4ODWA

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
218
structure length
208
Chain Sequence
VKLVESGGGLVKLGGSLKLSCAASGFTFSSYYMSWVRQTPEKRLELVAAINSNGGNTYYPDTVKGLFTISRDNAKNTLYLQMSRLKSEDTALYYCTRLYGNYVRIHTMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 Fab (IgG2b kappa) light chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 34
structure length 208
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA01
2E7LC 1BAFH 4X99A 3QFDA 3RP1A 3LKQB 3RKDC 5BOPA 1Z3GL 4P46C 3QUZA 4HW6A 4OLVH 4LL9A 3DVGB 3DX8B 3V6FA 2B1AL 3LIZH 4Q2ZA 2VDNL 5TQ2L 3GI8H 3GIVA 3M17A 1CF8H 4PJ8C 4RGMC 3OSKA 4ZTOH 2A6KA 2DQCH 1FDLL 4HH9A 2FCBA 4HV8A 1FO0H 3IDMB 3N85H 3VXTA 3QUZD 2BVYA 4JFFB 4JFQB 3VXME 12E8L 1YY8B 3HB3C 2VH5H 1JPTL 3U7YH 1K3ZA 4PRNB 3DNKA 2IPTH 3QXAB 4MJ4A 4X5WB 1GC1L 1BF8A 4HPOH 3RY5A 4YHOL 3ELAT 1R3KA 3VWKA 2EO9A 3GMNA 3EDKA 4JZJB 1YJDC 4YHZL 5CBAB 4MXVE 4L3EA 1PQZA 2FJFA 4P2RA 3LQAH 4GLRI 2R0WH 3WO3B 4MNHA 1YYMH 4KMLB 2C4XA 1Y6NR 4G80B 3UC0L 1IEAB 2WBJD 4HFWB 1KACB 1S9WB 1YZZA 5LQBH 4JLRA 2AJVL 1TDQA 2J8UB 1IAMA 4KQ3H 4WY7H 2OI9C 4X4XA 3RZWA 1U8PA 4Y19A 4YIQA 3KPPB 4QRSB 4P2RD 3TFKC 2OMBA 2VLME 5AZ2H 1KB5H 3SDXA 5D1XC 1U8JB 3T0EB 4F7TA 1RZIB 5F89B 5HD8C 5E70A 5GRJL 3X13B 2IBBA 4ZFZB 2AEPH 3NACL 3KPRE 2X4PA 3MOBL 4KUZH 3ROLB 4ZFFB 3ULVD 1ES0B 5EBMB 4XPFL 5ESVA 4X6DE 3VRJA 3M1BB 3HZKB 5IW1B 3IJYA 1KIRA 3VG0H 4OLUH 1I7UA 3P11L 2DQGH 1C5DB 1NUNB 3ME0A 4PREB 3ARDA 4O2EB 2YD9A 3RFZC 2AABL 4U31A 1S9VA 3D39E 1LO5A 2R29H 2BCKB 3NCYS 1RJCA 4XHJC 4Y5XC 3B9AA 4WRLA 5IB4B 4QRPE 3RGVB 3FT4A 5LXGL 1HXMA 1F90H 3F12B 2BSTB 1R24A 1YNLH 3ARDD 4XBEL 4FQLL 1EEYA 1B2WL 4LARH 1W8OA 1P2CB 1VPOH 1D5MA 3VXMA 1NCBL 5FYJL 7FABH 2I26N 4U05A 4BUGA 2H32H 4P4KA 1GHFL 3OKKB 1P84K 2QLVB 5F71A 5TE6H 2NX5E 5D71L 4PTUA 1GGCH 4YDVB 5DS8A 5L2JB 1PJ9A 4B7IA 4U0QB 3ZDYF 3OAUL 1CL7I 5GZND 3IFLH 2GAZB 3ESVF 2X9XA 4TUKL 4RMVA 4ODUB 1RVFL 3QUYB 2BNRE 5IROC 2UY6A 5GRYA 4P4KD 2OXGA 1NCCL 2MMXA 3I2CL 3DX7A 4JJ5B 4N0UE 2HT2C 4MA7L 1G7MB 1N3NB 2P8LA 1RIHH 3QUMA 5DUMH 1OY3B 4G6AD 1WTLA 3HS0A 4UQ3A 5T33L 3GJFA 2H8PA 1OAZH 2FWOA 1WFTA 4Y1AE 4U1JA 4GRWH 4PJ5E 3UTOA 1FORL 1JL8A 1NUDA 2A74B 1X5JA 1T22B 5E4EC 1F5WA 2F54E 4JAMB 2Z31A 2XOTA 1NBZB 2YSSB 4HUVA 1Q9KA 4IRJB 3K8LA 4GSDH 3KPRA 3PWPD 4KC3B 4WV1A 4HWBL 4X98A 1AGFA 1HZHL 1MHEB 1NGYB 4X6DA 3JWOL 1N0XL 5GHWH 1IGCH 3C2AH 4G9FE 3ARFB 5F7UA 4XVTH 3OPZH 3D85B 3ZZ1A 3IS0X 3P9LA 2VXSH 2APFA 1KTLB 5DJCB 4EDWL 1FL3A 5T1KA 2Z31D 4PJBE 3BKML 3U4BL 3O9WA 1UM5L 1DLHA 3O6MH 4J3UA 3KPRD 2OTUA 3CFKB 3D39A 4HX1B 3FQNA 4ODTH 5B4MC 1IBGH 3W5MA 4AIZB 3HAEB 4FFYH 5AUMA 3BN3B 2Z91A 5GGUB 4QRPA 1C7TA 4QGTA 3NTCL 1OTUC 3RWCB 4PTTA 2EYRB 1A1MA 4DKFL 3O9WD 5D2LB 4D0CA 2EC9U 1YMHB 2VZ3A 3C6SB 5IW6B 2MHAB 1U58A 3ZHDA 3W39A 1FJ1A 3CVHA 5C0FB 4DOHB 3L3OB 2HMIC 4R97C 2VLKB 4JRWA 3U46A 4OM1H 1X44A 2WIMA 5FECB 1OTSD 3KLDA 4D9RD 5CKGA 1NC2D 2XY2A 3GGWB 2E7CA 2I60L 2NX5A 3RIFK 2BFVH 4FQ1L 2R8SL 2YRLA 2R1XA 3BGFC 2BDNL 5FDWA 4RRPA 5DD3H 4K3HA 3IFPA 3HMWL 5IV2B 1ZLWH 5ITBH 1JGEB 3MUJA 3E8UL 2YS4A 1MHPH 3EDEA 2FIKA 3LQAC 1UWXH 3MXWL 3T2PA 2O5YL 2BNRA 1CFBA 2ED8A 3WE6A 4MNQB 2Q8BL 3OJMB 4N68A 1EGJH 5D1QA 3B5HA 4MXVF 4N0UA 4XNZC 4Y4FB 4PY7A 3MUGA 2ZUSA 1O7VA 2L7JA 1E4XI 2FR4A 1W72H 4I48A 1FNAA 3CVIH 5TPWL 3UJJL 3VRLE 4GO6B 4Y1AA 4PJ5A 2A9NH 2W59A 3BPLB 3DV6B 2K1MA 4ZAKB 5TFSH 2OBGA 1ZS8A 4PB9L 4RGND 4E0RB 1BBJA 2F54A 5AAMA 3ARBC 3IDYC 3TM6A 5LGJA 1YQVH 5D1QD 1SQ2N 4G6KH 3EGSB 5FAAA 2A9ML 3B43A 4XNMA 4X6FB 3NPSC 3GJEB 4KJWD 3RL1B 3VFMB 1MIMH 1RUAL 3LAFA 4NKQB 4P2YA 3EOTH 1EUTA 5BXFB 2ZSWB 4PJ5D 4G9FA 3LS5L 3MRMB 4UT9L 2RJMA 4OFYA 5D9SB 1J0ZA 2XRAL 5I1JL 4PJBA 3A0OA 3MREA 4OD1H 5SWSA 1EFQA 1UB6B 3BIKA 2X1QA 2W0FA 1OPGH 4D94A 4E41E 5ADOH 2DLEA 3IDGB 3THML 4YHML 4XBGB 1L4IA 3Q5OA 3SN6N 2FHBA 2Y5TA 5FA3B 3V7MA 3EAKA 5J1SC 2N4IA 4I9WD 1U8OA 5HGDA 1FP5A 3QQ3A 3H3BC 4NJ9H 5EO1A 5EIQA 2EEBA 2DAVA 3VWJB 4ZNCD 1JZ6A 2X40A 4GXUM 4OD3H 4CMHC 1I1FA 5F7DB 1EJOL 5SWSD 4J3SA 4WO4A 5DTFA 3IFNL 5EO0B 3LEXA 1DE4A 3F6IA 2V17L 4FHBD 1DL7H 4LCYA 5KW9H 3JV6A 3NFSL 3TF7C 5LGHH 4F7PA 4NZUL 2J8HA 2GFBA 1YC7A 1C1EH 4WWKC 1IM3B 4PJ9B 4Z8FH 1NLDH 1WFOA 2NY4B 1AR1D 4YPGA 3TA3B 3SGJA 5K9QG 1TCRB 1T1WB 4PGEA 2CKBB 4AZ8A 3FQTA 3PWVA 4WTXA 2VZUA 2R1WA 4UV7L 4I18A 4OZGE 3LDBC 3BPCB 3MGOB 3S97C 1QRND 5TJWK 1S3KH 4I0KA 5ITFB 2R2HB 5E99L 2LQRA 3RDTC 4JPVL 5DT1L 3KLAA 3IDJA 1BWWA 4WNQB 4UDUA 2VLLA 4HQQH 4Y2DB 1YEJH 3DOSA 3MNZA 3O4OC 1JPGA 1T1YB 2XYCA 3ZTJH 3UEZA 3DVIA 4YHNA 5CCKL 3BD3A 2VDRL 4BH8B 1MFDL 5H94B 4LOUC 1NC4D 1A7OL 2GY7B 5DRZA 4Y4HA 4NN7C 4ERSH 3OGCA 1BLNA 2M2DA 1UVQB 5KVDH 4DJMA 1AQDB 1HINL 5KS9B 1JNHA 4IRSA 2XTJB 3EYQD 3VCLB 3IXTA 1L0YA 2ESVB 4L8BA 3B8SA 5IMKA 3U6RB 5GIRB 1QFUH 1WITA 1HN1A 2CLVA 1G7HB 4YE4L 3IU3A 1T2JA 4U1LB 1WWCA 3MC0A 3PP3H 5KSAD 3B5TA 4BH7B 3I75B 4GKZA 4QRTA 5E2VH 1ZVHA 3BISA 5KAQF 2Z93B 4ZUWB 4AYFA 3NFPA 2X4NA 5ICXA 2APVA 5T3ZH 3DUUA 3RX7A 1JBJA 3LS4L 1KB9J 4IRSD 4QTHB 2X70A 1WEJL 3O6KL 5E5RB 3S37H 1QPXA 4J4PC 1NMBH 3GRWH 3KLHC 5GPRA 2ZUUA 4KUCD 5H2BA 3PUCA 3OAZH 3VW3H 4L9LB 1JTOA 4WU5A 4U33A 3PF2A 1HXYB 3SY0B 1XF2B 1J7VR 4B5EA 4JHAH 4PJ7F 1NAKH 3V4VL 3WFCL 4XC1H 4YDIL 3VDAA 2WINB 1NCDH 5ESAA 1UADC 4TVPL 4GW4A 2QHLA 3C5ZB 1EVUA 3OB0K 4Q9QL 2B8OT 3V6OC 4YHYC 1KPUA 5HYQB 1A1OB 2BY0A 2AK1L 4QF1B 2H3NA 3VFWB 4BZ2L 2UWEB 5HHVH 2ZOLA 5GRUH 2YKLL 5F7EL 2YD1A 5C09B 4X7TA 1FZMA 2IQ9H 4UB0H 4OZGA 2EH7H 2BVQA 4JKMA 4R2GD 1I8IB 2ITDB 4Z7UB 1INEH 1QSEE 4ETYA 4Y2OA 2WM0A 4MDIB 3WHE0 5DJ8B 4C56D 4XVJH 1MH5A 5B3JE 4JVPA 2CDGB 2YC1A 1FFPA 4RX4A 3QH3A 2A6JB 1A6TB 5DWUL 1T20A 3FMGH 1JHTA 3OKMB 4OLEA 3ETBF 3CLEH 1MRFL 1J5OL 3C5JB 5KSVB 2W9EL 3FO9A 1QVOB 4P57A 4NQCE 1NMCC 4K9EL 4KXZI 2V5YA 2VXTL 1XZ0A 3MLUH 2C1PA 1UQSA 3TBVB 4RMWA 3VA2C 1ZA3B 1Q94B 4HIHA 2A83A 4RX4D 3D9AL 1A6UL 3OJDB 5F6IB 3TCLB 2VLJA 4IOIB 4TSCH 4S1QL 3WNPA 5ID1A 2HFFB 4I0PC 2AXGA 5JR1H 4WDIA 1UC6A 4AJ0A 1VEMA 5EZOL 2GSIA 3QO0A 4YBLB 1A6VL 4IMLA 2Q7YA 4W6WB 2D4DA 1MOEA 5K9JL 4Z7NF 2ZPKH 3SDDD 5HHPA 2E7LA 4ODWA 4DVRH 3ZL4L 2OQJA 1A14H 3M17B 4P46A 1JGDA 2VR5A 3PP4H 4PLNC 2VLJD 3T4YA 4OI9A 2J8OA 2DWDB 1CLZL 1OM3L 4TQEH 4JHBA 4PJ8A 1I3VA 2PW2B 1YQ2A 4HV8B 5E9DA 3VXTB 4PG9A 4LLMB 4JM2C 1UM6H 5AYUH 2H45A 3RKDD 4WHTA 2WBJB 1IC4L 5IHUH 4LDOB 1G7PA 1FIGH 3GMNB 3WIHH 2R2CA 2A6DA 3F7RA 4TYUA 2BX5A 1F13A 4ZYKA 1DQJA 5E9DD 1PQZB 2FJFB 4P2RB 3WFZA 1ZLWK 4Q6IC 3BKYH 5C0NC 3BP4A 1BJ1J 4G6MH 1IEBA 4K3EL 4MNHB 1UWXK 4ZDHA 5HDLA 3TT1L 4ODSL 1WSST 4ZUVA 2VWEC 4CJ0A 5IIEA 1E6OH 1MEXH 3V0AC 1P7QA 3MV7E 1QSEA 4GKSA 1T03H 4ISVA 5I17A 1KSRA 2O5ZH 5CJQH 1N7MH 1FNEA 3RWFA 5IKCA 2JJSC 4NDMA 4XB8A 2NY7L 3V5KB 4YGVB 5EN2A 1VB9A 4P3CL 3SDXB 2RQ8A 2Y1VA 2P5WE 3TYGL 1MPAL 1ZWIB 1RULL 2VZVA 4P2OD 4YZFE 4HKXB 4V1DE 4AQ1B 5D1XA 1XMWA 1P7QD 3EDFA 5FKPA 1GXEA 3PGDB 1KN4H 2HKHL 4W6YB 4NQCA 4KTDH 1FSKB 1EFXA 3MV11 3BQUD 1DUYA 1CBVH 3LEVL 1Z5LA 1KLUA 2B2XL 3DSFH 2V5TA 2OJEB 2VXUL 5FM8A 3IJYB 5CJOH 4EDXA 1KIRB 4TRPL 2HKFH 1MRDL 4ODXA 3VH8A 1QLEL 4KRLB 5JW4Q 4JO4L 4YHLL 1MY7A 3KYMA 3ARDB 5FO9A 4JFPB 1KJ2A 4RMUA 3VMPA 4I8DA 5FHAL 3RPIB 4NQCD 2UZIL 2EDDA 4P5MB 1EFXD 3MFFB 3IFOA 5MHSD 4BSWB 4MXQC 2WNGA 4HIIB 3RNQA 3CMOH 1NEZB 4IJ3C 5JPMA 4HJ0C 2EDJA 4KMQA 2CJUL 2RR3A 1HXMB 2NLJB 4Y5XA 1VESA 4JFZL 4BFGA 3F65A 3TPKA 3RKPA 1R24B 4D9QE 5DHVB 1XT5A 3X14B 2NTFA 1ADQH 3HZYA 2FJGA 3DMMC 3JTTA 1IAKB 1D5MB 1OAXL 3QFJE 2XIDA 5GRXG 5FGSA 1S78C 3WJLA 5CEYB 5DHYA 1G0YR 4XPGL 3X12A 3PXJA 1TQCC 4Z7VE 3R06A 3O3BA 1XF4A 5INDA 3SHSA 2FSEA 5IGXL 3BD4A 1UFUA 2J6EH 4UIKL 4R96A 1J1PL 1A3LH 2DJSA 4EEEA 3KPTA 5KSBF 1EHLH 3T1FB 4KHTL 3SDCB 2P8PA 4NP4H 5FYLH 4ZFGH 1YNKL 5BJTA 5DK2A 3DX7B 4EQ3A 3DGGA 4HDIB 4M93B 3MV7A 5EU6A 5IROA 4WHDA 1U92A 3PWPB 1NAMA 5I66A 4AT6B 1QSFD 1CQYA 1MHCB 3GJFB 4OZHB 5GS3A 4RISL 4U1JB 2EIBA 5FCUL 1H3PL 4GMTH 2DQHH 3IVKA 2P5WA 1MRCL 1DBBL 4ONGL 2Z31B 4GAYA 3GSNH 4HLZG 5B3JF 1NFIA 3D3VE 5EU6D 4ZSOE 5DDHB 1Q1JH 5IB3A 2AJYH 5E7BA 5C08E 4LSSL 1UJ3A 5CP7B 5FYJU 2APWA 3QCVL 4PP2A 2RGSA 3SO3B 3LKRB 5JW4R 1TZGH 4LSUL 1J0JA 2DL2A 1QPPA 2DICA 2H2SC 4NUGH 4J3XA 3IYLW 2ZJSH 4OTXH 4H8WH 3QUML 3QB7C 2DBJA 4L4TA 4OCNC 1F2XK 2YD2A 4G6JH 4YXLL 4YR6A 2G2RA 3OAZK 5HSFA 5AUMB 1LVEA 2Z91B 2B1HH 1NC2B 5CSBA 1Q0YL 4NCC2 4S2SA 4D8PA 1T04B 1Z9MA 2YPLE 5EUKB 1NBYB 3X3FL 4IDJL 3G08B 3P4MA 1MCQA 3GMOB 3D6GA 4D0CB 3L95B 1BFOA 3J7HA 4PRAA 3CVHB 4L4TD 3LN4A 4PRHD 2JELL 1FO0A 2DQJL 1UH2A 3U46B 1G6RH 2B20A 2R23A 4MD4A 2VKWA 1JGLH 2HN7B 2P46B 1GYAA 2PYEE 4Z7VA 4YDLC 2VN7A 4BZ1H 5JOPD 5T1LA 3IFPB 2OTPA 1OTUD 4BSVA 4U1GC 5C2BL 4X6CB 3HLAA 2FEEL 4HS8L 1NMAH 5IFJA 4LLDB 4FXGA 5I1LA 4OLYH 4L8SC 1KLGA 2DTMH 4RGNB 1UEYA 3WE6B 1LDPL 3CX2A 2YK1L 5D1QB 3RIFF 2HMID 5E6IC 3HR5B 4M5YH 2NZIA 2R39A 3MUHL 4ZQKB 4AEHL 5T1LD 2FR4B 2R69L 5B38G 3S5LB 5J7CC 1UEMA 1KC5H 3DO3A 3NABH 2HRPH 2FGWL 4XCNA 4M1DH 1A7QH 2R9HD 2YN3A 1AP2B 2F74A 4PUBL 5IQ7H 5DD5L 3QYCA 1HK6A 2YD8A 5C07E 4GRWE 1OD9A 4R4FH 4NRZA 4LLUB 5JW4M 1KB5A 1UA6H 4GRLD 5ILTH 5LGJB 3VFPB 43C9A 3STLB 1PSKL 3D3VA 1A02N 1U6AL 4LVOB 4ZSOA 3ARBA 4H26B 4QGYA 1WWAX 5D7LD 5HGHA 3GSXA 1RZJH 3Q48A 1JYNA 1BWMA 4M3KB 5C08A 4YZFF 5ACMA 2B0SL 3PDOA 4HJJH 2P48B 3MCKA 3TBYA 4EI6B 1CFSB 4PJBB 1HSAB 4ZXBD 2G75A 4TUOA 4M00A 3HC3H 3MREB 5SWSB 4N90D 1RZGB 4UV4H 3BIKB 2IFFH 3ARBD 3QBTB 1CFQB 1N6VA 3NCMA 3HRZA 4TULL 1UWGH 1OAKL 2A2QT 4UT6L 2IH3B 2EIZA 1JPFA 1LO3H 2Y5TB 3T04D 4BYHA 1INDL 5FYKU 4NRXA 4X4MA 4M6OL 2COQA 1WBZA 5I9QC 5FOJA 3H9HB 4ODHH 2YWYA 1AH1A 4LPXA 3LEXB 5KSUA 2A6IA 4JJHA 4K7PL 1I1AC 3TNMA 2QQQA 1Z9LA 1G9ML 3DRQB 1QRNB 4HZAA 3WHXA 4F7PB 1F4WH 4KZEL 4G7VH 3UTTE 5D5MB 2GTZA 2VTFA 4S1RL 3WSQL 1UG9A 1T6WA 2PYEA 1J8KA 3O2DL 3WUZA 2OTWA 1J0HA 1YMME 4ZO6A 3V6OE 2H32A 3NZ8A 2VB5A 4YPGB 1J8HA 2OL3L 4WWKA 3FRPG 4HIEA 4OLWH 1M71B 4PGEB 5IHZA 6FABL 1ZVYA 1IKNC 1KT2A 2ZCKH 4Z7VF 4I18B 3EYVA 2DI7A 2C3VA 1MCPL 3VGBA 1B4RA 4WFED 1NC4B 1CLYH 2AKRB 4NWTH 4PV8A 4JPKH 3KPMA 2FX9H 3ZKMD 5D7IB 3BWAA 2VE6A 1WZLA 2I24N 3U83A 4O4YL 3UZQA 3WL9B 3KLAB 4WCYH 2HVKB 1J8HD 3LKOA 3MRLA 4UDUB 4U7SA 2VLLB 3WFHA 3RDTA 2BP3A 5KSAB 3K80A 1J10A 5JQ6H 3MNZB 1FVCB 3P0VL 4Q9RH 3CXHK 2FZ3B 4YPJA 2BK8A 4YHNB 1UCTA 1U41A 1A7RH 2JIXD 1UXWA 1X5LA 4UZGA 5C07A 1FG9C 1BLNB 3BDYH 4KJQC 3VFGL 1JNHB 4IRSB 4QKXB 5KS9F 1WIPA 1XGQB 3VGAC 5F1NA 1JZ7A 5F88A 2UV3A 3IU3B 2EZ0C 4TSAH 4KKBC 3WIFB 4H5SA 3T3PE 2VIRA 3TC9A 1O0VA 2CMRH 3HUJE 4QRTB 2FL5B 1K8DA 4RQQA 3NFPB 5C07D 3F8UB 3I6LD 4UAOB 3O6FD 4KK6C 1FBIL 1AE6H 4H1LH 3TBSB 3ZYJA 5E5MA 3VXNA 5IVOA 5FV2A 5I6XB 2IBGA 4H8WC 4RGOH 1A7PH 5CIPH 2C9AA 1R3LB 3N9GL 2HT3C 1KCSH 2HAZA 1T5XB 2OSLA 1HEZB 5EH1A 3H9YA 5AEAA 2BVOA 4GS7C 2XY1A 2B4CH 1F4XL 3I9GL 3G5VA 1KTDB 1UKSA 4WFGE 1YEEL 2DKSA 1BM3H 2K7PA 5ESAB 1VGKB 3MRFB 3GB7A 1LO0L 2C4FU 4LMQI 4JANA 1QYGL 1LK3L 4M7LL 4F58L 4R2GB 1ED3B 1YN7B 3BGMA 1KPUB 3UTTA 3QNYB 3MJ7B 4GRMA 4Q7DA 1X9QA 1YMMA 2H3NB 5JIHA 4C56B 3V6OA 4N8VB 5LJYH 4CGTA 5JO5A 1UM4H 1CGUA 3IGAA 4CW1B 3D18B 5B3NA 3GHBL 3X3GH 2D31A 3WXVL 1GL4B 4NM8H 4DKEL 1FZMB 4NHCL 2V2WB 3BJLA 4KPHH 2HWZL 4XPTL 2YD3A 4OCYL 5IMOA 2QKIB 4OUOA 5CLTA 4MMXC 5LAXA 1IARB 3BDXA 2A73A 3CGTA 4ONHA 5C0IB 3UTTD 2VWEE 3WIIL 1LEGA 1YMMD 3S7GA 1MH5B 3WMSA 3QO1A 1EGJA 1FL6B 1LO2L 1MQKH 1PEWA 3JUYA 1JJUA 4FQQB 2VQTA 2IEPA 3TNNA 4Z77A 1CGXA 4WI8A 1W72A 1SVZA 3MODL 3L5HA 1CD0A 1AJ7H 4QHNB 5DI8B 2BOCB 2XZZA 4P57B 2R0KH 2P24B 4LKCB 4AL8H 3BN9C 1RURH 3O81A 5F9WC 1NCAH 3C5SA 3SDDB 2C1PB 5D1ZA 4K23L 5EU4B 5D7SL 3UBXA 3WFDL 5J3HD 3MA7B 4HIHB 2A83B 2NY6D 1RZJC 4WJ5A 4GRWF 2VLJB 4EIGB 5A16A 1A4JA 3HUJA 2F53A 5ID1B 2AXJA 1KIPA 5IBUB 2UZYB 3QG6A 3P4OA 4UINL 3TJHC 5L0QC 3QEGL 4OCXH 1P9MC 1DVFD 3QIWA 3QO0B 4M62H 3AVEA 1SYSA 2VZTA 4I0PA 4XH2A 5HHPB 4ODWB 5D1ZD 4ALAL 4HUUA 2OQJB 2CK0H 5T3ZE 4LPWA 4H0HB 1VA9A 3EOBB 1JGDB 4X5XB 5DVKA 5I1AB 1FC1A 5C3LD 3B3IB 3EOAB 2AJZA 2B1AH 4M02A 2VDNH 5TQ2H 3T4YB 1DEEB 1I7ZA 3LH2L 3GHEL 2F53D 3DXAD 1BIIA 1F58H 1U95A 4U49A 3QIWD 2ZWLT 4J3TA 4UIMB 5HPOA 1JF1A 1FDLH 2FX7H 5E9DB 4I0PD 1AI1L 1OAUL 2DQDH 4O5LL 4UT7L 1CT8A 4WHTB 1MCRA 4JO2H 1JPTH 2EE3A 5T5FL 1EEQA 3QEHA 4JM2A 1JHLL 1ETZB 1G7PB 2MNUA 3DYOA 3Q3GB 1GC1H 5F9DC 4YHOH 2A6DB 4UBDC 2GTWA 1H3XA 2D7TL 1A9BA 3H9ZA 1I75A 1C12B 3BP4B 2B5IC 4YHZH 3NCYP 3VGHA 4BKLA 4ZDHB 3RY6C 1UZ8A 1M7XA 4XB7A 1J1XH 4Q6IA 5C0CE 1IILE 4O58L 4P2OB 4JM2D 1P7QB 3UC0H 1JE6A 3OXRB 5FK9A 5HI3C 2AJVH 3IDIB 4ISVB 1WLHA 2RB8A 5I17B 3I3EA 3RWFB 1X5YA 3BQUB 4S10A 5DD6B 4P5TC 5EN2B 4ZUSA 1IL1B 2OI9B 4R0LC 4LCUA 5E00B 2JJSA 3AB0B 5C0ND 2BXYA 4G5ZL 4M3JA 4KJPC 3KS0J 1AY1L 3MRIA 1AGBB 1AKJD 1D5XA 4PBWD 3GM0A 4NQCB 4GMSL 3NACH 1EFXB 1F8TL 2BOBA 3CCHB 5ADPH 4EOWL 4YBHA 4XPFH 3GBLA 1F11B 3HNVL 4FFWC 1N64H 2R56L 4ODXB 2ZKHL 4U1SA 2YBRB 1QOKA 1SY6L 1XF3A 3KYMB 3VI4E 1QEWA 3P11H 3ILPB 3UZVB 3VGFA 4NFBA 3I6KA 4NBZB 3T3PF 2AABH 2BNUB 3D0LA 2VN4A 4LSTL 3U30C 1D5BB 3GRWA 4IHOB 3G5XB 4CADA 2Q3AA 4WENB 1W2KT 3TYFB 4X4YA 3LV3A 5F9AC 5LXGH 3GMLA 1C08B 4KH2A 2B4CC 4KRMB 5HYJA 3FONB 4I3SL 3JTTB 3FB8A 4XBEH 4YEFA 2F19L 3EHBC 4FQLH 4HWUA 4DZ8B 4IDLA 1WWBX 1B2WH 1XFPA 1L7IL 1CGVA 2BNQA 2WV3A 4KWUA 1UXSA 3DMMA 1NCBH 5J6GB 5FYJH 2W91A 4YX2L 3FFDA 3MMEA 5JLZA 3O3BB 2P4AB 1GHFH 1XF4B 2ZUYA 1LEKB 2ZUVA 4BM7A 1W0YT 5IEHB 5D71H 1QSFB 1KJ3H 3C8DA 5HYJD 4R96B 4JGJA 1KJ2L 3QDGA 4G8EB 5DEFB 4F7CA 4WWID 2BNQD 3OAUH 3DMMD 4TUKH 1JN6A 4FQJL 4HK0A 1I8MA 4M9PA 1RVFH 4YK4C 4EXKA 5DJ0A 3QZWA 5EU6B 5EORH 3AMLA 3I2CH 1DP0A 2X4TB 2NY3D 4PYHA 3AXLA 4G43B 3QDGD 2ED9A 4QRRE 5T33H 2KQMA 3B9KD 3DLQR 3MYJB 3WFEL 3QDMD 4YC2C 1QLRA 4YDJB 3JV4B 3EYFA 1G7QA 2Y06L 2NZ9C 4CNIB 1SJEA 1HHIA 4PLJD 4PJDE 3ZSTA 2HT4D 1GOHA 2EDHA 5HJ3A 4HWBH 3SKJL 5K59E 1HZHH 2AQ1A 2NTSP 1UJ3B 3FT2B 3JZ7A 5DZLA 3TT3L 1N0XH 1HNGA 1VGEL 4X80L 1RK1A 4XNQB 1E4WH 1HDMA 2Q76B 5CILL 5DFWH 1T1ZA 1FLTX 3U79A 5JIPA 4OZ4A 1U42A 3VJ6A 3BKMH 3U4BH 1UM5H 3GM8A 4L4TB 2IFGA 2JJTC 4LASH 4QWWC 4PRHB 4YR6B 2G2RB 1BVLB 1Y6MR 5CZKA 3L3GA 1CLOH 1BEYL 1FNFA 4JN2B 4PJAB 5IK3B 5BMFL 5IB2A 1IM9D 4D8PB 3MLYL 3QEQE 1TETL 3AGVA 3AS1A 1FG2B 2X41A 3DO7A 4DKFH 1CICC 3DX6A 2ADIB 4PJFE 1YEIL 3L7EB 4MD4B 1S7WA 3K7UA 4D3CL 3SKMB 4JKLA 2GKIA 2IQAB 4OIBA 3X11A 4R97B 4K7FB 1GC1C 2I60H 5T1LB 1RQ5A 1H5BC 3MRRA 4FQ1H 4XWOC 4BSVB 2DKUA 4PD4J 2BDNH 5GQBA 1GGIL 4GAGL 4N0RA 3WIHA 4FXGB 1DUZA 3B2UC 1KLGB 3V5DB 1XF5A 4GUPA 4GRLB 3V8CA 3GSQA 2O5YH 4NO3A 4FNLL 4OLVL 4RMQA 2WUCL 3GFUA 1SEBA 3SKNA 4L8SA 2Q8BH 1CYGA 3PHOA 5FYLE 3SKOB 3GI8L 2PXYC 5FYKH 1WAAE 5D7LB 4NGHL 4XNZB 1T7VA 5E6IA 4R26L 4MA3B 3E3QC 1J0KA 4XCNB 4AENB 3KPQA 3H42L 5TPWH 3UJJH 3SE3C 3EYOB 3ZHLA 2DMKA 1N59B 1CDJA 1FO0L 4GBXD 4NRZB 1MJUL 2NY5H 5K33A 5IMLA 1ZA6A 1RJYB 4PB9H 1S5HA 4ZXBB 3WNLA 43C9B 3C9NA 5IBLC 2CKBL 4YNYA 1OTTC 1KPVB 4PJDA 3ARBB 3IDYB 4PGCA 2CGRL 2XA8L 4MDJA 1QKZL 2A9MH 5E6ID 3S3PA 1JV5B 1RUAH 3DVFA 1TJHL 4XPAH 3MRCA 3BHBB 2VUYA 1BQLL 5IJKC 3GBML 3LS5H 1HILA 2DIJA 4UT9H 5CS7A 1TVDA 1AC0A 2XRAH 2AEWA 4JFOA 2EKSA 5I1JH 4GQPH 4L4VE 1CFNA 4JRXA 2LAAA 1ZKAA 2BVTA 2NR6C 2EIZB 2XNAA 5HVWA 1S7SA 4QRQA 8FABA 4YHMH 3THMH 4MB4A 5JMOC 3QEQA 1ND0A 1ZLSL 4NRXB 1MUJA 1NPUA 5AZ2L 3T2NH 4X9IA 1WBZB 4QEGA 5DEGA 2YRPA 4GG6E 4JRXD 4EZMA 4RDQF 3TNMB 1ADQA 1DFBL 1IC1A 1C16B 2AEPL 4PJFA 1Y0LB 3HPJB 4GAJL 5E2WL 1I1AA 4MLIA 3D2UA 2ORBH 5I74B 1I7RA 2OTWB 5D5MF 3SKUD 1P6AB 3ULUD 2H32B 3DV4B 1MAJA 1J8HB 4S1SL 5BCAA 5IHZB 2I9TB 2DQGL 1TTFA 3S9DB 3EO0A 1CGSL 2X2YA 3P30H 3EYVB 4E42A 2J6EA 4M6AA 2JIXB 2YD7A 4N1EA 5CP3A 4UV7H 3QULB 5E08L 1IKNA 5CLWA 1I1AD 1PZUB 3BP7A 3BP5A 3D2UD 1ZHBA 3W82A 1QACA 4TSBL 5C92A 3BWAB 2VE6B 2X6MA 3BKCL 1AO7E 3HMXH 2NW3A 1MCCA 3UBXG 5J0BA 3CFBA 1E6JL 2H2PC 3L7FA 4JPVH 5DT1H 5DJDA 1LK2B 1A3RL 3H7BA 1JZ8A 1YEKL 3UCRA 2B7DT 4WW2B 3GMMA 3SQBA 3O6FB 3N50A 2VDRH 2AW2A 2PCPA 1MFDH 4JFEE 1EEZA 4JREC 3C8HA 1A7OH 3LY6A 4WUUD 1NJ9A 3F62A 4G3YL 4AQOA 5DA0B 1UACL 5I1EL 1X6NA 1HINH 5FF6B 5F1NB 3GSNA 2XACC 4L8CA 3VMOA 5EU5A 2PW1A 1JP5A 2A0LC 2VIRB 4LSQL 4YE4H 1IEHA 4EI5C 1K8DB 1S7UA 1Q72L 1P4LA 4PJDF 3IFLL 1MFBH 1JRHI 1HHGA 5JMRA 4L3CA 4ETQB 4X9HA 2XXCB 4M1CD 2R1YA 4NPYA 5CMAB 2A38A 1CGYA 4RMSA 4L4VA 3O6KH 1WEJH 4I5BB 3RIAK 3WKML 5HBBA 1YUHB 2RBLA 4HS6B 3QP3A 4JR9L 4KHXL 3BEWA 5IEKA 4RFNC 4XX1E 5I71B 4MX7B 5DUML 1RUQL 3C2SA 3FRUB 2EZ0D 4KKBD 1JMXA 1NFDB 5F1IA 5FCSH 1MJ7L 4G6FD 3RZCB 4PB0L 3G5VB 3V4VH 5J12C 2C7UA 4IRZH 3VRIA 4DFHA 4J3VA 4GG6A 1X5HA 2ENYA 2DQFB 1QO3B 4H0GA 2V7NB 5J8OA 3CH1B 3VXRD 3UTTB 3L3IB 2Q8AL 4Q9QH 3A6CH 1G6RA 5E2TL 2EKJA 3FCTA 1YMMB 2HT3D 5FO7B 1FVDA 1BD2E 5JO5B 4FOMA 3VFNA 1OP3H 4PJFF 2AK1H 3OPZL 4EBQL 1Q8MA 3CSYA 5JUEL 4G9DB 3ECBA 4BZ2H 1YECH 5EZJB 3MOAL 1BX2B 1Y18A 3CC5A 3U7WL 2IF7A 4OF6A 2GY5A 4ONHB 2CRZA 4C83B 3KPLA 5SWZD 1AXIB 4LBEB 1PD6A 3PWUB 1JHKL 3CFJA 1N26A 2EYTB 4FFVC 4HZLB 2DTSA 2NY6B 4Z0XB 3CXDL 3WDIA 1JUFA 2VAAA 4YFLF 4C4KO 3ZSSA 5HYEA 3OWEA 4NUJB 4LSVL 4NQVA 1DVFB 1X5IA 1D9KC 2NY5C 2C5DC 1WAAF 3RPKA 4O51A 3GUTA 1MRFH 4P2QE 1J5OH 2W9EH 4EJ1C 1O5DT 4DCQB 1ZGLM 1LO4L 5D1ZB 4EUPB 3TWCL 4OM1L 2OK0H 3GSRA 2W60B 2JKXA 2XZCL 2LU7A 4LKXB 4NOFA 3RWJA 4WJ5B 5K9KA 4PGDA 2V2TB 1OQXA 3OF6D 4F8TA 4KTYA 1U8HA 4OFIA 4CDGC 5A16B 1A4JB 4D0DA 2BRRL 1BJMA 2F53B 3D9AH 3DXAB 1A6UH 1KIPB 5F3HA 4H25B 3WLWD 5ITBL 3QIWB 4S1QH 4ZUTA 3LRSA 1NEZG 3TVMB 3NA9H 4I0PB 5EZOH 3QRGL 1P9MA 1A6VH 3MV9D 4B0MM 2WIIA 3BN9D 43CAB 2AEQL 2X05A 3DUSB 5EC1A 5IHBA 1I7ZB 4G8FB 1BZ7B 1R3JA 5IJVA 4TNVK 3IETA 1BIIB 4KU1A 4MGXA 5I1GL 4EN3C 4UQ2B 2Q6WA 1VFBA 4ZS6D 5EFIB 1KEML 1CLZH 1OM3H 3VXSE 1JF1B 4LHQB 4PV9A 5KVFH 5EIIB 4F7EA 5MEND 3I3BA 3KG5A 3MPCA 5TFSL 2QQLL 3T8XB 3FAWA 3MLWL 1TVHB 1CT8B 3O45B 3G5ZB 1XCTA 2YA1A 4JM2B 1LMKA 2BZDA 4G6KL 3TIEB 3ARVA 5DMGD 7CGTA 1KEGH 3FOLA 4XXDB 3NBNA 1IC4H 4GG6F 1EXUA 2HJFA 1BD2A 5DFTA 3WDJA 4WTZG 1AGEA 3EZ8A 2PTVA 1XIWD 1DQTA 4Y5YB 4K3GA 5BRZE 4KMTH 2H41A 5HHQA 4Q6IB 5IVXB 4K3EH 2BHUA 5FUOL 2OM5A 4ODSH 3RY6A 1AKJB 1FZKA 5ADOL 1KJMA 3U4EB 2K7QA 1BD2D 1HIML 2NW2A 4LHUD 4NN5C 3QI9C 2NY7H 4HWZA 1A22B 2PKDA 4P3CH 4PGZA 4P5TA 4OD3L 2V7HA 5HTSA 3TYGH 2WWKT 4R0LA 5F9JA 3LD8C 1MPAH 3ZKXB 1RULH 2MWCA 3MRIB 1ZLUK 4P2QA 4GXVL 2YUWA 2BOBB 4JE4B 3IXAA 4LSDA 1N4XH 2HKHH 2O61B 4HXAL 1AGDB 5I75C 2A1WL 5FGRA 1H8SA 2IADA 2DQIL 4OCWH 3FQUA 2B2XH 3LEVH 4QHUB 2VXUH 3L5WB 5HHOE 4U1SB 4TRPH 3QUXC 4P5TD 3E2HB 2GJ6E 1MRDH 3QXWA 3SCMC 1QLEH 2X4QA 3WKNA 4JFHE 4JO4H 4I2XE 4YHLH 4NT6B 1QBBA 4LQ1A 3UPRA 3HCVA 1KPRA 4U3HA 3V4PL 3F5WB 5FHAH 4NO0B 3QCTH 1YEDA 1QBLH 4H1LA 1S3KL 1MNUL 5F3BA 4QLRA 3PQYE 5CIPA 4BK5A 4QY8B 5FEBA 2VQ1A 5TE7L 4X4YB 3MR9A 1I1CA 4YHKL 5TGBB 3VFVA 4OF0A 3GMLB 2CJUH 1BVZA 1INQA 4FFWD 3RWEA 5AD0A 2VDPL 3DGCR 4JFZH 3VXSA 3W81A 5HYJB 4OIIL 4XVUC 5DUBB 5BW7C 2OXHA 5KN5B 5IP4A 2BNQB 4XI5D 1UXSB 3EJJX 3DMMB 4UUJB 4XMLL 4YLQT 4M4PA 3WBDA 1A8JH 4HGWA 3O3DA 2DWEA 1OL0A 1JFQL 1HHKB 3FFDB 1IVLA 5JLZB 4XPGH 1U36A 3KWWB 1QFUL 1KF9B 1T7WA 2W0KA 4JRYE 4NNPL 4ZPTB 4G8GA 1YEFH 3ARSA 1I3UA 5F7MC 2AI0L 5IG7B 2NY3B 2OP4L 3QDGB 5IGXH 4F7CB 4Y16C 3B9KB 4UIKH 4NO5A 4NKOA 3W0WE 1J1PH 2YPVH 4KRPC 1JN6B 3QDMB 1CK0H 3BPNC 3EHBD 5BRZA 3Q6FB 4AY0A 3S5LG 1B4JL 1AXSA 3L3DA 5DJ0B 4KHTH 1V8HA 3QZWB 1QFHA 5KOMC 1YNKH 4G8GD 4JFYA 4MQ7B 1FC2D 2BSSA 4MVBD 5H35B 1I85A 3VFRB 1PZ5A 1P1ZA 5CD3B 1NGWA 2LFGA 5ANME 1XGUA 5C6WH 4RISH 5BZWA 1N2RB 2E9JA 2ADFL 3E3QE 1QLRB 2E8ZA 5FCUH 3EYFB 2D03H 1LNUA 1DBBH 1HWGB 2P42B 4ONGH 3TZVC 3FN3A 3IT8D 5GS0D 3ARZA 2SEBB 2QV2A 2X4SB 3NH7L 1PW3A 4MJ6B 4Z78B 5HJ3B 3VFSA 3C09C 1ITCA 2HTLC 1S9KC 2VLRE 1GGTA 4JQIL 1SYVB 2EEDA 1IM9B 3MACL 4LSSH 1RK1B 3FT3A 3QCVH 2GJ6A 1T1ZB 5FOBA 1DANT 2Z92A 5GRUL 2JCCB 4I2XA 3MBEC 3W11C 2P44B 4QXTA 1FZJB 1WCBA 3B6SB 1RJLA 1ORQB 2NZ9D 1JGUL 2EDFA 5CFHA 1K6QL 4TVSa 1HQRA 3IKCA 1JWMA 4MA8H 1LD9B 5F8RC 3L3GB 2EXYC 4YXLH 4XNXL 1GSMA 2JJTA 3EDDA 4FZ8H 2QL1A 4QOKE 3FO1A 1IGJB 1Q0YH 1GH7A 4HKJA 3DO7B 1LILA 3X3FH 4IDJH 4XNUL 3MSPA 3FMGL 4HLZH 1XH3A 1LP9E 4N1CA 3DX6B 1LE9B 2O93L 2XFXA 4L3AA 5C0AA 4HUWB 4LVNC 2Z8WC 1MIEL 4JFDD 3BUYB 4U6VL 1CICA 3K4ZA 2QR0A 4XC3L 2DQJH 3X11B 2NXYC 2FIRT 2FECL 1DDHA 4JRYA 2YPKA 3P3YA 5CJ8A 3VXUE 5FYJE 3TBTB 1CD1B 1DQQA 4XAKD 4JCLA 3WN5C 2Z8RA 3ALWA 1H5BA 5C2BH 1JZ3A 5A2LH 5C0AD 3W0WA 5ERWA 4HS8H 4GBXB 3HNTL 3LRHA 4GUPB 3C60C 3U4AA 2HJLB 1SEBB 1NGZA 3IJHA 3VG9C 1DN0A 1OAYH 3PHOB 1EO7A 2YK1H 4JRYD 3M07A 3O41A 4AEHH 5E6IB 4YJZL 4R3SA 5FUCC 5GGSA 2PXYA 3KPQB 4XWOD 3V79C 5ANMA 3RI5K 4F9PC 2FGWH 5BVJB 5MEPA 1CD9B 4OCSL 3BZDA 4PUBH 4LNRA 5DD5H 2KKQA 3SE3A 3MRBB 4M6NL 1DBML 4NQSA 1AIFB 1MI5E 1T80A 4P23C 3GEWB 4B41A 3TIDB 4KQ4L 3UPCA 3PWJA 4MDJB 1G1YA 1PSKH 1U6AH 2WAHA 4MNGB 1ZGLA 1K4CA 5IHUL 3BOVA 2PXYD 5BOZG 3P4LA 4X83A 3WYRA 2VLRA 4JZOA 2OX5A 5ENWB 3E1F1 3SDYH 1TENA 2CDFB 2MKWA 5CD5D 2BVPA 4K2UL 2B0SH 1MREH 3CZFA 5JW5A 1RIVH 2AK4B 2HLFD 4ZOCA 5IJKA 3SEPA 4APQB 5GS1B 4JRXB 4LLYB 3MV01 1UYWH 3FZUC 3G5YA 1KB9K 2CXGA 4YAQA 3RVXD 4Q9BA 1HNFA 3OQ3B 1JNJA 2E5EA 3HE6C 2XNAB 1FNGA 1NCWL 3DROB 4TULH 1S7SB 3CD4A 3ISWA 8FABB 4U1MB 1OAKH 4MAUL 4UT6H 5GGRY 4LEXL 2LVCA 1UWEL 1ND0B 4PJEB 3PJSA 1MUJB 1MCKA 3RVUD 1PY4A 1INDH 5DEGB 3R8BB 2H1PL 4M6OH 2HFGL 1Q9LA 5I9QB 1QRKA 3TH2T 1G7JA 1WICA 4N8VG 4OFPA 1JYWA 1G9MH 4XP6L 4CVUA 4W4OC 1TPXB 4POUB 4F8QA 4KZEH 3K81A 1G0XA 4HJGA 5J9PA 3LN5A 2GW5A 4S1RH 4ZO9A 1GGYA 3DSFL 4HIXL 3WSQH 3O2DH 3HE7C 4J2XA 4BFIA 2HKFL 4TTDC 4U6YA 1E28B 2MCG1 2HTKD 2OL3H 2V2XA 3EO0B 5KG9A 3VFTA 6FABH 1P7KB 4IOFC 3TO4A 3MJ8B 4LLQB 2CLZA 1S7XA 5GZOC 1QQDB 3LKNA 1ZHKA 2E9IA 3KHQA 4WUUB 5IBTL 3DRTA 3KYNB 1L0QA 4XWGL 3F58L 3ARQA 2FBJH 4GAFB 4MA1B 3O11A 3L7FB 1RAMA 4HD9A 4O4YH 2EIDA 4FQHA 2ADGA 5FYKE 3H9SE 2LTQC 4R7DB 3TO4D 3P0VH 3GMMB 3B8YA 4HT1L 2PCPB 3LN9A 2ERJB 1MI5A 1FIEA 4H0IA 3VFGH 3SDAC 1I3RB 3GSNB 5IBUG 3QIUC 1I1RA 5C0GA 1FV1B 2PW1B 4PGJA 3NIDE 5I1DA 4FQXC 3VGAB 5K93A 5JOFA 4WFFD 2KPNA 3BAEL 4NQDE 4G6FB 4HWBA 4EI5A 3IJSA 4L3CB 4TTGA 3T08A 1MI5D 4NPYB 1FBIH 3QWOB 5F96L 4M8QB 4HMCA 5FYLL 4CU8A 4ZFGL 5DRNB 5K9OA 2BC4A 5EOCJ 5SX5H 3IDXH 3RQ3A 3BEWB 4FG6C 5DA4A 2X5PA 4C58B 3TESA 3VXRB 3REVB 5F1IB 3MRGB 3O8XC 1OT1A 4F33B 3MRJB 3ZYOA 5LVEA 5EB9A 4QTIL 1F4XH 1S9YA 3I9GH 1FE8L 5GISL 2DQHL 1D6EB 2IAND 1VFMA 2YHGA 3VRIB 1N5YL 1XGPB 3RIAF 1YEEH 3CFDB 1W0VA 2APBA 3G6AB 3NVQA 4KK5D 3D69A 4LGRB 1QYGH 5DZOA 2BSRA 4M7LH 3V7AG 3FB7B 3RX5A 1MLBB 4F58H 3T0VA 3GDBA 5GSVB 5SWZB 3EJYD 1L6XA 1FVDB 1LP9F 3EIFA 4HWEL 4PRPD 2J5LB 3O4LE 3DETD 3VXQA 2ATPA 5JQHC 5SX4I 2W92A 1A9EB 5F7LB 3WXVH 3GMPB 1HQ4A 5I15L 1TZGL 3AFLA 4LLWB 3WS3A 4DKEH 1M7IA 4OTXL 4NHCH 4AMKL 4XPTH 4OCYH 5B39B 1RU9L 4MS8D 3JUZA 1FNSL 2XQYK 4Y7MA 4YO0B 3CFJB 4LP5A 3WIIH 2IPKB 3NCJH 5FUZL 4DGYL 2G60L 3B5GA 3ES6A 2EDYA 2VAAB 1LO2H 3H9SA 2D0FA 2QQNL 1KCRL 1TIUA 3KYOB 4XCEA 4EIZC 2NYYC 4O51B 3GUTB 3MODH 4RAUA 4MAYD 4LK4A 1D9KA 5DRWB 5JDSA 3U2SB 3E6HB 3MV9B 3WHE1 3GSRB 1JGLL 4FRWA 4PJGA 4F15C 5FA4B 4K23H 5D7SH 3RWJB 5DQJA 3WFDH 4OZIE 4HIJB 2NCMA 1B0RA 3FOMA 3H9SD 4D0DB 4EKXA 3LQZA 3HR6A 1NCTA 1V05A 3PABB 4NQDA 4BFEA 4ZUTB 3HI6L 1B0WA 3VU2A 2PR4L 4UINH 2FO4B 3QEGH 3Q5YA 5MENB 2CDEA 1LQSR 3QIBC 4ALAH 5ID0B 5EC1B 5A2IH 4LRNL 4LEOA 4OQ1A 1R3JB 1K85A 2QSVA 1U8LB 1YPZB 3SJVE 4PR5A 4OZFB 3LKPB 4E9LA 4NQDD 1VFBB 3LH2H 1Q38A 3GHEH 1Z9SA 1T3FA 3EO1A 3KPNA 4WHYG 4PV9B 2EEAA 4F7EB 4EN3A 1OSPH 1XIWB 3WNKA 2BY3A 3UTQB 1AGCB 3K1KC 3P77A 4R4FL 1OAUH 4RA0C 5FM5M 3AUVA 5TDOB 4O5LH 2NNAA 5ILTL 4NZTL 4UT7H 5HYFA 5IR1A 4TNVF 1G9MC 3MV8E 4MSWB 3ABZA 2CIKA 2QADD 3GMQB 5T5FH 4DGIL 4RBPK 5KANI 1RZJL 3MNVB 3LPWA 1G7IA 5C0EA 1TXKA 4RNRB 4CVXA 4LHUB 2D7TH 3O4LA 3S8WA 2AP2A 3OKEB 4KFZC 3V8OA 4NYLA 4KVNL 3AAZA 3GO1H 4P4RA 4OGAC 1V7NL 2FEDC 3T1WA 1SEQL 2ZUTA 4PRIE 4O58H 2IFFL 3LZFH 3OGOE 3VDCA 1PKQB 1KJMB 3MLRH 4JM4L 2Y25A 3QXTA 3LCYA 1XR8A 5HPMB 1KYOJ 1YNTB 1S5IL 2X4OB 1NEUA 3O4LD 3QA3B 1KTRL 1QUNA 1V3MA 4HWZB 3HMXA 5E8EA 1WTGT 4P5TB 1U3HC 2QSCL 3BX7C 4H88L 1H3GA 4WUKL 2CPCA 4R0LB 3OG6B 3QI9A 5TDPB 5F9JB 2XN9E 3UAJC 4G5ZH 3ROOA 4OLXL 4OUUA 3KPSA 3BKJL 1AY1H 4GMSH 2VERN 1F8TH 1FFRA 4PGBB 4EOWH 5T1DH 1HHHB 4OZIA 4LCWE 3UTSA 2Y4SA 1EH9A 4ELME 5F1SA 1XGTB 1CQKA 4OF7A 4S11A 5E24E 2VDLL 2R56H 2ZKHH 4ZFOB 1SY6H 1UKTA 5E8OB 1TITA 5F7FA 3QUXA 4OBRA 3KPSD 1KPRB 2EDEA 2H6PB 3SCMA 3NIDF 2DDQL 5LBSL 1YEDB 6CGTA 4XCYA 1IFHL 4XAWL 4MJIE 4F57L 5CIPB 2DJ4A 5GSRB 3UTSD 5HVGB 4LSTH 3FQWA 3MR9B 4WCYL 3SJVA 3VFVB 4Y8DC 3RWIA 5JZ7C 3B2VL 3FHQA 3WUWB 2YEZA 1FYTE 3EW3B 2XWTA 2EH8L 3SCMD 5CGTA 5BQ7A 2QQKH 2E3VA 3FTGA 4I3SH 1A7RL 4DKAA 2F19H 4MCZA 5BW7A 1L7IH 5EUOB 4D9LH 2VUOA 2AXFB 3BT2L 3BESR 4NFCA 3FQRB 3QNZA 4Q58C 5M7QA 2OR9L 5L88L 3MV8A 1I9IL 1OD7A 4G8GB 4YX2H 3QXVA 4TSAL 5BS0E 4GKNA 3PL6D 4FXLA 2Z35A 1NSNL 1CIUA 1K4DA 5IB5B 2E7BA 1TMCB 1H3VA 3MNWA 3VD4A 1ACZA 5A2JH 1NDMB 1AXSB 3JWDL 2X4UA 4P2CG 1UJTA 3OHXA 5FM4A 4RWHA 4FQJH 4RGOL 3MV8D 4PRIA 3OR6B 4TVPD 4JFYB 3CNKA 3QQ4B 2BSSB 3U0PB 1P7HL 4ZD3L 1ZOXA 1P1ZB 1KCSL 1NGWB 1IAII 2X09A 5HI4C 2EDRA 4PG2C 5FUCE 3WFEH 2ITCA 1K5NB 5F7WC 1BM3L 1TFHA 4MHHI 1PYWA 4M9OA 5GGTL 2XN9A 4PRID 4JZJC 4YC2B 3P9MA 4Q74A 1ZT7B 3MYZA 1CDIA 4DWHA 3VDBA 4GFTB 4V2BA 3TBWA 1DN2A 2KBGA 3QPQC 3HPLA 3TZVA 1CDCA 3VFSB 5DJYA 3KJ4B 1M05B 4UTBL 2F58H 4P49A 3SKJH 1WQVT 1BGXH 4OQTL 1UM4L 3TT3H 5CBEA 3CDGA 5FOBB 1VGEH 4X80H 4QYOB 1VEPA 5KANG 1B6DA 1QFWI 5CILH 2JCCF 5CZXC 1WCBB 4OZIF 5FM5O 5C6TL 1R0AL 3B9EA 3BMVA 1U93A 1K8IB 3MBEA 1PGRB 1HQRB 2F5AL 2I07B 1A4KB 1HHJB 4JFDB 3BW9B 5IFHL 5DXWA 4MZ2A 4MJIA 4I3RL 2WBWB 3RTQD 1KNOA 3C8KA 3A6BL 5BMFH 1GAFL 4I4WA 1B90A 4GT7A 1FYTA 1W8NA 2CQVA 1XH3B 1J9CT 1PEZA 3CU1A 2DI8A 3LKSB 1Q9WA 4YXHL 5C0AB 5BV7B 3W11D 3MBED 2Z0BA 3DIFA 1YY9D 2YXFA 2GK0B 3GSOB 1YEIH 1RURL 4HPYL 4MJID 5ETUA 1NCAL 5JXEC 3AY4C 35C8L 3RWGB 1MFNA 3ZKQD 4D3CH 5L8JB 4JRYB 2X89A 2EXYD 4XZUB 4Z5RA 5BS0A 1BFVH 3NGBC 1FYTD 5C2UB 2QJDA 3D25B 3KXFB 1FVEA 4U1NA 5J11C 3RGVC 5DJ6A 4R6UA 4FFZL 3WN5A 3H2WA 5D72L 3U9UA 1FFNB 5CEZE 1N6UA 2VSDA 4LPYA 4N0FA 1ZLVH 4HFUL 2VXVH 1NGZB 2CK0L 3IJHB 3MRHA 4S1DD 1DN0B 3HZMB 1REIA 3RUGE 2X89D 4FNLH 3C60A 2WUCH 2AJ3A 5GJTL 3V5HB 1VADA 4R3SB 4Z7WB 4ZS7L 3OJVC 3PNWA 3MRKB 4CUCA 2PXYB 3RBGA 1F3JA 4NGHH 1F58L 4R26H 4IS6B 4LNVA 2X10A 2YN5A 4E5XA 1JCKA 3H42H 4DUWA 2FX7L 1MCSA 1CDHA 4P5KB 2DQDL 3QUKA 4XTRD 4F9PA 1F6AA 1MJUH 4GW1A 1J05A 3S96A 5GS2H 2CKBH 3PWJB 3KVQA 4JO2L 4LVHB 4FMFA 1F4AA 4P23A 1UCBL 1K4CB 1F6FB 2BXZA 2CGRH 1QKZH 2XA8H 3L3KB 3QUYC 5IVZB 1RZKH 4NQEA 5SV3A 3RI5F 3GMRA 3MGTA 4KK9C 4EQ2A 1TJHH 4X9FA 3OR7B 3VI3E 1JTTA 1BQLH 3GBMH 4JVWA 1CS6A 1ZT1A 4FXKB 2IGFH 5AYQA 1J1XL 3G5YB 4NNXA 4P9ML 4YAQB 1KCVH 4WW1B 4K3DH 4ELMF 3OV6A 2MFNA 3WXWL 3TN0C 4RZCB 3AU1A 4NQED 3VWKD 1JWSB 3RX8A 3QT2A 3HE6A 4IRJC 4AIXA 2BJML 2IMMA 4PJEF 1FCGA 3N1MC 4XP5L 3TV3L 4X4ZA 4L3ED 1ZLSH 4QXGH 4FTVE 1FL5A 2WBKA 4NKDB 5F44A 1G7JB 3STBA 3AREA 1PG7X 1CXLA 1DFBH 5INCB 4HBCL 4MHHG 5ADPL 5DJZA 4GAJH 5J9PB 5E2WH 2P5EE 2YA2A 1A1NA 1KJVB 4W4OA 4Y19D 5EOTB 1FLRL 1MVUB 2GEEA 3MRPB 1N64L 3IRPX 4S1SH 5D6CB 1LE5B 3TO2B 1NDGA 1MFEH 3UX9B 3ARED 4ENEC 4LLVA 3TO4B 4ELKA 4WTWA 1CGSH 2VISB 4XPHL 4QXUL 4L8DB 2LABA 5E1AA 1X4XA 1BZ9A 4N8PA 1K3IA 4O2CB 3DRTB 1NGPL 2D7MA 5E08H 2FHCA 3KR3L 4PJHB 3ZKND 3O11B 2M1KA 4TSBH 1OLZA 5L2KE 1A6WL 3BKCH 1DJSA 2ADGB 1E6JH 5HYSB 2ZUQC 2DL9A 5C9JA 5E4IA 1KCUL 4HKZB 4TTDD 4U2YA 1A3RH 4OD2A 4EUPG 3EDJA 1YEKH 2E6JA 5CEXB 3BJ91 3S4SB 4OM0L 3S6CA 5JA9A 3G9AB 2XG5A 3ARTA 4G3YH 3W9EA 1KLFA 1BQSA 3CSBA 5I76A 1UACH 5I1EH 4PPTA 3BH8A 3OB0H 2Q20A 3L9RA 5I1DB 3ARGC 2DIBA 3NFNA 3SDAA 5JOFB 2DM2A 1UH3A 3QIUA 1HOCA 1KJ3L 1ACYL 4LSQH 2UVFA 5DD1L 4FQXA 1YDPA 2FNBA 1WV7T 4Y4FC 2D3VA 4JB9L 1Q72H 3KNBA 4HUXB 2AJUH 2IANB 1WBYB 1RY7B 3VXMD 2WP3T 4KROC 2BC4B 2BMKA 4UDTA 4PJIB 4U1HA 3WKMH 3C6LC 4ZAKC 3N06B 5D70L 5EORL 1A2YB 3L6FB 3QIUD 1K2DA 1IJ9A 5JOEA 4JR9H 4KHXH 1RUQH 2C1OB 3T4AB 1X7QA 1MJ7H 4PB0H 4PRPB 1GOGA 4PP1D 4OFKA 3T77B 1I7TA 3O8XA 4FTVA 3EO9L 4OT1L 4POZC 4OV5A 1DZBA 4LAQH 3SGDH 1W0VB 1S7QB 1FGNL 2EO1A 3BZFA 4A2LA 5L8LB 4CU6A 2BSRB 1G7LB 2JK5B 5FXCH 1U8MA 4PY8I 4MB5A 2XV6B 2P5EA 4DVBB 5C0JA 2Q8AH 1D6VL 2X7LA 3VD5A 5E2TH 2YD5A 4M5ZL 3OJ2C 3O8XD 2VLMD 2VO5A 1E4WL 5E6ZA 5I19L 3STZB 4EBQH 4OKVB 5DF0A 5JUEH 3OKNA 3MOAH 4LCCB 1JF5A 3MROB 5IM7B 4K94H 1U8NB 4PJ7E 3U7WH 1ZT4B 5ALCL 5HHXL 2R4RL 3PV7A 4MAYB 3VWJC 4LASL 5IOPA 5MEQA 1EZVX 3DVNB 1YYLL 1ZSDB 4NZDA 1CLOL 5L2KA 1JVKA 5B22A 1JHKH 3ZTJG 4TUJA 1A6AB 3H9SB 1OF2A 3JWNC 2ARJB 3CXDH 5F72S 5T1KD 2VC2H 3PHQB 1CGWA 1D7FA 5DURD 3RUGF 5B8CB 2HJKA 4XCEB 4PJ9C 1IZKA 4LSVH 2NY4C 3M45A 4JPWL 1T66C 1I4FA 3D39D 3TA3C 3P4NA 2ATKB 4PJGB 4N9OB 1LO4H 1KN2L 3TWCH 5DQJB 4XMKL 3WCYA 3L5IA 1B0RB 4QRPD 2XZCH 5B21A 1KUMA 1RZKC 1WWWX 2RFXA 4PJCB 4B50A 4NQDB 3FB6A 2BRRH 5ACLA 4YDKL 3ZLQC 3RWDA 1RUML 3QDJE 2NYYD 3RNKA 4Y2DC 3I84A 3QRGH 5GRWA 1X5AA 3PGCB 1R3IL 3CDCA 3VI3F 3BRFA 4PJXE 1X5FA 1BOYA 2AEQH 4F37K 3QIBA 5FYKL 1CFVL 2NX5D 2QADB 32C2B 4H20L 4U0RB 1NH6A 4WHCA 5IQ9B 1UH4A 1JZ2A 5B38A 5DJ2A 1PX4A 3EO1B 3KPNB 1N8ZB 5I1GH 1OB1A 4XRCA 3BP6B 1U8KA 3RL2B 5HXMA 5EBLA 1KEMH 2W65B 1PG7W 5T1MB 1QLFB 3FB5A 2XKNA 5EDXA 2NY5L 2QQLH 3PDDA 4MQXC 4YBQD 1ITBB 3MLWH 2BNRD 4R8WL 5EBWB 3L3JA 2AV1A 3BGAA 2VABA 4EXPX 3QIBD 2CIKB 2ZNWA 3K8MA 5ICZA 2P49B 3TP4A 3CUPA 1CFTB 2IAMB 4PY8J 1KOAA 3BZEA 4Z0BH 5C0EB 2GIYA 4XPAL 4Z7NE 3PWNA 3TPUB 3O4LB 4XBPB 4Y1AD 2PO6C 3EFFA 4L9LC 2HG5A 5CWSB 3ARYA 3OXSA 1I1YA 3O2DA 4RAVA 3D0VA 4O2FB 3ZDZE 1XGRB 2F54D 2OL3A 3GSWB 3T65A 5DHVH 4PJ7A 5D96B 1ZLVK 1GGBL 5FUOH 5MP6L 4R7NB 3ESUF 1SMOA 1FFOB 1HIMH 4JFFE 4L29A 3ZDXE 4G9FD 5E8EB 1OWWA 3C5ZC 4M7KL 2GJJA 4OFYD 3T2NL 3WD5L 4A6YL 2WMPA 1TJGL 4LPCA 4NN5B 4OAWA 3ROOB 3SGKC 4OUUB 4JY4A 1RSFA 3KPSB 1U3HA 1RJZB 5DJXB 4OGAD 3LD8B 3QXDB 4GXVH 1H15B 5IF0A 4RMRA 4RA3A 3BXNA 3RWHB 2ORBL 5J13C 4K55A 1CDUA 4HXAH 3UTSB 2A1WH 1XCQA 4ZNEE 2DQIH 3PIQB 4X8JB 5E0QA 3N1FC 1IGFL 4BJLA 3FRPA 3P30L 2J8UE 3B4NA 2DMCA 3SCMB 4WO4D 3G6JB 3UAJD 1CL7L 3QDJA 4N9GA 4Q9CA 4AEIL 3CX5J 3V4PH 4XCYB 1UB5A 1T0NA 1KGCE 25C8L 4J3OC 1AD0B 3U48A 1MNUH 4R4BA 3FQWB 4N0YL 4PJXA 3HMXL 1MELA 5DMKA 3FO0L 3HZVB 5TE7H 4YHKH 3LQMA 5TH2B 4WI6A 3PL6B 5E1HB 4HWNA 1QA9A 5D2NB 5AWNL 2VDPH 2PTUA 4OIIH 1KIQA 5C0DB 4NQTA 5EIVA 2DD8H 4MCZB 3QDJD 4MJ5A 1ONQA 1JYVA 2ID5A 5FDYA 2JF1A 4P3DA 3QNZB 4XMLH 5D93B 2F8VA 3QEUA 5DK3A 2FYYB 1JFQH 2VKXA 2DQUL 4YBLC 4GKNB 1R3HB 4NFDA 1GPOL 1J0YA 4NNPH 5CKAA 4ZUUB 1WBXA 3AM8C 5GGVL 3LKQA 5DQ9B 1K4DB 2AI0H 2OP4H 3EBAA 4NKMA 4PD4K 5HY9A 4FP8L 3JSSA 3DVGA 1MFBL 3DX8A 2X4UB 4Y4HD 4K94C 5F7KC 1B4JH 3BPNB 3O6LL 2O26U 4NQXB 3HA0A 1BZQK 4E41A 3NN8B 3IDMA 1A0QL 4JFFA 4M43H 4JFQA 1YY8A 2WBJC 4JKWA 1B88A 4KK8C 3MCG1 3L3HA 1GZQA 2ITCB 4PRNA 1A21A 2ADFH 3U0WL 1PYWB 3QXAA 4PG2A 4IRZL 2ADJB 4XMPL 5D7KE 1E27A 4AH2B 2GUOB 3BZ4A 5KOVC 3V52H 4ZPVB 3TBWB 2EYSB 1PG7L 3HPLB 4JZJA 5EOQH 4E41D 5TF0A 5CBAA 2XTLA 3NH7H 3VGDA 4J6RL 3N1PC 4JFFD 3DX9A 5KSBE 4YGAB 3A6CL 3RTQB 4N5ED 2NY1D 1P4IL 2FBOJ 3BVNA 4ZNEA 1UGNA 4JQIH 4KKLD 3MACH 2P7TB 2ZCHL 5AZEL 4G80A 1YECL 2W07A 1BQHB 1T0PB 3QHFH 1TTGA 2CXKA 4QRUA 4Y5VC 5D8JH 3AS2A 1JGUH 3KPPA 1TQBC 1K6QH 1NUFA 4QRSA 1J1OL 4DN3L 1I8KB 3QPQD 5EPMA 5DC0A 4XNXH 1RZIA 1X6LA 5DUPL 3MLTB 1FSKC 2YMXH 1FAKT 3X13A 1FYTB 4ZFZA 1E4XL 3VD3A 3JV0A 1BPVA 2ZUWA 4XP9L 5SWQB 3ROLA 1T4KB 2XWJA 4XNUH 4PJXF 3QCUL 4MQSB 2VITB 1WFUA 5EBMA 1R5IA 2Z8VC 3DTXA 1J11A 5ETUB 1MIEH 4U6VH 4LVNB 1IRAY 2WANA 4XC3H 2OK0L 1S8DB 2CUHA 2I9LB 2KH2B 1MCBA 3UYRH 5JNYB 1C5DA 5JXEA 4KKNA 2VDQH 3QJFB 3AY4A 3W9DB 4PREA 2Z4QA 4I77H 3MLZL 2QEJA 3LEYH 1FVEB 1R5WA 4F7MB 4I1NB 4YHPA 4JZNB 1YA5A 5DJ6B 4NZJA 3ULUL 3BSZL 3MJ9L 2F9BT 3NA9L 4X99B 3U9UB 3QFDB 1UKQA 2YUXA 4N0FB 3I85A 5IB4A 3RGVA 3HNTH 3QUZB 3QAZB 1B0GA 1FPTL 4L5FL 5DLML 3F12A 3V6FB 4Q2ZB 1VADB 4KRNA 1JNNL 3GIVB 1V3JA 5D2LE 4TPRL 1MHHA 3ZDZF 3O3AA 5CGYD 1F3JB 4P0DA 4UILL 5EULV 1P2CA 3V95A 2A6KB 3S36X 2L0DA 1A5FL 4DOHE 2DQTH 2VLKE 5KVFL 4HH9B 4OCSH 1NL0L 3QUKB 3V0WL 3P0GB 2DQEH 4GW1B 2N7AA 2UVEA 4M6NH 3K2MC 2YD4A 1DBMH 3IDNA 1M6OA 3HFML 3ZDXF 4YDVA 4KQ4H 5L2JA 4P46D 5H37G 2XZAL 5FGCE 2PETA 1T2XA 1KEGL 3JVGC 5I1KL 5JW3L 3SDCC 4NQEB 3VWKB 1EAPA 1R3KB 3TLRA 2GAZA 5KSBA 1KXTB 3GMRB 4ODUA 3MGTB 4M93C 4PJ8D 3QUYA 5KVGL 2K9UA 4MNQE 4L3EB 1L7TL 4K2UH 3J8F7 1KFAH 4KMTL 1G7MA 1N3NA 1IQWL 1SY6A 3IRZA 2IMNA 3K3QA 3HB3D 1OP9A 4JLRB 3Q2CA 2DM7A 2MKLC 4Z7QE 1FYHB 2Z31C 1NCWH 4WEUD 9CGTA 2J8UF 3TN0A 3WLBA 4MAUH 1L0XA 4X4XB 4LEXH 1UWEH 1U8PB 3R0MA 4Y19B 3FN0L 4YIQB 1CU4H 1NBZA 3ZE2E 4NRYA 3RVVC 4IRJA 1I9EA 1GRWA 4F7TB 1ORSA 2H1PH 1NQBA 3AREB 2HFGH 3SO3C 3O2VH 2EDBA 5HYIA 1QSED 2X4RA 2KUTA 3ARRA 2X4PB 1N4XL 4KI5F 3D85A 4XP6H 5F21B 3TN0D 1C5CL 1A1NB 1KTLA 5DJCA 5ESVB 1AQKL 1NKRA 4OCWL 3VRJB 1ZMYA 4IMKC 4HIXH 1JZ4A 3KJ6H 2DM3A 4L9DA 4RAHA 5B39G 2Q3ZA 1NDGB 1I7UB 3DURA 3V6ZA 4LLVB 3CFKA 1OTSC 4HX1A 3TFKD 3V2AR 1CZ8L 2K3TA 1OW0C 3K46A 4AIZA 1J86A 1BZ9B 5D1XD 4WI4A 4OGZA 5HD8D 5GGUA 3QCTL 3RAJH 1S9VB 1LO5B 1QBLL 5F8QC 5IBTH 4DEPB 3RWCA 4XWGH 2AV7A 2ZCLL 3F58H 5D2LA 2XQYG 1YMHA 3WNOA 3FT4B 2PYFA 3C6SA 3H0TA 5GRVK 2MHAA 3D48R 4MCYA 5C0FA 2I25N 2VLKA 1EEYB 5ISZE 4HT1H 1BECA 3GGWA 4XGZA 3VXMB 1CDBA 1DBAL 1RUPL 1JPSL 2EDNA 5I76B 1KULA 2DLIA 4P4KB 1H0DA 1JGEA 2WQRA 4RGNC 3QIUB 2Y36L 1YEFL 4XHJD 4B7LA 2JJWA 4PTUB 2E9WA 3ARGA 5D1QC 5DS8B 2ZG1A 5C86A 3BAEH 2AVGA 3DYMA 4MNQA 3PE9A 5CEZL 2FHFA 5CP3H 2YPVL 3GJFK 4KJWC 2FLRT 4LIQH 1J87A 1CK0L 2IC2A 4Y4FA 4WVRA 4OZFG 5F96H 2D7NA 2BMKB 1F42A 1A64A 5HDQL 2AJXL 3HI5L 2UYLA 5C6PB 2LU3A 2XZQL 1S7RA 2P8LB 3QUMB 1L6ZA 3DV6A 3ARGD 3C6LA 4ZAKA 3HS0B 4UQ3B 4UNUA 4E0RA 1ZVSA 2H8PB 3HC0A 4LVOC 2FWOB 4LPVA 3P9WB 5KS9E 1I7TB 3O8XB 5FV1L 1IAOA 4QTIH 2ESVE 4OV5B 1FE8H 5GISH 2D03L 5E56A 1N5YH 3MXVL 4X6FA 3RL1A 3VFMA 2A77L 3BH9A 2J88H 4HUVB 4V1DA 1Q9KB 4LHUG 1U8MB 4KROD 2MOVA 3MV7D 2ZSWA 3QPXL 5BXFA 2MQCA 5JHDE 3KPRB 4WV1B 3C6LD 4X98B 1AGFB 5D9SA 4J23A 2HT2D 4X6DB 1VEOA 2BY2A 3MJ6A 4HWEH 3H3PH 4K8RL 3P9LB 1S9XA 2P5WD 1UB6A 1FL3B 5T1KB 1HWHB 3OAYH 5DURB 5I15H 1LWRA 4POZD 3L5JA 4I0CC 4V1DD 3O9WB 1DLHB 5IW3A 4DUVA 4JEGB 4XBGA 1BOGA 1MWAL 5MEQB 4OF8A 2OTUB 1AR1C 5IOPB 5FA3A 4AMKH 3D39B 4CVWA 3FQNB 1RU9H 1FNSH 4JY6A 4MA8L 2M8XA 3VWJA 4OLZL 4FZ8L 4L1DA 2VQUA 4OIAA 4QRPB 4TUJB 5F7DA 2QBWA 2HVJA 5FUZH 4K71B 2G60H 4DGYH 4KAQL 2DMBA 1H3WM 2HJKB 2EE2A 4PTTB 1A1MB 2QQNH 3MRQA 1KCRH 1NANH 1FFQA 5ISZA 5D2LF 1U58B 3W39B 3QFJA 1FJ1B 4M7ZC 3NAAL 5GXBB 4FQCL 2XG4A 4XCFL 2UWEE 1WZMA 3TA3A 5B4MD 1TCRA 2CKBA 3VA6A 5C09E 4GQ9H 2FD6H 2NX5B 2EICA 2RFXB 1EEUA 4XVSL 3DBXA 2R1XB 4OKDA 2R0LH 5FDWB 2UZXB 3BPCA 3MGOA 4D9QD 4QNPE 3EYQC 4Z7UE 4IIQC 3RWDB 1NLBL 5ISZD 2D9QB 1EK3A 3HI6H 4JHWL 5ITFA 2PR4H 2FATL 2R2HA 2FIKB 4U6XA 3QFJD 3RNKB 1AXTL 5KSAC 1D3CA 1FCCA 2NY4D 1FQ9C 3Q1SH 4WNQA 2BNRB 3WUWG 4CDHA 1OAYL 4Y2DA 3NCEB 3QIBB 4N0UB 4BQ6A 4LRNH 1WIUA 1U3ZA 4PY7B 3MUGB 4IRSC 5DJ2B 5H94A 1OB1B 4I48B 4XRCB 3CU7A 3NCBB 2VYRE 1UVQA 4Y1AB 5KS9A 3OX8A 1CXFA 3HNSL 4PJ5B 5DZNA 1A7BA 1Q0XH 4KZDH 2ESVA 3U6RA 1ZS8B 4Z7QF 5JXAL 5GIRA 1MY5A 4YQXH 3L3JB 1BBJB 2AV1B 1DLFL 2F54B 4F37F 4NZTH 1EO8L 4HGKC 3ZE2F 3I75A 5JHDA 3BZEB 4XNMB 4DGIH 5I6XC 2CO7B 5CSZA 3DI2B 2VJXA 2BERA 3PWNB 1QP1A 4JDVA 2NPLX 4MD5A 4QTHA 3E6FA 4G9FB 3SDYL 4DK3A 4AG4H 2ESVD 3D0VB 3L1OL 4LQFL 4P9HL 2BHZA 1MREL 2PO6A 1RIVL 4L9LA 3T3MF 2OL3B 3T65B 5M94B 4QHKI 1UYWL 4KVNH 1HXYA 3SY0A 4UI2A 1XF2A 4MQXD 1V7NH 3D3VD 5JHDD 1SEQH 2EE6A 2OZ4L 4BQCA 5CINL 2W0FB 2XXMB 5CZVL 4JM4H 1AFVH 2UUDH 4WHYH 5C08D 2WINA 1MCNA 3MO1A 3CLFH 1S5IH 5I1HL 4HF5L 4R2GC 1FNLA 1U8OB 1ULVA 5HGDB 3QQ3B 2PO6D 2YPLA 3N1QC 4X7EC 5EO1B 3C5ZA 2QSCH 4H88H 1NKOA 4WUKH 1I1FB 5IHLB 4XPBL 4WO4B 5DTFB 4OLXH 5HYQA 1DE4B 1CE6A 2Y6SC 3BKJH 5IF0B 3SGKA 1TJIL 3BXNB 4LCYB 2Q1EA 3VFWA 3JV6B 4P2RE 4BQBA 2UWEA 4NM4L 2GFBB 2DLFL 5C09A 5GS0L 5EZIH 1WGOA 3S88L 1X5KA 2YPLD 4F2MA 1A6ZA 4NCC1 1RMFL 4N8CL 1Q9OA 1JF6A 2VDLH 1C5BL 1I8IA 4Z7UA 4HMDA 2MQ0A 5JORA 3FQTB 3PWVB 3ULVE 2OJZH 2R1WB 4N9GB 5DJ8A 2DDQH 1KXVC 4B53A 5LBSH 1HYSC 2VNCA 3CK0L 3UTZA 3SDXE 4R4BB 1IFHH 4XAWH 2PYED 2FBJL 1WT5C 2A6JA 3IDUA 1A6TA 4F57H 4J12A 3IDJB 3Q6GL 3PG2A 4WI7A 4WWKD 3SDDC 5KSVA 3B2VH 3CAFA 1QVOA 3S36L 1JPGB 4MJ5B 2EH8H 2J2ZA 4G7YL 3HHRB 5DRZB 4Y4HB 5I0ZA 1ZA3A 4LGPB 3OGCB 5ESQA 5I8OL 2CSPA 3OJDA 1DR9A 3BT2H 4BFBD 3IXTB 4IOIA 4L8BB 5IMKB 2OR9H 5L88H 2HFFA 5E94A 2DF3A 1I9IH 2CLVB 4GJTB 2CRMA 3U0TA 1Y6KR 3RDTD 1WBXB 5TE4L 4Z95L 3O3UN 4NKMB 5HY9B 1NSNH 4GKZB 5IMMA 4BK4A 2EIEA 2GSGA 3AM8A 1CLCA 1P5VA 2E7MA 2X4NB 5SX4H 4D2NA 5ICXB 5HVHB 1ROWA 3DUUB 3JWDH 2X70B 3N1GC 4OFVA 4QO1A 4LOUD 4QHKJ 5TQ0L 2DWDA 5GGQL 1CVSC 5BV7L 4U1IA 3IDXL 5H2BB 2PW2A 4E41B 4BZYA 5E6YA 4WU5B 5L7XL 4J4PA 3M8OL 4ZD3H 3CSGA 2RHEA 3ALXA 4LLMA 2RCSL 3ZHKA 2G5BA 2NY1B 3L3HB 2V5SA 1GZQB 1MFAL 1O7SA 4ZO8A 5I1IL 3OTTA 2IBZY 2WBJA 4DAGL 1E27B 5A43C 2GI7A 2YRZA 3BZ4B 5GGTH 3HRPA 4WI3A 4K7PY 1S7VA 4GW4B 1YEHL 1NBQA 4J4PD 3SE9L 5EU7C 3WEXA 4JY5L 3KLHD 3BIBX 3DX9B 3UDWC 3S34L 4MQTB 3WO4B 4P2OC 4UTBH 3BVNB 4OQTH 1ERNA 4KK8D 5F93C 1RUKL 4OB5L 2ZOLB 3BQUC 5HHNA 2UWEF 3G9VA 4QRUB 3PWPE 4X7TB 1HI6A 1EMTL 3C08L 5C6TH 4CRPA 1R0AH 4C54A 4OZGB 8CGTA 2BVQB 3X17A 4OZHE 3V5KA 3AB0C 4Y5VA 4YGVA 2F5AH 4QNPF 3HKFA 4QXWA 5EPMB 1KTKE 4Z7UF 5IFHH 4I3RH 4KTEL 3NCJL 1ZWIA 3A6BH 2LVEA 1GAFH 2YC1B 4HKXA 1FFPB 3PV6A 3PGDA 3QH3B 1TVBA 5J1TC 4MLSA 2XWJB 2DLTA 1T20B 1JHTB 1DCLA 1Z9OA 1DANU 1R5IB 4YXHH 3DTXB 2OJEA 3FO9B 2ENSA 4X7SH 4HPYH 3GI9L 1FAIL 1F3DH 1XZ0B 3DHMA 35C8H 4HG4J 1UQSB 1V5JA 4PLKC 2Z4QB 1R5VA 4JFPA 4S0TD 4WEBH 2OLDA 1R5WB 3RPIA 5F7HA 4P5MA 3MFFA 4YHPB 3RJQB 3NGBB 3KHOA 4U2ZA 4BSWA 2AXGB 4WDIB 3OAYK 4HIIA 5J11B 2GSIB 1NEZA 3V9FA 2YZ8A 4FFZH 4D9RE 4IMLB 2Q7YB 5D72H 5HYSG 2NLJA 1B0GB 4HFUH 1KBGL 1OGAE 2IH1A 5DHVA 4M48L 3CIQA 4P46B 3X14A 1MHHB 1PKOA 3JBG7 5GJTH 3O3AB 5J6HA 3OKOA 4O02H 3S4SG 3WJLC 4ZS7H 4OCRL 1IAKA 3EKCA 1CE1L 3CFCH 4PJ8B 1DQDL 4RGMB 15C8L 1OSPL 5CEYA 3UJIH 3RA7L 4Q6YA 4PG9B 3IDNB 1G6VK 1CGTA 1M6OB 2RAMA 3LSOA 5AG8A 1T0MA 4KV5F 4X9GA 4X6CE 1UCBH 1EAPB 5KSBB 4KJYA 1J12A 3JVGA 1W0WA 4RGNE 3T1FA 3SDCA 3MFGB 4WTZA 4ZYKB 1DQJB 3KPOA 4WFGD 4CBPA 4CMMA 4HDIA 1X5GA 1IEBB 4XCCL 3GO1L 2ZSVA 3PWPA 4AT6A 1MHCA 3LZFL 4ZUVB 4JO3L 4P9MH 5IIEB 4OZHA 4KDTC 1CTNA 3MLRL 3WXWH 1QSEB 4GKSB 1RK0A 3TN0B 3WLBB 5DRXA 3SDCD 3ULVF 4HCRH 1FNEB 1BF2A 5J56B 5IKCB 4NDMB 5EZLA 4YUEL 1L9MA 2BJMH 4NRYB 5I8CA 5DFVC 4XP5H 3TV3H 4HKBA 2AGJL 3T0BA 1ORSB 4HXBL 3SDXF 1UJ3C 5DDHA 4KGJA 5K9QI 2F5BL 3O0RL 4JO1H 4KDWA 3PXHA 5D1XB 3ARWA 5FKPB 2X4RB 5CP7A 4HBCH 4PRBA 2VDOL 4I9WE 2Y7QA 2N7BA 5L6YL 3LKRA 1DUYB 5T1DL 1Z5LB 1KLUB 1JWUA 4IM8A 4EDXB 2OYPA 1FLRH 5SWSE 5LCVL 3VH8B 3DURB 3MBXL 3V6ZB 4IMKA 1U2HA 1VFUA 3RVVD 3UJTH 1OGTA 5FO9B 3HAEG 3IS1X 5T3XL 4OBSA 4QXUH 4XPHH 1KJ2B 4W70A 1NC2A 3JWDC 4TOYH 1OW0A 3IFOB 1T04A 1NGPH 3BFOA 5IESH 5EUKA 1D5ZA 1NBYA 2E9BA 3MLVL 2AV7B 3KR3H 3RNQB 1OGAA 2D9CA 2ICEA 3G08A 3GMOA 3L95A 2UUDK 5JPMB 1IGML 3AMKA 3I02A 1A6WH 2PYFB 3H0TB 4MCYB 4Y5XB 1IAIH 1KCUH 1QRNE 2ZUQB 2NTFB 2PF6A 3HZYB 2FJGB 2QQKL 4HSQA 2HN7A 5D5ME 2WWMC 4XGZB 4OM0H 1JNLH 4U6HA 3RY4A 4D9LL 5AAWA 2Z9TA 5T3ZD 1OGAD 2Y07L 2R9HC 5DHYB 1KG0A 3X12B 5FGCB 5EG6C 1H0DB 1QNZL 3F7QA 4MXQD 2G9HA 4X6CA 3R06B 1IC5L 4GRLC 5INDB 1RIUL 4LLDA 3ARGB 2FSEB 4HJ0D 1ACYH 3FO2A 3ZE0E 1HCFX 5DD1H 2XT1B 4JB9H 4GG8A 1FNHA 5D7IE 1BP3B 1DQML 5CJXC 3HR5A 3R4DA 4ZQKA 4WI2A 1QFWH 2P8PB 4FZEL 3S5LA 3U1SL 4HK3N 3WS6C 5C0CA 5BJTB 5DK2B 2UYLB 1D5IL 3H8NA 1S78D 5CUSH 3DGGB 4KROB 1S7RB 3MV7B 5D70H 1AP2A 4ZXBC 1U92B 3OKDA 3C6LB 1NAMB 5I66B 1ZVSB 4EUPH 5TDNA 3HC0B 4LLUA 2QSTA 3S35X 3VFPA 3STLA 4OZHF 1IAOB 1R6VA 4UNTA 1MF2L 4MYWB 3IVKB 2P5WB 3EZJB 4K3JL 4LFHD 3EO9H 4H26A 1WC7A 4OT1H 5C0CD 3BH9B 4GAYB 4J3WA 4V1DB 3GIZL 1FGNH 1MAKA 1NFIB 3BIAX 5E4EB 4ZTPL 4HGMA 1U3YA 2F58L 4EI6A 5A1AA 1CFSA 5IB3B 1BGXL 1HSAA 1D6VH 4X6DF 1T2QL 1FZOA 4PP2B 4M5ZH 3ZMRA 1NUGA 4HHAA 1RZGA 1S9XB 1WVZA 3I50L 3H3KA 3MLSL 1J0IA 1CFQA 5I19H 4KVCH 4LVEA 1CDYA 5JHLH 5JIIA 2IH3A 1BOGB 3MTRA 1WISA 4JY6B 5ALCH 5HHXH 2R4RH 2YOCA 4OSUL 3P73A 3HN3A 1YYLH 3H9HA 3D1MC 1ZAGA 2HVJB 2APTA 1KYOK 5F9OL 2FH6A 4S2SB 1JTPA 3NOIA 5I74C 3MRQB 3DRQA 3ZKMC 3A67L 3P4MB 3D5OF 1QRNA 5DVMA 1IMHC 1BFOB 5ISZB 5D5MA 4PRAB 3QFJB 2H2SD 3LN4B 4C56E 1G9NL 4JPWH 5KVEH 1FO0B 3BEVA 3RU8L 2R23B 4C55A 3JXAA 4N1HB 1KN2H 1M71A 4Z7VB 4XMKH 1BFVL 3DBXB 3DUHA 2V5RA 4UNVA 1NC4A 2NY0C 2AKRA 2IJ0C 3BGFB 3HLAB 4YDKH 4X6CF 2X9YA 4U6XB 5D7IA 5IFJB 5I1LB 4GKOA 4IIQA 2MCPH 5F7NC 5ECJE 3WL9A 1RUMH 1WCQA 1MAML 2HVKA 4LIQE 2VXVL 4GLRH 3QSKB 4WW2C 5KSAA 1R3IH 1FVCA 3O6FC 2FZ3A 3DYPA 5JA8B 4XHQA 1CFVH 4H20H 4NJAL 3P2TA 1E4JA 4ZODA 4PLOB 1QBMH 2DN7A 2XQBL 3OX8B 3KDMA 4HEME 4QRRA 2F74B 5DR5H 1XGQA 1NFKA 2BVUA 1ZHLA 1KB5B 3WIFA 1ZLUH 4OGXL 2VLJE 4K07A 4R8WH 2VXQL 3D3VB 3OMZA 4LRIC 5JHDB 4ZSOB 2FL5A 5JPNA 1MFCL 3A6OA 5CSZB 5HGHB 2G5RA 3GSXB 4QT5A 1RZKL 4JDVB 3TBSA 5HGBA 4MD5B 5C08B 4QRRD 3E6FB 5C8JA 5DD0L 3NPSB 4JVUA 2VDMH 5I8EA</