2KZWA

Solution nmr structure of q8psa4 from methanosarcina mazei, northeast structural genomics consortium target mar143a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
145
structure length
145
Chain Sequence
MNARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVRFKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Northeast Structural Genomics Consortium Target MaR143A
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein
total genus 9
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kzwA01
1NJ9B 3FB5A 3REWB 4KTDH 3U6RB 2YUWA 3BT2H 1FVEA 3VFMB 2YN5A 1N3NB 4OCWL 2YWYA 1WBZA 1F6AA 3PWJB 4NRYB 3UP1A 1TQBB 3SKOA 1Y18A 4OZIA 1U3JA 4XRCA 3T0AA 3ULVD 3V2AR 2XY2A 1KIQB 5HHPA 2YKLL 4BFIA 2X1PA 4ZO7A 4BSWA 3C5SA 2FSEB 2X2YA 1FO0A 5AUMA 3UPAA 2V7HB 2QSQA 1WBYA 1UC6A 3ARUA 5DFTA 5C0GA 1TDQA 1S7TB 5I9QC 1F4YH 5FYJE 2VQUA 2C3GA 4J4PD 4PRPB 4MCYB 1FIGL 3BZFB 3QPQC 3L3GA 1RU9L 1NGWB 2VUYA 5T3ZH 4X6EA 5DK2B 4JPVH 3FAWA 3BKYL 1U8JA 1NUDA 3OB8A 3FT4A 3MRHA 4R90L 5DMJB 5TPWL 1YEIH 5BJTA 4HC1A 3X14B 2PW1A 4X7SH 2P45B 3HR5A 1RQ5A 4HUVB 4JKPH 1A3RH 1F4XL 2J5LC 9CGTA 4U1MB 5DMKB 3OAUL 4LLMB 1G6RL 4PYHA 1LEGB 4S1RL 5HI3C 1QSEA 1OAXL 3FTGB 3GIVA 3S36L 4F2MB 3OB0K 4KK5D 4OCLC 1MAKA 3SDDA 1ZWIB 1IC4L 1XZ0A 4U6XB 4XP6L 1KPRA 3DROA 1LNUA 2R0LH 1QSFA 4OZFH 4UOW1 5TE6H 3TO4C 2DI9A 5F7DB 2DKMA 5D7JC 3TVMB 4PB9L 5C0ND 4EDWL 3NPSC 3O4OC 4W6YB 2GTZA 4BQBA 2X9YA 2NR6C 3ZHDA 3OKDA 1AXSB 4WY7L 1G6RA 3HI6H 4RCAA 4YDJA 3S4SA 5L7XL 4E41E 3PGFH 4PR5B 5C08B 4KKBD 4OF7A 5SWZE 4B5EA 4GQ9H 3IVKB 1KCRH 3RWEB 4J3WA 2P8PA 1NLDL 5T1MA 2VDOH 3KS0J 2H3NA 5ALBL 5JUEH 1INQA 2YZ8A 2MKLC 4YBHA 4AMKL 2LTQC 2X05A 3GSQB 4RGNB 2AQ3A 3PDGA 5SWQB 1YEGL 4AEEA 4NO0D 3I85A 4EBQH 2WV3A 4APQB 5GS1B 1N0XH 4IS6B 3ZKSD 3G5VB 5CCKL 2DQCL 2ZZUT 4I0KA 4Q74A 3V52L 3TPUA 4KH2A 5C71A 3L3IA 1L6XA 3K3QA 3KPOB 4ESKA 5CP7B 2YD2A 2XNAA 1JN6A 4QRPE 4UNVA 1MIML 5DJ8B 4TQEH 5EIIB 4U05A 2HT3C 5I30H 4JFYA 4H1LH 1FVDA 1DFBH 4PJEA 4KXZH 4JFQA 2YD3A 1MHEB 1CFVH 5D72H 4G6FB 1T21A 1HYRC 1S7XB 1X6NA 1CVRA 2VZUA 4NFCA 4AJ0A 4ZYKA 4NQXA 1EO8L 2VLKB 2ITCA 2X1XR 2VXSL 3D0LA 3KJ6H 4RISH 2WIIA 5HBBA 1KULA 4YPGB 5C0BE 3BDXA 4OM1L 3VMNA 4NWTH 1J1XL 2GSGB 5EA0L 2JCCB 4OIBA 5BV7L 3QNYB 1DQJB 1DUYA 4F15B 1J8HE 4QOKE 3QQ4B 3V9FA 4GQPH 5BJTB 6CGTA 3SE9H 3VRLF 2BY3A 1QYGH 2OZ4L 3Q3GA 5T3XH 2AXGA 4IHOA 4DGYL 2X4PB 4YHOL 5IFJB 3QUZA 4JFOB 1ZLUH 3TVMD 3U7AA 2X7LB 2D31B 3TEUA 1N8ZA 3OKOA 4L5FL 4KPHH 4N90D 1EGJL 4FQ1H 2JIXB 3FN0H 3BPLB 3LKQB 5E5MB 4XRCB 3QXTA 1DBJH 3QPQD 4MNGB 1I8IB 4S2SB 3QDJE 3VXUA 4N5EC 3MLRH 2DF3A 2LU4A 1F6AB 2QQQA 4F8TA 2AW2A 3BZ4A 3IDYC 5E9DA 4GKZA 4L9LB 1KPVA 1YNLL 3S4SB 4L3EE 3UCRA 2P48B 4QRQB 5H2BA 5TGBB 3NA9H 1E6JL 4R2GC 1J1OL 5GIRB 3TCLA 4X4ZA 1JMZA 2EDFA 5GGUA 4OB5L 3L6FB 4UINH 4KJYA 3CC5A 1O7SA 5I2IB 5BQ7B 3EFDL 5DQJA 4PD4K 4XAKD 4F9LA 4JHBA 1WZ1H 4XBEH 5ICZA 2EO1A 4WI4A 3BPOB 4RGOL 1H8OA 3O6FA 5FYJL 3BSZL 4P23B 5E8DL 3FN9A 1INDH 1KPVB 2H2SC 4NFBA 1YZZA 2FB4L 3DETD 4YAQB 1MRCH 1WQVT 2CGRL 2MHAA 3EOBB 4JPWL 4XVUD 1NFDE 5GHWH 4ORZC 3BP4B 3C2AL 3OX8B 2VDQH 4EI5B 1BOGB 3FT2A 1MHPH 4H0GA 4DN3H 1JWSB 4GMSH 4TVSa 3GMPA 1ZLWK 4HC1H 5SX5K 3BRFA 2XZQL 1CN4A 3NMEA 4JB9H 2R23A 4M6NL 1F3RB 1FYTA 1NLDH 5IIEB 2F53E 4WEMB 1XR9A 2I27N 4KTDL 4NC1C 2F8OA 4HHAB 4OD1H 4FXGA 1YEDA 2IJ0C 2BVOB 3B9DA 3UTQB 1IBGL 3MZGB 3Q5OA 4BFIB 4LIQL 2Y23A 1KIQA 4N5ED 4P48A 5HHPB 4CW1B 1IAKA 2PW2A 4JDVB 4U1JB 3IAPA 3O6LL 2A6DA 1DUYB 1S8DA 4GOSA 3D6GA 3MJGX 4X98B 5DZNA 3WL9B 3GJFB 5C0IA 1S7WB 2NW2B 3H3BC 3JTTA 4LCYA 3MA9H 4IRZH 4R4BB 1EH9A 5EOTA 4M61A 5KZCD 3P30H 3CMGA 4KXZI 5E2TL 4IDJH 1WZMA 3O11B 4XAKE 5C0IB 1MUJB 3DMMB 5BZDB 5JIIA 1RJLA 1ZS8A 4U6TA 1LHZA 4EZMA 1S7XA 4MA1B 5BV7B 5E4IA 5HYJA 4FFVC 3HNVL 1FNFA 3S98A 2BSRB 1QG3A 2VRAA 1NFIA 2F8VA 3EYOB 1H15B 1D5ZA 4PJ7B 4XPFL 3RNKB 4L3CB 2E3VA 4OGAD 4Z95H 5JNYA 1DBML 3O81A 5HVWA 4S1RH 3IETB 4J23A 4MB4A 2DKSA 3X12A 3LEXB 3VXUE 4OM1H 2HJKB 2V6HA 1UJ3A 2DLHA 1MJJA 3RWFA 5H35A 1NMAL 5F7YC 1TENA 4IOIA 3UTSB 4JKKA 4M9PA 2EXYC 2FWOB 2IFFL 3DXAA 4OGXL 25C8L 4JPIA 5E8EA 3DPBA 1LEIA 3UTZA 1ORQA 5IB3A 4IOSD 1AC6A 3OF6A 4HXBH 1HKFA 1MFAH 1QFWM 3RX5A 2FHFA 2WBJC 5J06A 1QYGL 3MUY1 5AZEL 3U2SB 4W68A 1SVZA 3V5KA 2R0WH 3F8UB 3ZHKA 2NX5A 1QZ1A 5E00B 3IVKA 3SCMB 1X9QA 2EDOA 5IQ9A 5F3BA 3DVNB 1UWGL 1XF3B 4P5KA 2YC1A 3ULVE 4PR5A 5JO5A 1UA6L 5D5ME 4FQ1L 5I1DB 4DCQA 1QBLL 1GGUA 4WEUD 1LEKB 2IBZY 2FH8A 1AGDA 5HPOA 3HC3H 4YGVA 3OKDB 1F97A 4AQOA 4D0CB 5HGGS 3EOAA 1A4JB 4LSPL 5HDOA 2XRAH 4HIXL 1QSFB 4OUUB 3DYOA 3GSVA 3NFNA 4KVNL 5CCKH 3OGOE 1RK0B 3QEUB 1E28A 3DRTB 8FABB 5DTFB 4QT5A 1BECA 1QPPA 2P5EA 5MP6H 1ZGLM 5KVFH 5EU5B 4RWYL 3RPIB 1INEL 1WZ1L 4TQEL 5KG9A 1G7MB 2FO1A 5DC9B 4UTAH 1NGXB 4NHUB 1S5IL 2ZCKH 1OF2B 3HE6D 4M43H 4JM2D 1H8NA 4N0YH 1VFUA 3UXFA 2J6EL 1NGWA 3EDFA 4X7CC 3VFVA 1F8TL 1PVHA 3HC0A 4JPWH 2JE8A 3L1OL 3PQYA 2NW3A 4QXTB 1TJIL 2WLZA 1L0YA 4G6ML 2HRPL 4WFGE 1A2YB 3VG9C 5BW7A 5IWLA 3RI5K 3ZDYF 5E7FA 5JHDE 4WFEE 3DO3A 4I18B 3W0WE 2DQIH 4M00A 3SN6N 1FL3B 1FYTD 1SYSB 1W8NA 4W6WB 1LE5B 5B8CB 3U36B 4LKCA 4KRNA 4QRSA 4QT5B 1JTTA 3MMEB 5D1ZD 3SOBL 3SE9L 1W0YT 4DGYH 1UM6L 4OIIL 2Y9RT 2BVTA 4TUKL 3VRIB 4ZUTA 4DQOL 1TETH 4ZO6A 4GMTL 1N4XH 3NIFF 3WDIA 1QO3A 2X4RA 3UEZA 4FQHA 4KPHL 3LN9A 5HY9B 1LEKA 5C6TL 1ZLUK 5HGBB 4D8PA 1MRDL 4HIHA 1CGWA 1VFMA 5DJ8A 4LSSL 4X6CA 3U48A 5D2LA 4QTHB 5FKPA 5EN2B 4PV9B 1VACB 3Q48A 1ZHBA 5E8OA 3SO3C 4IDJL 1DSFL 2AJZB 4EUPA 3ZLQC 5GRVL 1WV7T 4HLZG 1WZLA 1FP5A 3TH4T 2YPKA 5A2FA 4NQSA 2BVUA 3MRGA 5IB2B 1WEJH 4NSKB 2ESVA 5I1KH 4LNRB 3IF1B 4GUPA 2VJXA 3MRPA 4GLRH 5DWUH 2P24A 3ARED 3MCKB 3H9ZA 3OHXB 3ZE1E 4BZ2H 5MENA 4GKSA 4Y4KD 4JHAH 1D6EA 3MA7A 3SGJC 2VR9A 2G2RA 3C6LC 4EUPB 5M95B 2VDRL 4N0FB 4AENA 3UO1L 3QDHA 3FQXB 5ERWA 1Z0MA 4AIXA 2YD9A 2WK2A 1P4BH 5E8NB 1BX2B 1DE4B 2BSRA 3UPRB 4LCUB 5JXED 5D2LB 4XVSH 2CMRL 2AAVA 2VLLB 4NRZB 4GG6B 4QRPA 3WLWD 4JZJC 5GGRB 3BP5B 4AEHL 5EZIH 1RJLB 3I3DA 1QO3B 4YEEA 5MEQB 4HUWA 3I02A 1O5DT 4LU5H 5BS0A 5FF6A 4J3OC 2E7CA 4OZGF 4ODUA 3BAEH 4LVOC 3VWJB 1YYML 2Z93B 2XZQH 2CJUH 5CJXC 5ESQA 3MRMB 4LASL 3TO4B 2P46B 5IESL 4HPYH 1ZT7A 2FJHB 5IFAH 1EFXA 4OD1L 4O58L 3IDMB 2D03L 3LN5A 1KEGH 4JZJB 5KS9B 5IROC 4ENEC 4KU1A 2Q7YB 2WIMA 4OFPA 2B2XH 1ZSDB 4KHXH 4XHJC 1LK2B 1FFPB 3CU1A 2WWMD 2Y7QA 3KPPA 3ULVL 2DL9A 4MJIA 1QFUL 2X1WL 1JTPA 5FO7B 1YPZA 1AGBB 5GGVH 2WANA 1WBXB 5DK3A 1ZSDA 3NIDF 4ZNCD 1FO0B 1FORL 1HOCB 2BCKA 1CXLA 4F58L 3HAEB 5B38G 2I9LA 4L4TE 3HS0A 4NHCL 4LSVL 2PYEE 3ULSB 4HJ0C 1T2QH 5KG9B 3KYOB 5L0QB 3VFNA 2MHAB 3HNVH 1MI5A 3H7LA 4P46C 5BMFL 4XPFH 3QEGL 2P5EB 5HHVL 4U1NA 3WE6A 4Z7OF 4X5LA 5E8PA 3FQUB 1N64L 1BFSA 3QAZC 2EEBA 3OJ2C 3O4LE 3QDJA 1OTUC 3NAAH 2VDLH 4DVBA 2H32B 3QWRA 4HMDA 5DFVD 5HTSA 2CQVA 2DQTH 3C08H 3GB7A 5D7IE 5ABDE 5ICZB 2NY2C 5GS0H 2DMKA 4XPAH 1NCWL 2J3SA 3QJHB 4D0BA 3D39D 3TYGH 1GYAA 4OGXH 2M1KA 1O0VA 1XGQB 4ZUVB 1U8NA 1QVOA 4X6DF 1S78D 4HGKC 3CFEB 2ATPA 2Z31B 1QFWH 5C0JA 3D18B 4QNPE 2YXFA 3RBGA 4U1HB 4IDLA 5ECJE 2YC1B 4Q0XL 2G2RB 3ZKMD 2V5TA 1KJ3H 2VXVL 1QSEE 2VL5A 3DECA 3MFFA 4K3JL 1Q94B 1SY6L 3LEVH 5E00A 4U2ZA 1HH6A 4OGAC 4P2RA 3LKQA 1Z3GH 5SV3A 3ZYZA 4A6YB 1QSFD 1G7IA 2IPUG 4FQQB 2VDMH 3LS5H 1REIA 5HGAB 3K46A 4I0PC 1GVIA 3JWOC 3T77B 2BOBB 2DLGA 1DQMH 3STBA 1N8ZB 1J05A 1M7XA 1T0PB 4PGEA 2EIDA 4HGMA 1T04B 1RIHL 1CDJA 4RFNC 3VE0A 4Z0BL 1G1CA 3H3PH 1ZK9A 1HHKA 1F6LL 3VH8G 1CL7H 2PR4L 4OKDA 4QRPD 3D48R 3VFOA 1MVFA 3O6ML 2HLAB 4X6FB 5FM5O 2UYLB 1QFHA 1HXMB 4D3CL 2OI9C 3RU8L 1DQQB 1K9TA 1FC1A 4HW6A 3QR2A 4QHMB 5IMLB 3KYMB 3QXDA 3R4DA 4B53A 1CXIA 2VISA 2ZUQC 1AR1C 3FOLB 1NGQL 2XACC 4QYOA 4L4VA 4UTAL 2R1XB 3KJ4B 4RFNB 3S35X 4BSVA 3BO8B 4UAOC 3CFDA 2JIXD 2ID5A 2MPAL 3TNMA 3OV6A 4PY8I 2XFXB 5L2KA 3BRDA 5T33H 1QR1B 1YMHA 5DQDL 4L4VB 3CGTA 1GJIA 4NKIL 1SYSA 2A77L 1RJZA 1U91A 5CD5C 2VISB 5ESAA 1Z2KA 4X9IA 1ZANH 5L6YH 3Q6FA 1ZA6B 4HZAA 3IAGC 5FXCH 2H9GB 2HVJA 5HYJE 3UTQA 5K59E 1SEQH 2DM2A 2UZXB 4KWUA 4X5XB 2AI0H 3L3KB 4NOBA 4HHAA 4JJ5A 2ZUWA 4HX1B 2D7QA 4NUJA 2P1YA 3ARWA 3LMJH 5F1OB 4X7FC 4RIRB 2BDNH 1UWEL 3GSNA 4RWHA 3KYKH 3RVVC 4HXAL 4FZ8L 1YEKH 5C0AE 2DD8H 4K7PX 3PABA 4IJ3C 3JV6A 3M07A 2A9ML 5ICXA 2HFGL 3QULA 5JPMB 4MHHG 4GXUN 1U9KA 3QWQB 3T2NH 3CLEH 1XF5A 2VNCA 4WTZG 1T1XA 3WFBH 3AS3A 3BGMA 2H26A 1YEJL 3MGOA 1NLBH 4FFWC 3Q5TA 2Z8WC 1F5WA 4HD9A 3GSNH 5FA3A 4LBEB 3VD4A 3FB8B 4Y4FB 1TJGL 5DVNA 5A16A 1K5NB 3F58L 2CD0A 3GMRB 5DMIL 5MHSD 5GZOD 1OSZA 4NQEE 1ZLSH 2CUIA 4LSVH 4C4KT 1QP1A 3GHBH 5F9WC 3TN0C 3JV5A 5D7SL 3FFDB 1YEIL 4M8QA 3NIGE 4MA1C 5BV7C 4XCYA 5D7JA 3OAZH 1XGPB 1I1AA 2VN4A 4XNZB 1F4XH 3NVQA 4Y5YC 3CVHL 3QRFM 3IJSA 3ZDXF 5F7KC 4YNYB 5J3HD 1EHLH 4Z0XA 5LGJA 5LJYH 4L9LA 5JHDD 2O5YL 1QSEB 4NNXB 5DJCA 3FB6A 1SJHA 4G3YH 5BS0E 4M6OL 4XP6H 3KYOA 1WCQA 2OL3A 3SO5A 4Z8FH 1G7HA 2P5EE 4GRLC 2WUCL 3MLSH 4ORGB 3CDCA 4KK9C 3MRHB 1EVTC 1UVQA 1BQUA 3V5DB 3MXWL 3VWJC 2PO6B 3GGWB 5IB5A 4MD5B 4WENB 3QZWG 3PP3K 1MHHA 3GSXB 1CFQB 5DXWA 1A9BA 3ARSA 1ZVYA 4OZHE 4K2UH 1B9ZA 1YN7B 1EO5A 3SEPA 3VMOA 1S78C 3GMNA 2FBJL 5IBTH 3TZVC 5CLWA 4P59L 4NRXA 4D9QD 1PZ5A 2NY4B 2HFFA 3UYRL 3PGCB 1CL7L 4OI8A 2KKQA 3LEYL 5EOTB 4UIKL 4G9DB 4K94L 5LCVL 3M17B 1HQ4A 3BIKA 3SDCC 3ARFC 2FD6L 5T5NG 2EXWC 3LV3A 3RZCB 1MIMH 1ZA3A 2HRLA 3SCMD 2AJUL 3LQZB 4LVNB 1FFQA 1A6VL 4OV6F 5ETUA 3RY6C 1U58B 1AXTH 4Y4FD 2NY3C 3CMOH 3DSFL 4ZO9A 4NP4L 1LO5B 4LSRH 4F7TB 3CCHB 1GGTA 3MYJB 2AKRA 4U7KA 4PP2B 5JOFB 4AZ8A 1KG0B 4QTIL 1P6FA 1I7TA 2VR4A 1FO0H 3ZT5A 3MV8E 2XT1B 5JW4R 4XP1H 4O5LH 1MPAH 3TJHD 4WNQB 5KS9E 2ESVB 4XXDA 1YDPA 5KSAB 2DWDB 1C16A 2FDBP 3BGFC 5BV7H 3ZKNC 3F12A 3MRNA 4U6VL 3TYGL 5F9JB 5I1AA 3D25B 5E6IC 4ODHL 3HE7B 4OZ4A 2F5BH 4WDIB 1EVUA 1MH5B 4TNWK 4NBZB 4XPBH 2Q8BH 1CFNB 1IM9D 3LSOA 1IEBB 3JWNC 3GKWH 4KI5D 3ZE1F 4H20H 2HKHH 2AJSL 5IB4B 5EORH 3EYUL 1GGBH 2ADIB 2DKUA 4X6CB 2RJMA 3DUHA 3TCXA 2A9MH 4YDJB 2UZYB 3N1FC 5FOBA 1JPFB 3VFSA 2MCPL 5FIEA 4F15C 5TH2B 1EGJH 3IRZA 4KJYB 1JUFB 3E1F1 5D1ZA 4JO4L 1G0DA 1HHIB 4KMQA 3HE7C 3VRIA 1CGYA 3S3JA 1FIEA 4K3EL 3FFCB 3HAEG 4D0DA 3ZKND 3HI5L 2HJFA 1GOHA 5LWYL 5EOQL 1KPRB 1QKZH 1YY8B 3PHOA 1SYVB 1IVLA 3PHQB 2B7DT 4O2FA 4YHPA 1MOEA 5DRWB 4Z0BH 1I4FA 5EZJB 2AP2A 1MVUB 1S7RA 1UCTA 2AJVL 1GGYA 4M5YL 4JO1H 3PQYD 1UCBL 3D69A 4J2XA 4LLMA 2HT4C 2N4IA 3EZJB 1YC7A 1PY4A 4JDTL 3MUJA 4ODTH 4MAUH 1PGRB 3ARVA 4R9HA 1Q0XL 3ZDZE 3O6FD 1RUKL 4OZIF 5T5NF 5IR1A 2QADC 2D4FA 1JPSH 4UTBH 4AM0B 1BIIB 5E5RB 2HMIC 1C5DA 5EFIB 4MCYA 4LSUL 5D71L 4Z77B 4DW2L 3LPFA 4NIKB 2IANA 4K8RL 4FFZL 1B2WH 2MPAH 4LKXA 3PDOA 4L4TB 3L5XL 4WI9A 3BW9A 1LO4L 2EH7H 2BOCB 1FYTE 5GSVA 5FUCC 1BP3B 4M3JA 1G7MA 4WCYH 2ZUXA 3EO1A 4MNHA 5ADPL 4KQ3H 1V8HA 3MBEC 3VXQB 4EOWL 5FEBA 4HCRL 3SKOB 1A7QL 5L6YL 2R2HB 4KV5E 4JFPB 3TT1L 3D5OF 1I7UB 4M4PA 1YY9C 2Y06H 1KPUA 4UT7L 3QO1B 3MV8A 3TA3B 4P5MB 5CUSH 4QHNB 1K8DB 2WBWB 5KANG 3WUWG 3QUZD 1IZKA 2Q8AL 4QHNA 2X9WA 3MV8B 5FUZH 2PF6A 3UJIL 1QR1A 2XFXA 5L2KB 1Q9KA 4OQTA 3MRRA 3V4UL 4PJXF 1HNFA 1YNTA 3NFSH 3CVHB 4OLXH 3KXFD 3HMWL 4P2RD 4PJXE 1OCWL 1LDPL 2OI9B 4P5TA 1XH3A 2EC8A 3HE6C 2QQLH 4P2CG 1W2KT 3QDGA 3VGEA 5J1TC 1ZAGA 4NM4H 3B6SB 3KWWA 4PY7A 3SKMB 5CEYA 3I50L 2Z31C 5C3LD 5ITBL 4JFHD 4KZEH 5JIKA 4YDIL 1QSFE 2C7UA 4HBCL 5J56B 4NZRH 3D39A 4GW4B 4TTDC 4DAGH 1T83A 3CUPB 2IBGA 5E9DE 1D5ZB 3ZE0E 3IJYB 2VSCA 1V3KA 1K4CA 2ZOLA 4QGYA 4EI5C 4UQ3A 2EIZB 4WV1B 5I1IH 3P9LA 5FGRA 3DGGA 2V9TA 5I1EH 4NN5C 2GTWB 4YHLH 4Y1AE 4NM8L 1MFAL 2I24N 4FN0A 1VDGA 3HFMH 1X3DA 3B4NA 4NO0A 2NY0C 1S7RB 2HKHL 4CUCA 4OZFG 2OM5A 1JYNA 5F9DC 5EORL 5IT2H 4K71B 5DJ6B 3WFHB 4LCYB 4NNYB 2F58L 1KIRB 2X4SB 1PQZB 3FQTA 2IBZX 4QF1A 3ARFB 1KJMB 3BKML 1UXWB 5E2VL 2IGFH 1DVFB 5CGYC 3RWJB 1XGQA 1IMHC 1RZIA 4XX1G 1F4WL 4Q9CA 4XNYH 4K3EH 3MNZA 2AK4A 3HI5H 2F5AL 2NY3B 5ICYB 3GMQA 4P9ML 4BFGA 4ODSH 1NANH 2R39A 3UYRH 2NMSA 1LO3L 4ZDHB 3V6ZB 3QFJB 4HGWB 5B3JF 5C0GB 4R96A 4GBXA 1OTTC 4P5TD 5F88A 4LLQA 1IGTB 3SKNB 5B3JE 4BK5A 3HG1D 3VG9B 4JFXB 5AYUH 2VXUL 4MAUL 2NZ9C 5EU4A 3QIBA 3VD5A 4R97C 4X80H 4LHUA 2L0DA 2BNRA 3WNMA 3QEQE 4JG0L 3SJVB 2ZCLH 3L5WB 3IDIB 4WO4A 1E4XH 2J1KA 3DSFH 2C3XA 1RZKC 1FNSL 2P8LA 3V6ZA 5K33A 4PJCB 3L5XH 3D87B 1OSPH 2K1MA 2Y7QB 3QIUA 3W39A 4PP2A 1YJDC 4XZUA 5TE4L 4I18C 1MAJA 4HH9A 4ZTPL 1HHJB 3BUYB 3C5ZB 4G8EB 5I2IA 2I9TA 2HRPH 2AJYL 4IMKA 4UILH 1YECH 1EHNA 4F37K 5T1DL 2GJ6D 1QBMH 4JFED 4I0PB 3RWGA 5E2WL 4MDIB 2FX7H 1AIFB 1KLFA 3S37X 1GZPA 1T7ZA 5IW6A 2Q8BL 1IGYB 1ROWA 3PWLB 2FX8H 1B3JA 4ODUB 3OJDB 1F4AA 2VYRE 3DO7A 3MRDA 2H1PH 3KG5A 3BT2L 1FFRA 3DX8B 4LLVA 1KSRA 5I8CB 4NRXB 1N4XL 5DDHB 4CMHC 4U1LA 1X5ZA 2DRUA 3DX9B 3QFDB 4M5ZH 2ADJB 5HXMA 2XZAL 1CFSB 3WIHL 1CVSC 2XYCA 5FGBC 2VLMD 4MQ7A 3T3PF 3CUPA 3FO9A 5GPRA 3MREA 4L8SA 4GW4A 4L3EB 2Z92A 1LDPH 3C9NB 5EOQH 5FHAH 4JZNA 3O6KL 4Y2DB 2B5IB 4Q9RH 2W07A 4KKNA 4N8VG 1R3HB 4MNGE 4LNRA 2VITA 5F6HI 5I8CA 1CDGA 4N8CH 3DV6B 3A67L 1A6UH 3WS6C 3LKRA 5HPMB 3I50H 2AJ3B 4PTTB 3QFJD 2DIBA 3QQ3B 5E99H 3FCTA 4N5UA 3SDYL 3X3GH 1RUKH 4PJAE 3HLAA 5FO8A 5HYIA 4NQCD 1JGDA 3RZWA 3PL6D 2BY1A 2GFBB 3MSPA 1JGEA 4NWUL 5ENWA 1HYSC 1SMAA 3BE1H 4KRPC 3SJVD 2XXMB 1X5XA 1IT9H 1CGTA 4O02H 2OJEA 2CKBL 3WFCH 5HHOA 4OD2A 2FGWH 2E6PA 2EDWA 1XFPA 1NUNB 2GI7A 5EU7C 3VD9A 1UQSB 4PJ5A 1MCPH 3WFZA 1WFOA 5EU6E 3W39B 5ADPH 1JWUA 4EOWH 3F7VA 4YBLB 1LP9A 1TZGL 1EERB 2IG2L 2PYEB 3O9WA 1XGYH 4HCRH 4ENED 1IARB 1IC5L 2VAAA 1XMWA 3TP4A 1VEPA 4QRRB 2LVCA 4C56B 2CRMA 4WO4B 2CKNA 2Y07L 1RJYA 1JP5A 4FTVE 5B8CA 4Y4HD 4Z7UA 5CINL 3HZVB 3ARBB 1LK3L 5CZVL 5D7KE 2D03H 4AEIH 4H26A 2H3NB 5B39B 4Y16A 5GSVB 4P9MH 5CIPB 3NGBC 2W65A 2OJZL 3PHSA 1JZ7A 5LG1A 2IANB 2NW3B 3PQYB 5I1GH 2V2XB 4MX7A 4LLUA 4KDVA 1DLHB 3DARA 3KNBB 4FP8H 5SWZA 4CVXB 4WI7A 1CLZL 4ZAKA 2VLJE 2E8YA 5IR1B 1OF2A 2B0SH 3HMWH 5A2LH 1CG9B 4MGXA 4LCCA 3KYAA 3MLUL 4TUOA 3IDUA 4ZO8A 4WUUE 5F96L 2UWEE 4X4MA 3A6BH 1MJ7H 4OM0L 5FDWA 3QUXD 4KROD 4JG1H 2E7BA 5DA0B 4F2MA 5BRZB 3JWDH 1PFCA 1I4FB 4OCXL 3DRTA 3QDMA 1E28B 5GJTH 4ZPTB 4OCYL 12E8L 1MFBL 1MFNA 1JF6A 1DP0A 3BO8A 3BZDA 2APXA 5IJKC 4C58B 4NZTH 4GLRI 4OFDA 3RAJL 4QYOB 1FCCA 1RZKH 4NQEA 4Y7MA 5DURD 3U83A 4UQ3B 1U8JB 5J12C 5I1EL 2FL5B 2QHLA 3ARGC 5CZXD 2OR9L 4LP5A 1OAQL 5HYJD 3MROB 4OZIE 3UJTH 3WKML 1W72H 4UT9L 3DIFA 1KYOK 4LQFL 1WWBX 2EDQA 3LOWA 4WGWB 5IG7B 5I73B 4BSWB 2A74B 1RUPL 2Y36H 3X17A 2ZJSH 4XI5C 4JANB 1ONQA 3T4YB 3T1FA 1KNOA 4NFDA 1NDGB 1WWCA 1T22B 1FHGA 1Q9LB 5HYSA 1YNTB 5FHAL 4ZSOE 4PRHB 2UY6A 1KG0A 5MERA 3L7EA 4P2RE 5IFHL 3AGVA 1KC5L 2F19H 3VXSA 2EH8L 2LFGA 2V2WA 3DBXB 3U4BL 3G9VA 4POZC 2Q3ZA 3K2UH 5KVMC 2BNQE 5DMYA 4DUWA 4OGYH 4R6UA 4GAFB 2AJXH 4Y88A 1TQCC 1I85A 3VFGL 3TBWA 3QIUB 2JF1A 1L9NA 4PRHA 4L29A 4KKLD 1INDL 5CEZD 4G6JH 5D1XB 4PLNC 3IDIA 4TN9A 2WWKT 1NDGA 2R2CA 3CK0H 1AR2A 2KDGA 3F7PC 4GT7A 4GRLA 1V5JA 5DJAB 3KLAB 4H5SA 1HEZA 2R4SH 7FABL 3V7AG 3IYLW 2B1HL 2A74A 2DQDL 1IRAY 4FXGB 2A6KA 3MV7A 3QWOA 4ELKA 3ES6B 1C5DB 1RULL 4FG6C 5EFIA 4X4XA 1LGVA 4KTEH 2A6JA 3IFPB 2R0KH 3CIQA 1KACB 4MD5A 1MWAA 3O8XD 2CDFB 2FZ3A 4F9PA 2NY6D 2ICES 5I15H 5HHQA 2FL5A 2BDNL 2DQUH 3HNTL 4U1LB 5JHLH 2NY3D 3QXWA 4E0RA 4GAYA 4TULL 1BF8A 4ETQA 3WLBA 3DX8A 5DSCB 4MMXC 3PV7A 4LLWB 3TN0A 3P4NA 4LAJH 1FAKT 3WN5A 1J0JA 4WI6A 4UDUB 1G7LA 4H8WH 4MNQE 4FP8L 3WIHH 5DZLA 2CUMA 1YEJH 4MDIA 1A0QL 1CE6A 4S1QH 3L3DA 4O00A 3P4NB 5FF6B 1FNHA 3MLUH 3VRJA 1S9VA 4Q9RL 4ETQB 1CICA 3RY6A 4QO1A 5JR1H 2ZG1A 1MJ7L 3T0WA 4OM0H 1OGAD 4MWFA 4F7EB 1T66D 2EYTB 2YA1A 3VGFA 5IUSA 5GIRA 1KLUB 4NQUA 2V5MA 2OMNA 3SDYH 4BZ1H 3MRFB 4QRRE 1A1OB 4DUVA 2H26B 4UDTB 5FHBL 4JREC 3U30B 1I9JL 3PUCA 4MAYD 5C09A 1RZKL 1HN1A 2R8SL 3QT2A 3OHXA 2EDEA 5L8KB 3JTSA 3P4OA 3R1GH 5I6XC 3H6JA 2G5RA 1YMMB 1CZ8H 4PG2A 3VXOB 1J0YA 3PABB 3AVEA 3MRGB 5IB2A 4HXBL 3LRSB 2OR9H 1C5CL 2CLVB 3HNSH 1OAQH 3BN9D 1U92B 3M1BB 4P4RA 4TSCL 1M71B 5SV4A 5GGTA 1UM5L 1XR8A 3I3EA 5C2UB 1MCCA 4NKDB 2Q7NA 3HRPA 4TYUA 1FLTX 4NT6B 3MV9E 4X8JA 3DVFA 4Y5XA 1FCGA 3U0WL 4ODWB 2NXZD 2VE6B 3ALPA 5T1LA 1C1EH 5KVEL 3OGCB 2X4SA 1BQHA 2R2EA 1MELA 4URTB 1WK0A 3DUUB 4N8VB 4CAGA 3M17A 4Z5RB 4RGND 2NY6B 5BW7C 4Y4FC 2J4WL 4CMMB 1I7UA 1E4WH 4G7YL 5I75C 4LK4A 1PZ5B 2E9IA 1GSMA 1KC5H 4FQ2H 2IF7A 3N50A 3T1FB 5I18L 2I5YH 5EOCL 5HI4D 1G9NL 1MCRA 4O4YL 4JRXA 3MBXH 1DEEB 2ZSVB 4PJHE 1A6VH 1R3JA 4XP4H 1J0KA 3H42L 3I84A 2GJZA 4K9EL 2BMKA 2L4OA 1PAMA 3QUYD 2A83A 1VPOH 5BOZG 4YR6B 2Z8SA 1G84A 1NCBH 1ZLVH 1Q1JL 3O2WH 1BFVL 5F7UA 1BD2D 4O5LL 5E1HB 3AU1A 5EU6D 5I74B 5BCAA 1DQLH 5TQ2L 2N1KA 5LXGH 4CN1A 5IV2B 3KPMA 1L7IL 2ZG2A 3MOQA 3RVUD 1IKFH 3GSOA 5F89A 5IHZB 3MGTA 2KQMA 2V7NB 4YZFF 3ZE2F 2G5BA 1UH2A 2VH5L 3AS2A 2VDNL 4JAMA 3TGXA 4I3SH 1NQBA 3H9HA 3QDMB 5C0NC 5SX4H 3GKWL 3IDXL 2LQRA 5FDWB 1SYVA 2GSIA 4RMVA 4LPUA 3VXNA 1AD0A 3PXHA 5DJ0B 1G6RB 4TULH 4YIQA 3G08B 3KDMA 1X5AA 3PIQB 5C09E 3WFEL 1U8LA 5CBEA 3RX7A 5JW5A 2WBKA 1OPGH 3BEVA 3VFSB 1OSZB 1QBAA 5ACLA 1KPUB 1OB1B 4O2CB 3OXSA 3V6BR 4NGHL 4EDXA 1D5XB 4EN3D 5KSBA 1NCCH 3MNWA 3B3IA 4HKZB 1FBIH 1OT2A 4ISVA 1SEBB 5LWYH 2GJ6B 3QZWB 3QO0B 1DDHA 3K8LA 4LQ1A 4LARL 3FQWB 1I3RB 1MREH 1XIWB 3I2CH 1J87A 2HLFD 4M5YH 3CFKA 5C70A 5IFHH 3UBXB 3WXWH 3SGEI 3RGVD 2E9JA 1BZ7B 1IAOB 1C7TA 2RAMA 1J8HB 1UGNA 1CGUA 4M6ML 4PPTA 2VL4A 1AGEA 4PJGA 5IVXA 1A1NB 1KELL 2IAMD 2B4CC 3HZYB 4X5XA 2B4CL 4AK1A 2HVJB 4W81A 3IETA 3UPCA 1EZVY 4NKMB 3MV7E 3GMMB 7CGTA 1DBBL 1EHAA 3PDDA 4IBLT 1BZQK 2FSEA 5ESAB 2W0FA 2OLDA 4G9FA 2AXHA 3SDCD 3AAZB 2M26A 4MD0A 1JV5B 1YMME 4R4FL 2YEZA 2C26A 1FG2B 1I7RB 4QF1B 1NBZA 5DRWA 5EZJA 4BZYA 4Y19B 3EJYC 3BX7C 4BH7B 2NTFB 1C12B 4ZTOL 3HLAB 1DN2A 3KPRD 3ARDC 3C60D 1GH7A 1NAKH 3MJ8A 1RULH 5DR5L 1DUZB 4N0UA 3QPXL 4U0QB 5IK3A 1AP2A 3E2HB 3S37L 4QOKB 1IE5A 4F7PB 4D9RE 4S10A 4HPYL 4PGDA 3HC4L 1DL7H 2XQYK 4MNQB 3QCTH 5D6DA 4OTXL 3V8OA 5CUSL 2CDGB 4TPRH 1P1ZA 4OCMC 5D7LA 4JM2A 3BKJL 5GGVY 1IAKB 5I0DA 4HAFA 1U3HD 2E6QA 4X0KB 5JQ6H 1Q72L 1VKXA 5MEOA 2Z8RA 1T0NB 4KHXL 1CD0A 1JGLL 5FUOH 1SY6A 2ICCA 3DLQR 4RZCB 4JRWA 3V4UH 4YQXH 5F6IB 1KOAA 5HHME 4LRNL 1SVCP 2EIEA 4NQDB 1HILA 4RBPH 2V9RA 2PYED 1G7QB 5IMMB 4KK5C 2YPLB 1U0QA 4HS3B 4XP4L 4D9LH 5C2BH 1NFKA 4HS6A 5K9KB 4X4YA 1LE9A 5DUPL 4KGJA 2O5XH 2IBBA 4OF3A 4PJCF 3ARGB 3PWUA 2W9DL 5I1LB 1GC1H 4OLVH 5IW6B 4NNXA 1X5FA 1BFTA 2Y25A 5HVHB 2GY7B 1OVZA 4PV9A 3EO9H 2CK2A 5TQ2H 3K8KA 2DQTL 3DBXA 1L7IH 3C6LD 3LQZA 5FB8B 5HD8D 5I8EB 3VXRB 5J9PB 3ZYIA 2X4TB 1CZ8L 5AD0A 1D9KC 4F8QA 3L9RA 4I3SL 4GRMB 1WTLA 4OD3H 1WTGT 3WJLC 4I4WB 3DXAD 4CN6A 5IT2L 4ZS6D 2BSTB 5C6WH 4PRHE 1I8IA 4S2SA 5EO1A 4K7FB 4JN1L 1Z3GL 2JCCE 5GZND 3T09A 1FV1A 2VDML 3LS5L 1GHFL 4YK4B 2NY6C 4YFDB 4CGTA 3O4LB 2GK2A 3QZWA 2OTPA 5CHNA 4L8SC 3MROA 1MNUH 3W9EA 3QXAB 5KTEL 5KSBF 1ACZA 3STLA 4MNQD 4LP4A 4F33B 2Z31D 5ICYA 4NKOB 1JJUA 1F2QA 4UT6H 2AK4B 5JIPA 1KJVB 1UB6B 3H9SA 4OFVA 1J11A 3NTCL 1NGXA 5DRNA 1JI2A 4P3DA 1WIUA 1HSAA 1R6VA 3LD8B 3RHWF 3HZMB 4PRAB 5AYUL 5L9DH 2NXYB 4QRTA 4BQ9A 4PJ7F 4O4YH 3RVWD 5IMKB 2B4CH 5EULV 1PJ9A 1UENA 3EOTH 1AGCA 1FDLH 1LWRA 3QEUA 2W60A 5D5MF 4P4KC 1BAFL 5F7LB 4X5WA 4LCIL 5C7XH 4NC0B 3S5LG 3EJJX 4PREB 3ECBB 1D5IL 4XCYB 4WHCA 1A4JA 2V9QA 3TT3H 3P9WB 4ZUUB 3IGAB 1JGUH 2H32H 2OQJA 4FFYL 1GGIL 4LGRB 2NXYC 4U1GB 4JFQB 3KYNB 4EN3A 4IEFB 4JRYE 3WO3B 2UWEB 4R0LC 3PP3H 3F7YA 3PNWA 3IXAA 2UUDK 2YPLE 5DR5H 2YPVH 4OZGA 2BHYA 2EC9U 3BGMB 1S5HB 4S1DC 3CX5K 3S37H 4NQVB 5I76B 5J6GB 4GKOA 1CF8H 2EDRA 5MENB 1A6PA 4MLIA 4HUNB 5IW1B 5B4MC 5FGBA 5DD6A 1DEEA 3U2SA 4JRXB 1VSCA 5B38B 1E4KC 4GW1A 3P0GB 4BH8A 4XNXL 2OTWB 3S7GA 4Y16C 1MFEH 2DBLL 4BM7A 2VXQH 4ZOEA 1ZEAL 3H0TA 5C0RH 2FHCA 2FIKB 2XZAH 1HH6B 3K2MC 4JRYB 4HX1A 5I19L 1B0GB 2YXMA 4G6KL 5I76A 3LEXA 1X4ZA 4PLOB 1I9RL 4LVHB 1ZT1B 5E03A 2N56A 3TV3L 3F65A 1NCCL 1IC1A 1RPQA 4KKAC 4APQD 1LO5A 4MB5A 2X9XA 3OGCA 4GKNB 5FOJA 4D9LL 1BPVA 5D1XC 3QA3A 4GAGH 2XTLA 1JHTB 5CAYB 2OQJB 1YQVL 1RZGA 3SE4C 2EXWD 5KSUA 1ZS8B 1ETZB 3QUKA 4EEEA 2WP3T 1FZMA 3K8MA 1A7RL 1ZWIA 4YJZL 4QWWD 3UTPE 3C8DA 1UEYA 2W38A 5HHOE 3U36A 4P9HC 5C9JA 5ISZB 1PG7X 2CLVA 1IGIL 3U9UA 1FNLA 1KFAH 1IM9B 3MLZL 1DBBH 4PJHF 3MLYH 4NDMA 2MKWA 1JWMA 3WFCL 2XV6B 2R1WA 4YBLC 4N9OB 5B8CC 2HH0H 4Z7NE 2H8PB 1EJOH 3E8UL 4HWEH 3D85A 4WW1B 3MO1A 4YO0B 2D7MA 1OL0A 1TZGH 4MQ7B 1CGSL 4U0RB 2O26U 1N2RA 5IB5B 4BK4A 2MMXA 4U1IB 4Y5YA 4IRSD 1V7NL 1E27A 2G60L 5DVMA 2ZP0T 1KGCE 4P4KD 1H3TA 5DDHA 1AI1L 1I1YB 3CFCH 5I8KL 3RPIA 4ORGA 3TO4D 4EKXA 5I1JL 4ONFH 1OAUL 1R3IH 5CZVH 2XA8L 1NL0H 2DB8A 4LCCC 2V5YA 1ED3A 1HSBA 5IB1A 5KTEH 1YPZE 3E6FB 5F1IA 3FB6B 4WI2A 4XNZC 5GRZA 3U0TA 5JOPE 3PHQA 3SKJH 2VLJB 3I9GL 1NCAH 4IIQB 3MJ9H 2IH3B 3BMVA 5I1GL 4LFHD 3RWGB 1KCUH 3QG6A 4OBRA 4PGCA 1NMBL 4TNVK 3VWJA 4OBSA 3O6FB 4LLWA 3TN0B 3TWCL 3TJEH 1AFVH 2D4DA 3MV11 2F74A 2AXFB 2QKIA 3WEXA 3NBNA 4UQ2A 1CXEA 2QR0B 3ULUF 3NIFE 1U3YA 1U2HA 3D85D 4NQDE 5IJKA 1Z9SA 4CJ0A 5E1AA 5C2BL 3EOTL 3QRGH 4HEME 2Q76A 2MWCA 1NFDA 2FEDC 3A6BL 1KXQE 3HB3D 3FQXA 5ERWB 3VW3L 3RVTD 3JWDL 1NC2B 1R5VB 1RJCA 3ARGA 3PWUB 5ADOL 4XC1L 3LZFH 4PJDE 4ACPA 4X6DB 5IGXL 2HVKB 3D1MC 4WNQA 3KPLA 5DMGC 4JVUA 3SKNA 2YPKB 3L3JB 4PRID 3RP1A 5E2UH 4WFHE 5C07B 3FOMB 1JZ2A 3RDTD 3RHWK 2X4PA 2VDKL 5FECB 3RWDB 5AAWA 4RNRA 1U3HB 1U58A 4HS8H 1H3WM 1FE8L 2ADGA 4KKBC 1MFEL 4FABH 2EDLA 3O2DA 4J12A 4MJ5B 2EDTA 1OOAA 1JWMB 1DQJA 1MCIA 5IEHA 4I3GA 3IT8D 4CADA 4Z7OE 1OARH 3DMMA 2RQ8A 3S3PA 2Z4QB 4KGLA 4UBDD 5J89A 4TOYL 4OLWL 5EU6B 4YPGA 1ZVHA 4KQ4L 4RMQA 5FDYA 4LRIC 4MQTB 3W2DL 1RFDL 3ZTNL 5MI0C 1AKJB 1Q9LA 1WUNT 2OK0L 5DUBA 3S88L 3TZVA 1ZMYA 4P2QB 2NY5C 3AB0B 4F57L 1SMOA 1IGFL 5J3HC 5KZCB 2YD8A 4PJAB 1A14H 3EJZD 1YEDB 1JRHI 3LHPH 4P3WA 3C09C 4XWGH 4ZNEE 1TZHB 2O93L 4HWBH 1JNHA 3OKKA 3UBXI 3BZEA 3DV4A 1TFHA 4FZEL 3VFGH 4ZSOA 4YDLC 2DMCA 3QIWA 1AGFB 5IBLD 2CXKA 3MLZH 2R2BB 4ZPVA 2R69L 3G5ZA 3MLYL 1JHKH 4OFYA 1TCRA 4ZODA 5IWLC 3PGDB 4X6DA 1F11B 4PP1C 3GSQA 2OL3B 2R0ZL 3EHBC 1TVBB 2EYSB 2ITDA 5DS8A 1JYXA 1I8KA 5T1MB 1MJ8L 2EZ0D 3VCLB 1OTTD 4P5TC 1H5BB 5F71A 1CU4L 4WWKD 2A9NL 1CGSH 1G9MH 5JW3L 2FRGP 4OCSL 3MRRB 5ALCL 3P9MA 2HT3D 3ET9F 1KB5H 5KSBB 3BN3B 3GMLA 3IXAB 5JMOC 2GY5A 1QACA 3H8NA 2ATPB 2Z31A 4UT7H 1P84J 3QEQB 3VFTA 3LRGA 2X5PA 4KZDL 5D6CA 4P2OA 1T83C 3I9GH 2IH3A 2W91A 1IGCH 4YX2L 2D0FA 3FB8A 4Y4FA 4HK3J 5GGQL 3QUMH 1SBSL 3UJIH 1NMBH 3JV0A 4KDTA 3FHQA 4JO2H 4R2GB 5GS2H 3EYQC 3KPNA 3MYZA 1D5BB 2NX5B 2W0PA 3GSWA 1FL3A 3BEWA 3UZVB 1NUGA 1BVKB 2FJFA 1N6UA 1UKQA 3NPSB 1A2YA 1D6VL 2N7AA 3PGDA 4GS7B 3ZHLA 4R4ND 5EWIH 3GSNB 1N2RB 1HOCA 2BCKB 3MQIA 4X6EB 1R0AH 3LY6A 2XXCB 2W9EL 4NCC1 4PFEA 3EGSA 2M8XA 1T7YA 3SJVE 5H35B 3RWFB 2YWZA 3K4ZA 5IFJA 2WAHA 1A02N 1NCUA 4XP9L 5DI8A 3GUTA 5LKNA 4KRPB 4Y2OA 4NZRL 4PLKD 2C4FU 4I0PD 3AXLB 5FHBH 1R3JB 3G6AA 1H3PH 1GZQB 4PJ5E 3DYPA 3KXFB 5E7BA 4KUCD 1A7NH 5I74C 2E7LC 1GOGA 4JZJA 1TTGA 5JXAL 5C9JB 3IAQA 1EEYB 4Y5XC 3V4PL 4YHLL 1W8OA 2WIIB 1A6TA 1PKQA 3PP4H 1PZUB 4PUBH 4OUUA 3P0VL 3JWOL 2XPGB 1T5WA 2EEAA 4ZYKB 4D9RD 1KGCD 1OW0C 2F58H 1T1YB 3RZCC 4PJFA 5EUOA 1GXEA 5DF0A 2J5LB 1FPTH 2XZCH 3GBNL 3KYMA 1UZ6F 3PWNB 4N8PA 2FHBA 3QCUH 1WFTA 4JHZA 2YSSA 5KW9L 1RIVH 1U8PB 2UYLA 4CNIA 5FV1L 3MLVL 3HMXA 3KPOA 4L3EA 4R90H 1QA9B 5EUKA 1M05A 1MY5A 5T1LD 3JXAA 4MQXC 1NCAL 4OZ4B 5D70L 1R5IB 4TTGA 3BH9B 4DKEH 4GKSB 5LAXA 5EB9A 2D0GA 4RMRA 4U6HA 1A8JH 4MJ6B 2D9CA 4FQJH 2B1AL 1U95A 2I60L 1NC2D 1EJ6A 2UY7A 4IOIB 3RZCD 4MXVF 1G9NH 2NTSP 4NO5B 5EC2B 4P2OD 4X80L 5LAXB 3MBXL 1CTNA 2UUDH 3X12B 2DOCA 4PY8J 4EDWH 3LKOA 4HJ0D 4K9EH 2OP4H 2ZOKB 4JM4H 4KMLB 1VADB 3AREB 4WV1C 5LBSL 1CK0L 3N85H 3S97C 5DGQA 4MAYA 5L2JB 4RGNE 3WXVH 4JM2B 3QEHB 5TE4H 3T2QA 1ZXQA 1OP5K 2IALA 1I7ZA 2XWTB 1KENL 3GBLA 4C56D 5IGXH 2Q86A 3QI9D 1T1YA 4ZOBA 2W59A 3DURA 4WFHD 2VIRB 4U6XA 1JZ4A 3R8QA 3VG0L 4PGCB 1X4YA 1TJHL 4LGPB 3NPZB 3GK8H 1C12A 3KLHD 5AYQA 4JFDB 4GRWF 1T80A 3NFPA 3N1GC 1MCFA 4R4NC 15C8H 4WI3A 1MQKL 4GRWE 4LCWB 5I66B 4JFXA 2HG5B 1T89C 4AT6A 43CAB 1W72A 1BMGA 1KV3A 1TIUA 4QRUB 1YN6B 3QG7L 1QEWA 3CD4A 4ZXBD 4Y5YB 2R23B 5DVKA 2K7QA 2VZ3A 4JO2L 3WIFA 3PWPB 4KQ4H 4TUJB 3JUZA 1A7PH 2MJWA 2E7MA 2M2DA 5DJXA 3D85B 1YN6A 3CXHK 3VXSE 4R8WL 2A6KB 4HJGA 3VDBA 2WWKO 1UB5B 1A7BA 2BNQD 2CLZA 4XMPL 5I66A 2VDPL 3RDTC 1EO7A 1G7HB 3Q6GL 2EKJA 5EWIL 3OX8A 5A43C 2HTLD 4JO3L 5EO1B 4TVPL 4N8CL 4RISL 1EFXB 5CLTA 1ZT7B 2FJHA 3LKNA 1WBZB 1I3VA 2OTUA 1SJHB 2C3HA 3WXWL 2GSGA 1FVEB 1GCFA 4U49A 3DVGB 1J5OL 5EA0H 1VGKA 5CBAA 2XA3A 3FRUA 4LVHC 5FKAA 4X9HA 2B5IC 4YFLF 3HCVB 3AMLA 3ROLA 4I9WD 1PSKL 1SJVA 1MY7A 4IOFC 3BEVB 4TNVF 1I3UA 3B2UC 3B5TA 3S6CA 5T3XL 1KLGB 3L6FA 1NGPH 3GIZL 1F6FB 2W0KA 4YGVB 3PIQA 4U7SA 3UPRA 3X3FH 1KT2A 4HBQA 4JR9L 5IF0B 5LVEA 2HLFC 2A6IB 4CMHB 4QCIA 2LVEA 1JIBA 5DLML 4R4FH 3MX0A 3P0VH 4G8FA 4QHUA 4U1SA 4KMTL 3WJLA 2B8OT 2EIBA 1RURH 4HMEA 3V4VH 2FLRT 2ICEB 4LLDB 1ZLWH 3CDGB 5F72S 4LL9A 4MLSA 3FN0L 2B20A 1X5YA 1YNKH 2HT4D 3OL2A 3WYRA 1NAKL 4CDGC 4X4YB 1VERA 3MGTB 3KLDA 5LQBL 1CDIA 4WFED 2OR8A 2GCYA 3THMH 4MCZA 1UZ8A 4XBGA 2ZSWB 2BVQA 4GAJL 2DM3A 4YC2C 5TFSH 2CRIA 4UMGA 3C6SB 2IWGA 3W11D 4PLJC 4OTXH 1V3JA 2PO6C 1YNLH 3V6OC 4MZ3A 5DEFB 3ARZA 3BKJH 1MI5D 1J1OH 1KJ2B 2OJZH 1BF2A 4KUCF 5BRZE 2DTMH 3RWEA 4NOFA 1D5MB 4MA8L 4PJXA 3BD3A 3BQUC 4JJ5B 3VH8B 5CIPH 1S5HA 3VFWB 3EFDH 2D7NA 1P7QB 4BELD 5I1HL 3HUJA 3G5YA 3DX7B 3RIAK 1JCKA 2A6IA 5JA8B 2B0SL 2O61A 3UTOA 5B39G 5T1KD 4IRSB 4WTZA 4XGZA 5F96H 5F6HJ 4R97B 3RPKA 3RTQC 1F2XK 5BZDA 1PYWA 1TTFA 3L3HB 4M8VA 5E70A 2BNQB 1R0AL 3SDDB 3G6DH 4P4KA 4XPGH 5DUMH 1D9KA 3SQOH 4R4BA 3GHEH 3M8OH 3SQBA 4BSVB 4NQXB 5D8JL 3J8F7 4IRSA 4JM2F 4EQ3A 4N8VA 3DUUA 12E8H 1MFBH 4XP9H 3SGEH 4JQXC 1EFXD 1ZKAA 4MB3A 4CVUA 5C9KA 1GGCH 4X98A 3EO1B 3OR6B 5FAAA 4NZTL 1CQKA 4L3ED 4JB9L 4QNPF 2ZNWA 4M93B 1MEXH 3U0PA 3GRWA 4G8GD 2Q20A 3HG1E 1OP9A 1KJVA 4LEOB 5GZNC 4H88L 1IBGH 1A6WH 1OAKL 1WF5A 3L3GB 3VFVB 5DHVB 4S0TD 1KJ2A 3G5VA 4TUJA 3QEQD 3QXAA 4G6AD 4LEOA 5C0CB 3DX6B 4LQFH 4LDLB 4KUZL 5AUMB 4K8RD 2RB8A 2RIKA 35C8H 4H26B 3MRBA 2ZSWA 1YMMA 2Y36L 2E27L 4DKFH 3GBNH 4LCWA 2HMID 4OZIB 3B2UD 5AWNH 3CX5J 1SEBA 3BPOC 3O3AA 2A0LD 3DETC 4JFDA 1AHWA 4OT1H 1S9WA 2K9UA 2FJGA 3AC0A 3BVNA 4PP1D 5IHBA 1QVOB 2JK5A 3DURB 4OCRH 5AD0B 4JO3H 2EDDA 1KLGA 4Z95L 3SE3A 1AGDB 3G6JE 1O7VA 1FRGH 2O61B 1IAMA 3GBMH 3N9GL 5JW4Q 3DRQB 4FQJL 4S0SD 1L6ZA 1QLFB 5L9DL 4YHZH 1NMAH 3F7RA 1P7QD 4U31A 5IB4A 4PG9B 1FNGA 4GW5A 3DVNA 4TNWF 3V6OE 2HFEB 4M3KB 4P57B 3FQUA 5E8PB 3DGCR 1DN0A 3SY0B 4RA0C 1FLRH 4JAMB 3DVGA 1NFDF 3FMGH 4OFIA 1Q0YH 3U0TB 3OXRB 1KB5A 1RVFL 1VFOA 4I5BB 3MLWL 4M62L 4NJ9H 1NGPL 2DM7A 4J3UA 4ALAL 5IV2A 4TVPE 2PW1B 4OF0A 3LD8C 3BKCL 3TIEA 4NQCA 1AO7B 4LSTL 4R7DB 3UTZB 4HJGB 5JORA 1HI6B 5IMMA 3K4AA 2BRQA 1E4KA 2B1HH 3QDME 3HMXH 2VABB 3DV4B 4PBVC 3ZKQD 2FH6A 3O3UN 5ANME 5H94A 4XB7A 4FQLH 1MQ8A 3MO1B 4U1SB 4YO0A 3ARDB 1I1FA 2AV1A 4NPYB 4XCEA 4YHNB 1BWWA 5E4EC 4PJIE 5ETUB 4CVZA 4MDJA 3DX9A 3QFDA 2XRAL 5FO9B 5FGCE 1BGXH 2WINB 4JZOA 4LLVB 3L3OB 1ZOXA 5DO2C 1T1ZA 4W4OA 5GGTH 3QG7H 4QXWA 5KBNC 1LQSR 2I25N 3ULVF 2XPGA 1NC4D 3FB5B 3MJ8B 1YUHB 5DURB 3REWA 1IGYA 2OZ4A 1BFOA 4G6KH 3SE8H 4HKBA 5I0ZA 4Y19A 4N9GA 2OL3L 1B6DA 1WAAA 2OS7A 1ODAA 4DFIA 3P77B 5K93A 1URLA 5D1QB 4ZUSA 1FZJA 2CLZB 4FTVD 4OCNC 4UZGA 4N1HB 4X6BB 3OAYH 3L1OH 3A0OA 1HNGA 2PTVA 3G6DL 1J1PL 1JN6B 2YBRB 5J6HB 4PJCA 4DTGH 1M71A 5HD8C 1A4KB 1MSPA 1M6OA 4V2BA 3B9VA 4XPHL 1F00I 1JRHL 3MRPB 4Z78A 5DK0B 1W72B 5TF1H 43CAA 4I77H 1WCBB 4FQIL 3QDMD 3JUYA 2FEEL 1F45A 1EEZB 1IEAA 1RUAH 3EOBA 4NN6B 5DQ9A 2NX5D 3U46B 3BEWB 1EA9C 1J8KA 2DLTA 2NY4C 4TUKH 5F9OL 1K4DB 3DIFB 1AQDA 4F7MB 4XCCL 1DN0B 3SY0A 4TSBH 3B3IB 3QIBD 4HKJB 5HI5C 5J7CC 2YSSB 1YNKL 4BJLA 3NCCB 1OAXH 5D7JB 1QSVA 1QLRA 1OTSC 4I8DA 5LGHL 4HF5L 1PLGH 1HHGB 2RFXA 5L2JA 4Y4HB 3ALXA 1Z9MA 1S9KC 1G7JA 1C1EL 3F7QA 4OT1L 2NNAB 4PBXA 1K3ZA 3VXNB 5DJZB 1JF1B 2HT2C 4X7SL 4PRPE 1MIEH 3P9MB 2J4WH 3HZKB 4KKCC 2YN3A 3VFUA 5FYLE 5DSCA 5EC2A 5ACZB 3IDGA 4TRPL 5D7IB 1NDMB 2ITDB 1QNZL 3MOAH 5DS8B 3C60C 3MBEB 1BVLA 1KCRL 1ZTXH 4LFHG 2VDRH 1IC4H 1A21A 3BH9A 5C0CA 5J8OA 1XF1A 2DL2A 3H42H 3MFGB 3FMGL 1IQWL 1PG7W 3QRGL 5L2KE 4KVCH 1CS6A 5I75B 2PTTB 1YEGH 2NY0B 1ZHNA 3I6GB 4HUKB 4OKVA 5DHXB 5EZIL 4CNIB 4ALAH 1OAYH 3O4LA 4L8BB 1UH4A 5D8JH 5CEYB 1BJMA 1Q9OA 2ZCHH 2YD1A 2ZSVA 1Q9WB 3TPKA 3W5NA 1EHXA 3GJFH 4YDKH 4YXKH 3X11A 4K7FA 4PJHA 3RWIA 5I30L 1I8MB 5DTFA 1TTUA 5ESVA 3RKPA 2XQBL 2VDOL 4WUKH 1NANI 4X4ME 1DBAH 5ALBH 5JUEL 4QRRA 5CJBA 4HIEB 2KPNA 1KEGL 5EU3B 1OAKH 1WIPA 2NYYD 1Q9KB 2ENSA 3S34L 5C09D 4ZFOL 4EBQL 2UZIH 3KJ6L 2NCMA 3GJEA 3C5JA 5DT1L 2DQCH 3KXFA 4XCNB 4AL8L 5IMLA 3G6AB 3HUJF 3NA4A 4HG4J 1QBBA 4R0LB 3IRPX 5HYQB 3VWKA 4PLKC 3GO1H 3G6JA 4M7JL 4YDVB 5AWNL 1B4RA 2BJMH 3SE8L 4OLWH 4HV8A 5DEGB 3CFJB 4Z76A 3VJ6A 5D2NE 1BEYH 3B83A 3MV9A 4JQVC 4MSWB 4XH2B 2J12B 1MCWW 4XXCC 1J05B 3V7MA 2IMMA 3C6SA 2OTWA 4O51A 4FQQA 1G7IB 4LSQH 1INQB 4PJDF 5IG7A 1UM4L 3QIBC 1WGOA 8CGTA 4ELMB 1H0DA 1HK6A 3RL1B 5JTWA 3FT3A 1N5AA 4X9GA 4NZUH 4MVBD 4ZSOB 5DC0A 1CLOH 3ZT7A 4JZNB 2X6MA 3D3VB 3IFLL 1BHGA 4L8SB 5C08A 2HWZH 1KJ2L 1MWAH 1KB9J 3F6IA 5J1AA 5TF1L 2Q6WA 4FZEH 4GG6F 3P4MA 4JM2C 3MLRL 3UX9B 3TNNB 5JDSA 3RIFK 1IGJA 3QIUD 2FBOJ 4DN4H 3JSSA 4WFGD 3TBSB 4Q0XH 3NA9L 3TVMA 3MJ6A 3HPJB 4ONHB 2F54E 1AKJA 1S9XA 2ZWLT 1RY7B 2H32A 4L4TD 4TSBL 4UINL 3EYVA 1XGRA 1EPFA 3FRUB 3V5HA 3QG6B 1AGCB 3HMXL 3MGAA 1C8PA 2NTFA 3FO0L 1KB5L 2EE6A 1I8KB 1NBZB 3BOVA 3H3KA 4YHKH 2RFXB 4Q58C 2YEZB 1CR9H 4P3DB 2DDQL 4PGBB 1DL7L 1HIMH 2PR4H 1MRCL 1JYWA 1T20B 4I9WE 2X4QB 5GHWL 4KZDH 1FGNL 5CD5D 1N59A 1WC7B 4HQQL 4JVWA 3OPZH 1MRFH 3RU8H 3STLB 1A47A 4NQTA 3T2PA 4DN3L 1B4JH 5F7NC 2VLKD 1N59B 4QRUA 3B5GA 4OLYH 1S7QA 5DQ9B 4G42B 4RGOH 3ARBA 4M1CD 3BGAA 3ULUH 4JGUA 5I6XB 5KSAA 1T03H 1P6AB 4NDMB 2Y5TB 1IM9A 1IQWH 1X5KA 4YWGL 1D6VH 1TQCB 3LIZL 5GRVK 3DHMA 2UWEF 5F88B 5ESQB 4HG4K 1VHPA 5CILH 3OKNB 4J1UA 4YH6A 2VDQL 2W9EH 5IBUG 3V79C 1OAYL 1NFDB 1J0IA 1YA5A 3GMOB 1R5WB 4EDXB 5EO0A 1BVZA 2Y6SD 4GMSL 1ETZA 1CD1B 5IEHB 2E6JA 1CD9B 5HI5D 3NABL 4YE4H 5E2TH 2X1OA 3EYSH 1S7VA 5ITFA 4I2XA 1DE4A 4H0HB 2XQBH 3GEWB 3RWDA 3LV3B 3RZCA 4C56E 2V2TA 4HFUL 5GQBA 5DD1L 4NUGL 3ZL4H 4PRDB 5BXFB 1K2DB 5F9OH 4ZNEA 4C57C 3E6FA 1IAIL 3S34H 4I3RH 5CWSA 2X1QA 4HS6B 5DT1H 3LKRB 5K9JH 5CGMA 2J8UE 4PJ8D 5JMRA 4OLZH 3SDDD 1YY9D 1G7QA 3UBXG 2P7TB 5HDBF 1FPTL 4FOMA 3UTTD 2BVEA 4BH8B 1MI5E 4HF5H 4KK8C 3F58H 5GZOC 5C92A 1GHFH 2R9HC 5C1MB 1RIVL 5DVOA 1JZ3A 3GHBL 4YPJA 3MLTB 2FATH 5F7MC 4E5XB 5SWSA 5D1QD 3NCFB 5F8RC 1KIPB 1Y0LA 4R0LA 1NEZA 4LSQL 1DQDH 2QR0A 4HIJB 4X99A 2EO9A 3TIEB 3VI3E 2JCCA 4NQEB 3LDBB 5INCB 3ZO0A 3ZZ1A 4OLUL 2O5YH 1UA6H 1V3MA 5F3HB 1V7MH 1T5WB 2R56L 3G5XA 4K7PY 1MWAL 3ETBF 4QKXB 4GRWH 1SM3L 3QHZH 4DEPB 5C0BB 1I7RA 3KPQA 5BVJA 1T21B 2BC4B 5AZEH 2XWBB 4HIXH 3QUYB 4M9OA 3B2VH 4KVNH 2OMBA 1XCTA 1CK0H 4M93C 5CEZL 3FB7A 1P4LA 3T0ED 1V05A 4LNVA 1Q9OB 2H2PC 5E6ZA 3VFRA 3SGKA 3Q1SL 1E27B 4X8JB 4YDKL 2FGZA 5D7LD 4PRNA 1ND0A 3HZYA 3TM6A 4J8RB 4GRLD 3FO0H 3TBVB 3UC0H 4WW1A 3TF7C 4K55A 4Y5VA 2EDBA 3SJVA 2VKWA 2XN9A 1KN2H 1NUFA 4PJIB 1IGMH 1X44A 3RNQA 3BXNB 3QULB 4C59B 3MJ7A 4D2NA 3GKZA 5EZOH 5BVPH 2HKFL 3BXNA 3ULUC 1IGTA 3I75A 5IW1A 2F8XC 3KAAA 5I9QB 3GSRA 1OP3K 1RJYB 3MNWB 4HKZA 4ISVB 1IAIM 2VOTA 3QQ9C 3I3BA 1RK0A 4AH2A 1P69B 4LPTA 3LS4H 1BLNA 1B4JL 1B90A 1INEH 5DHVA 4DGVL 4DKAA 3CX2A 5FYKU 3W11C 2DBJA 5A3IC 5I19H 3T3ME 4GG8B 3NACH 1JWUB 4EN3B 5I71C 2QQNH 4LSRL 3VFTB 4HK3N 4IJ3B 4ZUUA 2ZKHH 5KVGL 3T08A 3LIZH 1RJZB 1U91B 1C7SA 4IOFD 4ZG1A 5CILL 5FGCB 1YEFL 5FA4B 1CYGA 2EDYA 3TYFA 3WFHA 5IMOA 3RGVA 4XVJH 2XKNB 2ATKB 4XNUH 3T0EA 1UWXH 2KQNA 1YY8A 3PHOB 4EI6B 2DQIL 2X41A 4ZFFA 1OLLA 5AAMA 4JRYD 1EEZA 1F11A 5J1SC 3X14A 2BSED 5D1QC 5IHUL 4YXHL 2ADFH 1JPFA 2VITB 4OIIH 5AZ2L 1WICA 2Q3AA 2O5ZH 4KY1L 4GMTH 5DLMH 4JFZL 1A3RL 3BZEB 4OLEA 4Z7QE 1D5MA 2FLBT 4XX1E 3ZDYE 4P46D 5DRZA 5E2JA 1MRDH 3BFOA 4OV5A 1B0RB 2J8OA 1CFSA 4LOUD 1JPGA 1FH5H 3KHQA 1FNEB 4HLJA 5D7LB 4EN3C 4H8WC 4KC3B 1AE6L 3BIAX 1UZ8B 5TE6L 1SQ2N 3PWVB 3DMMD 2PCPB 4WHTA 1CFBA 1RU9H 2OSLB 3LKSA 4BQ8A 1D3CA 3HG1B 1JZ5A 5TPWH 1OLZA 2F53D 1CDHA 2EDJA 1B6UA 4PB0H 1JK8A 5KOMC 5EU6A 4RAUB 4JDTH 3JZ7A 2XWJB 1J86A 4CVWA 4KK6C 1Q0XH 4HKXA 3RWHB 1IILE 2CK0L 4M6AA 5F1KC 3S9DB 2VE6A 4OLYL 4ODWA 1K8DA 2XN9E 5FO9A 4IRSC 4PRIA 1CICC 3QJHA 1QLEH 3K1DA 4JQXA 4LSUH 4WTWA 5DRXA 1WAAF 1T03L 3UTSD 3OZ9L 3ARYA 5KJRH 1B2WL 3NZHL 4ZS7H 5EBLB 2D2OA 3BQUB 2YMXH 4JLRA 2CMRH 4MS8C 2FO4A 2R2HA 2ZUVA 4FQCL 2B2XL 2R4RH 1H3GA 4AYFA 4XCFH 1NKOA 3QUZC 2QQKL 3UROR 1ORSA 3CFIC 5JPNA 5CEZH 5KSVB 1HWHB 4LU5L 2YPLA 3PGFL 3HHRB 4DOHB 4PYGA 1GGCL 3BYTA 4WFFE 1FNEA 4PG2C 2ARJA 4EUPH 4GQ9L 3QB7C 1ORSB 5IFAL 4NHCH 3R06B 1T2QL 4ETYA 2FEEI 2FO4B 3AM8C 4BFBD 3UTTB 1DTUA 4GRMA 3KPPB 5INDB 1OY3B 4KROC 4X0KA 4OQ1A 2D7OA 1OB1A 3MNZB 1OTUD 1T7VA 5DQJB 1CT8A 1T1WB 1W0VB 4M7ZB 1FE8H 3NAAL 2AXFA 3WNNA 2CR3A 4B7IA 4KV5F 3F6LA 3A6OA 5HHNA 1T6VN 5FYJD 1BD2E 3CFBA 4PJ8C 1MCOL 4JQIH 2NXZC 2GSIB 4TOYH 4B50A 2A2QT 1EXUA 4UDUA 2YK1L 1OP3H 2HTLC 5D72L 5CSBA 3EYVB 4I13B 4AY0A 2OZ4H 1VEMA 3G6JF 1ZLVK 1IL1A 3QCVL 1T3FB 3DSNA 1AJ7H 1HHHB 1T1WA 1W0VA 5BMFH 2LV4A 5L8JB 4KZEL 3A6CL 5J13C 2X09A 1LD9A 4MS8D 3DUSB 5DD3L 1AD9A 3PL6B 4F57H 3OKOB 3TNNA 1K4CB 2ZOLB 4XNUL 2VQTA 4NQCE 2Q6WB 5J1AB 2ZOKA 2CRZA 1CICD 4LBEA 4M7KH 3VRLE 3ES6A 1Y6KR 4QGTA 5GRUH 1CFNA 1DQML 1A9EA 2AV7A 2PUQT 3PXJA 1A6AA 2IPTL 5TJWK 5JA9A 1BQLH 4KJWD 1G0XA 4NO5A 4H5SB 3KLAA 1C16B 3IF1A 2DWDA 5B39A 3CFKB 2KZWA 4M62H 3QNYA 5H37H 2BERA 4FNLH 5C08D 4A6YL 3WO4C 3PWPE 1R3LA 2PYFB 3TN0D 2GJ6A 5D2NC 5EPMB 4Y5VB 3F5WB 1TZIB 1GRWA 2A73A 4XBEL 1CU4H 2IGFL 3RUGE 1BM3L 4YDVA 4PRNB 1JZ6A 5ALCH 3QUKB 3TESA 5KSUB 5C0DB 3LVEA 1FFNA 4LPCA 2BK8A 4XP5H 1DBJL 4UBDC 2IAND 4MD0B 4F3FB 1UQSA 5KVDH 4RBPK 2CIIA 3KHOA 1XF4B 4YC2B 2Q87A 3MV7D 3MR9A 1ITBB 1BJ1J 2VR5A 1N0LA 2YUZA 4RAUA 1MJUL 5C0BA 5DYOB 1CCZA 4X7DC 3BDYL 4GG8A 1NBYB 4OB5H 3U9PL 2H6PB 4K94C 3HG1A 1AGEB 4UV4L 5DEZA 4JPKL 2BZDA 3DTXA 1QHOA 2R1XA 5IVZB 4DGIL 4L8DA 5FK9B 3KPMB 4W70A 3WDHA 1QLEL 1C08A 3NOIA 2CO6B 3LMJL 1DANU 1QQDB 1UWEH 4P9HH 3VXOA 2OXGA 2ZKHL 2FB4H 5T33L 1HKLH 3VXPA 1OW0A 5HDBE 3T65B 2DD8L 2CGRH 4KHTL 3C2AH 4UDTA 2A77H 2GK0B 4JY4B 3MREB 2BVPA 2X4NA 1X5HA 4BQ6A 1JE6A 4JCMA 4OIAA 5MENE 4OI9A 3QWRD 3AFLA 1NLBL 1NBVL 5DHYA 1WITA 4M1DH 2LAAA 1SEQL 1C5BL 2FX7L 4ZXBC 3P30L 4XAWL 5HGHB 1VFBA 4O2EB 4FQIH 3ILPB 3GNML 4OAWA 5IJVB 4YXHH 5ACZA 5DJCB 3VI3F 3RFZC 3FFCE 1T5XA 4KAQL 5AZ2H 4NC1E 3V4PH 2P47B 3L3DB 1VB9A 3EJZC 5CBAB 5HVHC 5BOPA 2O5ZL 2YPLD 4KY1H 3TYFB 5A2KH 1T5XB 3MNVB 2HFGH 2HA1A 1KXVC 3MLPA 1X5IA 1XGUB 5D5MB 1EAPB 1KCSH 3OKYA 2IPKA 3WMSA 5JDJA 1NAML 1A3LL 1FH5L 5DRNB 4ONOA 4LCCB 4X99B 1CGVA 1CXFA 3FT4B 1Q38A 2IFFH 4DCQB 1U93B 2X4NB 3R0MA 4PJGF 5IVXF 1DLHA 1BLNB 4PJBB 4MAYC 3ZTJG 5F6IC 1X7QB 3O3EA 2GJ6E 1IC7L 4J1UB 5DD5L 2PXYB 4PB0L 3VXPB 5CIPA 1MH5A 3V5KB 5JPMA 2VLJD 2BRRH 1E0OB 1DBMH 2KH2B 2CK0H 2P7TA 3SPVA 3BD5A 4OGZA 4PJIA 2L7UA 2Z8VC 3MRKA 2B1AH 4ODXA 4NNPL 1ZTXL 3EFFB 1WBXA 5IBTL 2XI9A 4NWUH 4PJ7E 4KJQD 3U6RA 1M6OB 1ND0B 4XC3L 4Z8FL 1WFUA 4G80A 3S96B 4Z5RA 3ZYOA 5E56A 5EBLA 3Q6FB 4OSUL 5DFWH 2CUHA 5T1LB 4D94A 2JJTC 1NH6A 4PGBA 4M7LT 4JFEE 2ZCHL 1OGAE 5GS1C 1DR9A 5MP6L 1OT1A 2ZPKL 4G8IA 1CBVH 3L7EB 1JGDB 4LGSB 4Y16D 3MRCB 5CKAA 2XWJA 2AJUH 2ESVD 1BFOB 5L8LB 2XKUA 3CFDB 4NNYA 3LKOB 1G7LB 3VXME 3CH1B 1MFCH 4QEGA 2K3TA 4XP5L 1TJHH 3VDCA 4Z7WA 4N0YL 3BN9C 3GK8L 4RDQG 1K3IA 5KVDL 4HMCA 3L3OA 3GDBA 3PGCA 3B9KA 4JZOB 3NCJH 4E0RB 3KPRB 1ONQB 3LEYH 3MACL 2ICWJ 2A6DB 1IAII 2F53B 1MQKH 4PJEE 1TJIH 4U6HB 4XXCA 4Q97A 2EIZA 2EE9A 4WV1A 4E42B 1A1MA 4IRJD 4G42A 4OV5B 4OF5A 4UV4H 4N0FA 4AENB 4DUXA 3HA0A 3IU4L 4QXGL 5ELIA 1AO7E 2HTKD 4UU9B 2BJML 4MVBC 3RX8A 5HHMB 2EYTA 1A7PL 3QDGE 2GITA 3ARXA 3KPLB 3UTSE 1NGZB 2AEWA 3KPRA 2QLVB 1UJTA 1CICB 4JG1L 4KI5C 4OCWH 4NO3A 1T3FA 4QOKA 2H41A 4U1GC 1UM4H 4NQDD 4HUMB 5DD3H 5FYKE 4J3VA 2APFA 2EDXA 5A1AA 3VA2C 2JTDA 1K2DA 5E8OB 4RQQA 1RUQL 4I0CC 3G6JB 3WN5B 3MRLA 4GFTB 3QXVA 4QTHA 1A64A 4HIHB 4LAQL 3PWPD 1PSKH 4V1DA 4D0BB 2IAMA 2DI7A 3FONA 4RAVB 4M8QB 1IKNA 3CZFB 4MXQC 5CJ8A 1MCHA 3WKMH 4KKAD 1IQDB 4IRJA 4JO1L 3MRIB 5GRJL 4ZUTB 4YEFA 2XTJE 1CG9A 5A2JH 5JDSB 1FAIL 2YUVA 4DQOH 4YHIA 3GMRA 4JKPL 5F7HA 1RUPH 4Z7NF 3FO2B 3QQNA 4JDZB 2CDEB 5ID0A 3L5WA 2YKLH 3U1SL 3IU3B 5K9OA 1KN4H 4Q9BA 2G75A 1I8LC 5CZXC 3CVIL 5F7WC 3RL1A 4ELMA 4Y16B 1HCFX 3QUXC 4XHQA 2C1OA 1P4BL 5E9DD 3FQNA 4CU8A 3VFPB 4JFEA 3BW9B 2G75B 5AG9A 2PXYA 4L29B 3SO3B 3MPCA 2HAZA 1JPST 2NY1D 3GMQB 1GL4B 4WHDA 4ODTL 3H9YA 1A7QH 1CDBA 4ERSL 1UG9A 4BZ2L 5SWSD 4Y8AA 4PJ5B 5E4EB 2CJUL 3RWJA 1T89A 4L1HA 1JPSL 3QEQA 4NNPH 3WNPA 1UEMA 4LASH 4OD2B 4ELMF 3ESVF 5D71H 3KPTA 1UKTA 2XWBA 2GT9A 3LB6C 4FFZH 2BNRD 5TDPA 4XC3H 4ZPTA 4YWGH 4PB9H 4L8CA 4PS4L 4RX4D 4FFVD 2MCG1 2Q8AH 1BD2A 1A7OH 4NN7B 1A6ZB 2NXYD 4ZFGH 2FCBA 4AEHH 1N0XL 1T22A 4KQ3L 1PBYA 1I8MA 3RWIB 3INUH 3OJMB 1GAFL 5F3HA 4D0CA 4QRPB 5DD0H 2CKBB 3SGDI 3I6LD 3TBTB 5TH2A 5KS9F 1RI8A 1JPGB 4XAWH 2CXGA 2VXTH 3WHE1 3DXAE 1N6VA 5DA4A 3KS0H 5IESH 3CSGA 5SWZB 3KNBA 1Y0LB 4Y4HC 2WP3O 3GZKA 3ILQD 4HFUH 2A83B 3T0BA 2MNUA 4NUGH 3ZL4L 4JHWH 2ED7A 1N5AB 2F54D 2DJSA 3E2HC 1FG9C 4M1CC 4L4JA 3RIFF 1TLKA 3LSOB 2GJZB 2NY4D 2BHZA 3NCJL 2X89D 3QEGH 3U46A 1JVKA 4GG6E 3EYFB 2YOCA 4P23D 2IQ9H 4Z18A 2YD5A 4X83A 3NFSL 1QFUH 3C08L 1NDMA 1S3KL 3O2VH 5KSBE 5CWSB 1MFDH 1K85A 2DAVA 4CMMA 1VACA 2E8ZA 1OQOA 3REVB 3K80A 4L8CB 5JNYB 3LAFA 1G7PA 2FATL 3F7YB 3MRCA 1EEUA 1BJ8A 3FQRB 5C0JB 2D7PA 3U82B 3WBDA 4I2XB 3LDBC 1AXSA 2VXVH 2A1WL 1M4KA 5HHVH 1UKSA 2J7LA 3OR7B 3V6OA 4YGAB 4JKMA 5K9QG 1W0WA 1CI5A 1MCNA 5E2VH 1RIUH 4OLUH 5CJOH 3O11A 1J1XH 5I1IL 2R29H 4XPAL 4DWHA 3B5HA 3SGKC 1G1YA 4G6FD 4P4RB 5IMKA 3GSRB 4WWKC 3C5ZC 1NKRA 3VXQA 3I75B 3H3PL 4RSVA 1KEML 3HFML 5DMKA 1KTKE 3BWAA 3MTRA 1S8DB 4CN4A 3ZSTA 5EIQA 3G04A 3HS0B 1E6JH 4IMKC 5EBMB 5KN5A 1JYVA 1WSST 3HAEA 4OKVB 1UB5A 4XCEB 4YHNA 3WSQL 4MMZC 4U4BA 2JJWA 5ID0B 3TBVA 2FYYB 2C3VA 3W0WA 1XR9B 5C0AD 1A5FL 1HXYB 3GSXA 2FR4B 3QI9B 3F62A 1OP5H 5EZLB 4YHYC 3CVIH 1T0MA 4F7CA 2F15A 4R3SA 3VGGA 3NCYP 5CD3B 2YD7A 4HWBA 1KN2L 4P46A 5JHDB 3RL2A 1AO7A 4I48A 1RZIB 4J4PA 1HHHA 3D69B 3P77A 3CLFH 3RRQA 1OGTA 3MACH 1JGEB 5ENWB 4OUOA 5JW4N 5JZ7C 5MEND 1NCDL 3PWJA 2AJYH 5C07E 1PQZA 3FQTB 3MRMA 1AO7D 3QI9C 4LRIA 1QBML 5F1IB 4AIOA 2H45A 3V0AC 3VMPA 1NGQH 4HC1L 3JBG7 5HHNB 2DLEA 5D2LE 4JREB 1T1ZB 3NACL 3IXTA 5GSRB 5J13B 1I1AB 2IC2A 4NO3B 4PJ9C 4I48B 3RL2B 1CT8B 5D2LF 2X70B 3W9DB 2IFGA 4HH9B 4GG6A 4OF8A 5JO5B 4M48L 3RVVD 1ZHLB 1N7MH 4FZ8H 4Y2DA 5EZLA 5I16A 3MCLH 3RBSA 2AV1B 4NPYA 1FN4A 2WZPD 1CWVA 1I9IH 1AQDB 4F7MA 1J1PH 4ELKB 4DK6A 3O3AB 3QIWC 1CFTB 5T1DH 2DQHH 1RUQH 4W4OC 5CSZA 3T65A 2R1YA 4XPHH 3SKMA 4GXVL 5DJAA 4C54A 3WUWA 1ZHKB 4HS3A 1U2CA 1QQDA 5JPNB 5DK0A 4Y0GA 4P99A 1J10A 2FWOA 3DXAB 3U9UB 1MCEA 4PJ9D 2ADFL 3KVQA 5IBLC 5A2IH 2VQ1B 4YUEL 1R24B 4ZOCA 5GRJH 1CE1H 4LIQH 5J6HA 1DBKL 3TH3T 1YEKL 4OZHF 3BPNB 3O9WC 4Q9QH 4P23C 4NCDA 1LO2L 4XCCH 4K23L 1EAJA 3P3YA 5E99L 3OKEA 4PJ7A 3RNKA 4D9QE 4M5ZL 3HRZB 2GUOB 1TPXB 2QSVA 1U8PA 3T2NL 1B88A 1P2CB 3D0VA 3QDJD 2AERT 1EHLL 4WHYG 3MA9L 4DK3A 3C8KB 1KTDA 4G43A 3ARFA 1WIOA 2JB5H 3D2UA 3ILQC 3KPSA 4LPXA 4NO2A 4M6OH 2QEJA 5EO0B 4EXPX 5ILTL 3TA3A 1AE6H 3WFDL 3BIKB 3QUMB 5HHMD 3RTQB 3QO1A 1G9MC 1YUHA 2FGWL 1BBDH 4QY8B 1E6OH 5E24E 1TNMA 3GJFA 1T6WA 3EAKA 3CPLA 2VN7A 3SDAD 4MJID 1WISA 3P40A 3UMTA 4ERSH 2YRPA 4OI7A 2RBLA 3BD4A 3IFOB 4CW1A 2ARWA 1QNZH 3MOAL 4CBPA 2DQJL 2P44B 1GZQA 2BVOA 5J11C 5EIIA 1QBLH 3C5ZD 5H94B 2HLAA 4X6FA 3S4SG 3OZ9H 2MFNA 4NN7C 1OAZH 4AEIL 4UIMA 4ZS7L 4M7LL 4OZGB 1VCAA 2PN5A 5MHSE 3T3PE 1BIIA 2YD6A 1KEMH 2FIRT 2ORBH 4PY7B 2K7PA 4ZFGL 2R4RL 3T0DA 3GFUA 5TDNA 1BZ7A 1IAOA 2R0WL 4WHYH 3TBTA 2XTJD 4MJ4A 3Q5YA 2JLLA 5SWQA 5C8JA 4OJFL 1TPXC 3EYQD 3HAEH 1IC5H 2IPKB 3D39E 3QISA 4XVTL 4O9HH 1I3RA 4JQVA 5GISH 2JJSC 3BHBB 1X5LA 4PIRF 4YFEA 4X5WB 1MCBA 5DJ6A 5EC1B 1LVEA 5T3XD 4ZUWB 3O41A 1AXTL 1XGRB 4L1DA 5I73C 2G9HA 4PJ8A 4MJ2A 3ABZA 5DGRA 3NZ8A 4RGMB 5JQ6L 1Q72H 4LCWE 5GJTL 4H25A 2WBJA 3L5HA 1BREA 4LHUG 4JRXE 3RVTC 4LIQE 4XWOD 3RWCA 4K94H 5AG8A 3HB3C 1ZT4B 2IQ9L 4U6YA 4YIQB 2Z9TA 2EECA 4F80A 4HDIB 4LRNH 3C09B 4Y19E 1EUTA 4NKOA 4TVPD 4JFFB 5KVFL 4V2CB 4LLUB 4ZUWA 3D3VA 1VGKB 2QJDA 4NBYB 5F8QC 4S11A 4U1NB 3WE6B 4PV8B 5IOPB 4G7VH 3VCLA 1H0DB 1BEYL 3SOBH 1LEGA 3CMOL 2ZUTA 2C4FT 2O5XL 3MJ7B 3JV6B 1PX4A 2JB6B 5I1CL 1F58L 1N7ML 2A1WH 2I9LB 3A6CH 3ZKXC 4OCYH 2XN9B 5DJ2B 3ZTJH 5E95B 3TA3D 2ED9A 5IM7B 1J0HA 1I9IL 2ZJSL 3EO9L 3AMKA 1J12A 3UZQA 4G6MH 1F3DJ 1AGFA 5HHOD 3PWPA 4DVRL 3CDGA 4LSSH 43C9B 2YBRA 5D2NA 5GRUL 1KJ2H 3L9RB 3MRIA 1IQDA 4IRJB 4MQSB 3U7YL 4ODHH 3BPLC 5HI3D 4H1LA 1F4YL 2ED8A 1QKZL 3C5SB 3FB7B 1DSFH 3HPLB 4Y1AB 3IFOA 1H3XA 4DZBB 4H20L 4DFHA 1UM6H 3MRLB 4JY5H 4YHPB 4NN6C 2VERN 4K23H 4QY8A 3LQAL 1R3KB 1YEHL 5C6TH 4QHKJ 3UJJH 4Y4KC 3LKSB 2OSLA 1TCMA 2C3WA 4K3GA 4PTTA 2HFFB 2AJ3A 2KBGA 4WHTB 3RQ3A 4NO2B 4Q6IC 2PETA 2WINA 4HIJA 3ZDZF 4XMKL 1NGZA 1MNUL 1R3HA 2WNGA 5ILTH 1DQQA 3HE6A 4CVZB 1KIPA 1P7QA 2XNAB 3PDO