3U4KA

Crystal structure of the receptor binding domain of plasmid-born adhesin mrkd1p of klebsiella pneumoniae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
163
structure length
163
Chain Sequence
GSSCWQSNSAYEINMAMGRVVVSPDLPVGSVIATKTWTMPDNNTIYVTCDRNTTLKSDAKVVAAGLVQGANKVYSTAIPGIGLRFSRKGAISMIYPDSYTTTGSSFRLAGSTFTLDIIKTSTTTGSGTLASGPYTEYGPGFTILKTSLNADAITIVSPSCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the MrkD1P receptor binding domain of Klebsiella pneumoniae and identification of the human collagen V binding interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell adhesion
molecule keywords Fimbria adhesin protein
total genus 28
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2011-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u4kA00
3U4KA
chains in the Genus database with same CATH superfamily
5EEVA 4BA8A 2PO6A 2R9HC 4UINH 1HOCA 4XXCA 3E6FB 4JPVL 4EN2A 5IJVA 2F1BA 4FXTA 4G5AA 4FGMA 5KANI 3ZOAA 3PUCA 5F7DB 1EERB 1VAHA 1M7IB 5A2LH 1NGPH 1YYML 2E7MA 2BP3A 1I3GL 5IIEA 1QEWA 2FIKB 6TAAA 1M1XB 3MRPA 3IAGC 5F7EL 4YDJA 2ZJSL 3NDYE 1QLRA 3CUPB 4F7CB 4PJEA 4FL4B 4OQTA 2YGPA 3QJFB 12E8L 5C9JB 3QDGD 2FWUA 2R0LH 3IS0X 3MRDB 5IQ7L 4X7SH 1JTTA 4U3CA 3PP4H 4MQ7A 3IMBA 2PYFA 3ULVC 5BOZG 3CVHL 2MRYA 1KIUA 1ZE3C 2XDHA 4LMQI 1HH6B 5FGBA 3OF6D 5B1AB 2YPKA 2O6PA 2Q3AA 2NW3B 5T1LD 1V7MH 1M05B 3JWDL 3SKMA 2HX8A 1RZIA 4K3DH 5JXED 1PG7X 2OTPA 5GS1A 1JOIA 1I9JL 2Z8VC 3X14B 1SJEA 1AC0A 1IBZA 3BJ91 1KJ2H 3N41F 4Y1SA 1KCRH 4GAGH 4OBRA 1DQLH 4J5VA 3G5ZA 4EXKA 3RB7A 5I66A 4EI5A 2ICWI 4ODHL 1OP3H 1D5XA 2OYPA 3LRSB 5KSVB 1NAMA 1PG7W 4AK2A 4XPHL 1QSZA 4KMTH 3V8OA 1E9OB 2F6AA 3GSVA 2BC4B 3ARRA 1AHKA 3D1MC 1SUHA 4GG6E 3CFKB 1PIFA 1Z9NA 1H5BC 2Y2YA 3RWDA 1NDMA 4PJGF 4C58B 1K3ZA 5I1JL 3FB5A 5KYYA 4G8GB 2OMUB 5HGAA 4XMVA 3PHOA 3LNEA 3ROLB 2Q9OA 4MD0A 4YHMH 4BH7A 1N0LB 2VERA 3WN5A 4CSPA 1JZEA 4E42A 5HVWA 4YHLH 3CHOA 3WMPA 2AJVL 5DK2A 3CSYB 5DRNB 1CE6A 1TTGA 5EU6B 4ODXA 3BQUB 5KJ4A 4DK6A 4KKPA 3SKOB 1RFDL 3WFEH 1Q1JH 1QNIA 1A9EA 1HYRC 1U8QB 1OAQH 4I88A 3GGWA 1CFBA 4WVRA 3CVHB 3WJJA 3AZUA 2FH6A 2EDXA 4BSWB 5JO5A 1UXMA 4GRWH 1HH9A 5TDNB 5JOPE 5JW5A 3EYFB 15C8L 4MNGA 1VPOL 5E6RB 3F6LA 1EA9C 1KTBA 5E00A 1NDMB 1L9TA 1Q72H 3VXTA 2HT4D 3PV7A 1AR1D 3LPPA 2XFGB 5KUMA 3HI6H 5A16B 5C3IA 4F9LA 1WPCA 2WTPA 4BZ2L 3LN4A 3TEZA 4LL9A 4YDVB 5I1DA 1X7QB 1EH9A 1HS6A 3MGOB 2A77L 2EYRA 4LHUG 1ZLSL 1KLUB 4RDQF 1TJIL 5F7MC 5AB1A 4JR9H 4IDJH 1JMZA 5EOCH 2VQ1A 3NIFE 5TF1H 5BRZB 2O5ZH 1IEHA 4GXVH 2FX8H 2IQ9L 2V2TB 1HZKA 3DO4A 4M8VA 5DJ0B 4M48H 1AGFB 3ZDZB 3L3DB 4G6KL 1F00I 4I9WD 1WV7T 1VJSA 2X89D 4N8UA 4NO5B 4W9DC 3SDAC 4F8PA 4N86A 4PJHF 1YQ2A 3L3IB 3QG6B 4C83B 4JFEA 1SRDA 3L5HA 1A64A 1HH6A 5I6PA 1KCLA 4RMTA 4A7SA 4PR5A 5F70A 4ENED 5LXVA 1NCAL 4FQ2H 3FUKA 1L7TL 4MJHA 3BZEB 2NOYA 4QHKJ 2JTYA 1E5ZA 5GHWL 2ZD0A 5HYJE 1CJYA 2XVKA 2DWDA 4L37B 4PJIF 4N6RB 4QRSA 5DI8A 5T1KD 1T2QH 3FFDA 3B2VH 4IRZL 1S7XA 5HGDB 4ZJ9A 3X1BA 2Y0SA 4JFXB 1EJFA 2WSKA 5E2WL 3F7YB 4Z0XA 5E1QA 2P28B 3WEXB 1OW0C 3VWKC 4PPTA 1J0HA 1H15B 4TRPH 3RVXD 4IGBC 4TTDD 1JNLL 2A74A 2FD6H 4IRSB 5MP6L 5L8KB 5FX3A 3RZCC 2A9DA 3IMWA 3KL3A 4PJFA 4M62H 3SD2A 4M43L 1NWPA 3RPIB 3D3VA 2YMOA 5KSUB 1YO4A 5HD8C 3OKKB 3SZKC 4KVNH 3BAEH 4GS7C 3PWPA 1CS6A 5TDPB 1JS4A 3RIAF 2JCCA 4R7LA 3ETBJ 3PL6D 5FUOH 1MJJA 2R9HD 4Y9CA 4PWFA 4XP1H 4M7ZC 1G7LA 4WEEA 4GMSL 1KJMA 3VFOB 5EC1B 4WUKL 4MJJA 5DJAB 1EXUA 4A7VA 3CFQA 2B9AA 1SXAA 4PB0L 1F90H 3P1VA 3S9DB 2FE0A 3EHBB 3EO0A 3OMIB 5G55A 1A3LL 1JGLL 4OBSA 4Y2LA 2XN2A 4JDZB 4K7FA 5EV7A 2E7HA 4FA8A 3QXAA 4OF5A 3DLQR 4NQCB 3MVSA 4DF9A 1E9PA 2FK9A 1N5YL 5KSAA 1EJOL 3FFCB 4HWBL 3U0TB 2F08A 3PHQA 5DJDB 4HUKB 4PREA 5BZZA 3DVFA 1JYNA 3GMNA 2D7TH 1MCPH 5E5RB 1BJMA 3QDGB 4YAQA 3MLSL 1NFIB 3HKFA 3EGSA 3DETC 1BYPA 2CK2A 1O7VA 2DQFA 5ISZE 1OGAB 4GAFB 3NSJA 1IFHL 3BP5A 1PQZB 2X44D 4JBSA 4PUBL 3IVKA 4TNEA 3VFTA 3KBPA 3M17B 4XNAA 1ZTXL 2WXLA 1V10A 4KOBA 1U8HA 2ZQKA 4NWUH 1DLFL 3EJYD 1NGXA 2X3AA 1UWGH 5FYJL 2VE6B 4FXGC 4IRSC 3M1BB 2BP8B 1QRNA 2DJ4A 4GW4B 2VDNL 4PGJA 1CGXA 3FSOA 4MD5A 4N2GA 4IRJD 1PG7L 1YEDA 2B1HH 4APXA 3QIUD 2PW2A 5JIKA 2APXA 2NY3D 1P4BL 2F74B 2QQLH 2B2XL 4R3SA 3EXLA 1WA0X 5F1IA 1MWAB 3U1SL 3QXUA 5E2TL 1Q9WB 4QCIA 4BDVA 1V7NL 3VH8A 5IB5A 3V9CA 1P9MA 1GOGA 3B9EA 4CJ0A 2VLJA 2VJ0A 1FNSL 3R1GH 3WFZA 3S5ZA 5KYNA 3DXAE 2XYBA 3FB5B 5KYYB 1JFQH 3HTLX 3SO5A 3P9WB 1FC2D 2Y5EA 4S2SA 4HK3J 2ADFH 2E8ZA 3SIKA 5IMKA 5JNYB 1BX2A 3OXSB 4G6MH 2JJVA 2IFFL 4G8GD 3DMMD 4W9IC 35C8L 2B08A 3BPLB 2XVBA 5DSCB 4FCAA 5T1LB 3C60D 1PVHA 4X2UA 3SGDH 5E8EA 4KNTA 1KOAA 1UYWH 5HSFA 4MNHB 4ENZA 1F58H 2F61A 3F7YA 3KW7A 3QI9D 1I1FA 4RGOL 1PCSA 1GYVA 1KIRB 3FH8A 1F42A 4QY8B 3RWJA 3AG4B 2J1KA 4GEIA 4IDLA 5G5DA 2K9FB 3HUJA 5LBGA 4IBUA 3U0WH 1MI5E 4ZMZA 3FB8B 3X3GL 5CZVL 1S9XA 3C08L 3L4CA 2X38A 2K4WA 5KVDH 2VZUA 2O61B 3BIBX 2AQ2A 3V0AC 4Z7UF 3TYFA 3QUXA 3SOTA 4EQ3A 5DFVC 4JB9H 3NK4A 2BINA 2Q76A 2I7OA 4YC2B 5FO8B 4TSBH 4MCZA 3NMEA 4OZFG 4OAWB 4WCYL 3PPSA 1CLOL 5EZJB 3SBPA 3WUWB 4A04A 1PS3A 5TPWH 1DQTA 2YK1H 3IDNA 4HJ1A 1A9BA 1FG2B 1JN6B 3RIFF 2DWSA 4L8CA 4NYLB 3LX9A 3EDJA 4KH9A 1U58A 1R0AH 2CBMA 4HYTB 1TVDA 2BZCA 3PF2A 4KKCD 1OTUD 2HX9A 3KPPA 4MQSB 3UYPA 5AAPA 1ZXQA 2EXYD 4FCHA 4WO4C 4BFRA 4W9HC 5I8EB 3QBTB 4OFIA 1UXWB 3IEAA 3MUUA 4BXVA 4J4PD 4NO2B 3UROR 2ZUTA 2VWEC 5I8OL 3QUXB 4MZRA 3K4ZA 1Y0LA 1BF8A 1U93B 3KJ4B 2Y5TB 5C07B 2DYPD 4GAJH 1E4JA 5C0DB 1SM3H 5DRZA 1NC2D 5JXAL 3KW8A 3IFLL 5IQMA 3QISA 1BZ7B 4GH7B 4TVPH 1PZ2A 1A4BA 5I24A 4N8VG 4Q0XH 1QBAA 2EXWD 1FBIL 1M6OB 4NRXB 4OLZH 1AO7B 4UZGA 3VQLA 4R5TA 1TETL 5ALCL 1NCOA 3DJ9A 3OLIA 2J6EH 2JMRA 3QEQD 2OL3L 3QWQB 5EUOF 3B5HA 3C6LA 4LB8A 3MRQA 3ZE0E 3IFOA 1CTOA 1T1ZB 3PABA 3SBQA 3RFRA 2GJZB 4R4NC 1NOFA 5CBEB 1I53A 3O11B 5HDQL 1UOWA 3HI6L 3HS0C 4JFEE 2ZSVB 3EJPA 5CR8A 4YFDB 1CGTA 5I0WA 3MHZA 1NGZA 3TVMB 4HJJL 4JHAH 5JIIA 3BO8A 4ZSOA 2F7IA 4M6NH 3FT2A 3TONA 4L4TB 4NQEB 4NZUL 4PI2A 3NJJA 3SCMC 5GRWA 1CE1H 3LVEA 4LEOB 3O45A 1U92A 4AEFA 2K70A 4GFXA 5T5NF 5CEZH 5AAWC 3OVUB 1JTOA 4Y2OA 2XV0A 4QYAA 2L4OA 2PYEB 5IEHB 4OFPA 1IQWH 2YRBA 4YHIA 3GMOB 1INQB 1IM9D 1ZS2A 3OR6A 4TKWA 4JCLA 4J8RA 2QV4A 5B1CA 4PRBB 3GF8A 3QZWG 3U1PA 5E2VL 4X9IA 4YHNB 2DW5A 2YOCA 4WEBH 1RQ5A 4U0QB 2XKUA 2WHVA 1VFOA 3D9AH 4GO6B 1WTGT 2WIMA 3QUYC 4KI5F 5JPNC 1Q38A 1C5BL 2VDRH 1IC0A 4NM8H 4P46A 5E9DB 5JLZA 4DHLA 1YQVH 3BP6B 4UTBA 5ALCH 2E9WA 2WV3A 1L9SA 1ZIAA 2Z9TA 4F3FB 1OGPA 4PEEA 2G2RA 4X5WB 1FORL 2GJPA 5D1XE 1NWOA 4Z7NF 4PRPD 5T3XE 5GS3A 3NIGF 1H8NA 2WXKA 4XNYH 4WFFD 2BZDA 4JFHD 4YDMA 3SDCC 3PHQB 5FYLL 1F2QA 2R1YB 1VZHA 43CAB 4HIIA 3MRPB 5FS5A 5H37A 1BFVH 2KKQA 3MBWA 5I8EA 4A67A 4PI0A 2YAFA 4P2QD 3AXHA 5CEZD 2YGVA 5ENWA 1EGJL 1Z3RA 3VU2A 1HCVA 2WGNB 1AQKL 2W92A 3TP4A 1GZQB 3VFNB 1EXHA 4I89A 5EFIA 2DYRB 2XHNA 4KX9A 3ZQXA 4J3BA 5B38B 3ULSA 4JRYD 1RPQA 1VCBC 4AG4H 4B7LA 3UC0H 4OQ1A 1JGDA 1ZT4B 4OD2A 4PP1C 1OTTC 3T0DA 2ZONA 1IGJB 2J1WA 3PWPB 4QF1B 5HJBA 3UPAA 1H3VA 4ELME 1CFVL 5G4MA 2AK1H 4XMZA 4Z3FA 5L0QC 4FFTA 1A22B 1CGWA 2BIPA 2Y5TA 2OMXB 1NEZG 2BSED 4MJIB 4JFWA 2VR7A 5CZVH 3X3GH 1X5FA 3WFEL 5F9AC 1ZA3A 2V17H 4H5SB 1GW0A 3ZTJG 1RIHH 3BDBA 4KKAD 5IMMA 3P4OB 3ARGB 3QI9C 1T1WB 2HRPH 4FN0A 2FGZA 1QI3A 2VLRE 4CVUA 4ZW3A 3CVIL 2EAEA 2Q2LA 5EF2A 4NSKA 4AQZA 4M6AA 2XN1A 1K3IA 3RJQB 1HWGB 3UTSE 4EF3A 2I7SA 5A43C 1T83A 3IDNB 3KLAB 5HVHC 2Y07L 1PEWA 3GBEA 2NQ3A 1AJ7L 2OMZB 1FSKC 4IIQC 1ORSB 1TOXA 5FYKD 4NKDB 4FNQA 3V55A 4TMPA 2Y06H 2ZOWA 1WWCA 3BPNB 2I85A 3A0OA 2DBLL 3NN8B 5C6TH 3DYPA 5F6HJ 1K2DA 4HVBA 5EF3A 1MAJA 3QDMD 3FQTB 4QT5B 5IK3B 3TT3H 3CCHA 1TJHH 3V9FA 4LCIL 1S7VB 4KRPD 1JGUH 3GUFA 1ZLVK 3QFJD 4TYUA 4KAQH 4O9HL 2WXHA 5I1KL 5CLYA 2G5RA 3W5NA 4FQXB 1OSPH 4I3SL 3AS0A 4GG8B 3TF4A 3APCA 4K15A 1HFUA 5HYIA 1JE6A 2JSFA 5KYUA 4URKA 1KWGA 1NKOA 5H35A 1ZD6A 2XTSA 1T4KA 3QFJE 3SGKA 5DZJA 5FLUA 4KJYA 4Y4KD 1B0WA 2GQHA 1IL1A 3ARDC 1FJ1A 1L0XA 5FGCE 3OX8B 3JVGA 3LDBC 3O6FD 3IJHB 3TTSA 3DVIA 2V37A 3AWEA 3FSWA 3ALPA 3IDGB 1UZGA 5L0QB 1L9NA 4N0YL 3QQ9D 1A7QH 2A74C 4Y9GA 5JOPD 2A99A 2FUQA 4K71C 1LWJA 2VXSL 1QUNA 4MNGB 4L3CB 3Q6FB 4MCNA 3NESA 1HI6B 4IKKA 4GS7B 1NFIA 5DD6B 5GGUA 4ZS6D 4AVHA 3TBVB 3RJDA 2ENSA 1ACCA 2DN7A 3CQQA 4H1LH 4BV1A 4KZEL 3D07A 4NJAL 3B9DA 1G7HA 1GS8A 4LRNH 3T6ZA 3KWXA 4J6RL 2C9PA 2EUVA 3PWJA 1HHKB 1SFHA 1VFBB 5T1DL 3KVQA 5IR1B 4JDVB 4RX4A 2AJSL 4H0GA 5DFAA 4N8VB 1CXIA 4FQIL 4PG9B 3HN3A 3RDTB 1CFVH 3SGEH 1N0XL 1MG2C 2PWGA 5LN4A 4WQOA 3L6FB 5DRWA 2NY0D 2W0FA 3WU1A 1Z0MA 2WAHA 3BKJH 5IHUL 3V4PL 1MAML 3BP5B 3WLWC 4EIGB 2YZ8A 1QVOB 2FO8A 4OJFH 1KLGA 4HMDA 4U6YA 2BIQA 2AJXL 3BO8B 5JW4R 3GMNB 3V10A 1UOVA 1E30A 4LSSL 4XP4L 2UUDH 3EFFB 2KPWA 3G5YB 5D1ZB 5CEYB 1DVFD 1RJYA 1U8MA 3LZFL 4X8GA 1B0GA 1A0QL 4I18A 4K7PY 2NYKA 1DLFH 3AQYA 2PR9A 4XWOD 2FBRA 2IWKA 2WUCL 4PGCA 2FQEA 4FXGB 5FW7A 2IGTA 1NPUA 3A4FA 4N2CA 4PUBH 1BVLB 4XO9A 3PE9A 1SLVA 4PJ9D 3ILQC 4XO4A 1SMAA 4GJTB 4ZPTA 4C56A 2Q7AA 3VH8G 3U46B 4Y1AD 2A9BA 5I8CA 1J0ZA 2G4EA 3SGJC 1BG9A 2V2XB 4MD4B 1GR7A 1FZMB 2YA0A 4OZHE 4J6RH 3GMPA 2WIIB 4OZIF 4LO9A 5C0DA 2XJKA 4GKZB 1U93A 1OB1A 4TNVK 1NKGA 3BN9C 3L3OB 3LRKA 3DTUB 2Y6SD 1J9SA 2ENJA 3KS0H 4KVPA 1DVUA 1XF4A 3PNRB 1LD9B 5AYTA 4KKNA 5IVZA 1EJ8A 5LUMA 5J0BA 3NQIA 2VKXA 3S34L 3WJMB 2NUTB 2YD3A 5FYJE 2BVPA 1TJGL 3P4NA 3FN0L 4PJCE 1OM3L 2XX0A 5AVTB 3ULVE 4IRSA 4TN9A 3FRUB 3FT3A 5I73C 5BQ7A 4P2OC 4TPRL 4LARL 1WF5A 3DIFB 4NFDA 3R19A 4V2BA 3V4VA 2MNJB 1MFMA 2OULB 3IJ9A 2AXGA 2CE6A 1KLUA 4O2EB 4JPSA 1CL7H 1NEZB 4NSKB 3K7UA 5F8RC 1OT1A 4KROC 4E9XA 5DEZA 3ZXAC 4BFBD 3K6DA 2AXWA 4GINA 4V1DB 4H0LC 4PY8J 3NPSC 5AFAA 3FUDA 3BGFB 1ZA3B 5TTRA 4AOFA 5A2KH 2BVPB 4QMEA 4GG6A 2HTKD 2P24A 4XH2B 1OGAD 3THML 5L2KB 3L3IA 1ZVHA 4FLHA 3DOSA 5HYQA 2IGLA 4TUJB 5F88B 4JUSA 2J12B 5CHNA 3ORJA 4XN1A 4KBPA 1UT9A 4B95C 3UEZA 2FEJA 1AZCA 1QA9A 1T21A 4DP9X 3PREA 4N0FB 1AI1L 3HG3A 4WDIA 5GGTH 2FO1A 3GSUB 4BZYA 1P6AB 3N1MC 3CV5A 5F7AA 3DVGB 5A2AA 4XPFL 5AZ2H 2X41A 4RGNC 5KOMC 3OAUH 2ZUUA 5DFTA 4XAKE 3KGUA 4H0HB 2R23A 4M48L 4I0CC 4GB9A 2QKIB 4L3EE 4JANA 2AK4B 4ZFOL 3T8XB 3HBPA 3Q1EA 4YQXL 2XWZA 5FA4B 2AMGA 4V1DD 4D9RD 4X8JA 2DS4A 2YWYA 3RU8L 1ZLSH 3II1A 1AE6H 1II4E 1DQLL 3F6IA 3ET9F 5LAXB 3E9TA 4S1RL 3C5SA 2RD0A 3CK0H 1UB6B 2QDWA 2F1EA 3BVWA 4ZG1A 2AXFA 2IWEA 1H6EA 4LLUA 4HMEA 1WIPA 4WRLA 1GYCA 4Y7MA 3RVUC 1RUKH 4GSDL 5IVXB 5GSRA 5DD5H 5DVPA 1ADQA 1HL8A 2FEEI 4I1NB 4BK4A 4J8QA 3WY2A 3AADB 3CX5J 1XQ4A 4FYQA 3K6IA 1G9NL 3PAYA 1GKOA 4KGLA 4RFNB 1BZ8A 4KO9A 1VFAA 5D4HA 2YQGA 4YO0B 4F24A 3GSXB 2EIEA 2WC7A 1ET7A 3LH2L 5J6GA 3CMOL 5FWRA 3IFNH 5DUMH 2WB7A 4L4TA 4G7VH 4P99A 3AT8A 1A5FH 1MLCB 1OE2A 2NR6D 1ACYL 4PBWD 5D2LF 1O6SA 5B1KA 3QZPA 3VDAA 3D25B 4LLMA 3FQXB 1NIDA 3WE6B 3CHXA 4Z7WF 4JCWA 3M86A 3FO2A 1NZRA 4H8PA 4MNQA 3WTWA 1FI8C 2D03H 2OTUA 4NIKB 2F8XC 1MQKH 1IGTA 4WGVB 2WANA 4WEBL 5D7EA 2WNWA 1WAEA 2PTTB 3EO9H 4GO8A 5C0GA 3UZEC 1JNJA 2QR0B 1EDQA 1AR2A 2BWDA 4XC3H 5TQ2H 1YEFL 4U2ZA 2F5BH 1HYSC 4OGXH 4JM2A 3UTTE 2ORBL 3QEHA 5K9QG 3L4VA 4D9QD 1DQJA 4XPAH 1SXBA 4HETA 2I24N 4HIEA 1HC1A 4JR9L 3ULVF 2WWKT 5CEZL 3VA6A 3VI4F 2Y69B 2XT1B 4HEMA 2VDPL 5MEPA 3T0VA 5IFJB 2KZKA 4GLRH 3GO1L 3FO9B 4ZMQA 2NDFA 3UTZA 4TSBL 2ZG1A 3HFMH 3RFZA 4X4KA 3T04D 2F1AA 2PP8A 3G08B 3TA3D 4Z18A 2J57A 2W60A 4NWUL 4Z1PA 4WU7A 1QHQA 4OUUA 1BLNA 3L08A 1N5AA 4R0LA 2DTMH 3BDYL 2G9HB 2LR4A 4I77H 3BN9D 3V6OE 5CWSA 4B27A 2GYSA 5KS9E 3EH3B 5D1QB 1J5CA 2NX5D 4FXKC 5DC9B 4FQQB 1GGBL 4CA4A 4AW4A 2K6WA 2J5LB 1RU9H 5BNXD 2NUTA 4IBZA 2AVFA 2VC2B 1AS7A 3RIKA 2N3JA 1DJXA 5IFJA 3KG5A 3VGDA 1XB3A 4YDIL 1LNUB 1HE8A 2KZBA 3TBCA 4P2OD 3H9SD 1AKJB 5C0AA 3H7LA 43C9B 3CC1A 1Q9LB 5AKSA 5C09D 3GMPB 5J11B 1HAWA 2EACA 1F90L 4D2NA 4WI5A 5F0MB 3TEXA 1R19A 4A55A 4K07A 1TFPA 2XG4A 1Z3GH 4DEPB 1NFDA 2CSPA 3HMWL 4G1MA 4XPTL 4YBLC 4MXQC 4FFZL 3AREB 4XBPA 5CZXC 4U1JB 2KMWA 3H9HB 5L7XH 2VXQH 2OX5B 4YSCA 5BV7B 1GJIA 4X6EA 1KCVL 4QHNB 3QEUA 2WXIA 2OBGA 1I7TB 1F3RB 4UIKH 1G7IA 5C08A 3FRUA 3FT3B 2OYMA 5IB4A 3ZRSA 5FAAA 4GT7A 3U48A 4UV4L 5ENWB 5BPPA 4NN7C 3P0YH 3Q2CA 5IF0A 1OWWA 4K7PH 2CQVA 2FX7L 3WIIL 5BS0E 2WY3B 3FYEB 2UWEF 3U30C 2WLNA 1A4KA 1J0KA 2ITFA 2ADIA 1JSYA 3FHEA 4OVVA 4DKDC 1DJWA 3FO0H 1JGEA 3G5XA 1V7ML 2C3HA 3LJ3A 1EO8L 4Y19E 3KJ6H 4MSWB 5AYUH 3CVCA 3LZFH 1PFOA 1RUML 3CVHH 3QVAA 2VLRA 4G1EA 4UV4H 1HXYB 5GGSY 5H37G 3U4AA 4MD4A 4WY7L 1RZJL 1I9EA 1OAUH 2CPCA 2LLNA 1DVFA 5FO9B 4XBEL 5D7KE 1L3NA 3UTPE 3QJHA 1A7PH 4PP2A 3EO1B 4KXZH 4DQOH 2F7RA 5JZ7D 5DHXB 3QULB 2JI3A 4TUOB 2ZPKL 4OF6A 3WFBH 2FWOB 3K8MA 3PNWA 3U36A 2JJTA 4HIJB 4J1UA 3BD5A 1S7QB 3RI5F 2HMID 1AGDA 1I8MA 2DQGH 3VWKA 1E27B 3SDYL 1GZHA 4FFZH 4MA1B 3QCTH 4FP8H 4Y19A 3MOBL 2Z65C 2W1NA 3PJSB 2R27A 2QQNH 3BDXA 2ED7A 3GSWA 4Q4EA 2KC0A 4AIEA 1MNUH 3WMSA 8FABB 1TJGH 1OAXL 5CU9A 1GJUA 2FJHA 5DGRA 3MX0B 3RNKA 3GBNL 4R84A 2B0SH 3STZA 3IGFA 1E8WA 3BCFA 1NBYA 3ECVA 3GJFB 4FS0A 4X6DB 5CIPB 1VIWA 3CMOH 4PJ7A 1KBKA 2CA4A 4FNPA 5HDRA 4MMXB 4LT7A 1CD1A 1PLBA 3VGAC 3W57A 3PP3K 1OHZA 4ADGA 1QLFA 2OYLA 1ILUA 2XY2A 2D9CA 4GI9A 4YUEL 4EIZC 4GP4B 1J8HB 4M62L 4MXWH 2IMMA 3K46A 3CHSA 4OLUL 3DO7A 4JFYB 3BD3A 4GQRA 4I9WE 1W15A 4ODSL 3IM1A 1OAYH 2CIIA 5L2KA 1P1ZB 2P80D 4JJHA 5IIEB 3SE6A 4X0KA 3V9EA 4DGWC 2XICA 2WCPA 4FJYA 1OSZB 5CCKL 4Y9FA 1IC5H 4ISVA 3UBGA 3HG0A 4PJDF 4XN4A 4ZAKC 4MRBA 2ZIDA 4ZFZB 5TDOA 4XBGA 3T65B 4AGLA 2BNQD 3WEMA 4P5TC 2GUOA 2YR3A 1AXSA 4N22A 5K33A 4GP8B 3WN5C 2VLJE 1J1OL 1X3DA 4LF3B 3UJTL 4ZFOB 4DJMA 5EWIL 3K3QA 2DBLH 3SD5A 3WD5H 2F54B 4E2OA 1MRDL 3CN1A 1KLFB 3SPGA 4Z7OB 4U0RC 4N6RA 5DI8B 2BCKB 3F05A 2RQ8A 4G6KH 2Y5QA 3BKML 3LRHA 4AJ0A 3MR9B 3D2TA 1R34A 2F53A 4LDLB 3SDDB 3ELQA 2YAPA 5EU4A 2BCMA 2YMXH 5C0BE 3WUWA 1PNDA 2FX8L 5EO1A 1HCYA 5BOJA 5DJXB 4XOCA 3U2JA 3UX9B 2VMCA 5D1ZD 1HX0A 1XD0A 4TNVF 3N04A 1F8TL 3J27A 4NQSB 1FFPA 4YSAA 4F7MA 4FZEL 1XH2A 1Y7VA 3STZB 2WTOA 4Z7NE 5DUJA 3V4LA 4JVUA 1KXTA 4LIQH 4U1SB 2V2WA 3EYOB 4JN1H 4AYMC 2EYTB 3WY1A 4RISH 2J8UE 5FDYA 1M3IA 3BWUC 1W16A 4DUWA 1OWRM 4LIQL 4EI6A 1UTDA 3HN8A 4NPYA 3LN4B 1SY6L 4LSVH 4B3EA 2WZ0A 2ZOTA 1NBCA 1FWXA 3L13A 3VCLA 1T2QL 4IRZH 2EIDA 1KN4H 3PQYD 4G6JL 4HXBL 2GSIB 4P4KD 1GMIA 5GS0H 1WG3A 1NUDA 4NCC2 1TYJA 3Q44A 4GNKB 3MJ8B 1MDTA 2Z1KA 1X5YA 2OR9L 5JHAA 1X6NA 5AG9A 2QR0A 3ZDXF 4OM0L 3BP6A 3RRQA 4JL1A 2XQBH 2E27H 3VFSB 4AYBA 1MI5D 3GZQA 4ZTEA 2FIRT 3F04A 3NCJL 4B9ZA 4JFTA 3EYVA 4OF7A 1EHAA 4F20A 5EO0A 5LGJA 3J8F7 3D33A 3ZY7A 1TTRA 4A2HA 4Y4KC 3CHQA 1PDKB 2CK0H 2IANE 5C97A 4F5CA 2EC9U 5CIPH 2FO4A 2Z7YA 3HC2A 4X6CA 3T0EE 1I8LC 1LO2L 3MLWL 1YEGH 2NY5C 4PBDA 1BQUA 5ADOL 1OXYA 1S7UB 4TTDC 1N2RA 4X7DC 1NAMB 5D2NE 3VI3E 4KTDL 4FTVD 3HNVL 3CLEL 1T5XA 2NY1B 2KZ1B 2WQVA 3KAAA 2CLZB 3ZE2B 2GY5A 5EU5A 1A1MA 2AV1B 4LESA 5BXFA 1OLZA 2WLZA 1NEUA 5DZ9A 3FFCA 1CG9B 4QRRE 1UA3A 4W81A 3HMXH 2JLPA 3U36B 4FABH 4PTTB 3S37L 3RL2A 3O8XC 1N3NB 4ZAKA 4F37F 5AD0A 5FM4A 3QUZD 5CN1A 4LDEB 1RURL 1FFTB 1X9LA 4FNUA 4YXHL 3SJVD 2XQ0A 3HS8A 3C5JA 5EF0A 5JMRA 5K39B 1I9RL 3W0WE 4WWKD 3EO0B 3MRDA 3O0LA 2HN7A 3MV9A 4FZ8H 4MFHA 3ARED 4X98A 1UWEL 3S34H 2QGCA 1SJHA 1OAJA 3VUAA 3IXTA 5HJDA 3K4DA 2E8YA 5EC1A 1DN0A 1EZLA 2P5EA 1I8IB 3Q9PA 4AXWA 1MIEH 5KJRL 2ZUSA 3QYMA 1S3KH 2XTJD 3WXVL 1DFBL 5BOPA 2VUYA 1XR8B 3QUZA 4ZMPA 3K6SA 2C7FA 2JIXA 3JUZA 1PKQB 3OSKA 3TZVA 4DT2A 5ABZA 4GKNB 1P4UA 3TN0D 3EYSH 3MFGB 4UCFA 3F83A 3RWHA 3VXPA 3Q3GA 3LPGA 1GRWA 1BBDL 3BISA 1E9QB 1UH3A 4FNLL 4UQAA 5ETUB 2I5YL 4GSXA 3QCUL 5EULV 3ZIMA 1B0IA 4AQ8A 5JUEH 1TITA 5JDJA 1BFTA 3UIZA 3KVDD 3KWWA 2DOCA 1U3HC 5LNGA 3VXMA 1AYOA 5ICZB 2IV9A 1MHEB 2Q2EB 3ZZQA 4U4BA 3SE4C 1MPAH 5JQ6H 3BAIA 3MA9H 2FX9L 4IBLT 3RWFA 5FA3A 2BWQA 4J12A 3ARGA 2ESVB 1O7DE 3MUJA 4PJCA 3X12B 4DGYL 4OLYH 2MTPA 1BQSA 5JXEC 4JG9A 4NDMA 2C9VA 1WFIA 2WWMC 1CIUA 4LLQA 4BZ1L 4XVJL 1EHXA 4PR5B 5A3IC 1ZLUK 1RIUH 1BD2A 1TQCB 2B15A 4Z5RA 1OAYL 3S8FB 4EXPX 1B4TA 1I3GH 1NLDH 4PJAE 1VESA 3IETB 4BWTA 5C2UB 3MACH 3QK0A 5L8LB 2EIZB 4K8RL 3MRLA 4KZCA 2H47C 5ANMA 3B2UC 1MHEA 5LQBL 4ZK8A 4N5EC 3ULUD 2CKBL 4NZRH 3P30H 4WFHD 4FKEA 1OIOA 2D7OA 4PRPE 4NERA 1ED3A 3HOGA 3DMMC 3O4LB 1N64H 3SGKC 5ITBH 3KWVA 3B5GA 1CU4L 3VYOA 1U91A 5FO7B 3MV7E 2AEQL 1S9WA 2FL5A 4B96A 3PFQA 5MHSE 1K6QL 2OW7A 4XBMA 2J88H 3TV8A 1CI3M 3APFA 2W07B 2YUVA 4LLYB 1BOGA 3S88L 1BWWA 4ODVL 4A6YA 4EOWH 3KGSA 4UAOB 4LRNL 4RZCB 5IESL 4BXSV 2BSSB 5E6YA 3KE0A 1Q94B 3DRQA 1DQML 1KGJA 1UD8A 4D0CB 4ZS6C 1DQJB 4K9EH 3LRMA 3VD3A 1JFQL 3VGAB 1NMAH 3G5WA 5F0LB 3OLDA 2KLRA 2DQDL 5ECJE 2WQUA 1WAAE 5GRYA 3VD9A 5GSVA 4PHZA 2BLFA 4NBYB 4PGEA 1AXTH 2PWHA 5I5RA 2PTTA 2UXGA 2DWYA 3CQFA 4UQCA 3RVWC 4QGTA 3MYJA 4IKJA 1MW1A 2R69A 4JANB 5K1NA 5HI5C 3NJXA 2BNQA 2Z4QA 4FG6C 3CU1A 4E9SA 1NAKL 3CFEB 5HYFA 1M4KA 3WO4B 4ABQA 4MYWB 4TQHA 3T71A 1SJMA 3DK2A 4UWQB 4JN2A 5DUBA 3US0A 3GXTA 4OFVA 4EI6B 2ZKWA 2LQRA 4POZD 4YH6A 5BUGA 2A3TA 2NNXA 3DPBA 4GW1B 2ALAA 2VXUL 1I3VA 5DR5L 2Q7YB 4W9KC 3CIAA 5IHUH 4DWHA 1OSYA 4YAQB 1OD7A 4U1GC 3IRCA 1JXFA 5FC9A 1A1NB 3T3PE 4UM8B 1CFTB 1CDCA 2N1KA 3LDBB 3OKEA 1K8DA 2Y06L 4RWYH 2H1PH 1T7XA 5C0IA 5BUAA 1UJ3C 3S5LA 3QDMB 1Q9KB 1PD0A 4X4XA 3ZDWA 2X4SA 2VLKD 1FYTB 2B59B 1N6VA 3PWUA 1E40A 1MDAA 4K71B 3QW9A 4U1IB 4ZSOB 3S97C 4S1DD 1BF2A 4PY7B 5F3HA 2EDHA 2D03L 2XRAL 1D6EB 2JH2A 4PS4L 1G6RH 4PMFA 2XZAH 1QRNB 3KYOA 4OD3L 5SX4I 1AXIB 1RXLA 4YGVB 3VSQA 2FT8A 1A6ZB 3G6DL 2X12A 4MAYD 1T1ZA 1BZQK 2NUPB 2WKOA 4X99A 3GDCA 3FU9A 2F7OA 3NA9L 4NN6C 4PRDB 1XGZA 3FTUA 1IAII 3OKNA 4NUJA 1GS7A 4L2YA 3I75B 1I3UA 3H2QA 3RZCD 3O8XD 3HC0B 1MXDA 1TTBA 1C5CL 2AJUL 3OPZH 3JV6B 1RKRA 2H26A 5C09A 5DZLA 1M7DA 5D7JA 4ELKA 2A6DB 1KJVA 2CO2A 3DV4A 3QUZB 4OJEH 5DD5L 1QO3A 1Z7JA 2QSTA 1HWWA 4PJXB 4UOZA 4HS3B 1AR1C 3HMXA 4Z7VE 3H3BC 2OK0L 2EDFA 4G42A 4Y2DD 4L4VA 4KO7A 1NPJA 3X1GA 3VDBA 2Y7QA 3AU1B 4FQJL 5IB1A 3TJHC 2B1HL 1JNLH 2FD6L 1JDAA 1E90A 5FHAH 1FZMA 4NUJB 1ZT1A 4OD1H 4LBEA 3UJIL 4YZWA 3GD1C 4LP5A 5E2WH 1PX4A 1IEAB 1Z1WA 4B53A 2ZZUT 2VMFA 5IQ9B 3GK8L 2CK0L 2O61A 3MRBA 2OL3B 4ZUSA 4ONHB 1XGPA 2BVQB 3QJOA 2XZZA 5I5IA 3DTXB 4NM8L 2R1WA 1OT2A 1X9QA 3T1FB 5AQ0A 3RVVD 3WNOA 2BW5A 1TZGH 4XODA 1YEFH 3IFPB 1KLFA 1SLUA 3VD5A 2HA1A 3GRWA 4GO9A 4AGPA 2HLFC 5KAQF 3VFPB 4M5ZH 1WT5C 4ODTH 1Z6JT 1A2YB 2DMCA 4JRXB 4JO4L 1T20B 3UH8A 3VGFA 2W0FB 3S37X 3NEEA 4LOFA 2R8SH 2O5ZL 1HSBA 4MJIA 3D87B 3THMH 2RBLA 1DBBH 3LN9A 1R0AL 2Q8AL 2VABB 3ULUL 1I9RH 1MCRA 3MREA 3FDWA 4X80H 4HS6B 3MXVH 3UO8B 3GGWB 2RJMA 4WWKA 1U8QA 3MNWA 3FONB 5D7LE 1LGVA 2AERT 3IRPX 1OCOB 3NJNA 3VFRB 4JS7A 5AW5B 1EEZA 3LKOB 5DUPH 3VXRB 3TASA 2LFGA 4OJAA 1MEXL 4OZGF 4X7FC 5DF0A 4D9LL 1N7ML 3VRIA 5HGBB 1EO7A 2DY2A 3CLEH 4QWWD 4FZEH 5FA4A 4XPGL 1GS6X 3LZQA 1URZA 1I7ZA 1ETJA 3QZMA 3O2DL 4BSJA 1YG9A 2G60H 3A4DA 5MENE 3L4TA 2DLEA 4QXUH 4DOHE 1IT9H 3GRBA 3RUGA 1G0YR 3DBXB 1E9OA 5B8CA 3T3PF 5I6KA 5M94B 3O81A 2BOCB 5L8JB 4C56D 4ZMWA 4X4ZA 5MI0C 2X10A 3TBWA 2YBGA 3JTTA 3PDDA 1KB5L 4X4YA 2VL4A 3LKQA 2C9UA 1RLBA 1BGXL 4P2RD 1MCDA 4ORZC 2IDTA 1L7TH 2A0LD 4LCYA 3M8OL 5B1JC 4PVNA 3BPCB 5FECB 1PZ5B 5IKCA 3CDYA 1PY0A 4HDIB 4WFHE 4P9HC 5T33H 3T1FA 1HEZB 4Z95L 2JK5A 1CICC 3WEAA 4B5EA 3DXAA 1IGFL 5JHDE 3GC3A 1SYVA 5DURD 3O3EA 3VFMB 3H9SB 4WHDA 4RWYL 4D8PB 3BH9B 1YMME 4F8QA 1P7KB 1GJWA 1KGCD 5D7JD 1VKXB 5DLMH 4XCCH 3GRWH 3MLXL 1AG0A 3KM2A 2VXQA 3GXFA 5E24E 4M7LH 2VJ8A 3ZHFA 4IKIA 4JM4L 5AZUA 2HWZL 1NCCL 1UACL 4IRJC 1XX9C 5KBKA 3ZE1E 4BZ2H 3D12B 2CDGB 3ARBD 3QQ9C 2CMRL 1JZ5A 3PP4L 2Y7OA 3BFOA 3BAJA 4TVSa 1PW3A 5AZEL 2YMTA 1HHGB 3ATDA 4G8FA 4N2AA 1YEJH 1JNNH 1FZKB 3LQAC 4B50A 4HIEB 4K94C 1DQMH 4WO0A 4BINA 1O9WA 2A4EA 1LD9A 3BOVA 5HI3D 4AEEA 3RBGA 1FFRA 1W8EA 2BNRD 3D7PA 1LLAA 1F3JB 3C09C 3IU4H 4JKKA 5CLZA 1BIIB 3C60C 3QIBC 4LCCB 5ADPH 1I8IA 3NA4A 4RBPH 3ESVF 2ICWB 3CFJB 3EDEA 2GI0A 3BZDA 3UJJH 5IV2B 2V2XA 2Z34A 5JQHC 2QV2A 3QIUB 3GHEL 4F7EA 4M9PA 1FC1A 2DEXX 3O2WH 2BOLA 5D6CB 3VGGA 1SBBA 4PMEA 2ITDB 2NY0C 1JCVA 2IPTL 2H2PC 3UZVA 3SGEI 3OQRA 4YDKL 1S46A 5ADPL 1W72H 3C5XA 1CF1A 3TPUB 3TZVD 3WLWD 5DK0A 4DPBX 1OAKL 5KSBE 2FR4A 3WV0A 2JCCE 1PSKH 2EXSA 4NUGH 2HG5A 2H6PA 5IW1B 1JN6A 3MX0A 1KFAH 3RNKB 3P3SA 1CN4A 4KFMA 4NQXA 1J0IA 3AGWA 4HWNA 1LK3L 3PYCA 5F0PB 4TRPL 1GTFA 3UTSA 1NIBA 2EE0A 1KACB 1AOHA 2VXTH 4P2QB 2J5WA 1QR4A 2DWEA 3EFDL 4OCRH 4R2GC 4R90H 3VWKB 4BKSC 4Z78B 1QW9A 4CMMB 1I75A 2ZYRA 3Q6GL 1JUFB 2EXYC 3R18A 4Y7OC 3I84A 2B4CC 4JG1L 1F4WL 3D18B 3C08H 3UAJA 3VSUA 3CHPA 4JZJA 1WCBB 4Z6AT 5C07D 3P2BA 4GQZA 4YC2C 1UT2A 3NSDA 2NY1D 4OZGE 4D8PA 3QRGL 2WVSA 3NJVA 5I26A 4WV1C 4F91B 4U1IA 3RGVD 4TOYL 3T1WA 2X4SB 1P53A 4XCCL 2E59A 4WW2C 3NK3A 3SO3B 3AXIA 2BH0A 1W0YT 3NJGA 5BJTB 1DJSA 2FQGA 4L23A 2P5WB 3O2WL 1OCZB 4BIKA 4F7TB 2TSAA 1EVTC 2R4SH 2OMUA 5HGAB 4ALAH 4I3RH 2WZAA 4UZSA 1ZLWH 3ARGD 4J3WA 1X5XA 5HHOD 3WIHA 1EK3A 4R4ND 3GUTA 1HXMB 4S0TD 2GFBA 4DP1X 3F64A 1MREL 4JKNA 5HPOA 1X4YA 4MB3A 2NY4B 1JRHH 4CBZA 4D9RE 5MERA 4BGDA 5I30L 3U4BL 4L4VD 2ENQA 1KTLA 2H4EA 3ISYA 4PFEA 3S98A 5ESAB 2R0ZL 1BD2E 1T83C 2CHXA 5E03A 3O4OC 1NUFA 4APQC 3O9WB 3ATEA 4AGOA 2F53E 3PJLA 4HK0A 1NBVH 2IO5A 2Z93B 5T3ZL 4RH4A 2O6DA 4KDTC 4XXWA 4M00A 5B39G 5LJYH 1EFXA 4GIPD 4JMXA 3ILEA 2VM3A 4N0YH 3O3DB 4WGKA 4M03A 2C4FU 2GTZA 3ABZA 4QOKD 3SY6A 4XE0A 2OZ4A 2JI1A 3TLRA 1BJ1H 1HDMB 3DHMA 3P3TA 2MFNA 1L5GB 3RGHA 1GYWA 1RUKL 6PAZA 1H3PL 3FFOA 1KZYA 4YHLL 5CJQL 2GHWB 4LSRH 1E43A 1D9KA 5EO1B 2JQMA 2I9TA 2R0KL 5I0VA 1S5HB 5DLML 2X4QB 3QUYD 4NENB 1CDIA 4KDWA 2Q87A 3ZUCA 1QSEE 2P8PA 5IW1A 2QGBA 4Y4FC 1AZNA 2BFVH 4KHXL 2XKSA 4RGND 4HJEA 1A6WH 4YBQC 1JWSB 4ZUWB 4D94A 1W91A 2LTQB 3BIKA 3ARQA 1RHHA 3HZ3A 2EIZA 5D7HA 4Z95H 5E6IB 3UZQB 3L1OL 5F72S 3F6JA 4ZAKD 4P23A 3N1QC 1H6FA 1A3LH 4IDJL 4MAZA 2X4PB 2XN9B 3HE6A 3PRZA 4N5UA 3APDA 3HZYB 4BYHA 1AVAA 4UTCA 2UZIL 2A77H 1FPTL 2NTSP 4O02H 1TZGL 3PL6C 2MOVA 2P5EB 1NJ9A 3I85A 1IFRA 3FTXA 4HUMB 4KO6A 5J6HA 4KQ3H 5FV2A 3S35H 3FOLB 1TU2A 2GJZA 3DUUB 5TF1L 1BAGA 1VEOA 2YPLD 4QEGA 4YS4A 1SHMA 5FYJD 3O9WC 4P9MH 1R3KA 3ARBB 5HJGA 1FL3B 3DOSB 7FABH 3N44B 4D0DB 2DLFH 1MFEH 3WTUA 3D3VB 1PF3A 2BS71 3GMMB 4IU3B 3WEBA 4JFFD 1XH3B 5CJOL 4LVHC 4K3EL 4PJ5E 2X5PA 3ZZSA 4X7SL 4AYID 5DSCA 5SWSA 2M1KA 3HE6B 3UACA 4XB7A 4H8WC 4FF9A 1FP5A 4HJUA 2E5EA 1NBVL 1VFMA 2GK0A 3QNYA 2CDGA 2MPAH 3R4RA 3LHPH 5PAZA 4JM0A 1ET5A 2H26B 2UXFA 3VSTA 5F7EH 3UFIA 5L4FA 1UZ8A 1OGTB 3CFDB 1FIEA 3M7FB 1E65A 5I1AA 4PJ7F 4O51A 2WMPA 1FYHB 3NJKA 1RJZA 3REWB 4CDHA 1T03H 4P46D 4QR7A 4LARH 2ZSWB 1T7WA 4HJGA 4C4KO 1H5BB 1JXDA 2I9TB 3EDDA 4Q9CA 5K39A 2X9XA 1QTYT 2WVVB 2R1XA 2AP2A 2R0WL 3D85D 4KJPD 1E4KA 5EO0B 1E28A 1L3WA 3IDYC 5CNHA 2CXKA 1FNFA 2R2HB 5D2NC 3V4PA 5I71C 2VZOA 1KTDA 3HS0A 3MLVH 1A6TB 3NZSA 5IKCB 4KKRA 2P8LA 2HKFL 3C60A 3ARWA 2BOBB 3EIFA 4G6JH 3M17A 2A7BA 4Z7UE 1WBXB 4ERSL 3FZUC 2R2BA 1ACYH 4KHTL 3FQYA 2NMSA 4QRRD 1XDTT 4HC1L 4PJIE 2PF6A 3ARUA 3SYPA 4DAGL 4LL1A 3I6LD 4WK0B 4KK5D 1AHWB 1U3YA 3ROOA 3VA2C 4K94L 3NIFB 1J0YA 4ODUB 4L9LA 4NRZB 1W8NA 1IIKA 1E4XH 4PJ8B 4X7CC 3ZVVA 3FMGL 3O6KH 3DX7A 3WL9A 4OFDA 3TCLB 5F7WC 1XGRA 5T1KA 5KZCD 2ICWJ 3GUTB 3CBJB 3CVHA 3P0YL 3HEIB 3GPSA 1KTKE 2Q0ZX 1QNZL 2W8CA 4MMZA 4HUUA 2NNCA 4LQ1A 2V2WB 1L6ZA 1XZWA 4PS3A 3IFOB 1K5NB 2FQDA 3QXTA 4FXKB 4JKPH 5LDSA 3VQ1C 1B6UA 1GOFA 4YMPA 5IK3A 3B2MA 2FLBT 4AWJC 3KXFD 5I1IH 4W70A 3FU5A 2JXMA 2O6EA 4YQXH 3DMMB 1T7VA 1T5KA 2WBKA 3TBSB 1RUQH 2MH4A 2Y3AA 1WCQA 1JHTB 3KYKL 1SUJA 4JY5H 3RA7H 4HOXA 1LO5A 1N10A 4I2XA 5EZIH 2X6AA 3MQIA 2IOIA 1YN6A 4JFSA 4JQXC 1EXGA 1NA8A 3FT0A 5AZ2L 2WO2B 4PJGA 2XV6B 2YUXA 3VXMB 3S88H 4QRTB 5CU5A 3NFSL 3K2IA 1Y6MR 2H9GA 4MBRA 5DC4B 1M56B 4NNYA 3FTYA 3V0HA 1BQLL 3GIZL 5EN3A 4AMKH 2XNAA 2PXYA 2JKIS 3LPWA 2VXSH 4PREB 1QATA 1VGKB 2VMEA 5BZWB 3VMNA 5GRVK 3I6GA 1GC1L 1OARL 5C0AD 1SVZA 4HUXA 2D9QB 4UTAL 1NPNA 4WNQA 3RKDD 2PPAA 4UUJA 3UTZB 2QSVA 3DGCR 2NT0A 4PWEA 4AMXA 2N7AA 4H8WH 5D4IA 1X7TA 4CVXB 3WIAA 4KO5A 1HQRA 3RGVA 3GTTA 4LASL 5C2BH 2C9RA 4NLAA 5DWPA 5B3NA 5K9JL 5LXGL 2H7WA 2YARA 5AW4B 2IBZY 4DKFH 3ASWA 3TIDB 2YD0A 3CDGB 3FCBA 4Y9EA 3T8VA 4LPCA 5DGQA 4KTGA 1IIIA 2F54A 5AYQA 2A6JB 3RURA 2R2CA 3N55A 5TDPA 1D2PA 1MFCH 4J2XA 3HG4A 5D1XA 5J1AB 1H3TA 2HMIC 1UD4A 5ABAA 2QFRA 1KV3A 5ISZB 2XXGA 1QWHA 4LVNC 3TH2T 1DO6A 2ZWKA 4XBGB 3T65A 1KYUA 2OMZA 4JUTA 2H8PB 3VX0A 2A83A 3MUZ1 2VAAB 4JY6A 4YNYB 3SBWA 2CIIB 4H88L 5DMGD 5DQ9B 2FYYA 5C7XH 2RR3A 3GTVA 3IDXL 4OT1H 3BJLA 2GJJA 3ISRA 2J8UF 4G7RB 3DDGA 3K1DA 5KW9L 2L8AA 4BDVB 4MVBD 4QXUL 1IGCL 2BVOA 3HZMB 5T5FL 2DL9A 2DKUA 3JVGC 3O4OB 4YFEA 3L5WB 1DANU 3L16A 2OMXA 4LRIC 3QWOA 1G7PA 1KXHA 3FQRB 2ZCKH 4PB9H 3KDMB 5D1XC 3QQ3A 1V3KA 5KSBF 5KTEH 1MCOH 1LVEA 1QHPA 4M4RA 1AGEA 4R8WH 2QZ5A 4WJ5A 3DXAB 3MUHL 1AD0A 2YD9A 1CG9A 4XNMB 3FT4B 1LDSA 4QYOA 3O3EB 3UTTA 2DYSB 1U8HB 3NIGE 5C0CB 4PJHA 5DQ9A 4FKKA 4TNGA 4MS6A 3WNKA 1W0VA 4X8JB 2I25N 4JQIA 4A7UA 3MA7B 5BO1L 3MJGX 2ZUQC 3D2UB 4EIUA 2VERN 3U0PB 3K8KA 3GRWL 1IGML 4EN3B 3L1FA 1MVYA 4IIQA 2PMZA 1B9KA 3H6JA 3J7HA 1WBYA 3IS1X 4NQCA 4O58L 4TUOA 4U2YA 1TCRA 1J5OH 3QQNA 1X5GA 4N0CD 1JZDC 4LVNB 4PV8B 4LAQL 4YWGH 3QQDB 5IMOA 1QI5A 4B9CA 2RFXA 4PJEE 1FCCA 4MDJB 4WFGE 3QUKA 4UI2A 4PJHB 4Z7VA 4KK5C 5KJ7E 1HKLL 1TZIA 2P5WA 1ZHLA 4BZ1A 3AXLA 2X53A 1RPKA 2FBJL 5HYSG 1EJOH 2EDTA 4JRLA 5KYWB 1OZTG 2X2IA 4GW5A 5LG6A 1X4ZA 1J10A 3HRZB 4X0NA 1LNUA 3JWOL 2F19H 3WG7B 3KLDA 5I1LB 1OTTD 3V2AR 1BPVA 1RH8A 4KKAC 1TXKA 1LP9E 2C4XA 3EKCA 5SWZA 4PCKA 1EZSA 1U8OA 4I1RA 5DEFA 2YJQA 1KIQB 1PFCA 2XWCA 4LSDA 4FTVE 1F02I 3CH1B 4PCTA 1Z2KA 4KUZH 1IQWL 1RUAL 3UBXI 4JREB 3ZTEA 2OMWA 1OGTA 1J86A 2BY3A 4CNIB 3T0ED 2K78A 4FQXD 4ZD3H 5GZNC 2CGZA 3KPLB 3H54A 4GG6F 3QJQB 2WJ5A 3HR5B 3MXWL 4XHJD 3J07A 3ULVD 4M8QA 1NH6A 4FHKA 3WKQA 2AC0A 1JPTH 2IBGA 3RTLA 2WXPA 1J1PL 5KVMC 3K81A 5F8QC 4K55A 3QDJA 5DEFB 2VQTA 3IPFA 1KIPA 3KEHA 1IGJA 4BK5C 4ZUSB 1ZSHA 4HGKC 2I69A 4JFEB 5IM7A 5IGXL 2C9SA 3VG0L 2XTJB 3HW7A 4U31A 1I1YB 1W72A 3W9EB 1LE5A 3L3OA 4AK1A 2IAAC 4F2ME 1UENA 1A14H 3J2PA 1UM6H 2MKLC 5EOTA 4JE0A 2BCKA 3WY4A 1Z5HA 4LGRB 1JHKH 1UWYA 1Z9SB 4I2XE 5F1NB 4Y4FB 5FIEA 4E0RA 3FHAA 2CR6A 3IU3A 3TF7C 2YN3A 4LZKA 1ZHBB 3BAXA 1CT8B 3T4AC 2H1XA 3IF1A 4XMTA 1I8KB 1PGRB 1TYRA 2DQTH 3K6SB 4I9XA 2GUOB 3SPVA 5JHMA 4NC0B 2DH2A 4ZOCA 4XVTH 5DRXA 1CYWA 2YKLH 4YSPA 4GQQA 1FN4A 1RZ8B 3U79A 3MUGB 1U2CA 1NC2A 1NGYB 2J8OA 3BIAX 1Q9WA 5GS0L 2Q10A 5FCUL 4NQUA 4U6YB 4W9GC 1G7JB 1WD8A 1W0VB 2AVGA 2OP4H 2ADGA 3GXIA 3T6VA 4LPXA 1FH2A 4HQQH 1L9MA 3QG7H 4NQVA 1QPXA 4A2LA 4JHUA 4QRUA 2F53D 2D0GA 4FABL 2XETA 2J20A 3QO0B 4L8SA 3UBXG 1FL5A 3ATAA 1CD1B 5JORB 3BZ5A 1WGVA 2E56A 3FB8A 1TQWA 4AV0A 4OZIA 4P23C 3CZJA 4X6CE 4HXAH 4L1HA 5E6ZA 3N06B 4QOKE 3CGTA 2H0EA 4QTIH 5H8DA 5F3HB 4PB9L 2WVUA 4NP9A 2EZ0D 3CJJA 2K6YA 2XTJC 5DDHB 5ICUA 5LCVL 2GEQA 4MNHA 2WMPB 2O6CA 1AZRA 1FE8H 2BVOB 2CHDA 1YJDC 5AUMA 1XF3A 1JZGA 2Y22A 4FI7A 1ZAGA 5CFHA 4ODVH 2VH5H 1QUPA 4XTRC 4EOWL 3F62A 4PWHA 1ZY9A 4F9PA 3C8KB 4HIPA 2IV8A 2PABA 3AGVA 2HYMA 3PWLB 4J3OH 3NH7H 4P5MB 1SOQA 1KG0A 5IJKA 1HWHB 2OR8A 1JYXA 3UAJD 2GK2A 3QARA 4OI8A 4CMHC 4QD2E 4TUKH 2HRLA 3H9ZA 2VT0A 5ESVA 4HZ1A 2NYYD 4OZIB 1HHIA 4YDZA 5E4OA 3RWCA 1ASQA 2NZ9D 4FA6A 2I32A 3QULA 2JKRM 3IDYB 2AQ1A 3NZ8B 2QPFA 4O2FB 2D73A 4XPHH 4NUMA 2XPZA 5EUOE 4LCUA 4XWOC 3ILPB 4JKLA 4LHJB 4OD1L 5DQJA 3DYMA 3QR1A 3RWGB 4MJIE 1SVBA 4HZLB 4NGHL 5EBLB 5FO9A 2WWMD 1CC3A 4PJ9C 5D5MB 1YEDB 1JVOA 4APXB 3CDGA 3G5VA 1NCNA 3L3GA 4BEIA 4UB0L 2V5MA 2R15A 3O8XA 5GS0D 4DP8X 1I85A 3ECWA 3HBGA 3MUGA 5BO1H 4G80B 4L8DA 4NOBA 3U9UA 3WLBA 4RX4D 4LSVL 3NSYA 2VYRE 1Y0LB 1QEWB 2FIKA 4JGMA 4OLUH 4OUOA 4XN5A 3V4PH 3BWZA 3FN9A 3OKLA 5K5YA 2F18A 1OAZL 1AC6A 2MJWA 4W9FC 2PWDA 3FU6A 4FFWD 4K0OA 5DT1L 4YDNA 2C3VB 3QJZA 4IHBA 5FW6A 1GYAA 1P5VB 2BERA 4PJDE 2ZOUA 3ZKND 3ARFD 4AIXA 3AM8C 3QUGA 5B1BB 1V27A 1WBZA 4UT9L 4X6DF 3AACA 1HILB 3VO0A 5I2IA 2WZ6A 2CIKA 2NY5L 5FK9A 2GJ6B 1VLXA 2D7TL 1SPDA 5DD1L 4ZFQA 1IGYA 1N5YH 1RZKH 1TTFA 4Z0BL 4PGDB 5DMKB 2EO1A 4OQTL 5D6CA 3ARFA 2EYSB 1CQKA 1OB1B 4NZ8A 3IFLH 3GMMA 4PLOB 4OB5H 1QTSA 4MGXA 1MLBA 1EXUB 4FQXC 2VNCA 3L7FA 4JQIL 2DM2A 3D69A 2CM6A 1KBGL 4R7NA 4N2KA 3VW3H 2IALA 1NCWH 3BEVB 3GS7A 3ZW3A 2FSEB 4OLEA 1Q9KA 4FQPA 1BMZA 1RURH 2BMKB 1LK2B 2GJ6A 3A22A 5J56B 2ZKMX 3MGOA 1FIGL 2FWSA 1F1GA 1EHNA 3GSNH 3VXUE 1TDQA 4NKIH 4JE4B 1E7UA 1BLNB 1PCXA 2CGRH 1M7UA 4ZYKB 4BQ8A 4XCFL 4LAJH 3ARYA 3QORB 4NQDB 1E8YA 5BVPL 2D7PA 2YC1A 4M9OA 1PKQA 2A74B 4ODWA 4W4OC 4FOMA 5AWNL 2PPCA 5DTFB 3E1F1 3GHBL 2JTDA 3RWHB 1KG0B 3SOBH 4DIXA 5A6IA 1NAML 1NBZB 2Y1YA 4XC1L 2L04A 3WEXA 4HIIB 1MSPA 4X9FA 1NLBH 1N6QL 5FO2A 3SO3C 4LCIH 4AMKL 1P7QB 3PLYA 1CICB 3KPSA 3I9GL 4H8WL 4DPCX 2NY3C 5KWYC 4RWHA 4B9IA 3JWNE 3LS5H 2XOTA 3HI1B 2EDBA 5T5NG 5AW7B 4GUQA 5EU3A 4Q6IC 2A9CA 5CD3A 5GRJL 3FQWA 5T1DH 3NP3A 1VZGA 4NQQA 3JTSB 4AEIH 1Z66A 5C6PB 2KBGA 4RGMC 1QZ1A 3S5YA 1YMMD 4J3OC 1MFAH 4GKSB 3RL2B 1MZZA 4BK5A 4AJVA 3AAZB 2ODIA 3UOAB 1UM4H 1ZWIA 4AZ8B 3D4CA 1FVCB 3FUMA 4WW2F 4KTEL 3CVIH 3PP3H 3QJUB 4PIBA 4Y4HC 4B6ZA 1G7HB 5EF1A 3PDOA 2H5UA 2KYIA 3RGVC 5JHDA 1MQKL 5KSVA 3WTTA 1FZOB 1JF1A 5SV3A 3FF8A 4NJ9H 1GGIH 3PIQA 3QEQA 4NQXB 4OKVB 3QDGA 3WMQA 4HJSA 5ANME 5DA0B 3ZT6A 4AZUA 3I6KB 3ZTDC 1FLRH 5IBLD 3MACL 1ZT7B 3MI6A 3CFDA 5KSAB 2DL2A 4AKQA 4DN4L 2IXQB 4HEPG 3G6AB 3DUSA 2X3CA 4OZHB 3MRNA 3RPBA 4A7GA 3L2MA 1JWMB 3H3PH 5D7LD 4WJ5B 1BQHA 1XZ0A 4UNIA 1RK0B 4Y5YA 1PG7H 3QDAA 2ADJB 1A7OH 4XHQA 4LU5L 3FSVA 5I1KH 3CLFL 2MKWA 4AT6B 2DWXA 5DEJA 3V0IA 2WINA 5FKAA 3MRFB 3UPRB 4IU3A 1GHFL 5AALA 1HQ4B 1NCGA 5FR3A 2H32H 4PJCB 1VSCA 1DVTA 2XWDA 4ZUTA 4UTAA 4ZFFA 1NCCH 1EMTL 3S3CB 5BCAA 3EJZC 1MRCH 7PCYA 1KC5H 1IC4H 2FHCA 3TOPA 4G9FB 5F89B 1WC7B 1HYSD 1MVFA 4ZO8A 2MNUA 1BBDH 1FZJB 1MJUH 5CR1A 4YBHA 1JUFA 2H8PA 4PIRF 2AQTA 5T3ZD 3TA3C 4XVOA 3SQBB 4HALA 4K3HA 5I8OH 4IK7A 4P2OB 1DBML 1VGEH 3BP7B 3K2UH 1T20A 1IGFH 1TCMA 2V5YA 3HR6A 3TCTA 2XVGA 1UFUA 2VITB 2R69L 1ML0A 3GSUA 3EXJA 3L1OH 2BMKA 3IU3B 4JDEA 4CNIA 1DSWA 5D9SB 3AQZA 7TAAA 1AQ8A 1NBQA 5T3ZE 3VMOA 3GZKA 4KROB 1J88A 1BZ9B 2ZOLB 3FCTA 4CW1B 4Y5VA 3MV8B 3WS6C 1KNOB 4NO0A 2CO6A 1C16B 2J6WA 1VADB 2DIEA 3ATBA 4H7VA 1DN2A 1PLCA 4P3CH 2P52A 1ZVSA 2J1YA 3SPHA 4NRYB 4CILA 5HYSB 3N1GC 3G04A 4JFDA 4U7SA 3GSNB 3VGHA 3ULUF 2WXQA 1IGYB 4PLKD 3WJJC 4LQFL 1ZPLA 4UDUA 3TYFB 3AC0A 2RTTA 2NXZC 2IH1B 1QNZH 3VD1A 4XVSH 2ICEA 3ABGA 1KJ3L 3HB3B 1ZGLB 4DP4X 2A1WL 1S9XB 5CKGA 3Q13A 1G84A 5C9JA 5IQ7H 4P4KA 1LO0L 4GRLA 2HVKA 3MV8A 2YQ2A 3IBOA 5AKRA 2VQ1B 2ED6A 1DVSA 1UGKA 3CX5K 4TV3A 4PQXA 4BFJA 5D93C 4PSRA 3QRFM 3W82A 3VWJB 3MXVL 4ZFOA 4ONGH 3F00A 3HUJE 3MV9E 4PJIA 4H88H 4G8GE 4M5YH 3BZFB 2VIRA 2WNXA 4YHPB 5HPMB 1F1DA 4WK2B 2R1YA 5E00B 2D4FA 5F96H 4AM0Q 4F1SA 1QBLH 4A38A 1G6RL 1Z9OA 1OQXA 5F89A 3B5TA 1H3UA 3B2XA 1KSRA 5EU6E 3VRIB 2C4FT 1N19A 5T3XD 1YVLA 3EYVB 3KLHC 4PWJA 2GTQA 3BC9A 3CFTA 3VSVA 2R0WH 2VGLM 4IEFA 1TKWB 4N2DA 4GRMA 2A9NL 3ULSB 1E5CA 2MQGA 4WWKB 4O2FA 2ROXA 5CMAB 3ECBA 4U1HA 4MAUH 2E7BA 1HJBC 4PRHA 3MLRH 4UILL 4LSUL 3KPRE 3BFQG 3QHZL 1A7RL 3C6LC 2Q1EA 1XZ0B 2N01B 4G83A 2JCCF 4KJPC 1IC4L 1H3PH 2JB5H 3AG1B 5I6MA 1CF8H 1O6SB 5CUSH 4CL7A 1MHCA 2P5PA 4G8GA 3OZ9L 5EEZA 3GMOA 1U36A 3ARBC 1CVSC 2N1TE 3UYRL 2R4RH 5I75C 1DSFH 4S10A 3DOHA 3CZKA 2LAAA 2E7LA 5AOIA 5HDBB 3COOA 3L1EA 4H8UA 2EIKB 3PY9A 4G5ZL 3HBQA 4RGNE 1E6JH 1R3HA 4QXTA 1CDHA 1G9MC 1JF1B 1FZOA 2OPCA 4KRNA 4ZQKA 4P4RB 4KUCF 2BOCA 3FT2B 4PH8A 2BP0A 3PNWB 4PS8A 3B9KD 3H1ZA 1H9DA 2XPGB 3ABMB 2GAZB 1PJ9A 4QYOB 3UTTB 1PMYA 4XP6H 2P43B 5CJBA 2WNGA 1G43A 3HE7A 5TD4A 3MRKA 4PLJD 5L4IA 3QWNA 4KK8C 5LGJB 3IGAA 3KHOA 3FQWB 3CFCL 2O5NA 3MOAL 3RVUD 3GM0A 3SBRA 2BHFA 2GJRA 1CZ8L 3WSQH 2ICWA 3LKPA 2B14A 2YEVB 4YR6B 5E6SB 2HFEB 1TTCA 4CVXA 2Z91B 2X05A 4PBXA 4AJYV 5ANHA 4TLKA 5EUKB 4Z0BH 3ZSSA 2ZYHA 3O2VH 4QRPE 5L2KD 2CHNA 3DC0A 3QCVL 2C9XA 1X5JA 1EO5A 1KPUA 3MU3A 5DD1H 1DYZA 4GIAA 4N0UB 1F11A 3CG8A 2QBWA 1BW8A 5E4EB 4KZDH 2XWXA 4I8DA 3IDGA 1HNGA 3GQFA 5B7FA 3IJHA 1YUHA 3RVTD 1A7PL 1PTZA 1YEJL 3VRLF 5KN5B 4HPYH 1WHPA 2CCVA 1I7TA 4JFPB 1A2YA 4Y89A 4LPVA 1MG3C 1A7QL 4LNRB 4K5OA 4CC4C 3KDPB 1C1EL 2E46A 1DDHA 2DQHL 4UQ3A 2YPVA 5IMLB 4HKBB 2W9DH 4MA7H 1NSNL 3WFCH 4MCMA 4WSKA 4ENEC 5LDUA 1P0SE 3GNML 3I74A 4KGJA 2Y2WA 4HH9A 3OG6B 1HHJB 3NACL 3ZQ9A 1HSAA 1NC4A 3MAWA 5JUEL 4UB0H 1E2ZA 3ARDD 4QRQB 1BQLH 4N8CL 4TULL 1R5VB 3L4UA 3HCVB 4Y1AE 5KYXA 3BYTA 3N1PC 2B0SL 4XZ4A 5CGBA 1ZT4A 1S4IA 1FHNA 4NC2B 5D1ZC 1HIMH 2DQIL 5EA0H 4EPSA 1ZRUA 4F5CE 2IBBA 3ZRCC 2AJSH 5EU4B 4MAYC 4NO0B 2WQXA 4L1DA 3FAWA 2Y7QB 3AU1A 4Z7UA 3MBEA 2LOEA 1ZV5A 3ARDA 1MCBA 5BS0D 2KLTA 4PW9A 5DC2A 4ALAL 1E9QA 3LH9A 2WYHA 3T2LA 5I0YA 3RY4A 2XFXB 1OM9A 1JYVA 1RLWA 1P5VA 4PJFE 1HIML 4CSSA 1YDPB 1AGCB 4Z7QB 4YDLB 4G7VL 2CXGA 3ULUE 4N8PA 4U05A 1KPRA 1XWVA 3RDTC 3V6OC 1CURA 1M2OA 1Y18B 4ODBD 3EJCA 2VKWA 3LHAA 1U2YA 4ECNA 2Z91A 4NWTL 3PAZA 1I8AA 3GS0A 4PGEB 3AY2A 5CP7B 4OY9A 2HT3C 1N64L 1RIHL 1RZJH 3KEDA 2QPUA 1KGCE 3DA0A 4OU3A 4HEME 4PRDA 1NSNH 4Q4IA 3SQOL 1CI5A 2QTVA 2X70B 3FU3A 1CWVA 2Q6WA 3OSVA 2AW2A 5I17A 2J44A 1AANA 4JO3H 4MJID 3ASNB 2EINB 2YWZA 2ZXDA 3MNZA 5DQJB 4HUUB 5AVXB 1VHPA 3RWGA 4JFPA 3KNBA 2YO3A 1I7UA 2BIMA 4R2GD 3UPRA 1JGEB 2DMKA 2WINB 3HC3H 3EBAA 2RQEA 3BHBA 4ZOEA 1XB8A 4UQEA 4X80L 3RTQC 3FB7B 3GMLB 5ISZD 1KENH 1KTJA 2AV1A 4HD5A 5ID1B 4HC1A 2QT6A 4UQDA 4Y4FD 5ESQB 3V6ZA 4BRJA 4TL5A 4WHTA 2GVYA 4F8TA 1GAFH 5LNDA 2PYEA 5IEHA 3AU0A 2ZUXA 3EGDB 4AVIA 5T33L 4KMTL 3RNQA 2UUDK 3PL6A 5IB5B 3LD8C 1MI5B 3KYAA 3U0TA 2EVIA 3BH4A 2WXJA 1WVZA 1PLGH 5AB2A 4BFEA 4JFZL 4Z8FL 4XCEA 2X9ZA 1B0RA 1DJYA 4LOVA 5F6IB 2AV7A 1FORH 3UERA 2OCJA 3DX1A 4FFZA 1IAKA 5EIIA 3LKSA 4FFYA 1D5RA 4MDRA 5HTSA 4LPUA 5FYJU 5JYMA 4MB5A 5I8KH 3CZEA 5IVXA 5DC0A 1NGXB 2CPUA 4ONFL 2X0WA 3MJ9A 2J5LC 1JZHA 5FOBB 2X7LA 3L9RA 2CNZA 4HFUH 4K2UL 1D5BB 4HIHA 1FVEA 3QZLA 4K3EH 1DSFL 3CSFA 3B7YA 4UQ2A 5LCVA 3INUH 1RZ8A 1BOGB 1OAZH 1MH5A 2OMNA 3OX8A 4AG4L 1Q1JL 3BZFA 4YHPA 2VUKA 3QB7C 1E8XA 4WFEE 2PPFA 1OTSC 3T4YB 2DD8H 4A7TA 5F3BB 5TK2A 5C9KA 2Q8AH 5F1NA 4F15C 4E0RB 5IJKC 4P46C 3TN0C 3QIBD 2K0RA 1E7VA 2R8SL 1SOXA 3WIHL 1R17A 4RCAA 1I3RB 3BW9A 3FPXA 1LO3L 2XKNB 4H44C 1JL8A 1IAMA 2EIJB 2R29A 4NQED 1QASA 4KJQC 3IDMB 4WW2A 4ZUVB 4ZDHA 4Z7NB 1YEGL 2IDFA 1KCSH 2A0LC 3MNVA 4MHHG 2J56A 1TU2B 4X9GA 5J3HD 4HCRA 4X99B 2J8UB 4LLDB 1HDMA 3EJTA 3OKKA 4JO4H 1U8IB 4QRAA 3Q2NA 1WZ1H 3IKCA 1VGKA 2EDNA 2CLVB 4LEXH 3QHFL 4NQEE 1UHVA 1UM6L 2AXHA 2VSKB 4YSUA 1XTLA 3SDDA 2XWBA 2V4LA 2LLLA 3T09A 3PWVB 4N5ED 1BP3B 3TNNA 3ULUC 1Q0YH 5IMLA 3V0FA 3FH7A 1LDPL 1Q0EA 1O75A 2Z31B 3NCWA 4JRYB 1IAOA 3N41B 3SYOA 2VLRD 2VXTL 4I0KA 4G9DA 4Q9BA 5E2JA 3QNXB 3O41A 2DPKA 2BVYA 4WWPA 3BP7A 4X9HA 4DP6X 5AAWA 4AE0A 5CILL 2Z92B 4Z7WE 5D4JA 4YUEH 4O00A 4IKLA 2OJEA 2GFBB 2VLLA 4KQ4L 1NMCB 5FHAL 1AH1A 5AW8B 5B4MD 3MOQA 4EBQL 4K8RC 4K23H 3WBDA 3EG9B 1TLKA 3FCUB 5FFOA 1CE1L 5TK4A 4GUPB 3EBGA 4H26A 5TJWK 1D5MB 3MYJB 4A66A 1UURA 3GHPA 5E0FA 4P3CL 4QHMA 3L3DA 4HWEH 3HVDA 3V4VH 2ARJQ 3UTOA 1TT6A 5HDOA 2X28A 2F15A 1UD2A 4HUWA 5DJ6B 4RFOL 5F7LB 3S35X 3T0EB 5IMOB 2NY2B 2FB4H 3OGCA 4W6WB 3QUKB 3WOVA 1ILSA 4HJ0C 4WKXA 4FG6D 5E8EB 4GW4A 5GRUL 4P5SA 3D09A 2WXFA 4QHLB 4I87A 2EABA 4P9HL 1S3RA 1PEZA 2OSYA 1UGNA 3PGCB 4P2OA 4PWIA 1Y1UA 3FT1A 3O3BA 4FJ6A 1RPUA 4GXUN 4XNUH 1AYRA 4JFUA 4IMKC 2PTUA 5ESVB 4UDTA 1TLMA 1OF2B 1G9EA 5DD3L 1FZJA 5JIHA 1IQDB 1OGAA 2WYIA 2Q5BA 1FF5A 4OFYA 2X7LB 3VXUD 2OQJA 2Z4TA 4XVUD 4JHVA 1U8CB 4WO4A 1YQVL 1FLTX 3WHE1 4P4KC 2HG0A 3JWDH 5F1SA 1QKZL 5ICXA 2JIXD 1AIFB 1W9XA 5C0CA 3APMA 5FCSH 1T6BX 1JJUA 3EBHA 2DQ6A 4HFWB 4IHOA 4PW3A 3FONA 4PN6A 1H8SA 5GGRY 5KS9A 1WK0A 2EO7A 1NLDL 2WVVA 3CLFH 1INDH 1KB5A 2AJ3B 2ITDA 4GKOA 1N70A 4WUUB 3QJHB 4PP2B 4ZX3A 4GG6B 2ZG2A 3CZNA 4A2EA 1FFOB 4J27A 1INQA 4WFGD 4ESKA 4LSSH 2H6OA 4CN4A 5IHZB 3KH3A 4X9YA 4NO0D 3LQAL 5EC2B 2YBRA 4AENA 2NXYD 4GSUA 1J0JA 2D3NA 2AEOA 4CC0A 2VDNH 3S3DB 3WNLA 1NEZA 2PCPA 2CJUL 4M02A 1NAKH 4W68A 5EDXA 3WYRA 2AKRA 2JLLA 2QSQA 1MRFH 4YDKH 3BVNB 1J87A 2H32B 4ZO6A 3IT8D 3PIQB 3QEQB 4M6OL 4OKVA 1SDDA 4LVEA 4JO5A 5J12C 5I66B 3HMWH 5ID1A 1T1YA 1WISA 4K7PX 1USQA 1U3JA 3T3MF 4P0DA 3MO1B 3F7KA 4IU2B 1AMXA 3GIZH 2I5YH 5IB4B 4TXVB 4WLCA 2C3WA 4XI5C 3S36L 1SHWA 1W8OA 3B7RL 4MMZC 4U1MA 5DHMC 4NC1C 3AMKA 2XXCB 1U8NB 3ME0B 2OL3H 4TF4A 1X4XA 3L4WA 1ACZA 3BVTA 3LY6A 4HG4K 2EYTA 3ZMNA 4GKZA 3I3EA 4G1MB 5C3TA 4EZKA 5E2UH 1NDGB 4BKTC 5D2LB 3RY6C 1T21B 3DBSA 1NTDA 4Z3HA 3Q8AA 1KJMB 3VFOA 2XKNA 1IUZA 1JNNL 1UZ6F 3RGVB 3OWRA 1EHLH 1EHKB 1YEKH 3FUNA 4XWGH 4Z3IA 5IW6B 3RI5K 2FGWH 3BZEA 4LAQH 4X98B 4YWGL 5TGBA 5FF6A 5KG9A 3IAPA 4PRIB 1IKFH 2B4CH 4TNWK 2WBJA 3ULVL 2Z7UA 3NN8A 3OLGA 3O4LE 1JBJA 3IXAA 1G1YA 2X1XR 3SKJL 2MCPH 5EBWB 2VZ3A 1S9KC 5I5MA 4L9LC 4WNQB 2WP3O 4K8RH 1A6UL 3NG5A 2DJSA 3F01A 2HLFD 1X5IA 5DFWH 2D7QA 2H3NB 4LCYB 1A6UH 3OHXC 3RLSA 4HIHB 3NFNA 1RIUL 1F56A 1N5AB 5MI0B 4LSUH 3B6SB 3RVVC 5KVGE 3AWGA 1CLVA 3Q5OA 3S3SA 5FWQA 2DRUA 2K8QA 5FFLA 1EAPB 1IAOB 1CGVA 2F5BL 4BCYA 3KPSE 4PVMA 4Q6IA 3ZJAA 1HL5A 4N0CC 1CDBA 4ODTL 1I1CA 4ORGB 5EC2A 4OLYL 5I74C 1IFHH 5LG1A 4XNDA 3MLWH 2SODB 1I1RA 2F58H 1AY1H 5SWQA 1DE4A 3V0WL 4YXLL 2WLHA 3FK3A 5A1AA 4M6MH 4LVOB 5C0RH 5JW5B 4OZ4B 1BVNT 1G9HA 1A6AB 1MCLA 3C8DA 5EN2A 5G5DB 1QPPA 4P2AA 2BHYA 1DFBH 1M2VA 3LKNB 5CCJA 2CAKA 1XSIA 3PWUB 3BN3B 3AB0B 1NCUA 3B3IA 1K5NA 1MIML 4FXKA 1HEZA 1KCUL 2EP6A 3GYRA 3VTAA 4QXVA 3D0AA 4IBSA 4BKLB 4J3XA 3HJEA 3AXLB 1OE1A 1PYWA 2PR4L 4ZT1A 2FNBA 5JDSB 1IM9A 5CS7A 2XZCL 5MERB 1UC6A 2QLYA 5ITBL 4I5BA 5ILTL 3CXHJ 1DEDA 1JPFB 4XMLH 4FMVA 2YJLA 3TH4T 2CKBB 3BVXA 5CFAA 5IVOA 3MRNB 4QUOA 3L1GA 4HKJA 3FB7A 3CFKA 1R6VA 4IGBB 1YMHB 4XNQA 4QTHB 3G9AB 5T3XL 1LE9B 1JD9A 2FRGP 1E5YA 4G7SB 4X6EB 4NFBA 5I1EH 1ETA1 4KJYB 3E3QE 3ZR6A 2E47A 3KPRA 1QRNE 1JHLL 4DW2H 3ZIYA 4WEMB 1U9KA 1N67A 5GGVH 1CICD 4PRAA 2F9BT 2OMYB 3MC0A 2R2BB 3PDOB 1FFQA 4M7ZB 2YGOA 3UBXA 2X6BA 3VVVA 4K2UH 4EIBA 1Q94A 2IBZX 2RACA 1HXKA 1WS8A 3V4PB 5D7JC 3QPXH 3L6FA 3TIEB 4HHAA 3VE0A 3VM7A 4H26B 3AAZA 1LJMA 1RSYA 2BHUA 3TN0A 5BRQA 1BLIA 3CN0A 1LEIA 2YXMA 5IY5B 1VF5C 2LTQC 1THCA 1ZEAL 4P5TD 4Q6IB 2VABA 1LQBC 1TZOA 1JK8B 3NZHL 4S1QL 4XPAL 4YSOA 1LEKA 1HHKA 1VFBA 2QVFB 5CWSB 5I76A 3GSVB 2Z6FA 1E5AA 4KDVA 4RAUA 1MJUL 3HI1A 2DEYX 1TTAA 1LYQA 2OZ4L 1XCTB 1AI1H 4YGAB 4MCYB 5IB1B 3B8SA 1PZDA 4MJ5A 3LZOA 1KCSL 2HAZA 2W88A 5DJDA 4N9GA 3RWIA 1OK8A 3GEFA 1HOEA 3DECA 3IJYA 4WEUD 1B3IA 1SJVA 5EIQA 3WN6A 4F33B 5BMFL 2OSWA 1BPLB 3QXWA 5B39B 3LZLA 4HBCL 5DD0L 4LDCA 1UWEH 4N2IA 4ZYKA 2IIJA 2Y3NA 5HI3C 5CAYB 3BPOC 1IM9B 3N91A 1K9TA 4L9DA 1J1PH 1FL3A 1QA9B 3VYNA 4S1DC 2CUMA 5D70H 4JM2B 3UC0L 4R4FH 1G7LB 5ALBL 4MJ6B 2CDFA 4KDTA 4RGMB 5E8PA 3D2UD 4P59L 1AO7A 1M9WA 4K9EC 4ZUVA 3AFLA 2ADGB 2JKJA 3H56A 3ETBF 4F9PC 4RRPM 3ZE2F 5E0QA 4ZMAT 3IDIB 5FDWA 2WB1A 2NY4D 4POUB 3BUYA 2H2PD 4TPRH 4XI5D 2A1WH 3GBMH 4X4ME 3TVMD 3KXFB 4A2GA 2EVHA 1EX0A 2ZT9C 4ZXBC 1FFNA 1D6EA 4UT9A 2CBOA 3BI9X 2PNDA 5LN8A 3NP4A 4P3WA 1F2XK 3IB4A 5AW2B 1NFAA 3DVNA 1MFUA 5E94B 1BBJB 1VERA 1NCJA 4M7LT 1RHHB 3MGTA 2H0FA 4B3VA 1JZ4A 2F19L 4YHKH 1M7DB 1CT8A 4OT1L 1SGKA 5E6IA 3HNTH 3UZQA 1QBML 2FJUB 3D0LA 5FB8B 1TFHA 5IB2B 4RAVA 3GSXA 5GGQH 2OMTA 3TURA 1NGWA 2NNAA 8FABA 1PZ3A 3MGAA 1ZTMA 1YECL 2HTKC 4F3FA 2NZ9C 3IPEA 5GRJH 4L2LA 3HRPA 5HHXH 3OKOA 1RZKC 3VQ2C 1X5ZA 3JYBA 4CMHB 4ZX6A 3DARA 5C0JA 3CFEA 3RB5A 4X6BB 5HYSA 2ZCZA 4HIJA 3JWNH 1RCYA 5JOEA 1KIPB 1BWMA 1N3NA 5D7IE 4XO5A 4NZFA 3TBSA 5A2JH 4W4NA 3BUDA 3RKDC 1SHSA 5EOQL 5DQDH 2VZSA 5EOCL 1RAMA 4AC4A 3LOWA 2FVNA 3RL1B 2D4DA 5C92A 1ZJAA 3LXBA 2VDLH 1NCBH 4MWFB 1F41A 1BVLA 3FRPG 4G43A 3LHPL 2W9DL 2IADA 2K45A 2YAQA 4NNXB 1N59A 2D0HA 3VFVA 3W1ZA 5IHWA 5KVFH 5AEAA 3PGCA 1NCWL 3GXNA 4EZJA 1A4KB 2VJXA 3ARFC 2ITCB 3TBTB 5AW9B 2AI0L 1OP9A 1JPFA 2ARWA 1HL9A 2FL5B 2X2YA 3BP4B 3H3PL 1WC7A 3U9WA 3VXSD 3BQVA 2WXMA 3UAAA 4UIMA 2LVEA 1O5DT 4TSAL 3EGXA 4Z3GA 4P2RB 3N3EA 3DOIA 3MBEC 3ZK0A 2RIKA 1KN2L 4FI8A 2BJMH 3BE1H 3KPOB 3MCLL 5AW6B 3VFSA 5IFAL 1T7ZA 1XF1A 1FBIH 1Y6KR 4XBPB 3LSOA 3NJIA 2R59A 4L29B 1K4DA 3BZ4A 5EBMB 4N8VA 4CDGC 4NRXA 4OZ4A 5E9DA 1IKNA 1KYDA 2BP8A 3V7AG 5DYOB 3RY5A 2C3XA 1KB5B 2EC8A 1IBGH 4G8AC 4DGIH 4KTEH 4JFFB 3O6FA 1S6NA 3NJHA 3V4VL 2KHAA 4PD4J 5J13C 4PU2A 3FTWA 5BRPA 2A4CA 4PLJC 4WUKH 4P57B 2E6JA 3GJFH 3KBHE 1IVLA 5SWSE 3C5SB 1B4LA 2KDGA 4N8CH 4TULH 1PQZA 1KEMH 1MUJB 1SF5A 1YPZE 2GAZA 3AITA 5FUOL 4TOYH 3IVKB 5C08E 4EUPA 1XGUA 2QVTA 2CZNA 4XBEH 3BAEL 4EBQH 5B3JE 1HJCA 3Q1SL 4XCNA 4XAKD 4YBQD 1KJ2A 5MEQA 3G6JF 2Z31D 3RX7A 1EBAA 1Y07A 1NCTA 3B43A 4JGNA 5HJ3A 4X83A 3Q6GH 3SDCA 4XVJH 1OF2A 2VR4A 3QORC 3TFKC 1Z32X 4LHQB 5LXGH 3EZJB 4GP5B 1KV7A 2VDKH 2HPTA 1E4XL 1CFQA 1VFUA 2H6PB 4TVUA 3SPVB 1S2EA 2SEBA 3EOAA 2HSIA 2VISA 4H0IA 2QQQA 4NQSA 3EJYC 5HDBF 3F7VB 3HLKA 1BXVA 3RVTC 4JDZA 4K7FB 4D9QE 2IPKB 3KJ6L 4NO3A 2CUHA 1SBSL 1WFNA 2N0MA 2IANA 2VDLL 4IRSD 3U0WL 3VXOA 4C4KT 2GIYA 1MW2A 3RZWA 1ZTXH 4KXZI 4TUKL 4XNZC 3C8HA 3LIZL 3VFGH 3QUYB 1OSEA 4J3OD 4NWTH 3NEOA 1DSYA 1GH7A 3VD2A 5KSBB 3P11H 3B2UD 2X4RA 4EDWH 2P5WD 4ANXA 3MLRL 3RUGF 1QLRB 5DD3H 1D3CA 3ZDYB 1R5IA 3PGDB 2L3BA 1GZHC 4QJ5B 1W0WB 4Q8BA 4QHKI 5K93A 5D9SA 5TQ2L 1ETZB 1OKEA 2ILLA 1RULL 2HVJB 2IH3B 4XMKH 1IBGL 1SMDA 3QUML 4L4TD 2EIMB 5C8JA 3AREC 2Y23A 1CDGA 1I9IH 4KMQA 3QS3A 3S2CA 2QQNL 4JY5L 5LNEA 5C09B 3Q8FA 4WTWA 3JV6A 1HL4A 4P2QE 2G2PA 4YDIH 4WUUD 3EUDA 2A9AA 1SDDB 4EN3D 2BNQE 1T5WB 1FNSH 4U1LB 3KPLA