4XP6H 2BSED 1D5BB 4HKZA 4QNPE 1QEWA 3LB6D 3TIEB 1ZK9A 4CL7A 3GMPB 4JY4A 4NGHH 2WWMC 5DUPL 2HVJA 2UZIH 4JVUA 3BP5B 5ANME 3U0PB 3Q6FB 2H32H 2P8MB 4OGAC 4M6NL 5EB9A 4I18A 5F8RC 4ZMAT 3T0EA 5EN2A 3LPWA 3MUGB 5JQHC 4G7VL 2B8OT 1MRDL 4Q0XH 4P5TC 3KLHC 3K2MC 5DRZA 3EYUH 3NH7H 2A6KA 3QPQD 3S36X 2YR3A 4APQD 5D72L 3ULVE 4X0KB 5F6IC 4U0RB 3Q1SH 4KZDL 1PKQB 3IVKB 2I25N 2IEPA 2WP3O 3MV9B 4UQ3A 4Z5RB 5DJ0B 5IMMA 4X7EC 1BLNB 1AO7A 4G80A 4OFKA 3JTTA 3LQAH 5IIEA 4ZPVA 4N68A 5IHZB 2YPLE 4Y5VB 4JO3L 5J06A 2A9NL 3MGOB 4MQXC 3EKCA 2FD6H 4NWTL 4QHUB 4PRAB 4F7PB 5F7FA 4P2RD 3GJFK 5JLZB 3PWPE 4XGZA 5I17A 4Z5RA 4O02H 4YBLC 5FECA 4QXGH 1CS6A 3WNPA 5HYSB 4NM8H 3OKNB 2F8OA 5IHZA 4HKBB 5INCB 2CUMA 1NAMB 3EJZD 1A6ZB 1JN6A 2EDQA 5EU7C 1JF1A 1FRGL 2EIBA 3IS1X 4UMGA 5ESAA 3EYOA 1PQZA 2MJWA 5JLZA 5FYJD 3NBNA 1CD9B 5C0CE 3G5ZB 2AERT 1DQLH 5TQ2H 3OKNA 2R69H 4FQ2L 4J3OC 4CMHC 5JQ6H 3E3QC 1OGAE 2MPAH 1XAUA 5I16A 4WY7H 5EZJB 4DAGH 1KCRL 4LEOB 1XT5A 4JDVB 4DZBB 5C9JA 4NJAL 2WLZA 1E4KA 2VXSL 1A21A 4QHMB 2GSIB 4M7JH 4DN4L 1MY7A 2JJWA 1S7WA 3S3JA 3AMKA 2NTFB 4KK9C 5DEGB 4UQ2B 1T1ZB 5HHMB 4Q74A 4IDLA 1ZT4A 2GFBA 4NPYB 2P45B 2RCSL 1WZMA 2BMKA 4P2OB 4LEOA 1T0NB 4DZBA 5DGRA 3O8XB 3CIQA 1S7VA 1WITA 4NQVB 2A74B 2IFFH 3DETC 1H3TA 2PYEA 3O4LE 4FNLL 3WFEH 4K9EH 4G6AD 4TVPD 4RGOH 5I76A 3ULVC 5DMJB 1YA5A 4NNPH 5CBAB 1OF2A 2PO6D 1FPTL 3VXRE 3LN5A 2I26N 3MYJB 4O51B 2OTWB 4L4TE 3RVWC 4OCYL 1JNHB 4E42A 1ZEAH 4WU7B 1JHKL 4ZFGH 2VE6A 3KHOA 4JDTH 2HH0L 1L4IA 1I9RL 4XBGB 4Y19E 4I1NB 2ARJQ 5SV3A 5I73C 1GVIA 2R1WA 4LASH 1HH6B 3UTTD 2X41A 1XGTA 3ALWA 3NCFB 4WU7A 1HINH 1OTTD 1QSFB 3FKUS 1T5WB 4OI8A 2IJ0C 4CJ1A 3BJ91 2YEZB 2HVKA 1KUMA 1DN0A 5DUML 2UVFA 4XBGA 2OL3L 5DEZA 2VOTA 4XWGL 1NCTA 2EO1A 5EBWB 2HKHH 1KJ2A 3GUTB 4C83B 5GRWA 1GGCL 1LO2L 1BFOB 3CXDH 8CGTA 2VLJA 1NMAH 3MV7D 2R4RL 5CP3A 3H0TB 4H0IA 3L1OL 4KQ3H 1ND0B 1JVKA 4P48A 2WUCH 3HMXL 3MXVL 4PRHD 1S7XA 4WJ5B 5IB1A 4BM7A 3BEWA 3SGKA 3RI5K 2VDRL 5IV2B 1MJ8L 4NJ9H 4HIXH 4XHJD 1RIUL 1BFOA 4KDVA 2WQRA 4WCYL 1JV5B 2JELL 1WCQA 6FABL 5D7JD 3H0TA 5C0BD 1YN6A 4CNIB 3P4NA 2NNAB 5GIRB 1KBGL 1DBAH 3O6KL 3QUMB 4ONFH 5C0AE 2P5WE 1WJ3A 5TJWK 3UJTL 1ZHKA 5IV2A 5JW3L 5EOQL 4WFFE 5E4IA 5L9DH 3L3HB 3P0GB 5D6DC 3HAEA 4ZS6C 3V4VL 4WWKC 2X4TA 3RVXD 3WS3B 5IGXL 5C8JB 1ZHNA 5SWSA 3V8OA 1ORQB 3WSQL 4O00A 1FH5H 5E2UL 1QLEH 4L8SC 1HIMH 1R3KA 1INDH 4KRMB 3EDFA 5D9SB 4FQJL 2HKFL 4RGMB 5EO9B 4HGKC 2VKXA 3CFDB 3L3HA 1R3LA 5HXMA 4DKFL 4JFED 1KLFA 5F9JA 3WS3A 2NY1B 1UFUA 2ATKB 1M05A 1CFBA 5L88L 3IF1B 3HPJB 4FA8A 2RIKA 5LVEA 1JPTL 4LHJB 5D9SA 3VXUD 1NDGB 4X4ZA 1KB9J 2Z0BA 5E6ID 2F74B 4X5XA 4FQLL 2HLFD 2YSSA 3DYOA 2A77H 3HG1B 1TCRA 3HZVB 3UTOA 4JEGB 4CRPA 2NYYD 3IF1A 2AEPH 1GOGA 4WHTA 1E6OL 1OAUL 4KV5F 4NZJA 3V0AC 2X70B 3A6OA 1RK0A 5I1DA 2EYTA 4KHXL 3VFMB 3ZE0F 2BSTB 3TGXA 3HHRB 1FGNH 4EIGB 4P23B 3QFJA 4W6WB 2O61A 1IBGH 3LD8B 1CLZH 5IJKC 3VFNB 2IPUK 1NEZG 3PHOB 1Z3GL 5SWZB 2VLMD 4CVXB 4OKVA 1HHHA 2V7HA 5DHYB 5A3ID 5D1QB 4O2EA 2KQMA 2R2HB 1Q1JH 4HPOL 4P23A 5KVDL 5KSBB 5KSVB 4YUEL 3ZZ1A 2A6IB 4RSVA 1YQVL 3MRJB 3AFLA 3VFNA 1N5YH 3QWOA 4MXWH 5E4EC 3LKRA 5D1ZC 4DQOH 1QZ1A 1PBYA 4CVXA 3ZDYE 1U95A 3B9AA 5JTWA 1K5NA 5I0DA 1RSFA 5DHYA 5FKPA 3O3DB 4EN3C 4HS6A 3WNMA 3FT4A 5KSVA 2WIIB 1Y18A 3QDGE 1NCAL 4YK4B 3CVHH 1BBJA 1BZ7A 3PL6B 5DVOA 1T4KA 1BF8A 1MREH 2BX5A 3JV0A 3QH3B 5ANMA 2P8LA 3K7UA 3HI6L 4JZJB 4ZO9A 2NX5B 5IWLC 1JPFA 1MAKA 2KUTA 3O3DA 1UWXH 3U0TB 1MSPA 4NRZA 1PG7L 1RUPH 2DQTL 4M1GH 1TVDA 3RWJB 4J3UA 2J5LC 5ESQA 2YC1B 3MYZA 3KWWB 4JFPA 1J8HD 3UC0H 4OIAA 3ZT6A 2P1YA 3QT2A 4QRPE 4G9FE 3D9AL 3Q2CA 4JG0L 3UAJC 3U0TA 4FZ8L 3CFKB 1TETL 4AEIH 5I75C 2RAMA 3RWJA 1KELL 3VG9B 5HYIA 4OGYH 4PRDB 1JTPA 2YC1A 1V7ML 5E7FA 3ROOA 2YPLA 1GPOH 4B0MM 3RPIA 3OHXB 5ALBH 4HLJA 5J13B 2UYLA 3RKDC 4IS6B 4S1RH 4TNWF 5ACMA