4ODWA

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
218
structure length
208
Chain Sequence
b'VKLVESGGGLVKLGGSLKLSCAASGFTFSSYYMSWVRQTPEKRLELVAAINSNGGNTYYPDTVKGLFTISRDNAKNTLYLQMSRLKSEDTALYYCTRLYGNYVRIHTMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 Fab (IgG2b kappa) light chain
molecule tags Immune system
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
total genus 34
structure length 208
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA01
2ADGB 4PB0L 3JUYA 3CPLA 1FFPB 4PRIA 1OGTA 5EU6E 5CZVL 4IMLB 5LGHH 3L95A 1OSZA 2VE6B 4EN3D 4QRUB 1T1XA 1NCCL 4B7LA 2UV3A 1UEMA 3V95A 1ZV5A 4OIAA 1FZOA 4NC2B 4NKOA 1JMZA 5TDPB 4NQDB 4HFWB 3DBXB 1IGTB 1MVUB 4NSKA 1MJ7L 5FV2A 1E6JL 5F88A 3MRCB 2FR4B 3ZTNL 3MA9H 2H6PA 3H9ZA 3NAAH 3QCUH 3O2DH 4GAYB 1XZ0A 5LBSH 3MRNA 1OT1A 1W0VA 2Y25A 4CMMA 4BQBA 1S5IH 1N3NA 1DBAH 4KZDL 3TNNA 1MY7A 5ETUB 1MCDA 3WFBH 5B4MC 2IG2H 1CLOH 5HJ3A 4Q97A 5C0JA 4V1DA 4C56D 5CIPA 1FRGH 3CFKA 4U0RC 3RGVD 1JRHL 4Y8DC 4NNXA 5KVMC 4UTBH 1WBYA 3QIUC 1GGIH 1IILE 2XZCL 2AXHA 3DXAE 3GNMH 3P4NB 4IRSD 4Y5YA 5EWIH 3U4BL 2QL1A 1HXMB 3JTTB 3O0RL 3T3PF 4X6BB 1YECH 3QJFA 1NCNA 4XHJD 3O3BA 2WQRA 3I6LE 4R4BB 3ARGC 3WLBB 2J4WL 4I18C 1U6AL 4P23A 2GKIA 5DUML 4OZ4B 1FNEB 4O2CA 3NIGE 1KN4H 4KQ3H 3WD5L 1ZK9A 3SCMA 5DTFA 5DS8B 1WSST 4Y5VC 2GY5A 1FGVH 4G8GA 4Z7WF 1YJDL 5ESVA 2NXYD 3LOWA 3C60A 3WIIH 2LAAA 1SJHB 2HFTA 3RDTC 3KAAA 1J8HD 3G5XB 3MBEC 5DFTA 4PJIE 1V05A 2VAAB 5DRZA 2VIRB 1WIOA 1AHWC 3ZKQD 4NC1E 5EZIH 4PJ8D 2P42B 2ZCLL 3ESVF 2VKWA 1TTUA 4X6EA 4MCYB 4XVUD 1OAQH 3C08H 1XF1A 2OQJB 4EQ3A 1AE6H 4XCYB 4KK8D 1XEDA 3TCLB 1KTLB 3HG1E 2DQDH 5F6IC 1T03L 2PYEE 1U42A 3MRPA 4DTGL 2DQFA 3SE9L 2JJVA 3TO4D 4PY8J 1XGPA 2F53E 4D9LL 1U3HD 1EK3A 1IBGH 3QR2A 3LZFL 3U9UB 2XICA 1FNSL 4MWFA 5JZ7D 3OJDB 2VXVL 3BP6B 1NUGA 2NX5D 1RJLB 2MOVA 2FIRT 3NFNB 5F7NC 2FATH 1DQLL 4L1DA 4YQXL 5DURD 2GFBB 1KN2L 3P9LA 3HNSL 3VE0A 3WS3B 2CXKA 2I9LA 1ACZA 1EVUA 3G04B 3V5KA 3F7VB 4M6MH 2WWMD 3MOAH 2Q86B 3ULVH 4JG0H 3KPQA 4FXKA 5FA4B 5DJ0B 2BSSA 3EFDH 4HPYL 4AIZA 1DQDH 1HXYA 2NR6C 1KLUB 4AT6B 2F5BL 4FQ1L 4OGYH 2VSCA 5E6ZA 5K9OA 3V6ZB 3CSYA 2GJ6B 5D1ZB 3MJ9H 2IQ9H 4PRHD 5SX5K 3UTSB 4Y2DC 1QBLH 4JR9H 2YD6A 5HYFA 1ZMYA 2HKHH 3CSBA 5J13C 4FMFA 3ZYZA 5EC1A 2PW1A 3KYMB 9CGTA 1IAKB 4MMZC 4R96B 3UO1H 3WN5A 5ID0B 2Z93A 2C1PB 4YPJA 4YPGB 1LNUA 1CDYA 1BZ7A 5I0ZA 2PW1B 4XGZB 3TA3C 3P9MA 4I0CC 4P23D 5K93A 5BO1L 1HYSC 2DICA 1UM6L 4X8JB 1BOGA 3VFVB 3HMXL 2MWCA 1GC1H 5IBLD 1CF8H 2JIXA 2ZSWA 4PJFF 1Q9LA 1CGTA 3SGKC 3SKJL 3GJFK 4F8TA 4MSWA 3GSRB 5IMOB 1CFNB 4Z0XA 3UEZA 1IC7L 3QH3B 4LK4A 1HZHL 4ZNEE 4ZXBA 5L0QB 2LU7A 2BRRH 1MVFA 1SBBA 2CLZB 3V6OA 4PB9H 1Y6MR 1WBXB 4HV8A 4NDMB 4JHZA 1N4XL 3P0GB 1JF1A 2BNRA 3ZMRA 4AL8H 3C5ZD 2QADC 1GIGH 4WW1A 2GAZB 1K3ZA 1D6VL 4U1KA 2ESVE 1BIIB 3PJSA 4EXPX 2AJUL 2PCPA 3QPQD 3L1OH 4JQXA 1KYOJ 3GKWH 5GGUB 1KULA 5IUSA 5EN2B 2MTPA 4YDLB 3GIZH 2VR9A 3D85B 2VLKD 5B39B 4M7LL 2ZOLB 5C9JA 1CFSB 3DVNB 4Z7WE 3NCMA 3D0LA 4OLXL 3QFJD 2DB8A 2E7BA 5EO0B 1TIUA 2XOTA 4GKSA 3WNOA 1HHGB 4Q58C 5J4MA 2NMSA 2GJJA 1IM3A 5K59F 5K9JL 4IMKC 2LV4A 1D9KA 3GBNL 3GSWB 5I8OL 3DBXA 2E8ZA 2OL3L 4PRID 1F3JA 3MRIA 3P11L 3K7UA 4PRDA 4AIOA 4U7MA 5DHYB 2F74A 2NX5A 3ELAT 4HKXB 3RTQB 3UBXB 4HZAA 3LIZH 2Q8AH 2LU3A 1YQ2A 2NLJB 1X5JA 1KC5L 5E2UH 3WJJC 4O9HL 1XIWB 4CNIB 3O8XC 3NTCH 5DJZA 5A2LH 1HXMA 2AJVH 4PRDB 3A67H 3BIKB 2FYYB 3KJ6L 4MAYC 3FB8A 5T33L 4OLEA 5D7IF 1LP9F 3GMOA 4MLSA 3K74B 2JF1A 2VXTH 4PJIB 3TWCL 4TVPD 2HKFH 1OQOA 2NY5C 1CL7L 3NACH 4H8WL 3QRGL 4NHUA 2VR4A 3AREC 4CADB 4LRIC 5I16A 1I1AD 4JY4B 3LEXA 1C5CH 3LHPL 4F15C 2QQKH 2WMPA 3SBWC 4OLUH 5IF0B 3ETBF 3N9GL 5DD0L 1U2CA 5L2JA 4GRLB 4XZUB 2Y4SA 5DK2B 5FK9B 1ORSB 3U9PL 2YWZA 4J4PA 3L7EA 4X7TB 1IGFH 3CLFL 4QHLB 2VAJA 3IDNB 5DQDH 5C71A 1WWBX 2FDBP 3G6JA 4OQTA 3S36H 4UV4H 3RX7A 4C59B 5BW7A 3P73A 3BPNC 4U1GB 4LKXB 2QKIA 1CFBA 1CYGA 3EJYD 4FQJL 3QO0B 1ORSA 4I3GA 3QQ3B 2KQNA 3QISA 3KNBA 1S7TA 2DKUA 3O6FD 4NUJB 1CFQB 3QQ3A 4NKOB 2EDLA 4HS3B 1IT9H 1JFQL 1TDQA 4U7SA 4RMVA 4M48H 2APWA 3RIAK 2WBJC 4FNLL 3MRGA 1OTUD 3ILQD 1T3FB 2EE2A 3MGOA 2Z31C 4Q6IA 1XGYH 4JRXD 3EHBC 5BOZG 4JN2B 5EOQH 1NMAL 2R8SH 1MJ8H 3IJSA 1ZT4B 1KB9K 4PJHF 3PGDA 1RMFL 5C8JB 3HRPA 4XPAH 1LEGB 3K8KA 3MYJB 1W0WB 5B21A 2YXFA 1OW0A 3NZ8B 3Q3GA 4K7PL 2ED8A 4HS6B 3B9KD 1S78D 4LASH 2CRIA 4HKXA 5IMKA 5I1IL 4DOHB 3HNTH 2GTWA 1LP9A 4NO3B 1A02N 1L0QA 2HG5B 3VWJC 4PTTB 4AM0B 1P9MA 4LQ1A 2EDHA 1MCPL 2I5YH 1YMME 2D7NA 3ESUF 5IVXA 2FBJH 2AJZB 1MPAH 2BVOA 5E7BA 5GRVL 4R7DA 1QFHA 3E6HB 2EZ0D 1XCQB 5GSRB 4PLNC 1LDSA 1CT8A 3PQYA 3IDJA 1EEYA 4OQ1A 3TBTB 5EO9A 3M8OL 1TVHA 5D1XB 1U8NA 2OTUB 2VZ3A 4L8SA 4IJ3B 4JG1H 4RAUB 5FO8A 1OOAA 4HUMB 2GW5A 1A9EB 4BZ1L 2YD8A 1P1ZA 5MI0C 3I50H 3DUSB 4RX4D 2HFGL 4F9LA 5KSAA 3D87B 2YD7A 1U8OB 2A77L 1ND0A 3IDUA 4J3OC 4WWKC 5BS0D 4LOUC 3C09B 3VFPA 1E4WL 3RDTD 3T1FA 2MMXA 4YXKL 2HN7B 5J57B 1AR1C 1CN4A 4E41B 2DQHH 1NL0L 5IQ9B 2XI9A 1MHEB 3UBXI 1OTSC 4DAGL 1RU9H 5CHNB 2H32B 4FG6D 2BSTA 3HE7A 2AQ1A 1AGEB 3V5HB 1HDMB 5C08A 1VPOL 1KPRB 2QJDA 3B83A 2IADA 2NX5E 3MRLA 5DQ9A 1JGLL 1JWUA 1MF2H 3H3KA 3RVXD 1TZIA 5TPWH 1TNNA 3P77A 3K3QA 2F58L 3GKZA 1G7QB 1I9RL 4LSQH 4M5ZL 4ZTPH 4HGWA 3CX5K 3JWOL 3BEVA 2VUOA 4XP4H 1FFNB 2C4FU 5EBMA 1BGXH 4OFIA 1QR1B 4KZEL 4FFWD 3EYOA 4XPBH 3WUWB 1QQDA 1V7MH 1X5LA 3FT4A 5DRWB 1CIUA 4MA8L 3WBDA 1GHFH 4NGHH 2W38A 4Z7VA 1QSFA 2YC1A 5GSVA 5MHSD 4JANA 2B4CL 4LHQB 2A6JB 3P4LA 4HBQA 5IJKA 4OZHB 1YMHA 1U9KA 3QEQD 3D85D 4NQEE 3RPKA 2GCYB 4F58L 2EIDA 1MRDL 1O7VA 1T6VN 2D0FA 3GO1L 5JMOC 5H2BA 4V1DE 5E8OA 4OCSH 1PYWA 3NA9L 3RAJH 2ATKB 1MCWM 5DRXA 4WHTA 4DOHE 3OKNB 3VFRA 1ZA6B 3KPPB 4OZIB 2V9QA 3DO7A 5TGBA 4JY4A 4IRSB 4HFUL 4LP5A 2VL5A 4U3HA 4TOYH 1MIEH 1S9WA 2PO6B 5DZOA 4OD1L 1TQBC 5FA3A 2ZG3A 2YD4A 4BSWA 5IJVA 3T4YA 4IOIA 1E4KA 2WP3O 4XH2A 3MNZA 4EI6A 4YPGA 3BIAX 3HZYB 1KJMA 3IFPB 1VGKB 4IDJH 4Q6YA 3BSZH 1RHFA 4KK5C 3DVGB 3B9KB 4ETYA 4U6HA 4RAVA 3O3AB 1ZTXL 5SWSD 2P5EB 5I75B 4UIKH 3L5JA 2HFEB 2AJXL 1YPZF 2AGJL 4LEXL 4MJ5A 3WL9B 4Y4HA 4HXBL 1XCTA 3MLWL 3SQBA 3ZSTA 3CXHJ 3TJHD 2X2YA 4L1HA 1P7KA 1P7QD 3DETC 4JY6B 4PY7B 4WV1B 3O2VH 4HEPG 4I3RH 1M7XA 3TH3T 2I27N 4ONFH 3C8KA 3E3QC 4LNRA 4H88L 3MV8B 2JJTC 4L4VE 4DN4L 4YHIA 3IAGC 4JRXA 1VFMA 4OLZL 2DS4A 2AJ3A 2UVFA 3MJ8A 1R24B 1F3JB 1EGJL 2GYSA 3LN4B 2WV3A 4IHOB 1KJ2B 2OLDA 3TH4T 3ZSSA 2BNRD 4GAFB 3M1BA 5D7SH 1WC7A 1AQDA 3DX7B 5CJOL 4IHOA 3WJLA 4ZTOL 3SPVB 5IMMB 5FIEA 3MLYL 2R0ZH 4D3CL 2IH1B 2WUBL 1FV1B 1BZ9B 5KSAC 1L9NA 1D3CA 3TLRA 2P47B 4QTHB 3QIBA 2WSKA 5TH2A 4HCRH 3RWDB 3BESR 3MNWB 1SQ2N 1U8PA 3SHSA 3HNVH 1KEGH 4CU7A 5EU5A 4JY5H 1S7UA 2ED9A 4R0LC 4EVNA 2DF3A 4XVSL 4JM4L 4POYA 3TNNB 1MI5D 4TPRH 1A14H 1S7UB 5DMKB 2DWDB 3LMJL 3RIAF 1NBYA 2ATKA 4X4MA 1BFVL 2AS5M 5TE7H 4HKJB 1S7SB 1K8DA 3D1MC 3L7FA 5FYLH 3O11B 1IQWH 2YA1A 4FFZH 3THML 1WBYB 5T3XL 4GKNA 3TNMB 1IL1A 4A6YB 5BV7L 2NNAA 4WFFD 2IQAA 4R2GB 5DD1L 1YN7A 2WAHA 3GMQB 3ZDZE 1NCAH 3BGAA 5HDQL 1A9BB 4XPTH 5GRWA 1A4KA 4JDTH 3MMEB 2KH2B 4N0YL 4PJCA 3LKPB 3V2AR 1IGCH 1A7RH 1MCHA 2LAGB 1WUNT 5DD3H 4OV5B 4NKMA 2Z31A 3WFZA 5FO7A 5E08L 3OKKB 4XPGL 2GI7A 1A6TA 4ZQKA 2ICEA 5FUZL 4TTGA 4LSVL 4PJ5D 1E4XH 3BEWB 1KYOK 2VL4A 3QUZB 2VLRA 3VXPB 2A38A 2BNQE 4PJBF 4QHLA 2P49B 2D03H 4G8EB 1MHCA 3UJIL 4JQVC 5DJCA 5F8RC 5MI0B 1YY9D 4NNPL 4HK3N 2MHAA 4JDZB 4HWBA 2IGFL 4ZPTA 2O26U 2OJZH 4OM1L 1LILA 3CJJA 3OG6B 3HR6A 3VFGL 4MXWL 4YIQA 3BOVA 2VLLB 2IFFL 3KPQB 5C0FA 1IGYB 1Q72L 4P2OC 1BQLL 3D0LB 5DRWA 1NLDH 5HHOB 1DBKH 5F6HJ 1QOKA 5D6DC 4ORGB 4TNVK 4HDIA 1XR8B 1X5KA 4UNUA 1V8HA 2P4AB 2Q8BL 5I1GL 5JW4N 2BY3A 1BEYL 3RWHA 4FQCH 4RGND 2ZSVB 4LLWB 1GVIA 2QHRH 4GRWB 4QGYA 2QQNH 4G42B 4K71C 4WTZA 2NCMA 1DQJA 2LABA 4GXVH 3SDYH 32C2B 3H3PL 12E8L 1J8HA 3F62A 4LVEA 5F7FA 5JTWA 4D8PB 4S1DD 4CJ0A 5MENE 1QQDB 3QHZH 3DO7B 4RFOL 4M6NH 4HS6A 4PJXB 1CGYA 3BXNA 4DUXA 4KVNH 5EORL 4KRPB 4PUBL 1U95B 1VHPA 1DFBH 2DYPD 4MQ7B 4MNGB 3W81A 4P4RB 5CD5C 1NAKH 1E4KC 1R3KB 5DC0A 1Q9LB 3T77A 3B6SA 2RFXB 1GH7A 2JIXD 4NZRH 3MLTA 2D31A 43C9A 1AGFA 4WUUD 1OAZL 3HMWL 1KCVH 3KXFB 3X12B 2DL2A 4LVHB 3J8F7 3LQZB 1Z6JT 5ANMA 4PJHE 4LP4A 1L6XA 4M7KL 4LCYB 2EO1A 3R1GL 4GRWE 5D7KD 5TE4L 2OXHA 5C0RH 4KUZL 2XPGA 5EUOA 5BRZE 1BOGB 1AI1L 4HK0A 1CLZL 1YEJH 3RL2A 1S7RA 2QQLH 4WJ5A 1T83A 1XGRA 3EGSB 1I8LC 1FNGB 3P9MB 1F4YH 5FDWA 4U1KB 5F21B 3LKNA 2W0PA 3VI3E 1NDGB 3EYSH 5D7JC 4EOWL 5J6HA 2X4RB 2HT3C 3VXUE 4WHDA 2HJKA 4JFZH 4EUPA 1MELA 1I1RA 4Y2DA 2ICWB 1SEQL 4OI9A 2EIEA 3I3DA 2PYEB 1OP5H 4LCUB 2V9TA 1HDMA 4QCIB 5HVHB 3CCHB 3BP5B 3VRLF 3P30L 3MREA 2BCKA 4BKLA 3F7VA 1JPSL 1KPUB 4ONGH 5CHNA 4APQC 2W07A 4JFOB 1PG7W 2CDGA 1XGUB 1PEZA 1OQXA 3K8MA 3MBEA 5KS9F 5F9DC 3P0YL 5I74B 5DMGD 1W0VB 3G5VA 2C3GA 1XF5A 5SWSB 3DOSA 1UEYA 1KUMA 3BP7B 1KT2A 3WIFA 4UV7H 1DVFC 3TYGL 4E42B 2FSEB 1I85C 2JKXA 4FQXB 3VXSD 4IRJD 3OG4B 5GS0D 4BQCA 2BJMH 1AO7A 1GPOH 4P23C 1H3VA 1MVUA 5EC1B 1G84A 4HMDA 1YEKH 5HSFA 4HX1A 3QXTA 4CN6A 4OCMC 1NGPH 3FB8B 4K8RD 4DEPB 1UWGH 5D2NA 1IAIH 2AXFB 1T04B 3W9DB 3M1BB 4JPIA 3TPKA 4L29B 3G6DH 5GHWL 3AB0B 5IMLB 4UINH 5I1HH 2ZCHH 2BRQA 1C7SA 5JQ6H 3WNNA 2YD2A 3OKEA 5EZJA 2OK0L 2YPLE 4PJ8A 3CUPB 4N68A 4Q9QL 4G6JH 2JB5L 3F58L 4S1RH 4YZFE 2OX5A 3MNZB 1EA9C 2HTKC 3W0WB 1RZFH 5EC2A 5TQ2H 4LNVA 1SJHA 4G6FB 4XP5L 5ISZB 3DVFA 1QRNB 4L8CB 5KANG 3NIDF 3L3GA 3MZGB 3WKML 2CKBA 2JJTA 3QDMA 3QXAB 4ODXB 1CE6B 4OJFL 5TJWK 1FVCA 2DJSA 4OV6F 5DJDB 3UJTH 1I8IA 1CR9L 1UWEL 1MEXH 4I1NB 3HC0B 1LDPL 1NFKA 2XTJB 5D7JD 4TVSa 5JDSB 2VDQL 4XRCB 1H8OA 3BJLA 5HVGB 4UILL 5C0BA 4I3SH 3WNLA 4Z7QF 4K7FB 4P57B 3OXSA 4HUXB 1YC7A 4HULB 4WGWB 5F9OH 2ZUSA 1UKTA 2SEBB 3KWWA 4AENA 2CJUH 1VFBB 1MCIA 3V6OC 2VERN 1PG7H 2C26A 1DANT 3DRTB 2LFGA 3CXDH 5I66A 1R5VA 3VD9A 4P5TC 4X8XA 4P9MH 4I9WD 4XWOC 5K59E 3P4OA 1YPZE 2X9XA 3VG0H 2XRAH 5C09D 3KYKL 4LRIA 3B9VA 4O2FB 3QXUA 5D2NE 4JM2D 3HUJF 5FYJU 4G8IB 4YHIB 1A2YA 3KR3H 4PS4H 3CMGA 3D18A 1KCRH 1BLNA 3UTQA 3QQ4B 4HJJL 5E8DL 4LKXA 3EJJX 2WQ8A 3RA7L 5FEBA 2EDFA 5TDPA 4GT7A 5GGVH 4L8DA 1MWAA 1QP1A 1IGIL 3PXHA 5JIPA 4HWZB 1A3RH 4P46D 2AKRB 3X11B 1EJOH 3OJDA 1JNNH 4N0UB 5E56A 1SBSH 1RIUH 1GCFA 3PWUA 5EIQA 2CIIA 1U8LB 1OTTC 2YN5A 2EE6A 5T1KA 4P4KA 1ADQH 1H0DB 1JV5B 1LMKA 2X41A 3RWDA 3BPCA 3S97C 1R3IH 1FIGH 3W5MA 3PHOB 1BF8A 2Z8WC 3MV11 3T0EA 1JNJA 1OW0C 3MGTB 1JMXA 5C0JB 2XZQH 4Y5XB 2NZIA 3WHXA 4DKDC 3FOMA 1J8HB 4PJ7E 5DYOA 4HCRA 5T1DH 1ZS8B 4KGJA 2VQTA 4HBCL 3BHBB 5K9OB 1RFDL 5JPMA 3AU1A 1ERNA 3DGGA 3EOBB 3N06B 4FQ2L 4HWBH 5F9JA 4RFNB 3MV9B 1WAAE 5T3ZL 5AG8A 4S0SD 5I8KL 3MCG1 1WBXA 2ZOKA 1ZLVK 4XNZC 2C1PA 1XGPB 5BZWA 5DDHA 1VGEH 2PO6C 4JAMA 1KACB 4YHOL 1YNKH 3C5JA 1EHAA 2P48B 2DQFB 1GJIA 3G5YB 4G9FD 4HXAL 4AQOA 5D9SB 4JDVA 4JFEB 3T0VA 4P5TD 5IVOA 3H0TB 1A8JH 4PREB 4U1MA 2OTUA 4L8SB 3QUYA 4LLDB 3NFNA 1NCDH 4UQ3A 2JIXB 3VGFA 2RGSA 4O5LL 2NY4C 1OAXL 3VWJA 1WTGT 2A83B 4KPHL 1FZJA 5E2VH 4AQ1B 1T89C 1F90L 4WRLA 1I3GL 3MROA 5AZEL 1J1XL 3PP3H 1S78C 4JAMB 4ZQKB 3ZYIA 4HDIB 1QACA 3GHEL 5ALBH 3RL1A 5B8CA 4XB8A 4YUEL 3BKJL 1JHKH 5F7EL 4PJHA 2VXQH 4HV8B 3T3ME 4QYOB 1FE8L 2MJWA 1ZLUK 3GSXB 2VLLA 2FEEL 3EW3B 1F8TH 3T2QA 4ODTH 3KLHD 4U1NB 4JB9L 4Z95L 1MHHA 2WIMA 2XTJC 1KJ3L 4RFEA 4QXTB 4HG4K 3W2DH 3GDBA 4DGVH 4HIXL 5DJ2A 2CGRH 3U82B 4I0KA 4Z5RA 3WXVH 4F33A 4IIQC 3ARSA 2DWEB 5I1EL 2WZPD 5FHBL 3U4AA 4C54A 1IAKA 1QSFB 2EXYD 4QRPD 4S11A 4ALAL 1T2JA 3T0DA 3DXAA 2ENYA 5GJTL 3RNKA 1EFXB 1OAYL 2VDKH 4PJBA 3LKOA 1R5IB 3VXOB 4ZO8A 3QNYB 1CXLA 3HB3C 4LSRH 4FQXD 2P5WE 2NXYB 5HI4D 2F53A 3CSPA 4M4PA 4MQTB 1GZQB 5FYJL 3I6KB 4I5BB 3OB8A 4M62H 3V4PH 1UYWH 5JORA 4R96A 1D5IL 2YUWA 3BD4A 1A6WL 1KXTB 4RQQB 3W0WE 3DUUB 5IFAL 1HK6A 3T8XA 4K94H 1A6UL 2DKMA 5C08B 4NBZB 1G9NC 1PY9A 3OPZH 3C8HA 2IJ0C 2NTFA 4X98A 1I8MA 4G5ZH 5HHQB 5IP4A 1MLCA 1F4AA 3RJQB 4ODWA 1B4JL 3QJHB 2D7TH 3SOBL 5C0AE 3OKMB 2MPAH 5HD8C 5D1QD 5GISH 1T1XB 3SKOB 2B5IC 1XGTA 2G5RA 2CKBB 2LTQC 4QNPE 3IETB 1G9ML 5BMFH 5C0GB 4XVTH 1K3IA 4K23H 4DQOH 2J88L 4AENB 1JGDA 1HYRC 4QY8B 3OWEA 3TPUA 4AEIH 5FF6B 2EDRA 1P5UA 4DZBA 1JYXA 4G8IA 4MD0B 4JJHA 1H9VA 3WUZA 2OS7A 4K3GA 3GMNB 3CFCL 1LE5A 4ZFOL 4ZUVB 3TYFA 3QDME 3QCTH 2V7HB 4UDTB 1Z2KA 3OZ9H 4FTVA 3DYPA 4LLUB 3AREB 2X4OB 4ZFZA 5CJQH 3CPLB 4D9QE 4R26L 4I18A 1NSNL 1EAPB 2P5WA 4I77H 4XPFH 1QPXA 4WWKA 1NEZB 4Q0XH 5EIIB 1TETH 2X4OA 5HY9A 2IAMD 4CVXA 1CVRA 2XKUA 4U1SB 5EN2A 1AFVL 1U8KA 3BFOA 1Q9OB 1LD9A 5CFHA 4LLWA 4PRBB 1FL5A 4YC2B 5KOMC 4DN3L 2B1AH 3RUGE 4GLRH 3JV0A 5HPMB 1GAFL 3RTQC 3WMSA 2YKLL 1CBVH 3EDKA 2OR9L 1Q9OA 1BZQK 1EEQA 2R56L 4JANB 4CVXB 3LS5H 3MRMB 2R4RH 5EUKB 2DMCA 1S7SA 2KUTA 3HAEG 2O5ZL 3D25A 4HAGA 4JM2B 5HYSB 3I2CL 5HGHA 5C0CD 2R2EB 4DWHA 5IKCA 1IC4H 3QJFB 3BPOC 1MCFA 2BHZA 4Y5XA 1U8HA 4PP1D 1I1AB 2ZKHH 2RIKA 3RRQA 1HQRB 3C60C 1BHGA 3RBGA 1UH2A 3O2WL 2XN9D 5JW3L 2Y07H 4BFIB 2FNBA 1TJIH 2JTDA 3OKYA 1QFUL 1CLCA 5A40E 4LF3B 4XP6L 4NQVA 4P3WA 1SMAA 2OMBA 5CILH 1I9EA 3QPXH 2BC4B 5DO2C 1J05B 4MAUH 3JTTA 5CLWA 4BH8B 2XIDA 2VL5B 4I5BA 4NKQB 2Z31B 3MCLH 4KQ4L 5IHZA 5I6XC 1V3JA 3SEPA 1G9NL 1KBGL 3N1MC 1G1YA 4Y89A 2BSRA 1FC2D 5C0EB 3D69B 5DEZA 4P2YA 4LDLB 1GOFA 1AXIB 4JN1L 1NGQH 1ZSDA 4G7VL 2A1WL 4ZPVB 5E8EB 3PL6D 1EUUA 1NJ9A 4X80H 4Y16D 3BGMB 3VA6A 1A3LL 2CK0L 1U92A 4U6YA 5JDSA 4O2FA 4ZD3H 1S7QB 1C7TA 4LPCA 1QFWL 1INEL 3VRIA 2FR4A 4Q2ZB 3E8UL 3IDIA 4OAWA 4YGVA 2HT2D 3MRJB 3S37H 3WNMA 1QBAA 4Y1AA 2Z92A 7FABL 5DC9B 5FYLE 4NFBA 3DX6B 3LN5B 4GW1B 3WO4C 4FQLH 1JGUH 2ATPB 3LS4L 3QDJD 4RSVA 4KAQL 1MCRA 1WICA 3KLAB 4JO3H 5I30L 4TVPL 1EV2E 3QG6A 1T0PB 2UYLA 5GGSA 1FZOB 1ONQB 3FFCE 1DBJL 4MS8D 1EPFA 5J1TC 4X7SL 3DV6B 3OGCB 2BERA 4A2LA 4QO1A 1MAMH 2V7NB 5EZOH 4KRNA 1NUDA 3O4LA 2MQCA 4X9GA 4PJAF 1FZMA 4MA7H 4ODHH 5EUOE 3HCVA 3WDHA 2EDQA 4OF7A 4HUVA 2YPKA 4FQQA 1AD0A 3S96B 4IRJB 5C0FB 1PSKH 4MNGA 2MFNA 4QXGL 1F11A 2X70B 2P24B 4XCFH 1UG9A 2GK0A 4QRRB 2K7QA 5EU3B 5BZDB 4OF3A 1JTOA 1LQSR 2DQGH 3BKYH 3GSOA 2WBJB 3LDBB 4Y4KA 5IB5A 1HKLL 2YEZB 3QNXB 3FONA 4PG9B 5B38A 4RX4A 3FCTB 1CD0A 2VWEC 2HJFB 3QIWA 4N9OB 4DCQB 1IEAB 3MSPA 4X99B 4ZDHA 5KSVB 1I9JH 3IFNL 1TQCC 4YHZL 1IFHH 1NMCC 1XF4B 3QPQC 2JK5A 2ZPKH 5HHMB 3OJMB 2R9HC 4ZSOB 4HF5H 3RIFK 3IU3A 3VXNB 1GZPA 2VC2L 4NJAH 5IV2B 1FZKB 3T8XB 1LK2B 3OXRB 4XCCH 3CK0L 3PWLB 3H0TA 2NY2B 3MLVL 2AQ2A 4P49A 5DSCA 1RZKH 3H9SE 4AIXA 1F97A 4UUJB 1BX2B 3QI9A 1TCRB 2FEDD 1MCBA 2CMRL 3PXJA 3UAJD 2LU4A 3QDJA 5FF6A 3QZWB 2JELL 3EO9L 5F9JB 4M7LT 4U0RB 2AK4A 5GGRA 2DLGA 3MFFA 4NP4L 3QEHB 3PGCB 5DEFB 4XP9L 5IT2H 2G9HB 3O6FC 1V3LA 2ADIB 1NGXB 4NN5B 1ZLSL 5L88H 4FQIL 2HLAB 4J12A 4I4WB 3FZUD 1FORL 2FGWL 3VJ6B 4Y4FD 5KZCB 3EYFB 5FHAH 3UTSE 5DVMA 2ADIA 3HI6L 3ARRA 4APQB 3WUWA 1CXIA 3MRCA 1HIMH 3HZKA 2H8PB 2EC9T 3QQ4A 3UZEA 2R29L 4HS3A 5JHDE 4I9WE 1LO0L 1CE1L 1QA9A 3EAKA 4G6AD 1YN6B 3QHFH 1UXWA 3PQYE 1KNOA 4U33A 1NGYA 3AGVA 3O6ML 4JPKH 2A6JA 5KJRH 4G3YL 2FLRT 4KDTA 5D8JH 3WFHA 3OKDA 4XMPH 4N1EA 5HYJB 4B41A 4CNIA 1PKQB 1ACYH 2XWBB 1HXYB 4KKBD 1UA6L 1IGJA 2BX5A 3EUUA 4ELMF 3DVIA 3V0WH 1H3PH 1I9IH 4WU7A 1FL6B 4XBEH 3TP4A 5EC2B 2X6MA 1X5YA 5F7KC 2EECA 5I1LA 4JFDD 5IWLA 2IAMB 3BISA 4HMEA 3C6LB 5HHVH 4JHWL 2VISA 4NPYB 4MNHB 4OFYD 1D5BA 5EOTA 3OKEB 2X4TB 3QXAA 4TSCH 5EZJB 3TJEH 3HC4L 4QHNB 2YXMA 4LL9A 5J1AB 1ED3A 5DWUL 3IDJB 1UWXH 1E0OB 4P9HL 5JW5B 1G6RB 4F7CB 4OZIE 1LO4L 1DSFH 4KUCF 5E6IA 3ARQA 3UAJC 4MYWB 3Q1SL 1T66C 5DUBA 2AK1L 1JGVH 3RDTB 3VXRA 4MNGE 4PYGA 4KY1H 4P2RE 1DVFB 1WISA 3NZHH 4XAWH 4K7FA 2BHYA 5C6TL 3L5WA 1I3VA 4XNMB 3SE3C 1FNAA 4MNQD 3VG9C 5ADOL 1J1OH 4HC1H 4KK9D 1T0NA 4F2MA 5CCKL 1X4XA 3CH1A 1T1YA 4FTVD 3MRBB 2VXUL 3CD4A 1G7JA 4ODXA 2YMXL 3I6GB 1N0XH 3RVXC 2ATPA 3EYUH 1J5OL 2AEQL 3BWAB 4M61A 4P2QD 4X9IA 4AJ0A 2IPUG 2H6PB 5GIRA 3PDOB 2BNUB 2XWJA 3CU7A 2E3VA 2BNRB 4NQSB 3MRHB 5EOCJ 3QFJA 3CZJA 3RWIB 3U7YH 5J0BA 2MKWA 1FYTD 2EXWD 3CVIH 2VLMD 4GKZA 5F96L 4Q9RH 5IEHA 4POZD 5HHOE 2ZOLA 4WUKH 3OX8A 2AEPL 1LO2L 5CD5D 3P4OB 3KLSA 5DI8B 4N0UE 3T2OA 2YBRB 5LGJA 5I18L 4W6WB 1DBMH 1P4LA 3AS2A 5HXMA 1CGWA 2CDEA 1SMOA 1Z0NA 3QHTC 4FTVE 2R2HA 3L9RB 5MEOB 1D7FA 2B8OT 4XMKH 4X6CB 5E94A 4Z7UF 3ZT5A 1YPZA 1FH5H 4LEOA 1X4ZA 2LE9A 4M3JA 3OF6A 3WO4B 1RIHH 4M5YL 3FB7A 4P3DA 5D7IE 2FJFA 3GSUA 4ELMA 1AXTL 1QSEB 1QEWB 1I7RA 1JBJA 1KGCD 4LEOB 3R8BB 4ZDHB 4AG4H 5KSVA 2P8LB 3S3SA 3FCTA 4N5EC 1EFXA 4LPTA 1BVLA 5AZ2L 4HK3J 2F19H 2PW2B 4F7EA 2EH8H 5DMYA 3EYQC 2X1QA 4FG6C 2IANA 4WI9A 5DJZB 4GRLA 4XZUA 5GRVK 4ZOAA 5HDLA 3DV4A 3V52H 4WI5A 5F7LB 2F9BT 4BA8A 3UYRH 3PP4H 1J10A 1ES0B 3QUKA 5SWZD 4LQFH 4NUGL 3STLB 3BKMH 3SE3A 1MFEL 1W72B 4UIMB 4Y19D 5J11C 1B3JA 5E2TH 3R4DA 3S34L 1FGNL 3MGAA 3REVB 3WXWL 3TIEA 1QSZA 2QSVA 3MC0A 2WBJD 1BD2E 4N1HB 4P2CG 2FJHA 4L5FL 4FFWC 5DJXA 5GXBB 4MDJB 4JQIL 1NAMB 5E99L 4BZYA 1UZ8B 4PJ9B 4YEFA 4XC3H 2BSED 3S7GA 1JVKA 2XZAH 5D7KE 2Z91B 1EEZB 4IOFC 4JEGB 3V4UL 2MCPH 2C1OB 1K4CB 2RR3A 4L8SC 2UZIL 1AC6A 1SYVA 5DJXB 3G6AA 4C55A 1G7QA 4JJ5A 4H8WC 1EJ6A 3IU4H 4D94A 3DIFA 4PLJD 4XCYA 3OMZA 1SJEA 2LVEA 1CXKA 4Y5VA 5DUPH 3D3VE 4QHMA 1OVZA 1RUMH 1XR8A 4FOMA 3VXUB 4KDTC 5D9SA 2MKLC 1MAKA 3MLXH 2ZNXA 4UT7L 3GM0A 4BM7A 1YMMD 1C5DA 1U3HB 5L7XH 5IB1A 2YPKB 4FQQB 3AY4A 4YHPB 1MRFH 2W92A 1WAAA 2MQ3A 3IJYB 1M4KA 3HRZA 3D5OF 2N7AA 4K3EH 3JV5A 4MNQB 1X5XA 1UH3A 3O6LH 4OD3H 5KVGH 4RMSA 1JPTL 2E6QA 3LRHA 4MS8C 1GGCH 5CGTA 5FKAB 3ARUA 4K94C 2J8UA 1GGYA 2RB8A 2IPKB 3QXVA 1QTYT 2NY3D 5E1AA 1KB5B 3L3DB 4L4VA 4NWTL 2CIKA 4O2EB 2C7UA 1BD2D 4XCNB 1BBJB 3KXFD 1X6LA 5ANMB 1NCTA 4R2GC 4G43B 3ALXA 4DKFL 3MV01 1OTSD 4D0CA 3NCYS 1F45A 4P4KD 4AEFA 2AJYH 4GBXD 5F1IA 3GSRA 1R5WB 1NBZA 5CKGA 1WZLA 5IBLC 3B8YA 1UACH 3WHE0 3TVMB 2HRPH 3BUTA 3CVHL 4K71B 1A4JA 4U1JB 3UZVB 1IC5H 4ODUB 5CEYA 4LCCA 3U46A 2KDGA 5D5MA 4OIIH 4Z0BH 5CP7B 3ZE2F 4ELKA 3IFLH 2DKSA 4RMQA 3SJVA 5J11B 2EICA 4GG6F 3NH7L 3K4AA 1IEBB 25C8H 3R0NA 2BHUA 5BJTB 3D69A 5BVPH 1RD6A 4LSPH 4ZO6A 1NBZB 5C0IA 1AGFB 4U1LA 3A6CH 3BIBX 1HINH 2BCKB 4BKLB 2VZOA 2R0LH 2ZSWB 3W11C 5MP6L 1OGAE 3RU8L 2WK2A 2PYEA 4WEUD 3T1FB 5EBLB 1N59A 4HJ0D 4Q9CA 4ZFGH 4YDIL 1QKZH 3QIUB 1XF2A 4DK6A 4ZXBC 3MLZL 4AEHH 3TF7C 3GMNA 5E0QA 1A22B 3ULUC 2J6EA 5F3BB 5KS9A 2VE6A 3LKNB 4GW4B 2HMID 2O61A 2C1OA 4JFHE 4WWKB 2XQYG 4BQ8A 1HHHB 2R0KL 2R0WL 3ECBA 5C0GA 3S35H 3CFEA 1T4KA 1DQMH 2DQEL 4QRQA 3TC9A 3GSNH 3QQNA 4YK4C 1R0AL 3BW9B 2IWGA 1RZJL 1WFOA 2X4PB 3DSFL 1F6FB 3QNZA 4GUPA 1RURH 5L9DL 3DX8A 2W9DH 1TJHL 2IH3A 3SE8L 1C5BL 4DKEL 5ABDE 3KDMA 3GI8L 3BVNB 4BFEA 1PVHA 2NW3B 2IF7A 4X5XB 1WV7T 1RZIB 1UJTA 1MFCL 2AV1A 5SWSA 3OB0H 4X6CF 3KPMB 43CAA 3E3QE 4PGDA 3S36X 5T3XD 5ENWA 3AXLB 2W0FA 5TDNB 4UNVA 3Q3GB 4OSUH 3KG5A 4WI2A 2YOCA 4LIQE 4QRRA 5IEKA 3DX9B 1FBIL 1TQBB 4W68A 5CSZB 4I18B 4G9DB 4MAYD 2DJ4A 1A7OL 1MFAL 1MREL 4N90D 3I75B 1MUJB 4WCYL 1FLRH 3BMVA 3C5SA 2L7UA 1WQVT 4ENED 5FA3B 2EDWA 2NYYC 3C8DA 3ZE2E 1QRND 2C7UB 3GBMH 1C16A 3DHJA 1KPVB 5ENWB 5H94A 4JFXB 4OCWL 1VFUA 3LEVH 4B50A 5GS0H 2O5XH 3BKCH 1DP0A 1GC1C 3WLWC 4DW2L 1ZLWH 5I17B 3BYTA 1RZGB 2L0DA 3CIQA 5CSBA 2R1YA 1A7PH 1A5FL 3DUHA 1FL6A 2WLZA 3FTGA 3FL7A 5F1SA 1OM3L 2DTMH 4OF0A 3VFNA 4R97B 4QF1B 4ISVB 3EOTH 1QLFB 4QRTA 1ITCA 2VITB 3U30C 3LQZA 1NQBA 1AKJB 1HEZA 5IB3A 4P2OD 3WLBA 5L6YL 4OKVA 3O41B 5C7XL 1B90A 1K85A 1U8JA 2WUCL 3IGAA 1FNFA 4HQQL 1NCWH 1Q1JL 5I15L 4HLZG 3LKRA 4JPVH 5BVJA 1K6QL 3VU2A 5C07B 4ZYKA 4XNYL 1XGRB 5FK9A 1CFQA 1JI1A 5IOPA 5EBLA 3WFCL 4NSKB 2DQCL 2ID5A 2PF6A 2PR4L 3RIFF 3ME0A 5GGTL 4JFQB 5L2JB 1S7TB 1T2QH 1N64H 5FCUL 5J9PB 1QUNA 5DJ8A 4Y5XC 4ODBD 2ZUTA 1H3TA 1RK1A 1SM3H 5HGDA 4JE4B 1HKFA 4GSDL 2CXGA 2HRLA 1WZMA 5FM8A 5MERA 2ERJC 5FO9A 3HAEA 1WEJL 4YWGH 4P46B 4JFQA 3CFDB 4R90L 2ZSVA 5IW6B 4QWWC 1DR9A 4FXKB 4OB5L 5FA4A 3G5ZB 3U2SA 5DHVB 5LWYL 4GS7B 3FO9A 4NFCA 4TNWK 5KSBB 1KTKE 3BGFB 2DWEA 2J6EH 2DLTA 1DBBH 4PJEA 1DE4B 2JCCF 5HY9B 1RJYB 3JWOC 3H42L 4U05A 5C0AD 1F02I 4M8VA 4F7EB 2B7DT 5DYOB 4LHUA 4JKMA 3P9LB 1XR9B 2GK2A 5D71L 1C12A 4YE4H 3KVQA 2BC4A 2OL3B 3U7WL 1U3HC 1IAII 1CGSL 3V0VA 3H7LA 4ZUSA 4FFYL 4QLRA 2JK5B 3QULB 2BNQD 2OI9C 3VMPA 3ARFD 2G60H 4NQEA 4MA1C 3UC0H 4L9LB 3QFJE 3V0VB 4NM4H 4PLKD 5KSAB 5DHXB 5GS1A 1PLGL 3T0AA 1AGDA 3QDHA 3L3JA 2XKSA 4M7ZC 1OLLA 1BAFL 4LSSH 5ID1B 2BFVL 3RY6A 1LO5B 3IFPA 3ZTJH 4HLZH 3QA3B 5I76A 5CZXC 4YDVA 5CUSL 2VLKB 4PJ7B 1JNHA 1W72A 2N4IA 1B4RA 5AAWA 2W0LA 4O4YL 1YEDA 2V2WA 4HGKC 4PRNB 2J1KA 4YLQT 5MEPA 4LKCB 2PN5A 5FB8B 2P8PA 1MJJA 1NFDB 2GSGA 5INDB 3BO8B 3STZB 1U8JB 2OJEB 3FQTB 4YFEA 1HOCB 4GBXB 5FO7B 1JHTB 3RUGA 4E0RA 4XWOD 1NAMA 4LAQL 4G8FA 4PJBE 4GRMA 2RQ8A 4O02H 3B9AA 3MV8E 4UT9L 5LAXB 1KB5H 3UDWA 3N85H 5EO1B 2ESVA 2R4SH 2VDLH 4LCIH 2E27L 4NM8L 3CC5B 4FZEH 4G6KL 3HE7C 3FN3A 5TF1L 1FZMB 5DK0B 35C8L 3L3OB 3I6LD 1TQCB 2Z92B 4YJZL 3MRPB 3TT3H 4R97C 3RQ3A 3RWGB 1YEGL 3BZFA 4JREB 1U91A 3MRKB 3ULSB 5I8CB 1N6QH 2APTA 1BOYA 3VJ6A 5IBTL 2NY5H 4FXLA 3KLAA 5JXEA 2R2HB 3VFWA 5DMIL 2VLME 3O9WD 3DXAB 4LU5H 2YD5A 3V6ZA 2DLEA 2AV7A 5CJBA 1OARH 1RUQH 4C57C 2Y1VA 4CW1A 4PRPB 5L2KB 1JPST 2FHCA 5IBUB 5LQBL 3UJJH 3DX9A 5CSZA 4WHTB 3MRDA 3O3DA 1BMGA 5KTEH 4JVWA 5I1LB 3ZL4L 1CICD 2FHFA 1D5MB 2VDPL 2WLYA 5GRYA 4Y8AA 4J7RA 4KKNA 4TSAL 3FMGL 4NBXB 1U3ZA 3QAZC 3RWEB 4LARL 1QNZH 1RIVH 3CGTA 1K5NA 1JZ7A 5L8LB 3HFMH 2AV7B 5EU6D 3QUZC 3O9WA 3WV0A 1KB5A 3OGOE 1M6OA 4TN9A 1AQKH 2JJSC 2AJSH 2OP4H 3UTSA 1VADA 4R4BA 5KVFL 2DMBA 4HIEB 4P48A 4L29A 3MRRB 1J7VR 1Z3GH 1N5YH 1Q0XL 5IF0A 3QIWC 4JFFB 1T5XA 4O51A 4PGBB 4GG6B 3WCYA 1T1WB 5DA0B 3VFMA 3HTLX 4L3EB 3SQOL 1I1CA 4P4KC 5HGHB 1XGQB 2OR7A 2QR0B 3S35X 5DD5H 3V4VL 3PHSA 1G7MB 1RVFH 5GPRA 3RVTD 1PD6A 3VMNA 4S1SL 3JV4A 5BCAA 1HHKB 4ODUA 4PY7A 5IB4A 4U6VL 1BP3B 1HILB 4PJGB 5DVNA 5CBAA 3WO3B 4WU5B 3HKFA 4J1UA 1Q0YL 3BZEB 3RUGF 1IGMH 1Q8MA 5KW9H 2NY4D 1GOHA 5D7IA 3QDGB 3WIHH 4E5XB 4RGNB 1DLHB 1KIQB 4HWEL 4JRXB 4YXLL 1OSZB 2Z4QB 3QI9C 5INDA 3CFEB 3FT2A 4ZUUA 3PE9A 3OBAA 4UT6L 3AM8A 4LNRB 4PJ8C 1ZHNA 4FZ8H 4XNUL 3W11D 1TENA 3FHQA 2XA8L 1NCUA 3EKCA 2UWEB 5GGRB 3DWTA 5M94B 1QO3A 4HT1L 4XNMA 1I8KA 1T1ZB 1FG9C 1FHGA 1NMBL 1HYSD 1Z5LB 3IXTA 3O4OB 5J89A 5CMAB 3F8UB 4F37F 3SKMB 3T0XA 1T1ZA 3TESA 4QRQB 4B53A 1TZHA 2R23A 3ARBB 2I60H 3UYOD 4G7YL 4H5SA 4PBVC 1LK3H 3OHXB 5IESH 5F6IB 1U8IA 5HGDB 1RJYA 5JUEH 4Y1AB 4P59H 5DRNB 4LDOB 1KEML 5D7LA 3NZ8A 2FSEA 5FYKE 4LCWD 2HVJB 2ZUVA 4YGAB 1NFIB 4WW2F 5JLZB 1KNOB 4P5MA 1NGWA 1H0DA 1JV5A 2DQUL 1WFNA 1E6OH 2R1WA 4NBYB 4U31A 1DTUA 4KI5D 2PW2A 5FECA 4OGAC 3LH2L 2J8OA 4EEEA 3H6JA 4P2RA 4I0PD 4XNQB 3HI5H 1CK0L 5JMRA 2XN9B 4H1LB 1B9ZA 3MGOB 2R1WB 1EVTC 4PGCA 5IJKC 5A1AA 5D1XC 4FQXC 3MRNB 5FYKL 2WINB 4OLYH 3DYMA 3FQUB 2FJFB 3GSUB 4E41D 5ILTL 1NLBH 1WWWX 5EU4B 1CXFA 1R5IA 1T7XA 1EZVX 5GGRY 5SX4H 3QWRA 4HIEA 3EOAB 1MCOL 3MRFB 2WBKA 4GMTL 1YEEL 5EBWA 4JO4L 3LQMA 1OT2A 2EKSA 4GW5B 4FHBD 5GQBA 5JIHA 3FOLA 1TFHA 4WFFE 3ISWA 4JM2C 1NCBH 1HI6A 3PGFH 2EKSB 1K8IA 5IROA 4L4TE 1I8IB 1A6VL 5IB3B 4G6AC 3U0PB 1MJJB 1NFDA 2GSGB 2P8PB 4NKIH 1UM5H 5F6HI 2W60A 1AJ7H 1J0YA 2DQJH 4D9RD 3T2NL 1YNLL 4MJIB 4RBPK 5FYLD 3B3IB 1V3MA 2F54D 2ZG2A 3MXWH 2O5YH 1NPUA 4PG2A 3H9YA 3IGAB 2BY1A 4JO1L 4QGTA 2ZJSL 1P4IH 1MNUH 5IK3A 3BUYA 3U9UA 4NJ9L 4JFPA 3ARED 3RX5A 4GQ9L 5JR1L 1AD9B 2VLJA 4KHXH 3RY4A 1U3HA 3OKKA 5GIRB 5F3HB 3FB6B 5I8EA 3RVUC 4FP8L 2APFA 4HIIA 1JNLH 4GRWH 3RY6C 5GRUL 1YDPB 2HWZH 4YHKH 5EO1A 5J7CC 3HB3D 5F3HA 2JJSA 3WKNA 4DVRL 1CG9A 4LFHD 4QT5B 2CIKB 1L7TH 4OFVA 5F1NA 3MODL 4POUB 1VKXB 4C58B 2FX9H 3FFCD 3OGCA 3GMLB 1QVOB 2NY6C 4NQXB 4NO3A 5IHUH 2FRGP 3KPNA 1OP3H 3QCVH 4L8BA 2HH0L 2B2XL 1Q94B 1F4XH 1R3LA 1O5DT 4AMKL 3NCCB 5T1KD 3U1SL 1EMTH 3C60D 2EE3A 3IJYA 1KCUL 4BZ2L 4M1GH 5HYSA 5T1MB 3RX8A 1RUKL 2CKBH 1DL7L 4KTEL 3NCJH 4U1HA 4BH7A 1TZGL 1RJZA 2VDNH 3CSGA 3HA0A 5CP3H 3RHWK 3WYRA 4GAJL 3LPWA 5TQ0H 3T3PE 3O4OC 5HGBA 2P8LA 5I1KL 3CDCA 3P3YA 5TFSH 2PYFB 5IIEB 4XGZA 1NCCH 3HR5B 1E28B 1P4BH 3LSOA 1CU4H 4G80A 5ESQA 4OZGA 3MGTA 2DWDA 4L3EA 3BDBA 3SDXF 2AQ3A 4PLOB 5A16A 4KKCC 1MJ7H 1UM4L 3MRFA 4MSWB 2F5AL 1QFWI 3TN0B 4Z77A 2W9EL 3LB6D 4RWYH 1LEKA 2WWKO 1GGBH 4EUPB 2DLFH 3GGWA 3LKQA 3OQ3B 1WJ3A 1M7DB 2Q7YA 3FT3A 5EPMA 1S5IL 1ZT1B 4PJEF 3SJVB 3NIFE 1U58A 2PCPB 2QSCH 4HIJB 2GJ6D 2IPTL 1BJMA 1YQVH 5GJSH 4GAGL 1KIRB 3PWNA 5DT1H 5JOFA 4F15B 1U92B 1RZ7H 2FX7L 1QSEE 3ARBC 3C87A 3O6FB 2NY1D 3WFEL 4YBQC 4NQSA 2QADB 2X7LA 4CMHB 4LSUL 3HZKB 3TZVD 1A7NL 3MA7B 4L3ED 5EFIB 4RRPA 4YHNA 4LLDA 4WY7L 2XZCH 2X44D 5J12B 3QBTB 1UB5A 3VWKD 1PAMA 1FL3B 3X14A 3BRGC 3SO5A 3X3GL 2J4WH 3CVHB 1U6AH 2X7LB 1G7HB 4L4VB 5DUMH 3RL1B 5C92A 2NY4B 4KK5D 2A6DB 3WNKA 2FO4A 3QUMH 4BSVA 4P2OA 3BEVB 1SVZA 4NQUA 1FGVL 2DM2A 2VH5H 4M6OH 2HVJA 2PTUA 3K2UL 1OGAB 4XP1H 1AXSB 2DQIH 5CIPB 4P3DB 3AY4C 3ZKXB 4GG8B 1DQTA 1OPGH 4OCNC 4OFPA 2VN4A 1TVDA 1A7QL 1X5GA 5A2KH 3F7YA 5H94B 5B39A 1PG7X 1AO7E 1XR9A 2Q86A 3MQIA 1LE9B 3S8WA 5C2BL 3E2HC 4OD2B 1TITA 4PJEE 4QXUL 5JXAL 3QO1B 3QG7H 1F4WL 1AXSA 5E5MB 4JFED 1YYLL 1NKOA 4PV9B 5IEKB 1L9MA 4A6YL 4OT1L 4F57H 4R8WH 3C9NB 1N7MH 5JIIA 4ODSL 4MA3A 3RJDA 2BDNL 4N9GB 4G8GB 3SDXA 4RDQG 4JGJA 1BFOA 1OL0A 4F37K 2VTFA 4CGTA 1K9TA 3QUZD 3RTQA 3CUPA 3VW3H 3C9NA 3PWPE 1A64A 1IBGL 3LZFH 4PP2B 1J86A 2DIBA 3SDCD 1FNSH 3QWOA 1ZHBB 2VXVH 3DSNA 3MMEA 15C8L 2P1YA 4L4JA 2X09A 3QQ9D 3IU3B 4R0LB 2FATL 5ERWA 4RAHA 2H26A 3P9WB 4MCYA 2Z0BA 3AUVA 4DZBB 1JL8A 4IOIB 1FNEA 4O2CB 2VQ1B 5FUCC 3TZVC 3OAUL 3RVTC 2EH7H 1HSAB 3LD8B 1JPGA 3FT3B 2M26A 1KFAH 2PXYD 3O6KL 4JFPB 3EFDL 5GS3A 4R4FH 3UTOA 1R5VB 5CINL 3FZUC 3IDIB 4OAWB 4GJTB 1FDLH 4PTUB 5F1OB 1KPRA 5DD6A 3H9HA 2X9WA 1TJGH 4KMTH 4W70A 2E9BA 3V7AG 1NGXA 3KLDA 3MOBL 4RGOH 3FO0H 5FAAA 5C07D 3FO9B 3ULUH 3OXSB 3D39B 3P77B 4L3AA 1RHHB 2HKHL 5HJ3B 4XAKD 2BP3A 1NGWB 4WVRA 1Q9KB 4KRPD 3L5XH 3FO1B 5D70H 4Z7WB 2WP3T 1BZ9A 2Y06H 4FQPA 4LBEB 3BQUC 4NHCH 1R6VA 4KDWA 3OHXA 1UM6H 2QEJA 3SJVD 1JPFB 3MLSL 1BVLB 4YX2L 4HUKB 4O58H 1GC1L 1CF8L 3HPLA 4E9LA 3BE1H 4MDIA 5KSUB 3IB4A 4UZGA 1OAUL 5LXGL 2RHEA 3GB7A 4ONHA 1U3YA 4X7DC 4OLVL 5KVDL 5JHLL 4HGMA 5GGQH 1N6VA 3PL6C 3MRMA 5DJAB 4IMKA 1S7VA 5E24E 5CEZL 2H2PD 4FABL 1OCWL 3TBYB 5EIVA 1REIA 4YO0B 4ZMAT 4K55A 1D5ZB 3C09C 3BX7C 3HC3L 3D0VA 2FB4L 1VEOA 3IDGA 5EU6B 3ZT6A 4L4VD 2N1KA 5JA9A 4EVNB 3L1OL 1TVBA 1LO5A 5T1LB 3GJFH 1JN6A 1KLFA 2L4OA 3FQUA 4MNHA 4WFEE 1D5ZA 1ZGLM 3FO2B 1E4XI 4ZAKC 1WIUA 5IG7B 4ERSH 1BBDL 1DCLA 2R1YB 3NBNA 1BECA 5IVXF 5IHLB 2P5ED 5IFHL 1ND0B 2I07A 1SYVB 3FTGB 5JDJA 1J05A 4WU5A 1JJUA 1GGTA 2VLJD 3B2UC 4ZG1A 4X7EC 3SKUD 2BXZA 5MEND 5DS8A 1YMMA 1U8NB 5ITBL 3GBNH 5SWSE 2OL3H 2H9GB 4H20H 4Z7VF 1GSMA 4NZDA 3QDGE 5GS1C 3DURA 3M17B 2XKNA 1MAJA 4HWUA 3CCHA 1BJ1H 4RAUA 1KCKA 1TTGA 1CXEA 3FN0L 4FRWA 3C2AH 4H0GA 1IAMA 4Y2DB 2FZ3B 1UZ8A 4C4KT 3LIZL 1TPXC 3LKPA 3UP1A 4LRNL 3C8KB 1C5DB 4Q2ZA 2X5PA 1WZKA 3LRSB 4Z8FL 3A6BH 3UYPA 2AJVL 5DQJA 5K9KB 5DJ6B 1HWGB 1G7PB 5T33H 2IH3B 1JGEA 1JRHI 5F7HA 1Y0LB 5DMJB 5IK3B 4N1CA 2HKFL 1U8KB 1HH6B 3QRGH 1G7LA 3HPJB 3IDMB 5HHXH 3SGJC 1H5BB 1W2KT 5FO9B 3HZVA 2XWBA 5GSVB 5IFJB 1ZANH 4N8VA 4OCRH 3U0WH 1C5CL 1BD2B 1SY6H 3LHPH 5EZLA 2NY7H 1X5IA 2QQKL 1JTPA 2QADD 3UTZA 3RI5F 4DGIL 2VDRL 3LQAH 3G6JE 4PJBB 3JWDH 4P2RB 5DFVD 4EDXB 1T66D 1UXWB 5CGYD 1IGJB 3OKOB 3MO1B 3U9PH 2DDQL 2A6DA 1IM9A 5JXED 4KVCL 5I8CA 4NIKB 1JUFB 3O9WB 3BPLC 5IR1B 1EHLL 1QEWA 2FD6L 3QIBD 3G08A 4P3CH 3INUL 1ZT7B 4IRSA 1RZ8A 4TQEH 5H37G 3REWA 4MZ3A 1G1CA 1T5XB 4O51B 1XF3A 4PGBA 4HZLB 2ZCKH 3GI9H 4RCAA 2AABH 3TN0A 4PJXE 4KMLB 1ZWIB 4FFVD 5HPOA 4AK1A 4MQSB 1UZ6E 1UCTA 3LEYH 4HS8L 2RFXA 5JOPE 3TNMA 1I4FB 4R9HA 4C83B 2VJXA 3IDXH 5CWSB 3CZFB 1P6FA 3QDJB 4LSTH 4JLRA 1INDH 1R3KA 1JFQH 2EYRB 4J8RB 4J3XA 4M48L 2J8UF 2D0GA 1UGNA 2XQBL 4O00A 4XC1L 5LKNA 3S9DB 3MLRH 4QOKD 4ZODA 4XBGA 3Q5YA 1HSAA 1JPGB 3TVMA 5LCVL 4QWWD 3HLAA 1A9EA 3FFDB 1KF9B 4WV1A 3TO2B 3VGGA 3I3EA 3OXRA 3KWWB 2AK4D 4J6RL 2Y5TB 1FYTA 1NMAH 4Z77B 2YPLD 4BK4A 3BP5A 2R8SL 4PRHE 2ICES 3L5IA 3RWCB 4F7PA 1LWRA 1Q9WA 1T2XA 1YEFH 4GO6B 3F6LA 4LLUA 4PLJC 4M7JL 1RUAH 4R0LA 4KTDH 4F9PA 1IMHC 1IE5A 1KB9J 4PJGF 3EZ8A 4K7PH 5J6HB 4EI5C 1FPTH 3RUGB 4E0RB 5EIIA 1WLHA 1FNGA 3HNTL 5T1LD 2AV1B 3MX0A 1RULL 4ZS7L 2WIIB 3CFBB 1JGDB 3NIFF 3JUZA 3ZKMC 4WEMB 2I5YL 2YSSB 3QG6B 3RVWC 2FBJL 1CL7I 2DBLH 3MOQA 2IALA 1MPAL 3NABH 1QO3B 1RZKC 2OTWB 3GZKA 2DQTH 4LPWA 4NT6B 3C6SB 3AMLA 4OLWL 1D5XB 4XMLH 3VXRD 4NN5C 1KCLA 3QIWD 5BXFB 2AJ3B 2EYSB 4EDWL 4JKLA 1I7ZB 4JG1L 1ETZA 4HC1A 3N50A 2C5DC 1KENL 1Q9KA 2HFGH 4ODVH 4MCZB 1C16B 1PKQA 4HPOH 2GHWB 4PP1C 4L4TD 3S37X 3T0EB 1OGAA 3FRPA 3MV9D 3MXVH 3DPBA 1T1WA 1IKFL 4RGNC 4YDKH 4FFVC 4S2SA 1PY4A 3DROB 4MJ6B 4ZNCD 5E94B 4BELD 1XGQA 4HX1B 2IMMA 2BVOB 4DAGH 2ILLA 2NTSP 4QEGA 1E27A 5ALCL 3BT2H 2NNAB 1CDJA 1K5NB 1OTUC 4XWGL 5GRJL 5AYUL 1BFSA 3SGEI 5F71A 1CDHA 2YK1L 1HNFA 5ID0A 3EYVA 5SWQB 3REVA 4D0DB 5E8NB 1JGLH 1MF2L 3BPCB 2IQAB 2FECI 3QEGL 1KG0B 2F58H 4DGYL 3B43A 4OKDA 1I9RH 5T5FH 3JWOH 3ROOA 4KHTL 2BVYA 5J56B 4OZ4A 4XP4L 3VXME 1KG0A 4PREA 4NWUH 2XZZA 5AEAA 1AY1L 4XPBL 5EOCH 1BPVA 5CD3A 4D0DA 5AWNL 4N0FB 5SV4A 5I66B 3T0EE 5FGBC 3O9WC 4U6XA 1L7IH 1OSPH 5JA8B 1YZZA 4X7TA 3PL6A 5GZND 5HYQB 1CD1A 3MV9A 1NJ9B 4GMSL 4ZS6C 4RISH 3VH8G 5DLML 3CMOL 3K80A 1X9QA 1P7HL 2YHGA 4YXHH 5HBBA 4P57A 1JHLH 1T0MB 3DHMA 5BW7C 5JQHC 1MRDH 2D2OA 4OGXL 3T3MF 3I02A 1CQKA 2XV6B 1N26A 3D9AH 2VUYA 1CLYH 4QRPB 3GIVB 1FVDA 4L3EE 3RP1A 1PZ5A 2Y72A 1KIPA 1NC2A 4GQPH 1HH6A 1MJUH 3WE6B 1MCCA 1QLEH 4HUNB 4TOYL 4AIZB 2XN9A 3PWJB 2PTVA 2D4FA 2A9ML 3RWHB 3TT1H 3RNQB 2P43B 4QHMB 5FKAA 5DR5H 1EUTA 4K9EH 3NCBB 4HHAB 5D6CB 4M00A 1DLFL 3NFPA 1A2YB 1MRCL 2YPLB 1JWUB 3DMMB 3FB5B 1YY8A 3ARGB 5SWZE 43CAB 4JM2F 3I9GL 1F00I 1ETZB 5JOEA 1OGAD 2Y6SC 2FX8L 3U36A 4L3CA 4PG2C 2EEBA 5BS0B 4PB0H 2V17L 1MHPL 3GMLA 5D6DA 3TN0C 1NEZG 1TVHB 2AJXH 5L8JB 4LHUD 5AYQA 1RY7B 2YPLA 1F11B 2X70A 3UCRA 3CDGA 2ORBH 3BH8B 5CEZE 1XF4A 4F9PC 4MXVF 1IARB 1MLBA 3NA4A 3U48A 1B0WA 4ONFL 4K3DL 2XTJD 5D7JB 4DCQA 3ET9F 4DN4H 1XT5A 3DTXA 2HG5A 3ULVE 4D0BB 4WI7A 4WI3A 2E7HA 1M7IB 3DLQR 5HHNA 3U6RA 2OYPA 5LBSL 2IANE 1CFVL 1MFDL 5ITFA 2OQJA 4TRPH 5B22A 1ADQA 4YH6A 2X1WL 3OAZK 3WFBL 4R7DB 3G5XA 5JO5A 5CJXC 2IG2L 5D7SL 4L4TB 1MHCB 3F65A 3GRWA 5CJOH 5FV1L 1AD9A 5FDYA 4X8JA 4QCIA 4ZTOH 1IQDB 3KPSE 5IROC 1P9MC 4GXUM 4UB0H 3DI3B 2DYPB 4WHYH 3PP3K 1IM9D 3O0RH 1M7DA 4PBXA 3MBEB 4RRPG 1G7IA 2X9YA 4NNYA 5E03A 4XVJH 2YA0A 3EGSA 3QZWG 2H32A 2H2SD 4JY5L 1S8DB 1DDHA 4X6DE 3BGFC 4P9HC 1ZVSB 4WUUB 3WIHA 4U6HB 1INQA 4XVSH 1OAKH 4NZJA 3WD5H 3FQWA 1H15A 4TPRL 1A6ZB 2VQUA 3L3IA 4WW1B 1YJDH 4Y16A 4LIQL 1PKOA 4OTXH 5DFWH 3LMJH 5L2KD 1BFVH 1B0GA 4FQXA 3PWPB 1RUPH 2KBGA 4NQCD 3IDYB 4JQVA 2AI0L 1EO5A 2DL9A 5HD8D 2Y6SD 2Q1EA 3KPSD 4PGEB 1T6WA 3TIDB 1TZIB 3PG2A 5E95B 1RJZB 1II4E 2ZCLH 4APQA 4RFEB 2AXFA 3UMTA 3B9EA 5TGBB 1NCAL 4KTYA 1EH9A 2BVTA 2DN7A 3TEUA 4JDTL 4DEPC 1VACB 5KG9A 5ESQB 4M7ZB 1OD7A 3KPOB 2DQDL 3S96A 2VZTA 1N8ZB 3SDAA 3H2WA 3IRPX 5A2JH 4PLKC 4OM0L 4CVUA 4UOJA 4CVZA 1RQ5A 1FO0L 4LCCB 3U46B 4PJ9D 1WGOA 4YR6A 2NX5B 1NBVH 4CADA 1NAMH 4IEFB 4D9LH 2XACC 2FWOA 1P2CA 4KKBC 3GK8L 3QDMB 4XT1C 4CRPA 4ORZC 5HDBE 5MENA 2R69L 3ARXA 3VXRB 1EXUB 1A1MB 3VCLA 3QO1A 5D1ZA 1U95A 1G6RA 4F7CA 4CKVX 4S2SB 2P5EA 3TV3H 1CCZA 4E41E 3ALWA 4X4ME 3CH1B 3P0VH 1B0RB 1CD8A 2C3VB 3HNSH 3CLEH 4NC1C 5I74C 4IRZH 4OQTH 4NPYA 1UJ3A 1BQLH 3VWKC 1NBQA 3MOAL 3IAQA 2IAMA 4TUKH 4WTZG 1KIQA 5L2KE 4RZCA 4OCYH 3B4NA 2K3TA 2EDJA 8FABA 4LAJH 2F5BH 4FQ1H 4JFYA 4BSWB 3KS0J 4TUOA 5CSGA 1V7NL 4QHUB 4P5TA 4UTAH 4JZJC 4U4BA 4H25A 4TULH 4U1MB 4Q74A 2X89D 1S9YB 4XB7A 3VGAB 3IVKB 2Y36L 2CDGB 2VNCA 4MMXC 2BVEA 4X98B 2XYCA 4NDMA 4G8EA 1O0VA 3DX6A 4NQED 1GGUA 3T4AB 1QBLL 4JR9L 3QO0A 3FFDA 3ZZ1A 4YGVB 4H1LG 3A0OA 3DX8B 3S3JA 3DVGA 4NO0B 1A1OA 4CU8A 2P5WB 3QHZL 3FQXA 4GRWF 5CBEA 1VERA 5E9DE 1AGCB 4LVOB 1ULVA 3WSQH 1KJ2L 3DV6A 1DFBL 2ZZUT 1T7WA 4EI5D 3Q6GH 4TTDC 1KELL 1BQSA 2UYLB 2YR3A 4ETQA 2HT4C 3HMXH 3D3VA 3GJEB 3ARDD 4NQDD 4DZ8B 1QSEA 5TDOB 4PRPD 3ES6A 1OAZH 3QAZB 1F5WA 3X11A 3LN5A 4GW1A 1HZHH 2DJUA 4OI7A 3OX8B 2CH8A 3EFFA 1H8NA 3PV7A 5EA0H 3FO1A 5C6PB 4IBLT 3ARBA 4PB9L 2HT3D 5DMKA 1TLKA 1UC6A 3S6CA 4JKPH 1RZJC 4N5ED 2IANB 1XMWA 1IM9B 2VZSA 2R1XB 3MRDB 3O3DB 1WZ1L 4AL8L 2HT2C 3HE6B 3GBLA 3IAPA 1D6VH 1H3WM 5EU4A 1ZGLP 3EYVB 2ADFH 4C56B 1N3NB 4X0KA 1FNLA 2Y7QA 3MNWA 3EYSL 4BSJA 5D1ZC 3GIZL 4NYLB 3MNVB 1QLFA 4NOBA 5JOPD 4LLVA 3QIBB 3FB7B 3S5LA 2F53B 1Y18A 3QEQB 4LSDA 1J1PL 3X12A 2NY1C 4M7LH 2WM0A 3I84A 1FZKA 2HFFB 4X7FC 2E6JA 4F8QA 2VWEE 1QPPA 5I1JL 4OLXH 1JI2A 2WNGA 1JPSH 3MLUH 2GTZA 4HW6A 1I1FA 3KPSB 3QFDA 3TBSB 2EYTA 3HG1B 3W0WA 2Y5EA 4KJQC 3BPNB 5C09A 1RZGA 4ZYKB 5C07A 4RDQF 4N8CH 2LVCA 5I8OH 1ZEAH 3QUZA 3RTQD 2P7TA 4NHUB 4OCLC 5IGXH 1JHTA 3O2DA 4EZMA 5C9KA 3LPFA 4M02A 4K8RH 4OKVB 5I1CL 4FMKA 4NZTH 4CVWA 1F58H 4M93C 2GSIB 1FZJB 5KSBE 1SY6A 4UBDC 2B0SL 4OUOA 1C1EL 5A16B 2OMNA 5LAXA 7CGTA 2Q76B 3GMQA 1S9YA 3I3BA 3EOBA 1DEEB 2JCCB 4MD0A 5IB1B 5BRZB 4QRSB 1ITBB 1PEWA 4MD5A 3DRQA 1BX2A 4LVOC 2ITCA 2YS4A 1CZ8H 2ZCHL 2VLRB 3VXPA 4M43L 1CL7H 3NACL 2OK0H 2VXSL 1VFAA 2ICEB 6FABL 4NO2B 3GHBL 4XPHH 4Y19A 5JHDB 1EEZA 1AH1A 1J12A 3WS3A 2Q76A 3DIFB 1RJCA 1YY8B 3ARGA 3BAEL 2KZWA 2CQVA 4X4XB 1J9CT 2YRZA 3IRZA 4NQDE 1EO8L 2NY3C 3WE6A 1PBYA 3JXAA 5J6GA 2IPUK 3LKSA 4Q6IB 1B2WH 4H26A 3ZO0A 1IGFL 4MQXC 1EHXA 1T22A 4JVUA 4HEME 3S4SB 1CR9H 1UWEH 5DQDL 4NQEB 2YD3A 5FUOL 4HWZA 1BWWA 2WBWB 4PJEB 2YPVL 1UZ6F 1PX3A 5E8OB 2DI8A 5C0CE 1LEGA 1U8LA 1QRNE 4LPUA 3T0ED 3TBWB 5L2KA 1PDKA 2X4QB 4K3JL 2P8MA 4JKKA 4V1DD 4IRJA 3PNWA 5F9OL 5AD0A 1AO7B 1G6RL 5EG6C 5CZVH 3V8CA 1WIPA 2B20A 5BJTA 2CJUL 2G2RB 4CDHA 1KOAA 1AHWA 3F12B 1JK8A 4Z0XB 3D2UD 1FYHB 3CXDL 2PYED 3DUUA 2XRAL 4EN3B 4PRIE 3GMRA 4GW5A 2ITDB 3PNWB 1XGYL 3K0WA 3ZTNH 1BVKB 4HJJH 4XVUC 5AUMA 2X40A 3LRGA 3QCUL 5FCSH 5IW1A 1QBMH 2Y5TA 5JW4M 4KRPC 4HKBB 4EBQH 4MXQC 2HFEA 4QKXB 4YHLL 1DBAL 1LHZA 2XWTB 3VXQA 4KZDH 4EN3A 2JB6B 4P2QA 2EE9A 3GFUA 1VFBA 3MR9A 1EJOL 2OJEA 3FQTA 1FRGL 4JLRB 1VGKA 1BVKA 1JRHH 2NY0C 1RIUL 1FVCB 5MEPB 1T5WB 1BJ1J 3N1QC 2M1KA 4OGAD 5DFVC 4UTBL 5T5NF 1GGIL 4CN1A 1AGCA 5IEHB 2ESVB 3ARTA 3GNML 5EWIL 3RGVB 3U4BH 5C0BB 1R3IL 1UT9A 1BD2A 3MZTA 1QSED 4ZAKA 2OTWA 3GMPA 3D3VD 2XZQL 1NEZA 1XZ0B 3M8OH 1D6EA 3VD5A 2DAVA 2WWMC 1OGTB 1RK0A 3VXUA 4ZO9A 5HPMA 3GMPB 1KLGB 3VXTA 2EDDA 3VGHA 5BOPA 4GG6E 1X5ZA 3GSXA 2A77H 4WGVB 3WIIL 3TGXA 1JYNA 3H9SD 4PV9A 1E4WH 3EIFA 2BOCB 3I75A 2FYYA 4FQ2H 3KHOA 5F7MC 4HWBL 1VSCA 1QVOA 5T1KB 5D93B 5T3ZH 1CFSA 4R6UA 5INCA 5EZIL 2X89A 1FAIL 3KPMA 1MWAL 4QNPF 3V7AE 1MQKH 4JFFA 3F7YB 1ZLVH 4PTTA 4AM0A 4EUPH 3JWDC 2HJLA 2EIBA 4I48B 1FYTE 1NC2D 4L8DB 2B39A 2EYRA 3S5LG 4J2XA 1IVLA 1NCDL 4XH2B 3AAZB 2GTZB 4DTGH 5B38G 4WU7B 5TPWL 1OAXH 2BVQA 2E9WA 4MA1B 3JV4B 5DHVH 5JW4R 3STLA 4NO5A 2BVPB 2CIIB 4M5ZH 4P2QE 4ZTPL 1F90H 1I3GH 5DTFB 5E2WL 4BJLA 3NVQA 1PZUB 2Q7NA 1BGXL 2BSRB 2CRMA 3QEUB 4KZEH 4M1DL 1V3KA 1K8IB 1DQLH 1FE8H 4YQXH 1DQQA 4WEBH 3WL9A 2B1HL 1OTTD 1AGBB 4ODTL 3SDDA 2X4SA 4Z95H 5CEXB 2EXYC 4QHKI 4E41A 2A0LD 3ULVL 2D9CA 4JG0L 4KWUA 2WANA 1T21B 2XPGB 3LD8C 4DGVL 5E8NA 4ZFFB 5EUOF 1CVSC 1MFBH 3ZYJA 5ADPH 3GO1H 2VDOH 4OGYL 1YYML 1OWWA 4OCSL 5HI4C 1G0YR 1XGTB 4MHHG 4PV8A 1Y6KR 3BZDA 2ADGA 5CEXA 3RVVD 2EEAA 4FQHB 4PRAA 3MJ9L 4ALAH 3X3FL 1H3UA 5KAQG 1KXVC 1MIEL 3SY0A 1W72H 4TUJA 5T3ZD 3F7RA 3UO1L 4EN3C 4PTUA 1UCBH 5D72H 3KYNB 4N8VB 2YZ1A 1R3HB 5E9DA 3SKNB 5BO1H 1UYWL 3MCKB 3BSZL 2XTJE 1A0QL 4PRPA 1J0IA 3KDMB 4U49A 3ES6B 4RNRB 4X4YB 1UENA 1ZVHA 1MIMH 1A6UH 5EU3A 5BZDA 4MNQE 2CRYA 4EI5A 4HXBH 2BRRL 4S1QH 5D2NB 3ARFC 3UX9B 3E6HA 3ULVC 3REWB 4LGSB 1L4IA 2XN9E 3O2VL 1N4XH 2A6KA 5FYJD 5D7LD 5DJ0A 3QUKB 3CH8A 3NGBB 4WV1C 4JFDE 2AJUH 1SHMA 4XXDB 5EO9B 2A9NL 3AU1B 4ZS6D 2BNQB 4YBLB 3GKWL 3U0TA 1BM3L 1S9VA 1KCSL 2X4UB 3BH9A 3CFCH 2I24N 4LLQA 4OZFB 1CTOA 2DIAA 3QCTL 5FYKD 3GSQB 3W5NA 3KPTA 2DI7A 2W60B 4KROC 5C0IB 2FEEI 1A6AB 4GKOA 1ZS8A 4YO0A 5DDHB 2W91A 3S5LB 5CJQL 3WEXB 4DVBA 2UZXB 3ZKNC 2X05A 2R0ZL 4D3CH 4Q0XL 2WUBH 5J13B 1JN6B 5IQ7L 5BRZA 5ESVB 2E9IA 1ZKAA 4Y1AD 1OB1A 3MUHL 2AP2A 4HCRL 1T5WA 3P11H 1NDGA 5ACMA 2B1AL 1A9BA 3PV6A 5E8EA 3WFDL 3UXFA 5FOJA 3D2UB 5E9DD 4Z7OE 3GSNA 1FFPA 2YKLH 4PRIB 1S8DA 1KGCE 3U0PA 1FVEA 1LO3H 4KMQA 2Q8AL 4Z76A 2KZ1B 1UXSA 4O9HH 3SCMC 4KJWC 2R4RL 2FH8A 3NTCL 3DJ9A 5I0DA 3I2CH 5TE7L 1CD9B 1IC4L 3OKMA 4BQ9A 4CDGC 3ILQC 3FB5A 1QA9B 3GRWH 1QLRB 2VXTL 3TWCH 3O2WH 3OKOA 4LPXA 4NUJA 1G0XA 2GAZA 4H8WH 1KLGA 1DDHB 4ZFOB 3MACL 3WIFB 2KPNA 4HUUA 5FKPB 3IF1B 1HNGA 5KVEH 2HVKB 3WHE1 4Z7WA 4OZIF 1JP5A 1KIPB 4LBEA 4MAUL 4ONOA 2MQ0A 1LE9A 1N8ZA 3SDAB 3X13A 3MJ6A 3OKLB 4D9RE 4G9FE 5TE6H 2NY2C 1KTRL 2CLRB 1XGUA 2DLIA 4N0YH 3BZFB 4M1CD 1IGCL 1A7RL 3NFSH 1KBGH 3PWPA 2X4QA 5E08H 1QR1A 4XPGH 1YUHA 4JO2L 2HMIC 1NGQL 4JFHD 4U1NA 3KJ4B 2HA1A 1E4XL 3WUWG 3AAZA 2AEWA 5E1AB 1ZHLA 1WCQA 4MD4A 3Q6FA 3LQAC 2HTKD 3MO1A 3L6FA 3RZCA 3S36L 4UV4L 4G8GE 4JCMA 4ZOEA 5SX4I 1LP9E 4AT6A 3MV9E 4QTIL 5CGMA 4NQVB 4RFNC 4FQJH 4HMCA 1UJ3B 4YHMH 2V9RA 2IFFH 3GUTA 3KGRA 1B0RA 5F70A 7FABH 2XFXA 1MUJA 3HE6C 2H26B 3DI2B 3QH3A 4LVNC 1AGBA 4FQLL 4AZ8A 3MLTB 5E8PA 1T7VA 1IT9L 4NZUL 2R2EA 2AK4B 1EXUA 3MUY1 4H25B 3B6SB 3SGDI 2Q8BH 5I1GH 4G80B 2XG5A 4EQ2A 4OZHE 1DJSA 4YZFF 4FQCL 5I17A 2NZ9C 2QQNL 1FG2B 1J0KA 1PQZB 1T1YB 4UDUA 3SDYL 5EOQL 4ZUUB 5EZOL 5I19H 12E8H 1MJ8L 5DSCB 4LLYB 3JSSA 2I9TB 4JFEE 1RMFH 2HTLD 3E1F1 3H9SA 4MHHI 4I8DA 4L4TA 1P7QB 1C8PA 4MA7L 4ODHL 3U4EA 2C3VA 3STBA 3V0AC 2HN7A 1PGRB 4MXQD 4YFLF 1T0MA 1EDQA 2IBBA 5E6IB 5EORH 4BFGA 5DJCB 3VXUD 3MLPA 5E4EC 4ZUWA 1P7QA 3HN3A 1XAUA 1VB9A 4OCXH 1FFRA 5GS2D 1JF5A 5TF0A 3LN4A 3HHRB 4GW4A 1OP3K 3TPUB 5DJYB 4NZRL 3JV6A 1E4JA 1U2HA 5LGKA 2H2PC 3PIQB 2VLKE 3S88L 1BIHA 3HMWH 2H41A 3OAZH 4Z9KB 1I9JL 4I4WA 2BZDA 5HGAA 3ZDZF 5KG9B 3ARFB 4JY6A 3MV7E 2X4PA 1P84J 3BI9X 4H0HB 4JGMA 2FEDC 4YHYB 5CGYC 4Y19E 4Z6AT 4H1LH 4PD4J 3SY0B 2VDMH 4XI5D 2FWOB 3K2MC 3I50L 1CLZH 2UUDK 1Y6NR 4P46A 3B2VH 3F6IA 1F4YL 5D1XD 3OR7B 3VG9B 2FCBA 4EOWH 3RZCC 4HKJA 3VFSB 2HLFD 4JHBA 3P4NA 4G6ML 4LPYA 3K1DA 4MZ2A 2OBGA 4CN4A 2W1NA 2DQHL 4PJFE 2CMRH 3RNQA 5JPNA 1U3JA 3TVMD 1RU9L 3KHQA 1IKNC 1UQSA 4QOKA 4P23B 4OD2A 5IT2L 1U36A 1I3UA 4KKAC 4F3FB 3JVGC 1VPOH 5EBGA 3R8QA 1OY3B 1QFWM 4V1DB 3MYZA 1A4KB 3TA3A 1HN1A 1YEIH 3CFIC 4JPWH 4GBXC 2H3NA 2OZ4L 4LSQL 5DVLA 4NC0B 5IB5B 4PRNA 2R29H 2H1PH 5E8PB 2HFFA 5HYJE 3L7FB 1JCKA 5F1KC 3SCMB 3MBXL 3K4ZA 1V7ML 1NGPL 4MA8H 3ARDC 4GRMB 5D8JL 1S3KH 5C2UB 5H35A 3KJ4C 4XMPL 2GJ6E 1UXSB 5IHZB 4F7TA 4EKXA 3G6DL 5GHWH 3GSVB 1ACYL 5I1HL 2RCSH 3MV7A 3P4MA 4CAGA 5EH1A 1G7PA 4Q9QH 2VQ1A 4XTRD 2VB5A 5K9QG 1CFTB 4K7PY 3EO0A 1YEHH 5DQJB 4F58H 3GEWB 5GGSB 1GOGA 5J06A 5BV7C 1CICB 1RZFL 5TQ2L 4TSBH 1H3PL 3EFFB 4XP5H 1K4CA 1Z9MA 4X4XA 3DECA 5J12C 3K81A 4WFGD 3X17A 1QYGH 2DD8L 1X5AA 1CGUA 1FVEB 4X4YA 3OKLA 5F7DB 5HHVL 4K2UH 4JHAL 5BS0A 3MRJA 3UJTL 4X5XA 1LDPH 5MEQA 4LLMA 4PR5B 4XAKE 2IPKA 4Y4KB 2BOCA 3BPOB 5HHOD 2E5EA 3MRIB 4UILH 3PWVB 3BDYH 4ZAKD 2Q3ZA 5KSBA 1VACA 3ZKXC 1JGVL 4OZGF 1QSFE 4XNXH 3OL2A 4BUGA 2FECL 1J1OL 3HCVB 2A2QT 3LVEA 4HC1L 1ZTXH 5LGHL 3B2UD 2V7NA 5E00B 2AKRA 1PG7L 1ZA6A 5T1LA 4N8PA 3G9VA 3LY6A 5D96C 4LEXH 4NRXB 1Z9OA 1KV3A 4K8RC 2IEPA 2XXCB 4P9ML 5I6XB 4X6FA 3BP4A 4MJ4A 1I4FA 4W4NA 4X6CE 4C83A 3ULVD 5JNYB 2C9AA 4I3RL 4KK8C 1E6JH 2KQMA 3WHXB 3TCXA 1KCRL 3MA9L 4ZUSB 3KXFE 3NAAL 5E8DH 4LCWE 5JNYA 3O2DL 4OLZH 1U58B 1CDCA 4UU9B 3U7YL 1PFCA 3RA7H 2JB6A 1DUZB 4X9HA 3LKQB 1T7ZA 5ICYA 3QNYA 2XQYK 4LLAA 3SKOA 1EZVY 5I71B 3RL2B 1CLOL 1HCFX 3D2UA 4IM8A 2XG4A 2YUXA 3VXNA 2G75A 1MSPA 1ZGLB 3ARBD 1SBSL 1NGZB 1ZA3B 1G7IB 3KPRE 1ZSDB 4ZPVA 4OZGE 3MLYH 4PJDA 4LGPB 2GQHA 1FIGL 1GL4B 4LCWB 4M5YH 4ELKB 1S7WA 3EYFA 1YECL 1BQHG 1AXTH 5D2LB 4Y16B 1G7LB 5IMOA 2ZWLT 3VE0B 1AGEA 1ZA3A 3V5HA 1BQHA 2R39A 3QUXC 1KN4L 4KQ3L 4H5SB 4HH9B 1S7RB 4P99A 3O3UN 3VFWB 4HBCH 2V2XA 4YBQD 5AZ2H 1A14L 2XT1B 5DJ6A 3BDXA 1S9KC 4X6DF 4LCUA 4W81A 5HGAB 5DRNA 5J8OA 1NDMB 2CUHA 1KIUA 5D2LA 3SKNA 3V52L 3VWKB 1O7SA 5FYLL 5JHDA 4XCNA 3ARGD 4YBHA 5E70A 4JGUA 3JVGA 3W9EB 3PP4L 5I8KH 1D5MA 3FQXB 4I2XB 5ICZB 2NLJA 1WCBA 1DUYA 3IFOA 3BKML 5EUKA 1MFEH 3W9EA 4PFEA 5J6GB 1OAQL 3C08L 1IC1A 4HXAH 1NUNB 4XPTL 2H32H 1FGNH 3H8NA 1AE6L 2E7LC 3SDXB 4GUPB 5IBUG 4I48A 1T03H 5EU5B 1D9KB 4L3CB 3JTSB 2CRZA 4LCCC 3SE9H 3C6LA 2W0FB 4JQIH 2R2CA 5TDNA 1HHGA 3EDDA 1SYSB 3UTTE 1DUYB 3N1FC 3L3GB 5FUZH 1PKQE 5AZEH 1J1XH 5C70A 4NO5B 3O45A 4MX7A 2QR0A 5FGRA 4Q7DA 2F74B 4YUEH 3QUMB 1JHKL 1S7XB 3U83A 3VGBA 4NNPH 3SDCA 2F54B 3IU4L 4OZFA 4M9OA 5D4QA 4FN0A 1KN2H 3ZHLA 1HHJA 2OJZL 4WIQA 4OM1H 1EEYB 4HSQA 1F8TL 3TBTA 4PJGA 5CBAB 5DUPL 5ID1A 4MXWH 2FGZA 3ILPB 4X7CC 5SWZA 4JB9H 3W0WD 4NN6B 4PY8I 4F7PB 4M6ML 2F54A 4KJPC 4QHNA 1EAJA 3BWUC 1F42A 2ADJB 2CGRL 4HPYH 3RKDC 5BZWB 1DQDL 4LLVB 4WW2C 3U30B 3HAEH 2H9GA 1Z9LA 3AVEA 5I1EH 1IEBA 5DUBB 1BEYH 4HUWB 5FHBH 2OR8A 4OGZA 2QHRL 3ZDYE 3MUZ1 2X42A 4NRYA 5HYQA 1I1FB 3KPSA 3QFDB 1DEEA 2JCCA 3CX5J 3TBSA 1IL1B 3B3IA 3MV7B 2IQ9L 3RWCA 4RIRB 3TH2T 3VFOB 3L3HB 5E1HB 1DQQB 3HAEB 4U0QB 1XIWC 4NWTH 1X44A 2VDK