2KZWA

Solution nmr structure of q8psa4 from methanosarcina mazei, northeast structural genomics consortium target mar143a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
145
structure length
145
Chain Sequence
MNARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVRFKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target MaR143A
rcsb
source organism Methanosarcina mazei
total genus 9
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kzwA01
1UVQB 2HMID 5J3HC 3DURB 4RNRA 2YOCA 1NKRA 1CICC 2G75A 5E2VL 2RJMA 1FGNH 2XTJE 3SDCC 3VD4A 4C4KO 1JFQH 1HI6A 5T1DL 4ZFFA 5DSCB 4WWKD 2HRPH 3O3AA 5TE7L 3D5OF 3MREB 7CGTA 5LAXB 2AKRB 3DRTA 3GMPA 4LCUA 2PXYD 4U7KA 3S5LA 3TYGL 3UROR 4ZAKC 4Z7NF 4YEEA 4JPVH 4QWWD 2RCSH 2GQHA 2XWTA 3ARVA 4X7TA 3GMRB 4HWBL 5IWLC 1MREL 4RWHA 1TZIB 3WUZA 1U8IA 2R2BB 5I30L 3VRIB 3EGSA 3Q5YA 3BZEA 3DUSB 3GSQA 2ARJA 3O6KL 1CDUA 1NDMB 1NGWA 5IB1B 4P5KA 1OTSD 2UZIL 3ARGA 4WUUA 5IB4B 1CLYL 3O4LE 4EN3C 4CJ1A 1CU4L 4YAQA 3UO1L 4UINH 1WZMA 5FO7B 5ICZB 1H15A 4F15C 4WFGE 5DHXB 2FR4A 5ISZA 2WWMD 3GSRB 1YEFH 3S96B 5CP7A 4NP4H 2Q6WB 3TBSB 3PWLA 1DBKH 2R69L 3LKOB 4GW4A 1E4XH 4YXKH 1PKQA 1NH6A 3FFCD 1TJIH 3ZHLA 1KFAH 2H41A 3HS0B 3DXAE 3JVGC 4N8CL 2X4TA 1HZHH 1T66C 5GRWA 4CU8A 3OAZH 3F7VA 1MFCL 3WFCL 5FM5O 3C08L 4NNPH 1CXIA 4MNQB 2AJUH 1HQRA 4X6CA 5F88B 4X6FA 5H2BB 3NIGE 4JDZB 4ODTH 1FC2D 4MWFA 5I1DA 3DX7A 1GL4B 3SCMA 1U8JB 3HRZB 3BUYB 1IL1B 4FZ8H 3L7EB 4YHPA 4C83A 5IBUG 4RMUA 4NN6C 4JRYD 4WWKC 5FB8A 5JIKA 4HJJH 4JHBA 1N59B 2D7TL 5F6HI 4YHIB 5I1HH 2BY0A 1MAJA 4MXQD 4UUJA 4P46A 4BSWA 4AQ1B 3TBWB 3LSOA 3TYFA 1HHHA 3VH8A 3IGAB 5SWQA 4BJLA 2PTVA 2V2XB 1WWWX 4JO3H 5JOFB 2CRIA 1UH4A 2E7HA 3CJJA 4PJIA 1RUPL 1OTSC 2FEEL 1FGVL 4XBPB 4YFLF 4OBSA 4R4BB 2XNAB 1EJOL 3RWFB 2X4QB 4JG0H 1GSMA 4TTGA 3E6HB 1I3RB 5JW5B 2VLME 4XT1C 1UWEH 3BPOB 5I1GH 2P5ED 3R1GL 1MI5D 2YD9A 5DQJB 4AEIH 5CIPB 1ZA3A 3UTTE 4RX4D 1F45A 4YGVB 1AFVL 3TO2A 4JO4H 2NQCA 5AG8A 2A73B 1FZJB 3N1QC 3PG2A 1KJ3H 1MLBB 4XX1G 3FO0L 1QBMH 5DGRA 5GGRB 4C56B 4Y19A 4LAQH 2LFGA 4XCCL 3ZE0F 4AEFA 1CDHA 1CF8H 4FQ1H 5B3JE 1CGYA 3QEQB 3BP4B 5MHSE 4TVPH 4PJEB 2NY5L 1BGXH 4K3JH 5K9OA 4QT5B 3QWRA 3EFFA 5CGYD 4PRPA 5M94B 3JV4B 4JVUA 4LCWB 1RZ7H 5JIIA 1TJGH 4EI6B 5IFAL 4PS4L 2AEWA 3BFOA 2IAMA 4XWGH 3DX6A 4JFYB 4R9HA 1IM9A 2DI7A 1F4HA 2F19L 4FHBD 4G9DA 5D2LA 5E70A 2WM0A 35C8H 1MWAB 4MA1B 1IAOA 2FLBT 3BH9A 5T3ZD 4J3OC 3B4NA 5DRNB 1GGCL 4Q0XH 1F6FB 4BZYA 1IGIH 3TWCH 5EH1A 3B3IB 5I8OL 5K9JH 5AWNL 5MENA 3QUXD 1RULH 3K1DA 4WI2A 3R06A 1T21B 1S9XB 4LU5L 4YDKL 4MNQE 2CLVA 3ARRA 5I0DA 3C2AH 1FV1A 3MV7D 3R8BB 4OM1L 1P4IL 2BOCB 1HHIB 1H0DA 2J7LA 4Y4KA 1MF2H 4WHTA 1XEDA 1GGTA 1UB6B 3KYMA 3MRQB 1HINH 1Z9MA 5IEKB 5GSRB 1D5IH 5F1IA 1KJMA 2IFGA 3N1MC 4JY5H 3QULA 3GMQA 3FQXB 3M07A 4ZTOH 1F6AB 2ICEA 2IH1A 2K7PA 3BN3B 5JDSA 1R24B 1U3HC 2HYMA 4LSQH 4CMMA 4OIIH 5D7LD 5GXBB 1JNHA 5C08B 5TE6L 3QHTC 5T3XL 1ETZA 1BOYA 3AREA 4FQQA 4OTXH 4AEEA 1BEYL 5GS0C 3NZHL 4Z5RA 4P9HC 1G9NH 4JLRA 5TPWL 2X44D 4G8FB 1I9JL 4MQ7B 5L88L 2X4UA 1TVDA 3HNSH 4IRSC 1YA5A 1F58L 3GSVA 1SY6H 4BFIB 1A1NA 5TDNA 4HULB 3KAAA 2IADA 3MV9B 4KDWA 3Q2CA 2QQLL 1G9MC 4AL8L 3LKRA 1HEZB 2R2EB 2R29H 4DZ8A 1MJ7L 1UFUA 4CMHC 5TDOB 4JANA 4JR9H 4UDTA 3WYRA 5INCB 4I0PD 4GRLD 5HHOD 4IHOB 2ADGA 3CXDH 3L5WB 5EC2A 2IALB 4EUPB 1CDIA 2B5IB 3RNQA 3EO1B 4BSJA 2OCFD 3GM0A 2IAND 5E2UL 1AKJA 1OAZH 2D03L 4S1DD 4HW6A 4C56E 5JNYB 2IPTH 3ARPA 4XP5L 3UYPA 3MLXH 3FRPA 3DSFL 4RA0C 5CSZB 4LF3B 1IQDA 4HC1A 1BBJA 1C8PA 2DRUA 3HE7A 3AXLB 3S7GA 1DBAH 4H25A 2Z8SA 4KI1A 2BNQE 4U49A 3PGCB 4NKMB 4U7SA 3ZKXC 5C0CB 1I1YB 4KKCC 5DK2A 4HS3B 5ANME 1PG7L 2D4FA 3FQWB 3AREB 3TH2T 4P57A 5IVXB 4KK6C 4U6YB 4ZD3H 2YKLL 4LNVA 3FAWA 3OKKA 4NQTA 4WFHE 5I1IL 1MRFL 1MAML 4NO0D 3MGAA 2ZCKL 4JN2A 4LHUG 3VGAB 5BVPH 4Q6YA 5KSUB 4GG6B 2APTA 2W9DL 3LKQA 1CIUA 3MOBH 1J18A 1XR8A 2BC4B 1BFVL 2WIMA 5GS0L 32C2B 4Z95L 2UY6A 1FSKB 1MHHB 4QRPB 5FYLD 3PP4H 1U6AH 5D7KD 3QUZD 1P9MC 3T0EB 2VDPL 1TJHL 1A6AA 2X4SA 2Q1EA 5FUCC 4JHAH 2RGSA 3WLWD 2BXZA 5MERA 4LKCB 1G9ML 3SDXE 1S78D 3PABB 1NC4D 2OR8A 1Q0XL 1J8KA 1O5DT 4MNGB 5ICYB 3D0LA 2XYCA 4KKNA 3ZDYE 3RL1B 3OTTA 5D6CA 5DJZB 2FEEI 3T0XA 3ARBC 5IVZA 4Y2DA 4X9FA 3QJHB 2G2RB 3QT2A 1U91B 2BVPB 3U0WL 4I77L 4NWUH 1P1ZB 3B2UD 5E8OB 1MPAL 2GJ6A 3MRJA 4C57C 4KDTA 4LPYA 1RZIA 1M7DA 1A1MA 5TFSH 4BH7A 1IILE 3P4NA 4NO5A 4Z77B 1P5VA 2EYTB 3PL6A 4RAVB 5HXMA 4AMKL 4KMLB 1WGOA 1RUQH 2OLDA 3D25B 3MBXH 4GAGH 1UADC 3ZE1F 4YHZH 2Z8WC 4DAGL 1X5ZA 5HTSA 3W39B 4LQFH 4XPFH 5GGTA 4UIMA 2Z4QA 5J11C 1UJ3C 5DURB 4DKAA 1PAMA 2B2XH 3FO9B 2VISB 3GZKA 3PJSA 1N0XH 4PRBB 5I6XC 4IDJH 1FDLL 5B39G 5C7XH 3FMGL 3KJ6H 3QUZC 4HHAA 5DJ2B 5ACZB 1VACA 4HAGA 5T1MB 3U6RA 3ULUD 4JY4B 5TQ2L 5KS9A 3QQ4B 1F5WA 1C1EL 3WLWC 2VN7A 1W72H 2EIZA 5I8EA 1NAMH 1ZGLP 3O2DL 3AU1B 1S78C 5LGKA 4K3EL 4HWNA 5EOCJ 5EN2A 3VXSE 4UV7H 5HHPA 3G5ZB 3PQYE 1JYVA 3VFWA 3DETD 5DUBA 4BQCA 4GRMB 1T1ZB 4Z7QF 4N9GB 4YK4C 1NEZA 2Q8BH 1OWRM 2JELH 3BHBA 5AZ2L 1FVEA 4FNLL 3I9GH 4S1RH 3VXMB 1YJDC 1U36A 5JO5B 1HN1A 3JXAA 4UTBH 1MCOL 4JGJA 3H9ZA 1OAUL 2DIBA 1LDPH 2DDQH 2JB6A 1MJJB 2YUWA 2GFBA 4U1JB 3PF2A 5C0ND 4XP6L 2LTQB 2C3HA 5HVHB 1DQJB 4YUEH 1AI1L 1UKSA 4O9HH 5JLZB 4YDLB 5KVFH 3OKOA 3RDTA 4KZEH 1IKFH 4WO4C 4N5UA 2XTJC 4L4VB 2A2QT 1YPZA 2D0HA 3E2HB 3T0EE 4TNVK 4HFWB 4ZS7L 5L7XL 5HDOA 3IKCA 3H3PH 3MLTA 2DBLL 2NY3D 5C0FB 3G5XA 1R3JB 2RIKA 4OKVA 5EWIH 1AQDB 4KTEH 1FL3A 1I8LA 4JKMA 4KRPB 4G80A 3S36L 3L3KA 3GSXA 1A3LL 2JJSC 2YK1H 3NZ8B 4GMSH 5HJ3B 4S1SH 4HCRL 2F54B 5K93A 1VGKA 5B38A 3DRQB 4KUCF 3ZTNL 4FQHA 4ZUVA 4XMPL 1Q8MA 4OLWH 4RRPG 4HUMB 1FNSH 3ARDA 2PYFB 2NXYD 3ZYIA 1UWGH 1KEML 5C3LD 1CZ8H 1NMAL 4WWID 3IDYC 4PRHD 5EORH 3D3VD 4NUJA 1P84K 4MAUL 3QPQC 1DZBA 4N0FB 4ZFGH 1ZHBB 3MJ7A 3MV01 4O5LH 1V7ML 4PJ9D 4PRAB 3V52L 4G8IB 3W2DH 1QLRA 2I9LA 1RD6A 5D1XC 4P2OD 1YJDL 4NCDA 4ONHA 4HKZB 1N64L 4QRTB 3O4OC 2EKSB 3WEXA 2X41A 1GPOH 4K7PH 4OLZH 5F9DC 4KVNH 5CJQL 1XGQB 2I24N 3D48R 1R3HB 5MEQB 1LK2A 3DVGB 3BW9B 1W0WB 4FABH 3GKWL 5C0EA 3RWDA 2I27N 3ZDZF 1TMCB 2H2PD 2VLKD 3TFKD 3KPQB 4J3TA 2NY3C 4LNRB 4CVZB 3GO1L 1D9KC 3RVUC 5ESQA 3MXVH 4MXVE 3D69B 2R39A 3ZYZA 5DK3A 4HUVB 5FKPA 4HLZG 1A0QL 1P7KA 4KKBD 3IDJB 3WBDA 1CLOH 3CX2A 1RIHH 3BWAB 4OIBA 2VLRA 2H32A 4LMQI 4F3FB 3TLRA 5I1AA 1DQMH 5CD5C 1IC5H 2NXYC 2EYSA 5I19H 1AO7E 3B9EA 3VFPB 2YA2A 4MMZC 2BVQA 3HNTH 1XH3A 5L8KB 5EBMA 2VZ1A 2OJZH 2NY2D 1IGML 3CLEL 2J88H 4D0DA 5HHVL 3SDYH 3W9DA 1U58A 1MY7A 2R23A 4HMDA 3PIQA 3H2WA 4WCYH 3IXAB 3RUGF 3HG1E 1K4CA 1XF4B 5F7MC 2DD8H 3FB7A 2Y06L 4PGBA 4JFEB 3PE9A 5EPMA 4LDOB 2VLLA 4I8DA 4YX2H 5HPMB 4X9HA 4M7JH 4AT6B 3WXVL 1YEGH 4DVBA 4OGAD 3MODL 4Y1AE 3VGDA 2F54E 2FGZA 1WIPA 3ARGD 3QFJA 3OX8B 3DOSA 3EYQD 3N50A 1FBIH 2GITA 4WUUD 3NH7L 1MJUH 1G6RL 3QWQB 4WIQA 4F8QA 3BN9C 3DUHA 5ESVA 3MCLH 5JHDA 5EO0A 5ISZD 3GHBH 4HIJB 3KR3H 5IMOA 1CN4A 4PYGA 5IJKA 1ZHNA 1MHPL 2F58L 1RURL 4PJDA 1YECH 2ZG2A 1RUAH 3RAJL 5FYKL 4LBEB 3GRWL 3MJ9L 3VRJA 5C6TL 1FNGB 4BSVA 2O5ZH 1MCWW 2R15A 1BQHG 3UPAA 4QYOA 5DEGA 3IFLL 5L2KA 2EYSB 4L8CB 3T2NL 2Y1VA 2XN9A 1XH3B 4NN7C 3MRFA 4WFEE 5EBMB 5BMFH 3MRHB 4YHML 1T5WB 3L7FA 4UDUA 2V7HB 3QRGL 4DZBB 3OKNB 4ZPVA 5LQBL 5ALBH 1T80A 1YNKL 3KLAA 3SCMD 1QQDA 3DIFB 3MOQA 2X4RA 1I7RA 4KK8C 4OCRL 5C07A 3WUWB 2VXSL 1NFKA 1LP9E 4G8GA 2KPNA 4YE4L 2Q86A 3O3UN 5HGHA 3UTSA 2ZUWA 1OAKL 1RZJH 4PBXA 1OAQL 4P46D 2X1OA 1FORH 3CVHB 4J3XA 4LCWD 5CEYB 5E99H 5C0GA 4LDEB 3WXWH 2HH0L 4Q2ZA 1XGYL 3TZVB 3OKDB 2DQUH 2R56L 1I9IL 4OGAC 1R0AH 2VABB 4I3RH 1J1XH 2FGWH 3TC9A 3WIFA 3A6BL 3AAZA 4IJ3B 4X4ZA 1OSZA 3HC3L 1XCQB 3EYQC 1MELA 2VERN 1K8DA 5ADOH 3QDAA 5D7SH 5DD5H 4R90H 4PJDB 2CIKB 4K23L 1M7IA 1QBLL 2JJVA 4MA8H 3JUZA 3GB7B 4XI5D 2AK1L 4KTYA 2ATKB 1TQCB 2XXMB 3HMXL 4WUKH 2PW1B 4O2FB 5HYSG 1I1FB 3RWJB 4Z18A 3MJGX 1JZ8A 3BPOC 4OZ4A 4EUPG 2DTML 4I0KA 3LQAC 1YEKL 4XVSL 1Q94B 3U4BL 3ARXA 1QFOA 2Y5TA 5INDA 1HYSD 1QSZA 3PHOB 4OCYH 4FFZL 4UQ2B 5HHME 2EDBA 5KAQG 4M1DH 1IC4L 5IV2B 3NCEB 2A6KA 1J9CT 4FQCH 1LWRA 4WJ5A 3LN4A 2E7MA 4U1SB 5KVDL 1CDCA 1L0YA 3NMEA 1NBQA 1KELL 1NANI 1EHNA 3QWRD 2D7PA 4L1DA 4IRJB 4PRPD 1U0QA 4FXKA 3KPRB 1CFVH 4TOYL 4NWTH 4QNPF 4AENA 1ZLSL 4P2RE 2OTPA 4J8RB 2IAMD 4FQJH 3D9AL 3G04A 3V5DA 4P46C 2DBJA 4NHCL 5JHLH 4ODHH 1IM9D 43CAB 1KCRL 4JFXA 8FABA 2QSCL 2J6EA 4ODSL 1NC2B 4L3EB 4NCC2 5EUKA 1IEAB 1EJ6A 2AV1A 1L7IL 3EFDH 2AXGA 1MLCB 3TPUA 3KS0J 4U1LB 3HUJE 4MA1C 2QLVB 5T5FH 4QHNA 1E4JA 3QJFA 1GHFL 4X9IA 1IC1A 3IF1B 4XAWH 5DVOA 4HGKC 3QUMH 4FQXA 3OHXA 4G3YL 3T4YA 1OPGH 3BVNB 4IRZL 4LFHG 3X13A 4D3CH 3FCTA 4E41B 1WBZB 2CLRA 1JZ5A 2XZQH 1A4KB 5KZCB 4ODWB 1QLEL 4WFFE 3T04D 2NW2B 4Y4KD 2A77H 2GT9B 1DVFB 2QQQA 5C6WH 3C6LB 3NCCB 3DV6A 3DROA 5E2VH 3MOAH 3BQUA 3EYVA 1T7WA 4Q74A 5T1DH 5LXGL 3QI9B 2NPLX 3LN4B 5CEZE 4JJHA 5E95B 5C0CD 4JG1L 1X4YA 1FPTL 4OZGF 1DLFH 3TYGH 2HT4C 1D3CA 4ONOA 1BBDL 3ARED 1YEHL 1IGYB 3QEGL 5ERWB 3VJ6A 3WHE1 1AP2B 2WWKO 1DQLL 4JRXA 1MREH 3KPPA 4P3DB 3UYRL 1PY4A 3O3DA 3O3BA 3MLWL 2Y72A 4XMLH 3U7AA 3QHZL 4JFHD 3O6KH 4JZJA 4EXKA 1A22B 3D18A 2UZIH 4HPOL 2VITA 3FJTA 2OZ4A 1C7SA 4MQXC 3UO1H 4GBXA 1JP5A 1XIWB 4Z7VF 2F74B 3BKCL 3P3YA 1UWXK 1VESA 2Z8VC 3W9EA 1U8NA 4F37F 1KT2B 1NLBL 4ELKB 4WW2A 2EDEA 3O4LA 3UTPE 3LVEA 2R69H 3O2VL 3SKMA 3D0VB 4QO1A 1MWAL 5EOQL 1NCWL 4YLQT 3TNNB 1VGEH 2B5IC 5AG9A 2ICWA 5JXEA 1KPVB 1QSFE 1MFCH 3NFNB 1LEKA 3WFCH 3C08H 3BP6B 2OBGA 1MIEL 1T6VN 4Y4KC 5T5NG 3GBLA 2DN7A 3KPRE 5J06A 5I1CL 5HI5D 2VAJA 1BHGA 4N0UB 4NQEA 3RTQB 3IS0X 1K2DA 3TO4A 1JPGB 3PWVA 2VQ1A 4OB5L 5IEHB 4POYA 4K8RC 5CHNB 1KXQE 4YR6A 4D9LL 3B9KB 4F7CA 5IB5B 4MDJB 3MGOA 4FMKA 3AREC 2J2ZA 5EO9A 3V7MA 2R1WB 5JR1L 3QO1B 2BVUA 3RVVD 2KUTA 5AYUH 1G7PB 4PRDA 1JGDB 4NNYB 2IGFL 4B53A 4GQ9L 2Q87A 4BUHA 3VD3A 2R9HD 3KYOA 2NY6B 4WHCA 1SMOA 2VITB 3V6ZB 5B39A 3VGAC 1T3FA 3SQBA 2ITDA 2OQJB 3NA9L 1OGTB 1HXYB 2XY1A 4LSSL 1RUPH 2LU7A 4RQQA 1FGVH 1ZT1B 1JV5A 1EJOH 1U3YA 3LEXA 4HIEA 2CIIB 5EA0L 2DLTA 2VL5A 2DKMA 1FSKC 2EH7L 1FZMA 1IAII 4PJ8A 1E28A 4AY0A 4IDLA 1IMHC 5DS8B 1G1CA 4PJAB 2DLGA 5CEXA 4KJWC 2VXVH 5IROC 3LIZL 1NFDF 1L9MA 3MLRL 4LSVL 1TETL 1QFWM 4X5WB 1A2YB 3FO0H 3V4VL 3UTTA 3VE0B 2OK0L 4Y2DD 3WNOA 4XCCH 3STZA 3VXMD 3ULVC 2QSTA 3JUYA 3FO1B 2GJ6D 2P5WA 2NY5H 1V5JA 2NXZB 3FHAA 1BVKB 1S7XA 4JFFB 1HQ4A 3AVEA 4Z7WB 3HPLA 3C9NA 2WZPD 4QOKB 5IQ9A 5IFAH 3PL6D 4PS4H 3TT1L 3VGEA 3AFLA 1U95B 1XGPA 2ADJB 4PJXF 4RAUB 3CFCL 5CP3A 2F19H 3QP3A 1B0WA 5FYJE 4Z6AT 3UAJC 4K3DL 3SDAB 4FQIL 4I9WD 4Y8AA 5JW4R 4NQXA 1L6ZA 1GGCH 3H9HA 3OG4B 4LL9A 3HFML 3NGBB 4P5MA 3DYOA 5E08L 2OXGA 1FNEB 4N90E 2YD6A 4ELME 5I15L 5I8OH 1JZ6A 3THML 1REIA 4RRPA 5FK9B 5AWNH 2HJLB 5C3TA 4XNMB 5DMKA 1CQYA 4LU5H 2OL3H 2SEBA 4YDKH 3DX9A 1QFPA 4UNTA 1BFTA 1U8QB 3VXNA 4D9QD 4OM1H 2FZ3A 1P4IH 3CSYB 1UXSA 3MRPA 1EFQA 2ESVB 3KPSB 2HKHL 2NNAA 4KXZI 1VFAA 1A6TA 1K4DB 5FYJU 4AYFA 4JZNB 5HGAA 2X10A 4PGZA 3U79A 4MD0A 4OF7A 3IVKA 1T6WA 2F53E 3LKNB 3T65B 1TCRB 5TE6H 4NQSB 4HC1L 4KDTC 3MNWA 4GAYB 1BEYH 4DWHA 2E7BA 1HE7A 2BNRB 3U36A 3VFNB 3NZHH 3FL7A 5TPWH 3ULVL 4URTB 1WAAE 2VMFA 3L3OB 2ZUYA 1I9JH 4KK9D 3RDTD 1JPFA 2LTQC 1F97A 3CFEA 3RVTD 4Y5XA 5HVHC 1F58H 1ZTXL 2EEDA 1DQDL 3X14A 4YDLC 2UVFA 1KIPA 1ZT4B 1T4KB 2CUIA 2QQLH 3E2HC 2Z91A 3HPJB 3SQOL 4MA3B 4PJAE 1MJ7H 3MRDA 2G60H 4Z7UB 5GSVB 3T4AA 2YEZA 5E4EB 1NGXA 2PCPA 3MUY1 2FL5A 1CWVA 1YC7A 4DKFL 4KRPC 4PG2A 4XP1L 4XWOD 1RZKH 5E2UH 3ULUF 2D03H 3U30B 1GVIA 3L3DB 4LGPB 3QIUB 4XP5H 3ARDD 4FQ2H 3RP1A 3DSFH 3WJLA 2GSGA 2AGJL 1IKNC 5E8DL 3MA7A 2Z31A 1WITA 4MJ2A 2Y5EA 5HI3D 3SDDA 5FFLA 3QB7C 2WIIB 4PP1D 3ZE2F 2DQIL 1PG7H 1GAFH 3RGVA 5GZND 5IT2L 2BNQA 4FOMA 1ZSDB 1S7WA 1VERA 5DQ9A 3EAKA 2R0LL 3FT4B 2YKLH 4HLJA 1FNHA 3RWIB 5F1OB 2APFA 5ANMA 1CGSL 1UZ6E 3IU4L 5I1IH 1Y6MR 3KJ4B 4YPGB 1MAMH 4EVNA 5A3ID 3WUWG 2L7JA 5ICXB 2W9DH 2OI9C 1BFVH 3T0BA 2X70B 3QCVL 1PLGL 5IFJA 2XIDA 1KPRB 2Y23A 4UU9B 4ORGB 3UTZA 4MZ3A 4Z95H 4EDXB 1RQ5A 1JF1B 1G7QB 1SYVA 2PR4H 2DMCA 4R3SA 1TJHH 2WBKA 3P9MB 3GMLA 2GY7B 4Y5YB 1JK8A 2DKSA 1G9MH 4L8BB 5GGTL 2EE6A 3CFDA 5TQ0L 3DHMA 1Q0XH 1DBBL 3WV0A 4X80L 5C09B 5JPNB 5H94B 2VLRD 4CBPA 3AMKA 5HHQB 1U8LB 1U2HA 3SDXA 1IM3B 5ABDE 2HJFB 3K4DA 3ARDC 2YN5A 5DJCA 4KHTL 1ZHKA 3D39A 3VXUB 1EVUA 3HHRB 3U0WH 2DQTL 3FOMA 1TVHB 4KC3B 3O6FB 4NZJA 3MO1B 5IESH 1MPAH 3VXPA 4K71B 2FX8L 2MCPL 4ZUTB 4KI5D 1XF5B 3S97C 3CMOL 2GK2A 2BFVL 1ZS8A 4AMKH 5BXFA 3MRNB 4LPVA 6FABL 1ND0B 4DAGH 1FH5L 2A1WL 4HXBH 4KK5C 5E94B 3P0VH 2A74B 4OZIB 3QDHA 3ZO0A 2DMBA 4R4NC 5IB2B 3OKMB 3E0GA 5EO1A 3WDHA 3QFJD 4HH9B 5FXCH 4HV8B 2MHAB 2HKFL 4XZUA 1FDLH 2IH3A 3G9VA 1R3KB 4MJ6B 5JHDD 5HYSA 2HN7B 4R7NB 1EAPA 4OZHE 3QUYB 2FNBA 1OQXA 1WFTA 5TQ2H 4OI9A 1HSBB 3UJIL 5T1LA 1UT9A 1U8MA 2Y7QA 1FAIH 1P4BL 1KXTB 3B2VL 2E7LC 3CUPA 5CZXC 4NN5B 4L4TE 2EDKA 3MSPA 2BOBB 2K9UA 4BQBA 3MCKB 1G7LB 4JHWL 4MJIA 5L2KD 4QY8B 1X7QB 3W11C 5DJCB 3QG6B 5E4IA 1RI8A 5E1AA 1JWMB 1JMZA 2I07A 3D39B 1CFQA 2XN9D 5AZ2H 3M1BA 4FNLH 2ERJB 1RUKL 1Z0NA 3FOMB 3IXTA 3VXSA 2ITCB 3PQYA 1BFOA 3GIVB 5K9KB 1KCUL 2VDQH 5AUMA 5SWSB 1MCOH 2WINA 1OAUH 4I1NB 2AJYL 4OUUB 1GOGA 5DD6B 4V2BA 5LGHH 4V1DB 2P8PA 4NIKB 1YNTA 2VAAA 3V8OA 4K7PX 5L9DH 4XP6H 4G8GD 3VWKA 1AI1H 3UTSD 5EC1A 1J0KA 5BZWA 1QRNB 2AJ3B 3PXHA 5E2WL 4YZFE 3W5MA 3NPZB 1P2CA 4YC2B 3SPVB 4RGOL 3B9AA 3VXRE 3UZQA 4ZS7H 2R2HA 1DN0A 4MNHB 4MHHG 2ZCHL 4RDQG 2XQYK 2DBLH 1A14L 3FRUB 1ZVHA 2Z35A 1QHPA 4I4WA 1NSNL 2DF3A 3V79C 3HAEH 4L3ED 3TZVC 4JY6A 4Q7DA 2IH3B 3SOBL 5IB3A 4LLVB 5C09E 4HCRH 1S7UA 2EYRB 4H88H 2P1YA 4HZLA 4IJ3C 1TDQA 3I6KB 3ZTNH 5I74B 3EJZD 3FTGB 2CLZA 1N3NB 3DBXB 4PUBL 1CGWA 1FP5A 4PJ7B 5DRWB 25C8L 4M9PA 5FYLH 4IIQA 4I48B 1WTGT 2FIRT 1TQCC 3QXTA 4X4XA 1CFQB 5EBLB 5KSAA 1NMAH 1MCHA 3LZFL 4RCAA 4LLDB 5J56B 1MVUA 4JVPA 4WY7L 4BYHA 4OLVL 3DV4A 4P4KB 1X5XA 3VFTA 1RIVL 1V7MH 1W0YT 4I3SL 1A4JA 3N9GL 3QI9D 3V52H 3WKNA 3PNWA 1ZANH 3ROOA 1YUHA 1LO3L 1DQQB 1YJDH 5CUSH 2VRAA 3IYLW 4D9RE 3AB0C 1JN6B 1QFWL 1LMKA 4WV1B 4PJEF 1MCNA 2JKXA 4KJPC 2KZWA 4IRJC 4X8JB 4AQOA 3Q6FA 2IBZY 1FNAA 5DVMA 3CDGA 1CE1L 2Z8RA 3LS5L 2YBRA 4P99A 3P0YL 5IB3B 1A9BB 2VZVA 3GO1H 2HP4A 4GMTL 4PGCB 3K2MC 3VD7A 1SJHA 4AEHL 4GUPA 3I75B 1BVLA 5BCAA 5ADPL 3WJJC 2F5AL 3CFJB 4MD5A 5IJVA 2G9HB 4FQXD 3BD3A 1KTRL 4I18B 1KJ2H 5FUOL 1ITBB 1D5MB 1BIIB 2M2DA 5FA3A 4PJHE 3GNML 1DTUA 2GI7A 1KENL 1FZOB 4A2LA 4NQDB 4HDIA 3KYKL 3ULUH 2D0FA 3GBNL 5CJXA 3G6DL 6CGTA 3REWA 2X4OA 2Y9RT 4J6RL 3REVA 4JFDB 4JEGB 3BQUD 3PWUB 1EX0A 4AM0A 3SJVB 1IGMH 3VG0L 3CLEH 1K85A 5HHVH 4O51A 1AO7A 3K2UL 3HZKA 5D6DC 1FYHB 4JFPB 3QI9C 5C0RL 2BRRL 1PY9A 2VZOA 3G6AB 3K46A 4N5ED 3VXOB 1PEWA 3MNZA 4JRXD 2Y06H 5HYQA 4M4PA 3V6BR 3VFUA 1E27A 3HB3C 4ZXBB 4HZAA 4LVOB 1IT9L 3U83A 2H6PB 4ZMAT 3WXVH 3SY0B 1S7VB 2A9NL 2FBJL 2HWZL 3HG1A 3MODH 4Y16B 4OLYH 3V5KA 3F58H 1B0GA 1J8HB 2UUDH 3NIFE 4X6BA 5D2LF 5DLML 5I16B 1NGZB 3RWEA 2MOVA 3SE4C 1G6RH 4GBXD 4LLMB 1BVLB 1FZKB 5IK3B 1KTDA 4Y1AA 1FLTX 1HNFA 5CILL 5JW4N 3O4LD 1MHPH 2F58H 1RURH 2I9TA 1N5AA 1XIWC 3MLSL 1UJTA 2W65B 4RWYL 1VKXB 3L9RA 3RAJH 2YPKA 3GRWH 3MJ9H 5BJTB 1KCSL 5C6TH 5J0BA 3TCXA 4QHKJ 1RJLA 5IGXL 4K9EC 4M1GL 5CJ8A 2FATL 4C4KT 5IHZB 1DBML 5JXED 2FYYA 4CADA 3MV8E 3UPRA 5BRZA 5L2JB 5EU3B 2AJVL 4JDTH 3TNMA 3TBVB 3OF6D 4M7KL 3QRGH 1QO3A 2OMNA 5GIRA 5LQBH 4HMEA 1YNKH 1PBYA 1EEZB 3MBEB 4NQED 4PR5A 1NBVL 3TO4D 1QNZL 5M7QA 4JFOB 1EVTC 3BIKA 3O0RL 2LABA 5AEAA 4OCRH 2VXSH 2VLJE 3RTQC 4YE4H 3OZ9L 2HFTA 4JFFD 4HF5L 1A7OH 3TA3A 4DVRL 1OAQH 2PYEB 2UWEE 3B9KC 2Q76B 4DCQA 3S34L 4GRWE 1BD2B 5HI4C 2ILLA 2HH0H 1LP9A 3ULSB 1J0HA 1XGYH 1PYWA 5B8CA 1I9IH 1GGIH 3KLSA 3MMEA 3MRMA 3J7HA 4NQUA 5DFVC 3STLA 1S8DB 5I1EL 4CUCA 1KTDB 3A6BH 4ODBD 1J86A 1NMBH 2NY6C 3HC3H 3GI9L 4NZTL 1R3LB 2HFGL 4PPTA 4PRIE 4CU6A 3F12A 3BDBA 5EBWA 5FO8A 1A6ZA 1HILA 4U05A 3HC0B 4YBLB 4QXTA 4APQB 3QDGB 1QBLH 2O5XL 3H0TA 4PJ8D 5JMRA 3H9SB 3WCYA 4HXAL 3F6IA 1W72B 5CKGA 4NZRL 2NTSP 4P2QE 4E0RA 3MRKA 3UTQB 4G9FB 4JFDE 4RBPK 4OD3L 3WNLA 2DTMH 2XPGB 4MXWL 5BRZB 1BZ7A 2VLMD 4CKVX 1V3KA 3CFBB 1YEKH 4XVSH 3OMZA 3CZFA 3ILPB 4OV5B 4Q58C 3U4BH 3UTTD 2ESVD 2NYYC 3KPSD 3WFHA 4MS8C 3BO8A 4HUNB 3RY6C 4RFEA 4FFZH 4KHXL 4PD4J 1IC4H 5JW4Q 3EYOB 1IAMA 5JQ6H 2P5WD 5KVDH 3MRLA 2BSSA 1AIFB 4RBPH 1JWSB 2V7NA 1ZHLB 5CSBA 4ZNEE 3C6SA 3CCHA 4ETQB 2VIRB 3PWPB 4TTDD 3CC5A 1AY1H 3O41A 4GKZA 1J8HE 1VHPA 2NXZC 4WTXA 5B4MD 1F4WL 1YEEL 4TOYH 5DR5L 5MHSD 1F8TH 3RZCA 3D9AH 4W6YB 1I8IA 4KROB 1HDMA 4NHCH 1ES0B 5DK0B 1KCRH 3V6FA 5BQ7A 5JPMA 2QSCH 1JTPA 2FX7L 4ODSH 1EERB 3STLB 3UBXA 4P2RA 3V6OE 3O6ML 2FIKA 2PKDA 5HYFA 2YZ8A 2HTKC 2BP3A 2FJGB 1TLKA 2R1XB 3BISA 4OCXL 5EU4A 3MGTB 3VGFA 3K1KC 2AJSH 4KXZH 3JWOH 2AXFA 3MFGB 3U48A 4NRXA 1GHFH 5D1QB 3EUUA 4YDVB 3NGBC 4FN0A 3FONA 2XWBA 1WZ1H 4C59B 2Y36L 3HUJA 3QDME 5C0JA 4WRLA 4IRZH 2OZ4L 1I8MA 3GSOA 2BHYA 1IGJA 4X7DC 1J05B 4Z0XA 4F2MA 4WNQB 1N0LA 1EO7A 4HGMA 3QIUD 3BGMA 2DM3A 5DJYB 4LCCA 1ORQB 3AY4A 4HUWB 4YHLL 1RJZB 1EGJA 3DGGB 5IIEB 1BLNA 1RJYB 5DRZB 1WCBA 2EE3A 5LXGH 4QTHB 3MRBA 4PY7A 43C9A 3VI4F 5EDXA 2GW5A 4JG1H 5CIPH 1FPTH 3HZYA 5J1AA 1RZGA 2JJWA 4OI7A 2Z92B 4DGIL 3HZVB 1BBDH 1MIML 1XFPA 3K4AA 1YEHH 4P4RA 2H3NA 3QEGH 1GC1C 5I18L 1XF2A 2ED8A 1M71A 1U8OB 4NRZA 4TTDC 1DQLH 4HUUB 1LK3L 1SVCP 4DUWA 1MHCA 1V3MA 2GAZA 5KSVA 4YNYA 4TULL 3UYRH 1EK3A 2P45B 1KLGA 5MI0B 3MLWH 3SKNB 1QZ1A 3C8KB 1X44A 3QHZH 3BYTA 3FB5B 3W82A 1JZ3A 3LB6D 1DEDA 4KRNA 1K8IB 4K2UL 2HG5A 1TZHA 4PJ5B 1OQOA 1P84J 3U82B 3ZTJH 3DGCR 5I2IA 5IM7B 4BFBD 5EU6B 2WANA 4PIRF 3BZFA 3KPTA 1FYTB 5TH2B 3QRFM 2VDNL 3BKCH 3CH1B 4XGZA 3MYJA 1AHWB 1N7ML 1NLBH 3F5WB 3PP3H 3K8KA 4OD2B 5E4EC 1VENA 2AEIT 3X12A 1NDGA 4KAQH 3J8F7 3O2VH 1CIDA 2YPLA 4QCIA 4YHNA 4ESKA 1P5UA 2DQGH 2QEJA 4MAYB 1MWAH 5EOQH 5DJ6B 1NCWH 5EFIA 1RSFA 4L8DA 3M8OH 5D1ZB 4LSTL 1ROWA 4PJBA 2EDQA 3U30C 3TIDB 1CR9L 1IEHA 2HT3D 2VNCA 4U2YA 1MIEH 1IAKB 4ALAH 3QIUC 1A3RL 3L6FA 3ZE0E 2Z31D 2NTFB 4N0RA 5IBTL 1JYNA 4POUB 3FQNA 5F7HA 1QSFA 3CMGA 3SDDD 5I1CH 4OSUL 2EZ0C 3RGVD 5KN5B 4R2GB 3W5NA 2ORBL 2WW8A 2X89A 4D9LH 3IDIA 3MC0A 5E7FA 2B39A 4NT6B 2XWJB 3L3JA 2CUHA 4JRWA 3OXRA 1WWBX 3LRSB 1BF2A 3ZKMC 5IVOA 3OGCB 4NDMA 2IGFH 4R26L 3JZ7A 4GQ9H 1KLUB 5KVMC 3KJ4C 4P2CG 2VQUA 2DB8A 1YPZF 2Q3ZA 3NA9H 2GUOA 4OFIA 4LSSH 2OTUB 1EFXB 5DXWA 5F3HA 2HFEB 3BP5B 4U4BA 1S7RB 2X09A 4GFTB 2EH7H 4X6DA 5E6IA 5EUOA 4HPYL 4IOIA 3TVMA 1T89A 4J12A 4Y5YC 2DWEB 1B6DA 5EU7E 1JWUB 5SV3A 5ID1A 4KJYB 4PJBB 3LIZH 4NRYB 4PREB 4M7ZC 2GCYB 3MLRH 3RBGA 4G6FD 4LSVH 2PW2A 1CK0H 1TETH 2APXA 3C5ZB 4OM0L 3SHSA 2VXTH 3V4VH 5SX5K 2BNUA 1OOAA 2OK0H 3WLBB 1HOCB 4PJGE 3D39D 4Y4HA 1D6EB 2JK5A 2EKJA 5DMIL 4R8WL 3EHBC 5F6HJ 3WHE0 5CS7A 5C2BL 4M61B 5E9DE 1FE8L 4OAWA 5IBLD 3O6FC 4HSQA 2QKIB 4V1DD 1XT5A 1DDHB 2DQJH 3TP4A 4K71C 1WUNT 3RHWK 4L8SA 2V5TA 4UB0H 3TT1H 3KPNA 4XH2A 1JGEA 4ZTPL 4N8VG 2MTPA 1QRND 3CFCH 5EU6E 5TDPB 4H20L 1FL5A 3D85B 3IETB 5HY9A 3F7YB 2X2YA 3D2UB 2IQAB 4U1NA 1MNUH 4KJQC 2YXMA 4YDJB 4FQIH 3B5GA 3HCVB 2OJEB 1HSAB 5FGRA 3C60A 3QIBA 3JTTA 2CKBA 3QXAB 3HFMH 3QA3A 1OAYL 1TIUA 5HGDA 3U0TA 1OF2B 2E8ZA 2DWDA 3VFVB 3THMH 5I76B 4MB3A 2CDFB 4X5XB 3ZT5A 5T1LD 4PGEB 1T1WB 4ELMA 4NPYA 3QUYC 5BS0B 1OP3H 3SBWC 2OMBA 1FVCA 4NJ9L 2PTTB 3MA9L 1HXMB 2GEEA 4MJID 1ZLWK 1PG7X 1AGFB 2X4PA 4NN5C 2HKHH 2VB5A 2NLJB 1YEFL 4J4PC 2EO9A 3VXSD 3IT8D 3MZGB 1GGBL 5D2NA 1HHKA 3RIFF 2ID5A 2BVEA 3UEZA 3L5XL 3ARYA 1FL6B 2GK0A 2ERJC 1KEGL 3K8MA 2BSRA 1VADA 5DT1L 4JB9L 3U0PB 4PV9B 2C1OB 4HC1H 1HZHL 2W0KA 1OGAB 3VWKD 2BY2A 4NM4L 5ITFB 3WO3B 1ZLUH 3ULVH 2YD7A 4KI5F 2BVTA 2F53A 3BSZL 4Y5VA 1JHTB 1QKZL 4ODTL 3EOBA 5IW6A 4BUGA 3P4LA 5CBAB 1T22B 1FCGA 3NVQA 2DTSA 4ZUSA 1ZTXH 1N2RB 1DQDH 4NO3B 2LQRA 4YWGL 4DOHE 1J1OL 3IFPB 4YC2C 1WAAA 3TBTA 3SQOH 2ICWI 2HJKA 2DWDB 1FO0A 2L0DA 2WBJA 3QUMB 2NY7L 4NC1E 5HYIA 4JJ5A 4XP1H 2R1YB 1ITCA 3QQ3B 4PBVC 1X5JA 3NPSB 4LIQE 4F57L 1UZ8A 2B7DT 4PJDF 1FIGH 5I74C 4NHUB 5D5ME 2AP2A 3GJEA 5HYJE 1UKQA 2HVJA 3BPCB 2C1PB 3V95A 5KSAD 3VGHA 1CE6B 1OT1A 1YYML 1DANT 3LKPB 3IFNH 1XR9A 4UQ3B 5E8DH 2P8LA 4M43L 2RFXB 5K9QI 3RVXD 1ULVA 4QRUB 2BSRB 4Q6IB 2DQIH 2IFFL 2FHFA 5CBEA 2CDEB 5CD3B 3SJVD 1PJ9A 1R5IA 5IT2H 1C5CH 1CD8A 1JI2A 2E7CA 4P4KC 5GRZA 1ZT7A 4JO4L 4DGYL 4TSCL 4PV8A 1CGSH 1OY3B 1MCJA 1JZ4A 5F3BB 2CXKA 4Y4FB 3O9WB 4J2XA 3T2OA 4WI5A 1OW0C 5C1MB 3WE6A 5FOBB 4LVHB 1JHLH 4MCYA 4WV1C 5H37G 1LE9B 2ICES 4YXLL 3FQTA 4TVPL 3GSUA 1NPUA 3QCVH 1PLGH 2MWCA 1QSEE 4M62H 5C0BB 2MQCA 4K3JL 4M8QA 5I66A 3U46B 4DKDC 1C7TA 3WDJA 5SWZB 3TN0B 4HK3N 1X5YA 3BEVA 5GGTH 3GSWB 3RL2A 1F13A 4HX1B 5JDJA 5TQ0H 1TVBA 4OJFL 1DBBH 4X80H 4G6JL 2GSIB 4LCYA 5A2FA 4M5YL 3WSQH 2VWEC 1INDL 4I18C 3TWCL 4M9OA 4ZFZA 3TCLA 1BECA 1C5DB 3L95B 5K9JL 2NX5E 2DM7A 4KHTH 3OAYK 2P43B 4OGYL 5IP4A 1OGAE 4QRRE 2W0FA 1CDJA 1VA9A 2A83A 4GQPH 3BMVA 2FX8H 1AO7D 3QNZB 2MCPH 4LSUL 3KLDA 5C0AB 3M17A 1UC6A 1LILA 3A67L 3F7RA 3CMOH 1Q9LB 1S3KL 4HGWB 1KYOJ 1NMCB 2BFVH 4QF1A 2ZG1A 5HDBF 1HINL 3H8NA 5DHYB 5F7EH 4ODXA 2PYED 2A1WH 5IG7A 5E24E 3RUGB 4ZNCD 3HG1D 4ZTOL 3IJHA 4M8VA 3IJSB 4ZXBC 4LVOC 3BGFB 4N0CD 3M45A 3QO0B 1OB1A 1UENA 3KXFB 5E8PB 5TE4L 5BVJB 1K5NA 2HKFH 3DUUA 4WU5A 2XFXB 4DQOL 2OYPA 1M05A 4Y1AD 2VYRE 4CVUA 4R96A 2BDNH 3ZYOA 4JFQB 1YDPB 2XKNA 3HNSL 3UJIH 1SY6L 3GGWB 4HQQH 4N0YL 1P4BH 2GTZA 5TJWK 4OI8A 1NLDL 1XGUB 3EKCA 4E42B 3B2VH 3U9UB 1A1OB 4OZHA 3LS4H 3E3QC 4HS6A 4GKNA 2HFFA 3SKOA 4JR9L 3IDMB 5BRZD 1F3JA 4GXUM 4G42B 1RUKH 4ODVL 4L4TA 3RVWD 3QWOB 1FFRA 3QPXL 4X83A 1KCUH 1MFAL 1S7SB 3VFMA 1ACYL 1BREA 1OAZL 2AJYH 1D5XB 3MJ8A 3EDKA 1UEYA 3S4SA 3DX8A 2R8SL 3MBEC 1Q9OA 1DP0A 3KPMA 4KPHL 4J3WA 5JXAL 1CDYA 1FNLA 4DK6A 3TA3D 3FFDA 4JE4B 2BMKB 5T33L 1KPUA 4ZQKB 1SEBB 5E2WH 3RKDD 3OJDB 4R7DA 4WWKB 4TUJB 1WSST 4RGOH 2APWA 1MUJB 2ZCHH 1EBAA 2PXYB 3EIFA 4PTTA 1A14H 3ZDZE 4H0IA 1NSNH 2Q3AA 3RIAF 1T04A 1T5XA 3CGTA 2OP4L 3VXRA 3SOBH 5C8JB 1ONQA 4HKXA 3KGRA 2I60H 2YN3A 5E03A 1DCLA 3VW3L 5J6GB 4XMKL 1EIBA 2AV7B 2Q7YA 2YD8A 5BVPL 1YN7B 2OL3B 4NOBA 2EDLA 4TPRL 2V9QA 1KIQA 1GZPA 1Y18B 5LGJA 4YBLC 3RZWA 4WW2F 4APQC 1LNUA 1T83A 5F9JA 1F11B 4L3CA 3U7YH 3TIEA 5IMKB 4HIIB 4R6UA 5DVLA 4MQSB 3PP4L 4POZC 3T0WA 5F44A 2JCCB 2O61B 5E8NB 2OR7A 4JHAL 1IGTA 4CNIB 4WY7H 5FGBA 4H26A 3O45B 3V8CA 4OLVH 3RVWC 2VR9A 1RIVH 2H32H 2Y07L 4UAOB 4RMQA 2C4FT 1AJ7L 2Y6SD 3B83A 3N9GH 1LO0L 4ZUWA 4FQPA 3D1MC 3W0WE 2Q20A 3BZ4A 4P5TA 4NGHH 2C3GA 3RUGE 1LO3H 2P42B 2V2TB 5HHMD 1HH6B 1UH3A 3GJFK 1QFWH 3NN8B 3Q5TA 5IR1A 3RZCD 3KXFE 1H8NA 1JPSL 2YMXL 2KQMA 2CSPA 3GUTA 3SGKC 2FD6L 4JRYB 1CE1H 1SYSA 2ZSWA 1T5XB 3LS5H 3CH8A 1S7TB 5DJDA 5KVGH 4KROC 1YMMB 4P2RD 3P0YH 5DMYA 5TF1L 1I4FB 1YNLH 3LV3B 3ALWA 3LH2L 3GHEL 3VCLA 4GMTH 1WV7T 1QP1A 3X3FL 2HLAA 4AEHH 4Z8FL 4LKXA 1B90A 2F5AH 5GJTL 1FYTD 3U2SB 4XPBL 4YHZL 2QR0A 3PV6B 1NCCL 1INEL 1LNUB 4L3CB 5J4MA 3G9AB 1ZK9A 2E6JA 4LQFL 5FUOH 3VMOA 1F4AA 2RR3A 3GNMH 4XNQB 1U3JA 4F9LA 3QDJA 1KENH 3T1FB 1DL7L 2R0KL 4N1CA 1RK1B 3OKLB 2DKUA 2XA3A 3TBYA 1IEBA 3KYKH 3ELAT 1G84A 3GBNH 3G6DH 4MX7A 4PJHA 2B1HL 1TITA 2A6DA 3QUKB 4GKOA 2P5EB 4J6RH 4WFFD 1MI5B 4QLRA 2X4NA 4K55A 1W72L 1JCKA 3QIWA 3MRRA 3VG0H 2BSTB 3BP7A 1UA6L 3P9LA 4YBHA 2JJUA 3K2UH 4GW1A 5GISH 1D5BB 2FO4A 4FFVD 4W81A 5C0RH 4GSDH 2VR4A 3RWGA 5C9JA 2FX9L 3MFFA 3P30L 1EH9A 1QPXA 4OZGB 4K3GA 4V2CB 1YEJL 1HCVA 4HKJA 1IT9H 5F1NA 2FBJH 2A9NH 3L3IB 5CLWA 2CXGA 3ECBB 3U4EB 1P4LA 2EDHA 3K74B 3I6LD 1GYAA 1PW3A 4B50A 3FOLB 2R4SH 1ZWIB 3U4AA 5K59E 5MI0C 5DLMH 3FQUA 2AS5M 4I0CC 1NBZA 3OPZL 4OCLC 5DHVA 1Y0LB 4KZEL 4ONGL 3DO7B 3FT3B 3UC0H 5I75C 2GJZA 1YN6A 5E7BA 3MLSH 4RWYH 1PQZB 1LO4L 4WI7A 4YIQA 3DMMA 2H8PA 2YPLD 3H3PL 1KCSH 1AHWC 2P7TA 4XRCB 4F9PA 2VSDA 5IGXH 2CD0A 4M1GH 5EWIL 4QRQA 3UTPD 2FATH 4W6WB 3FFCE 1CFSA 4MAYC 3QUXB 4D0BB 2A6DB 1XGRB 5D1ZC 1B0RA 4LEOB 2AJVH 2FEDC 4NC0B 1T2JA 4IMKA 1YY9C 5T3XE 1QR1B 4RISH 1S9WB 1XZ0A 4OGXL 3MV8A 4HK3J 4PB0L 4OLWL 1FNSL 4N8VA 2XI9A 2X89D 1HH9A 4MVBD 1ZEAL 1UM4H 3T77B 1T0MB 3OZ9H 3QZWA 5E8EB 1DSFL 4HF5H 4QNPE 1UQSB 3PUCA 4DVRH 4R2GC 5EORL 3HE6A 4XVUD 3S34H 2VLJA 5GS1A 4XVJL 1EO8L 3E6FB 5GRJL 5FO9A 5D7LB 4O5LL 3VXQB 3TEUA 2UWEA 3IDNB 3W2DL 4EKXA 2P49B 4U6VL 5I1EH 1DEEB 4JKKA 4GAJL 3OKEB 1JI1A 1FFNB 1AGEA 4GKSB 5DEFA 2HFGH 3PWNB 5KBNC 4Y2OA 1QLFA 4X6EA 4RSVA 2J6EH 4K7PL 5E6ID 3P11H 4OLZL 4U6HA 4KVNL 1S9VA 2H26A 4HXAH 4HMCA 4PRIA 1G7JA 4XHQA 3GFUA 4NZRH 4WW1A 3TV3L 1FG9C 3LRHA 4OD3H 4MXWH 4W4OC 5F97E 3PWJB 4UT6L 4I0PB 1B0RB 4GRLB 5DJ8A 3RWCB 3VWJA 5HHOB 4LP5A 3GEWB 2M26A 4P2QA 4H5SB 4LPTA 3QNXB 1UYWH 4Y4HD 2JTDA 1NFDB 3C5ZC 4XCYA 2IANB 4KKAD 4YBQD 3VFRB 2CO7B 4OZGE 3HN3A 5MEOB 1CDGA 4M3JA 1HH9B 5IKCB 4XPGL 1DQML 1IC5L 4JAMA 4LMQE 1F4WH 1YEEH 4KMTL 3FN0H 5DR5H 5GZOD 3H7BB 1EGJL 3I2CL 4QHKI 5GS1B 4MDIB 4ZNEA 3HNTL 1WC7A 2DL2A 4AH2B 3EJYC 4FTVE 1RZJC 5CINH 2FX7H 5DJ0A 4UT7L 4PLKC 1JBJA 1BX2B 2G5BB 4HS8L 1NGYB 1MCLA 1QVOB 3O6MH 3HAEB 1HHGA 3C60D 3QIBD 1T7YA 1ADQL 4OCXH 4Z7VE 4NO0B 4BK4A 5FYJD 1HHJA 3FQRA 4OZIF 3OR6A 3LQZB 2H2SC 3V6OA 1CYGA 5J8OA 5T1KA 2DAVA 1KC5H 4LLYA 2Y36H 1CI5A 4N90D 4DEPB 2OZ4H 3BDYL 1LEIA 2DQCL 2LVEA 3ARFA 1YEDA 1BOGB 3MV7E 3QDMA 3HI1B 4N9OB 1EV2E 2FWOA 3BXNA 3KR3L 5J7CC 4YHLH 1AGCB 2A9ML 4I2XB 3SO3C 3BD4A 3BH8A 1YECL 1O0VA 2ZOKB 1NC4B 3VD9A 2YUVA 1NJ9B 3WS6A 1TPXB 2C7UB 3TJHD 3JV6B 4OZFA 4YBQC 4U1IB 1MIMH 3H3KA 3PGDB 1NQBA 4O2EA 4UV4H 1CG9B 1W0VB 1T0NA 1UM6L 2FCBA 2O5YH 1LK3H 3FO2A 4RFOL 2F53D 2Z0BA 1ZA6A 2NW3B 3OR7B 4TULH 3OXSB 1DUYA 3DVNA 4YFLI 5GJSL 2BCKA 1RZFL 4PGDA 1KTLA 3HZMA 4JKPL 2A6IA 1F3RB 4HWUA 4K2UH 1XGTA 3IRZA 4XXCA 3LKSA 4ZDHB 1H5BB 1RZJL 2VDNH 1N8ZA 1KGCE 4RGMB 3GDBA 3SGJC 4I3GA 1N7MH 5FUCE 5DC4B 2WBJD 3WXWL 1U8KB 4TNWK 1V3JA 3KNBB 4PJFA 5EU5B 1NAMA 5I73B 5HSFA 1KJ2B 4IOFD 3ARFB 2PUQT 1RHHB 2ARJQ 1NFDE 1J1XL 1PKOA 2FGWL 2IANE 3AM8C 4LSTH 3QXUA 3TM6A 3NPSC 1JGUL 4ZODA 5ADOL 4BKLB 4ODUA 2I5YL 1A3RH 3UP1A 5FA4B 2A6JB 2CO6B 5KAQF 2ZOLA 4X99B 4OSUH 4OZFB 2CDGA 3VXTB 5D2NC 1C12B 1BZ9B 3DVFA 1NCNA 2ORBH 1KG0B 3FT2B 4OV6F 1MOEA 3G6JE 5TGBB 1TQBB 3QXVA 1B4RA 3FB6B 3QXDA 1QPPA 5DD1L 5EIVA 3CLFL 2VE6A 1T1XB 4PJXE 4R26H 3JSSA 1TZGL 4IBLT 4S11A 3RNKA 4Y4FC 1MEXL 3O9WC 1OSPH 4L9LA 4FQCL 2HRLA 1S5HA 2XA8H 3EO0A 4LVHC 1NCUA 3QAZB 4HUXA 4U6XA 3LKSB 1XCTB 2IBBA 1CGVA 1G6RB 2ENSA 1J0ZA 5E00A 2ADIB 3ET9F 3TT3L 4NWTL 5D7JA 2VDOL 5CP3H 1F6LL 3CPLA 3CSGA 5D7KE 1R5WB 1T20A 2IPKB 3P73A 4HPYH 1JRHL 4QKXB 1JPTL 3TN0C 3WHXA 4GH7B 2D31B 2GYSA 4J3VA 4ZYKB 1QA9A 1SMAA 5HDLA 1QSVA 4EBQL 3IDGB 4OM0H 4HK0B 4E5XA 1MRDL 4WGVB 3DTXB 3T2QA 4HEME 1NAKL 3L5JA 4HJGA 3QUML 5DMIH 4R8WH 3V0VA 3UBXI 1OPGL 5C2BH 5F7FA 1U8HA 1FE8H 4PJGA 4X4YA 4GG8B 3KG5A 5FAAA 3QXDB 4A6YA 5I8CB 3D3VB 1BJMA 1I3GH 3BE1H 1KB5A 2A77L 4I5BA 4U1MA 5ESAA 3WN5A 4PTUA 4ZTPH 1FFQA 3MOAL 2XQBL 4TYUA 1T7XA 1I7ZB 4H20H 4JREB 4NSKB 1NMCC 2YSSB 4PJ9B 3S9DB 5GGUB 4ZSOB 5FDWA 3Q1SL 4P2OB 4BZ2L 1DLFL 5JTWA 2RAMA 4F7EA 2KQNA 2JJTC 3KDMB 1H8SA 1OAYH 2FSEA 3CPLB 4HG4J 4AK1A 3RGHA 5KSBB 1FN4A 1ZKAA 3BGFC 4TUOA 1AD9B 4IS6B 4XMLL 2GY5A 4NQCE 2VLKB 4K7FA 3F6LA 4HLZH 5FDYA 4NNXB 4MJ5A 3ZKND 3VFSB 1L0QA 3KHQA 4NJ9H 1I85C 1MCRA 3MA9H 4P49A 2BVOB 3KWWB 3QEHA 4H1LA 3MNVA 4N1HB 3MPCA 5HGBB 5D7IE 1AXTL 4ZO8A 2KKQA 1EXUB 2IMNA 4E9LA 3KPLA 1GGBH 1UEMA 3L5XH 4CVXB 1MH5B 1KEGH 1U93A 2AEPL 1SJEA 4OLEA 2AABL 2XG5A 5DT1H 4JB9H 4NN7B 1VGEL 1UB5A 4RNRB 3IJYA 1NEUA 2QQKL 3PDOA 2DQDL 4NM4H 2NY5C 4S10A 2G75B 2HMIC 4PJCE 4RZCA 1OD7A 3CZJA 3V0WL 3BSZH 1QKZH 1HI6B 4ZFFB 2NY2B 2MQ0A 3EDJA 3O3AB 2HTLD 3PHQA 1G0YR 5J9PA 4QRSA 3DRTB 1AXSA 3GMPB 4LCUB 4YWGH 1J1OH 3S5LB 5BV7L 2YUZA 5IF0A 4X0KA 1YMMD 1HKFA 2XWTB 4L29A 2PXYC 3VXRD 4X7TB 5FYKE 1KIRA 4LPXA 2EEBA 4QWWC 1U8IB 1I1CA 5FHAL 4RMVA 3EGSB 3WD5L 3BZEB 3GSQB 1ZLVK 2ARJB 4NO2A 5AYUL 1I8KA 1FCCA 2NY7H 1NGWB 4P5KB 4KWUA 3ARGB 4WUUB 4XHJD 4DGVL 1BQSA 4F57H 5J1SC 4YAQB 4HFUL 1H15B 3ETBF 2HVKA 4HIHA 2FR4B 5ISZB 1NFIA 1YYMH 3NABH 3VDBA 1RAMA 5EIIA 5CP7B 5GRVK 3PWLB 4GW4B 1FG2A 5D5MA 4PRHE 2OXHA 3D3VE 2WWMC 4M43H 1PKQB 5HYJA 5EULV 4O2CA 1UXWA 2IFFH 3WL9A 3EW3B 3R0NA 5DDHA 5C9KA 5FYKU 2X4TB 2VXVL 5IMLA 3P4OA 3OBAA 3F7VB 4P5TD 1WQVT 1Z5LA 4DGYH 4TSCH 5EZLA 1HQRB 2X7LA 4UAOC 4X6CB 1T1YA 5DJXA 4X6FB 3SKUD 3NCJH 3CDYA 1G6VK 3CFKA 4MWFB 5I1DB 3DX7B 3SCMB 4YHPB 4C83B 4D9RD 4Y89A 4YXLH 2HTLC 1PZ5A 5FB8B 1A47A 3MRIA 4L29B 1G7IA 4ZPTA 1LP9F 4XC1L 3QR2A 4G7YL 5J6HA 4UUJB 4P46B 4BSWB 2CR6A 3O3EA 4NYLA 4F7TA 1QSEA 2W60A 3LSOB 1Z3GL 5DMGD 4MXQC 5EZIL 3TYFB 1HHHB 3SE3A 3VH8B 5IHBA 1SEQL 3HMWL 5SWQB 5BZDA 4YDIL 2CR3A 3WDIA 4Z9KB 3WNMA 4OJFH 4DFIA 4PJIB 4XPTL 4G6JH 3RBSA 3QDJD 2IPUG 4M5YH 4PLNC 1INDH 1RZKC 4TNVF 4MHHI 5EIIB 2NR6D 1GGUA 5D8JL 4WDIA 4O2CB 3TF7C 4OGYH 4D2NA 2VXQL 4NBYB 5BW7C 1OARL 2OL3L 1ZA3B 4KVCH 3QIWD 5MEPA 1JRHI 4EZMA 3TO2B 1WK0A 2NX5A 4LSUH 2DLIA 4ZFOA 4NJAL 1AE6L 4UBDD 4XNXL 4PFEA 4QRRA 3A67H 4QEGA 1IBGL 1S3KH 3ARUA 1L7TH 4Y19B 4MMXC 4PGJA 2A38A 4PRNA 1DJSA 4S2SA 1YYLH 2V5MA 4EI5A 3CXHK 1I9RL 1U9KA 1DUZA 1OTUD 1G7IB 3ESVF 5K9OB 3Q6GL 3EFFB 4JZOA 4PRPB 5TE4H 1HCFX 4C54A 3L3GA 2IAMB 4DQOH 3VFOA 3DX6B 5CGYC 3HAEG 1IM9B 1PEZA 3KHOA 4G9DB 5D2LB 3MUJA 1PD6A 1E4KC 2HAZA 5FHBL 2EDDA 1IAOB 3BH9B 3DMMD 4N0YH 4GW5A 5AAMA 1NLDH 1D6VL 2MKWA 5HHNA 2DQEL 1GIGL 3CFIC 3NCYP 4BQ6A 2G60L 5A2JH 4GS7B 5MENB 1LD9A 1SHMA 2MJWA 4ODVH 1FLRL 3R06B 3T8XA 2DIJA 2CLVB 2PO6A 1YMHA 3QPXH 1JZ7A 3P0GB 3QUXC 1MFAH 1FV1B 2OTWA 3MV8D 1ACYH 3B43A 1RZKL 1H0DB 1CXLA 4Y4KB 4DK3A 4FQ2L 2R8SH 4WHTB 3QEQE 1ZMYA 5CMAA 3KYMB 1X5GA 3O8XA 5C0DA 1AGBA 4KPHH 5JXAH 4HWBA 2FJFA 1IGFH 4PJEE 3HE6D 5F1IB 5T33H 1KJMB 3MUHL 1E6JL 3R4DA 3QULB 3GMQB 4RIRA 2ICEB 1JUFA 2VLJD 4LCWE 2IH1B 5JDSB 5C71A 4CMMB 1CL7L 1JNHB 1GAFL 1ETZB 2ZSVA 2AXHA 4FQQB 1CXFA 2OP4H 1MCWM 4Z5RB 1VFOA 1ZVSA 4JLRB 4F7PA 5FF6A 3DNKA 5KG9A 3VW3H 2X4UB 2BSED 1P7QA 4XMKH 3GSVB 1I7UA 3IFOA 2GTWA 1A1NB 4KGLA 5TDNB 4LLQA 1U92A 1J12A 4TPRH 2IADB 5GGVL 4R0LA 4PRID 2YD1A 3LKRB 2FJHA 4JPIA 4DZ8B 4LRIC 5CZKA 1FVDA 3Q3GA 4JANB 4UDTB 3I02A 3VWJD 2PR4L 5D4QA 2ADGB 5DYOA 5AD0A 5EC2B 1ORSA 2WUBH 4P2QD 4MSWA 4PJBF 3RNQB 1QBBA 1CD1A 4I0PC 4GRLC 1EHXA 5LVEA 1AKJB 4IMKC 5F9OL 5KOVC 4JVWA 5T3ZL 2Y07H 4F58H 4M1CD 1AJ7H 1WEJH 1LO0H 4AIZA 2VN4A 5KW9H 1IQDB 4S1DC 5I1JL 1BBJB 3SDCA 3HE7B 4X7EC 1NL0L 3GSNA 4H25B 1B4JL 1I75A 4K94L 2PN5A 4JM4L 2DQFA 5C08E 4PRPE 2X1XR 3W0WA 2YMXH 1JPSH 4KDVA 1NBYA 5DK2B 4ZAKA 1WT5C 1GZQA 2FD6H 3UDWC 3WS3A 5IESL 1G7MA 4P57B 5GS1C 4XNUL 5IWLA 2W07A 2H1PH 1M4KA 3OKKB 5TF1H 1M6OA 3LH2H 3GHEH 1MCEA 3RWHA 3X3FH 2NY1D 5DC0A 5DEZA 2UZXB 4JN2B 1GH7A 3MV9E 4Z8FH 3NA4A 3EOAA 4CAGA 1Q72L 5GJTH 3LKQB 2HT2D 4XPBH 5T1KD 1XR8B 1I7TA 5A2LH 4EN3A 4HXBL 1NCCH 1INEH 4NQVA 4XBGA 3P0VL 3T3PE 3V9FA 4X6DF 1KOAA 5EUOF 2E27H 3LMJL 5J1TC 1DL7H 2R0KH 3ARFD 4DEPC 5IW1A 1A6AB 3X3GH 2X4SB 3QDMD 5FCSH 5KJRH 2X9XA 5D9SA 3MROA 5MERB 1F2QA 1WBXA 2B1HH 4MA7H 3RPIA 3JVGA 3G08A 4NZUL 4R4FL 3SKJL 1FAIL 1UA6H 2ZUVA 3D0LB 1EBPA 5D6CB 1DLHA 5C0CE 4LARL 1DE4A 5IVZB 1TPXC 2FX9H 3P30H 4Y2DB 5FKAA 4X9BA 5IVXE 1GZQB 4PLOB 1YEJH 4U1HA 5I17A 4Q9RL 1MQ8A 2GJ6B 2VDQL 3MRJB 5CWSA 4M00A 4O02L 1RZIB 2UZYB 1M7DB 3O11A 1A1MB 5LGHL 3B2UC 2V6HA 4BH7B 2OSLA 4GG6E 5L9DL 3P4NB 4NO5B 3PL6B 1C16A 3OPZH 4XCFH 4S0SD 2C3VA 1HIML 4M7LH 3FZUD 4ONGH 4XP9L 4QRPE 5GGQL 1Q9KA 5GGSY 1H5BC 2KH2B 4UIMB 1LO4H 2EIDA 2Z4QB 3GI8H 3IB4A 3HTLX 3LHPL 4HWEH 4RGMC 1FFOA 4J1UA 1SVZA 5JW4M 3PJSB 5DTFA 1CFNA 4GOSA 1NCAH 4EOWL 4PY8I 1X5FA 3C2SA 1TTGA 4P3CL 4UT9L 5I73C 3ARFC 4HHAB 1CFTA 1VACB 5EZOL 3U6RB 1EEYA 3GMMA 2E9BA 3LN5A 4MNGE 4H88L 5KS9B 1RK0A 3B6SA 3QFDA 2EIZB 5I8EB 3S35L 3ZSTA 3ULUC 4OGXH 2P4AB 4CVWA 4P0DA 2X42A 2Q8AL 3ULVE 4PB0H 5EN2B 5HHPB 2X1WL 5F1SA 1A7RL 2EE9A 3N1FC 5FYLL 2AK4A 3VFWB 4OLUL 4NKDA 1OWWA 1IZJA 5DUBB 5ETUA 4FXGA 3F7QA 3LEVL 1ZEAH 1NEZB 3BHBB 1DSFH 1FVEB 3DETC 3AGVA 5I17B 3RI5K 1TQBC 2NCMA 1WZLA 5DA4A 1EUTA 4WEUD 4XVJH 1EO8H 2JB6B 1CT8A 5GRJH 2GFBB 3L3HA 1J87A 5JOPE 2B1AL 4LLUA 4U6VH 1ZANL 4GAJH 2ZKHL 3KVQA 5CUSL 5FIEA 2APVA 1X4ZA 5C0NC 3OKOB 1WAAF 4LDLB 3CU1A 3RDTB 4OCSL 4H8WC 3QAZC 5D7JD 2OI9B 4KRLB 3BIBX 1YPZB 1BJ8A 5JQHC 1IVLA 3IKCB 3MLTB 4QHMA 2GHWB 3G5XB 4QHLA 12E8L 4OKVB 2DJ4A 1FL3B 2PNDA 1CL7I 3GBML 3TV3H 3HLAA 4G80B 5GPRA 3L3KB 3GSXB 3QQ9D 3O2WL 4DUXA 4UT6H 1J88A 4ZUUA 4OF0A 5EZJA 3MTRA 1VGKB 2Z93A 5B38B 4FFWD 1EPFA 5IOPA 3DO3A 4W70A 1BMGA 5F89A 3S3JA 4G6AD 4QTIL 4XCNA 4FQHB 4ZUVB 4OFPA 3OKYA 1L6XA 5EOTA 4AIXA 1ZGLA 5HVWA 2AK4B 1KNOA 1KJ2L 1BVZA 3GMOA 1CTOA 5IHUL 2YR3A 3ARDB 3QG7L 3VXME 4HKBA 1VFBA 1D5ZA 4G43A 4XPGH 2ED9A 4WU7A 4NUJB 3I6GA 2V2WA 4KMTH 3ULUL 5FECA 1EGJH 3I2CH 4O58H 3X11A 1U3HA 3MJ7B 2YD5A 5C0IA 4UT7H 4TN9A 3UPCA 2VOTA 4HS8H 3GK8L 1QLRB 4RAHA 1S9YA 2I9LB 5KANI 4L4VE 2XY2A 5J89A 4W68A 1G7HA 2KDGA 4JREC 3D87B 4ONHB 1G0XA 4PJ9C 2J3SA 1ADQH 4FTVA 1MQKL 4IRSA 5F9WC 3WEXB 2PF6A 3KPOA 4MCZA 4P2OC 5CJOL 1ED3A 1I1AA 2P44B 1KBGH 3DI2B 3GJFA 3ROLA 1LK2B 3H9YA 4JDVA 1N6QL 2EDYA 5C0EB 3RWDB 4Z7VA 2YRPA 2V5SA 3JTSA 4OLYL 2J8UA 1EDQA 3F58L 1F4XL 3BDYH 2DQCH 4H8WL 5ESQB 4ETYA 2YUXA 3V5HA 2H2PC 4RFNB 3TFKC 3MUGA 3C5JA 5JA8B 5FKPB 1P7KB 5DJAA 3KYNA 3CIQA 1TCMA 1VCAA 2A9MH 4FFWC 3PGFL 3WMSA 2VXUL 3MV7A 1CDBA 1Q9WA 4KKBC 2VLRB 2H32B 5GGSA 4AZ8A 5BOZG 5A16A 5I1AB 4HWZA 3RY5A 1AGDA 4Y7MA 1Y6KR 3K8LA 1LO5A 4LSRL 4WHYG 5IBUB 3AROA 3CNKA 4YFDB 1V05A 2BVQB 1INQA 1UM6H 4D0CA 1UM5L 2RQ8A 4RFOH 2EDFA 4JDTL 2VR5A 4RGNB 1KTKE 3SE9L 4F7MA 4ZOAA 4D0DB 5ID0A 3CSPA 1QBAA 3W9DB 1U58B 5GJSH 2R23B 1RZFH 1WTLA 4JKPH 2VDML 2NY2C 3PIQB 2FB4L 3VDCA 2LVCA 1K4CB 1MCFA 3FB7B 1A7OL 4PGBB 4FXLA 5EPMB 3B9DA 2VLLB 5JORA 2NY4D 2YXFA 3SN6N 4DVBB 3K4ZA 5DGQA 2J8UB 2QBWA 4MGXA 3JWOC 5C70A 2MPAL 2P8MA 1D7FA 3CDCA 3O2DA 1CLZL 5DD0L 1P9MA 1RPQA 3QFJB 1GGIL 2GITB 3BEWA 4U31A 1XF3A 4HJ0D 5GS2D 1V7NL 4ZG1A 1QFUL 1NMBL 5ESVB 3ARGC 5FM5M 5FM4A 1KLFA 5I1LA 1JGUH 1MHEA 4WI4A 5EO0B 5JHDB 4OZHF 5IMOB 1S7QA 1ZHNB 2I5YH 4OF8A 4MQTB 3RX8A 3S3SA 3FKUS 5HYJD 3VRJB 1YQ2A 5DA0B 3HKFA 4BSVB 4FG6D 3ES6A 2JCCF 4WGWB 5EIQA 3ARBA 4QYOB 4U1KA 5DEGB 5L2KB 3A6CH 4LHQB 5ENWA 3X17A 2XZAL 5E5MA 2XN9B 2X1PA 3MRFB 3P40A 5DUML 5DD1H 3CLFH 3L7FB 4UDUB 1F4YH 5IUSA 2DYPA 3VRLE 2LAGB 4ZPVB 3G6JA 4Y19D 3L1OL 3KLAB 1QQDB 2WP3O 1TZGH 1QEWA 2GIYA 2X4RB 4Z78A 3GMNA 1MEXH 1I7RB 5C07B 5JQ6L 4A6YL 3AB0B 4JFEE 4PJXA 4G8GB 3SCMC 3MRCA 4W4NA 1DBJL 2Q86B 1KB5L 2YWYA 5HGHB 3UTSB 1TNNA 1AY1L 5DI8A 2NZ9D 5E56A 4X98A 3TT3H 2VDOH 5C0GB 1F8TL 1QSED 4M03A 1UJ3A 4WEMB 4Q2ZB 3QNYA 2ARWA 1A7PL 1JRHH 2YC1A 1JPTH 4PP2A 3WIFB 1RZ8A 3AAZB 2CKBH 1OSZB 3QUZA 5FYJH 4JPWL 1K8DB 4EBQH 1YEIL 2CK2A 4HJ0C 1R5VA 4JFZL 2AJSL 3JWOL 3MLUL 1WBYA 2ATPA 1KV3A 1MRDH 2AJZA 1M7IB 1ZXQA 3N1GC 1C08A 3V4PH 5MEND 4R97B 1NAKH 3C5SA 3MQIA 1WZ1L 4LLWA 3FN3A 3DARA 4XI5C 1FJ1A 3LD8C 4OZ4B 2NX5D 3VGGA 4YQXL 2EDXA 2H9GA 4J23A 5F7DA 2ZWLT 2A0LD 4QRRD 3QHFL 3IU3A 2Y5TB 5INDB 3HR5A 4G5ZL 2EECA 2XQBH 3GMNB 1FC1A 4OLXL 3FB8A 4ZS6D 4EI5D 2YD2A 2A6KB 5J12B 4WJ5B 4HBCL 3AS3A 1HYSC 4QHUA 3NAAL 4Z76A 3Q1SH 4BZ2H 1FAKT 4LHUA 1BZQK 4WO4A 5F96L 1CVSC 3JWNC 4FXKB 3MRGA 4YHYB 4AENB 4NKOA 4S1QL 1H3GA 3V5DB 3G04B 4JFXB 8FABB 1GRWA 4CW1A 4EQ3A 2IAMC 4MLIA 5EUKB 5DF0A 2AV1B 4HAFA 4ISVA 4PJDE 2AXGB 1EZVY 2DJUA 4CGTA 4N1EA 3TPUB 4M02A 4GAFB 4CU7A 2B0SL 3LN9A 4QHNB 3QJFB 2VZTA 4NQCA 2P48B 4JQVA 1A3QA 4X4ME 3WNPA 1AXTH 4HT1L 1SBBA 3U1SL 4DW2L 4FQXB 3P2TA 4Q9QL 3OHXB 4KMQA 1BWWA 3T4YB 4G8EA 2PO6D 4GS7C 5DFWH 3X13B 4KAQL 3FCTB 2ADFL 2CLRB 5D7IA 1GOHA 2DQGL 3CVIL 2AEPH 3SO5A 1AKJD 2AABH 5F7DB 5IMMA 2D9QB 1LE5A 3M8OL 5F7LB 2QQKH 3G5YA 2O26U 2VJXA 2DQDH 3O8XD 1JL8A 5CGTA 1SBSL 3DV6B 4DKEH 3DROB 1UWXH 3WFDL 2W59A 3EJJX 3BQUB 3HE7D 1YY8A 1H8OA 4ALAL 3EYVB 3V0WH 3DXAA 3EYFA 1A9EA 5D1XA 2DL9A 3TESA 3NFPA 4PJCA 4M6AA 5BV7H 1JNLL 2W91A 3VJ6B 4Y8DC 2VC2L 3FHQA 1E4WL 4JRXB 4L3EE 2QADD 5FHAH 4IMLA 3KPPB 3OJVC 1P7HL 3WD5H 4RMRA 1P7QD 3O3DB 4D8PA 3O3BB 3Q5OA 4XPHL 4JZJB 1D9KA 3NIFF 3D18B 3P4MA 4DGVH 3VD5A 3IKKA 1J0IA 1AD0A 1KJVA 5AYQA 4GBXB 3IAQA 5A43C 4HFUH 1S5IL 1U8PA 1LEGA 2R2CA 3VI3F 2VDRL 2IEPA 4BFGA 5GGRY 1WF5A 2P24A 4YO0A 3W9EB 5HD8D 1U8NB 4E41E 3QH3A 5JIPA 4WW2B 3O4LB 1ZGLM 4F33A 2CGRL 4PG9A 1WICA 3SKMB 4AIOA 4XCEA 2ZZUT 5H35A 5J3HD 1IZKA 5L0QB 3VG9B 2ICWB 1OCWL 1SJXA 2AXJA 4PRHA 1LEKB 1CD0A 1UVQA 4BH8A 3DURA 3SDCD 1CK0L 5HDBE 3EO9L 2VXTL 3Q0HA 2W92A 3O8XC 1KF9B 3RX5A 3JWDC 5ECJE 3W0WD 3HE7C 2ICWJ 4ZAKD 4NQEB 1K2DB 3TO4B 3PWVB 5DSCA 2VQ1B 3MREA 2C26A 4ZFOL 5LAXA 2AKRA 3LAFA 1NGPH 2N56A 3IRPX 4OQTA 5HI5C 4YR6B 4F7CB 4XC1H 4G7YH 3MGOB 2EE2A 5EO9B 1OVZA 2DQJL 1A6WL 3GMRA 4X7FC 2UWEF 2MMXA 1MCQA 4NBXB 1TZIA 4PRDB 2R2BA 4GRWF 4UB0L 3VRIA 1Z3GH 5EZIH 3DUSA 1SEQH 3HMWH 3KYOB 1WZKA 3RVVC 5B39B 4EN3D 1T3FB 3HMXA 1PDKA 4YDIH 2ITDB 1NDMA 5IB1A 1MNUL 5IB4A 1KN2L 4JO2L 4LOUD 5I71B 2R9HC 4XPTH 4RQQB 1JV5B 2P24B 4Q97A 3LEXB 4UTAL 5ICZA 5FO7A 4HIEB 4AG4L 2VL5B 1MFBL 3GSRA 5D8JH 1FZMB 3S96A 2FHCA 4PJ8B 1E28B 4UOW1 2Q6WA 3TBSA 2VXQH 3LKOA 4M4RA 1JPST 3N85H 5CEXB 1T66D 1OARH 2VL4A 3HS0A 4YPJA 4BH8B 4NJAH 5CSGA 2E3VA 1AE6H 4XNXH 5F7YC 3F62A 4N0UE 4MNQA 1IBGH 3UTTB 5F88A 4M48L 5H2BA 3STZB 4U2ZA 4JDZA 5L8LB 4K07A 4B41A 1RU9H 4NOFA 1I9RH 4JRXE 4Y2DC 1U8JA 2P5WB 3HRZA 3BUYA 1IL1A 1CFBA 3L7EA 3QXWA 2XZCL 1S7XB 3Q6GH 1HQ4B 3MYZA 5JOEA 2XT1B 3HPLB 3C9NB 3HC4H 1N59A 5GRUL 5IQ9B 3JWDL 4YHIA 5E6YA 4EQ2A 2RBLA 1XGPB 3TBWA 4LCIL 5D93B 3PL6C 1LO2L 3RRQA 3IGAA 5FHBH 3RFZC 2V2XA 5A2IH 4NQXB 5JOFA 1D6VH 3H9HB 3OAZK 2IQ9H 2DQEH 4P5MB 2WBWB 1GIGH 2YRLA 4LOUC 4XBPA 1QYGL 4R4BA 2XNAA 2YA0A 2K7QA 4KUZH 3RWFA 1WFOA 4LASL 4MD4A 2X4QA 4M6NH 2J12B 5DMKB 3E6HA 3BRFA 1I3RA 5JW5A 1FLRH 2SEBB 1UACL 3DX9B 3VXNB 5DQJA 5CIPA 1JYXA 2IG2H 2FZ3B 2K3TA 3CK0L 1FIGL 4YGVA 2AK4D 1UXSB 3U9PL 3MRPB 4NQEE 5T3XD 2WAHA 2A73A 1FZJA 4OF6A 1MLBA 2NNAB 4DN3H 4LPUA 1VFAB 3OL2A 1A6TB 3IFNL 5GGRA 4C56A 5HGAB 4M7LT 4JFFE 1E6JH 3OB8A 4LGRB 4MD0B 4Z7WE 4ENED 3IVKB 3QEQA 4QOKE 3BP4A 1A5FL 4PJEA 1CL7H 2WQ8A 5D70L 3BYYA 1C5CL 3MNWB 4QT5A 3GSNL 3U36B 3LPGA 2N7AA 1IQWH 3JV4A 4LCWA 2BRQA 2FECL 1Z6JT 4EI6A 1ZVYA 1JPFB 3CFEB 4Y5XB 4JFYA 1MRCL 4XC3H 3X14B 1KIPB 4KK9C 3RDTC 4F80A 1JHLL 4UMGA 2XKUA 5GGVH 3RVTC 1JGVL 1MWAA 2Z91B 4M62L 4ZOBA 3MRDB 5DRNA 4PJFF 3T4AB 1L4IA 4MD4B 2YEZB 1NGXB 2PCPB 2FL5B 3B3IA 1I8LC 2XXCB 1AR2A 5KTEH 2W9EL 1BQHA 3JBG7 1T21A 1S9XA 3IAGC 2ESVE 5F9OH 3KPSE 2NY0D 4M7ZB 5T3ZH 1H3XA 4Q9CA 1OL0A 4CN4A 3K80A 4XWOC 2BOCA 1HHIA 2GSGB 5I1JH 1EEQA 3WSQL 1JNNL 2P5WE 1NL0H 1B4JH 1UB6A 3MRQA 3MA7B 1ZE3C 4K94H 5F9AC 2Z31B 2HLFD 4JM4H 5IEKA 2XZZA 4NBZB 5GSRA 4DTGH 3RKPA 1U3HD 3SEPA 3SDDB 3T0DA 4HH8A 2BNRE 1RHFA 3FQXA 3RGVB 1F6AA 4RGND 4ENEC 1JNJA 2BNQB 1S7WB 5GS0D 1R24A 5DQ9B 5HI3C 4XNUH 4PP1C 5C08A 1KCVL 4KV5E 5GZNC 5ANMB 1YQVL 4G6ML 4FTVD 4IRSD 2BJML 4EVNB 1W8OA 4YHOL 4G8FA 4MQ7A 1I1AD 1Q72H 5F7EL 1R3IL 4Z7UE 5A3IC 3BJ91 4BFIA 3C8HA 4J3UA 2IJ0C 5IFJB 3MV9A 2D4DA 2DQHL 5KSBF 2X40A 4WENB 3UTZB 3LMJH 1HEZA 2R2EA 1CGUA 1SYVB 5DHVH 1K6QL 4R3SB 5TDOA 3GMLB 2IBZX 1E6OH 5FUZL 5INCA 1BQHB 3V0AC 1JK8B 4IHOA 4EXPX 2BDNL 3L5WA 4RFNC 2IALA 4EUPA 4U1GB 3EO1A 3CFDB 1H3PH 1RV6X 2YD3A 4MB5A 4NZUH 4R4FH 3SKJH 4HQQL 5C2UB 2NY0C 5JNYA 5I9QB 4G6FB 1F02I 3SDXB 4LARH 4XBEL 3LS4L 5CSZA 4LF3A 4KKCD 3AC0A 3AXLA 4PJGF 1ZHKB 3PGCA 4NKMA 1TTFA 2HLFC 5C0CA 1I1YA 4QXGL 4Q9RH 4HS3A 4KK6D 3VXPB 4O02H 5FCUL 3F7PC 3FQWA 1NUGA 4RGNC 5IVXA 4JM2A 4U6YA 5J13B 5C07D 2C4XA 1ZS8B 4KI5C 3ZDXE 5BXFB 2R0ZL 3P9WB 1HIMH 1PG7W 1VEPA 4X7SL 1VSCA 2BY1A 2V5RA 4XP9H 5KSUA 4GG6A 3UTOA 1I1AC 5GGQH 3B9VA 2BC4A 2XRAH 3LHPH 5EO1B 32C2A 4GRWH 1KGCD 2WQRA 4EOWH 1KN4L 1MHHA 4XZUB 4QRPA 3ZL4L 4P3CH 4UT9H 4F8TA 1AQKL 3T0EA 5HYSB 2I60L 1EAPB 5EZOH 2LE9A 5T1LB 1IJ9A 4LKCA 5IROA 4BQ9A 1MY5A 3PXJA 1U8MB 2Y7QB 3S35H 3CUPB 3PABA 5IJKC 2ZUQC 2Q8AH 3N1PC 3ARWA 5DVKA 5CGMA 3ARBD 1A7RH 4MNGA 2CJUL 3U7YL 1ZV5A 4OLUH 5ICYA 4MJIB 3VXUE 1EUUA 1IAIM 3RL1A 3LEVH 5E1AB 5DJZA 2I07B 3M1BB 2APBA 5ITBH 3IXTB 3VXSB 3PQYB 1BFOB 3QJHA 3DVIA 1XAUA 2DYPD 2J8OA 2G2RA 1U91A 2BVPA 3DWTA 5AUMB 2WINB 1P1ZA 4X6CF 3BT2L 5E8OA 5ACMA 4JM2B 2P8PB 1YNTB 2VAAB 3OGOE 2B1AH 5A2KH 3VWKB 4NGHL 2ZKHH 1X3DA 5EC1B 5BZWB 1NCTA 4KY1L 2MCG1 3TGXA 4Z77A 2EYTA 4OCSH 4RAVA 4OZIE 3EDFA 4P9ML 1P2CB 3D25A 3MACL 2R2HB 1DN0B 1KACB 3L5IA 4P9HL 2Z35B 4I4WB 3W39A 4ZOEA 12E8H 3ZT7A 1TTUA 5KVGL 4JY6B 3FO9A 1M7XA 3Q48A 2VISA 3GBMH 4IM8A 4PRBA 1YNLL 2QQNL 2Y4SA 1NGQL 3O2WH 3N0PB 4QXWA 1S7UB 3CXHJ 4HZLB 1SJVA 2FECI 5DJ2A 5ACZA 1P6FA 5T1MA 4PJIF 3LQMA 4QTIH 4JY4A 3QQ4A 2CLZB 4C58B 4KRMB 3AU1A 3D39E 3EJZC 5D5MF 5IHUH 4R97C 1T2QL 4IIQB 3SGDI 1OP9A 3QG7H 2D7MA 1JHKL 3DJ9A 3G5ZA 4X4XB 5KSAB 4GRMA 1T1ZA 3I50L 5SWSE 4N9GA 4TVPE 1MVUB 4OF3A 4V1DE 3VXMA 3DV4B 1J7VR 5JO5A 2AI0L 2EC8A 1UKTA 2PETA 2XICA 3VFTB 4Q9BA 1A4JB 3EZ8A 4OZFH 1QRNE 1MJJA 3GK8H 3PNWB 4U1JA 3ROOB 4Z7OE 1YUHB 4WTZG 1Z0MA 1JTOA 4LHUD 5GISL 4WO4D 5J12C 5H37H 2XTJD 1DQJA 1MQKH 5HHXL 5JLZA 4GSDL 5CJOH 1WJ3A 4L4VA 3ZMRA 1CS6A 3Q6FB 5JZ7D 2D2OA 4YHYC 1N6QH 3CDGB 1BQUA 4HFWA 2YBRB 4DJMA 5C0FA 1H3TA 1F4XH 5K9QG 4PD4K 1R3JA 1CXKA 2R4SL 3UYOD