4ODWA

Unliganded fab structure of lipid a-specific antibody a6
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
218
structure length
208
Chain Sequence
VKLVESGGGLVKLGGSLKLSCAASGFTFSSYYMSWVRQTPEKRLELVAAINSNGGNTYYPDTVKGLFTISRDNAKNTLYLQMSRLKSEDTALYYCTRLYGNYVRIHTMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A6 Fab (IgG2b kappa) light chain
publication title Structural Basis for Antibody Recognition of Lipid A: INSIGHTS TO POLYSPECIFICITY TOWARD SINGLE-STRANDED DNA.
pubmed doi rcsb
molecule tags Immune system
total genus 34
structure length 208
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-01-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4odwA01
1A5FL 3MBXL 2VWEC 4K55A 5I8OH 1HIML 4JZJB 5KVGL 4ZPTA 3JV6A 3LKQB 4P46D 2NTFA 4PLKD 4JPIB 4PY8I 4YC2C 3MA9L 4Z9KB 4X0KA 1NCCL 3KYNB 3KXFE 5K9KA 5FYKL 3NIDF 5E7FA 3TN0C 4NQXA 3VGFA 3WNKA 4JN2B 5EZIL 3WHXB 3GO1L 3FT4A 4PJ9A 5K59E 1OGAE 4ZFZB 3NOIA 4JQVA 4WUKL 3LD8B 4U1KB 1T5XB 2A2QT 4PV8B 1MCWM 3MLPA 3INUL 5HGDA 2YWYA 3QUMB 3MQIA 1W2KT 2G5BB 4JHAH 4I0PD 1RFDL 5T3ZE 4GG6A 2NXYB 3STBA 2AK1H 2DQDL 4XVJH 4Y1AA 1ND0A 1M05A 5CD3B 3OJDA 2H8PB 3CXDL 1UWXK 5E4IA 3G5ZB 5DMKB 1S8DB 4IDJL 5D2NA 4TUKL 3MZGB 4P2QE 3MJ9H 1DBJH 4C58B 2ZPKL 2ZWLT 1DDHA 1YY8B 1JNNH 1YEFH 2B1HH 4QRPE 3V7AE 1SEQH 43CAA 1BECA 3F62A 3EYVA 1XF1A 3N85L 4KHTH 4MLIA 1NDGB 4YHOL 5D6CA 4TQEL 3MUZ1 5IVNA 3NCJH 5GJSL 3WFEH 5E03A 3I84A 4HHAB 2XPGB 3W82A 2HFEA 2CDFA 1CE6A 3W2DL 3MLXH 2ORBH 1S7SB 1ZGLP 1W0VA 1Q9OB 2APXA 4D3CL 4BQ6A 3N1QC 4U1IA 2EIEA 4MB4A 5D1XC 3ULSB 1HINH 3SDCB 3BE1H 4XMKH 2KQMA 1D6EB 5H35A 3TBWA 4NUJA 2MHAB 1PKQB 4CNIB 3SKOA 5JXAL 4O2FA 3KG5A 1FNSL 1E4JA 4OGYL 1I9IH 5DRZA 5DMGD 3CDCA 3NTCL 2NXZC 1BM3H 2Y06L 4U6VL 4P4RA 5E6IB 3C09B 4G6FD 1T7XA 1IBGL 4HIHA 4LLYA 3T0VA 3RVVC 5F7LB 2YMXH 3NN8B 5DMIH 4JN1H 4PJXB 4MB3A 3DUSA 4NQSA 4NO5B 3JV4A 3HZYB 4QXUH 1A4KB 4NHCL 4IMKC 2BSSA 4QY8B 2I60H 3NIDE 3U4BH 3K2MC 3T2QA 5D2LA 1D6VL 1KCUL 2O5YH 4JKPL 4JO1L 3IAPA 5F1IB 5FA4B 3QRGL 2EDNA 3MRPB 4MA7L 3ARYA 2DI7A 4MJIE 4YHNA 3EDKA 4H88H 5BS0B 1NCAH 3GSUB 1ZGLM 5GZOD 2BXZA 3DHJA 2VR4A 5GGTA 5F6HI 4KROC 1IEHA 4OTXL 3FQRA 4K3JH 1S3KL 3TBVA 3CSYA 4PJ7F 4IOIA 4XNQA 1NANI 5EO9A 2DKSA 4RWHA 3I50L 2I9TB 1CFTA 4RFOH 4LF3B 2Q7YA 4CKVX 4PJ5A 4HUUB 4U1SA 1Z9LA 1H9VA 1KPRA 3EOYG 4XPTL 3HI1A 3BPLB 5FYLD 5IB2A 4C56E 1P7KB 1OD7A 3O2DL 4XHJD 1MJ7H 1YJDH 4NKIH 1Y0LB 1MSPA 5D8JH 1MHEB 5FDYA 1RK0B 3JWOC 3TBSA 1U8KA 3ZZ1A 1CT8A 1PW3A 3ZKXB 4XPGL 4HXBL 4NZJA 3KXFD 1KYOK 2YN5A 1V7NH 3G5VB 4NNYB 4F7EB 5F9AC 1KIPB 3I3DA 3RRQA 3LPFA 4FOMA 1H5BC 4FQQB 3ALXA 4LHJB 4LSTH 4G6ML 4CVZA 4YPGA 1FGNH 3EHBD 4U1NA 1V05A 4X4YA 1W0WB 2PYEE 4L4JA 1F8TL 4HIIA 2FD6H 4PY7B 1BBJA 4FQJH 5T3ZD 1OAYH 4YE4H 4AEHL 3ZT7A 4TVPH 2Q8AL 4ZUTA 3AU1B 4MA1B 3OJ2C 3K1DA 3ARRA 1A7NH 3MV7E 5DK2A 4BUGA 1P7QA 3T2OA 3H0TA 5T1LB 3L5XL 1UJ3C 4QRPD 1W72H 2D03H 4RGNC 2FZ3B 3HS0B 2C26A 2NNAB 2C3VA 1L9NA 1DFBL 1P9MA 4WDIB 1WTGT 5D5MA 4Z78B 2QSCH 5HBBA 4X98A 4P4KC 3GIVB 4K9EC 2V5MA 3V5DA 4P59L 5INDB 3PHOA 2QQLL 4X80L 3RZCC 1U8MB 3CZFA 4JGJA 3RNQB 4HIEA 1NBZA 1XEDA 1AXTH 4UU9B 4Y5VA 4NBYB 3E2HB 1JGLH 5E5MB 3V4UL 5F9OL 4PJ8A 5BQ7B 5GGVH 4O9HH 5BVPL 1QBLL 3D9AH 2EE9A 3TIEB 3T0EB 1PZ5A 1A6ZB 2FEEI 4JFHE 6CGTA 5JIPA 4WEBL 4FMKA 4N8VG 4IJ3B 5E9DD 43C9B 3NIGE 3O4LB 3BN3B 2Z0BA 3BZ4B 3GM8A 1OB1A 5GHWH 3FONB 3SBWC 4GFTB 5C6PB 3JZ7A 2NY5H 1KXVC 5EO1A 1FRGH 3HLAA 1EAPA 4IRJD 2ICWB 2J2ZA 5KSVB 3X12B 3SDXF 4ODSL 4TSAL 2QV2A 2X7LB 5EBGA 3O9WB 1I7TB 3HC4L 3W9DA 4L3CA 4H20H 1BD2B 5HHQA 1ZLSH 3O8XC 4LPXA 1GC1L 1DEDA 3JTTB 2DMBA 4NRYB 3PP3H 5JR1H 4MJID 1QSEA 3C5SA 3REWB 2ADIA 1FCCA 1S5IH 3BSZL 4LPTA 1JZ5A 3UPRB 1PEZA 2ESVE 1FFNA 3P30H 1DQTA 3BHBB 3Q1SH 3WNOA 1KJ2H 2Q76A 4Q9RH 2M26A 4ODXA 3C6LC 2PTTA 3LQAC 4WWKA 5HI3C 3VGEA 4PJCB 1EVUA 4BZ1H 4EQ2A 3K4ZA 1RUQH 5FCUL 3RI5K 8CGTA 1NGXA 1ZS8B 4OGZA 2R2BB 1QFHA 4WO4D 5F7NC 5CZVH 1FNFA 3JVGC 3NZHL 4LBEA 4K7FA 4K07A 4TNVF 4MX7A 4XX1E 4CVUA 3HNVL 3F7YB 1RIVL 5DD3L 2PXYD 3WFDL 3GSOB 2FX8H 5EZLA 4HC1H 4RIRA 4YDJA 5IWLA 1E27A 2CDEA 3ARFD 3G6AA 5GGRB 1QNZL 5TDPB 4BH8B 1IGTA 4RAUA 2AV1B 2X70A 4HJGA 5FYLL 5JW3H 3VE0A 4U1GB 1T66D 3K74B 3KHOA 4PUBH 2PW1B 2PYED 4IEFB 1ZLUH 3FO2A 3L3IB 1T6VN 1RUAL 4IMLB 5KN5B 2HN7A 2R0LL 3FN9A 5C92A 4M43L 2Q7NA 3DBXA 1MRFH 2VLJA 4JZJC 1DZBA 1Y6MR 2OK0H 4KI5E 4KRPB 2PETA 3IAQA 3U36B 1ORSB 2E7HA 3R8BB 3MCG1 3BYTA 4FZ8H 3TT1L 4X6BA 4UUJB 2NX5A 2CKBH 1JI2A 4D9RE 3OKOB 3CGTA 4PP2A 3QIWA 2D7TL 2EKSB 1YPZA 4GW5B 1AKJD 4X6DF 1ZEAH 3RHWK 1MLBA 3LD8C 4LAQL 4XH2B 3DRQB 1HHHB 1JNJA 1XR9A 1I75A 5KS9E 3QHZL 3OR7A 1U6AL 3BP7B 3S3PA 2W9DH 3BWAA 2J1KA 2NXYC 1J11A 1NAMB 4JFYA 5LXGL 1N6VA 1HEZB 3SEPA 4KZDH 2R56L 1TVDA 1L0QA 3KHQA 1CICD 4FNLH 5I15L 4NQUA 5B8CA 3RUGA 5ANMB 3N1GC 4EXPX 3RA7L 1T04A 4N5UA 4XI5C 5I75B 4NGHL 3RY5A 4NO2B 3A6CH 2CIKB 5C0CA 4M7JH 5DSCA 3L1OH 4MNHB 3MLVH 1N4XL 3MACL 2I9LA 32C2A 3T0XA 3AM8A 3OZ9H 4ZYKA 2DKUA 1A1NB 4JFHD 4ODHL 5EUOF 4NPYA 3SGJC 1VESA 3DV4A 5MEOB 12E8H 4IIQB 4MZ2A 3KJ6H 5DEFB 2DQHL 4TPRL 1VSCA 4NRXA 1WFUA 2LAAA 1A9BA 4GKSB 5M7QA 2RB8A 1QSFB 4CGTA 2Y5EA 1BF8A 3MA9H 1M71B 1NCCH 1UH4A 3QH3A 3F6LA 5D72L 4HV8A 4ONOA 2JIXD 3SDCC 2X4TB 5EIIB 5EG6C 4ZUVA 3V9FA 3LY6A 2YPLB 2X4NB 2GYSA 4PJBB 2HJFA 3GSNB 4MZ3A 4H0HB 1G9MH 4OFYD 3INUH 1M7DB 2R2HB 4KKLC 3L7FB 2ZUWA 1OTUD 3HPJA 3IDNB 4MD0B 1SY6L 2V9QA 2VXQH 1I3UA 2DQDH 4DOHB 2VLME 2YC1B 4FTVB 3MJ8A 4BM7A 5E6IC 3GB7B 3D5OF 3D3VD 4RAHA 1MF2L 1GZQB 4TUKH 4MXQC 1LEIA 1RMFH 1ZA3A 4R4NC 3GSRA 1T0MA 3LKPA 4LLWB 2ESVD 1JPTH 2JCCA 3D1MC 1INEH 3RWEB 3N85H 1BVZA 1G6VK 1SJHB 4YHOH 4TQEH 4YUEL 5GJSH 1SMOA 1JK8B 2HKFL 3WUZA 1MFEL 3DV6B 2ZUTA 3B9KA 4WFHD 5F6IB 4Q6IC 3UDWA 3GMPA 2OZ4A 2P7TB 4D3CH 4DKFH 1UGNA 3L5WB 5C09D 1P4IH 4S1DD 2VTFA 5ALBL 1G6RA 1ZVSB 2X4SB 4M00A 1N6QH 4M6AA 5AUMA 1FL5B 3IRPX 4K3EH 4GH7B 5BW7C 5HYQB 2DQGL 4HWEL 4YHPA 3TN0A 3FN0L 5DEZA 1H3VA 5IG7A 3KYOB 3NA9L 3FT2B 1EUUA 2FHFA 4GW4A 1KLFA 1I1CA 1T3FA 2V2XB 2YPKB 4NQCA 1RD6A 2Y06H 4U6VH 4U7MA 4IRZH 4QCIB 1GPOL 3ROOB 3VFMA 3QDGB 3SE3C 5LKNA 1JP5A 3EJZD 3QQ4B 5E94A 2F53E 1ULVA 3RGVD 3BPLC 3CU1A 1K4DB 4Y2DD 4P3DB 5FUOH 3ARZA 4QRRA 2B2XL 4WTWA 1X5IA 3IDYB 4KDTA 4KI5D 3STZA 1A21A 3KAAA 4PR5A 4JO3L 4W6YB 3MRNB 3WKML 1OQXA 3MV01 5I2IA 4PGCA 4Q2ZA 3V4PL 3O4OB 1UB5B 4LNRB 1KCUH 1ADQH 4JO1H 4FXGB 4N8PA 4ZD3H 5E5RB 5IHLB 5L2JB 3CX2A 3QCTL 4P2RE 3P0YL 5F1SA 5DHXB 4OIBA 3VXMB 4OTXH 2DQIL 1IGFH 3TO2B 4HLJA 1SEBA 3L3JB 3VCLB 5F97E 4MNGA 3VWJB 1WFNA 1JYNA 3C8HA 1IM3B 1HZHL 3WL9B 1NJ9A 1I8IB 5TJWK 4ZG1A 1JF1B 2V2TB 3ZDZF 4H5SB 1BGXL 2XWJB 5F7FA 3H3PH 4GAJL 5GRWA 1DLHB 1Q0XL 2NZ9D 3FB8A 4XPTH 3C60D 4C57C 1OAKL 2YD9A 1EFXA 4M61A 3F12A 2J8UB 5EBLB 5BXFA 5GS0D 4N0UA 4YHIA 5IK3B 5H37G 4BK4A 1PQZA 1K2DA 5AZ2L 5JHDA 3DGCR 2HFTA 5ITBL 3SDDC 3OAYH 5IHBA 2I07B 1AI1L 2NW2B 3E2HC 3OL2A 4IMKA 3TLRA 3F8UB 1TDQA 5EPMA 2QTEA 3SO3C 4G8GE 2BDNL 3BMVA 3M45A 4PJIB 4Q97A 4K94L 5B3JF 5A16B 4KK5D 4RRPG 5DTFA 4AM0B 1CGWA 3NFPB 3T0EC 3K3QA 1LWRA 5M95B 4MSWA 4R4FL 2VLMD 3TIDB 2AJXL 5IB5B 3DX6A 4OZGE 1PD6A 3RWIB 3F58L 2EIDA 5JW4R 3HRZB 1UM5L 5DYOB 1MCBA 4P9HC 4LPUA 1BIIB 5I73B 3QNZA 5HPMB 1U8OA 2CO7B 5KOVC 2DYPA 1G7IB 3RKDD 3G5XB 3S4SA 1XF2A 4M1CC 3FO9A 1DFBH 3TC9A 3QDHA 5TH2A 4UQ2A 2XTJB 4KY1L 1CWVA 2A73B 4FQHB 1NLBH 4FFVC 1I1YA 4FZEH 1I7RB 4Y4FA 4P2OA 1B0WA 5T5NG 1VEMA 2IBZY 2V7NA 3CXHJ 1T1ZB 2YPVL 3HB3D 3L5HA 4TUJB 1QFWI 5F9OH 1FFQA 1H3PL 1N2RA 5E2VL 3FQNB 2AK4D 2RR3A 1EZVX 1SBSH 4DK3A 4PGZA 4XPBL 1YY9D 2V7HB 3FQTB 4H1LG 4ZO7A 1XF3A 4L8CB 2VQTA 3O3BB 4G7VH 5HY9B 4Z5RA 4XTRD 1L6XA 4KV5E 3CC5A 2Z31C 3IJYA 2WUCL 2IWGA 1CLZL 4HIJB 3RWHB 1X5HA 2MOVA 4F57L 1RUML 3HZMA 3ABZA 4AH2A 4OFIA 4TSAH 3IKCA 4GMTL 1Q9KA 3SGDH 1UJ3A 2G9HA 3A67L 3HC4H 4PJHF 1WZ1L 3QIBD 4OD2A 4LSDA 4TNWF 2IG2L 5C0JB 5FA3B 4OKVB 4IDLA 1GC1H 1LP9A 5FUCE 4JFDB 1G9NC 4UDUB 3SE4C 4U1GC 2WLYA 4YHML 2HRPL 4P2RD 2D7OA 1AO7A 3RZCA 4XXCC 2OXGA 4OZHB 5FM8A 1F4AA 5ACZB 4L4TE 3C5ZC 2WW8A 5JMOC 1MEXL 1NEZG 2OX5A 3ARPA 3QCVH 4LLQB 1FIGH 2YSSB 3UTTA 3MJ7A 3WJJC 2C3WA 2A6JA 1NMCC 3CFEA 3HG1B 3H7BB 4KRPC 3QDJB 2FYYB 4NFCA 3S98A 2VSCA 2VDML 4NYLB 1X7QA 4FFZL 1AQDB 3TPUB 5CSBA 4XVTL 2MFNA 1TVHB 1GIGH 3VXPA 4OQTA 5EC1A 3WUWA 5DVLA 1CZ8H 3UJJL 1UADC 3MYJA 4DTGH 2ZUVA 2JJWA 2VDLL 1EGJA 3X14A 4Z7VA 2Q6WA 3SBWA 3QIUA 2PN5A 1RIVH 4WEUD 2HT4D 5FUZH 5KBNC 4X9GA 4XP4L 4L8DB 5DURD 3O3EB 5DS8B 4AYFA 3J8F7 4EUPB 5D9SB 3SN6N 2DBLL 1U2HA 2EEAA 1CBVL 3L7EB 1QNZH 4GAFB 4TYUA 3PWPD 1YDPB 1P4LA 5FYLH 3ULVC 2DLGA 2P5WB 5I1JL 5JPNA 3ILQC 4RISL 3IJSA 4LL9A 1A6TA 3P11L 3LIZH 4M43H 1T22B 4OLXL 3I3BA 1G7PB 3S88L 1J8HA 2CD0A 1A9EB 2J12B 2ZP0T 2QADD 5F3HB 1KJMA 5HGBA 4JRYD 5L88H 1JZ2A 4V2CB 1BVLB 2VLKB 4PRPE 2MJWA 1WAAA 2EKJA 1F4YL 1DE4A 1ZWIA 1UWEL 3CD4A 3NCMA 1FYTA 2VZUA 2YBRA 3MCKB 2HT3D 3JVGA 5EULV 3LKNA 1XAUA 4ZUSB 5L2KA 1ES0A 3R0MA 4ZSOA 5LXGH 3UYOD 4WY7H 5E2JA 3RAJL 4UIMA 4XP9H 4LGRB 2X40A 4LEOB 2DTMH 1ZHNB 2J4WL 3IF1B 4BJLA 3S37L 2H26B 3MRIA 1QKZL 4W81A 3RA7H 1J7VR 1BVKB 4L3EE 5ESQB 4NGHH 1LEKB 1I8MB 1QBML 3MRMB 3D0LB 3MACH 5GISL 4ZDHA 4FQXD 4KKAD 2BMKA 2PYFA 4EN3B 2GHWB 4ODHH 4PTTA 5T1MB 5IQ9B 3EDDA 3V6OE 3MBEB 1NGZA 1AC0A 3D25B 3EDEA 1CDYA 4JZJA 2VDRL 3LKQA 4PGBB 4AIZB 4JPIA 3KYNA 4HXAL 2KUTA 3AAZB 4JFOB 1UWXH 4AEEA 4JN2A 3WHXA 3V95A 4KHXL 3LDBB 4ZFZA 1SY6H 4WI8A 4KRMB 4U1KA 1NLDH 1T5XA 3O45B 4PV8A 1CFQB 2QLVB 3QUMA 1MWAH 1N0XH 3KPQB 5DVNA 2G5BA 4Z7QE 1I4FB 2BSED 1T2QL 4GG6E 2OL3B 3TZVB 2A77H 4Y1AE 5CD3A 2H8PA 1KULA 1QLRA 3G5ZA 5DMKA 1S8DA 3A0OA 3U30B 5EOCH 1B4JL 5D2NE 5F88B 4HCRA 3IDYC 3N9GH 4ZXBD 3O6FD 1RJZB 4YUEH 1WSST 1HXYB 3GSQB 1GGCH 2HKFH 5EUKA 2ZCLH 3KNBB 2VDKL 4OCNC 1NDGA 5DC4B 3O4OC 1CD1B 1S7RB 5KTEH 3SGJA 2ZCKL 4X99B 4HHAA 4M8QB 3KJ4B 2XPGA 3NCEB 1S7SA 1L6ZA 1CGSH 2B0SL 5CS7A 1Q9OA 4N9GA 4GUPB 2XWTB 4GQPH 3ULSA 1U8HB 3PJSB 5HVWA 1NSNH 2DQGH 3SDCA 2PUQT 1D6EA 1T2JA 4X7CC 3FN0H 4YGVB 3SJVB 2MHAA 4HWBH 1PKQA 4CNIA 5F89B 4NKQB 4K9EL 3CLFL 1CF8L 3KPLB 1T2XA 5FYJU 2YA1A 3BOVA 2R4SH 3RWDB 2E7LC 4KJQD 2NY6B 1GPOH 2IFFH 2RBLA 1JYVA 3UXFA 3S34L 1D5IL 5E6IA 3IS0X 5D70L 4PRIB 1R3KB 2X5PA 5EU6B 2B2XH 2R2CA 4KFZC 3A6OA 1YN6B 3IRZA 3FQWB 4GAYB 4OIAA 3NN8A 4YEFA 5T3XE 1OP5K 2NLJB 5HHMB 3BRFA 5DD0H 4PJXA 4PRPD 2ARJQ 2GSIB 4NO5A 1FO0L 3HZYA 1A4KA 1FG2B 3DXAB 4HK0B 4QY8A 1JNHB 3TJHD 4PTUB 1MRDH 2PO6D 3P0YH 3EGSB 5D2LE 1HOCB 2F5BH 5CILL 5F1IA 5FA4A 1X5GA 3MRPA 4NJAH 3HAEH 1EXUB 1T0PB 2YD4A 3K4DA 5BS0A 4KK6C 3GSUA 3TEUA 3OGOE 1WV7T 5JA9A 3ISWA 2XZAL 3NACH 5BW7A 5DUMH 2DQTH 4Z7UF 3LRHA 3PHSA 3HMXA 4L3ED 1FE8H 1NCDH 1WCQA 2I9TA 2XZZA 4GAJH 4LF3A 3WFBH 4MDIB 5E2WL 4ZO8A 3C87A 2BVOB 4OZFH 4PJ5E 4HUUA 1OAKH 3O6KL 2ATPB 2XTJC 1QBBA 2B4CL 2A1WL 3DX7B 2BHUA 1UEMA 4UDTB 1RZJC 3CFCH 1KG0B 1P7KA 5FM5O 1Y0LA 3RVUC 1MHEA 5AZ2H 4M6NL 1RK0A 5E99H 2FECL 1IC7H 3MSPA 5C0DB 1AI1H 2BERA 4JKWA 3TO4B 4NIKB 4ZTPL 5AZEH 2VN4A 3G5VA 4NNYA 1AR2A 3GDBA 4XBPB 4F7EA 5SWQB 2B5IC 3VXRD 1KIPA 4K94H 3ILPB 4M6OL 1WT5C 4FQQA 4PJ9D 1U3HC 3RX5A 1RZKH 4R4FH 4GRMB 1W0WA 2V6HA 3OJMB 5KSAB 1QR1B 4NKDB 3ZYOA 2G60L 3D2UB 2UUDK 5CEZE 2QEJA 2D7PA 3F58H 1UM5H 3AU1A 3HNTL 4Y1AD 3IXAB 6FABH 4ZFFA 1WK0A 1A14L 4LDLB 2VH5H 4G7YL 1EUTA 2A0LD 5JOPD 5T1LA 4PJ7B 4QTHB 1TZHB 3DX9A 3EYSH 2R1XB 2FZ3A 3HS0A 4KY1H 4P3CL 2NNAA 2W9LA 2W91A 1JWMB 1SYVB 2VQUA 4POZC 4XNXL 3GMNB 4YLQT 4MJ5B 2AP2A 4Z78A 5J9PB 3MOAL 1J9CT 1JPFB 5D5ME 5C8JB 3GIVA 3EJYD 4BK5A 2FX7L 5INDA 2BOBA 5F3BB 1U8MA 2QSVA 1OAUH 4ZUUB 2YPVH 3JWNC 4UB0H 3RNQA 4Y4KC 3SDDA 5IVXF 2R2EB 4GXVL 1NGPH 4UU9A 5TPWL 3LCYA 1H3PH 1W8NA 5E5MA 5GS1B 5E2VH 2GCYB 2KQNA 3V2AR 1NMBL 1CR9L 4GT7A 5BQ7A 1AY1L 4Z7WF 2GITB 3TIEA 3T0EA 1A6ZA 3MJ6A 4PFEA 3U1SH 5JW4M 1F6LL 3VU2A 3PWJB 4TSBL 3WCYA 3GNML 2WUCH 3LS5H 43C9A 4F57H 3O4LA 2LAGB 4HIXL 3BZ4A 4NM4L 3X3FH 1RUMH 2AEWA 3P77B 4V2BA 3RDTB 2XTLA 3FONA 2W38A 4KTDL 4GMTH 5HHVL 2ICWA 1WZ1H 5T3XD 5KSVA 3X12A 4PG9B 2X7LA 1YPZF 3O9WA 2IG2H 5E8OB 1I7TA 4DN4L 5HDQL 5ILTH 1BD2A 4IBLT 4O2CB 2HRPH 5IGXL 3B5TA 1CXHA 1MLCB 5IHUH 4J4PC 4FS0A 4JAMA 4NZUL 1SVCP 4AT6B 2JJSC 3JTTA 1MEXH 5DGRA 3TH2T 1QYGL 4NRYA 3MNVB 4C59B 4IOFD 3REWA 3UAJC 1QSEE 4BQCA 3UPRA 3RUGF 1J1XH 3RVXC 4PBVC 4YHLL 3WYRA 2WBJB 3ARGB 1NC4D 1UCBL 1I1FB 3BHBA 1LK2B 3QI9B 4XVTH 2D2OA 3BGAA 1CFVL 2FH8A 4R6UA 3MUHL 4PJCA 1MAKA 4RX4A 4PJ5D 3UJJH 1ZS8A 2R2BA 5KAQF 2C4XA 3ZHLA 2F58H 3QUZB 1KBGL 1FIEA 1J18A 1TFHA 3O41B 1ODAA 3DPBA 5CZXD 1A7RH 1VDGA 2ERJB 4EVNB 2VXSH 4OB5L 2NY2D 3F7YA 5MI0B 1X6LA 1TJIH 5A40E 5HYSG 3GSOA 3CPLB 1CBVH 4JDZA 3MXWL 3G6JA 5EN2B 5I1AA 5DJ0A 3SDXB 3FKUS 2CMRH 5GGRA 5GS0H 5TDPA 4BH8A 1Z3GH 3WS3B 3SE4A 4EN3C 5MENB 1CDBA 4OLXH 1YNLL 2PW1A 5AD0B 1VFOA 2BY0A 3L3IA 3HMXL 4EI6B 5I6XB 5CEZD 4IMLA 3RWJB 5DA0B 5KN5A 5F7UA 1AGEB 4J3WA 2HTKC 3WJJA 4FABL 2WWMD 3MUJA 1A22B 5EU7C 2VLJE 5CINH 4N90E 3UTQB 1ORSA 1E4XI 1UWEH 4HMEA 5BZDB 4E41D 2DLHA 4UUJA 1P7QD 1C5BH 1PKOA 1DQDL 2NX5E 3OKOA 4KVCH 1GGUA 2EKSA 4GW5A 4HG4J 1VGEH 1YPZE 1E4KC 2EDXA 3SCMD 1G1YA 2W92A 4XH2A 4GKOA 1HHHA 4XPAL 1YMMB 1R3HB 3RAJH 3BP7A 2KL6A 2WINB 4GAGL 3ZE0E 3MGTB 1NAMA 1NGQL 1T7ZA 1HEZA 3TZVC 1QKZH 3VGAB 5LGHL 4Q74A 4BQ8A 1E6OL 3MTRA 5DFVD 5JQ6L 1AE6H 2CUMA 2WV3A 3RI5F 3U30C 1F3JB 5ANMA 3RUGE 5GISH 2F74B 4M62L 4NO2A 1T7WA 2CIKA 4JCMA 5DJ6B 5CMAA 5C3LD 2C7UB 4PJ8D 4MNHA 5C0CE 4YBQC 5EA0L 3WIFB 1CXKA 2FECI 1X5FA 3X17A 1Q9LB 1A1NA 3VI4E 5MEOA 4IIQA 1KB5L 2Z4QB 5DEFA 5IEKB 3MLWL 1C5CH 3FZUD 4GKSA 4BSWB 1QSFA 3GMLB 4RWYL 2XZQL 4TN9A 3WIIL 2GJ6B 4E0RB 1M71A 5J1SC 1OQOA 1KTDB 3MRGB 5J11B 5HDBE 1UC6A 1WWWX 1KCSL 4QHKI 2BC4B 2DTSA 5EWIL 3RVWD 2X4TA 5EIIA 2Z8SA 2YPLA 2X4NA 4MXWL 3GKWL 3GSNA 4KHXH 4R2GD 1G9EA 2E27L 1G7MB 4KQ3L 4OZIF 3O0RH 1M7DA 2R2HA 2BNRD 1GGBL 1G7LA 1EJOL 3L7FA 4KZEL 3WD5H 2EH7H 2DRUA 2FHCA 3IDNA 3PP4L 3QQ3B 4MD0A 4X6DB 3BGFB 4XCNB 5K93A 1NQBA 1T2QH 2WM0A 4KWUA 4AEIL 1YNTB 2YC1A 1NANH 4FTVA 4XHQA 4J3SA 1XZ0B 3CFKB 3GB7A 5L7XL 3VXUB 5I8KH 4UTBL 1GZQA 3P0GB 5AYUL 3S96A 1A6AB 1BQLL 1QSED 2ID5A 1Q72L 3RHWF 5HGAB 3QDMD 4LLWA 1DVFB 2JCCE 3U9PL 3RWEA 2VDKH 1SJHA 3AY4C 2FSEB 1OSPL 1XH3B 2CJUL 5CJBA 1JK8A 2ZCKH 4WWKD 3DV6A 1JGUL 1IE5A 2BRQA 3AS0A 2F8XC 2OMBA 2B0SH 1QLEL 5DO2D 2XYCA 3CFJB 3KS0H 2P7TA 2FL5A 5EUOB 4PIRF 1KJ2B 2VWEE 4YQXL 3VW3L 3L5WA 3NCCB 4LKXB 5C6TL 1GJIA 5IMKB 3U7YL 1ZVSA 5DFTA 2X4SA 3P4NB 1FL5A 4NWUH 2XKUA 5HYQA 1FNAA 3CLFH 4YPJA 5C08B 3ULUE 4U4BA 1JWUB 3KYOA 3FT2A 1UH2A 1VA9A 2NY3B 3SDYH 4DKDC 4NM8L 2V2XA 3S34H 4OFVA 2YKLL 3V8OA 3DECA 1D5IH 3PV7A 4NQCE 3VXOA 2GJZB 1MCJA 2P46B 3ZKMD 3QDGA 2DMKA 3HC0B 3ZE2F 3QQ4A 3BYYA 4X8JB 1ZMYA 1ZVHA 2H6PB 2PNDA 5GRUL 1KGCE 4G43B 4JPKH 1K4DA 1LD9A 4KI1A 4P3DA 1H0DA 1FPTL 3D39D 4G3YL 1MIEH 5T1KB 4QRRE 3U46B 2VLJD 1FO0H 5HHOB 4N90D 3RBSA 5JZ7D 3MRNA 3TO4C 2CSPA 2VITB 2BVYA 3BZFB 2NX5D 3WFCH 1UB5A 4LNRA 4X7DC 3LZFL 5C0GB 3QIWD 4UIKL 4FXGA 5CILH 2D4DA 4K3HA 5L2JA 4MGXA 4WFEE 1X5AA 5KSAC 5IP4A 4JO2H 5HYJB 2CKBB 2PW2B 2AXHA 2XZAH 4OJFL 3VXMA 4RGMC 1NFKA 2EDYA 1IAOB 3TO2A 1JF5A 3VCLA 3VWJA 1R0AH 4UNUA 3VFVB 5CWSB 1IM3A 4MNGE 3H2WA 1NPUA 5IROC 3WL9A 5D71H 3U6RB 1I8IA 2R0ZH 5GGUB 1LK3H 1JF1A 4B7IA 1P5VA 1BLNB 2E7LA 5BV7B 2V2TA 3LB6C 4H5SA 2XWJA 3T0AA 5IBLD 2YD8A 5C0CD 1DLHA 2XRAH 1I1AB 1MHPH 2B4CH 2IH3B 5E8NB 1KB9K 4XWGL 4AK1A 3VD5A 3MRQB 2YUZA 1MY7A 2J8UA 2EYSB 2K1MA 4M6NH 5EBLA 1MQKL 4K3GA 5IK3A 5GZND 4N0UE 4J1UB 4JVPA 5IESH 4UV4L 4P5TB 4GW1B 3I9GH 3F7VB 4CW1B 5JHDE 3H9ZA 2I07A 2P42B 2PF6A 2CK2A 2WUBL 3RIFK 2F8OA 3TA3C 1IAIM 4JLRA 4I5BB 1IAIL 4PJIA 1IC4H 1ORQB 5DF0A 5A16A 5F72S 4AM0A 3KPMB 2G60H 3NFPA 4QHMB 4S1RH 5DQJB 3WBDA 3MV9B 5D6DC 1KUMA 2GY7B 2LU3A 3TIDA 3HNTH 5IB5A 2VE6B 3B9VA 1F97A 5I74B 4G7YH 25C8L 4KMTL 4WRLA 3RWIA 3ULVL 1YUHB 3RDTC 3HRZA 5DYOA 1RI8A 1BIIA 5L0QB 5HPMA 1JYXA 1G7IA 4ETYA 4Q6YA 4WW1B 3G5XA 1TJGL 1MJ8H 1FYHB 2MQ0A 4KKNA 3BDYH 2EXYC 4G8FB 3MOAH 2A73A 2H41A 1XGYH 3NAAL 4FQHA 3MLUL 4Z0BH 3UYRL 3B9KD 2FX7H 4OF7A 3KR3L 4LPCA 5ENWB 1I7RA 1GZPB 3AB0B 3AS2A 4GXVH 3BKMH 4LCYB 4W68A 3WJLC 1PY9A 3U48A 4G42B 4TUJA 5DVMA 5ITFB 3GEWB 3V5HB 4X7TB 2VAJA 3RIAK 3ULUD 3QYCA 3H9SD 4MCYB 2WBJC 3ARGC 1WWAX 3FQNA 3QI9C 4L8SB 4LCUB 2V7HA 1WBXB 3FQTA 5ACLA 2R0KH 3LV3B 4L8CA 3Q5YA 1NGYB 3O3BA 5HY9A 1AXSB 2R8SH 3QUZC 4XBEL 2FR4A 4GSDL 2ICCA 4KXZI 4HIJA 2FLRT 3HI6H 4KTDH 3RWHA 4AIXA 1KGCD 5HHVH 3W5NA 3OR6B 2AJUH 1LMKA 2KBGA 2ERJC 3TV3L 1FN4B 1F4WL 4QRRD 5MI0C 3LSOB 5HPOA 1CDCA 5SWZA 4OCSH 4DN4H 5AWNH 1KCLA 5HDQH 2QQKL 1VERA 3ARWA 4R97B 3RTQC 3P4OB 2X4UB 1UACL 1YJDC 1NMAL 1FC1A 3B43A 3DUUB 3ZHKA 5C0JA 5FA3A 4OKVA 3P9LB 5DUPL 5GGVY 3LH2L 1CU4L 1LP9E 4ZUWB 4LAJH 1YQVL 3B8SA 4KUZL 4WFED 4K3DL 1AO7E 4OZHA 4LSPH 1WBZA 2GJJA 5ACZA 5JHLL 4Y4KA 5TF0A 4HDIB 4KJYB 3WS6C 4LLQA 4YHLH 2YSSA 1KJ3L 3UTTE 3KPOB 3HG1A 4FP8L 1UM4L 5HSFA 3H7BA 3QDJA 2FYYA 1N59B 5A2LH 4NYLA 2YWZA 5C0NC 1AQDA 3TPUA 1ZGLB 3VRJB 1UB6A 4JVWA 4M7LL 1KBGH 3QFJB 4XB7A 3S9DB 1ZT1B 4JR9H 3QP3A 3I75A 4NZRH 3GZKA 4OM1L 5FK9B 1EFXD 5F7YC 5E2TL 1ZV5A 2VLRD 5FM5M 3VH8B 4Z7VE 4N8CL 5FGSA 3MRBB 3FB6B 1CXEA 5DK3A 3RVVD 4MNQD 5DHYB 4A6YL 1M6OB 4MAYC 3VGAC 2HLFC 1P84J 4L8DA 3RVTD 1ZHKB 4HMDA 3O3EA 5DS8A 5JHDD 4EUPA 5D9SA 2ADFH 3MXWH 5KW9L 5EZOH 4YDVB 4WWID 4DKEH 3VJ6B 3L7EA 2XZCL 4PJHB 5M94B 4JQXC 1GYAA 1DL7L 1YDPA 3HUJF 1YNKL 2UVFA 4J4PA 1YEJH 1YNLH 2P5WA 2P5EA 1X5ZA 2JJSA 3TM6A 1T22A 5ADPH 5E8PB 1DQMH 4FABH 1G7PA 1KELH 3H6JA 4GXUM 3T65B 5C2UB 4NJ9H 1A9EA 3HA0A 4OF5A 5F3HA 1J8HE 1UG9A 5TGBB 4YWGH 4DVBB 1BVLA 2VLKA 3F7RA 2DF3A 1E4WL 1UKQA 2JLLA 2DYPD 1WAAE 3OB0H 2NR6C 4N9OB 3ZLQC 1YECL 4XVUD 1YZZA 1HHKB 3U7AA 3VRIB 2BFVL 1FYTE 1PSKL 1HWHB 1RHHB 3SGEI 3MCKA 4JM4L 3MR9B 4KTEH 1ETZB 2NY5C 1OM3H 1B4RA 2R15A 2R9HC 3BGFC 4OBRA 5L2KE 4ZSOE 1NGQH 4OF0A 5LGHH 1E6OH 4Y4FD 4P2OD 1FCGA 4LEOA 1T21B 5INCB 1ZHNA 1F90L 3IF1A 2W9EH 2H26A 3K81A 4X0KB 5ESQA 3VA6A 1LEKA 1I8MA 4LHUB 1YN7B 4HKZA 1CIDA 3FFDB 3MRMA 3D0LA 5CCKL 5CLWA 1ZVYA 3O2WL 5JNYB 4GQ9H 4EN3A 1CG9B 4QXWA 4CU7A 1EV2E 1AH1A 5T1MA 1S78D 1KB5H 1FLRL 1EERB 5IQ9A 5I1DA 4JQIH 1IQDB 3B3IB 3MBEA 2XZQH 1MJJA 3D25A 4UAOC 4Y0GA 1QLFB 1Q94B 4EDWH 5C0BA 5EWIH 2DQFB 4MS8D 3BX7C 3EDFA 4PGBA 4AIZA 4MXWH 5SX5H 1WVZA 3UCRA 4GO6B 1S7VB 3AAZA 4JFOA 2E27H 4YIQB 3OF6A 4KQ3H 2MTPA 1MREH 4P57B 1VGKA 4LVHC 1GGBH 1ZLVK 1ZT4B 1EJOH 4KZEH 2NY4B 3TNMB 2NY3C 5F8RC 5CHNB 1E4KA 4X4XB 4DGVL 1I8KB 3O45A 2QJDA 1CFQA 1CE6B 1M1SA 3CLEL 4ONGL 2LFGA 3QNXB 3T0DA 4UTBH 3V7AG 5T3XH 2OL3A 3TZVA 1QA9B 5AYUH 3L5IA 3RZCD 1BQLH 1ZK9A 1YEDB 1MI5A 1KXQE 3I6LD 1B88A 1IM9D 5CKAA 5H35B 4ODTH 3UTTD 2EEBA 5F88A 4FQ2H 3U9PH 3RFZC 1OTSC 1RJZA 4OLZL 1HXYA 3GSQA 3LQZB 5TFSL 1OSPH 3VG9B 3PE9A 4ZS6D 2HFGL 4DJMA 4JE4B 3CSBA 1DBKL 3KNBA 4XT1C 2AGJL 4NFDA 3VXNB 1JZ4A 3LMJH 1QLEH 1CD1A 3QEQD 1S7RA 3UJTH 1T03H 4M8QA 4P4RB 3WHE0 4YQXH 3VW3H 4MDJB 2ZKHH 1IGCH 5DA4A 5C6TH 5GGTH 1Q0YH 4GUPA 4DUVA 4Q9CA 2DL9A 3F7QA 2E9IA 2D0GA 2OR9H 1U8HA 2EH8H 3PJSA 3QIUD 3L95B 4DGIL 1CLOL 4YGVA 2OJZH 3P40A 1WIOA 2A6IB 2VDPL 4GLRI 3SJVA 1LILA 5F89A 1PKQE 3EUUA 4IRSB 4NM8H 5EOCJ 4QNPF 3KPLA 3VFGL 4L29B 3RWDA 4FMFA 5BV7C 2VABB 1U0QA 3WDJA 2ARWA 4Y4HB 3HE6B 1I1AC 5ISZD 3TYGH 4YXLH 4PRIA 1FPTH 1R3KA 3WNPA 4PJAF 5EU6A 1DSFL 1F4HA 1OPGL 2BVQB 4L9LC 1HXMB 1YN6A 1J8HD 3FQRB 4KKCC 3FQWA 4GAYA 4OIIH 3IVKB 4P5TC 5EU4B 2OP4H 3AY4A 3S5LB 5GJTL 4MJ2A 4PJXE 3E1F1 1MAML 1FG2A 2EDEA 3HMWH 3DXAA 4UIKH 4HK0A 5HI3D 3GBLA 1JNHA 5IF0B 4XP1L 3TWCH 4PTUA 4JANB 5CEZH 4U49A 1EO5A 4NO3B 1V3LA 3EGSA 4LMQI 4N0CC 1HOCA 3G04B 4UNVA 2ZCHH 2VC2H 3HCVB 1OT2A 3CK0L 1EXUA 4W4NA 5DLML 5L2KD 3FTGB 1N5YL 4AIOA 2DLFL 1MY5A 4NQDB 1FC2D 4Z8FH 5BS0E 3MPCA 5IVZB 5I74C 1G9MC 1IARB 1UQSB 3QPQC 1I9RL 4KVNH 4LLMB 5L0QC 2EXWD 2NW3B 1F00I 4MDIA 1KN2H 4Z95H 2BVOA 4U6XB 2YHGA 4XWGH 3O81A 5I1CL 2ATPA 4Q0XH 3DX7A 4OCYL 5IBUB 2RFXB 4UDTA 3BPOB 1BBJB 3QEHB 3KPRD 1M7IB 2CLVB 2X09A 2GAZB 5C0DA 4KH2A 4UT7L 4EJ1C 1U3ZA 1KF9B 2WUBH 3WFZA 3RWGB 5IW6B 3CAFA 3TO4A 5EH1A 2H2PC 5SWQA 4XBPA 2P48B 2Y23A 4Y8AA 3M8OH 15C8L 1J86A 3ILPA 5AG8A 1WQVT 1LHZA 4L8SC 4QNPE 4XNYL 3QHTC 4GRMA 1KLUB 4X5LA 5DQ9B 5KSAA 1QR1A 4U3HA 4NKDA 4OV5B 2P8PB 4HS3A 2VZOA 4CRPA 2YK1H 2OI9B 3D2UA 1FG9C 2C9AA 4KMTH 3CU7A 5KANG 3G5YB 4NBXB 2NXYD 4MQXC 4CAGA 5DZLA 3IXAA 5KVDH 2O5ZH 3LKRB 1CDIA 5IROA 5BJTB 3ZTJG 4Z7UB 4PJ7A 2AQ3A 2AJSL 3ZMRA 1TZHA 3SE9L 5K9QG 2FJFB 2R1XA 2ZG3A 2BSTB 3MLUH 4R97C 3UYRH 1JWMA 1LO4L 1PG7W 1SYVA 2FBJL 3GMRB 4NKMB 4MJ5A 3QCUH 2DQEL 3MJ9A 5J9PA 1BJ8A 3FAWA 5C8JA 1WWCA 5AG9A 2DJSA 1VFBB 2VDQL 3NFSH 1BFSA 1OB1B 5F3BA 4I3RL 5HI5C 2AW2A 4HQQL 4PRAB 5LGJA 4ZUUA 2R2EA 3UTSB 2L4OA 5FYJL 1EAPB 2H2SC 1DEEB 3H3BC 4QTIH 5GS1A 3BN9D 3G6JF 2IAMB 2GCYA 2X4QB 5H94B 5K9JH 2GITA 1J0JA 1H15A 3GUTB 2APVA 3T0EE 5D6DA 1LO2L 4OM0L 5IIEB 1YYLL 1DQLL 5D7IF 4UINH 5E6ID 3O4LE 1GSMA 3TV3H 1F4WH 3P77A 3RDTA 3MMEB 1L7IL 1UA6L 4O51B 1K8IB 5HGGS 4CDHA 3MRCB 2H9GB 1A2YB 2GTWB 2MCG1 1UACH 4G8IB 4PG9A 1FVEB 5DD5L 5E8OA 5CJXC 1S9KC 2WQ8A 2C3HA 5DUPH 4POUB 1CU4H 2P8MB 3ZDXF 1YQVH 4O2CA 3J7HA 1BD2E 1KN4H 1MLCA 3ARFB 4K3DH 3OSKA 3MFFB 4MA8L 4AT6A 3W11D 1KPUB 4NC1C 2Z8WC 4RA0C 3MNVA 3BPNB 4S1SH 1F2XK 3WJLA 3AUVA 4FP8H 2VZ3A 5BMFL 3C2AL 4JFXB 5IVXB 4JRXB 4GS7B 2WBJA 3ARGA 1I1FA 2HFFB 3QI9A 3ULVF 2BVUA 4HKXB 4P46C 4YDJB 4M7LH 3NCBB 2ZOLB 1U3YA 4IM8A 4PJCE 1A6UL 2OTUB 5DZOA 1UZ6E 2AJYL 4Z7WB 2CUIA 3QUZA 1NGWB 1VADB 1GGIL 5EBMB 3O41A 4YO0B 3ARUA 2MCPH 2DM3A 1KLGB 4HBCL 4Y16D 5D1ZD 4A6YH 4NRZB 3TBYB 4OZFB 4EVNA 5KW9H 4I0PC 1V3JA 4PJEF 3LEVL 3CPLA 2RAMA 3E6HB 5E70A 5ECJE 5DD6B 3TPKA 2NQCA 3AREB 1ZAGA 1YNKH 1Q1JL 5EN2A 1WJ3A 3G6JE 1VKXB 3SDXA 5CUSH 1OAXH 1U92B 1BP3B 1YPZB 4OSUL 3WS3A 4D9QD 4HPYL 1U8IB 5MENA 4P23B 3H3KA 1OWWA 5J1AB 2XY2A 5AD0A 5DK0B 1AR1D 4EI6A 1TTGA 5IBTL 3IFNL 3RWJA 3WS6A 1AGEA 2J88H 4LRIA 3MLSH 5FAAA 3PQYB 3PHQB 3F5WB 3K8KA 1KENL 3UTQA 5BZDA 2BCKB 1YECH 4LSSL 3MXVH 2Y07L 5CJOH 4MQ7B 2JIXB 1PSKH 2AV7B 5T1LD 5D93B 3HFMH 3VWKB 2I9LB 3ARTA 2NY4C 2X4PB 1NCUA 1Q8MA 1YMMA 1R3HA 4HKBB 5JXEC 3HHRB 4XCEA 5DMGC 4HF5H 3UO1L 1I3VA 2WINA 2Z35A 5FV2A 1T83C 2UWEF 3MGTA 2HRLA 1F90H 4Y19D 3U4EB 4WFFD 3MROB 5ESAB 3BQUB 1GC1C 1NH6A 3WN5B 1F3JA 2HJFB 3MRFB 3O2WH 5ANME 1BJ1H 2F74A 4U2ZA 4D0CB 2VQ1B 5DJ6A 4Q9QH 4HPOL 4X9FA 3VG9C 2C7UA 4X8XA 1KFAH 4WJ5B 5LAXB 2OZ4H 2D4FA 4AY0A 3PL6D 5B4MC 3T0ED 3T2PA 2AQ1A 2Z4QA 5IEKA 3C9NB 2ED9A 1A3LH 2O61B 3SHSA 4JHAL 4BSWA 2YZ8A 3GMLA 3ULUH 1QSFE 5TQ2L 2GJ6A 1A7QH 4E0RA 1KTDA 1ZA3B 3MRGA 5C09B 1NFDA 4R7DB 2BC4A 4DCQB 5E1AB 1AXIB 3T4AB 4YX2H 2YPLE 5AAMA 5GZOC 4N0YH 5JQHC 1PBYA 4N1CA 1N0LA 4IRSC 1JNNL 4HFWA 4DGVH 1G7MA 2B1HL 3O9WD 4YFEA 1ZTXH 3ZKQD 4PRHD 5FGCB 5FGBC 3CLEH 4ONGH 3QQ3A 4FFVD 4X6DA 4XCNA 1TQBB 5E7BA 1I85C 3NCJL 1BD2D 3VG0H 3WFEL 3D0VB 3MUGB 4DOHE 1YNTA 1XZ0A 2Q20A 1XF4A 4FTVE 3CFKA 2AXFB 3ALWA 3VXUA 4I2XB 5B3NA 4QKXB 3T3MF 1A6AA 2Y72A 4YR6B 2WSKA 3L3OB 1HINL 3BE1L 3TN0B 2HFGH 1DVFA 1DBKH 2AGJH 4GW4B 3BEVB 1EZVY 4AQOA 1UXWA 3JV5A 1RU9H 2FSEA 3T09A 1XH3A 3OGCB 4F15B 2ITCB 4JDVB 1Y6KR 5DRWB 3VFNB 5ADOL 4RX4D 1TETL 2YD5A 4PG2C 3CFJA 5MERB 5EUOA 3ZDYF 1CGYA 4DUXA 1KJ2A 4YFLF 1JRHL 2Y6SD 3MRKB 4LKXA 5IMKA 3EHBC 3QXWA 1F58H 2ICES 4KK9D 4LGSB 3QUYB 2RGSA 5H37H 2IC2A 2JTDA 5C08A 2YMXL 3UZVB 3OKMB 3VFGH 1UH3A 4NN7B 2CLZB 1JWUA 2P47B 5DMIL 4APQB 1KC5H 1Z9SA 4JN1L 4Q2ZB 5IR1B 4XPHH 4LMQE 1FVCB 1JZ6A 4XCCL 4OF3A 4OZIB 2GJZA 2IALB 5D7LB 5C0IA 4F9PA 3RPKA 2O5YL 3QDGE 1KT2B 4HC1A 4X8JA 1DSFH 3PGFL 2H6PA 5D1XB 4G43A 3KS0J 1MFDH 3BI9X 4H88L 1NCAL 3HZKA 5T1KA 3U46A 1IAKB 4OBSA 5GJTH 2YR3A 5HHOA 4K3JL 4KRPD 3C6SB 4QGTA 3BH9B 2X42A 2VITA 3BZFA 3FQXB 4XP1H 4PLNC 3MV8D 2AEIT 4PP1C 3DVIA 4UQ3A 2X41A 5C0GA 2NXZB 1GRWA 2E9BA 4ETQB 1U8JB 5A1AA 5ERWA 5DLMH 3F12B 4HULB 1N5YH 4OD1L 5DJ2B 2VO5A 4Z7NE 5HYJA 2CKBA 2PW2A 2OI9C 1JBJA 1IAOA 4MMXC 1MJ7L 1YJDL 3VXME 4NKIL 5D8JL 4G6JL 4M8VA 4PYGA 3VFVA 5CWSA 4LDOB 2R4RL 3EOAB 1S9YB 3U6RA 5F1NB 5GGUA 4TTDD 4M93B 1BLNA 2CH8A 3GMMB 3P9MB 4IRJC 5I1CH 5GS2D 1FSKC 5A3ID 1I1AA 2IH3A 4G6KH 5E8NA 3QPXH 3GRWL 1HI6B 1FGNL 2EYSA 2VXTL 2J8UE 4PB0L 1G84A 3OAYK 3W39B 4J1UA 3GBMH 1OAYL 2NY1D 3QXTA 4GW1A 3PDOA 4P5TA 3F7VA 4CW1A 35C8H 3TVMD 1HH6B 3EYQD 4FQCH 4U1LB 2E6PA 2XQBH 2B7DT 2IBBA 1AP2A 2YPLD 2IAMC 4I5BA 2P24B 1NUFA 4XNYH 1ACZA 3VI3E 1ORQA 3BAEH 1N6UA 1W72L 2D03L 4PJIE 4UQ2B 2AK4B 4FG6D 3KPMA 4XAKE 4QHMA 5DQJA 1JHLL 1U58B 1LO3H 3MV9A 2Q87A 1QRND 1MCCA 2QSCL 2VE6A 4FTVD 4WO4C 2DWEA 4P9MH 1T89C 1YUHA 1QO3B 4WTZA 3O3UN 1INQB 2ZSWB 3STLB 1AXTL 1DUZB 3IJHB 4WW1A 1JGLL 1N26A 1H5BB 2FBJH 4ODBD 3GI9L 4K7PX 4D0DB 4G8FA 3FJTA 2XTJE 4JM2F 3BP4A 4MXVF 3ARFC 3JSSA 4I3RH 3RWCB 5ENWA 2V17L 2YD2A 1GZPA 2APWA 1T66C 4LCYA 4XVSH 1M7XA 3OKLB 1P6AB 5GHWL 1LQSR 3IDIB 4PLJD 2MMXA 4ZS7H 3LHPL 4G42A 5KVFH 5ITFA 1FNGA 3V5HA 2I26N 4X7TA 3Q5OA 3IKCB 3EYFB 3TNNB 4RGNB 2VXUL 4MCYA 4GS7C 4OQTH 1PGRB 2GTZB 5E0QA 2DICA 3K7UA 3FAXA 3QA3B 4L8SA 5CAYB 4LCUA 1O0VA 4QHNB 3U82B 4OM0H 1WBXA 1SJEB 5IB4B 1T20A 3LV3A 4H20L 1EGJH 1NGYA 1AXSA 4P4KB 2EDJA 3VA2C 1YYLH 5T5NF 2YRLA 3ROLB 1J05B 1ZLSL 2JELL 3QDGD 5J6HB 3D69B 3FB7B 3FHAA 5FF6B 2D9CA 3RIFF 1JFQH 2CRYA 3OR6A 3MLYH 1E0OB 1FN4A 2ZSVB 4RMTA 1S5IL 1U41A 3LSOA 5DD5H 2PTVA 4N0RA 5MEPB 5ESVB 4GBXB 3I85A 3P30L 5SWZE 1X7QB 4ISVB 4K8RD 5HVFB 1CICC 3Q1SL 4NP4L 3P4OA 2X4UA 4Q9RL 1OAQH 1QOKA 5BRZB 3DUUA 4R4BB 1ZSDA 2XICA 2YXMA 3P9LA 2VDNH 3BP5B 3PWPB 1RUQL 2YD3A 1P84K 3OQ3B 4ZUWA 1S5HB 1FO0B 1UKTA 3MYJB 1VACB 4HWUA 5FKAB 2YEZB 4P23C 5CZVL 1BBDL 4M7LT 4OZHE 5HI4C 4I4WB 4HDIA 2QBWA 4K94C 3CUPB 4IOSD 3LQAH 3KPOA 3BT2H 3VWJD 1C16B 3HG1E 2CK0L 1N59A 4JRYB 3QDJE 4ORGB 5FHBH 1A6UH 1CL7I 4U3CA 5EOTA 2AJYH 1ZGLA 1ZKAA 1P4LB 2F8VA 2VLLB 3T08A 3VRJA 3K4AA 3O8XB 1Z0MA 3QFJA 3LVEA 1ZT1A 3EO9L 3QDAA 5ICXB 5JW3L 4GRWF 5FK9A 4HBCH 1R6VA 4PUBL 3RIAF 3VH8A 1OTUC 3MRBA 3OXSB 7FABH 3FB6A 1VCAA 2WWKO 4FHBD 5DHYA 1M6OA 1ZHKA 1TTFA 1MRFL 1T6WA 3O2DA 4YDLC 2OK0L 4YDVA 3C6LB 4NN5B 1FZKB 3BQUC 3VJ6A 3WN5C 5CJXA 5J4MA 4OSUH 2BY1A 4FZ8L 4PJHA 4H26B 4RCAA 1WZKA 3DWTA 3VH8G 1L0XA 2EDLA 1S9VB 3DJ9A 1ZEAL 2P5WE 2P5EE 3IFNH 1TPXC 4O02L 3BKCH 5E8PA 2R29H 4KK6D 4QLRA 3T65A 1SMAA 3IS1X 2D31B 1RUPL 2W9DL 4G9FD 5TGBA 4DVBA 2VLKE 2Y07H 4FNLL 1BQHG 3NIFE 1V8HA 4XZUB 4JHBA 3WLWD 4GMSH 4YHYB 4UTAL 3QUMH 1HHKA 2NMSA 3VRIA 3A6CL 1J1OH 4ZQKB 1I3GH 1RHHA 5I16B 4PTTB 3S35X 3MLVL 3MR9A 3C08L 1X6NA 1ETZA 2WK2A 2GK2A 5SWSB 1FBIL 2FX9H 4LIQE 1INDL 1CXLA 1LNUB 3UO1H 3KLAA 3P4MB 3OZ9L 1TQBC 5MHSE 4LSRH 1NGZB 2WZPD 12E8L 4I48B 1AFVH 3KJ6L 3T0WA 3RVUD 4U1HB 4F58H 2P44B 4B53A 2QSQA 5INCA 1T21A 3EJZC 3IDXH 1SM3H 2B39A 1TLKA 4U6YB 4WCYH 3VRLF 3RNKB 2FATH 3DNKA 3O3AB 3F7PC 4ODWB 4K7PH 4Y2DC 5CGYD 3EYOB 4HPOH 3PDGA 1YN7A 4LHUA 3FFDA 1BOYA 4QRTB 5DD1H 5JNYA 5KSBA 3O6FB 4KI5C 1CG9A 2DWDB 1G9ML 3ECBB 3CZJA 3HUJB 1RIUH 1AHWB 4F15C 1ZLVH 1BJMA 1IQDA 4DKAA 1DBAH 2ZNXA 2VXQL 3B3IA 4J2XA 2A9MH 3MZTA 5TQ2H 2DMCA 4ORZC 4LHUG 4M1DL 1QLFA 1QLRB 2RHEA 1Q94A 2DQFA 5EU7E 3OKKB 4G6AC 4LLDB 2Z91B 1A64A 1RMFL 3QUYC 1S7VA 3LAFA 4EZMA 4YIQA 5C0EB 5EBWB 4NN7C 4P57A 1JPTL 5EUKB 4APQC 1INEL 1ZT4A 3TNMA 4C4KO 1RUKH 5CHNA 4X4XA 1I8KA 5DJZB 5JXEA 2NPLX 1ZANH 4JFDD 2XIDA 5F96H 3QNXA 4N9GB 2IF7A 2X10A 1QA9A 3C60C 3VFSB 4DZBB 1OVZA 1YEDA 3FB5B 4DKFL 3TGXA 1MI5E 1P4IL 5E8EB 3RY4A 3JWDH 5DJ8B 5GS0C 4PJGF 3EW3B 3P0VH 1N6QL 1ZHBB 4QXTB 2D7NA 4K3EL 3SOBL 4X7EC 3LQZA 3QDJD 3UJIL 1ZT7B 2JF1A 3VXNA 5ADOH 1TETH 2P8LB 1HN1A 3MNZB 4IRZL 5JUEH 4L5FH 1J12A 1JRHH 4BFGA 4MDJA 5GRJL 2G2RB 3VD7A 3KPSB 4OCWH 4KK5C 1IFHL 5J06A 4Z77B 3V0WH 1CCZA 4OCRH 4YZFE 5HVHB 2NYYD 3MOBH 4NNXB 3L95A 4HGWB 5FUOL 2A6IA 3C2SA 2AI0L 2DB8A 2HKHH 3SJVE 4MJ6B 4IRSA 4MMZC 4P2CG 2P49B 1C1EL 3EBAA 4L29A 4XCCH 5I66B 4M93C 3BP6A 2VABA 1TJHL 3M1BB 2I5YH 5FGBA 4Q6IB 2DQJH 4Y4HA 2CR6A 3RKDC 1I85A 3HE6A 1ADQL 4PGEB 4J4PD 3PGFH 4ZD3L 5FEBA 1SHMA 1BQUA 1MFCL 5IFAH 2X1WL 2W0KA 2K7QA 3GJFK 4PRIE 4OLVL 5EU6E 3UAJD 2BVQA 1Z9OA 2QHLA 3REVB 1HXMA 1IGFL 5L9DH 3IVKA 5EU4A 2VLKD 1HH9B 5HHME 3S5LA 1OTTC 2VUYA 4WI6A 4OCXH 1RZGB 2Z92B 1QFUL 4QXGL 3DXAE 3L3HB 5DR5L 5IF0A 3S8WA 4JANA 3H3PL 4NO3A 4PG2A 4CJ0A 1A0QH 4OD1H 3PNWA 4LRNH 4X7SL 1T1XB 3G04A 4LCWB 3ESUF 1AD9B 2COQA 2LTQC 3VGBA 3HCVA 5MHSD 3FTGA 1MJUL 3ZE1F 2EO1A 4G6JH 4NQDA 4BH7B 2DM4A 3OPZH 4XCFL 2G75B 5IVZA 1UQSA 2R4RH 2A6KB 4I8DA 4LLMA 3S35H 2NW3A 3MLZH 3U0WH 4KXZH 2YD7A 1OGAD 1FFRA 4U6XA 4M3KB 4K2UH 1H3GA 3GRWH 2SEBB 4DK6A 1RK1B 5MEQB 3FRUB 4EN3D 4JRWA 1L7TH 2VXTH 1LO0L 2WP3O 2RFXA 4PB0H 4F7TB 3QB7C 3QEHA 1M7IA 4EBQL 2CLVA 3MBED 1YEIL 3AXLB 2HTLC 2GAZA 3QEGH 5GRXG 3ARSA 4ZFFB 4PJAB 5E24E 4MQTB 1KB5B 3G9VA 4P2QD 3RWGA 5IW6A 3PV6B 2JJVA 1D7FA 4HFUL 4MD4B 2Y4SA 3DX9B 4U6HB 3PGDB 4PJFF 4N1EA 1JHLH 3BD4A 2F5AH 4ZOCA 1AIFB 1KLUA 5DQ9A 2E8YA 1NLBL 4OV5A 2P8PA 4LSVH 4XMPL 4U1MB 2BOBB 2FNBA 4WTXA 1BQSA 5F70A 3G5YA 4H0GA 1FV1B 2R23B 4FZEL 5E9DA 4U3XA 4X9HA 2ICEB 3SDDB 1SY6A 4LCCB 3LKRA 3UBXI 7CGTA 1CDHA 3S36X 5BJTA 3THMH 1XGPA 3CX5J 4JFPB 5GSRB 4L1HA 3RL2A 4Z7UA 5F7WC 3SO3B 2HT4C 1G7HB 4PJ7E 4ESKA 3GI9H 2FJFA 4GBXC 4WNQB 3VMOA 5C2BH 2BSTA 4F9LC 1SBSL 4NKMA 3GMRA 1B6DA 3OKNB 4CU6A 2FH6A 2V17H 4G7VL 4KUCF 2BHZA 1AGCB 3PIQB 5JORB 4J3XA 1VFBA 1WWBX 4PRAA 3LHPH 4AZ8A 5JO5B 3UTSA 1DEEA 2VXUH 2J6EL 3V6FB 2VZSA 1U42A 1U8LB 1WTLA 2IAMA 2X4QA 5H94A 3SJVD 2RCSH 3GSVB 5F9DC 1J8KA 3T3PF 3HN3A 4C83B 4FFWC 1C08B 2NY6D 3GUTA 4YFDB 1I8LA 5DHVH 2JELH 5IIEA 1X5YA 4JAMB 2DDQH 4G80B 2W65B 3NFNB 3L3DB 1SJVA 1W8OA 2HT3C 1F4XH 4FQLH 4LVOC 5I9QB 4NQVB 5FCSH 1UM6L 4PRID 3MMEA 5I30H 4O51A 5EU6D 1K8IA 5ETUB 3QCVL 1TVBA 3MRCA 4JG1H 1FIGL 2H9GA 1A2YA 2GTWA 2B4CC 1I7ZB 4NP4H 2NY2B 5HHMD 1K5NB 4G8IA 1FVEA 3DO7B 3VD9A 4ZTOH 1U3JA 4NN5C 1RSFA 3Q5TA 5TF1H 2E7MA 2LU7A 1Q38A 2P8MA 4DW2H 3WXVL 2W0LA 1GIGL 3ARFA 5GRZA 1P1ZB 4KMLB 3MFFA 1CZ8L 4KKAC 2C4FU 2Z31B 2Z9TA 1BBDH 2DQUH 4NOFA 3ZHDA 1YYMH 4C56D 1KPUA 4DTGL 4Y8DC 4ENEC 3TCXA 3JV0A 3KLHC 3W81A 3QXDB 2N7BA 2CK0H 4U1JB 4XWOD 4JFXA 5IVXA 4JRXA 5FUZL 4JDZB 5HHPB 2HFFA 3G6JB 4HKXA 5I1AB 5DJ0B 4GG8B 4YXKH 2ZOLA 1MHHB 1UFUA 4YHYC 4E41B 2VKWA 3EO9H 2OTUA 1EEQA 5HYIA 1TENA 1KIQB 4Z7WA 1NGWA 2LVEA 1VADA 2Y7QB 3X13B 2BX5A 1NAMH 5EBMA 4HBQA 4O4YL 4YO0A 3C5ZB 3SCMB 3RX8A 1JN6B 4M5ZH 1JI1A 4FQIH 1KLGA 3LIZL 5D7IB 1NFDF 1Q9WA 4NRZA 3TBYA 4OZFA 1NMCB 3AC0A 4RMUA 1NC2B 1IC1A 2QQQA 3N0PB 1WFTA 4X6CF 5GS2H 5L88L 4ALAH 3MV7D 3E6HA 1WIPA 1Z6JT 1IKNC 5HDLA 5DD6A 1CICA 2VZ1A 4JZNB 3TO4D 1TTUA 3AREA 1JGVH 2CRMA 1H8NA 4N8VB 1VKXA 1C5DB 3D18B 4HX1B 3SDXE 1U92A 3P4LA 3O6FC 3T3PE 1NUNB 1U8IA 2CR3A 4Y7MA 5T3ZL 3HKFA 4O02H 1CK0H 4P23A 4B7LA 5MENE 1AHWC 5J1AA 4I3SH 5DK0A 5C6WH 1RUPH 3D2UD 4WI9A 3UYPA 4WY7L 3PQYA 3PHQA 3F5WA 3GSNH 2C3GA 4XP9L 4D94A 2DTML 1RY7B 4HKJB 2BCKA 3NMEA 4WW2B 3TJEH 4UTAH 3MLRH 1A1MB 1WF5A 2JIXA 3L6FB 4MQ7A 3LB6D 4QO1A 2UY6A 2AV7A 5JDJA 4KU1A 5CMAB 5E8DH 5HGHA 4LK4A 3C08H 1JTPA 3VWKA 3L9RB 4WU7A 1FBIH 1DP0A 4R2GB 1INDH 4TVPE 2X4PA 1Y18B 2QQNH 2ZG2A 2VXVL 4HKBA 1UWGL 4M02A 1A8JH 4KJQC 1YMME 4E9LA 4KPHL 1IL1B 2FJGB 3R0NA 2OR7A 5MP6H 5I18H 1CQYA 3ZKSD 2APBA 2PR4L 5ALCH 3U4EA 3WIHH 3MROA 3D3VA 2CO6B 5ESAA 3BQUA 3WN5A 1Z2KA 4PJEB 3MRFA 2OM5A 2VISB 1CTNA 4LU5L 5GPRA 4D0CA 4YNYB 2VQ1A 3QDMB 4WJ5A 5LAXA 5BOZG 1G7LB 4H8WH 1UCTA 3ZKNC 4LNVA 1NLDL 3C9NA 4M1DH 4O00A 1MWAL 1N0XL 3D85B 2O61A 2PO6C 3LS4H 5IKCB 5H2BB 3R1GH 2A77L 5B39B 2GJ6E 3RDTD 4I77H 5C09A 5HVHC 4R7DA 5DI8B 3EFDH 3NZ8B 5GIRB 2NCMA 5E1HB 4DCQA 2XNAB 5E1AA 4TOYH 5EOCL 3T4AA 1CD0A 5J12B 1MNUH 1KIRA 3N9GL 2GSGB 5EC2B 3OX8B 4NQEB 1GGCL 5C71A 2ZCLL 1BJ1J 3FN3A 2EDWA 4X6FB 4JY6B 4D2NA 2IMNA 5L8JB 4X6DE 5KTEL 3D0VA 3MUGA 2FL5B 1CVSC 4OUUB 2AXFA 2DS4A 1GHFL 1CGSL 2GW5A 3DVGB 3VXUE 4I2XA 5CGTA 2UWEB 4K8RH 5C0FA 1MCOH 2AKRB 2XA8L 2GK0B 5IV2B 4YR6A 3SOBH 3L3OA 1B2WL 1NSNL 4Y2OA 5CP3A 3D39B 3UJIH 5J3HD 1MCDA 5EOQH 3QAZB 4HWBL 4LOUD 3BEVA 4DN3H 1CGVA 4PV9B 5CLTA 2R4SL 3OGCA 3UZQA 2ITCA 4JDVA 5DRWA 3VFNA 2IFFL 2JJUA 3QG6B 5GRJH 3VXOB 4CMHC 5KSUB 4JKMA 4PJDF 4RAVA 1IFHH 5MERA 3HI5H 4ELMF 4TVSa 2E5EA 1NL0L 5EUOE 3WSQL 4J3VA 3Q6FB 3MRKA 1LD9B 4NO0D 3ALPA 3VGGA 3LN5B 1H0DB 1BWWA 2CDGB 2AI0H 3QUYA 2BRRH 1A02N 3GMOB 4R90H 3OKMA 1C1EH 5C08E 2CLZA 2HT2D 4APQA 3GSXA 1TJHH 5LWYH 5DD0L 4OGXH 4L4VB 5IR1A 4D9RD 4HWZB 4A6YB 1E28B 1FVCA 5D2NC 1BFOB 2A0LC 4UBDD 2DOCA 4OZIA 2IALA 4JDTL 2DN7A 5D7LA 2YA0A 4ZAKD 1MRDL 1MFCH 5MEND 1KT2A 2F5BL 4HUVB 1NCNA 3C60A 3I6KB 3NABL 4OLVH 3B4NA 1HNFA 5D1XA 4NJAL 5JIKA 2WIMA 4CUCA 1MOEA 3T1FB 3EJYC 1IAKA 3T4YB 4EI5B 1A47A 1QEWB 3NACL 5DUML 2DQTL 3LOWA 5HHOE 1QFUH 3C6SA 4QXGH 3BH9A 3P9WB 3SO5A 5DR5H 3FQXA 3MRDB 1FE8L 1NCDL 2X4OB 3DURB 3WFBL 2NY7L 1PFCA 1YEGH 4X7SH 1CFNB 4ETQA 4TVPD 5EIVA 1U8JA 3SKMB 1A6VH 1MJUH 5DJ2A 1YMMD 1J5OH 1T1WB 1IC5H 2K9UA 4XCFH 5HYJE 3CFCL 1OGTB 1BIHA 5E99L 4UT6H 2HLFD 1IC7L 1URLA 2QR0B 1N5AB 4LCCC 4RDQF 3TESA 2WIIB 3EOAA 3V0VB 1S9YA 1RULH 5F1NA 4YXHL 4ZMAT 1U91B 3GMMA 3P9MA 4JLRB 3I2CH 5AZEL 5F71A 4JCLA 1RVFL 1U36A 1NFIA 2CXKA 1LO0H 4YDKH 3B9EA 5A2JH 1HI6A 4JPVH 1RZKL 4EBQH 5E2UH 1YEIH 3WEXB 1I7UB 1D9KB 1EVTC 3W39A 2VIRA 3CSPA 1KB9J 4GRLB 4HFUH 1HH6A 4U1LA 6FABL 2V5SA 1BPVA 2VH5L 4IOFC 2FEDC 2H32H 5I1HH 1JZ8A 2G5RA 2ED7A 5CKGA 3IFOB 2P24A 3UMTA 4WVRA 3MA7B 2V9RA 3H9SB 3EYSL 2AK4A 1JPSH 4LLAA 4M48L 3C5JB 4P5KB 1U58A 4XMPH 5FYKE 1MCIA 2R9HD 4YHZL 2Q3AA 5ID0B 3MV9E 5CIPB 2IJ0C 3HE7B 4GKZB 4JFZH 3S4SG 1S7XB 1FL3B 4RMWA 2EDOA 1V7MH 1EBPA 3VXUD 5I9QC 3S97C 1QO3A 1MCPH 1MRCL 1OAUL 1W0YT 4HUWB 4YHKH 4UB0L 3BZEB 1M4KA 1BFVH 1INQA 5DJXB 2ZSWA 5BO1L 3STLA 5EU3B 1NGPL 2B5IB 1DUZA 3IJHA 5ICYB 1YQ2A 1TIUA 1H5BA 2FDBP 3DX8B 2NY2C 1DVFD 4LVEA 3BH8B 1U3HB 3K8LA 4GOSA 4D0DA 3ZDZE 5I19H 2IGFL 4QYOB 2UYLB 3F65A 1LDPH 2AERT 3U1SL 1R5WB 3RWCA 2FR4B 3QJFA 3I6GB 2IQ9H 3T77B 2F53D 3LS5L 3NH7L 4NHUB 3KYMB 5IMMB 1VPOL 3OKLA 2J6EH 3X3FL 3IDIA 3UTOA 5D4QA 1J88A 5DWUH 3FMGH 5F93C 1KEML 1JGDB 3EYFA 3TNNA 1NBYB 5I76B 5SWZB 2GTZA 3ARQA 5SV3A 2GT9B 2WWMC 1IMHC 3EO1A 3QA3A 4HLZG 5D1QB 3E3QC 4QHNA 1EIBA 2BJMH 1SJEA 5IB4A 2GY5A 1FH5L 4P4KA 5ILTL 5B3JE 1MCQA 3ROLA 1J05A 1LE5B 3C8DA 5IHUL 5J6HA 1UM6H 3D69A 3FB7A 1WBZB 2EYRA 3SCMC 5FF6A 4Y4KB 2VL5B 2VERN 1DLFH 1JGEB 2AXGB 2VLRB 2ZSVA 4JO4L 4F7MB 3K2UL 4YJZL 5T1KD 1J1XL 2EDFA 4MNQB 1I1RA 3L3GB 5KVEH 5MEPA 5ESVA 5HHOD 4GBXA 5IJKC 1JV5B 4H0IA 3UTPE 4ISVA 5D7JB 4F9LA 3WXVH 5BRZA 1UB6B 3EFFB 4R4BA 5C0AB 2J7LA 5B38B 4I0CC 3BP5A 3PWPA 3I75B 1HK6A 1S5HA 1VEPA 1FO0A 1F11B 1VACA 4JM2B 1UVQB 4HGMA 4PJ8C 2F58L 2YEZA 3DHMA 5FKAA 3KDMB 4I4WA 5HYJD 3CUPA 3DOSA 1A7RL 3WUWG 2VXSL 1VB9A 5DT1H 3FZUC 4JGMA 1C16A 1TJIL 4HZLB 4JRYA 3QULB 4ORGA 5KSBF 3EOTH 4RFEB 4WW2C 4LIQH 3GM0A 4LEXL 4NKOB 2VLLA 4G8GD 3RVWC 3BW9B 3O8XA 2YXFA 2CMRL 4DVRH 5A43C 5GS0L 2GUOB 1Z3GL 4R2GC 2P5EB 3QFJE 4O4YH 1I1AD 5ICXA 1HYSD 3SQOH 3H42H 3QBTB 4U31A 3OXSA 1IQWH 4KKCD 2FGWL 3IETB 4NUGL 3N1MC 2NY0B 4P5TD 3D6GA 3C6LA 4H1LB 5CINL 1FZKA 4H26A 4XC1L 4PJHE 5J6GB 1C5BL 4LARL 5T3ZH 4KVCL 3V0AC 1S9VA 3DI2B 4XPFH 1XR8B 1VGEL 1YEKH 1AGDB 5FYKD 2X1OA 5IT2H 3B5GA 5F9JB 3MV9D 3VFOB 4NC1E 4WWKC 3CDYA 3VGDA 4QRUB 5C7XL 4HUMB 2D31A 1OP9A 3SDAD 4FQ1H 5DO2C 3X11B 4CVXB 4QRSB 2C1OB 5I17B 3OB0K 4F2MB 1KCVH 1AE6L 3QQ9D 4OFKA 5DEGB 4HKZB 4XZUA 2ZJSH 5J12C 2QKIB 3SPVA 2VXVH 2IEPA 4ZQKA 1DQJB 5I16A 1UWGH 4KJWD 5HXMA 3GHBL 5SWSA 3UTZB 4KPHH 5I1DB 1NEZB 1LNUA 2YRZA 4XAWH 3P4MA 2I24N 3PGCB 2PR4H 1MJJB 3H8NA 4I48A 4GRWB 2ATKB 5LQBL 4U1HA 1V5JA 1G7JB 3ZKMC 1A3RH 1C5CL 4O2EB 5C0BB 1GAFH 5HD8D 2XQYG 2EYTB 4U6YA 1KEGL 3WKNA 1IKNA 3RNKA 3BIAX 2CXGA 4CADB 4LU5H 3O3AA 4ODWA 2H1PL 5IEHB 2H2PD 1IM9B 3EYOA 5CEYB 2O93L 4UV7H 1VGKB 5JTWA 3QAZC 4QRTA 3O6FA 4JG0H 2IQAB 2YD6A 4P5MB 4DQOH 5KSBE 1ZLWK 2DWDA 3ECBA 1R3LA 5JZ7C 3HUJA 4J7RA 3O0RL 5JLZB 1AHWA 4CN6A 1N7MH 3WD5L 2EH7L 1CD8A 3QEQB 4JREC 5KG9B 1A7OH 5FHAL 3QIWC 3U4AA 3WMSA 5SX5K 4L4TD 1MI5B 4K23H 5J89A 1VFAB 5I8KL 3OKKA 4LLDA 2Z91A 1FLTX 3O6LH 5LBSL 3CVIH 5TDNB 1WEJH 5C0EA 5EBWA 2XI9A 2D0FA 3UTPD 1K85A 1GOGA 5K59F 1CGTA 1R5IB 3MOQA 5B8CC 5DJZA 3ARDB 2H3NB 2W0PA 2LU4A 1GHFH 4JVUA 4LKCB 4DZBA 5HI5D 3VFSA 5EORL 2XA8H 5EFIB 3FB5A 3OXRB 1IGIH 2VR9A 3AM8C 5E8EA 1B2WH 4BSVA 5DJ8A 2EDDA 1HSAB 1ZHBA 4NWUL 4QXTA 5JIHA 4EI5C 4KJPD 3GGWB 2CGRH 4OD3H 1EHXA 2BHYA 3GI8H 1PLGL 1ZT7A 2KDGA 4M4PA 1BZ9B 3SDYL 2P8LA 4F7PB 3MUY1 3GHEH 3U7WL 2L7UA 1WITA 1IGMH 3MNZA 3CFDB 1AJ7L 3CVHL 1NL0H 3WSQH 2G2RA 2PO6A 3KPSA 3PXHA 2P4AB 4Z77A 3LQMA 3B5HA 1CVRA 4NCC1 5TE4H 4JPKL 4NNXA 5EIQA 3SE8H 4PD4K 4HGWA 3GJFH 1MIEL 1HHGB 2EECA 4MJ6A 1XMWA 2XT1B 4JHWH 2BZDA 1FZOB 3QZWB 2YA2A 5I66A 1RURH 2GEEA 4LHQB 3M1BA 4JDTH 4Q6IA 3WFCL 2DQCL 3QUXD 1SQ2N 4PGEA 3NPSC 1IEBB 1NEUA 2AJ3B 3NABH 3MRLB 3BUTA 4XP6L 3BXNB 2WLZA 3MLTB 1AGFB 1XIWD 1D9KC 1UJTA 4JO2L 3B9KC 3B83A 2A83B 4MWFB 3RX7A 3KPRB 5FYLE 3UDWC 3REVA 4M3JA 3BISA 4DWHA 2BSRB 2VSDA 4GRLC 3ZO0A 1HH9A 4PJGB 1R0AL 1A4JB 2FEEL 5JA8B 4W4OC 2NY7H 5FXCH 1RZGA 5D71L 2Z92A 3ZTJH 2ITDB 2R0ZL 1EEUA 4PYHA 1LK3L 3L3HA 4MAUL 1B0RB 4X6EB 4EOWH 1MVUA 3ULUC 3VXRA 3SE3A 1KCRL 4W6XB 3ET9F 2XRAL 1T1XA 2IPTL 1MHPL 4LCWA 1AD9A 4MA3B 1JHKH 3HE7C 4BH7A 1YC8A 4YH6A 4NQDE 1QP1A 1R3IL 1X4ZA 2G75A 3BUYB 1XCTB 2A6KA 1HCVA 5IESL 4YXHH 3I9GL 3OG6B 2F9BT 4M7ZC 1F02I 1QQDB 1QTYT 1RVFH 3WNMA 4LHUD 5ACMA 1DBBH 1HCFX 2H45A 4B0MM 4KDTC 2SEBA 2FBOJ 1RK1A 1IC4L 3OB8A 5MEQA 3FRUA 2FLBT 5TQ0H 2VAAA 5C07B 2F54B 4HS3B 3CX5K 1HHJB 1IEAB 4S1RL 4F7TA 4U7KA 4RGMB 2Y5TB 2X9YA 3FFCB 5CGMA 4LCIH 5T1DL 4NN6B 3AXLA 1EO8H 2BOCB 3QWOB 4PJAA 2Z8RA 2FRGP 3GJEA 1JPST 2Z93B 1KB5A 1GH7A 4PRNB 4MVBD 3ZL4H 3TT3H 3PV6A 4MD4A 4ZFOL 1TZGH 5LG1A 1RZ7H 5JIIA 4U6HA 1MJ8L 5TDOB 3PGDA 4M48H 5C9KA 2NY4D 5D1QC 4YHZH 4LPWA 3BDYL 4XP5L 3KPTA 4G8EB 3RY6C 1AIFA 5JXED 1XGYL 4Z0BL 2VMFA 1CDJA 4KQ4H 4U1MA 1FV1A 2R23A 5LGJB 1CL7H 1MRCH 2ICEA 5E9DE 2UZIH 4LCCA 5BO1H 3BKML 4G9DB 4JFPA 5GSRA 3IDGB 3TA3B 4POYA 5I71B 1KTLB 4V1DB 4Z7UE 1G7HA 5SV4A 4WNQA 3RVTC 4DAGL 3LEYL 2IGFH 5D7JC 5I1GH 3BIKB 1PZUB 5TE7L 1H15B 1CDGA 3MGAA 1MCNA 3OKNA 5B4MD 2R0KL 3ZTNL 3V4VL 3NH7H 1AGCA 3PIQA 4LVNC 5JORA 4JM2C 2R8SL 1U9KA 1VPOH 3TFKD 3OMZA 1OARH 5JO5A 4HUKB 1KEMH 1T80A 3HI6L 5I1LB 1TZIB 4TSCL 1ONQB 3ESVF 5IOPB 2AJUL 2ICWJ 3UTSE 2RQ8A 3V6FA 3H9HB 1QPPA 4FN0A 1U8LA 1ZXQA 5DQDL 1OOAA 4LASL 1H8SA 1CLYH 3Q6GH 3GSVA 3PG2A 4IRSD 4OCSL 5AWNL 1NC4A 5KOMC 4C83A 3P73B 5DRNB 3SKUD 2N1KA 1FH5H 1C08A 3IGAB 3OTTA 4PJFB 1OHQA 4FFYL 1XGTB 4ERSH 4OLEA 4Y4HD 4XVUC 3HE6D 4G80A 4D0BB 2W65A 3NFNA 3L3DA 3VFPB 1CFBA 5C86A 3NIGF 4NQVA 1DBMH 4JO4H 4LSPL 4WI7A 3K2UH 1HSBB 1T7YA 1OF2B 5ETUA 2LABA 4Y16B 5D1ZB 1T4KB 1I7ZA 3IAGC 2IPUG 2NY0C 4P2OC 4Y4FC 4OUOA 4ZNCD 1K5NA 3Q48A 1KNOB 3DO7A 1B90A 4LSQH 3BFOA 3BO8B 2EC8A 2A6DB 5ELIA 1P1ZA 4HK3J 1XGRB 5CP7B 2Z31A 4JR9L 4URTB 1RZIB 3GMQB 4NZRL 1PG7L 1L9MA 1S78C 4XNZB 3DSFL 3QXDA 4NQDD 5FO7A 2CLRB 1EDQA 5CD5D 4U1JA 2GKIA 2XFXB 2XKNB 2JJTC 4HSQA 4JRXE 5IVXE 5HHPA 4RQQB 3RTQB 4LEXH 4DEPB 1MHCB 2ADFL 3KGRA 4MS8C 3QWRA 4OLWL 5EZOL 4GG8A 4DKEL 1J0IA 1MHHA 4E41A 1MH5B 1S7TB 3AS1A 1KIQA 4TRPH 2UY7A 4Z7WE 2JB6A 2X4RB 2CKNA 2Y7QA 4XXCA 5DDHB 3X13A 1YEJL 1KTKE 3C5ZA 3SCMA 1JN6A 4KAQL 5D7IA 5E56A 2EDRA 2FGWH 5ADPL 4NUGH 1DQML 1KELL 1NC2A 2C5DC 2BNQB 2AEQH 4NJ9L 4HH8A 4HT1H 4YWGL 4X7FC 4Y19B 5IJKA 1K6QH 4XC1H 1EBAA 4JZNA 2OR8A 3QSKB 4LARH 5DJDB 4FA8A 3CDFA 1NAKH 4N8VA 1C5DA 3D18A 4HX1A 4PP1D 3VFTB 1O5DT 2VZTA 2J8OA 5FFLA 5IJVA 3MYZA 4ZS6C 4KTEL 1N8ZB 3PL6B 1FGVL 2R1YB 4AMKH 5IQ7L 4XCEB 1K9TA 1P5UA 1OM3L 4CN4A 3CH1B 5C7XH 2Z35B 1FFPB 1IZJA 1W72B 3AGVA 5IB3B 1WC7B 4MAYB 3VFUB 3O3DB 2VJXA 4GKNA 1Z0NA 3PQYE 1QHPA 1SVZA 1R24A 3LN4B 4HKJA 2DIJA 2W9EL 4KI5F 3MREA 4WW2A 2X6MA 5AEAA 1JF6A 3QIUC 1A1MA 3L6FA 4Q7DA 4ODVH 1O7SA 4LSUL 3L9RA 3GHBH 4GQ9L 1Y18A 2Y9RT 5BCAA 1R5VB 4OGAC 4OF8A 4AENB 1BREA 2BNRA 3ARDC 4PRHB 1TCRB 5LQBH 1IL1A 2FJGA 4JQIL 1G0DA 5KS9F 4M5YL 3VXSB 1KEGH 4R7NB 2AS5M 1NFDB 3T0BA 5E6ZA 2H1PH 4EDWL 3D3VE 3UTSD 4PJEA 4X6CB 2VISA 1HDMB 2IAMD 3RP1A 5ID1B 4HFWB 4YNYA 3PABB 2YRPA 3QDMA 1MREL 2IANB 4J6RL 1C8PA 5FHAH 1FJ1B 4OLUH 1FHGA 1XF4B 1CDUA 4WFHE 1UZ8B 5HYSB 3D85A 4TULL 5IKCA 5H2BA 4M6MH 5T3XL 4L8BB 1RIHL 5B39A 1CXFA 5LBSH 4NCDA 1OSZB 5DI8A 3GFUA 5C09E 5DHVB 3NZ8A 5GIRA 4CBPA 5CBAA 4WHYG 2XNAA 1CGUA 4ODTL 2OLDA 5F8QC 3T2NL 4FQ2L 2HVJA 4JFFB 5IFHL 1QG3A 2GSGA 5EC2A 1UXWB 2HLAB 4K7PY 2HH0L 3OX8A 4NQEA 5DUBB 3L5JA 3AFLA 2DJ4A 2EXWC 1MUJB 2D3VA 1EAJA 3AS3A 4X6FA 4I13B 4I0KA 5FGCE 5B39G 3LMJL 4JY6A 5I8EB 3UJTL 1MPAH 4UAOB 3IFLL 1T03L 3A6BL 5EORH 4OUUA 2D7MA 2UZXB 3BGMB 1JPGB 2ZKHL 1IGCL 3GIZL 1AD0A 5GGTL 3DVGA 1Q0YL 2UWEA 5IV2A 2AKRA 2OR9L 2GK0A 4I2XE 4JY4B 4OI7A 5HYEA 2OSLB 3W9EB 2EH8L 3D39A 3DUHA 2W1NA 4LVHB 2OJZL 1PLGH 2KKQA 4JRXD 4YAQB 3OAZK 1AC6A 4LFHG 2ZUXA 4TUOB 1XF5B 4PV9A 3ZSTA 3U7WH 2FO4B 2WWKT 1AJ7H 3CVHH 5KSUA 3MV8B 3QG6A 4JPWH 2EO9A 3PF2A 5C0IB 2DIAA 4OLYH 3RJDA 4HMCA 3ZYJA 3Q6FA 2XV6B 4KK8D 5I1KL 3TYGL 5F21B 4YXLL 3LN5A 4ZFGL 5IUSA 3DMMB 3HZKB 2CDGA 4M03A 5BV7H 3GMOA 2AAVA 3DROB 3EOBB 5HJ3B 4OIIL 1D3CA 3W0WB 3TBTB 2B20A 2OP4L 1H3UA 4L4VA 5JOFB 3VD3A 1FNHA 5EO0B 5FM4A 4F3FB 2DQCH 3ARED 2Y36H 4HWZA 4A6YA 3HMWL 1E28A 4UQ3B 5J13B 4QGYA 1BFOA 1NKOA 5H8DA 4XP6H 1OAZH 3TWCL 5ERWB 4OZIE 5CEZL 5D7LE 1DANT 4YBLB 3B2UC 4P23D</