4ODWA

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
218
structure length
208
Chain Sequence
VKLVESGGGLVKLGGSLKLSCAASGFTFSSYYMSWVRQTPEKRLELVAAINSNGGNTYYPDTVKGLFTISRDNAKNTLYLQMSRLKSEDTALYYCTRLYGNYVRIHTMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords A6 Fab (IgG2b kappa) light chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
total genus 34
structure length 208
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA01
5ENWB 3KG5A 1JWUB 1Q9OA 1VPOL 3HMWL 4S0TD 3PL6B 2XNAA 4ODSH 4OLWH 5GGRY 1H8SA 4OZIB 4PUBL 1HZHL 3EO0A 3H9SE 3PP3H 1D5MA 5JORA 1I1CA 3CVIL 3W0WA 5F8RC 4ZTPL 1IKNA 4ODVH 3G08B 3O2WH 2IQ9H 3TBVA 2X1WL 5KG9B 3EHBC 3TO4C 1F4YL 1SQ2N 3NH7H 3LRGA 3UBXB 3IAGC 5GJSH 3LKQA 3OBAA 3AMKA 3L3HA 1F90L 4FQPA 2WW8A 5DK2A 1SYVB 1MWAA 4X4ZA 3BZEB 1TCMA 4I0PA 5ANMB 5IBTL 1V3MA 1QSED 2DQTH 5IFHH 4HMEA 4JGUA 2PO6A 2OMBA 3PUCA 1AFVL 2P5EA 4JFYA 4M43L 2DMBA 4KRPC 1DP0A 2W9DH 3T65A 4X9GA 3RGVA 1ZHBA 1FQ9C 4NFCA 4MJ6B 2FJHA 2VUYA 3SHSA 3QQ9D 4K2UH 1HSBA 2FBOJ 3HAEH 3QG6A 1MJUL 2EEAA 3ARDD 3QDGD 3P9MB 1BAFL 2QQKH 4OZHB 3PJSB 5EFIB 3WN5C 2JJWA 2ITDB 3IRPX 1BX2A 2QQNL 4IRJC 1V3KA 2HLAB 2VR5A 1IFHL 1NC2D 3G5VA 3B9EA 3LAFA 3S37L 1T1XB 4MD0A 3UTPD 3FQTB 4P4KC 5IHUH 2HWZH 4XGZB 3WHXB 4GJTB 5JHDD 2C1PB 4PGDB 1BD2A 1I1FB 4PY7A 3IXTA 1DDHB 3TFKD 2GT9A 4P23D 3F65A 2D7NA 2ORBL 1Q38A 3HPLB 2AAVA 4G9FA 3VGGA 1O0VA 2PYEA 3VWJC 2KBGA 4YX2L 3WFBL 4UINL 2KQMA 2WBJD 5T3XE 4XNMB 2P46B 1W0WB 3QH3A 1OT1A 4PGZA 4ZTOH 2DIBA 2YKLH 2HVJA 4OTXH 3T4AA 1EUTA 2J8UE 4LSVL 5KS9B 2Z8SA 3QISA 4F7CB 1C1EL 2CUIA 3FFCA 2FIKA 3CSPA 2D7TH 3QIBA 3KXFA 1UGNA 2Z31C 1KOAA 2B20A 2J7LA 3IJHA 1ZHLB 4HUWA 4D0CB 1CD0A 1KJVA 1B0GB 3A67L 3MV9E 5I18L 4JHAL 1CTOA 3TIDB 4PG9A 1CD1A 3V5HB 3G5ZB 4L8BA 4NC0B 5DO2D 3ZKMC 4QXGH 2AV7A 1JK8A 4CRPA 1LO4L 2AK4E 1YJDH 3QUZC 4XH2B 1HILA 4JDZB 3BOVA 4HK0A 1NH6A 5BV7C 3UYPA 1XIWC 4UMGA 3FFDB 4OZGF 4LU5H 5FGCB 4NN5B 4U1HA 2ZUSA 5KVEL 3QULA 5C0IB 3RU8L 5J9PA 2EDXA 4AZ8A 4OI8A 4WW1B 1IMHC 1KJ3H 3HE7B 4I5BB 4ODSL 5IEHB 2WBWB 2HVKB 2DJ4A 4R7NA 2YBRB 4KPHH 1BQHA 4DN3L 2W9EH 3O2WL 3V6OA 1A6AB 1QHOA 5DHVH 4NQEA 3P0VL 4YLQT 1EGJA 4OUUB 5GJSL 3MYJB 4JFZH 2XKNA 3TVMD 3QDME 4EVNB 4YXKH 4GMSL 3WJLC 4JRWA 1W8NA 1Y6MR 4N0FB 1G9MH 1NKRA 2EDRA 5E03A 2DI8A 1VKXB 5EZIH 3DO7A 2ZCHL 5C08B 1QZ1A 1H15B 2XWTA 1XGQA 3GSNH 1NGWA 4JLRA 3RY6A 4Y1AD 2X6MA 1JZ4A 5HHMB 3AREB 1C8PA 3C5JA 3R0NA 4P59L 1NCWH 2A2QT 4NHUA 1UEYA 4NFBA 4ZO7A 3T09A 4W4OA 4Z7UE 3EOTL 3QIUD 4TVPE 1A9EB 4XNYH 1CVSC 3QO0A 1X5KA 3IGAB 4MZ3A 4GT7A 3LEVH 4FQQA 3Q1SL 3O4OB 3MRJA 4LDOB 5DVNA 3MACH 5BOZG 5IMMA 2A83A 2FL5B 12E8H 4XP6L 5F7FA 2I9LA 5IHUL 4DOHE 1EH9A 1JYVA 5C0AB 5HGHB 1RZKL 2BNQA 3VFWA 4P5MA 1QR1A 3VFUA 4JVUA 1OW0C 1YNKL 2Y72A 4HBQA 1S9YB 4M93B 4OKVA 3ULVF 3MA7A 4YDJB 3LQAH 5I0DA 1H3PH 3JBG7 2PYFA 1TVBA 4ZTOL 4CN4A 1GZQB 1UC6A 1MHHA 1GOHA 4HFUL 1J18A 2J6EH 1P7QA 3RZCD 1U3YA 5DGQA 3H7LA 1P2CA 3QFJB 1HHJA 4UI2A 5HHOD 4GG6A 4R9HA 3JTSA 2QSTA 4V2BA 1ACYH 1FFNA 1CD8A 1M7IA 2FH8A 4P2CG 1WIPA 4KHXH 1NCBH 1G6RB 5E8EB 4IHOB 5HGAB 3NN8B 1HYSC 2PUQT 1JWSB 2F53A 1QLFA 3G6JA 1Q9LB 5KW9H 1UVQA 1MF2L 3ARBC 4H1LB 4QXGL 3L3KA 3P9LB 1F3DH 2ZUYA 2BOCA 1G7PA 3QUMH 3Q2CA 2FBJL 3IFOA 1P1ZA 5EOCH 4S1QL 3KDMA 3LVEA 2ZJSH 4XCCH 3MLWH 5GGVY 1RHHB 4HGMA 3BFOA 3B9KD 5C0FB 1AO7A 3OZ9H 1YPZF 3D0VA 4JFFD 1AGDB 1N2RB 2Z93B 2OL3A 4KKAD 3E2HB 5MENB 3L6FA 5IHZB 3PIQB 3G5YA 1OP5H 1MCWM 4Z0XB 5HYJB 3QUXB 4HJJH 1CD9B 2VKWA 4NOBA 1FYTD 5TE6L 1WAAF 5D9SA 3KLAA 3KPRB 4QCIA 1DR9A 4YHZL 1U8KB 3MV9A 3TH4T 3VXUB 3E6HA 4PGCB 4OD3L 1IEAA 4RFOH 4D9RE 1XR8A 4JKKA 4BH8A 2C3VA 2R1WB 5GRJL 2YN5A 4X6CF 2A9NH 1HIMH 2JJTC 3VI3F 4EQ2A 4WHTB 5F93C 5I75C 1CXLA 3M8OL 3QB7C 15C8H 5ETUA 1RUML 3IS0X 4XWOD 5LQBL 3ULVD 4JKPL 2XZCH 4EIGB 1NAMH 4X7EC 2BP3A 5I71B 1A6WH 3U4AA 3D69B 4L5FH 4FP8H 4QRPD 3CFDB 4L9LB 3TA3B 2YMXH 1T21A 1KC5H 4XC1L 3HE6A 5IMKA 5EORL 4MAUL 4NO0B 3QJHB 1P9MC 3I6KB 4PV8A 1HSAA 5DRWA 4OB5L 1NGXA 2EXYC 2X4OB 4TUJA 5CSZB 3JVGC 1RIHH 2F19H 1JPFA 2VKXA 3BP5A 3G5XB 3IXAB 2R1YB 3UTSB 3M07A 1FDLH 5L2JB 4KU1A 5T1MB 4XMLH 1X5LA 4P2OC 1XGRB 1HQRA 4YDVA 5FIEA 4LOUD 1G7LB 1OP3H 1I8IA 5C0JA 4QHMB 3OKKA 1IVLA 2CKNA 2ZUUA 2ZPKL 3UDWA 5INCB 2AW2A 3S5LG 4HJ0C 5E5RB 1RZKC 5I1DB 4JDTH 4N5ED 5INDA 4OJFH 2AJYL 3MLVL 3QUYA 4LRNL 2J6EL 5FOJA 1P4BL 1SY6H 4TRPL 5D1QA 3UC0H 4Z7UA 5TF0A 3ARFB 3Q0HA 5F1IB 4ZXBA 3ECBB 5D72L 4HWZB 5DD1H 4JM4L 4QRRA 2X1XR 5I73C 4QRUA 2HG5A 2RQ8A 1KIQA 2J8HA 5CEYA 3MLSH 1IAIH 3AU1B 3BKJH 3ZDZE 4KHXL 1H3VA 2AEIT 1DQQA 4ISVA 4P46A 4P2QE 3RBGA 5AAWA 4NC2B 4YC2C 1YPZB 5D7IF 5E9DB 1CXFA 2VLKB 1YMME 1AGBB 4LLVA 2VLRB 3GIVB 1KCLA 1W72H 4C4KT 2IALB 1HCVA 3BT2H 3C60A 4XMPH 5DQ9A 3QIWA 2F54E 5EU6B 4HIIA 3WXVH 3QQ3A 2F8OA 1XF5B 3FO9A 4S1RL 4F7TB 3CFBB 1YDPA 1U3HB 1GRWA 3FRPA 4KQ3H 3Q6GL 4FZ8H 4XCCL 4P2RA 3KPNA 3QEQE 5DFVD 4U3CA 3PHOB 2DS4A 4WWID 4X6FB 1Q0XL 2OCFD 5D8JH 3RDTB 1F11B 4JY4A 4X6CB 2JIXB 4H25B 1G7IA 4EXPX 4WO4D 1S9WA 4E41B 1S7XB 4EUPB 4MSWA 4LHJB 4J3XA 2JF1A 4HJJL 5HI5D 3RWIA 4M9PA 1FE8H 5CJQL 3LEYH 1D9KA 4HCRA 4MQ7B 3CLEH 5DMJB 5IQ9A 1CFNB 4QY8B 3WNLA 1OGAD 4PJ9C 1CDGA 2BK8A 1I8KA 4QRQA 5F9AC 3V0VA 5LXGL 4U1IA 1XH3B 5F6HI 4ZOCA 5GIRA 2GEEA 4XRCB 4M6ML 4IMLB 4PJ8C 5FA4A 3H0TB 3IFLL 1GGCH 3B5HA 15C8L 5IKCA 3H42H 1MPAL 3KPOA 4RA3A 1JWMB 2MQ3A 3KPPA 2VLLA 1N26A 1PEZA 2OYPA 4EIZC 1SJHA 1INDL 3SDCC 4JFDD 1NCCH 1JYXA 4XP1L 1UWXH 2V2XA 2ERJC 3DX8A 4KC3B 1UWGL 3BP7A 3NABH 2YMXL 5JZ7D 4MD4B 2QADC 1IGMH 5HHVH 3VXPB 43CAB 3CMOL 4L8CA 4J2XA 1LNUB 4NM8L 5DWUH 3F7RA 5SWSD 1BIHA 1VDGA 5GS1A 2DQGL 3P4MA 1NQBA 3O6LL 3O9WD 4PGEB 4PLOB 1G7HB 5I1HL 1UG9A 5IVXF 2V5MA 1UEMA 1XCQB 1J88A 2Z4QA 5GGRA 4K07A 4NKOA 1E28A 2V5YA 4RDQG 1A6TB 2NXZB 3PV7A 4M7JH 3MJ6A 5JDSA 2NX5B 3UTTD 4EN3D 4JCMA 4DAGH 3LQZA 1CDUA 3T3PF 3RHWK 1NDMA 4JDVA 4QXWA 4JRXA 4FQXD 4FQJL 1TVHB 3MGOB 4PRPD 1S7SB 3UP1A 5IIEB 5E5UB 3WFCL 2JB5H 1PYWA 4WWKA 4WDIA 2BSTA 4M8VA 4OQ1A 1T04B 4L3ED 1U92A 4F33B 1SY6L 5ERWB 1JL8A 1P7KB 5D2NE 4KMTH 5J12B 5DD6B 5TJWK 4X9FA 4UV4H 4JHBA 2E27H 5DD1L 2GCYB 1DVFC 5DMKB 1F8TH 4XPGL 3IVKA 2FEEI 2EEDA 5C7XL 3OGCB 3MLSL 3HI1A 5DLMH 1CGYA 3W9EB 4Y4HA 1BVKB 4NCC2 5CBAA 2BERA 3NACL 1NMAH 2VQ1A 3GHEL 1A1OA 2GY5A 3NPZB 4G6JH 3ZHKA 1W72L 2Q76A 3D0LA 3IKKA 1N6QH 2E7LA 5JR1H 3AFLA 2HFEA 1N4XL 4N8CL 2VWEC 4XPFH 4P4RA 3WXVL 1OY3B 3GI8H 3S4SB 1TQCB 4HT1L 4U6TA 3ZDYF 3TJHD 1B2WH 3W11D 2X4QB 3W9DA 1N59A 3LPFA 1IBGL 2NR6D 4ZNEA 2XFXB 2C4FT 4L3CB 3FN0H 2J12B 2H3NA 3QNYB 4PS4L 1YNTB 4LCWB 3D6GA 1JRHH 3HRZB 5FAAA 2J88H 3HUJA 3GMRA 3RWEA 2Q3AA 4KAQH 5FKPB 1QPXA 3C8KB 3T0XA 1U8PB 4R90H 3IDJB 5GSVB 1G7QA 2FSEA 3PGDB 3VGAC 4ODWA 5H2BA 1F5WA 3RGHA 3T8XB 5D7JB 4LF3B 4PRAB 1YMMA 1IGCL 2YPVH 2E8ZA 3T77B 4BSWA 1DBMH 1IAOB 5FO8B 1RZIA 5BXFA 2GSGA 2IC2A 3EJYD 2IQAA 3HB3C 1OAQH 4OM1H 3DYPA 1I7ZB 2CLVA 3MUZ1 4KY1L 5CIPB 5IVXB 1MVUB 3LH2H 3RI5F 1K4CA 1LK3H 4PRDA 3NZ8B 2WQRA 4N0CC 4J4PA 2EDOA 1PKQB 1MHCA 4NQTA 5A2JH 3C5SA 1YUHA 5CGYC 4U7SA 5HHVL 2RCSL 5LKNA 4DKEL 4KXZI 4Y5XA 2FWOA 1V05A 1JFQH 4W70A 4IDLA 4LCIL 2DIAA 4CADA 4QHUB 4OF6A 5CWSB 3OTTA 3ZMRA 2ZCLL 5IBUG 3ZKND 2FX7H 4QOKD 2VE6B 5I9QB 3WUWA 4F57L 4BH7A 3X11A 5K9KA 1KJ2A 3STLA 3T4YA 2HJKA 4Y5VC 3O6FC 4XI5D 5TH2B 2HTLC 2NW2A 1NMBL 2UZIH 4PRHB 2YRPA 3DVFA 5D4QA 4EI6B 4YDLC 3ALXA 1VACA 2EC9U 5JXEA 3FB7B 1MRCH 3PGCA 4GQPH 4OD2A 4NUGH 2ICWA 5LGJB 1S5IH 1VGEH 3TO4B 2FO1A 4X5WB 4KKCD 3RFZC 4KK6D 4OGZA 5D5ME 1U91B 1SHMA 1WCQA 2V7HA 2V5TA 1EFXD 3PWPD 1OAUL 1G1YA 4UT6L 3HR5B 4TNWK 5IK3A 1MCJA 1KJMB 2VYRE 5ISZD 4XNXH 1WFNA 5ESAA 5I1JL 1CIUA 1IGJA 2C7UA 3AS2A 5B8CA 2AJVH 4KRPB 1NL0L 5CSGA 1RJYB 5DVLA 3BRDA 5DLML 5AYQA 1JTOA 5DJXA 5FK9B 2HKHL 4PJAE 1NMAL 1S5HB 3VD7A 1A7RH 4ZUVB 2X4UA 2Z35A 1CE1L 4G6JL 4MXWH 1MCQA 5D7KE 4ZG1A 4R7DA 5JR1L 4K8RD 4NNXB 4GG8A 4MYWB 3WN5B 5T3ZL 3SY0B 4AIZB 2OM5A 1EO8H 3CFCH 1J1PL 4IRJB 4POUB 4WRLA 1B2WL 4K7PX 4MCYA 4P4KB 3VGBA 1SMAA 4KI5E 5FOBA 2F9BT 4YO0A 3QRGH 2VDPH 3FN0L 4OAWA 5C0CE 3MR9B 3VD3A 2VITB 3KPMB 1QSFB 1FZKA 2HJFB 2QEJA 2NY7H 2NZ9D 1X3DA 3HNTL 1YEEH 4X8XA 2BOBA 1L6ZA 5IG7A 4LARH 2J88L 2BRQA 2OSLA 1QFOA 5J8OA 4KAQL 3VWJB 3OHXB 2NCMA 1KCVH 5HI3D 3CC5B 3O11A 5JO5B 4F7EB 1WBZA 2AEQH 3MRFA 4LHUA 1F6FB 3QCVH 5CZVH 1ZGLP 1E4KA 1BZQK 3HA0A 4OZFB 4I0CC 5EO0B 1WBYB 4BFEA 2DL2A 3QI9A 1WZKA 2IAMC 5DTFA 2Z31B 1OAQL 2ZCKH 4HIEB 5IBLD 1LGVA 4XX1G 3WIHH 2OR8A 3SDDC 1KV3A 2RBLA 4W4NA 4HULB 3VRJA 4NCC1 4MB4A 1OL0A 4LSQH 4LCCC 5EA0L 1B4RA 1LK3L 3V4UL 2DLIA 2HKFH 2H1PL 3WUZA 3O0RL 1DUZA 1EBPA 3LEXA 2A1WL 1LVEA 4RAVA 1GHFH 1QSEE 1MIEH 1FFPA 4FMFA 4OCYL 1ERNA 4O5LH 1H5BA 3QUZB 3PP4L 1AE6L 3U48A 5BV7B 1XIWB 3LN9A 4ODTH 1U8OA 5JW4Q 4QHKI 6CGTA 4LSPL 3K4AA 3K7UA 1U95A 1OP9A 5DUPL 3CDGA 4F8QA 1BEYL 3QDGE 3VH8B 1GPOH 3UJIH 4V1DA 1N64H 3BH9A 1MI5B 4ALAH 3WIIL 1HHIB 3U7WL 3UTPE 4XNZC 3SJVA 3TBYB 2H32A 4XTRD 3QNXA 1MRCL 2NY6D 5JHDE 1NC4D 3QJFA 4I3SH 3X17A 4ZYKB 1ZXQA 3GO1H 1VGEL 3P0GB 1MWAL 5DJ0B 5H35B 1VEMA 4N0UA 2OZ4A 4UAOC 1GCFA 4Y88A 5KSAD 4U7MA 4MB5A 2AJSH 4P57B 4CN1A 3MTRA 1KENL 5D2LF 1FZJB 1KCRH 4BA8A 3MX0A 4XVSH 4P9MH 3BXNA 4F9LA 3QEHB 4UZGA 4XNXL 3FONA 5GRXG 2P7TB 2P42B 3PGFH 1ES0A 1BHGA 1KCKA 3QDJA 3U9UB 2LE9A 4FXGA 4YHML 2P5WD 3QNZB 4IS6A 5GGTH 2VDLH 3ZYJA 4NWUH 2V17L 1XGYH 5MERB 1BQHG 5E8PB 3K8LA 3MRIA 4HLJA 4S1SL 4KZDH 3DECA 1FG9C 1J1OL 2ZSVB 3CFCL 1FO0H 1Z9LA 1ZT1B 3PV6B 1C16A 2YD2A 4M62L 1IEHA 3GEWB 5DMYA 4G5ZL 5DEFB 1G7JB 1GJIA 5IM7B 3DURB 1BECA 1LP9A 4J3SA 3V6FA 5I2IA 4KROD 3O3DA 3QO1B 4GRMB 4HC1H 2ZNXA 4ELKB 1H3GA 1HYRC 4DFHA 2DLTA 3C6SB 1XZ0B 3O45B 4ORGA 4HG4J 5IHBA 3QPXH 4ONHA 3PQYB 1A5FH 4Q58C 4U6VH 5AG9A 3KPLA 1B0WA 5CZVL 5IWLC 4ODHH 4ELMF 3VXSD 1JF1A 4UU9A 1QKZH 1V3JA 3VFOB 5B38B 5GZOD 4KH2A 5IQ7L 3DBXA 4XB8A 5C9JB 3VXMD 2M2DA 1UZ6F 4LQ1A 3BDBA 3WDIA 1ZAGA 3OXSB 1QYGH 1JWUA 1RJCA 3UZVB 1P5UA 4E42B 3HI5L 4WU5B 2VN4A 5SV4A 4F7MB 35C8L 4Y19D 3PL6A 1RVFH 3V2AR 1DBKL 1RUAH 3B83A 3PDDA 5D7LD 1T2QL 3F58H 3ZTNL 4MNQD 5KVGL 3I9GH 2HKFL 4EXKA 1ZA3B 3GBMH 3RWGB 4D3CL 4XMKH 2FEEL 3I3DA 5ADPH 3FT4B 5C0CA 1CZ8L 2X42A 3G08A 3EDFA 3ARBB 3BEWB 3NIGE 5SWQA 3U9PL 5KG9A 4Y1AE 3SKMB 3MNWB 5T3XH 4F80A 3ULUD 3PG2A 1JF5A 4CVXB 1N0LA 5EZOH 2YUZA 3TYFB 4ZOAA 3PWVB 4Q0XL 5T1KA 5KZCB 2ZOLB 3BZEA 1LE5B 3AAZA 3ROLB 3NTCL 5F89B 2CMRH 1LEKB 5FDYA 3NA4A 3U0TB 1R24B 2EYTA 4P0DA 5SX5K 4XVUD 1SEQL 3EDJA 5DC9B 5DZLA 3N1FC 4ALAL 1J86A 2ILLA 4FNLH 3BP6B 1EGJL 3BISA 3FQUB 3FRUB 5EN2B 1U8HB 3GSRA 4PJGB 1FORH 3HLAB 3P9MA 4OV5B 4GRWB 3E0GA 4Q9RL 3SDAC 5EIIA 2ITDA 1JGVL 3EYVB 3P30L 4QRSB 5IT2H 5I75B 1TETL 1MCSA 3HKFA 3LOWA 4P9ML 1MCOH 1T66D 2IWGA 4XGZA 3WHXA 2C1PA 5BOPA 1MJJB 4PGDA 4I0PC 2A0LC 3WFZA 1UADC 5HHOE 3VXQB 1AD9B 4ZFZA 3ARDA 1YYMH 1UA6H 4XNMA 3ZE1F 1S9KC 4M7KH 5HYQA 3K2UH 4MA3B 1GAFL 5E7FA 4X98B 1FCCA 2E5EA 5KS9A 1MCPL 1FO0L 4FFWD 4F7CA 2C3GA 4S11A 2DM2A 1S7UB 5F8QC 2WWMD 4NPYB 2HT3D 5F9JB 1D6VL 2GTZB 4P23A 1MLBB 2IBZX 4P2OB 4RZCB 2UWEB 4JN2A 4JY6B 5C70A 1FFOB 3L5IA 4OCXH 4MJIB 4HH9B 4FA8A 3VXTA 3MRKA 1ZHLA 3D39B 4MXVF 1BM3L 1RFDH 1B0GA 2NY5L 1JN6B 3TIDA 3OKOA 1OARL 3K81A 3G5ZA 4JFFE 4HUXB 3HZYA 3V52H 2P8MB 2OJEB 3MREB 4ONFH 5I8OL 1EZVX 3U0WH 5ELIA 1UXWA 1IRAY 4C56D 1OTTD 4JFOB 3FT3B 3FFDA 1QKZL 3OKEB 3ZKXB 4HAFA 1FYTE 5I73B 3B2VH 3C8HA 4LPWA 1DZBA 4OLUL 1QYGL 1AR1D 4OGYL 4RWHA 4WW1A 4M6NH 3CPLB 3HE7A 3DMMD 5T33H 4YC2B 3DGGB 5F6HJ 5LBSH 2HVKA 1I3RB 3LMJH 3OKDB 5EWIL 3JV5A 2CUHA 3ULVE 5DJ2A 3NCYP 4NZUH 3T3MF 1A6AA 2W0PA 3OAYH 2BY0A 4UB0H 1T0NA 3TT1L 2BHZA 3MRHB 3K2MC 5B39A 1J1XL 4HIXH 4YEFA 5JW5B 3BAEL 4QRPE 4LSTH 4BZ2H 3CIQA 4N0FA 3VFMB 2D2OA 2ICWI 5C08A 4TNVK 5FV1L 4IRZH 4JEGB 1PX4A 4X7SH 4HK3J 3AREA 3VFVB 2A6DB 1QLEL 1C7TA 4U3HA 4MA1C 5E6IB 4ESKA 1H3WM 5HVGB 4I4WB 1J8HB 4WI9A 3DROA 3TVMA 1H0DA 3GZKA 2D9CA 3LSOB 1FORL 2P47B 1IC7H 2E8YA 1NFIA 4JREC 4X7CC 3DVIA 1TJGL 4PJ9B 4JFXB 4XC3H 3IGAA 3L7FB 5KVDH 5JA8B 3WXWL 3KPTA 3D87B 1E4WL 5F9DC 2W65B 5D1ZC 4U3XA 4PD4J 2FL5A 1MHEB 2BVQB 3FRPG 5CJXA 1MCOL 4PJEE 5DFTA 5HGHA 4YHLH 2D4DA 3SDCB 3WO3B 1BIIB 3T08A 4FTVD 1RZ8A 2ERJB 1S9YA 3LN4B 3RY6C 3W2DH 4I2XB 2QADB 1CU4H 1YYML 5I17B 3RJDA 1WAAE 4RRPA 5EZJB 3ZE2F 2J8OA 1XGTB 2GW5A 1IGFL 1C5BL 4QT5B 5HHMD 2CH8A 4FRWA 3WS6A 2CJUH 1ZVSA 4RMQA 2GYSA 4MLSA 5CP3A 3OKMA 1CLOH 3PWUA 4BZ1H 5CLWA 2BJMH 1FVDB 2R0WL 4OCXL 3KLHC 4NHCL 5E8EA 4IHOA 5DRNA 4OZGA 1FL6B 1N0XL 2DLFH 5FYKU 1JWSA 2R2BB 4LAJH 4AIXA 2VSDA 4D9LL 1Q9LA 2BVYA 4NQDB 2YD3A 4H1LA 5C0AD 5E56A 3FJTA 3P9LA 2EYRA 1FHGA 1A3LH 4G80B 4Z0BL 4TVPL 2NY5C 2Q7YB 2XZAH 4WNQB 3TPUB 1DVFB 5C0FA 4LVHC 2CDFB 3UTQB 1IC1A 3S35L 1PW3A 1AGDA 1N2RA 3FOMB 3ZE0F 4ODXB 2DQCH 3SBWC 4J3UA 4O2CB 4MAYD 4FXKB 2OK0L 1OGAE 1QRKA 4PREA 3UO1L 3B9AA 3PIQA 1J0KA 3RA7H 4B5EA 5LBSL 4OQTA 3UJTH 5SX4I 5HYJA 1RURH 4PJFF 4KJPD 1VGKA 1U36A 1KLUB 2YD1A 4PRNB 3KPRA 4Y4KD 2BHUA 3VWKD 4I77L 4PGCA 1VSCA 4JFDE 2J3SA 4M61B 1CBVH 5DD3H 3DTXB 3CK0L 2IPTL 1AGEB 2O5XH 3RL2B 4WHTA 2X1PA 4XPAH 5FUCE 5SWSE 1M7XA 1EEYB 1EJOH 4BSJA 1IC4H 4N68A 5MEQB 1WSST 4PJCF 4EZMA 5H37H 4Y0GA 4LDEB 2IPKB 4YBQC 3P73B 4U1NA 5F88B 3OJVC 4AH2A 4ENEC 1FYTA 1MCHA 3DSNA 1J05B 1Z3GH 3FL7A 2FGWL 3CFDA 2R1XB 1TJHL 3L3JA 4L9LA 3TA3A 3KYMA 3DUHA 1ADQH 1UH3A 4K3JH 1NLDL 4NO0A 3QJHA 1S9XB 4NGHH 5IW6A 1ZK9A 2IANB 3VGAB 3OKLB 2X4OA 3UTTE 1KCSL 3OX8B 4C54A 1UM6H 1E4XI 3OJMB 3VFSB 1AI1L 2I9TB 3RBSA 1QNZL 2IH1B 2PNDA 4A6YH 3WKMH 4X6DE 4LEXH 4PRPE 3IAPA 4Z7OF 4HBCH 5L2JA 5F7YC 4PRID 1TJIL 4YFEA 4ZUSB 4CBPA 4YHLL 3BRFA 4L3EE 5F6IC 3TCXA 5JLZB 4MNHB 5BVPL 4MA7H 2ITCA 5KSUB 3BZ4B 3PF2A 3DV4B 1VADA 2BCKA 3W2DL 5EOQH 3ZYZA 4Z76B 5INCA 1I8MB 4ETQB 2NTFB 4XBGB 4X5XA 4WGWB 4DUVA 5J11C 4DKFH 1KYOJ 3B8YA 3EYQD 5F1IA 4YDKH 1YMHB 3RVVD 4HWZA 1ZLVH 3ARXA 5CUSH 2AJUH 1ZEAH 3TBTB 3SN6N 4Y5VB 3O6FB 1OAKH 1QBLH 2VR4A 3U83A 3KHOA 1BF8A 4X5LA 4JQXC 4WU7B 5CEXA 1YPZA 1U8NA 1HDMA 3QAZC 3LKRB 4NSKA 5AUMB 3UTSD 1F6LL 2D4FA 4CW1A 2B0SH 3GSQB 5HI4C 2DWDB 1OWRM 3MBED 2EDYA 5E2WH 4GBXC 2VTFA 1KIRB 3MGTA 5ID1B 4K3DH 3RWHB 2XZAL 4NO2B 4PJFB 2M1KA 4Q6YA 3NCJL 4I1NB 2MHAB 4ODBD 5TQ0H 5IJKC 1WAAA 4Z7WF 4WUKH 5JDJA 5HDQL 4HKBA 5EOTA 3AGVA 2DQDL 1AH1A 4UT7L 4K55A 5IMOA 1F11A 1UCTA 4X6CA 1M6OA 4H25A 2DQHL 5DJCA 5H94B 4DGYL 4KUZL 3SDXF 1JBJA 3OPZL 3BEVA 1D5IH 1C08A 1U0QA 3UJTL 4LQFH 1RURL 3MJGX 4KRNA 1ZLUH 5IP4A 3DLQR 1YQVH 3C08H 1UYWH 1I85C 2L4OA 2XZQL 1I9EA 3BGAA 1CFNA 3ME0A 2EDFA 1CBVL 3C60C 1WWAX 2ADJB 5DD3L 1XH3A 1ZANL 4MQXC 4XRCA 2VLRD 5HYIA 1TCRA 3H0TA 1W72B 1X6NA 1I9RH 2VC2L 4PJ5D 3MBXH 2BVUA 5FHAH 1YN7B 1JWMA 3QA3A 4XP9H 4N0RA 5JQ6L 2IBGA 1CDIA 1KTKE 4YUEH 3WNKA 1N5YL 2PTVA 4NKDB 4KK5C 3PABA 2UUDK 4XCEA 3IFPA 1FG2A 4GW5B 4QOKE 5GSRA 4HQQH 4EDXA 1ADQL 2EDLA 2VAJA 1OGAA 1VFMA 4J8RA 4GAGL 3RDTD 5C0GB 3I50L 1B0RB 2JIXD 1CWVA 2R29H 2CIKB 2O93L 1G7HA 1OLLA 2EO1A 3JZ7A 4LEOB 4D9QD 3OAZK 1XCQA 3ILQD 2P4AB 5GZND 3VMNA 4A6YL 1MRFH 3KLSA 4NBYB 3N1MC 4NZRL 5L0QC 4JFDA 4HBCL 3SDDB 4OZ4B 5T1LD 3O2VH 4A2LA 4Z7VB 2Y6SD 2ENYA 2H9GB 4LCCB 1D3CA 1LO0H 4MA7L 3PWPE 1NCTA 4Z5RB 1I3UA 3KYAA 3LPGA 4KI1A 4L4TB 4E9LA 5ISZE 1TVHA 5C3LD 5IIEA 2LU4A 2QR0A 4M5ZL 3VJ6B 2MKWA 5IEKA 1I4FB 1A9BB 4KKLD 5EULV 3MCKA 5D7IA 4O58L 1T04A 1PZ5A 4F33A 5ERWA 5GS1C 5DD6A 3DSFL 4DKFL 4LHUG 4YDKL 2Y4SA 2BRRL 3BRGC 4LSUH 2GCYA 1K8IB 1BQLH 5DMKA 5B3JE 2I27N 1MHPH 4TQEL 4FQCH 1MFBL 4KK9C 5EO9A 2AJUL 4JB9H 3MRCA 3P4OB 3K80A 2GJJA 1ZMYA 1F3RB 4FQXA 4TUOB 5SWZB 3RQ3A 4Z7WB 3N9GH 1MUJB 1MRDL 4NRXB 4BQCA 5E2VL 2AERT 2HN7B 1IKFH 1T22B 2VLJB 3OG6B 2EICA 4JRYB 5EIQA 5AYUH 4BKLB 5AZ2H 2B0SL 4F58H 5JHLH 4HKZB 1D6EB 1FSKC 4K94L 3OR6A 4UAOB 2NX5D 5E2WL 2XTJB 1X7QB 3QDAA 4K3DL 4YHIB 5MEOB 2X4QA 3EJZD 4RAUB 4WWKC 4G7VL 4U0RC 1OB1A 4QEGA 1A1NB 25C8L 2XFXA 4BFGA 1MCWW 1MFCL 1T1ZB 1R5WA 2Q1EA 2ESVA 4X99B 1DLFH 3S96A 1CYGA 2D9QB 4F7PB 1E27B 3Q6FB 3OJDB 5GS0L 4W6WB 5FKPA 1D5IL 3C8KA 4LQFL 1FPTH 1U8PA 2VXUL 2ATKB 3VRLF 4HUUA 4C58B 5MHSD 3LS5H 3MV7D 5GSVA 1Q8MA 2X70B 3PGDA 1P7HL 4JO4H 2XRAL 3GSVB 4PRAA 5DT1H 1G7MB 2V6HA 3TP4A 3BPCA 4OGAC 1HHHB 3T77A 5HHPA 2WINA 1IAOA 4HF5H 1MJ7H 3E6FA 1BBJB 3ARTA 4FFVC 4LIQL 1MAMH 3TEUA 5FHAL 1J0ZA 5CIPA 4XP9L 5JA9A 2CSPA 5IVXA 4WI6A 1MVUA 3T2OA 4YUEL 3D85B 5I19L 2APBA 4JANB 1I7TA 1OTSC 3NZ8A 1QBMH 3DIFB 4XCFL 5FKAB 5BZWA 4XCNB 4AL8H 3X3FH 3D2UD 3LRHA 5DUBA 5IVOA 5IV2A 4JAMB 4M1CC 1GC1L 1OHQA 3CX2A 2WP3O 1ZKAA 2KKQA 4S0SD 2R29L 4LCWD 4KVCL 5CWSA 4C57C 4LPYA 4RGOL 1MQ8A 3SQOH 1MFAL 1JMZA 3B2UD 4WW2C 4NQCD 4PLJD 5F1KC 2X4RA 4Z8FH 4ZAKD 1ZV5A 1T5XB 5TH2A 1FNGB 2HT4D 3DI3B 4EI6A 2I07B 4I0KA 4YZFF 3FB7A 5DZOA 4I48A 3SE8L 1BVLA 5F1NA 4XHJD 1KPUB 4JE4B 4K9EH 3TO4A 4N90D 4LAQL 5IGXL 4OLXH 1BFSA 2F8XC 2DB8A 4K3GA 4OCRL 1YA5A 2EH8L 2ZZUT 4PP1D 2P5WE 1FJ1A 2EZ0D 4Y5XC 2P45B 1KSRA 3C5ZD 3RWJB 1BQLL 4FFYL 2F8VA 1WZ1L 4LLUB 4JB9L 5I1LB 1CFVL 4X7FC 1PY4A 1UQSB 3IFNH 1FLTX 1WISA 5GPRA 4GKOA 1RJYA 1RZGA 3TGXA 5DMGC 5FK9A 2DJUA 1T80A 2XNAB 3U82B 2OZ4L 4ZFGL 1CL7I 4QTHB 1FL5B 1GZPB 5EBLB 5AYUL 1EFXA 5L2KD 5D70H 1MFEH 1NCAH 3F5WB 1TVDA 5JXEC 4P3CH 4NNXA 3AVEA 1Z0MA 2P8PB 3SDAB 3WN5A 3SY0A 2HRPH 1UENA 3V7AE 5DJ8A 4IRJA 3UBXG 1FFRA 3NZHH 2VZ3A 2VXTH 1XF3A 3L3HB 4HV8B 5C0BD 3Q48A 4OCSL 5DK2B 4XWGL 4WHDA 2ZSWA 4OD1L 1QA9A 4I0PB 3MR9A 4K94C 1OQOA 2Y23A 2VITA 4XNUL 3KPMA 4DWHA 1HHGB 2EIZA 5E8OA 3MLXH 1QSFA 4MJ4A 2HJFA 1FZOB 4ZODA 1MJ8L 2WLZA 3VXSE 2PO6B 3KR3L 1AC6A 3UYRL 1FH5H 1FL3B 2D0GA 3VXME 5B8CC 3MLUL 3T65B 2Z8WC 4JKMA 3CC5A 1ZHBB 4Y19E 5HJ3A 4F7EA 5D7LE 1AXTH 3THMH 2FJHB 2IG2L 1RQ5A 4MNQE 4JO4L 3DXAD 1HSBB 3EDDA 3SDYL 2FD6H 1FGNL 1WBXB 1NGZA 4OF5A 1CFBA 4Z7NF 3BO8B 5GS0C 4DKDC 2FIRT 3HC4H 5D2LE 1MJ7L 5TPWH 1P5VA 1BOGA 2O5YL 4QLRA 3ULUE 4G43A 2XWBA 4MD0B 3W5MA 1EV2E 1Z5LB 4QRTA 4PLNC 3HG1D 4GFTB 2A9MH 5C2BL 1BD2B 4APQD 4IOFC 4R4FL 2ICWJ 3BKMH 4YJZL 5D2NC 2HFGH 4PY7B 3IXTB 1U9KA 4LASL 2YHGA 4IRSD 3X3FL 5I76B 2J1KA 4G9FB 2O5ZL 3QUZA 3RWDA 2AXHA 5CJOH 4HS8H 2R0ZH 1XIWA 2F74A 4POZD 4Q9CA 4UNVA 4KDVA 4YHOL 1AGCA 1QRNB 3T4AB 1HK6A 5FYJD 1ITCA 5BMFL 1OT2A 1E4KC 3MNVA 2EDHA 4IDJH 1GC1C 1N6UA 3FFCB 1ZVYA 2FIKB 2X2YA 1EHAA 3QIBB 4F9PA 1TTUA 5I1GH 1CXHA 2PTTB 1NJ9B 2R69H 3K74B 4OZIE 4DGVL 4O4YL 5JPMB 5JOPD 3FOLB 1RUPH 3HNSL 3IJHB 3TBYA 3SGDI 1KJVB 2OX5A 5ITFB 1DLHA 4ZO8A 3NCBB 4K9EL 4LPUA 4NZJA 4PG9B 1CD1B 5MP6H 3TBSA 4NN6C 3JWDH 2AI0L 2BSED 1NAKH 4L8BB 2RHEA 2AV7B 4WUUD 2DLEA 1JK8B 2DMKA 5GRVK 5ANME 4ELME 3BGFC 1H5BC 1FZJA 1HILB 5F97E 3QEHA 2C4XA 1GGBH 1UZ6E 2CK0L 3BN9D 5D6DA 3MXVL 2P7TA 3D18B 2VUOA 4F37K 4GQ9L 3QULB 4MA1B 2HRLA 1QSZA 4XVJL 4YBLC 2CR6A 3OR7B 3ZT5A 4LGSB 2ID5A 2FX8L 4YHNA 5E08L 1NBVH 4FQIL 4OZHE 3GJFH 1MFEL 4UDUA 2CXKA 4JREB 5MERA 5E8PA 1A64A 2HTKC 3OGOE 2HRPL 4R0LA 1MI5D 3OF6A 2ZSVA 1JGUH 3NZHL 5D1ZB 2J8UF 4L4VD 3FTGB 4KTEH 4U49A 1G7JA 2NY1C 5IM7A 2DQIH 2XWTB 4RGMC 1XGQB 4F9LC 1OW0A 4C56E 4JLRB 5HVHC 5BS0B 4HKXB 5IUSA 5J13C 5CJ5A 3O45A 4Y16D 3I6GA 4G8FA 1YEHH 4MD5B 4PPTA 4NHUB 1HN1A 4O00A 1XAUA 4M3JA 3IU3A 1RZJH 4HHAB 3NIFF 3CFIC 5L88L 4RMUA 3DO3A 2IFFH 3WFEH 3VFOA 3QO0B 3HC4L 2N56A 5C9JA 4WCYH 4FQQB 1C7SA 3CFEB 3MRJB 4F7MA 1CICD 5C07A 1JNLL 2A83B 4JZJC 3SQBA 1DCLA 1QFHA 3GBNH 1FO0B 3TT3H 4ERSL 4CMMA 4UILL 1PD6A 2BNQB 3GRWA 4S2SB 3VFWB 2R56H 3VFUB 3FT4A 3V4VH 3WSQL 1QFWI 1TITA 3QWOB 4OKVB 3MNWA 1T0PB 2R23A 4R4NC 3MA7B 2KZ1B 1KB5A 4CVXA 3QBTB 8CGTA 3MV8D 1QQDB 2F5AH 2PYFB 4RRPG 5DDHA 4M5YL 2V2TA 2HLFD 5HGBB 2X10A 4LVHB 5EU4B 1LE5A 3QHTC 2ZUWA 4Y19A 2YC1A 1SMOA 5I74C 1P7QB 4MNQA 1P2CB 1HHJB 3PQYD 3TZVD 3U0TA 5T5FH 3L1OL 5JUEL 1N3NB 4EI5C 4JO2H 1JHLH 5D2LA 3BDYL 3O2DH 4XCYB 3FQUA 5EN2A 2CKBH 5DGRA 4KI5C 3HLAA 5MP6L 1QLFB 2G5RA 3G6JB 4HX1B 4FTVE 2JKXA 1M4KA 3MOQA 4H1LG 1UVQB 1DBJH 3EYVA 2FNBA 2BOCB 4R8WH 5D1XD 3UPRB 3MCG1 2QQLH 2B1AH 1OGTA 3BUTA 4XBEH 3KDMB 1X5HA 1GGBL 3H6JA 4K9EC 5HGDA 5TFSH 1MJJA 2XY2A 3V8CA 5HHME 3PWLA 2X09A 3R1GL 4LVNB 3GMLA 5CZKA 1NCDH 4PB0H 3VXQA 4CMHC 1S9VB 2QSVA 1FIEA 2J8UB 1AD9A 3HPJB 4EDWH 3L6FB 1FGVH 3T3ME 2VXQH 3QHZH 4OFDA 4WTWA 4MA3A 4C83A 3OKNA 3KLAB 4QCIB 1Q0YH 4NO3B 3MV9B 3E6HB 1JPGA 1VA9A 3GSWA 3SKUD 1OAXL 1XR8B 4AY0A 1IM3B 2C3VB 4NPYA 5ALBL 5F9JA 5C0AE 4JY5L 3MRRB 1FFOA 2JJSA 3C2AH 3HC3H 4ELMA 2AK4B 5ETUB 5L8JB 3D39A 4G9DA 4YGVA 3NFPA 2OJZH 1LEGA 3BWAB 1RY7B 1DN2A 1Q72H 1URLA 4IOSD 3QQ9C 3DRQA 3CSGA 2P8MA 3F7VB 1CF8H 2OJEA 4XPTH 3ARDC 3MREA 3VD9A 5IMKB 4PV8B 1RZJL 3VXNB 1HSAB 4J7RA 5DRWB 4X4XA 5J11B 3NGBC 2DD8L 4JFOA 2D0HA 3FT3A 4TUJB 3LV3B 2FATL 3BYTA 2FB4L 1X5XA 2YPKA 4OCWH 4PJ7F 4WEBL 4DW2L 1JPFB 1GIGL 4WI7A 1Q9KA 1KTLA 5GHWL 2QJDA 4KWUA 3CPLA 3OAUH 3QDMB 3TFKC 4P23C 3GBNL 1I3RA 1SEBA 4YDVB 2MPAL 1NUNB 4P2OD 4U6YA 2NY0C 2WBJC 3MLZH 4C56A 4OF3A 5C0JB 4KKNA 3MRHA 4LGRB 3OKKB 4MJID 4GBXB 1WV7T 3TWCH 2Q86B 1BGXL 5JW5A 3GIZL 3AXLA 4FZEH 1CL7L 5C1MB 4G6AD 3C6LD 2BXZA 1YEFH 2X4SB 2LU7A 2N7AA 4EOWH 3UCRA 4LL9A 3VXOA 1F4WL 3ELAT 4Z7UB 4L1DA 1MCBA 2C3WA 1OCWL 3RTQD 3OB0H 1T3FA 3B43A 4QRUB 3RP1A 1JHLL 2HG5B 2VDQL 2A6DA 1KIQB 3VFVA 3TV3H 3O2DL 1A7OL 3BSZL 5CEYB 3GMNB 1LK2A 4QXUL 2YK1L 3L5XL 4ISVB 2RIKA 5IMLA 4PRIE 2CKBL 5DO2C 5ESVA 3LSOA 4J6RH 4DOHB 4LLVB 1MREL 2LVEA 5HYSB 2DDQH 3Q5OA 4PJ9A 4ZD3H 4BQBA 3C60B 4TUKH 3L7FA 4TPRL 2ADIB 1DQLH 5I8CA 1ZOXA 4PJ8A 2W65A 3QQ3B 3VFTA 1NFDE 2B1AL 2QQLL 1CDJA 4LRIA 2P49B 2BVQA 5LCVH 5CINH 3GM8A 5DHVA 4P2RB 5TFSL 3T0ED 3DUSA 1GGUA 1MCEA 2RGSA 3SDCA 1BIIA 4NDMB 4Y5YC 3CU7A 1KG0B 3CH1B 3QXAA 1NBZA 3LN4A 1DE4A 4JY4B 1A3RL 1G7IB 5I17A 4M7LT 1FGVL 3MGAA 1S9WB 4EUPG 2ZP0T 3N0PB 2R4RH 3ULVL 3GSNA 1KBGH 4LP4A 4MSWB 1U41A 4YPGA 2MJWA 5BRZD 3RWIB 3TVMC 1IEBB 2FLRT 3CVHH 1WEJH 1Q0YL 5EH1A 5DUMH 1D9KB 5E6ID 4Y8DC 4HW6A 3UTSE 3LZFL 5HGGS 1V5JA 4QRQB 5L0QB 3ZSSA 2GJ6D 3STBA 4KKBD 3C2AL 3HC3L 4PJCE 1SJXA 4PJHF 5IKCB 2DQEL 3INUL 3KPOB 2GSIB 1FL6A 1U2CA 4YEEA 3ZDZF 1NSNH 1IGYA 4MQTB 3CAFA 4AEIH 1SJHB 2K7QA 2R2BA 3IAQA 1Q72L 1T03L 3V79C 2V2XB 1A14H 3DX8B 3WHE0 3QIUC 4NQDA 3BP7B 4WW2F 1CF8L 2B5IC 2BSSB 4P9HL 2Q8BH 4L8CB 4LK4A 4IJ3C 3ZDXF 5J89A 5GS1B 5TF1H 3VW3H 3P4MB 4MDIA 4WNQA 3TPUA 2QADD 1DVFA 2CDFA 1PG7H 3CH8A 3UTQA 1MCCA 3FOMA 2R15A 2R0KH 3DGCR 2Z4QB 4G3YL 4O2CA 4NKOB 2J6EA 2VO5A 1RZJC 2XQYK 5EU7E 3OAUL 5B22A 3F6LA 5JDSB 3MC0A 2RB8A 4JPKH 2VLRE 4PJ5E 2VDKH 1CGWA 5I1KL 4MMXC 1KB9K 4HZAA 1U6AH 1YEJL 2FJFA 5C0RH 1NDMB 4PRNA 1REIA 4X80H 1FSKB 3VGHA 2Z9TA 1Z6JT 4OLYH 3T0DA 1I7UA 4WI2A 4CVZA 2VNCA 3NVQA 3PHQB 3LDBC 3RZCC 1PYWB 5JIPA 4WWKB 4U0RB 3RL2A 4YHKL 1B4JH 2DICA 2WUBH 5TE7L 1LE9B 2C5DC 1H3XA 1BPVA 1RUKL 4R97C 3QUMA 1ZTXH 2HP4A 4KHTH 4MWFA 4D9QE 4WTXA 3U7AA 1JGEA 3MO1B 3BKYH 3HNVH 4WHYH 1QFUL 1PG7W 1MLCB 3VWKA 8FABA 2B1HH 4OFIA 4LBEB 5C6WH 3EYFB 1S9XA 5CBAB 3IETA 4P5TA 2IANA 4U6XB 4Z78B 3OKLA 1A1OB 4EBQH 2Q76B 3D0LB 3MODH 5I6XB 4ZD3L 2I9TA 2HFEB 4MS8C 1KLGB 2YXFA 5E4EC 3LQMA 2V2WA 2NY4D 4HXAL 3B9KC 4DVRH 2X4PA 1VEOA 3ZHDA 2J2ZA 3WIFA 5K9OA 3TH2T 5E2UL 4N0YL 1CDCA 4KKAC 1N59B 2CK2A 3MLTB 2CRIA 4AEHH 3E8UH 4JG1L 3MOBH 3H3KA 4NN7C 5HY9A 4HWBH 3BZ4A 3SDXE 2X9WA 1OM3H 5AZEH 4Z76A 1BZ9A 1A7NH 2ARJA 3RWEB 5B3NA 1SM3H 1NAMA 1A4KA 2GITA 4N9GA 4NQSB 4LLAA 3STZA 1CK0L 4ETQA 1T5WA 2X05A 2AV1B 2GI7A 4M7LH 5E2TH 1WEJL 4P2QB 4PRIA 5H2BB 5DUML 4OCNC 4TULL 4WW2B 2IADB 1YMMB 3K4DA 3PWNB 4JG0L 3RL1B 4XWOC 3ULVC 1SJVA 4QTIL 1TZGH 3SKJL 3TBTA 4KVNL 3BQUD 1RZIB 3EO1B 4FFZH 3T2NH 5BXFB 1XGUA 2NX5E 4Y5VA 3O6FA 1MCFA 3RIFK 3TO2A 1N8ZB 2F54B 2LV4A 5C09D 2R9HC 2XXCB 3EDEA 3L3DB 3SKOB 3O3EB 4JN1H 4WU7A 4FQ1H 4A6YB 1U3ZA 3LKRA 4KZEL 2CIIB 1U8MA 4HUKB 4AEIL 5AUMA 1K4CB 3QEQB 1FRGH 3ARGD 3LKSB 5FCUL 1MHCB 3GSQA 3HFMH 2DWDA 3C5SB 3H7BA 4N0CD 5ID1A 1P4LB 1EEZB 4PJFA 1O7SA 1VEPA 2FWOB 2MHAA 2G5BA 4Y5XB 3VW3L 1UWEH 5MHSE 4YBHA 3MV7E 1X5IA 4PLKD 1OSPH 3OSKA 4ONGL 2A74B 1OQXA 4M4PA 3WUWB 3ARUA 4P9HC 3BW9A 5GQBA 3X11B 4JCLA 1SY6A 5DVOA 3STLB 5H94A 3ARVA 4QXTB 2W91A 1T2XA 5HPMA 3QT2A 5ALCL 2HFFB 3CFKB 2VDKL 3BGMA 4Y2DD 5DURD 3QCUH 4NZDA 1VACB 2QLVB 5C0RL 1I3GH 1M7DB 3QXUA 4YHYC 1CLCA 2Y5TA 4HDIB 5KTEL 2GKIA 3KVQA 3P40A 3PGCB 2DTMH 4OLYL 1JZ7A 4OD2B 2VMFA 4NFDA 4ZUWB 1NEZB 4RDQF 4QHNA 1W72A 2V7HB 2Y07H 3L3GB 5DQJB 1KJ2H 4YPJA 4U6HB 4WTZA 5IK3B 4IOIB 4K8RH 5AG8A 2G60H 3F7YB 4LCWE 1ZTXL 5CJBA 4MMZC 1AKJD 2YD5A 3JXAA 5ESAB 2QL1A 3MRQB 4GW5A 2C7UB 1U58B 3HNVL 4CJ1A 2ARWA 5B8CB 1JV5B 4NQCE 3LHPL 2VAAB 1I1YA 1MIMH 2CO6B 3EYOB 1LEIA 5C0GA 1Q94B 2X4UB 2Z35B 2UV3A 1XFPA 3MODL 4RSVA 4PJ5A 4HFWA 4LEOA 3MUY1 4PY8I 5C6TH 4GG8B 5IESL 5I8KL 2Z8VC 1F4XH 2IAMA 4DVRL 4YDIH 1TQBC 5DFVC 1K5NB 3TCLA 3H3PL 4PG2A 3SDDA 4N90E 1YEKL 4DZBA 5JXAH 4G6FB 3GMOA 2PXYD 1SVCP 4Y4FD 4CAGA 1WWBX 5FOBB 2H9GA 1MEXH 2VZVA 1CQYA 1R3LB 4WO4C 4CUCA 4YO0B 3MOBL 3RUGF 4OAWB 3VRIB 5D2NB 1RZ7H 1U2HA 4HPOH 3BN3B 1INEH 1FZKB 1T7VA 5C9KA 1XF1A 5HI5C 3SCMD 3BIKA 5F7UA 1OAZL 5ITBL 5IOPA 1A9BA 2O61B 5ILTH 1FBIH 5DMIH 4XP5L 4P3WA 1BFOB 5D71H 5SX5H 3DVGA 5D5MF 5T1LA 1X5GA 1WBZB 3CXHK 3RIAK 5E99H 2VH5H 1SVZA 2DL9A 4KGJA 2DQFA 3SO5A 1K8IA 5L2KE 1RK1A 5E00B 1E6OL 4OZFG 3P4OA 4FFZL 5DEGA 3MLRL 4YIQA 4Z7WA 5SWZA 3FKUS 3F12A 3QSKB 3WLBA 1AJ7H 5HHXL 5C0BE 2HN7A 3VRJB 2BC4A 4PJIE 1AC0A 5JW4N 2XY1A 5JZ7C 2X9XA 4JRYA 4BKLA 5FUCC 4PJAF 2ADFH 1DUZB 3LEXB 4NN6B 1D6EA 4R2GC 1RIVL 4RAVB 2YUWA 3SDXA 2Y06L 3C09C 3O9WC 3WV0A 4E0RB 1X7QA 1DFBL 4P49A 2D7PA 4HXBH 2OP4L 1FAKT 1WK0A 1H5BB 3BGFB 3BPNC 4RAUA 4NJ9L 1JHKL 4U1KA 4UOW0 1VB9A 1UFUA 1OSPL 2VDOH 4JQIH 1U95B 1WFUA 3P4LA 4KI5F 1KELH 2DM3A 3DXAE 3CDGB 4X99A 3SOBH 4EN3C 4X6BA 3VH8G 4H20L 1W0VB 3MJ7B 4M1DH 1AY1H 1E27A 5DSCB 4YBLB 9CGTA 1RU9H 1HINH 3RVXD 3VG9C 3ZYIA 4FQXC 3SPVA 5GRUH 3GUTB 3QCUL 5IB5A 3CLFL 4Q2ZB 2X70A 3KPSD 1UXSB 3F7PC 1T20A 3QNXB 5FO9A 2NW3B 3HG1E 1QR4A 5CBEB 3QJFB 5KN5A 2G75B 1G7MA 4S1DD 3WDJA 1HHHA 4X9BA 2JE8A 4WY7H 2VLJD 5CMAA 1KCUL 3BUYA 3QCTL 3U7YH 2NY1B 2Q7NA 2VIRA 2L7UA 3D85A 3M17B 2YPLD 4OLVH 2XTJD 2Y7QB 5BVJA 5HVHB 3FONB 1FNSL 1X9QA 5J13B 4OIAA 4I9WD 5FYJE 4GAYB 3ARWA 3X12A 4XCNA 3B9DA 4RGND 1R0AL 4G8IA 4FXGB 4JAMA 4IS6B 4JHZA 4U05A 3X3GH 4FQLH 5IWLA 1DEDA 1F45A 5JOPE 1EA9C 1A6UL 4J1UB 1IM9B 1A6PA 3WD5H 3TJHC 3W11C 3MRIB 2WMPA 1F4XL 2NR6C 1QSVA 4XNQB 4U1GC 5GS3A 5L7XL 4YQXL 4GSDL 1BZ7A 2KL6A 5JXAL 1T5XA 5D5MB 4HD9A 4JZJB 3RJQB 4LP5A 4WUUE 2EE9A 4NUJB 1UCBL 3LKPB 1PQZB 4LCYB 2I07A 3S36H 3V6FB 2YA1A 1DQTA 5I2IB 1YECH 1FNAA 2W0FA 4PR5A 5I30L 2FECI 5TE4L 1BFVL 2CGRH 5HD8D 2GFBA 4HUVA 4LLQB 3VXRA 1FBIL 4OV6F 3ZKSD 4M02A 2HH0L 4Z7NE 4PJAB 1WUNT 3IDMB 3KPLB 5I74B 3EZJB 4AMKH 3EJYC 1AGFB 3TESA 2G2RA 1GGIL 4UU9B 4MNGE 5B38G 5I1LA 5EG6C 4GAFB 3ULUH 4DJMA 1MAKA 4EI5B 1MI5E 4KQ4L 4R26L 1R3HA 3QEGH 2AABL 3TIEA 3VMOA 3CDYA 1GOGA 1ZHNB 4L4VE 1DUYB 2IEPA 3ZLQC 4QTHA 1FL5A 4DTGL 1BLNA 1GZPA 1ZT7B 5EBLA 5FYLH 4HKJB 3F5WA 5C0CB 2B4CL 1K3ZA 2P8PA 3SDAA 5SWQB 3HMXH 1BMGA 4KRLB 5J7CC 4NIKB 5BO1H 3C9NB 1FIGL 3SKNA 3ZKNC 4HV8A 1S78D 1EO5A 4L8DA 1I1AD 5T1KB 1FVCB 2IPUK 2NY3D 3FB8A 1EHLL 1DEEB 3AAZB 4OF0A 1HHGA 4XI5C 1FZOA 1HI6B 3RVWD 4CMHB 3VU2A 1PLGH 2EYTB 2FX9L 4M1DL 1P53A 5L2KA 5F72S 1FL3A 1HINL 4M3KB 1KT2B 1YEGH 1KNOA 5GRUL 1JPTL 3HR6A 1UM5H 1RD6A 4KKCC 1SBSL 2AJXL 4KK6C 4NQXA 3GKWH 3WDHA 3VG0H 4AQOA 3GSRB 3L5HA 3G6DL 5KANG 1WBXA 1OPGL 1YC7A 3QEUA 3BO8A 2AJZA 5EIIB 2ICEA 1QSEB 1U93A 1Y18B 4DUXA 1JPST 2XQYG 4FMKA 3O81A 3W0WD 1UWXK 3MV8E 5HHQA 3EO9H 1QPPA 1X4XA 2YXMA 1YY8A 1Z5LA 1N6VA 3P2TA 4OLVL 4WV1A 2NY2D 3OKYA 3EYSH 3O6ML 4PBWD 1J11A 4P48A 5AEAA 3DXAA 3PQYE 5I76A 4ZFZB 2YD6A 3ARDB 3QDGB 1HXMA 4RA0C 1I9IL 1TTFA 4K8RC 3NIGF 3X3GL 2M26A 4GRLA 3WFDH 2PO6D 4ZS7L 4FQ2H 5HYQB 2P5ED 2EC9T 3IDXL 1QRNA 4JHWL 2IGFH 2VDRH 1Q9WA 4W6XB 3RGVD 3S34L 3TYGL 1NGPH 4APQA 3GRWL 1P4IH 1OTUD 1T7XA 5CD3A 2OR9H 1V7NH 2DQJH 2PTTA 1NJ9A 1WIOA 4IRSA 4P23B 2NZ9C 4JN2B 5JPMA 3FOLA 3VXTB 3MRKB 1T7WA 1KB5L 4JPIA 4XVTH 2AK1H 3L3OA 5ITFA 4Q9QL 2NY0B 2WBJB 3S88H 2WUCL 5J3HD 2C26A 5HI3C 4TN9A 4W68A 3OKOB 3WIHA 1KFAH 3EAKA 5GJTL 4CU6A 4FQHB 1UM4L 2DQUH 4M48H 1LO5A 5KSVB 3HZYB 4KJYB 3NIFE 2VDNL 5CCKH 1K4DA 1UXWB 1JCKA 4OI9A 3WLWD 4K3EL 5IBLC 4G9FD 4GKZA 1R3IL 3ARZA 1HQ4B 2PYED 5TGBA 2R2EA 3D18A 4WI3A 3M1BA 2XN9A 3VFGH 1U8IB 1LDSA 3H9HA 3QEGL 3F62A 2DLHA 4NJAH 1U8LB 4F9PC 3OR7A 4OLWL 1DQMH 2W59A 5HBBA 4WUUA 4UV7H 4H0GA 1ITBB 3FFCD 1M05B 2R4SH 3FO1A 4WIQA 3QIBD 3KXFD 3GDBA 2ED9A 4ODVL 5DJ2B 3MFFB 2IQ9L 1T0NB 3HMXL 4U31A 3NH7L 5EU5A 4NOFA 3MUGB 4N9OB 5D1ZA 5B39B 5BO1L 1WTGT 2VB5A 4TSAH 4RNRB 3CFJB 4LVOC 3FTGA 3PNWA 1WCBB 5F96H 1IAII 5BQ7B 1CGSH 1DL7H 5C6PB 4RBPK 2HMID 1WC7A 2B4CC 4D2NA 4Y5YB 4KMQA 4LLMB 2DQTL 5IFHL 2IH3B 3TNMA 1PLGL 5BS0A 4HKXA 3G9VA 5D6DC 1HOCA 2AEPH 1BJMA 4XTRC 4YFLF 2MCPH 5F7EH 2W9DL 2NY6C 4MD5A 1FVEB 3CZJA 3ROOB 5K59E 5L8KB 3DROB 3TVMB 5EU3B 5KSAC 1H0DB 3GKWL 4HHAA 4K2UL 5ICYB 3VG0L 4L4VA 1KPRA 1NFIB 2QQKL 3N85H 3H9SA 1E4JA 1NKOA 1JGDB 3MCLH 1ZSDA 4R0LC 3S3SA 3PDGA 4DGIH 5EUOF 3CFEA 2DWEA 4MJIE 5KSBF 4NWTH 3MLYH 4K71C 4TSBH 5K9QG 4N1EA 2HWZL 2UY7A 1FO0A 3V0WH 1XF4B 3CXDH 1U42A 3MA9H 4NQED 1JPSH 4S2SA 1IT9H 5ACZB 1RZ8B 3KLDA 3QIUB 5HDOA 5F9OH 4DCQA 3CSBA 3QWOA 2B5IB 5IVZB 4IIQA 2PR4H 5DVKA 1QQDA 3FQXA 5J1TC 3NAAH 4HC1A 1TTGA 1YC8A 5B21A 5HGBA 2YA2A 3SE3C 2V9RA 2YKLL 3U4EB 2PKDA 4GUPB 5EU4A 4OTXL 1JVKA 1CE6A 2BDNH 1ZVSB 3SBWA 3LB6D 3FQNA 3OKMB 1LDPH 4JPWH 4LSRH 4BUGA 1N3NA 2D7TL 2HYMA 2H2SD 3WS3A 3PWUB 4KROC 4YR6A 4XCYA 1NBQA 1RIUH 4XPHH 5DRNB 4OZGB 2GTWB 3JV0A 3T0EE 1KFAL 2EDWA 3DRTB 3K1DA 5JMOC 2DQUL 4HX1A 4YNYB 3LDBB 5E1AB 4N5UA 3MRBB 5HHOB 3TZVA 2EYRB 2BNQD 5GZOC 1YJDL 2UUDH 3UPRA 5FHBH 1ZE3C 1ZGLM 2YZ1A 4PJ7E 4UT9H 3ORJA 3U46A 3DX6A 4G42A 3UZEA 4R97B 5A2KH 5BRZE 1HXYA 3LPWA 3DNKA 4LU5L 2F58H 1G6RH 4L1HA 4PJEF 1PAMA 3VFGL 1XGPA 3NCCB 1S9VA 2J8UA 1UZ8B 5E0QA 5I15H 4ODUA 3HPJA 4PREB 3A6CH 1P7QD 1KJ3L 2D03H 2EDKA 3O8XD 2AEWA 5GRYA 2GJ6E 1PDKA 3ULUC 1JGLH 2R4SL 4KPHL 3ALWA 1VGKB 2W9EL 1NLBH 1Z0NA 3N1PC 2V9TA 4NO3A 1CDHA 1VFBA 5E4EB 4PJXE 4JFZL 2XA8H 2BNRD 1IM3A 2DI7A 2CKBB 4JFFB 4YXKL 1U8JA 1G9ML 3MRRA 2F53D 1CGSL 4JKWA 3JV6A 5EZIL 1B3JA 4XVUC 2AK4A 3GHBH 3GK8H 3W81A 4NN7B 1KXQE 3GSNL 3F6IA 4CU8A 3B6SA 3TF7C 4I2XE 3BWAA 4U1NB 4PBXA 4AH2B 1FYTB 4DZ8A 3TNNA 1F2QA 3F7VA 3L3JB 5L9DH 1JTTA 1NCWL 3KYMB 3MXWH 1AO7D 4YBQD 1RUQH 43C9B 1FNFA 3VXNA 3FAWA 5F7DA 5IW6B 2F5BH 2FECL 3LV3A 3NOIA 3N85L 4MJ2A 4XNYL 4PRBB 3LEVL 1T66C 4P99A 3A6BH 3MACL 3D25B 5ACMA 5I1CH 1JRHI 12E8L 4MXQD 3RWCA 2GJZA 3QDMA 4JQXA 4QRPB 2ARJQ 4RFEB 2JJSC 1F97A 3RNKA 1PSKH 1U8QA 2IJ0C 4O51A 2ITCB 2B39A 3D9AH 3MV11 1VADB 2BCKB 2APTA 2PW1A 4GBXA 2Q86A 3LQAL 1H3PL 1CGTA 2FDBP 3O3BA 1LO3H 3J8F7 5IJKA 2X4SA 3VDBA 4FFWC 1RMFH 2AQ2A 3NIDE 1QFPA 4X5XB 5LJYH 4LSSH 2WWMC 1KB9J 2HT3C 4QNPE 3UYOD 3HE6D 1BWMA 2MKLC 4JPWL 2H45A 2DYPA 1ACYL 1ACZA 4PJHE 1PJ9A 1CG9A 3T0BA 2XOTA 4PY8J 1CFSB 5CJ8A 3GMNA 4MCZA 2FLBT 1NCBL 1RIUL 4XPHL 1UACH 4LMQI 5CEXB 2VWEE 4PJEB 1U8NB 2P43B 1HDMB 1I85A 4YHYB 1AXSA 1INQB 4NSKB 1R3KA 5HYSA 2APXA 3ULSB 4CW1B 2APWA 3ZDXE 1BBDH 5KW9L 1OD9A 2ADIA 1OTTC 1EIBA 4BSVA 3QUML 4XZUA 3MGTB 5I1IH 5IJVA 3RTQA 5EOCL 3EFFA 4NM4H 2ZJSL 3MLWL 4X6DF 1AR1C 1H9VA 1Z9MA 2F58L 3OZ9L 4HKBB 5EOTB 3IU4H 4NDMA 2QV2A 3DMMC 2VZSA 1KG0A 3CH1A 5DQDH 3OXRB 5IMOB 4NP4H 3QUYD 1YJDC 5I15L 1M6OB 5F21B 5DJCB 5D1QD 4ZXBD 3KGRA 4HMCA 3BEVB 3VMPA 1C08B 1X5FA 4KDWA 4QRRD 3L9RB 5C09E 3MJ9H 1IEBA 3U6RB 2DRUA 3S8WA 3N06B 1L4IA 1TQBB 1K8DA 4RFOL 4P46D 4ZNCD 1U3JA 4O2FB 2A9NL 1HIML 4X9IA 5CHNB 1TCRB 1YNLH 3REVB 3I6LD 4LRIC 3GHBL 4YXHH 1F2XK 4WO4B 3V5KB 2GSIA 4WTZG 2XZCL 3QA3B 4MQXD 3FCTA 3QIWD 3UJJH 4EUPH 1S7QA 1D5ZB 4PJ7A 1NAML 4PJDE 3CCHA 1A6WL 5BRZA 1NANH 4WEUD 4IBLT 3PABB 4XCEB 3IFPB 1GYAA 2ICES 1FG2B 3D3VD 4L5FL 1G9MC 2JJVA 4FP8L 4P2RD 5GSRB 3MXWL 2FR4A 4EDXB 1KC5L 2BSSA 4OSUH 1OGAB 1RULH 1EEUA 4I3GA 4OGXH 2H26A 3NA9H 1I9JH 4J8RB 1JF6A 5DZNA 5F1SA 4XP4H 2F5BL 2IPUG 2I60H 2GJ6A 3FO0H 5J57B 5J56B 3V5DA 1RIHL 3ARSA 2W0LA 2F19L 1KEMH 3I2CH 3A6BL 3IJSA 1UH4A 1YEIH 2OTPA 3QPQD 5I1CL 4JFDB 1FDLL 1TMCB 2X4TB 4XMLL 1D9KD 1TNMA 5IFAH 1L9MA 4NQVA 2BFVH 3GMQB 4ZUUA 3BKCH 4R2GB 4UIKH 3C09B 3O9WB 2Q8AH 2QR0B 1IGIH 3R4DA 3BPNB 3PHQA 3RAJH 2NPLX 5IEKB 5DRXB 1F6AA 3MCKB 5D7IB 4JDTL 2BHYA 4OJFL 1RMFL 5E4IA 1PZ5B 1JTPA 3UC0L 1LE9A 4X4ME 1F00I 3UTTB 4EN3B 3LQAC 5EO9B 2OXGA 3B3IA 4RAHA 3MRCB 5K93A 2H6PA 3MO1A 4PJBF 3VG9B 1IAIL 2QQQA 3BKJL 4FQXB 5DD5H 1MLCA 4X6DB 1FZMB 4HWEH 5IF0A 3KS0J 2ZUXA 4FG6D 4PRPB 4LBEA 3EYFA 2KZWA 2BMKA 4GKNA 3MROB 4U6XA 3VD4A 4Z78A 5DJZA 3GMPA 4L3EB 2I5YH 4L8SC 3BT2L 3CNKA 5A2LH 1Z9OA 1CVRA 3PDOB 1BBDL 4XMPL 1KLGA 3OR6B 5I1EH 4B7LA 3IDYC 4JFQA 5IB3A 3GSOB 5CKAA 7FABH 4KQ3L 3O4LD 3SE9H 4FZ8L 1QLRA 3MLTA 4JRXD 3S37X 4MAYC 1OB1B 3SGJC 1MCLA 5DJYA 3KYKH 1R5WB 4XAWH 1F58H 5TDNA 3VFNA 2ESVB 1HWHB 5D8JL 4NP4L 4JFPB 3S96B 4BELD 3IDGB 3BJ91 2EKJA 4R6UA 4PJHA 4Y4KC 5B4MD 1KN2H 1DSFH 4NQSA 1J8KA 1EMTH 3VWKC 2K3TA 1PGRB 4HUUB 1FE8L 2AV1A 2X89A 3LEYL 4P2QA 4P5TC 2JCCE 4NNPH 3CLEL 3QHFH 1ADQA 4WW2A 2IADA 1N7MH 4U1GB 5JW4M 3BPCB 3PWNA 1A6VH 4Y4HD 2QHRH 3BI9X 3RL1A 2EXWD 5HHPB 2APVA 2WINB 2JELH 5E24E 3EO1A 1I8LC 2CD0A 3E6FB 4P3DA 3FQWB 3QRFM 5B3JF 1N8ZA 2F54A 3AMLA 1GGCL 4U7KA 1AHWC 3SKOA 3H42L 1FFQA 2BVOB 3L3DA 3WYRA 3O3EA 3UJJL 4A6YA 1BP3B 4LNRB 3CXHJ 5D96C 4U1LA 2CIIA 3MRMA 1I7TB 3QEQA 1NCCL 3LKSA 3TLRA 4Q9BA 4J3TA 4NC1C 4Q97A 5BZWB 3NABL 4OBRA 1IGML 5DUBB 4OGXL 1P4LA 4R3SB 5DWUL 2E6PA 5IV2B 1FCGA 1EEZA 4O2EB 3EYUH 3QWRA 1X5YA 1QTYT 5C09A 4ZSOE 3KPSE 2E3VA 4YAQB 5GGQH 1KEML 4G7YH 2A74A 1BJ8A 4AT6A 1WQVT 4OLEA 4QHLA 3DETD 5ICZB 2CUMA 5DK0B 2X4RB 3RUGE 2VLJE 4QXTA 4M7JL 2HFFA 3EZ8A 4BZYA 4O9HH 2AGJH 3CFKA 4DAGL 4M1GH 5MEPA 4XAKD 2W0KA 3BKCL 1M7DA 4I48B 1BVLB 4HDIA 5F1NB 5FFLA 2YPLE 4EKXA 2XTJE 3MOAH 1EFQA 2Y5EA 4I9WE 3GI9H 5C0EA 2JB5L 3EYQC 4ZUWA 4QOKB 2Y1VA 3RVVC 5FM5M 1NEZA 4RGNE 4J4PD 3K4ZA 3L3GA 2AXGA 1FJ1B 1OAYH 5DQJA 5E5MA 4KMTL 4U6HA 4ZMAT 4UV4L 4IOIA 4PFEA 5KOMC 2E27L 3F7YA 1F8TL 4JJ5B 4H5SB 5LWYH 3MRQA 1U58A 1JV5A 5DD5L 4HWEL 1E0OB 1K6QH 3QDHA 1RZGB 5CD5D 2VAAA 3EYOA 1BF2A 3MBEC 2O26U 1Q94A 1N6QL 2I5YL 5EBMA 1EFXB 3L3IA 1A3QA 3PWPB 4XPFL 5I1EL 3GI8L 3KYNB 5DJ8B 1K5NA 2Q6WA 7FABL 3BE1H 2A6KA 3Q5TA 1XF3B 1V7MH 1G0DA 4F2MA 2ZSWB 1LO2H 1QA9B 1R3LA 5CEZH 1TENA 1F58L 3VRIA 1QEWA 1MCIA 5D2NA 2EIZB 4GXVH 5E8OB 5C86A 4X4MA 1G9EA 4YXLH 5H8DA 3LIZH 3VA6A 2DM4A 2XA3A 1JRHL 2OS7A 4QKXB 1KLFA 1FNHA 2MFNA 1UKSA 1DSFL 2O61A 4JFED 4TTGA 4R90L 1BFOA 2Z91A 5EU7C 4O02H 3IDIA 5HJ3B 2CDGA 1P69B 4JM2F 3QHFL 4GS7C 2R0LH 4G8GD 4IEFB 2NNAA 2YPVL 1NGZB 5E00A 2OMNA 2JELL 1DBML 4CN6A 3TN0D 3V4PH 5FO7A 2OQJB 1BOGB 4OM1L 2D7OA 4PG2C 4G43B 3SCMA 2XWBB 3GBLA 2E7CA 3LH2L 4QRTB 3MRDA 5FYJH 1RAMA 1J10A 3EDKA 1XCTA 4HH8A 4G6FD 2DLGA 3DX7B 3RDTC 3R0MA 3WNPA 4E0RA 1ZLSH 2YR3A 3BMVA 3JWOH 5FUOH 2NXYC 5IROC 3ILQC 4G6MH 4OZFH 3RWDB 5GZNC 1I1RA 1LWRA 2WP3T 1JFQL 4WI4A 2XG4A 2F74B 3MRNB 4IM8A 4R96A 2YD8A 1AGCB 1FAIH 2FX7L 2Y6SC 1KEGH 3MJ8B 2BVPB 3MNVB 3FHAA 2MNUA 1W0VA 3L5WA 3MJ7A 5DSCA 1TZIA 1IZKA 1A4JA 4LHUD 1T4KA 2UZIL 1S7TA 3GUTA 4M1GL 3W0WE 4Q2ZA 1UXSA 3HZMB 3RVTD 3QI9D 4KKLC 4X9HA 2NW3A 1DLHB 4NUGL 4Z9KB 5CBEA 2G75A 1S5IL 1S3KH 4NZTH 3ZL4H 3TBSB 1TPXC 5ECJE 2A6IB 3UMTA 4LVOB 2XI9A 2EDTA 4UIMB 4M8QA 3AM8C 1OAYL 1C5DA 1O5DT 3AS3A 3M17A 3ULUF 2Y7QA 2P5EE 4LFHG 4ZSOA 3ARQA 4GAYA 2V5SA 3UAJD 1IE5A 4XXDB 3X14B 5ADOH 2AJVL 2NY6B 1EPFA 4JM2D 1K6QL 2C3HA 3HMWH 2WSKA 1CCZA 1QG3A 2VERN 1EAJA 5KSAB 1A7RL 4YHNB 4MXWL 4V1DD 4PUBH 1HZHH 4U1MA 4UDUB 4J1UA 1IM9A 3CVIH 5DJDB 4ZTPH 3EJZC 4R0LB 2CRMA 4XNQA 4OLZH 1EO8L 2YPLA 4XX1E 1F4YH 1KUMA 3SJVD 2XACC 4K71B 5I16B 3C2SA 1V7ML 1F90H 2UY6A 5D5MA 4JZJA 4KK8D 4NUJA 3LKPA 1F4HA 3QRGL 2VDPL 5FGBC 1PQZA 4LCYA 2P5WB 5IBTH 3LY6A 3H8NA 1QD0A 4OZIF 2NY7L 3F8UB 1AQDB 4G9FE 1YEEL 2N1KA 1AFVH 4LARL 4D8PA 2PYEE 4QF1B 4LLQA 4S10A 3I6GB 2HFTA 4G8FB 1KCVL 3LN5B 2LABA 5FB8B 3IU3B 3BIBX 2AEQL 4PJAA 3IDMA 3QCVL 4ZOBA 5E6ZA 1AGFA 1MJUH 1F02I 3HCVA 3QDJD 3FFCE 1BAFH 2X41A 4HZLB 1HE7A 3KXFE 5ACLA 2X40A 5D7SH 4EI5A 1QBBA 2B7DT 4KROB 1G0XA 2QQNH 2ZCKL 4QWWC 1IFHH 3WIHL 5C07B 1ZHNA 1H8NA 5FYJL 1DUYA 4LSQL 1HH9A 4WJ5A 4CMMB 5FV2A 1ZT7A 4NCDA 4HKJA 4PGBB 1GHFL 5J6HA 1MIEL 3FZUD 2ORBH 5FGRA 4OZHF 1ZLSL 4O5LL 3PWJB 2R23B 3JWOL 3WL9B 1KB5B 4G6ML 2D7QA 3C9NA 3WFBH 4UINH 3VXMB 5DDHB 3B2UC 2V2TB 2UZXB 4ODTL 1FVCA 2VRAA 4R4ND 1FC2D 4ZAKC 3OJ2C 4Y19B 2YC1B 1DEEA 1FAIL 5D7LB 2HT4C 4LSVH 4MNQB 1HI6A 1ZLUK 1B6UA 5FYLD 1GPOL 3FO2B 3UJIL 5D6CB 1C1EH 5AAMA 1N64L 1KT2A 3DX9A 2H2PD 4XHJC 5D2LB 5T1DH 3NBNA 3HS0B 4ONOA 3SGKC 5TDPB 1IARB 4PP2B 5LG1A 5DC4B 2VLMD 4JVWA 1EVUA 3V6OE 2P44B 3A67H 5I18H 1HH6A 4JHAH 4NQEE 4I3SL 3GO1L 1IAKB 1S3KL 1DANU 4PP1C 4NZTL 3ZL4L 3PL6D 2EZ0C 3C5ZC 4J3OC 5J6GA 2E9IA 1QSEA 1Y18A 2AJSL 1LO4H 4V2CB 1OGTB 3KJ4C 1KCRL 5FECA 4XVSL 4N8VB 3MNZB 1BWWA 5HGDB 1X44A 1WWWX 2XWJA 3UTZB 3PWLB 1K85A 3PGFL 3GMLB 5ADOL 1G1CA 5T1KD 2DKSA 2GAZB 5ESQA 1KF9B 5KVEH 1HHKB 3RU8H 3QDGA 4GRWH 3V6BR 4X4YA 3FAXA 4U4BA 5GGTL 2VDLL 1NFKA 1QO3A 3HI6H 1CR9H 4NWUL 1X5ZA 1XGYL 1NC2A 1TZHA 2R2HA 4K3HA 4C83B 5K9JH 2BSRA 3OKNB 5F9WC 4DN3H 2K7PA 1YN6A 4KZDL 1G9NH 1ZHKB 3DV6A 4GXUN 4OLZL 5JHDA 1JPGB 3P0VH 2HT2D 3GSWB 4UTAH 3MRLA 4GMSH 3HAEB 2BNQE 4ELMB 2ZCHH 3HZKB 4NYLA 4G9DB 3D5OF 4YGVB 2WBJA 4WV1C 1OOAA 3NFPB 4OKDA 4HC1L 3SGEH 1LEGB 3T2PA 4FQHA 3VDAA 3S3JA 2JK5B 5KSVA 1JZ2A 4KJYA 3DRQB 3QPXL 4P59H 4ZUTB 1A5FL 4HIJA 5MI0C 4U6VL 3U4BH 4X4XB 3EOTH 4GG6E 4GRLC 4ODHL 3KYOB 1KPVA 5EUOE 3ZTJG 1NMCC 1HQ4A 5KSBE 5D7SL 2YPKB 4Z77A 2MQCA 3W5NA 1U8IA 2XTLA 3Q1SH 4Q74A 5HXMA 1Q9KB 1KTLB 4APQC 4K7PH 1RVFL 2BNRE 1U8LA 3BMWA 1RUAL 3QUKA 4XP6H 4U1SA 3F58L 4IRSC 4HEPG 2F53E 3I9GL 4I3RH 1RZKH 1SEBB 3G6JE 3GBML 4XMKL 1I75A 1M05A 5ADPL 1YNKH 3MFFA 4U6YB 4C56B 4POZC 5T3XL 3MUGA 4Q6IA 5EZOL 5JW3H 4RNRA 3CFJA 1OF2B 2NY0D 3AXLB 1VFUA 3W39B 3SE4C 1WCBA 4M6OH 2CLRB 1AO7E 1CLYH 4HFUH 5BQ7A 5CP7A 3KWWA 3VXOB 4Y5YA 2CMRL 3DMMB 4LLMA 3GJEA 4NKIH 2IH3A 3JWOC 2DOCA 1AXIB 1O7VA 4HG4K 2XV6B 5JIHA 1T3FB 4CGTA 5T1DL 4R4BA 2VL4A 2YWZA 3I75A 1FVEA 1LK2B 1UB6A 2DN7A 4FNLL 4Y8AA 3ROOA 1T0MB 4KDTA 5IMLB 5EU3A 5F44A 5ESVB 5ICYA 1YEDA 5HYSG 3HE7D 1JGDA 1MF2H 2BVEA 3I02B 5I8CB 1QOKA 3GJFA 4HGKC 1XMWA 4PJ8B 4Y1AA 3RX7A 5IT2L 3BN9C 2FBJH 3VFTB 2C1OB 4X7DC 2E6QA 1ZVHA 4S1QH 3V0AC 3RNQB 5DHVB 5I1AA 1XF4A 3DUSB 3TM6A 3CSYB 3BZDA 3WJJC 5ACZA 2QKIA 3JWNC 2EDBA 3QIUA 3QXAB 1NBZB 3VD5A 3QXDB 1DE4B 3VGFA 5IVZA 5C08D 5JPNA 3GSNB 1UA6L 3HI6L 4CU7A 4YPGB 1CR9L 5DEZA 4M7KL 3K2UL 4RIRB 3U4EA 5K9JL 4GUPA 5TE6H 3ARED 1DQJA 1G9NL 3TJEH 5E70A 4YHZH 2HJLA 2KPNA 4OD3H 4LKCA 4UTAL 1A7BA 4QYOA 4FTVB 5GRJH 3RVUD 4OM0H 3M8OH 3QZWB 1RUMH 5LQBH 1RFDL 4JKPH 4Y16C 2GTWA 2X4NA 1ODAA 4JGJA 1T6VN 3KS0H 1IGYB 3DRTA 1L0YA 2YRZA 3VI4F 2FRGP 4YNYA 3V52L 3RZCA 5E1AA 2PCPA 1VCAA 3MRBA 5HHOA 4RMTA 4ONFL 4IIQC 4XC1H 3U0WL 5EORH 1NGYA 4MAUH 5ICXA 3U4BL 2FYYA 4OB5H 2BY2A 4JFHD 4QRRE 4MDIB 5I8EB 4YHPA 2AQ3A 1CICC 1NFDF 4GW4A 4LCUA 2ZUVA 3B2VL 4HIHA 2H8PA 1UZ8A 4K7PL 5DYOA 4M6NL 1KACB 2YD4A 3NCEB 5T33L 3JSSA 3OB8A 3GMMB 3QFJD 1PVHA 5E8DH 3LMJL 4I3RL 3I6LE 4L8SB 2FJFB 1TIUA 4NZUL 3O2DA 4UB0L 3IB4A 4GH7B 3WFHA 4DN4H 2HLFC 3IDYB 3K0WA 1I7UB 4CVZB 3B9KA 4HIXL 2ZPKH 5JW3L 4JFFA 2CKBA 3D3VE 4P2RE 4LSTL 4BZ2L 4ZO9A 3TZVC 4M6OL 4MAYB 3RKDD 1CLYL 2AJYH 3MLVH 4LRNH 2YS4A 1P4BH 2L0DA 3O8XA 4TRPH 2EO9A 4NKIL 2G9HA 4NKQB 5D72H 2LU3A 2R8SH 4JM4H 1QVOA 3QUMB 4IRZL 1Y6KR 5EUOA 5CZXD 1WT5C 4MWFB 5KSBA 4X7SL 1PZUB 2DKMA 1JGEB 1DN0B 4Y4KB 3MRPB 3VWKB 1JJUA 8FABB 3CUPA 43C9A 1A2YA 2KQNA 2BNRA 1D5BB 5SV3A 3IETB 4P5TB 4NQUA 1IC7L 3BPOC 1JP5A 5D1XC 5MEND 4XC3L 4Z7QE 3BHBA 1WFOA 4PRBA 5KVDL 4AEFA 2APFA 3D25A 3WMSA 5HYJD 1Q1JH 2V2WB 3QFDA 3QUXD 1ROWA 2X4PB 4S1RH 1AHWB 3WIFB 5K9OB 5DJ6A 1T1YB 5BZDB 3KPRD 4MS8D 3Q6GH 4QRPA 3VXUD 4RFEA 1JNHB 5D96B 4OIBA 2XG5A 1IJ9A 5HY9B 3T0AA 1Q0XH 1QBAA 1KGCD 5GGUB 4PV9B 4HWUA 3VGEA 5F70A 1CU4L 1FNEA 1BZ9B 4NRYA 3DVNA 2ARJB 2ZWLT 1NAMB 1A4KB 1S7WA 1EERB 2GITB 4N9GB 4UBDD 5H37G 3STZB 5EO1B 1ZS8B 1T5WB 1CXKA 1EXUA 1BVZA 5CJQH 3TJEL 2CJUL 1J0JA 4PRIB 4J3WA 3TA3D 1WJ3A 1E6JH 3IJYB 3UZQA 3V7MA 3B8SA 2WM0A 4NO0D 1CLOL 5LXGH 2WIIB 2PF6A 2RFXA 4LLWB 4BZ1L 1XGUB 3TO2B 4M6MH 1XR9B 2BJML 1CFSA 3IFLH 3ILPB 4DK3A 4OM0L 4LLDA 1A21A 2NLJB 1MPAH 1G9NC 1NFDB 4YDLB 5EIVA 3O4LE 2FEDD 4B41A 3U36A 4KJWC 4PJEA 2EIEA 4JRXE 5C0ND 2ZUTA 1UKQA 1INQA 2DLFL 1U8MB 1IAMA 2R9HD 1INDH 1MY5A 3OG4B 3D1MC 2CPCA 4XP1H 2Q87A 3ULSA 4N1CA 2PN5A 4H0IA 1UWGH 3NFNA 1LD9A 1B9ZA 4PD4K 1A3LL 3CMOH 3H7BB 4NM8H 1UJ3C 2W60B 1EHNA 2BNUA 2DQGH 4LSDA 2G5BB 4ZFOA 3O6LH 2LFGA 2NQCA 5I1HH 4TSCH 2EECA 1K2DA 2BZDA 4JZOA 3H9YA 3BVNB 2DQCL 3D48R 3WUWG 4HLZG 3OXRA 3BW9B 5IB4A 1CFQA 3GJFK 3JUYA 3DUUA 3HHRB 2VOTA 3ARFD 3RA7L 5HPMB 5E8DL 3MBEB 3L9RA 5FA3A 3BGMB 4PJCB 2MMXA 3A0OA 3TBWA 3U6RA 2Y5TB 4G6AC 2YRLA 3C6LC 4DN4L 2JB6A 4FQJH 4Q7DA 4H26B 5GGSY 3L5JA 3WFCH 5EBGA 5E9DD 3OWEA 3DJ9A 5E8NB 3EIFA 4O2FA 4BQ9A 2VLKD 1NEZG 4ZNEE 2O5XL 4QHNB 5CHNA 2WIMA 3REVA 1H8OA 4XPAL 3RTQC 4WO4A 1KTRL 3BYYA 3V5KA 1EJOL 1D5ZA 3V6ZB 1IC4L 4CNI