2KZWA

Solution nmr structure of q8psa4 from methanosarcina mazei, northeast structural genomics consortium target mar143a
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
145
structure length
145
Chain Sequence
MNARDNKFNTWNDSRGNYWSDYEGSDENGDGIGDSAYAVNPEAGSMDYMPLMEYLHSSPVLPTARFTSDITEGFAPLSVRFKDFSENATSRLWMFGDGNTSDSPSPLHTFFNEGEYIVSLIVSNENDSDSASVTIRALEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein
publication title Northeast Structural Genomics Consortium Target MaR143A
rcsb
source organism Methanosarcina mazei
molecule tags Structural genomics, unknown function
total genus 9
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2010-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00801 PKD PKD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2kzwA01
3T0WA 1VFAB 1KB5L 4GW1A 4XTRD 3U4AA 4V1DB 5IQ9B 4PRHD 1L9MA 4Y4FA 2JB6B 5L2JA 1T0NA 1CFSA 3VGHA 3VGGA 1R24B 5EN2A 3U9UA 2PR4H 4YQXL 1NLDH 12E8H 5IKCA 1UXWA 5HDBE 3G5YB 2YN5A 3MFFB 3QFDB 1K85A 1J05B 2XNAB 4S1DD 4NOFA 4WW2A 5FUCE 1SM3H 2GT9B 1KELH 1FSKC 5AZEH 1W72H 1HQRA 3ARGC 4KVCH 4KFZC 1E4XH 5F7HA 1MEXH 2WSKA 4M6MH 1FAIH 3IKCB 1P7KB 5TQ2L 1GAFH 3S37X 5EOCH 4EZMA 2VKXA 4RCAA 3FN9A 5HHNB 2FIRT 3TIEA 4BK4A 1EFXB 3RL1A 3HC0A 3QQ3B 3DVFA 1GSMA 5ENWB 4N9GB 3QPQD 3MUZ1 3OAYK 1XGYH 3QDMD 5B8CA 1GOFA 1ADQH 5D8JL 2W1NA 1G7PA 1BVLB 1CE1L 3BE1L 3OG4B 5D2NB 3M1BB 3EFFB 4A6YL 4AENA 3RWGB 4NQCA 4XC3L 4HUXB 4TTGA 1YYLH 3LZFH 1VFMA 4NUGH 2EZ0C 1MFAH 3BZDA 4XP5H 2NR6C 3VFSB 4DGVH 4Z8FH 4M7LL 4JQXC 3VD5A 12E8L 4X4MA 4K3GA 3HS0B 2BJML 1TENA 1KT2A 2VR4A 1KPUB 1U58B 4V1DD 2VH5L 4M43H 3DIFA 4PJFA 4O2FA 1SM3L 5AZEL 4KWUA 4GG6B 5IK3A 3U6RA 5CHNB 1OOAA 4Z7UF 1E4XL 1OAQH 3EO9H 4M6ML 4EN3A 1FAIL 5HYQB 2VR9A 1EEYB 5BRZE 5MENE 3NIGE 5EOCL 1AD9B 3JWOH 1U8NB 1IKFH 2Z31A 1KIPB 2DDQL 1A22B 2FSEB 5C0BE 5I1KH 3F65A 5D6CB 2X05A 4JPKH 2HTKD 5FFLA 1YQVH 4WHTB 2LU3A 1ADQL 3TCLB 4QY8B 1S8DA 3QIUC 1Q9KA 2B20A 1EFXD 2QQKL 1K2DA 3MGOB 2H26A 1HSBB 3MRBA 1YYLL 3LZFL 5E94A 5F7MC 4NUGL 3WO4C 4LLVB 1MFAL 1Q9OA 4XP5L 4C57C 4DGVL 4HKXB 4MA7H 5HHXH 3SGEI 4RX4A 1S7SB 3RX5A 3RPKA 3WHXB 3BH8B 4I0PB 1MFEH 3BKCH 4L1DA 4M43L 5A2FA 4N90D 3ILPB 3IAQA 4ZPTA 1S7XA 3MLTA 4X6EA 2Q6WA 3AB0B 1OAQL 2OZ4A 2Y9RT 3AFLA 1YEDB 3T2OA 3JWOL 1KLGA 5IHZB 3T77B 4NO2A 3U4EB 5I1KL 2BFVH 4JPKL 1BWWA 4YFEA 4XH2A 3QJFB 4QCIB 5T33H 2UUDH 3CJJA 1IMHC 5DHVH 3HAEB 4X6FA 4OD3H 4YDJA 4ORGB 3PE9A 1NMAL 2XFXB 2OJEB 3LB6C 3BW9B 1YNTB 3S35H 5KSVB 2FZ3B 2C3XA 2VXTH 5EU6E 1QSFB 1RFDH 1RUQL 1YZZA 2A6DA 4PREA 5KAQF 5CS7A 1JZ2A 1MFEL 3BKCL 4HF5H 2D9CA 1EMTH 4PBXA 5F96L 5C8JB 4MXVF 1KNOB 3MA7B 3IVKA 5A2IH 3REWB 4GLRI 3PDOB 4GXUM 2F9BT 5DHYA 3BIKB 2X4QB 3B6SA 3DOSA 4XNUH 1OW0A 1IVLA 1FZOA 5LGKA 3VFPA 4I0PD 3DX6A 5EDXA 1VACA 3DHJA 2FBOJ 4JCLA 3ILQC 1RK0B 3EYFA 5FECA 5CSGA 5FEBA 2BFVL 4XPAH 3KYNB 1J8HB 3HAEG 1Z3GH 3FO9A 3WIFB 1LO5A 5J6HB 3SDDC 4OD3L 3R0MA 3VFTB 1OGAB 1FFNB 2P5EB 1LO3L 3MQIA 1V3MA 4ELMA 2ZZUT 3LQZB 3X12B 3GSRB 3P0GB 1XGTB 1ITBB 1FNFA 1EA9C 3S35L 3IDIB 3MGTB 4G80B 5DZNA 2VXTL 2BRQA 4BQ8A 2PXYA 4UT7H 4QGYA 5AUMB 1EDQA 3WFHA 4NRZA 3X17A 3GUTB 1XF1A 5MEPA 2MKLC 4HF5L 1YEEH 4BSWB 2BSRB 1RZGB 1DQLH 4ESKA 4U49A 1RUAH 1NGYA 3QB7C 3ARDB 1QSFD 2EDEA 3HI6L 1A6ZB 4XNUL 4KDTA 4YHKL 5DVLA 3MRHA 5ICZA 4PTUA 2OS7A 1KB5B 2JJTA 2AGJH 3P2TA 3D5OF 3FQNB 1UZ6E 2FJGB 4HZLB 3KHQA 1QLEH 5IW6A 5D7LA 3VG0H 3FOLB 4OZHB 1U8IA 4JRYB 3P9LB 1JP5A 4R4FH 1JTTA 5EU4B 3RZWA 2DS4A 3QH3B 3RFZC 1IAII 2MPAL 2IANA 5DYOA 1FNEB 1P4LA 2WBJC 1VA9A 3GJEA 4WI6A 1T1YA 4L8SC 4NN6B 4ZDHA 1J8HD 1T7WA 5JW4N 5IM7A 5FXCH 1NDMA 2XZQH 4UT7L 2B5IC 2DQCH 3DX8A 3ORJA 3GSXB 5D5MB 2AEPH 3PL6C 1UH2A 1OGAD 2P5ED 1U8JB 3O6LH 3KLHC 1RUAL 5TGBB 4Z9KB 1P1ZA 3UZEA 1JTPA 1Q0YH 1D3CA 4Y7MA 2VAAA 4BZ1H 4PJXB 1IGTA 4HX1A 3QCTL 1MAMH 5B4MD 2X4UA 4ZUSA 4CMHC 2AGJL 4X0KB 4P4RB 3S4SB 3L3OB 4KXZI 3SE3C 1Y18A 4A6YB 3PIQB 4GKSB 3VG0L 4NP4L 4GRLA 3ARDD 2NY7H 5FB8A 5BVJA 3NN8A 3VFWB 2FLBT 1W2KT 1T20A 2AV7A 2XIDA 4JHAH 1JUFA 1W72B 1HNFA 4JRYD 1NQBA 4OF0A 4XI5C 1KJMB 2XZQL 1KCUL 2DQCL 1NBVL 4P2OB 1RUKL 3S5LB 5I9QB 2AEPL 4ZUVA 2Q20A 1T1ZB 5B39A 1XF4B 2HLFD 5JDSA 4D0DA 1E4KC 3QUMH 1FL5A 4UU9B 3NH7H 3PV6A 2AXJA 3ISWA 2C1PB 3CUPA 1PZUB 3H42H 1MAML 3S4SG 5HHQB 2VN4A 4PJ7B 1T5XA 3QG6A 3D39A 5CJQH 1G9NC 4FXKA 4LLQB 3VJ6B 4M00A 1B90A 5IB3B 2NY7L 4DKEH 3ZE1E 1I8KA 3IYLW 3QNZB 4LVOC 3ZDXF 3JV6B 4PY8J 5HYSA 3C5JA 1F6AB 3QEQE 3QQ4A 1H0DA 3MYJB 2F53A 2CIIA 4LHJB 4G9FB 3B43A 4JQVA 4P9HC 4CW1B 4NDMA 1PYWA 1R3KB 3RWEB 1VFUA 3BN3B 4JHAL 4HHAB 3TNMB 3L5IA 1LO0H 4EI6B 4HULB 3S5LG 3UTSE 2GSIA 2L7JA 1NAKH 4RFEA 3AXLB 3ECBA 3MOBH 4WWID 4N0UE 4IIQC 5ESQB 2HLAB 3WIIL 3QUML 1EJOH 3MCKB 1ZWIB 5EUOB 3ZKNC 2A1WH 4PV9A 2E7HA 1FPTH 3GIZH 3V7AG 1INDH 2O61A 1IL1B 2GJ6E 2ZSWB 4P2OD 4F7TA 3U46A 2X4OA 3O2DH 4FA8A 1CVRA 3DXAA 1LEGA 4DGYH 2A83B 1V7MH 5CJQL 5FO9B 4MB3A 3FB7A 2UY7A 2DMCA 1GOGA 3BJLA 1JN6B 1E4JA 1TJGH 1TZGH 2GI7A 4DKEL 1X5XA 2FATH 4U1NB 3HB3D 3VRJA 2NY6C 4EQ2A 5JMRA 3S98A 3RTQB 1JWSA 3MX0A 1YPZE 1WVZA 3O45A 5MHSE 3HNSH 4QWWD 1XZ0A 2EKJA 1LO0L 1BWMA 1CLCA 4DJMA 1WBXA 3WSQH 2YEZA 2BXZA 4H1LH 3STLA 3MOBL 2FH6A 4G9FD 2DQEL 4TSBL 2J8UE 3BGFB 4M8VA 3I9GH 1VFBA 5I1HH 2A1WL 2QBWA 5IF0B 1FPTL 1I9RL 5B21A 1INDL 5FO7A 1F3RB 5DHVB 1TQBC 4CMMA 1OF2A 3E6FA 2B2XH 3DARA 2LABA 3B2UC 3O2DL 2AJUL 1EGJA 1I9JL 1A1NB 4R9HA 4QTHB 2OLDA 3CFJB 5CD5D 2XA8H 4DK6A 5H2BA 3B3IB 4Y89A 4M3KB 1TZGL 2FATL 3CPLB 5IVXA 1H9VA 3CFCH 1S7TB 2XN9E 4KKLC 5HI5D 4D9LH 4RFOH 5FOBB 3MNVB 4YNYA 1CVSC 1Q72H 2VXUH 3IXAA 1F3JA 2X89D 3BSZH 2YUWA 5B38B 3MJGX 1R3JA 1JPGB 3DV4B 3RTQD 4POYA 3S3SA 4U1GC 1MWAH 4JANB 4M9OA 4GRWF 4HAGA 1EHXA 5E6YA 1X7QB 3OKOA 4WFHE 3CDCA 3C5ZC 3GIVA 4P59H 3D3VB 1G6VK 4NO5B 5I1HL 4NQXA 1NFDB 4IRJA 2H2SD 4P3CL 5IW1B 4JJ5A 1D9KC 4W4OA 4NBZB 3RY6A 1F13A 1SYSA 4TUOA 5I1EH 2XA8L 4L3CB 4NWUH 2FX7L 1F4XL 1P2CB 3TPUB 3WN5C 4JFYB 1OARH 2EXYD 4EDWL 1OWWA 3IETA 3CFCL 1FYTB 4RFOL 1CK0L 5ILTL 3VH8A 2ED8A 1YMHB 2GJZB 3OKYA 5CUSH 1Q72L 7FABH 1X5KA 2VXUL 2X4PA 3BSZL 4LQ1A 2NX5E 2A0LC 4C56A 2UY6A 1T89C 4RA0C 2IFGA 3TNNB 4OI8A 4UILH 1OGTB 1NGWA 4UTAL 3IAGC 1FCGA 3UTPD 4X5WB 1JF5A 5ISZB 3MRQB 5CP3H 3ALPA 2CKBL 5DI8B 5T1LB 3OKKA 4OIBA 4P59L 5A16A 2O5XH 1F58H 1CLZH 2YRZA 1PZ5A 2F5BH 3PNWB 3Q2CA 1G6RH 1RI8A 4G9DA 5I1EL 1Q0XH 4MAYC 1T2XA 3D3VD 5GRVL 1NC2A 5ACLA 4NWUL 5F6HI 5INCA 4UINH 5IB1B 1RJLB 4GSDL 4OQTH 1CDIA 5CINL 1QQDB 3NIDF 4XBEL 3D2UA 3ROLB 3F8UB 4ZUTA 1IQDA 3PJSB 1G84A 2I9TB 4HC1A 1I4FB 4PLNC 1I7ZB 3BGAA 3L5WB 2IPTH 1X5JA 5DGQA 2MQ0A 2YD5A 5SWSE 4AZ8A 3T65B 1I3RB 3MV9B 3OPZH 4UILL 1FYTD 5DUPH 4HBCL 1JK8B 3P30H 4IDJH 5EZLB 3QEHA 3G6JB 1IAKA 2EO9A 1IKNC 4HV8A 4E0RA 2ATKA 3K2UH 1F58L 1CLZL 5HDOA 3TA3A 1BLNA 2WWKO 5D2LF 3TT1L 3D48R 2F5BL 4F58L 2VLJE 2YPVH 1MAKA 1TVBB 5ISZD 1BOYA 4PB9H 4IOIB 1E0OB 1FNLA 3MRRB 3V2AR 1A1MB 1FIEA 5T1LD 5DK0A 1Q0XL 4NNYA 5HGHA 3DWTA 3QUKB 4NHCH 4J12A 3BXNA 5BS0B 4KI1A 3QR2A 3T0EA 1S7RA 1FNAA 2YUVA 4OQTL 4R6UA 4O51A 5A3ID 5DS8B 5F1IA 3QXVA 4XPTL 4NKOA 1LEIB 3V6FA 4NQVB 3QUMB 5HHPA 2BCKB 2N56A 4YHPA 1RUMH 5JIKA 4P46C 3QDMA 2YN3A 2W9LA 1M7IA 5CGYC 4P48A 3QUZC 5JXAH 5E1AA 4TUJB 2RHEA 4AL8L 1KEGH 5F7LB 3K7UA 4KPHH 3OHXB 1JGUH 3VWKA 2RCSH 1G9MH 2F19H 5HJ3B 2VAJA 4NKDB 3ZLQC 5IMMB 5TF1L 3O8XB 3MV9D 1VFAA 5DRNB 3O2VH 3GMRA 4PB9L 5IQ9A 4V1DA 4HIJB 5DJ6B 4WO4C 5KSBF 1K5NB 1XF5A 2JB6A 5I8EB 2GUOA 4PJEB 1ZGLP 5C6PB 5C0CE 2FJHA 3Q6FB 1CGVA 5JXEA 3QIBA 3G5YA 4JM4L 4F7CB 5KS9A 3MFFA 1X5IA 4Y2DA 4PY8I 4LCYB 1FVCB 2FX9H 2GT9A 3Q1SL 2HTLD 4PJGA 2C26A 5BS0D 4N5EC 5D72H 3MNWB 1M7DA 3ESVF 1EEUA 1P7KA 3MJ9A 4QHUB 5JXAL 1UEYA 2WBKA 1EFXA 4XP9H 1CFNA 3HE6B 4M6OH 1KEGL 3I6LD 3VCLB 1FG2B 1ZGLB 3KPRB 1NCWH 1UEMA 1VB9A 4KPHL 1JGUL 5CJ8A 3QRFM 1G9ML 3EDJA 2F19L 5IB2B 3QDJA 1YA5A 2RGSA 3L5XL 2R1YB 4J3WA 5CEZH 4BSVB 2X9YA 4NJ9L 1CR9L 2ADJB 4CNIA 5IJVA 4P2QB 4PRNA 3EZ8A 3O2VL 1MELA 3IGAB 4HUXA 3HI1B 2YBRB 4Z7VE 4OF8A 5IOPA 4XBPB 3O8XD 4GG6F 3HS0A 3PXHA 1WWAX 3H9ZA 4XNZC 5E2UL 1KPUA 4XVJH 3JV0A 5IMOA 2FX9L 4MNQA 1KN4H 5C07B 3EYVB 4GAGH 5DFVC 5D72L 1MCDA 4YHOH 2W91A 5GS0H 2Y7QA 3CCHB 1OLZA 4TTDC 1AD9A 5E1HB 4UV7H 4Z77B 1QA9A 2WWKT 1A7OL 4Y4KB 4XP9L 4M6OL 1KIPA 1OAUH 4G8GA 3NMEA 4JPIB 2A6KB 3U83A 3PGDB 2OM5A 1WCBB 4WHTA 5IESH 5CEZL 2FHBA 4H88H 1KUMA 1LP9E 4KZEH 1H8NA 4EN3C 2JIXA 3DVGB 3MA9L 5E7BA 2R8SH 3ALXA 3HE6D 3KPRD 3MGOA 4N8VB 1U92B 2Z31C 3D1MC 2FR4B 1A2YA 1HSBA 4YH6A 4ONOA 5ELIA 4JQIH 4DN3H 5E08H 4L4TA 4H1LG 1JE6A 2HFFB 4P2QD 3RUGF 4ZD3L 3MACH 1MWAB 3NCJL 4JFHD 1IAMA 4N0CD 4UB0H 5E95B 1QNZH 5E2TL 2EDOA 1U8LB 1XIWB 2GSGA 3CFDA 1TCRB 5TJWK 4YHOL 1PKQE 3L3GA 5C0IA 4H20H 4JVUA 2YWZA 1ULVA 1DTUA 4UNTA 4UV7L 1X5AA 2X4RB 3WBDA 2JELH 1KGCE 1JHTB 5IBLC 5IHZA 4X4XB 3IDXH 5C07D 1GC1H 2QSTA 4HFUL 4KK6D 5BW7A 1C8PA 5D7KE 1S9VA 1U3ZA 2EC9U 3I85A 3VXUA 3PHOB 1WISA 4ORGA 1TVDA 1KN2H 4KZEL 3TO2B 4Y4KD 4KKAC 4GKZB 3FFCE 4N8VG 2OJEA 1AHWC 1NJ9A 3PWUB 5K9OA 1KLFA 3BW9A 5H8DA 1YNTA 5L2KB 4PLOB 1F8TL 4J1UA 4DN3L 1QSFA 5EC1A 4I48B 4LSVH 5IVNA 4BKLA 5HYFA 1MRDL 4LDLB 4UOJA 1Z0MA 2GITB 4CRPA 3MACL 3NOIA 3OZ9L 3NABH 5F70A 2QSQA 1KNOA 3B4NA 5DTFB 3UPRB 1F4YH 2ZG1A 3REWA 3PDOA 2EDFA 3MLUH 5HGBB 3BIKA 1X3DA 5LGJA 1RJCA 2ZKHH 3EHBD 1Y6MR 3U0PB 5L8KB 1NFKA 1UC6A 1VGEL 3SBWA 3T3MF 4OCXL 1U8HB 1G6RB 1HK6A 2QSCL 3C08H 5ITBH 1X5YA 1MPAH 5DJXA 4OZIF 1NCCH 2JELL 5LCVH 4G6ML 4M7ZB 1JGDB 2HJLB 1XIWD 1CN4A 3E2HB 4N0FA 4UOW1 2KPNA 3WIFA 4JDTH 3FO2B 2EH8L 4U6VH 4Q2ZB 3NBNA 5D70H 1H3VA 3GSRA 4QRRB 4FXGB 4PGBB 1XGTA 3ULVH 4PRIA 3IDIA 1RJZB 3MGTA 3QFJA 3OJMB 4LSVL 5ALBH 1FLTX 4LPYA 4X6BB 5DJDA 5EO9B 5FKAB 1QFOA 3H0TB 1DLFH 2K1MA 1QLRB 2BSRA 3WFBH 3NABL 2WBWB 4PFEA 3Q6GL 1DE4B 3GBNH 5L2KD 1UCBL 3IDJA 3MLUL 5SWQB 2ZKHL 3EDKA 1ZVHA 3V5KB 2Y36L 5DJ2A 3N85H 2J1KA 1QRKA 1KB5A 3C08L 5CJXC 4UIMA 3VXNA 1MPAL 1NCCL 5DEFB 4D9QD 1IAIM 1T4KB 5LCVL 3VD4A 1KB9J 1NKRA 4OZHA 2PUQT 4QHNA 3QH3A 1SMAA 4JDTL 3ESUF 4N0YH 4U6VL 1CFQB 3SDCA 5D70L 5D5MF 2JJTC 4M93C 3PGFH 1YN7B 2EDJA 4LVHB 3QQ9C 4NT6A 3GSXA 5ACZB 3E1F1 2KZ1B 1E4XI 5I1JH 1DLFL 2X4TA 2EXWD 5IHLB 1KCKA 4QRRD 1U8JA 4ODXB 3V4UH 4LCIH 4Z7NF 1KTKE 1MHEB 1LE5B 4AIZB 2P47B 4UOW0 4PJXA 1U91A 1A6AB 4LLMB 3PWPA 3QDGE 3HC4H 5I19H 3IDNA 4OZFH 5C9JB 4X0KA 4KHXH 2VERN 3TIDA 3OXRA 4A6YA 4GKSA 2AK4A 4X6DB 4WTXA 5DMGC 2HT4D 2VITB 1CU4H 2W9DH 3DSFH 3MV7B 3PWLA 5HVHC 2IBZX 1MQ8A 3ME0A 4JFPB 1RV6X 3HUJB 4OKDA 2X2YA 2DYPB 1YEJH 2OP4H 1WWWX 4D8PB 4LASL 5JW4R 2BRRL 2ERJB 2WM0A 3MPCA 4JO4H 2VSCA 3PGFL 1D5MA 4HPYL 3MOAH 1G7MA 1XGRA 5GS1B 2NW2A 5JNYA 5JHDA 5ID0B 2NY2C 3U82B 1UYWL 2ZCLL 1JYNA 5TDPA 3FHQA 1CDCA 2YR3A 3V4UL 4LCIL 1I7TA 2R56H 4MMXC 4QTIL 4R0LA 3ZSSA 3HCVB 4XCEB 3N1MC 4PGEA 3BZFB 3SKNB 3M17B 4PJ7A 4UQ2B 3KPPA 5IQ7L 5D96B 5C92A 4QXTB 1PW3A 1K8IB 5E9DA 2VZUA 1XMWA 5DK3A 3IFLH 3CVHL 4M1CC 3WL9B 5I16A 2W9DL 3DSFL 4FNLH 3NFPB 5J9PA 3HTLX 1B6UA 2BHUA 4H5SB 3MXWH 4FZ8H 1JWUA 3JV6A 1MCPL 2UWEF 3CZFB 4ZODA 4I3GA 2FB4L 4DW2H 1YEJL 2OP4L 5F9WC 2YD1A 1UM4H 4ELME 4PLKD 3KYOB 5F9AC 5GGSB 4CW1A 1UM5H 2DLIA 2YXMA 1EBPA 4HHAA 3MV7D 4JO4L 4OF3A 3TNMA 5GRJH 6FABL 4ZFOA 3HNTH 2WLZA 2VMFA 4YHMH 5EUOF 1T0MA 4ZXBC 1R5VA 3BPCB 2DYPD 3VGAC 4OV5B 4PJIB 1VDGA 1OSZB 2HLAA 4Z0XB 1FP5A 4HK3N 4D9RE 3MCKA 1ZWIA 2R56L 4FZEH 4XB8A 1AQDA 1ZSDA 3UCRA 1QFUH 3R8BB 1T7VA 4PG2C 4Q9CA 2E7LC 3VXSB 4YLQT 2A83A 3RKDC 5E5MA 1Z5LB 5HYJA 1T2JA 4LLYA 4Q74A 1RUPH 3TJHC 1JRHH 1RJYB 3MXWL 4FZ8L 5CEZD 3RWIA 3QO0B 2IANE 4JZNB 2NYYD 1QLFB 3GMMB 3MZTA 3KWWB 1N0XL 1T0PB 2EE3A 3GSVB 3CDGB 4U1LB 3AY4C 4Z7OF 1ZLWK 5C0ND 4F8QA 3HNTL 2FEEI 3F6LA 4YHML 4PGCA 1HEZA 5JORB 3IFPB 2OQJB 1UWGH 1B0GA 2QL1A 1NDGA 5J13C 3SDXB 2VE6A 4MDJA 2OI9C 5T5FL 2HWZH 5IF0A 2IQ9H 1U3JA 2BY1A 5GS0D 3V4VH 3P9MA 5B3JE 4PJDB 1RMFH 2XKNA 5F72S 1A1NA 1ZT7A 4MS8D 4RGMC 1HWGB 5IVZA 5T3ZH 4ETYA 1RK1A 1U8KB 4RGNC 3VXPB 4GXVL 1OTTC 1KPRA 2BNRB 4MCYB 1YJDH 3FOMA 4J4PD 1OP3K 3VXSD 2NY0C 2WIMA 4HPOL 1NUDA 4AK1A 4K94C 2H9GB 4U0QB 4R97C 5C0DA 4ZO9A 3MUY1 1WFTA 2OL3H 5DT1H 1AKJA 3RVWD 3UAJD 5B38A 2G75A 4D0BB 4WNQB 3DV4A 5F7FA 1UWGL 4LVEA 1HYSD 4P2RE 4NO5A 2HWZL 2IQ9L 1N5YH 3QSKB 5SX5K 5I15L 2OK0H 4S10A 2R4SH 4GKOA 3C6LB 3ARZA 3D85B 5IW1A 1I8IA 5JUEH 4KHTH 2JCCB 5F88B 4ZUUB 1RMFL 3RVTD 4Y5XB 5FDWB 3ULSB 3FRUB 5T3ZL 2P49B 4W68A 5T3XH 4FHBD 1MHHB 2BSSB 4L3CA 2NY5C 2AEQH 5DMKB 3B9KA 3VXTB 1IGCH 5CEXB 3ULUC 1URLA 1ZT4A 3GSWB 1GGIL 1YJDL 1MCLA 1H3TA 4Y5YB 5IV2A 3KHOA 1VADA 4W4OC 2HT3D 3HG1A 3E8UH 4NBYB 5L0QC 1A6UH 3ZDXE 1N2RA 4NZUL 4KV5F 2OL3L 2E5EA 2JE8A 5A2KH 5D7JB 3VGDA 5K59F 3OKNB 2BNRD 3BP4B 4C83A 4X5WA 2OR7A 4Y16B 5DWUH 5ISZA 3JV4A 3K4ZA 4K8RC 1B4RA 1RZIA 5LBSH 4HUVB 4ODBD 2MJWA 3NGBB 3JTSB 2JJUA 1U42A 4YBLB 4OIAA 3KS0H 4O5LH 4ZSOB 4DEPC 2I27N 1NGPH 2EYRB 1OSPH 3GSNH 5JUEL 3AMLA 3DXAE 4YDKL 2J8OA 3H3KA 4AEHH 4F8TA 3MUHL 5C86A 1G7HB 3NIFF 2DQHL 3UBXA 4PTTB 1C1EH 2GEEA 1RJLA 2R69H 1QQDA 2HFGH 3C6LD 3D85D 3ROLA 3PJSA 5KSUA 5AAMA 3TJEH 3ULVD 1KIRB 2B7DT 1TETH 3E8UL 3FT3B 3L5WA 4PRPB 5IUSA 3RA7H 4OGXH 5HVFB 4UBDC 5TQ0L 1SBBA 2ZUQC 1I3RA 2C7UB 3MV9A 3B83A 3KYMA 3RX7A 3Q0HA 5ESVB 1JK8A 4OZFB 5GZOD 1M71B 4JFEE 1J12A 3S36H 4LSQH 1PDKA 1NGZA 4JO2H 4RGNE 5EO0B 1T83A 5I1LA 3KXFE 4O5LL 5D7JD 2KH2B 1NGPL 3QBTB 5BCAA 5GXBB 2VLRA 1OSPL 4HK3J 3GSNL 3UO1H 3TC9A 4HUNB 1A1MA 3VG9C 3LEVH 1FHGA 4XTRC 1TQCC 5L6YH 1LK2B 5IJKC 4ODVL 1C1EL 1D5IH 1QFHA 2HFGL 2PYEB 5KG9B 1TVHB 3SJVB 1U2CA 3VFGH 4KK8D 2NLJA 1YMMB 4LLUA 3BH9B 4NQVA 4WUUB 3QUMA 1OP5K 2XPGA 1UWXH 4IS6A 1BQSA 2OR9H 4S1DC 3MR9B 4X80L 3RA7L 3WUWB 2F74A 3H2WA 2MKWA 1SHMA 3KPNA 1L7TH 4OZFG 4Y19A 3O2WH 5DF0A 5EOTA 4JGUA 2R29L 4I0CC 2LTQB 5HHOB 3S36L 3FO1B 4LSQL 2BVUA 1LDPL 4JO2L 4PRPD 1BZ9A 4NKDA 3C87A 4HIHB 4HXAH 3ULUE 4FQXB 3EYOA 3K81A 2RIKA 2YOCA 3O8XA 3QPQC 1GZQB 5DJCA 3R1GL 1J1PH 4TNVF 4ERSH 3UO1L 2WQRA 1YYMH 3O81A 3RPIA 5BO1L 3LEVL 5MENB 1NFIB 2AJZB 4PJEA 3B5TA 1DQDH 1R3IH 3Q6FA 1JZ5A 1WICA 4L4VB 3IXTA 1A7QH 4O9HL 3VFGL 1FVCA 5I8CB 3BP6B 1DLHB 4FMFA 4APQA 4MQTB 3VWJA 5TE6H 3WUWG 4HG4J 3F58L 3MNWA 4LL9A 2PYED 4NCC1 5GSRB 3O2WL 4NN7B 3SJVD 3O2DA 3MODH 5F21B 4ENED 1P84K 1YMMD 3HE6A 2BY3A 5K33A 1AGBA 2CDFA 4WJ5B 4WUUD 2XZAH 1C16B 3DMMA 1VKXB 3WE6B 1NCDL 1F4HA 2HTKC 4UT9H 1P9MA 5DRWA 1NL0H 2ADJA 1PEWA 1J1PL 2YXFA 4ERSL 4X8XA 5HHOD 1YYML 3IGAA 3LD8B 5ICXA 5AAWA 1WAAA 5GZND 2YBRA 5F3BA 1IC4H 1I7RA 4FQXD 1DQDL 1R3IL 3QNYA 2BNQE 4XBPA 4FG6D 3WDHA 1MLBB 4XXCA 3ZHLA 5DDHA 4MD4B 4BH7B 3K4AA 1WBYB 1PG7L 5D2NC 5MEND 3TFKD 3OAUH 2DQIH 5CSZB 3JUZA 3G6DL 3TBTB 4YR6B 2CK0H 4I18A 5CAYB 1U6AH 4L4VD 3MODL 3W11D 3TM6A 3OAYH 1MJ7H 1ZHKB 4YWGL 5DQ9B 1IC1A 1IBGL 4PRHE 3PGDA 2DQUH 4QHMB 1CD8A 5L7XL 4PG9B 1LO4L 4UT9L 5DVNA 3QULA 3CFBB 1NAML 4P5MB 4AIOA 4HKZB 3N50A 3VDAA 5AZ2H 1NANH 3U7AA 2H41A 1CQYA 1IC4L 2OL3B 1JPSL 3W0WB 5HPMA 5GISH 2OTWA 2D0GA 2Z4QB 3U30B 1RZJL 2V5MA 4Q9QL 4BK5A 5E8NB 4MDIB 1Q8MA 4N1CA 2CKBA 3JWNC 4H8WC 1SMOA 3MLVH 5DLML 5E6IB 1XIWA 5FYKH 3GEWB 1TDQA 4LSUH 3TT3H 3QDME 5JW4M 1CL7H 5I74B 4U7KA 2OR8A 2CK0L 2ZJSL 3BKJH 4TUKH 2X4RA 4MMZC 5HDQL 4OD2A 4I0PC 1JHTA 1FDLL 1HHKB 2AXGB 2P44B 3ARFA 2Y6SD 3UTZA 5BZDA 4FTVB 3SGJA 4NSKA 4TULH 1Z9SA 3HPJB 4WENB 3AB0C 5DD6A 3KDMB 3TO2A 2PNDA 3HRPA 2X1OA 4KKCD 4GKZA 1JI1A 4V1DE 4ZFZB 5MP6L 1EEZA 4GQ9H 2MFNA 4FFVD 1T22B 1ZV5A 1HHHB 5CCKL 4M7KH 5T3ZD 2F8XC 3FHAA 5AZ2L 4K9EC 1GXEA 2FLRT 1EH9A 2OCFD 1RU9L 2YD2A 4F9LC 5GISL 4G8IB 4CN6A 2NXZB 5FA3A 5FO8B 1VEPA 1A7PL 5C2UB 2IPKA 2R2EA 2NY3B 1A47A 3NA4A 4ALAH 3MLVL 4MJ4A 5HGBA 5FYKL 3TT3L 1HZHH 4LSUL 2DBJA 5BZWB 3TVMB 3W0WD 3U0PA 1CL7L 5JOFA 4BFEA 4KUZH 3GSNB 1F2QA 4PB0H 4I3RH 1VENA 5HGAB 3QJHA 3KYKL 4XCYB 1JGDA 5IHUH 5E6ID 4L8BA 3U36B 1H5BB 4OQTA 1KLUB 1K8DA 1NMBH 3N0PB 4HMCA 4Q2ZA 4Z78B 3GM8A 5D2NE 4QRRA 1BJ8A 2BVPB 1EUTA 4FXGA 3CFEA 4M7KL 4N90E 3LKRA 5ANMA 5T3XD 4QXUL 3HA0A 4MA3B 4XMPL 1EZVX 4FTVD 1R5WB 4NUJB 2HJFB 1JNNH 4X6BA 4ACPA 2AQ3A 5FKAA 1F97A 3LKNA 3MV01 4ZAKA 3HKFA 3QCVL 4PR5B 5DFTA 4EDXA 5CWSA 3V6ZA 3T2PA 2X6MA 3MUGA 1KJ2H 3ZE2F 4ALAL 1BAFH 2APTA 4Z7QE 2I5YH 1HZHL 3V5KA 5J11B 1T66D 2NXZD 3THMH 3MBEA 3U48A 4KUZL 5CMAA 4KK9D 2P4AB 2VUOA 5DEFA 4I3RL 4JRWA 1DQTA 2Y07H 4W6WB 5B4MC 1NEUA 2NY3D 1IARB 3DVIA 1NLBL 4TPRL 3T1WA 5E2JA 3ZDYF 2NTFB 1HIML 4LMQI 3TVMD 2XTLA 2HN7B 3ARDC 4GAJH 3V6OA 3NA9L 3VW3H 1CFQA 1PSKL 3DROA 2X4SB 3TBYB 3OR6A 1FO0H 1CG9A 1N26A 1T6WA 1MQKL 5B22A 1JNNL 4BSJA 3ZT7A 1RIVL 5INDB 3ZL4H 4OLVH 4GRMB 1CDYA 1FJ1B 1KULA 1TCMA 1UKSA 1FZJB 1X5GA 1DL7H 2VL5A 2HLFC 4XWGH 4KI5D 4NN6C 1PEZA 4JO1H 3KYAA 2I5YL 1I1RA 1PY9A 4UDTB 5GGRY 3D0VA 3KPSA 3WEXB 3THML 3X11A 2BOBB 3DGGB 4U1JB 2HKFH 3HUJF 2VWEC 3AVEA 3UTSB 2Y07L 2FCBA 2M8XA 1AGFB 1QBAA 1T7XA 4X6DA 4CADA 4KTEH 1Q9LB 5DK2A 1EAPB 4KUCD 4OT1L 3KPMA 5GJSH 3SKOB 1S5HB 5MI0B 5DD0H 2ZSVB 2A77H 5HHVH 4D8PA 1B6DA 4FABH 1FO0L 1OHQA 4PRBB 3CXHJ 1LE9B 5E4IA 1QSFE 4A2LA 4YEFA 4OM1H 1QVOB 3RVVD 2GY5A 2J88H 4LHUB 4R2GB 5D1ZA 4NKMB 3RL2B 3NCYP 3L6FB 3R06A 4CUCA 5EIIA 5E2VH 1BEYL 4P3WA 3FQTA 1JPFB 2WUCL 5I2IB 1NUNB 2LU4A 3QUXB 4JO1L 35C8H 2DLFH 1J0HA 2PCPA 3IDGB 1ORSB 3K74B 4P2OC 3T3PE 4AEIH 5I9QC 4Z5RB 2HKFL 3PF2A 3D25B 1K8IA 1M4KA 3P77A 3DTXA 3LRSB 3BPOB 4OFKA 3G5ZB 3MCG1 5F7WC 4ISVA 1J8HE 3NFPA 2B1HL 5GJSL 4M4PA 3CZFA 1EBAA 2BP3A 4OCWL 3HB3C 4PJAB 1OGAE 3MLWH 3CFIC 2C1OB 4P57A 3UTSD 5GGSA 5ADPL 3GHEH 1IT9H 1CGTA 4FABL 3QFJE 5KN5B 2DIAA 1OB1A 2XACC 2NY1B 1SBSH 2GTZA 5KVFH 5ITFB 4QWWC 2AEIT 4X9IA 4G5ZH 4HH9B 4OM1L 1UWEH 5JR1H 3BPCA 2X41A 1UA6L 1REIA 4PJIA 2VNCA 5E2VL 1WFUA 2CIKB 1OSZA 3EAKA 3HC3H 3L1OH 1I8LA 5FYJH 2P24B 3JBG7 4MB5A 1J1XL 3H9SA 3EOBB 3MV11 2VABA 1JZ8A 1M1SA 2ITDA 4EUPH 3I02A 1J1OH 2DLFL 4LPVA 1MI5B 3EYQD 4LHUD 4GOSA 4R2GD 2XQBL 4LEXH 3VFMB 3JWOC 3SO5A 1QRNB 3IJYA 4JFOB 4GFTB 1RPQA 2Y5TB 4J8RB 4XNQA 5T1KB 3ZDZE 4OZHE 1IAOB 4JRYE 3QUXD 2ZWLT 4Z18A 3VFNA 5CD5C 4QHKJ 2UV3A 3QO0A 1TLKA 4JZNA 2FGWH 1QLFA 5HDLA 1W0VB 3QI9B 4W6XB 5HI5C 5DXWA 3PUCA 3GSVA 3GHEL 4HT1H 1IT9L 2EICA 3FCTA 5KSBA 1HDMA 4XZUB 3K8MA 4FOMA 5KVFL 5D5ME 4W4NA 4JY6B 5D1XB 2VWEE 3MRKB 3K8KA 5AEAA 3VGBA 3RTQC 3L1OL 4M7JL 5GGUA 4EXPX 5FYJL 2B0SH 3WXWH 2YD8A 2NY1D 4IMLB 3P0YH 1AFVH 1ZHLA 2X9WA 4PJXE 1J1OL 3IJSB 2YKLH 2MQ3A 4LEXL 2H2SC 4DGIH 4I1NB 1FG9C 3N1QC 3BGFC 4U1SB 5EC2A 5C0EB 3P11H 3GB7B 3RJDA 5DQJA 1U8KA 1N8ZA 1MI5D 4MCYA 4TVPH 3TBWB 2EXYC 4NM4H 4Y4HB 4LQFH 3OJDA 1A14L 1QRND 3MRLB 3SEPA 1MJ8H 4HT1L 1SEBB 3FQRA 5T1KD 1HILA 3ARWA 3VI4E 3KS0J 4D0BA 4JKMA 2EYSB 5KZCB 4WNQA 1I1AB 3QI9D 3LPGA 2PW2B 1CBVH 4MNGB 2FWOA 5FYLH 5C1MB 3L3KB 5EIVA 1B9ZA 5BQ7B 2OX5A 2DOCA 4M6NH 4AT6B 1E4WH 2B0SL 5DD5H 4LCUB 5FYKD 3WXWL 4AMKH 1BOGA 1ETZB 2ZG3A 2R2CA 1AFVL 4TOYH 4NRYA 3V7AE 4XRCA 3CMOH 1J18A 1G1YA 5D1XD 3C6LA 3D85A 2YKLL 4BUHA 2JCCA 4PJ7E 4J3UA 3H3PH 2YD7A 4U0RB 1DJSA 4Y5XA 1T2QL 4DGIL 5FDWA 5I18H 1FE8H 2EE9A 3FRUA 3MJ6A 2BSSA 1Z2KA 3VA6A 5DMKA 5C6WH 3EOAB 3KLAA 4DUVA 5C0AB 1Z0NA 5CEXA 5HYIA 4L3EB 2OYPA 4CVUA 5C3LD 3EJYD 4GUPB 4J3TA 4TVPL 1A6TA 3NTCH 3GKWH 4QYOB 4JN2A 4KMTH 4G9FE 4DAGH 4LARL 4LQFL 5EUKB 1OTUD 3LS4H 3RIFF 3J8F7 2XOTA 1KJ2B 1NCNA 4PV8A 4GKNB 1U8MA 4LKCB 2EDWA 5DC0A 4XGZB 3BP4A 2F5AH 2GTWB 2D4DA 5DVMA 4LLWB 4U6TA 3EYSL 4JDZB 2IEPA 3L95B 4Y4HD 5DJYB 2C3VB 1CBVL 4WFED 3TYGL 2DKMA 3JTSA 1F4AA 1E4WL 4AMKL 5DD5L 4PJCB 4ZSOA 4OBSA 3L9RB 2C4FT 5KZCD 1AQKH 1I1AD 2EYRA 3CMOL 4Z7WF 1F42A 1LDSA 4P5KA 1JGEA 5I18L 1OQXA 1FFOB 1FO0B 3AM8C 2VXQH 1AE6H 4WHYH 5C7XL 2V2XA 5C0FB 4X7SH 4XAWH 1I85A 5CEYB 5J8OA 3NTCL 3GKWL 1D6VH 2F54B 2Y25A 3LS4L 2OZ4H 2QADB 3A6CH 3RAJH 5A3IC 1KIRA 3FT3A 3GSOB 3WS3A 3X13B 5C0AD 1U93B 5HDBF 5H94A 4L3ED 4MB4A 2C7UA 2F5AL 4F7EB 3I6GB 5LWYH 1LNUA 4L8CA 2DWEB 2FBJL 4L9DA 1ZHNA 2E6QA 4UT6H 3W81A 3LOWA 3SPVB 2NQCA 3CVHA 1BVZA 2AJ3B 2AAVA 3QA3A 2CR6A 2MQCA 1JGLL 3SO3B 3WFDH 4XMKH 1AQKL 2WP3O 4OTXL 2V9TA 4ZO6A 4JDVB 3RZCA 2VDRH 5TF0A 4KTYA 1LK2A 3QXAB 4UTBH 4XNMB 3DRQA 2PYEA 5JPMA 3QXDB 2VL4A 3UTPE 3QP3A 2BHYA 2Q76B 3BH9A 3FQUB 1BX2B 4MJ6A 4XPFH 4F80A 5C09A 3AREB 4HJGB 3RDTB 2HTLC 3DYPA 4M1DH 1VPOH 4WDIB 1V7NH 1ZGLM 3IS1X 1B0WA 2VC2H 2A74B 5HHOA 2F54D 1ZLUK 4UT6L 2QADD 3BP5B 4S2SB 3WNKA 3D3VE 4HIHA 5AWNH 3MO1B 1DUZB 1NFDE 3NIGF 3MLYH 3WFDL 2B8OT 1Y0LB 1EHAA 3CH1B 4XMKL 5FM8A 1BP3B 1JRHI 4HGWB 1DVFB 4M4RA 2PO6A 3JWDL 1QO3A 2VDRL 1G7LB 1NFIA 4FMKA 1QSZA 1BVKB 3DETD 4UTBL 4HCRL 3O3BB 1FZMA 2VQTA 5JQHC 3VXRA 3O8XC 2FL5B 4L4VA 1FYTE 2XWBB 4L1HA 4XPHH 1DCLA 2EH7H 4XPFL 5A43C 4HUWA 3BYYA 3HG1E 2F58H 1LP9B 2WANA 1AO7B 4EUPB 4M1DL 3P40A 1A1OB 4Q6YA 4MD0B 4PUBH 2VLKB 1QKZH 3MV8B 3PQYB 1DBBH 2ZCHL 3EOTH 1AGEA 2VC2L 5ETUB 5IHBA 5ISZE 4XPGL 3FT4A 4WJ5A 3WJLC 1K4DB 5F89A 1QSEB 3ARED 1VKXA 1NGQH 4DUWA 1MLCA 3BAEL 3WE6A 3RDTD 1FN4B 4HKBB 3LKSB 3U1SL 3MLYL 4LIQH 1XCTB 4JM2B 4EIZC 4S0SD 2CLVA 4RNRB 4UQ3A 2XWTA 5KW9H 4FP8L 3HE6C 4PIRF 3SQOH 3DBXB 2QQLH 5TFSH 2IGFH 3BN9D 1CIDA 3QHTC 2Q86B 3MROA 4QHKI 1P9MC 4MD4A 4X7TB 1DVFD 1UADC 2IAMB 4XPHL 2EH7L 4NCC2 5F71A 4K7PY 4QKXB 3S37H 4EUPG 4N0CC 5JW3H 4JPWH 1NC4A 8CGTA 3TBTA 4GJTB 4Y4FB 5GRXG 1S9XA 3KJ6L 5L2JB 1CFSB 3MV9E 1S9KC 5EN2B 3U9UB 4XXCC 1OQOA 5IKCB 3G6JE 1UXWB 5FYJD 3N1PC 5FGSA 1F11A 1NGQL 1AO7D 4HEPG 2CUHA 4QHMA 3X14A 4KK6C 4WW2B 2VLKD 1XGUA 3DUHA 3MV8D 3PQYD 4LIQL 1HQRB 4HFWA 3VA2C 5DQDH 4Y4KC 2P46B 5KW9L 1QSED 1WC7B 5C0GB 3SQOL 1A7BA 5IEKA 1J9CT 2QQLL 5BS0E 5TFSL 2OL3A 3TIEB 3BZ4A 1BFTA 4TSAL 1BD2B 3W0WA 5K9KB 3HC0B 3ZSTA 1V5JA 3O41B 4JM2D 3VFUB 1Q94A 1I1YA 4RMVA 1B2WL 4IRZH 4MDIA 1NSNH 3MRFB 3I6LE 2JKXA 5B8CB 3GI8H 3K1DA 3FN3A 4LP5A 3L3JA 4OFYD 5CIPA 3S37L 4J3VA 1IEAA 5AYUH 1RHHA 3UDWC 5JW3L 4JPWL 1ACYH 5D7SH 1IC5H 2APVA 4KKNA 4NQCB 9CGTA 5J1SC 3EHBC 1IGMH 1JYXA 1JTOA 3EYUL 2IAMD 1RZFL 4YE4L 2ICWI 1CTOA 5D7KD 2CXGA 1MCCA 3N9GH 1KT2B 4QRTB 3EOYG 3DIFB 4PJFB 1XIWC 4Y4FD 4O2FB 1V05A 2MSPA 3U6RB 3QZWA 5FK9A 2AJVH 5DQDL 4EN3B 4NWTH 5L8JB 3A6OA 4I5BA 4PJEE 4HW6A 1S9YA 3ZKXB 4H0IA 1BBJA 3CVIH 4WU7A 4G8IA 3SGJC 3LEXA 4TVPD 3ABZA 3BFOA 4KDWA 4IRZL 4GMSH 2AKRB 3G6AB 5SWZA 4KJYA 3AU1A 2WV3A 4MXQD 1VEMA 4O58H 1MRCH 1BD2D 5DJ8A 1A7NH 1ACYL 1K2DB 1IC5L 3MXVH 2A38A 2H26B 1IGML 5E94B 2Z8VC 1DQQB 1Q9OB 2V7NA 3G08A 5FYLD 3KPRE 2YPKA 2E7CA 3RU8H 3N9GL 4B50A 1ACZA 1LEKA 3BZEB 1H5BA 1B4JH 3GMPB 3PWJB 4NQCD 1KLUA 3UEZA 3B2VH 4P2QE 1JNHA 4ZPTB 5BVPL 4JFDB 4JFHE 1S7XB 4X6EB 2Q6WB 1WAAE 2X70A 1A3RH 4NWTL 4YHLH 1ZLVK 4RDQG 3GSQB 1KCRH 1KLGB 2W60A 4M7ZC 5H37H 5HI4D 4G43A 3FQWA 3E2HC 4NO2B 3L7FA 1ROWA 3EKCA 4RQQA 1EUUA 3W2DH 5CBAA 5EZIH 4WI8A 3ZTJH 2V7HA 4EN3D 4FQ2H 2EXWC 2XWJB 5C07E 4YDJB 4NPYA 1MRCL 1EGJH 4R96A 1WUNT 3BP7B 2E7MA 4PGZA 1U95A 3MXVL 4U4BA 2BXYA 3EZJB 4XX1G 1NBYA 4WCYH 1MCWW 4PREB 2YD6A 4WHYG 1FIGH 1LMKA 3BIBX 3LY6A 1BFSA 4KTDH 1WZLA 1WEJH 3IVKB 1L6XA 4YEEA 5DHYB 2P43B 3BDYL 1NH6A 3B6SB 4OSUL 1A3RL 1FZOB 4NZDA 4YHLL 1QFWI 1KCRL 5FGRA 3ZE1F 3DX6B 5DMIH 1VACB 4UDUB 1A4KA 3BKYH 1TJHH 4LEOB 3EYFB 5GS3A 3G04B 3W9EA 2P1YA 4JFDD 3CX2A 1XCQA 2NTSP 3M45A 4GRMA 1MIMH 3V6OC 1FJ1A 3VFOA 2VDOL 4FQ2L 1FAKT 1LO5B 1Y6KR 5JW5B 4QXGL 3NCCB 1WT5C 2C4FU 4UDTA 4LVHC 3GMQA 2GFBB 4U1JA 2VIRA 1KFAL 4QRPB 3KPTA 3TBSB 2PXYB 4WCYL 5EZJA 3WFHB 2X1XR 1EAPA 5D7IA 2G2RB 5MEPB 4D0CB 4NQEA 1G9MC 2PYFA 4I3SH 5GHWH 1L0XA 4KTDL 1CTNA 1NGYB 1WEJL 3ARVA 5FYKU 1CDJA 2XZCH 4FFWD 3MRHB 2IH1A 5ICZB 5L2KE 1IEHA 4PLKC 4PRBA 1LE9A 1NCAL 5DMIL 3MYZA 3QG7L 4LHUA 3WFZA 5IW6B 5D7LB 3RL2A 1HQ4A 3L6FA 1IZKA 1U8IB 1YPZF 2NZ9D 3PABA 4D9QE 5I1CH 4HGMA 3D0LA 1CXIA 1JPFA 5DYOB 2ERJC 4NM8H 2P5WB 2LVCA 1P4LB 4DKFH 4MVBD 1ORSA 5JOEA 5GGVH 3IU3A 4F33B 1NAMA 3EBAA 5GS1C 4ZDHB 2J8UF 5IM7B 1EVTC 1NDMB 3D25A 1FC2D 2FECI 2IBBA 2I25N 3G5ZA 5T1DH 2J12B 3QYCA 3UJIL 2PKDA 4HC1H 2XXCB 4KKBD 4JFFA 1YNKH 4QRPD 1PLGL 2C1OA 2NYYC 1I7UA 2PXYD 4QRRE 5C08A 5DRZB 5EORH 3C2AL 2XZCL 2VAAB 5D96C 1IGTB 25C8H 5ANME 2XY1A 3DURA 5IT2L 5SV4A 1CLOH 2Y06H 2QHRH 5ITFA 5DVOA 4HS3A 5C0NC 3U79A 3I84A 1BGXL 1Y18B 2J6EL 1INEH 1H15A 4D9RD 1OPGH 3BRGC 1CL7I 4GRLB 4PD4J 1MSPA 1LGVA 4MWFA 3BDBA 2VQUA 3OV6A 5EU5A 2LVEA 3EOBA 5BVJB 4HS8L 2AJSH 4DKFL 1A4JA 1V3JA 1T20B 2AV7B 5GGVL 5D7LD 1UJTA 5EA0H 3HNVH 4JAMA 5GS0C 5DD1H 1UFUA 2UVFA 4ZUVB 4MS8C 2P5WD 1OWRM 1GIGL 2X7LA 3CIQA 3TWCL 4ZOAA 3WO3B 5B39B 2VDLH 5JDSB 1TTUA 2I9LA 3V6OE 3ET9F 3PV6B 4F7PA 1W0VA 3QI9A 1YNKL 3WJJA 3CUPB 5JDJA 4J4PC 4S1RH 2CLRA 1IILE 25C8L 1HXMA 4RA3A 1CLOL 4LVNB 2Y06L 2QHRL 1T5XB 4XZUA 3D39B 4Q7DA 3BD3A 4FXKB 1INEL 1DANT 1XT5A 3UAJC 2JJWA 4M62H 5D1XA 3ALWA 3DGCR 5JMOC 2VXVH 1I8KB 1Q1JH 2Y72A 1MREL 1HYSC 3QQ4B 4WFGD 1H0DB 2F53B 3S97C 2ZP0T 3P3YA 3IJSA 3PWNB 1S78D 3KPLA 2DN7A 4JREC 4MA8L 4GRLD 3DYOA 2BDNH 2GSIB 4OLWH 5K93A 3RVTC 3MRDA 4X6DE 2CSPA 4ONGL 4RFEB 4R8WL 3MV7E 3ECBB 1X5ZA 5B39G 1GC1C 4JPVH 3QHZH 2VDLL 2CDGB 1ZLWH 3TBWA 4KQ4H 3IFOA 1L0YA 4NO0A 4PV9B 1HI6A 2QJDA 4S1RL 1SEBA 3BWAA 1EFQA 4HMEA 2HT3C 2VDMH 2HA1A 2WMPA 1ZHBA 2X4OB 4F7TB 2EDXA 3SGKA 1LEGB 2J3SA 1T21A 2EYSA 1QR1B 4XCCL 1I1AA 1OAZH 3BESR 4M62L 3MGAA 3G9AB 4MNGA 4P2CG 3VRJB 4JR9H 5BQ7A 4CJ1A 1AR1D 4JRXB 1JWSB 1F6LL 1NEZA 4LCWA 4ZFGH 3D39D 4X8JB 5CEZE 3M07A 3O45B 1XZ0B 3FZUD 5JZ7D 4PLJD 3WV0A 4OLWL 1WBXB 2AABL 2YEZB 4WTZG 1OP3H 3OGCB 3VRIB 3EOAA 3STLB 3E0GA 2F53D 3VD9A 5C0AA 4L3EA 2ILLA 2K7QA 3QHZL 5LG1A 4ZO8A 2YSSB 4U6XB 1VFBB 4EVNB 1KCSH 3AS1A 3C6LC 5FO7B 3V0VB 1HHGA 3E6FB 4Y5XC 2NY0B 4XCNA 2VDML 3OKMB 5IFAH 3ULVC 4CJ0A 3O3EA 1OAZL 4LLWA 5H2BB 5JLZA 4PJIE 5DC9B 5SX5H 2FO4B 1E6JH 3KPOA 3O4OB 4Y5YC 5GZOC 4B5EA 5IVXB 2LE9A 1JPTL 2W9EH 4JR9L 4WIQA 4G42A 5D9SB 3I3BA 5I73B 4LP4A 5D7JC 3VXMA 3VXSE 3IXAB 5I71B 1F3JB 2ENSA 1KENH 1J86A 4X6CB 1R3JB 1LO2H 3DECA 1N64L 5H37G 1HCVA 4JRXD 3RRQA 3NGBC 3TZVB 1N59A 5C6TH 4YBLC 5C0FA 4ZTPH 5CEYA 5FYJU 3GIVB 5SX4H 3ZTJG 1KCSL 2F54A 2OSLA 4NQXB 1U8PB 4KK8C 4IRJB 4WV1A 1H3WM 1RZKH 5IFAL 4CU6A 3HE7A 4B53A 5EO1A 4TUOB 3I6GA 3DYMA 5HVWA 5JPNA 5L9DH 4P9HL 2A6JA 4JG1H 1E6JL 3CFKA 3SPVA 3SDXE 2W9EL 3IETB 2Z9TA 4JY4A 3KVQA 5E2WL 2YHGA 1SJXA 4PJDE 4ODTH 1CQKA 4K23L 2ADFH 4JZJA 4YFLI 4C56B 1TXKA 4NC0B 5EBWA 1RY7B 3SN6N 4XNMA 5J56B 1AXTH 2BNRE 4ZTPL 3ZKSD 1L0QA 3QXDA 3OKKB 4OF7A 3SGDH 1TZHB 5A16B 1T5WA 3AC0A 3V5DB 2AS5M 1KPVA 1PZ5B 5AD0B 2J2ZA 1G1CA 2EDTA 5A40E 2Z91A 3GMOA 3TZVD 5I75B 4OLUH 4L5FL 4G9DB 4DWHA 1RIUH 1T03H 5INCB 5L9DL 1CD0A 4KAQH 4ENEC 3BP5A 4OM0L 4S2SA 4YFLF 4IRJD 1GZPA 3IDUA 3UXFA 3SOBH 3D2UB 1S3KH 1IQDB 4K3EL 3MRNB 1Y0LA 2JJVA 4PJBB 1AY1H 1GGBH 3D69A 3TEUA 2JCCE 5BMFH 2GAZA 1OLLA 4ODTL 2D7NA 4WEMB 2V17L 3KLDA 2ADFL 2LTQC 4UIKL 3ULVE 4WRLA 4E42B 2R9HD 5GZNC 4MZ3A 1A7RH 3O3BA 2ZUUA 1LP9F 5J1TC 3QEHB 1AXTL 4FQXC 1OP5H 1IAKB 4FG6C 4RAVA 2X1WL 4E0RB 4HV8B 1FYHB 2ATKB 2XV6B 3TA3B 1BLNB 1MRFH 1XGPB 5KTEH 2BERA 4HJJH 4C56D 2A73A 4Q6IB 1KB5H 3TFKC 2AJXH 4P23B 2CUMA 1A1OA 1T7YA 1QPXA 3PQYA 5DK0B 3DLQR 3GBLA 1DN2A 5I1GH 1ED3A 3BOVA 4R4ND 1RIUL 3IRPX 3BXNB 4JVPA 3LS5H 3T0EB 4IOSD 4KRLB 3W11C 3MJ8A 4KAQL 1AGCA 2AVGA 1QSEA 3MRPA 3SOBL 1WZ1L 2KQMA 1S3KL 4HKBA 4V2BA 4ZSOE 5KANG 4NKOB 4CN4A 3V6FB 1HH9A 1XCTA 4WGVB 4BFIA 1AY1L 5HHPB 2X42A 4YHPB 5BMFL 1N6VA 5FHBL 4NN7C 4MA1B 1BJMA 2YWYA 5TQ2H 1M7IB 3DNKA 3DBXA 3D2UD 3BPLB 5DMYA 4H26B 3CK0L 2LV4A 5IFJA 3VWKB 2IAMA 3RQ3A 4CL7A 1MRFL 2PETA 3VRLE 5KTEL 3DO7B 4HJJL 1IM3A 4DOHB 3LD8C 4PRPE 1XR9A 3GGWB 1CE1H 1ZEAH 3BE1H 4OV6F 6CGTA 1CXKA 3DV6B 1HINL 3GMRB 3EO0A 2AJXL 4A6YH 3HN3A 4XC3H 1XF5B 5I1GL 5CD3A 2GUOB 4HH8A 3TA3D 3LS5L 5FCSH 4M7LH 2FJHB 2Z8SA 2BJMH 4HDIA 3QIBB 5KS9B 1MCHA 1SJVA 4Y2DB 4HS6B 2VH5H 5GJTH 4P23D 2Y6SC 4EEEA 4X5XB 5E8EA 1MCIA 4PJGB 1FV1B 5D1QB 3T0ED 5GPRA 4KKCC 2VR5A 4LPTA 1M7DB 1WC7A 4K3DH 5C0GA 4FFVC 1PFCA 2BY0A 1ORQA 3L3HB 5K9QG 5K9KA 1BD2A 1CFNB 2DWDB 2DDQH 3CC5A 2JF1A 2PYEE 3O41A 4WWKA 3VFUA 4U6HA 3SJVE 2ARJA 3QDJB 3WMSA 1HXYB 1YJDC 1YMME 5LVEA 3MRFA 1XFPA 4WUUE 1OD7A 4CNIB 5IJVB 2W0FA 4PRNB 1ZEAL 4J6RL 1J0YA 1JNJA 2QQKH 3C8HA 3ARUA 4GAFB 4PRAB 3VWKD 4X7CC 4LRIC 2AW2A 5HHOE 3RGVB 1YY8A 3U30C 5IOPB 1TNNA 2YD3A 2Q8BH 4FQLL 4GXUN 4QRTA 3AS0A 5GJTL 4LFHD 1A64A 1QSVA 5E6IC 1KJ3L 4MSWB 5IMOB 4MNQB 4RDQF 5I74C 5F1KC 3QEUA 3MLSL 3T4AA 1SQ2N 4PGDA 4TNVK 1FFPA 5JXED 2DJ4A 3QIBD 2Y7QB 4K3DL 1C5CH 5E00B 5DD3H 1I3UA 1A0QH 1QA9B 4Y2DD 4MD5B 4HWUA 4CDGC 1E28A 1VFOA 2VISB 4G8GB 1DANU 4OIIL 4UV4H 4Y8DC 2Q7YA 5IWLA 5D1QD 4L4VE 3RX8A 2G5BB 3F6IA 3C60B 1VHPA 2AKRA 3G6AA 4V2CB 4OQ1A 4LSTH 4HIEA 3SCMB 2JIXB 1NMAH 3OJ2C 4GS7B 1A2YB 4YUEH 4KK5D 2OMNA 4KZDL 4YFDB 1T66C 3QDJD 2NXZC 4YGVB 1DQQA 4BQ6A 4BZ2L 1WBZA 3WNMA 5FOJA 4KK9C 4L4TB 1RUQH 2VXSL 5DFWH 2Q8BL 4MXWL 2NY3C 3BZEA 4BUGA 5FGCB 5F96H 3GMPA 3PWJA 3CLEH 3U9PH 5F6IB 3RWJA 3TVMC 5CGMA 3SDYL 1UJ3A 4JFDA 3RGVD 1BIIA 4ZFOL 2GSGB 3CFDB 4C4KO 1UM6H 4HKJB 4W6YB 3GSQA 3L3GB 5C0IB 1C5CL 2NW3A 3IDMA 5DD3L 1A0QL 1IGFH 3ZHKA 4UV4L 2G5RA 1H5BC 2MOVA 4MNQD 4I0KA 1S9VB 2WK2A 2XWJA 4LSTL 5FUZL 3VXUB 3O3DB 3MC0A 4C54A 3HMWL 4P3DA 4KROB 3UPCA 1KACB 1LO3H 3BP7A 5A2LH 4G8GD 1NJ9B 2ZCKL 4HK0A 5K9OB 4KI5C 4L9LA 1W8NA 4YUEL 1EJ6A 2CO6B 4J1UB 2ED7A 5ID1A 3C60D 4HQQH 5EC1B 3U0TA 3WIHL 4C55A 1BF2A 3VFRA 5TE4L 4QRQA 4X4YB 5T3ZE 4BKLB 5FGBC 2PW1A 3SCMD 2JIXD 1P7QB 4HCRA 1U41A 5EBLA 1QFWM 2X09A 3U9PL 3CLEL 3WKMH 2EIDA 3LRGA 3WS6A 5J11C 1OT1A 5LGJB 3HI6H 4L4TD 4YHKH 2XZZA 1XF3B 4F15B 7CGTA 5FCUH 2W0LA 1UM6L 2BSTB 1MFCL 1PJ9A 4UDUA 5CSBA 3RJQB 5TPWL 5DJXB 1IGFL 3W0WE 4MNHA 4LEOA 5KBNC 3G04A 3RVVC 4ELMF 1I75A 4N0FB 3BYTA 2X5PA 2MPAH 3LMJL 5JW5A 5JIIA 2R2HA 1G0YR 2HJKA 1S5IL 4PRIB 3E6HA 3QFJB 2H45A 2GFBA 2DM2A 3MRIB 4QRPA 1SY6A 3OXSB 1ZLSL 4HQQL 3TBSA 2XKSA 5DJDB 3VXUD 5T3XE 2ICES 2OTUB 3QDAA 4KROD 4FTVE 4D0CA 2IADA 2G2RA 3WKML 4XVSH 2Z92B 5F9OL 3IDJB 3GM0A 2V2TB 2P42B 4Z7WA 3TCXA 3VE0A 4YBQD 4NC1C 5FCUL 5DJ2B 3QCTH 1P7QD 4UIMB 3VXNB 1MOEA 5GS2H 3P4NA 1N4XH 3ARSA 3QXTA 5T5NG 3LV3A 1F4WH 2XTJB 4NP4H 2PF6A 4LNRA 2EO1A 4QHNB 1MCKA 5MI0C 3RNKA 3BMVA 5I30H 2DIJA 5IR1A 1CGUA 2P5WA 1SVZA 2YK1L 1KTDA 3SDCB 1ERNA 3O3UN 3VMNA 2QLVB 2P8LB 4F33A 3QEGH 4CU7A 1XH3A 3RGHA 3EYQC 4R2GC 2DQDH 3GO1H 1KCUH 3SE4A 5J6GA 1NBVH 4NT6B 1RUKH 1CS6A 4C4KT 2X4TB 1IRAY 3SGEH 4Y2OA 5BXFB 3QUXC 4NOBA 4XVSL 4PRID 5B3JF 3QFJD 2NXYB 1FGNL 4NFCA 1CF8L 4G3YL 5DRZA 5BV7H 4OCRL 4NNPH 1U91B 2ITCB 3PWPB 1ZKAA 3BPOC 3IDNB 4KI5E 4OCYH 1N4XL 1MVUA 3TIDB 3OXRB 1IEBB 5HGGS 2R0KH 2AK4B 4GMTH 1F4WL 3TO4A 1DN0A 1AXSB 3CX5K 3PWLB 1HHIB 3OR7A 4ORZC 5I30L 2BC4A 1U8OB 1X5LA 1C5DA 4WFFD 3CXDH 2DBLH 1KJVA 2NY1C 1P7HL 2XTJD 3QEGL 1D5MB 4M02A 2LAGB 3HZMB 4QEGA 2DQDL 1S9WB 3GO1L 3MLPA 4K3HA 1G7MB 1XGRB 4RMQA 2NW2B 4MYWB 5JNYB 4R4BB 2ADIB 2VN7A 3WNLA 2FEDD 5JHDB 3ARPA 3QNXA 2R1XA 5M7QA 1QBLL 2H1PL 3SDCD 4GBXB 1WIOA 5TDPB 1CFVL 3W9DA 3WIIH 5C3TA 1YNLH 1I7TB 2W65A 5BRZA 2D3VA 4R0LB 4PJ5B 5IB5B 4MHHI 1H3XA 5BV7L 2FIKA 3F7QA 3MRJB 1CICA 4GLRH 4IRSB 4NNPL 4PGEB 5FKPA 5C0BA 3LH2H 3KPPB 1BZ7A 4OCYL 5E9DB 3AMKA 1QEWB 5CZXD 2R0KL 4GMTL 2NXYD 1FVDB 5I16B 4QGTA 5J9PB 4ZS7H 3ZYZA 3QI9C 1JWUB 1TJIH 3EGSA 1AI1L 2HFEA 2ZOLA 2PTVA 3PWPD 3GJFA 3V79C 4XPBL 4GQPH 1IGJA 3ZTNL 3CXDL 5EFIA 2DBLL 5ESAA 2WZPD 2ICEA 3PWNA 3NVQA 1WK0A 2AK4D 3MBXH 1F6FB 4NC1E 4TQEL 4ZFOB 5D1XC 4EI5B 3FMGH 1T0MB 2ADGB 4RMSA 1R5VB 1HSAA 4WTZA 1H8OA 2DQEH 4G6KH 4TSBH 4YO0A 3JZ7A 3TYFB 3VGEA 4I4WA 1YNLL 2CDGA 3GMLB 4P99A 5LKNA 1MNUL 1AQDB 3MCLL 3EJYC 1I9RH 4JB9L 4ODUB 1ZSDB 3IB4A 2CLZB 1OAXH 4LLDB 3V4PH 1MH5A 5IB4B 1FNGA 5JHDD 4PJHB 1OTUC 3RIAF 5KVEH 2AJUH 3LH2L 4GBXD 1I9JH 2EE6A 5E5MB 1QR1A 5HYJB 3G5XA 4LLYB 1OP9A 2K9UA 4PJ5D 4ZS7L 2CMRL 4XAKD 4IRSD 4I77L 2EC9T 1TJIL 4Y4HC 3ARGA 3RWIB 2OTPA 2VYRE 4MX7A 5TDOA 4JRXA 3LPWA 5JO5B 4X8JA 3BWUC 1A21A 5E9DD 1H3UA 2D9QB 3MBXL 1I1AC 3Q48A 4UAOB 4OCMC 1XEDA 2PTTA 2YPLA 3FMGL 4PGCB 1HEZB 3OGCA 3VRIA 4NN5B 1JFQL 1B0GB 4G6KL 1NDGB 3FRPA 2VE6B 2YSSA 2IJ0C 4MDJB 5DSCA 1DUYB 4U6XA 4PJAE 4EVNA 4EI5D 3OX8B 1FGVH 1O0VA 4Q0XL 1OAXL 4U0RC 3V0VA 3V4PL 2DICA 3OGOE 3UMTA 4P3CH 3OKMA 4JHBA 5KVEL 1T1XA 3P9MB 4JQXA 2XKNB 1ZT7B 4M7LT 5IVZB 2FX7H 1F4XH 4KXZH 1AGDA 2FO4A 3WLWD 1RK1B 4P4KB 3PHQB 4EDWH 1KPRB 4X7DC 3FOMB 1E27A 2ID5A 5D9SA 4LBEB 1CK0H 5ILTH 1IAIL 1MI5E 5HYJD 5C0DB 3ZHDA 2DKUA 2ZG2A 4IM8A 1AKJB 1QRNE 2G75B 4X6CA 3ULUF 4UTAH 4YHZH 1YEFL 1YEGH 2DQGH 3CZJA 3TZVA 3SKJH 4O02L 2CKBH 3F5WA 2ORBL 5IG7A 3QIUA 4MZ2A 3ARTA 3T04D 3RWCA 1FGVL 1TTFA 1U8PA 2EDNA 1PVHA 4Z7UB 4KQ3H 4MQXD 4P5TB 1I8IB 5FYKE 3BD4A 4NFBA 5HTSA 4WHCA 1MHPL 4J3XA 4G8FB 1HOCA 2JK5B 3B9KB 3IF1A 1C5BL 4XVTL 4OZGA 4GSDH 4YDVA 1MIEL 5CINH 4F2MA 1ZT4B 4XBEH 1EVUA 3LPFA 5F7EL 2H2PD 2QADC 2ICWA 3P73B 4MJ2A 5IV2B 3T0BA 1TMCB 3ARYA 1VADB 1P53A 1T80A 3DVNA 3HG1B 2VQ1A 15C8H 1HHJA 1GGUA 5B38G 1N2RB 4U1HB 5KANI 1LILA 4P4KD 4OGYH 4R26L 2IFFH 4ZNCD 2VZ3A 4C83B 2IMMA 3W5NA 4YHZL 3BPNB 2DI8A 1YEGL 4HBCH 1JZ4A 2DQGL 3JV4B 4NZRL 3SKJL 3DETC 1RZIB 2J6EA 3GRWL 1TZHA 3SO3C 3UYRL 4YJZL 3V5DA 3NCYS 4FQQA 1AKJD 2MTPA 2NY4B 3TT1H 5AD0A 4F58H 1B3JA 4WFEE 4DKAA 4KQ3L 5DO2D 5BOZG 4YHIB 4JFZL 4XMLH 3PP3K 1X4ZA 4N68A 4XXDA 1QBBA 2DTMH 2UYLA 2E9IA 1FC1A 3UBXB 1QPPA 4MNGE 1S7VA 3OJVC 1CE6A 4P5TD 2EDBA 4HXBH 4QRUB 4JZOA 3AREC 5KSUB 1BBDL 2FYYB 4U6YB 4XPTH 3RDTC 2A6IA 3MRNA 5GSVA 4PJBA 3RKPA 15C8L 3B9KD 3LAFA 4OGYL 5BV7B 4FQJH 2IFFL 1ZTXH 3KYMB 1P84J 4E42A 4AL8H 5C0AE 4L3EE 1NGZB 3SDDA 5IMLA 3BN9C 1AXIB 3HG1D 3WNOA 5CGTA 3BO8A 4R7NB 5I1LB 1RURH 1XGPA 1DVFC 4GG8A 5TF1H 1AC6A 4A2MA 2ZUXA 2VLRB 4M1GH 4Q6IA 1ZOXA 3QDHA 1ZLUH 3MUJA 1NCTA 5GS2D 3VDCA 3RIFK 4P23A 3K8LA 4XMLL 3WCYA 4WU5B 3C9NA 1W0WA 4LCCB 4ZTOL 3UBXG 2DTML 4HMDA 3O9WB 4IMKA 3QEQA 2NY4D 2V5YA 4O2EA 1UQSB 4JM4H 4CKVX 3T09A 4HXBL 2VUYA 5EOCJ 3OAZK 2NLJB 4PJCE 4LLUB 2BY2A 2HVKA 2GHWB 3Q1SH 1KYOK 1X4YA 3MRGB 4X9HA 2XPGB 4IS6B 3LVEA 2K3TA 3VXME 2F74B 3JXAA 4N0UA 3OBAA 4FQJL 1ZTXL 3KPNB 4HLJA 5GGSY 4JO3L 4Y19B 5EOTB 4H26A 4K2UH 5KAQG 2GJ6A 4RRPA 1U36A 4C59B 4BJLA 1BZ9B 2WBJA 4IOFD 4JM2C 2D7MA 4LPXA 2F54E 5J57B 1ZVSA 1RURL 5CBEB 3L5XH 3EYOB 3DO7A 3MOQA 1IM9A 5DJCB 5IROC 4L8SA 4NJ9H 1CR9H 2AP2A 2B1AH 2NY5L 1G7JA 3GGWA 4M1GL 5FF6B 3DV6A 5F1NA 3KG5A 3NZ8A 5CP7A 3ULUL 3RPIB 4HWNA 1GPOH 2IMNA 2DAVA 4HWBL 4JE4B 4DFIA 3FB8A 2IAMC 4QF1B 5E2UH 2VLRD 1JMZA 1ZA6A 1DEEB 4HS6A 3IXTB 4E9LA 4X5XA 4Z0BH 4APQB 3VWJB 1FV1A 3O9WD 4Y4FC 5D1QA 1AJ7H 4G6JH 3SE3A 1GHFH 3B9AA 3OF6D 1A7OH 2MNUA 3L3HA 4K07A 4K2UL 1ND0B 5IP4A 1BECA 2DWDA 1AGBB 2CDFB 5CJOH 1CXHA 3DMMB 4WW2C 1OM3H 1OT2A 1HXYA 5DRWB 2R0LL 3NFNB 2B1AL 4Y19D 4DVRH 3MA9H 1UCTA 1HCFX 1K6QH 4MXQC 4RMTA 5ICXB 5F93C 4PRAA 1FL6A 4G7YL 2IWGA 2DF3A 1GPOL 3H8NA 2CRIA 1KCLA 3RGVA 5F3BB 1I7RB 3Q5YA 3QNYB 1JZ7A 4LAQH 1X5HA 5B8CC 4KRPB 2QQQA 1BMGA 2APBA 4ZD3H 5DDHB 4Z7QF 1EK3A 3NCJH 4NIKB 3BEWB 4MSWA 4Z0BL 5E2TH 1AJ7L 4G6JL 4X99A 1L9NA 1GHFL 4BQCA 4OGAD 3QO1B 2H3NA 5E00A 4I18B 5CFHA 1DSFL 2I07B 2EDHA 3MMEA 4O4YL 4MD5A 3AS2A 2G9HA 2VISA 2H8PA 3LEYH 3L5JA 4H0GA 4KJWD 4APQD 3VWJD 5HI4C 1GOHA 5CJOL 1U3HB 1OM3L 2G5BA 4HFUH 2VDNL 4RAUA 3LQMA 1K3ZA 3C60A 3QULB 5FYJE 4DVRL 2DQJL 3DUSA 3OWEA 3SCMA 1AO7E 4AG4L 3GJFK 3RHWF 1K6QL 3Q3GB 3ZKXC 2VLKE 3MV8E 3PQYE 2B4CL 3DMMD 1IQWH 1WTLA 3KPQA 1YUHA 1F8TH 4YGVA 2W0PA 2N7BA 5IWLC 4XC1H 5HPMB 3DPBA 2OTWB 1MRDH 1QSEE 4LAQL 4F3FA 1DEDA 3FB6A 3OZ9H 3HR6A 1BQHA 1M6OA 5CJ5A 3SKMB 2NX5A 2X40A 2CKBB 2O5ZL 1KBGL 1A9BB 1N3NB 1K3IA 2R1WA 3FL7A 5F7UA 1VGEH 3LQAH 4HKJA 4OCXH 4KRPD 4LRNH 4JVWA 2QSCH 3F7YA 1I3VA 4KH2A 4OD2B 4G6MH 3LEYL 1SJHB 3B5HA 4F37F 2R15A 3ARFB 4Q9RH 3UTZB 5BZDB 3QPXL 3U0WL 1P4BH 4WUKH 4NSKB 2BHZA 3ZYOA 4DUXA 2EH8H 3O3DA 5DD6B 2IALA 4GT7A 4JKWA 1EEZB 1ITCA 2VLLA 2WIIA 1L7IH 1U3HD 4K7FA 3AAZB 1Q9WB 1QZ1A 3LN9A 1IQWL 2EKSA 3BI9X 4XC1L 4X4YA 1DQMH 2AERT 5FA3B 1V3KA 1P7QA 5EH1A 3Q6GH 5SWSA 1ZLVH 2IPKB 2R2EB 3UYOD 4TVPE 1BQLH 3T3PF 1UCBH 4PYGA 4J2XA 5FAAA 3A67L 4N1EA 1XF3A 2Y36H 3LQAL 2EIZA 4NZJA 5JOFB 4WI9A 1EX0A 2BSTA 4PP1D 4LRNL 3FN0L 4FFWC 2WNGA 4OFPA 1KEMH 4PY7B 1BD2E 2I60L 1T1WA 3QJHB 1JI2A 1G7QA 2VZOA 5GGTL 3UZQA 2VLJA 4Z76B 4Q9RL 5DURB 4ZUWA 4L8BB 4Y88A 3CSYB 3WS6C 1P4BL 3PGCA 4K3JH 4WUKL 5FYLE 2DJUA 2NZ9C 1K8DB 1OW0C 1F02I 5FM4A 3U4BL 4NQCE 1ZA3A 3CFEB 1L7IL 3ARFD 3LKRB 4MVBC 5ANMB 3N1FC 5T1MA 1D6EB 2EYTA 4G7VL 2KZWA 3MRIA 4KC3B 4YIQA 4I2XB 3OXSA 3GK8H 4X4ME 3C5ZA 5E8OB 4HUUA 3LKNB 4LKXA 1DQML 2OTUA 5IMKA 2E6JA 4ZAKB 4PJFE 4ODWA 3WLBB 4EDXB 2Z92A 5CWSB 3V6ZB 3TH2T 1BQLL 5DHXB 1MCSA 3MUGB 2G60L 2V2TA 4KKBC 3V6BR 5DEGA 5EU7C 2VJXA 3WKNA 3ZDZF 4OZHF 2PXYC 3MBEB 5CMAB 3WN5A 4DQOL 3O3AA 4LPUA 1KIQA 1KEML 1ZS8A 4E41B 3KAAA 3QUYB 3TN0B 4GRWB 2HG5A 4MQSB 4K3JL 4KDTC 2EEDA 5I8KH 4FQHB 3DROB 3UTTA 1N7ML 2WW8A 3O6KL 4LASH 2BRRH 2BVOB 2P8LA 3ZKQD 3OR6B 3SDAB 4DVBB 3S88H 5FUOH 1J5OL 1CG9B 5DURD 1A6VH 1JV5B 4HPYH 2A9NL 2VZVA 4G6AD 4XX1E 3GK8L 4JKPL 4OBRA 1UYWH 2ZCLH 2RJMA 4PJXF 1TPXB 2DTSA 5BXFA 3PG2A 3ZKMD 3WHE1 2VL5B 4QTIH 4JFDE 3DI3B 3HZKA 1II4E 3B5GA 4MAYA 3D0VB 3KPSB 3NCFB 3BVNA 3X11B 3SE4C 2ITCA 5IQ7H 4ZAKD 2Y23A 1IEBA 2BVEA 2AI0H 3CVHH 5AYQA 4CADB 1AXSA 3SKUD 3T4YA 1GCFA 4GH7B 5JOPD 3STZA 1HHIA 5DK2B 4NZTH 5EZOH 1PY4A 3KPMB 4BA8A 1MCPH 1U8OA 4K9EL 3EDFA 1I9IH 1G0XA 3MBED 1NBQA 2FB4H 5I8KL 3VI4F 3BKML 4TYUA 4E41D 4Z7VA 4RZCA 3QUYD 3TN0D 3S88L 5FUOL 3U7YH 2J4WL 1S78C 5ICYA 6FABH 1A6VL 2CJUL 3HZMA 1S9WA 3P9WB 3H9HA 5KVMC 4GRLC 4KMQA 4R4BA 2ADIA 1MAJA 5D1ZB 5EIIB 3R06B 4GBXA 5IIEA 2BMKA 3SDAD 4PJ7F 1RAMA 3FQTB 2CPCA 4PJ5A 3OB8A 5IB5A 5CILH 2PCPB 3BGMA 3MRJA 4IRSA 5FHAH 1T7ZA 2BNUA 1JIBA 4NO3A 4YAQA 1CWVA 2Z93B 3P77B 5LGHL 5GGRA 1F45A 3DTXB 1QEWA 4NRXB 2AI0L 1FVDA 4ISVB 2MMXA 2I24N 4BELD 4NZTL 5EZOL 3KPSD 3HZVB 4MQ7A 1I9IL 3S96A 4P46A 1N0XH 4P57B 4LVNC 1AR1C 3LKPA 2EDLA 3QUZA 3U7YL 3WHE0 4EI5A 3LCYA 2XQYK 4QRPE 1OB1B 5EU7E 2GTZB 2WAHA 4HWEH 3FZUC 5JZ7C 4PLJC 1FL3A 2ADGA 3TYFA 3CU7A 1JNLL 3NACL 2QKIA 4JQVC 2DLEA 1FLRL 2IG2L 3GMLA 5T5FH 4DN4H 3H9SB 1J87A 2VABB 4WO4A 2ITDB 4ODUA 1FNSL 2CLZA 1MY5A 4LLDA 3I02B 5CILL 5IB4A 5C0JA 1IGYA 4ETQA 4PJHA 3AUVA 2D7TH 5D1ZD 5FHAL 1UKTA 3L3IB 3IJYB 2LFGA 5D7LE 1INQB 4X98A 1UG9A 4CU8A 4UUJB 4XNQB 2FD6H 3GDBA 3VFNB 3WIHA 2VDPL 3FFCA 4GXVH 1PAMA 2P5WE 4S1QL 4QXWA 4PBVC 4HPOH 5JO5A 4QOKB 5DUBA 4XB7A 3F7VA 4LIQE 3DRTA 4FXLA 4R7DA 3FCTB 5KSBB 3RI5F 1HDMB 5A1AA 4JREB 5EG6C 4HWEL 1EIBA 4HIIA 3ARRA 3TGXA 5EULV 5TDNA 5GGUB 4JG0H 3V5HA 1DUYA 4DN4L 3OX8A 43CAA 3IFNL 5I15H 1ZHLB 1BZQK 4N8PA 2DLGA 4POZD 8FABB 2D7TL 4WFGE 2HFTA 3MJ7B 1H3PH 2AJYL 3P4OA 3ZYJA 5EC2B 3H9SD 1JGVL 3F12A 1RIHH 3C2SA 2FD6L 2FHFA 2V2WB 5DQJB 4R3SA 4P4KA 3PHSA 3PHQA 1N8ZB 1GGIH 4YPGA 4LBEA 5TE7H 3OJDB 3SY0B 2PR4L 2A2QT 1NLDL 2D7OA 3FQRB 4NZUH 1WLHA 1HILB 3GI9H 3CNKA 2VZ1A 4H25B 1YN6A 4RBPK 3O4OC 4QRSA 1KELL 1W72L 4KVCL 1NFDF 4QOKD 4CN1A 2FWOB 1MEXL 5E0QA 4JG0L 5CIPH 5JHLH 5I73C 1GAFL 1NMCB 4FFYH 1BOGB 1A8JH 1GJIA 4NRYB 5I71C 2QEJA 4XNXH 4XRCB 4Z7UA 3K0WA 1EXUB 4P5TA 4CVWA 4XHQA 4YDKH 3D39E 3VFVB 1XGYL 1H3PL 1KXTB 3TZVC 4G8FA 3WDJA 2DQHH 1QR4A 4YDLB 1RIHL 2JK5A 4RFNB 3KLAB 1JZ3A 1HH6A 1WJ3A 3UBXI 5F1OB 3FT2A 1A6TB 2JJSA 4OCSH 2DM4A 3P73A 4X9GA 2WINA 4IRJC 4JN2B 2F53E 5TE7L 4YX2H 4CBPA 4Z8FL 3RY6C 1CGWA 3IJHB 4PV8B 4U1HA 3GI9L 4HSQA 5TQ0H 1D5XA 1U8MB 4K7PX 3C5SA 3OTTA 2OXGA 3MRCA 3BMWA 3RUGB 5GIRA 2R9HC 4KJPD 5JQ6H 3EO9L 3RWHA 2V6HA 5JHLL 5FM5M 4QNPE 3QDGA 1AHWA 4FFYL 1IKFL 4XNXL 3K2MC 4P5KB 4YHIA 1JGEB 1YQVL 4ZO7A 2Q3AA 4OLYH 4LDOB 2LAAA 2FO1A 3H7LA 4ODVH 4R4NC 2V2XB 4E5XA 3OQ3B 4OCSL 4QRUA 4JRXE 1R3LA 2FYYA 4U6YA 5J12B 4X7EC 4YX2L 4XVUD 4MA7L 3WS3B 5I75C 5HHXL 3WD5H 3QWRA 4X80H 3BEVA 2HRPH 1YY9D 3G6JF 3VI3E 5H94B 4W81A 2VDKH 2YPLE 1UB5B 1T04A 3RNQB 2R29H 1LNUB 3I6KA 4L8CB 1OAYH 1ZHNB 3T0VA 1LDPH 1CFTA 3DI2B 5JQ6L 3CVHB 3PDDA 4R7NA 3LKQB 2AK1H 3QA3B 1UZ8A 3R1GH 4M5YH 3V95A 4N0RA 3RY4A 2GK0A 1JYVA 3RZCB 5BO1H 5T33L 5ERWA 4WU5A 4LCCA 4OZIB 3O9WA 4OLYL 5D93B 4XHJD 2FH8A 5IVXE 4YZFE 1UQSA 3TA3C 3DRQB 2FRGP 3GSUA 5JPMB 3OF6A 4O9HH 1LVEA 4Q6IC 4MJ6B 2CRYA 3MRGA 5C09B 1RFDL 4P23C 5DUMH 4FRWA 3WD5L 5CJXA 3F58H 3TBVA 2HRPL 1TZIA 2VDKL 1EMTL 4IMKC 3CSGA 4X6CE 3T0EC 1TFHA 3ARXA 3FTGB 1OAYL 4OUUB 3JTTA 2FEEL 1DDHA 5J7CC 5IGXH 2AK1L 3LN5B 1NCDH 3DX7A 1VESA 3DX9B 5CBEA 1UGNA 1DBMH 4LAJH 2KKQA 4MA1C 4PJEF 4U1KA 4HUKB 4M5YL 5FF6A 1A9EB 5F6HJ 4XPAL 2PO6B 3BPLC 5K9JH 4FFZH 1QO3B 4JHZA 1Z3GL 1A3LH 5BJTB 32C2A 3VWKC 4OZGE 1BFVH 3D87B 3UJTH 1FZMB 1M7XA 4QF1A 3VXRB 1Z9OA 1DEEA 2HP4A 1PG7H 3RZCD 1HWHB 2XICA 4HUWB 5HVGB 4ONHA 5JW4Q 3U2SB 5DUML 1G9EA 4WI4A 4IBLT 3G6DH 1YEEL 4C56E 1C7SA 1DQLL 1FRGH 1WITA 5JXEC 1AGEB 3QIBC 1ND0A 4YWGH 1D5ZA 1IBGH 4Y2DC 3FT4B 5C09D 2UZXB 5IGXL 3NFSH 5F89B 1MLCB 5L7XH 1WAAF 1LO4H 5D1QC 1DBML 3NFNA 1NAMH 1QLEL 3CD4A 2CLVB 4UQ3B 2XWTB 5K9JL 3FQXA 4FFZL 4R4FL 3LDBB 3PP4H 1A3LL 3FJTA 1JPSH 4KK5C 2AXHA 1BFVL 3UJTL 3MROB 5I17A 2APFA 1RZJH 2PO6D 4Q9QH 3BEWA 2ATPB 5IW3A 2EIBA 2E9BA 4PJBE 2DQFA 5DLMH 3SHSA 1OTSD 5CZKA 1SYVA 3FFDA 3A0OA 1NC4B 4M61A 3QO1A 3RGVC 1S9XB 5MEQA 3O6LL 4P2RA 1FRGL 3VXRD 2ZJSH 3ARBB 5HDQH 2I07A 1FDLH 5E70A 5F8QC 1TIUA 3HFMH 1Q0YL 1U3HA 3NFSL 4KRNA 4BZ1L 1F11B 1PBYA 2P7TA 3O4LB 1GH7A 1LWRA 5HGDB 3X14B 4P0DA 5J1AA 1XGUB 4FS0A 4HFWB 5I1DA 5DJZA 2J5LB 5MP6H 3Q3GA 5EPMB 5CCKH 4ZXBA 2GJJA 5F97E 3PP4L 5IEKB 3C09B 3UROR 2X1QA 3T0EE 1RU9H 3BZ4B 4Z95H 4J3SA 4TNWK 3C60C 1JZ6A 1Q94B 1I1YB 1A7PH 1EEQA 3HR5A 3SCMC 1CD1A 2UWEB 3SKMA 1XGQB 3CDYA 4PG2A 3L3JB 4OKVA 3GRWA 1DP0A 1L6ZA 5CIPB 2E7LA 4GS7C 1A9BA 1IEAB 1N3NA 1RHHB 2KBGA 2GYSA 2Z35B 5HYEA 5HBBA 3NH7L 1SJHA