3U4KA

Crystal structure of the receptor binding domain of plasmid-born adhesin mrkd1p of klebsiella pneumoniae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
163
structure length
163
Chain Sequence
GSSCWQSNSAYEINMAMGRVVVSPDLPVGSVIATKTWTMPDNNTIYVTCDRNTTLKSDAKVVAAGLVQGANKVYSTAIPGIGLRFSRKGAISMIYPDSYTTTGSSFRLAGSTFTLDIIKTSTTTGSGTLASGPYTEYGPGFTILKTSLNADAITIVSPSCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Fimbria adhesin protein
publication title Crystal structure of the MrkD1P receptor binding domain of Klebsiella pneumoniae and identification of the human collagen V binding interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
total genus 28
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2011-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u4kA00
3U4KA
chains in the Genus database with same CATH superfamily
3QFJB 1BF5A 5GGUB 2CDGA 4AIEA 3DROB 4DK6A 2UUDH 4ZUSA 2EVHA 3L5JA 2OTPA 3HBQA 4PRNA 4PJ5E 3CFBA 4AQAA 4JFSA 1GTFA 2F5AL 3CHPA 5J5EA 3WLWC 5IF0A 1FNGA 2CKBL 3EGDB 4CU6A 3REWA 3H3BC 4J3OD 2P28B 3SPHA 1CI5A 4HX1B 1PZAA 2XBTA 2K6YA 3KYNA 2ITDB 4TSAL 2R1XB 5DRXB 3ZTNH 2AQQA 4W9CC 2OBGA 4MQSB 1J9SA 1BLNA 1FFPA 3IS0X 4Y7OC 3MLTA 4XPBL 3MV8A 4DFIA 4PBWD 4TRPL 1U93A 4A66A 5C0EB 1PKQE 2ZPKH 2NUPA 4WW2C 4I89A 4EUPG 4HEPA 3RNQA 1FZMB 3CSGA 3X17A 5GGVL 1J8HA 4FQXC 4HSQA 4I77H 4OGXH 5E2UH 5LQBL 1JZ5A 1IRAY 4M9PA 3LNFA 3OQ3B 3O2VH 3GT6A 1TZHA 1UM6H 3AY4C 1WC7A 5GRWA 5F3HB 2YMXH 3ULVF 5A43C 2X87A 1CL7H 5FUOH 3WIFB 4DCQA 2PLTA 1BXVA 2OV0A 2DQEH 3ML9A 4MBOA 1ZT4B 3UCRA 3LXAA 1QNZH 3JZ7A 3LSOB 5HYJB 4QRTB 2FJHA 4JR9H 5FO2A 1I1FB 5LBVA 4FFYA 1QHQA 4V1DB 4FHJA 4LZKA 1PZ5B 5EEYA 3PP3H 2O5NA 2ED8A 1RH8A 4WJKB 5FO7A 2KI6A 4JAMA 4PLJD 5I1HL 3ZMEA 4LEBA 3W11D 4N85A 2QVKA 2JB6A 1XR9A 4TUOA 5JIHA 4EO5A 4I5BA 1VPOL 3E80A 2AEOA 2EDYA 2CLZA 4L05A 1RZKC 4QHPA 4N0UB 4IKNA 1SM3L 2VM9A 1WBXB 3KBFA 4JPKH 4AE1A 1MCDA 5EC1B 1ZLWK 4R7DA 4C4UA 4CVZA 4ZMWA 2HFTA 3V4PA 4ATWA 1GGTA 1E3FA 1IGIL 4EXKA 1AD9A 1T80A 1FF5A 4PJCA 3M8OL 4AVHA 4G9DA 3SBQA 3ZDWA 3Q6GH 1C5DB 1D5IL 1TJHH 4IRSA 3NJHA 3RVWC 4FQLH 1KFGA 4PWIA 3OLEA 1IGTB 2I26N 2P8LB 1EEYA 5ACLA 5SX4I 1MF2L 3RWIA 2MOQA 2HAZA 4NO3B 1A4JA 5D6CA 3U30B 4KRPC 2Q9OA 4A2GA 3FB7A 1UT1A 1X5JA 4XRCB 4GMSL 1AS7A 3HC0A 4HZ1A 2W9EL 1LK2B 3L8QA 3QDME 4OCYL 3WXVL 1J1XH 3R0MA 3HZ3A 1UWYA 1U8NA 3QWOB 4L0PB 2EE9A 1XTMA 3MGOB 4PJIB 5JW5B 1C8QA 5EZIH 1UZGA 3QYCA 5DD6A 5KJ4A 3R8QA 3VXRD 3G6DL 1CWVA 2BX5A 2EKJA 4B9PA 1CGSL 2DQ6A 2XSKA 2CO2A 2XX1A 4TNWK 4QYOA 4FXKA 4HSCX 1IEAA 4XGZB 3D3VA 3KCPB 1FAIH 4HFUL 2H9GB 3DVNB 4LRIC 4X5RA 3SE3C 5E9DE 2Y5QA 1FGVH 2XZCH 4YAQB 2OZ4H 1CGYA 1NANH 4JFFB 1AR1D 2WY3B 1D5ZB 2NT1A 4M5YL 4PREA 3W2DH 2ZUVA 1Z0MA 2J55A 3WIIL 5E4AA 4BRVA 5IFHL 3MNMA 2R29L 2Q76B 1T0MB 1HJBC 1N0XL 1CFNB 2V7HB 4RESB 3QJRB 2K9UA 5SWQB 2VDOH 4AY0A 2K45A 3GSVB 3UTPE 1S3RA 5CJ8A 4AGLA 4ZOCA 3UEQA 4N2GA 5J11B 4UQAA 4PJ5A 3CZSA 4NQEB 4JK0D 4XPTH 1CFQB 4NRXA 4F15C 3N85H 4KHXL 1A2YA 3NJMA 3QISA 5TDNA 4RISH 2NSQA 3TNMA 3APFA 3JUYA 4QRPE 3BQUA 1H0DA 2B1HL 1E43A 2FQDA 5E00B 1GGIL 3S2AA 5HDBF 1Z9SA 5ESAA 4ESKA 1E3ZA 1U58A 4YGAB 1KCKA 5EU3A 2JXMB 1QFWI 3RL2A 1OSYA 1U30A 2VXUH 5GHWH 3LJ3A 3VFWA 4EI6A 2CO1A 5ADOH 1PKQA 4JZNA 1C8PA 1KCSH 1OW0C 3HTLX 3RTQB 1JGIA 2F58H 1C5CH 3M17A 3FULA 3VJ6A 4BSVB 3SE8L 1CMOA 2N01B 4TKWA 5KS9E 1DVFA 1IMHC 1J5OL 4D3CL 5G5DB 3VRIA 1A6WL 3GHEH 1ITBB 1ZHKA 2Z6FA 3V9EA 2CJTA 5C0IB 3OAYH 4JGMA 3IJSA 5M94B 3T8VA 1HU8A 1N8ZB 4F9PC 3EH5B 3B1TA 3L9BA 4OF6A 5IMKA 1MFDL 3QQNA 2R56H 1ZIBA 1PG7L 3V0AC 3LDBB 3SN6N 3LQMA 5TQ0H 3VTTA 3RY4A 4QAWA 3MRKA 5F21B 1IUZA 1BZ9A 3QIWA 1I82A 2FT7A 3WAKA 1NBVH 1QACA 3FRUB 3IFNH 4MJ4A 4O02H 1MQKL 4KJWC 4D2NA 4NEHB 4NPJA 3DPDA 5LAXB 2F53B 2IDFA 1UCBH 4EDWH 1CDBA 1MJ7H 3GQFA 4N2LA 5DYOB 3T04D 5I5RA 2YC1B 3Q1SH 2CIKB 3WYRA 2F1AA 5SX5K 2B39A 3P4MB 3OAUL 2PETA 1MRFL 1OE1A 4FFZL 3DSNA 4KRPB 4OUOA 1YN7A 2WTRB 2QTVA 3DV6B 4YSPA 3IN0A 3O4OC 1P7HL 1FHNA 3ZDYB 2B1AH 4MJHA 2H0JA 4BGDA 4B3EA 1M1XA 1KTDA 1T5XB 2Z93A 1IGYB 1YAZA 2ICEA 1SJEB 4FFTA 3U1SH 5DFVD 3UTQB 4XCYB 4Y5VC 3J7HA 4WWKC 4KK9D 2CJ3A 4U0RC 1KB5A 1R5IB 2FEDD 1DQLH 2J6EH 2IH3A 1EBPA 2LU4A 3P0GB 1NH6A 3HJEA 4Y9EA 1XF1A 2R2HA 1EJOL 3D09A 4WV1A 5E4OA 3SEPA 3QDMA 1OM3L 4EEEA 3TCTA 5IMOA 1NAMA 2ZONA 3MCKB 1XAKA 5HBBA 4HBCH 3QJQB 1QSFB 1IC5H 2BP3A 5T1JA 2OP4L 2CKNA 5A2KH 1TMCB 2CE6A 1ZS8A 2WQUA 3CK0L 1E2ZA 2HCZX 1RERA 3GXMA 4JPVL 4Y4HA 5EU5A 4DSYA 3EJZD 4ZW5A 2OYKA 6PAZA 4Z0XB 1S7SA 1XCWA 4OGZA 1Z5LB 2E47A 1UUSA 5JIIA 2X9XA 3UAJC 4HT1L 3S5LB 3AMKA 4MNGE 2I85A 1BBDH 3VFVB 3UPRB 1AKJD 4S0HA 4JEGB 1D2OA 4IJ3B 3RTLA 5GGRB 2HFFB 1XGQB 1ZANH 4FQCL 2DQMA 1U8PA 1N5YH 3BVXA 3M6DA 5E9DA 1I4FA 3WAJA 1N0LB 3D69B 3BPLB 1BQSA 4AZ8A 4XWOC 2PTTB 3IDNA 4H40A 4QKTA 4XI5C 3N40P 2PW1B 1KB9J 3GSUB 5D1QD 4F15B 1NC2D 1S5IH 5D1XE 5D7HA 3IFOB 1RZ8B 4W4OC 1NUDA 3UDWA 3GSWA 1X7SA 3MRCA 1KIRA 3NSXA 2Z1PA 3MXVL 4LCWD 1FG9C 5CZXC 2WN2A 3QP3A 3ZTJG 3KPLB 3II1A 1U91A 5F9DC 2G4GA 3HNSL 3VXOB 1PD1A 2BDNL 2CHWA 1NOLA 3QI9B 3PAVA 5G4NA 3ASNB 3FN3A 3KH4A 5EUOF 1TIUA 3RGVD 4I0PC 4PUBH 4BELD 3NIGB 4OFDA 5T3ZE 1XBDA 2J1KA 2V9UA 1IIKA 4QRPA 2GSIA 5C0AD 1JXKA 1QNIA 1OAZH 2YK1L 2ADYA 5ENWB 2NQDA 4OFYD 2FIKB 4YXHH 4Y5YA 2FHCA 3V5HB 3BSZL 4PJ9C 4P5KA 3W3BA 3FT4A 1I7RB 2X6CA 4NBZB 1DUZA 2XQYK 2BW5A 2PMZA 5EBLB 1YJDH 3MJ7A 3PAYA 3Q3GA 4KXDA 1X9QA 3N42F 2BVOB 1ZT1B 4K9EC 4MDIA 4UYQA 3DX0A 2VDQH 3HPLB 5KS9A 3MLWL 2NY0C 1YMHA 4NN5B 3TBTB 4GW4A 4ODHH 1U3JA 4QHNA 4GAJH 5D7LD 1HAWA 1JFHA 3CN3A 4XX1G 3UBXG 4BUGA 1FRGL 2WTOA 2YD2A 3O2WH 2BY3A 3MBED 4LSRL 2X12A 5F7AA 3RJQB 1U9KA 1DQJB 3A6CH 1J0KA 3WEXB 3O6KL 3QO1A 2WWMD 2X4SA 4FN0A 2MCG1 6TAAA 1LP9A 4UQEA 2ZXGA 2FWUA 4OIFA 4MNHA 1G1YA 3AABA 2UYLA 3MX0A 3GD1C 4KAQH 1BMZA 3LVEA 3JWDL 4PYGA 1EUTA 5DMKA 4IRZH 4Q9RL 1D9KA 1H3TA 2V8LA 4MAUH 3TZVA 1JZ7A 1MZZA 1EHLH 3O4OB 5C08A 2VDLH 3BDYH 3NCCB 4XNYL 3ZIYA 1L9TA 5C09D 1NM4A 4J1UB 1RPKA 3ZRCC 5IQ9B 1GGUA 5FCSH 1QWHA 2C3WA 4Y5VB 2IWKA 4WWKB 4U0RB 1U8HA 3L3DB 4LCYB 1FPTL 5KBMA 4PRHE 3U6RA 3ARFA 2O26U 5A2BA 3CLEL 2CA4A 4BGLA 4G9FE 2EEAA 4XC3H 3VI3B 5L8JB 4LSPL 2AXFA 3HLAB 1BMWA 4ZTOH 4DO5A 2VXSH 4FZEH 5HP5A 4PBDA 2FWSA 2IPKA 4JRLA 4AEHL 3ALPA 3GSOB 1MCIA 1I1AC 4PJAE 5I1LA 1NCNA 3SGKA 3Q2CA 4HGWB 1OAKL 3CH8A 1FNEA 3P3RA 3VWJD 5HPMA 2IALB 1G6RH 1UTDA 3SZ6A 1HIML 4NJAH 3W0WD 4AG4L 2G30A 2P5EE 1PS3A 4RSVA 5EEUA 5IQ7H 3NOIA 2BK8A 4JDTH 3DGGA 1ZEAL 5IQLA 4BJLA 4H8PA 5SWSD 3WFHA 4BV1A 4HULB 4UDTA 1DLHB 3MQIA 3ZQWA 5JA8B 3ZDZE 4DTGL 2X4TB 3IF1A 4L1SA 4ZDHA 3PGCA 1LILA 4HKBA 4M3KB 3GRBA 4MNGA 3ATFA 2HYMA 1A9BA 1GS6X 2YJQA 3RY6A 8FABB 1HSBB 4Z77B 2BO0A 4ZMZA 3PUCA 1MRDL 2WWOA 1XXFC 5EUKA 2HG5B 3CPLB 2IANA 2BS8A 2ZP0T 3DWTA 5D72L 2A6JA 4AC2A 1URLA 4EXPX 4HPHA 3X11A 1AC6A 4I0PB 4G70B 5CINH 2R0ZL 2KS0A 2XBDA 3VTAA 1A4CA 5CGYC 2ERJC 3TH3T 1I1CA 4ZMVA 5AB9A 4ZFOA 4Z7QB 1PYWB 1V7ML 3QPQD 3KPNB 4PJ9B 3LEYH 4NUGL 3OG4B 3UIYA 2HJLB 3IU4L 4KPHL 4YHKH 4UTAL 2HWZL 4GQPH 4XB7A 4PW9A 1BVNT 1XH3A 3ESPA 2R59A 4B9ZA 4U4BA 5DXWA 2E7LC 1CLYL 1ZVNA 2P8MB 3I9IA 4BE5A 1T7XA 2HPTA 1OZTG 2VXQH 2NY0B 5CBEB 5INCA 3BXNB 1JHLH 2DICA 1SN5A 3FB6A 2AITA 4I3SL 1KFAL 2B8OT 3RY5A 1TJXA 4R3SB 1K8DB 2KDGA 4WI5A 1IFHH 5HI5D 2DLFL 5IB1B 2FH8A 5DRZA 3BVDB 4GKSA 3VFRB 4HOWA 4KNQA 3NSCA 1ILSA 5GQBA 1E30A 2XT1B 2WSPA 1CCZA 1E67A 5CXPA 3QUYC 4FZ8L 1AP2B 1RQ5A 3BUBA 3MZGB 2LLNA 4ZPTA 3GJEA 1MREL 1YEWA 1H9VA 1XL4A 5FGCE 1FORH 4YR6B 4Z8FH 4NP4H 3FSZA 1S7RA 4XPHH 4XCEA 3MJWA 4QLRA 1CZ8H 4GRWF 2UXFA 4Q0XH 2QSCL 4XC1L 4LHUG 4XN4A 5FV1L 2HJFB 3QDJB 4X4XA 4JB9H 3KPSE 1QSZA 1T21A 3LD8C 5EO0B 4C55A 1LMKA 4YPGB 2FCBA 5JXAH 4GSUA 1GHFH 1TJGL 3BHBB 2YD6A 3FQWB 3KPRA 1BQHA 4MMZC 3Q5TA 3K71B 4TPRL 3RE0A 3OVUB 2FJFB 1DBBH 4ZMOA 2VITB 2CCLA 1KXTB 1I1AB 1OAJA 4E0RB 4PRHA 2EDDA 5T1MB 3SYPA 3B2XA 4G72B 1NEZB 3WI9A 3KWWA 2WLJA 1SY6A 4MFHA 1UZ8B 1NLBL 2HKFH 4KFMA 5DJ2B 1DJZA 3OB0H 1RIHL 4BQCA 5E9NA 3GI8L 1OK0A 1DQDH 4PP1C 3LYRA 1SHWA 4IGBC 4PJAA 3QZOA 5I74B 2W9DH 3KR3H 5E8PB 3UTTE 2VDOB 1B4RA 3CVHH 1THCA 5FA4B 1QR1A 5C3IA 4NO5A 5ANME 1XCTB 3VD1A 2RTTA 4JZJC 5HGAA 2NY1C 2QHRH 2YD7A 3MREA 5KYWA 1A64A 1T3FA 2P5EA 4FCAA 1XAUA 4ZTPH 1OCOB 1NM9A 3HNTL 5CP3A 2WSDA 4M29A 1K5NB 4MD0B 1MFMA 1P7QB 2VN7A 3BLPX 3HW7A 4TL4A 4S2SA 1KTBA 4P4RB 4YHPB 5TTRA 3K8MA 2RH0A 3CVIH 1RUKH 3AGWA 3DYMA 5F7UA 4Z3IA 4YDLC 2Y5TB 4I18C 5DJXB 3ZY7A 3UAAA 2JK5A 5D1XC 4ZZKA 1D5XA 3T4YB 2ERJB 1Q72L 4XVSH 5E8DL 1RUML 4F24A 1N3NA 3QT2A 1U8OA 1EJ6A 2DWDA 3G5XB 1D3CA 2OQJB 1AE6H 3FUEA 4K3JH 4NKQB 7PAZA 5KSUB 1JVOA 1A7NL 1AY1H 3RFZB 5EWIH 1OGPA 2VDNH 1VADB 1A66A 5EZOL 2A83A 4GYBA 4XN8A 3F5WA 1I3VA 3GS7A 3PG2A 4G7QB 1PGRB 3SBPA 4N8CH 4WAFA 4Q2ZB 3VGEA 4Y2DA 2CM5A 2COQA 1YJDC 2LQRA 2ZKHL 3BUYA 3BX7C 3LMJL 3QC6X 4UT7H 4M7LT 3WKMH 1XH0A 2HT2C 4U1NB 2Z91B 2G9HB 2VR8A 3JWOC 3K72A 4JY5H 3FCBA 3TC9A 4ETQA 3VAEA 4OGAD 2ICES 2DLEA 2X4OA 4MA7H 5CLXA 4NO0B 4RMUA 3QHZH 4UUJB 4H44C 4HYTB 1LDSA 4O02B 4OD1L 1OP5K 2WC7A 1KN2H 1R33A 2CRZA 4Z3GA 2DYPB 1QQDB 3SDDA 4XNQB 1ZKAA 4GEJA 2R1YA 1MEXH 3FU8A 3O3EA 3DIFB 4P07A 4X80L 1MFEL 3S6CA 1IFRA 1QLFB 4W9GC 5KVDL 2OSLA 3IWVA 1VGKA 2J1ZA 3UL4A 3DGDA 2HKHL 3CDGB 5IJKA 4YXKL 2VMFA 1XGUA 3MLZH 4N1EA 4CAGA 1F4YL 3E6FB 4CNIA 3FO0L 3EGXB 3S34H 1NGZA 1R46A 2VJ8A 3PIQA 4W9LC 4S0TD 4ANKA 1DSFL 3HR5A 4MHHI 2L4OA 2G5UA 3LD8B 5JHDB 4N5ED 3BH4A 1XF3B 1BWWA 3SKNB 2B2XH 3D39E 1Z5YD 4WTWA 3LPFA 3UZEA 4TOYH 1YY9D 3HN8A 4G1EB 2PO6A 4G80A 4MMZB 3VRJB 1E6OH 5F7KC 1YEEH 5I8OL 4QUOA 1SXBA 3U46A 3WNOA 4XMKL 2QDWA 2L7QA 3KPSA 4NYLA 2DYRB 5AZ2H 5E4IA 3S3JA 15C8L 1BVZA 3UP6A 1X5XA 4U3XA 2WXJA 1U8KB 2A9NL 3HG1D 4WCYL 5D71L 5BXFB 4Y8DC 1USQA 4WW2F 4LOUC 4LOFA 4F9LC 5IMMA 2QPDB 1E9QB 5DK2B 3LVTA 1EZSA 3T0EE 4IGBB 2L0DA 2E8ZA 5CZVL 1JI2A 2OMYA 3CXHJ 2ZT9C 3HG2A 5EZLB 1DSWA 4LHJB 4XAKD 5AAPA 5E6IA 2DL2A 2IMMA 5KSAB 4PIRF 2GKIA 5TDOA 4U1HA 3TBSB 3JQOB 5J1SC 3FOLB 1SQMA 3MNZB 1FSKC 1OOWA 2CU9A 2W81C 1I7TA 2R0LL 4WKXA 2Q7YB 4AMKH 3BH9B 3UTTA 2BS9A 2Y36H 2WD0A 4S1QH 3FCSB 1UVQA 4DEUA 4XE5B 1SOKA 2ZYRA 3AU1B 3IJEA 1BOGB 5ESVB 5I0YA 4JKPH 1Q0YL 5JPMA 3UO8B 1R0AL 1JL8A 2BP0B 4R90L 4BZ2L 4Y16C 5JIKA 1MJ8L 3CD4A 4I18B 1FZOB 4H88L 4N90D 1TTUA 1HINH 2P49B 4X5PA 4M61A 5AL0A 3WNPA 2WJ5A 4ZYKB 3VFUA 4GP5B 4XO8A 1AQ8A 1IBGH 4L8BA 4Z18A 2EDOA 4S1RL 3F7YB 5D1ZD 3UMTA 3WIHH 1KJ2L 1PNDA 2A77L 1ORQB 3TLRA 2ZCKH 5IM7B 3GWJA 5TE4H 3OKYA 1N19A 1DBMH 2NY4D 4I9WD 5JNYA 1J9RA 1SN2A 5BZDA 4LRNL 4TM9A 4XP9H 2MTAA 1S3KL 2GBTA 1MN4A 1EJ8A 3MLRL 1HDMA 4ES8A 1JXFA 3GEFA 2BNRA 4HQQL 3L4VA 5L8LB 4FD0A 4YQXL 2OMXA 4QNPF 3MNWA 2VDQB 2DJSA 3RWJA 3KM2A 1QFUH 4WTXA 3LX9A 2DQJL 1BYOA 3EO1B 4J28A 5BQ7B 3O0LA 1ZA3B 5DZPA 5EG6C 2Z7YA 4WGKA 1KG0B 5J8OA 1JK8B 4G3YH 4ZI8A 1SF3A 2PCXA 4LEOB 3KLLA 2DWEA 3V6ZB 2D9QB 3GBNL 4PJ7E 5J1AA 5JW4M 1DLFH 2NXYC 4OCRL 4FQ1H 3JVGA 4WDIA 2OA9A 5TGBB 5DZVA 3RILA 2OLDA 1MXGA 4F1ZA 2BZCA 1XB3A 2UX6A 3T8XB 2AERT 4KMQA 4JZOB 3FT2B 4N0UE 4TSCL 1RUAH 3V0HA 2GEQA 2Y07L 4KHTL 1EZLA 1MCPH 1U3YA 1U2YA 1VB9A 2FNWA 3BJ91 1QW8A 3QORA 2VDLB 2W59A 1YEHH 3QUZB 2WCSA 5TK2A 5TQ2H 4DP7X 3S9DB 1K5WA 4HJJH 1FL5B 1FJ1A 1F42A 2H1PH 3W39B 4X4YB 3CSYB 1GC1H 2A2QT 1R5VB 5DQDH 5F6HI 4L9LC 3X3GL 4Z23A 5B39B 4NSKA 1H9DA 2XPZA 4AQZA 2Q3XA 1AOHA 4UOW0 3PNWB 4Y0GA 4G82A 1JWSB 1F4WL 4AGNA 2WZ5A 3HAEG 5ETUB 5IJVA 5K9OB 2F8VA 1UA6L 3SJVB 2YD3A 2CBTA 1P1ZA 1VFBB 5F7HA 3SOBH 1AD0B 1KT2A 3S8WA 3QZPA 1AJ7H 3CDZB 1MY5A 4P2QE 3MLYH 2H3NB 3EJRA 5GZND 3NBNA 3NYKA 3D39A 1OQXA 3FO1B 5I30L 3PS6A 1JSYA 2R1WB 3W1ZA 1TKWA 4PV9A 2JJVA 3B5HA 4W93A 5FYJL 4C83A 2XN2A 4OT1H 3B3BA 5JPNA 1G6RB 2K70A 4C59B 3AM8A 1UD6A 1P2CB 3D08A 5BCAA 1I7UA 3X1BA 5AW4B 4NS0A 4ZX4A 5IHWA 2AJSL 3OKEA 1R3HA 1UA7A 3ARBB 3P2TA 1U6AL 3QUXB 1PZSA 4NHCH 3DOSB 1MZYA 4KJQD 2FATL 3SGDI 1ACXA 2CNYA 4OIIH 3CU1A 5HHOB 3L4WA 1GL4B 1S7VA 3OC5A 3L1EA 2H45A 3T0EA 1FSKB 5FOJA 3HNVL 2Q6WA 4M3HA 4Z7WB 4AYID 4W9JC 4OFVA 1IE5A 4AENA 4NKIH 4X7TA 1QWNA 1N10A 4F2FA 5HVHC 4GUPB 1ZS2A 1BBJA 3EYSL 5FPIA 4NUJA 4DPCX 4PRIB 4Z7OF 2VQ1B 3ECWA 3HZKA 4Y16B 3QFJA 1Z5HA 4P4KC 5GGUA 1G43A 3T3MF 3S36L 1KLUA 1HQ4B 5EZJB 1F1GA 5JO5A 3NEOA 4EAEA 1KXVA 1HE7A 3C6EA 4MQTB 3T4AA 1IB5A 4M6OL 3SPVB 5AYTA 4EN3C 1K85A 1J88A 4FDWA 3NACH 1ADWA 1A7QH 3ZUNC 2VUKA 3CCHB 1XF5B 2OMUA 4ODWB 3ZU8A 5KAQG 3V5KB 3O2DA 1FNFA 2O6CA 2OJEB 5K9KA 1ETA1 4PJCF 3EJCA 5FYLE 4DQAA 4QD2E 2KPWA 1EK3A 2B5IC 5HHME 3ZKNC 4O5LL 5FW8A 4S1DD 5FM5O 1BQRA 3AADB 5TE7H 4TV3A 5HJBA 4IMKA 5C0EA 2X6BA 3RYMA 3HVDA 3T2QA 4H0LC 1BD2E 5EBWB 5BUGA 4NM4H 1FZMA 2E9WA 2CRYA 4FQ2H 2YGNA 5AZEH 4QRRB 4CN1A 4YXLL 1SUJA 4D9LL 2OW7A 3DI3B 3FUFA 4QT5B 5FEBA 2YPLE 3WIFA 2UY6B 1QSVA 4M1CC 1ZT4A 2F5AH 1IM9B 4HDIA 4L8CA 2OTUB 2Y69B 4RGND 2CKBH 2NXYB 2JELL 3BZFB 3V4VL 5AWNH 3TX4A 2PPEA 2VOTA 3NCJH 2WZPD 1G7HB 2FJGA 2B4CC 3PHSA 1HNFA 4V1DA 4TSAH 3TEUA 1JS4A 1FO0L 1ZXQA 3Q13A 2AV1B 3N91A 5BS0B 3MRIA 1RAMA 1I3RB 2BY1A 2NYYC 5ITFB 3VWKD 3WKPA 4M5TA 3U4BL 4XPBH 4PJ7A 4Z3TA 1N2RB 4IHBA 1RUQL 1SFDA 2H26B 4TRPH 5ILTL 4N1CA 3B56A 3T9WA 1W0YT 4MSWB 2BOCB 4I9XA 4M7JL 5B3JE 3WO3B 2AK4E 2J43A 2ZUQC 3NH7L 4N0UA 1TO4A 4ZO9A 1IKOP 1NCCL 4FQPA 2WIIA 5MEQB 4MJ6A 1T89C 1FI8C 3EO9H 1TYEB 4JN2B 3ILDA 2NOYA 1S7WA 3ZW3A 1KGIA 2MJWA 4N0YL 1BJMA 2O93L 2NQ3A 3FXIC 3ZDYE 4LNRB 4LIQL 2EE6A 1ASPA 3PWNB 4PRBA 4AQOA 1DN0B 3ILEA 2NY7L 2E4FA 3LH2L 1CDHA 3ZJAA 4NO3A 4OJDH 4JRYE 4OZHB 4XRCA 2WLZA 3VD2A 3ECVA 2VAJA 2N59A 4IOIB 3DHMA 3D4CA 4WQOA 3IDGB 3QHFL 5B7FA 4NN6B 1J0IA 3OAZK 4YIQA 3CVHB 4R96A 1XF2A 1VPOH 2KYIA 5D6DA 2OR8A 4PJIA 1FLTX 2AJ3B 5D5ME 2QFRA 1SM3H 4JFYA 3VMOA 2CR6A 1BQKA 2JF1A 3P69A 1AIFA 1H3WM 4R4NC 3CSFA 4XP5L 4PM1A 4ZPVA 3JWNH 1IGIH 1XSIA 4KV5E 3PJNA 5FKPA 2WMPA 5HVHB 2MPAL 5EU6B 3M8OH 2HRPL 1CFSA 3GMLA 2XWZA 3MRLB 4MXQD 1USZA 1D5IH 4JHBA 4CVXA 5LCVL 1U92B 4LVHB 3KCPA 2NXZD 3QA3A 2ZX9A 1EGJL 3P30H 2YUZA 2BSDA 4KK6D 2AJZB 4YAQA 1SNRA 3QWNA 2HN7B 4RDQG 1LEGA 4HJ1A 1QPXA 2IWFA 2I9LB 4RQQB 5HHNB 4M00A 4EN3B 2MRYA 3L9RB 4GMSH 2Q76A 4AYSA 3ULVD 2W9EH 4OCYH 2KZBA 4OF5A 2AK1L 4MJIE 5SX5H 4R7LA 5SWQA 2K6WA 3MBXL 1B90A 4J3OH 4A7VA 3INUL 1A6ZA 5KVMC 3D52A 4GIAA 1EHXA 4ZK8A 2XWEA 4N2BA 4AMXA 2VIRA 2Y2WA 4KK5C 5FHBL 5ID0B 5T1KA 1CFQA 1CLZL 1Z3GL 2B5IB 3VE0B 4YWGH 2VW7A 3G6DH 3QIBA 3DI2B 1NGPL 4ZMXA 2CO6B 3FCUB 3PGDB 5DC9B 1CGSH 3BH8A 3VFMB 3TL5A 1G9NL 2Y23A 2LAGB 2ZTBA 4Y19E 3HCVB 3F2LA 4JQXC 2YGPA 4TTDC 3NP4A 4HFUH 4WW1B 5F93C 3D48R 4N1HB 4PJHE 4XWGL 4AWJC 2KERA 2JXMA 3QRBA 1HOEA 3GI9L 5HI4C 2V33A 4M5YH 4LOVA 4NQXB 1MIEL 3H2PA 2HRHA 3WIIH 4EI5C 1Q9WB 3RTQA 1BD2A 3D50A 2R29H 2AJUL 3FZUC 4J3UA 1KPUB 4LHUD 4YHLL 5MP6L 1N0XH 2DQHL 5JW3L 3NVQA 4AGQA 2F7PA 4X7SL 5D7SL 4A2HA 4ZMYA 1V10A 4PG2A 2JH2A 1DQTA 4HU2A 4LAJH 1J1PL 1PFOA 2HTKC 5G5DA 3VA2C 2VO5A 3KXFD 2DIBA 2YPLA 3CNKA 3Q05A 2NDFA 2WYIA 1Q9LB 4Z7NB 3LHAA 5C0CB 3TF7C 1HHKA 4KHXH 1WFMA 2EH8L 3TIEB 3I9GL 4JM2D 3BLKA 5GRUL 1MHCB 1T66C 3SO5A 1IZKA 3IGAB 1GC1C 2LABA 5K93A 3W37A 3S35L 2WYTA 2Y25A 4P2OC 1G7MA 2B1HH 4XZUA 5ICXB 4JFPA 4JE4B 1FDLL 1ZY9A 4POZD 1EAOA 1ZLVK 4E9YA 3NABL 5BRQA 4XPGL 3FRUA 3V7MA 3QZMA 2QPSA 4Q6KA 3EDEA 3VCLB 2ESVD 4NCC2 4DT2A 5BJTB 2ZSWA 4ADIA 3TYFB 1CT8B 4U1MB 5DD1L 2Z7ZA 5IVZB 4TXVB 4P3CL 4WGWB 3MRGA 2C9SA 4KK8C 5FXCH 5I66A 4NJ9L 5JW4Q 1X5MA 1MCBA 4YHOH 5IR1A 2X70B 1A6WH 1U0QA 3BFOA 3DV6A 3VD0A 4F7CB 3UYRL 2HA1A 3NZHL 1YO4A 5HY9B 4QXTB 5J56B 5AW9B 3TPUB 3ULVL 3WV0A 1JMXA 1IGYA 3EHBD 1A9EB 3UTQA 1MFDH 3C8KB 3DTDA 4L4JA 3OGOE 5C97A 1UM5L 1UACH 4ZFGL 1PG7H 3PP4L 4R97C 5I17A 2BXYA 2WXKA 4UOW1 1B4TA 2AFNA 3B9KD 4W9KC 3IMVA 1OB1B 1XMEB 4EOWL 3BCDA 3HRZC 4KU1A 3ZE0E 3F64A 3MCKA 4JFHE 3GZOA 3ZHNA 4ZFFB 4AW4A 2RGSA 4Q9QL 1MQKH 4PHZA 2N0MA 2BC4B 4CMMB 4C8XA 3IT8D 3UTOA 5FECA 4UIKL 1JVKA 2VN6A 4HF5L 1F4HA 2P43B 2Y1VA 2DYSB 5EIIB 2BP5M 1MVYA 1TMQA 1NKGA 3WKYA 3RDTC 1MRFH 4GXVL 3FSOA 1UXSA 4PR5B 5KS9F 2EILB 3E8UH 2G60L 1XZ0B 4G7VL 4F7PB 3A4FA 2CLVB 4W9HC 4X5LA 5HHPB 3UPRA 3VDAA 2HZHA 1HKLH 1EEQA 5GGRA 5KVEL 4YDKH 1XGQA 3IGFA 4QRUA 5J06A 3KJ6H 1VSCA 3SBWC 3DURA 5FM4A 3D69A 3MODL 4G8EA 5DJ0B 3UJTL 2ZOKA 3OJDB 5I0WA 2PW1A 2WXQA 1BM3L 2XTJC 4MCYB 3IFOA 5LKNA 1BIHA 2SODB 1EJOH 2EYSA 2P52A 1LP9F 1VCBC 2VLRB 4OFIA 1RULH 4MJIA 1OM3H 1I53A 4HC1A 3P4NB 5DVPA 2WXNA 3CFDB 1DP0A 3KL5A 4FA7B 3V6BR 3KPLA 5D7JB 1YPZE 2WQXA 3QE5A 4HIEB 4RCAA 5IROD 2OP4H 2JKWA 3VXOA 2ZG3A 5B1KA 3DV4B 2HTLC 3QI9A 5LBSA 2ZCHH 4NENA 1OTUD 5HSFA 3CK0H 4I7ZC 3EOTL 5C6TL 2WBJB 3PHQB 2IGFH 4YFLF 4EI5B 1FFOA 4HT1H 4PLOB 1DTUA 4UI2A 1KENH 3ZO0A 4Y19A 3GUTB 3QIUC 4E41B 1M9SA 1MW2A 2N1KA 2R0WH 3QGVA 3BRGC 2UZIL 5ENWA 1BEXA 2CHZA 2FIKA 4FQCH 3SSGA 2WJ7A 3BN9D 1FIGL 3V5HA 1RMFL 3VXME 1OCWH 4GINA 1TZGL 5D55A 5T1LB 1HS6A 3O45B 4NGHL 4WI9A 4HV8A 3CBRA 3D85B 5CS7A 5DWUL 3NCXA 3VYOA 1HCZA 1IC4H 1NGWB 1ZHNA 2V2XB 5F7NC 2JJSA 3MXVH 2EDNA 4CC4A 5K9QG 4LBAA 1CBJA 3BT2L 2YEQA 4MLSA 3HNSH 3CIAA 3JT0A 4E9SA 4GQZA 5DQJB 3SE9L 3V5DB 3OWRA 2BDNH 3ES6A 5E9AA 5EV7A 2IO5A 1IGFL 5A2LH 4X6CE 5B38B 1ZTXE 5K59E 3VQ2C 3BZEB 1XIWB 2UWEB 2E6JA 4KTEL 1Y6NR 3DDGA 4KNUA 1OZUA 3X1FA 4UV7L 2EE0A 1DFXA 3VFSB 5G4OA 2J8UE 3L4YA 3NPZB 3EOBA 3P9MB 2VERN 3S5LG 4APQA 1KWKA 1JBJA 2PPDA 3IMWA 3QDAA 2NNAA 5IBLD 3Q01A 5CBAB 2J5LC 2A9ML 3GBDA 4HK3J 4JE0A 4LDCA 4GKLA 4AJWA 2ZWKA 4R8WL 2XZQL 2A1WH 1PQZA 5L0QC 3UG5A 2GK0B 5IQ9A 2V5YA 5IHBA 1SBBA 4M8VA 3MNVB 4OFKA 3OLDA 1XSOA 3MLWH 4IBQA 3SKUD 4LCYA 4BFJA 2BWQA 4ZW6A 3QS2A 2ZX5A 4OZIB 1DBKH 3TASA 3F6LA 3VB8A 2ETWA 3C6LD 4HETA 4FHKA 1HL4A 3HRZB 2GITA 3ZUCA 1LTXA 1KZQA 3N1PC 3W57A 3JWNC 4UDUB 2KZWA 3LN4B 4LSRH 1BG9A 2XIDA 4L4VB 5FYKE 1M71B 3MCYA 2J21A 3O6KH 3VMPA 1Q9OB 5DD3H 3A6BH 3ECQA 1QEWB 3MRBB 1YUHB 3QO0B 3KWXA 3RDTB 4DZ8B 1HC1A 3QEUB 3L2NA 3JWDH 5SWZD 4I48B 5DZAA 3W9DB 4Q9RH 3OZLA 1XD1A 3SDAC 3L1OL 4UAOB 1GJWA 4XNYH 3OC8A 3NZ8A 3EDJA 1RHHB 4BUQA 3CFIC 1JJUA 2DWYA 3MGTA 5DVLA 3E9TA 5EU7C 4J3OC 1NFDB 3G6JB 4LPCA 5DLML 5E7FA 4WSKA 5EPMB 2VDPL 5DDHB 4PJ8C 3IGLA 1FPTH 4FP8L 4Y2NA 3CLEH 3U9WA 2IG2L 1OCRB 4LSPH 4K73A 3QRFM 4BZ1A 4WNJA 1F6AB 4KDTA 4NAJA 2JKXA 3VXUB 1ZVSA 1ET7A 3BC9A 4QEGA 3JYCA 3UBGA 4BQ9A 1XL6A 3CPLA 1LDPL 3C5XA 3FFCB 2F7OA 5T5FA 1P1VA 2EDHA 2ZWNA 3D4ZA 3CZEA 4MBRA 2NCEA 1OAKH 4PJBB 3E3QC 4PCSA 5DZ9A 4YEEA 3FNKA 1YPZA 1FH2A 3PWUA 5EO1B 3QIUB 3SY0B 3TO4D 2VL5B 4IMLA 1T04B 1PYWA 2CKBB 4WJG3 4OAWB 4OI7A 3KPNA 3OXRB 5LHDA 5D7EA 2HJLA 1II4E 3SDCD 1MLBB 4YDIL 2WO2B 3HI6L 4DTGH 1L6PA 1A1MA 2YJLA 3MV7B 5BO0D 1BOYA 3DJZA 5JXEA 5TH2A 1NDTA 4XHJD 2C4FU 1E9PB 1FH5L 1OGTB 5CCHE 3BKJL 2H6PA 3VXMA 4BFIB 1UH3A 3BXNA 5E24E 3F00A 3F7VA 3WNMA 1MRDH 2PP8A 4EQ2A 2A4EA 3E6HA 3BKYL 3L54A 1XVSA 2FBJL 5D72H 1R1CA 4R3SA 1K8DA 1SXZA 4PJAF 3DX8B 1XF4B 1NKOA 5IB1A 5TFSL 3NA9H 1KB9K 2MQGA 2R0ZH 4N9GB 5DFAA 5HDLA 3C2SA 4PVLA 5ERWA 5GGTH 3N0PB 1XBRA 1IARB 3T65B 4N2IA 1JVLA 4XX5A 1V7MH 2VSCA 3BP5B 1H6UA 1GYWA 5KSVB 2C3VA 4X6CA 2H4EA 4OB5L 3FRPG 4RSYA 5F7WC 4HFWB 1FV1B 5HJDA 4ZQTA 4UTAH 3IU4H 4KPHH 5LDSA 5IOPA 4LQFH 2HWZH 4JJ5B 3GFUA 3EXLA 3KPMB 5KYNA 3ZDZF 5L0QB 2ZUUA 3CBJB 2AXGB 1IEBB 1CLYH 2M1KA 4LDOB 2DQDL 3QR2A 2J8UA 1DZ0A 2QQLH 2H5UA 2HJFA 3EO0B 3QDJA 3RZCA 4GP8B 3AXIA 2J72A 1WTLA 1IILE 2ARJA 5EO0A 5JR1L 2CDEB 4G5ZH 1T0NA 3BHBA 4JHVA 1R3IH 4I3SH 3FQWA 4X7DC 5IIEB 2VT0A 1OIOA 5E94A 1NL0L 2EINB 2MQCA 3FUNA 4IBYA 4WHTB 4F20A 4F7TB 3K71A 3IE4A 2VITA 4MQ7B 3X3FL 3A22A 2D03L 5A3IC 5CR1A 1TU2B 1FL3B 4W68A 1VZHA 1CXHA 6FABH 5T1MA 1AMYA 3O11B 1OL0A 1UZ8A 4GBXB 1EFXD 4FZ8H 4TVSa 2W07A 3UPCA 2IFFL 3THML 3V9FA 1MREH 2OZ4A 2XZAH 4TVUA 3ZL4L 1JXDA 5FGBC 1HWWA 1QTSA 4QDGA 3LQAH 3SDAB 4UINL 2XV2A 1IGCH 3CMOH 5I8KL 4JHUA 1LD9B 2PWFA 1CYWA 2MHAB 2FYYB 3CFQA 5AOIA 3VQMA 1AZNA 1PW3A 2VLLA 2QSCH 3MOQA 4XC1H 1A65A 1FGNL 1FVDA 4KKCC 4UT9H 4R0LC 5C0RL 2MNWA 1NGYA 2OR9L 1BX2B 3IDMA 3BSHA 1TJGH 3FK3A 4LSTL 2YEZA 3C60C 2W65B 5IWLC 1UM4L 3V8OA 4ZAKC 4NC2B 4TPRH 4EF3A 3CXDL 2YD1A 2EDWA 4PHXA 4KI5E 4MD0A 5MEPB 2ZUTA 1NPJA 1P7QA 2XDHA 4HIPA 3NESA 3MLUL 2EDEA 2ICWB 4EIUA 2ODIA 2WGXA 3WKNA 1AO7E 1KDJA 4UV4L 2IQ9L 2NR6A 4MAZA 4TF4A 1M3JA 1RU9H 2HLFD 1NLBH 2Y5TA 4KKAD 3U1QA 3UYPB 3MRFB 5TE6L 5JUEH 1YNKH 1RIHH 3KYAA 3TNNB 5ABZA 5IB2B 3D18B 5KOMC 4N22A 2HKAA 2TRYA 3T0WA 5BNXD 2W95A 3G5XA 4UAHA 2FL5B 5KSUA 2BWDA 3RFZA 2N3JA 2H47C 3ZOAA 4EZLA 3CZLA 2N4IA 2WN3A 3GKWH 3VW3L 3BPOC 4QMEA 2EDTA 3LIUA 1MELA 3FSVA 4Q2ZA 4YZFE 3GB7B 3HNTH 4OCXL 4D0BA 3LN5A 2R27A 4U1NA 2Z91A 2G9HA 4FNUA 5EN2B 2CH8A 2NTFB 4RAVB 3DVFA 3ZIMA 5DU7A 5I18H 1NJ9B 3R1GL 4O2CA 3EJSA 2BXZA 4LB8A 1LMIA 2NNCA 2B0SL 2EDBA 1AS8A 3T0AA 5JOFB 4UUJA 3VFPA 3CZFB 4O02A 2Y6SC 4U1JB 2MMXA 3DXAD 4PS7A 3PHOB 1NEZG 1MHHA 3AG2B 1Q72H 3QW9A 5E8DH 1RUMH 2DYPA 2F5BL 4QF1B 5LB1A 5HYSB 1QQDA 1MFAL 2BCKB 1BREA 3MCLL 4JFQB 1A7NH 2GTWA 3H3PH 4TQIA 4WNQA 1ZGLA 1DVSA 1T6BX 3DUSB 3B7UX 5EZOH 3OM3B 4GO9A 4N6QA 3MVSA 1H6TA 2YD5A 3IFPB 1ZPUA 3SJVE 2BNUB 3RWDA 1J1OH 1N68A 3OD3A 5INDA 3EGXA 4LGSB 4TLSA 2HMID 1CXEA 2RIKA 3H9HB 1NDMB 1HKFA 2DQTL 3Q8AA 5JHDA 3OF6A 5AVYB 3DRTB 5E4EC 3SKNA 4X7EC 3CZKA 3D0AA 2J6EA 3WNLA 2YWYA 3APCA 4KK9C 4LDLB 1F4XL 3D0LA 4G1EA 4KITB 3RIAF 4GW5B 4FQIL 4J8RB 3VRJA 2XKNA 5DMJB 4L3CB 3OXSB 3ULUE 5KSBE 1I8MB 4XCFL 2BERA 3VXRB 5BMFL 1J9QA 4OD1H 4UIMB 1RK0B 3BGMB 1WT5C 3RVXC 2OXGB 3K4DA 4NWUL 2BSTB 5GRJL 3DJTA 1IAOA 1JGDA 2Z0UA 4DWHA 4C56D 3DX9B 3QQ3B 5CWSA 5SV4A 1FYHB 1MFEH 4RZCB 2P5WD 2Q1EA 3JWDC 4ALAL 5KVDH 3EJZC 5H2BB 3AXLB 2V5RA 1AR1B 2HKHH 2WYHA 1QHOA 4KO9A 3LRMA 4YXKH 1X7QB 5F72S 5K1VA 1F4YH 3VXSB 3FO0H 4A2MA 4XT1C 1EA9C 2DQGL 3RJOA 2GIXA 2H3XC 1C5BL 4R0LB 5GS2D 1A21A 4PGBA 4WFGE 3DMMD 2LE9A 3BI9X 5EBMA 4FNPA 5KSAA 4PRIE 5I76B 4IDJL 3TBSA 1TSRA 3QZBA 3P77B 2IQAA 4L8SA 5F1SA 1CTOA 3C60B 3MNZA 1RHFA 1ZLUK 4ZAKB 4G8GE 3LPOA 2JIXD 3N50A 1SXCA 3DA0A 4DP5X 2YAQA 1SHMA 1MFUA 1W0WA 4G8IB 3C8HA 2BH0A 1RY7B 4XMKH 1BOGA 1GTNA 3MYZA 1L9MA 3N04A 1IL1A 3V0WL 3VD9A 4S1SL 15C8H 3UX9B 2EYRA 3TVMD 1G9ML 1RUPH 2ITCB 5JHLA 4ACPA 4F33B 5D71H 4ZYKA 3U2IA 1GVIA 1TEYA 3NIDB 1P5UB 4QRQB 3RGVC 1R47A 3F7YA 1MI5D 4BCYA 1AO7A 1I8AA 5CZVH 2ZYHA 2QBWA 5C2BL 3QNYB 4LVEA 4EQ3A 1A1OA 2OW6A 3BPOB 3TA3D 1ODAA 4NRYB 3TA4D 1UURA 1N8OE 2XN0A 2ROXA 4J27A 2FT6A 2AHIA 4RGOL 2XUWA 3JUZA 3S97C 3VM7A 3WTVA 2J73A 4H0HB 2R0LH 1T4WA 4WK4B 2VLJD 3QHTC 2X2HA 4LLVA 4QTFA 2JE8A 1O7SA 2F54E 4F3FA 1A3LL 1L3WA 3EH1A 5HJGA 1R0AH 4R90H 3HE7D 1KYOJ 1ZA3A 2Y3NA 5IMLA 1E5AA 3OHXC 4BZ2H 1HX0A 1MJ8H 3ATEA 3EDDA 4H88H 4C4KO 4DP2X 2GABA 1JK8A 1KLGA 5BS0E 3NCEB 3B3IB 5IKCB 4MQXC 3T0DA 2UZYB 4LEOA 1GIGL 1LK3L 1SBSL 4OJEH 4YSCA 4GSXA 1B0RB 1XHHA 4U6VL 1ZJAA 4LLUA 1KJ2H 4NQED 1S9VB 4FMFA 2A77H 4HPOL 5B4MC 5TGBA 1J10A 1ETZB 2FD6L 3C08L 3R06B 5D93C 4Q6IC 3DYOA 2X3BA 1QYGH 5CJXC 1JRHI 1BHGA 4LRNH 3CN4A 1S3KH 2AGJL 3MLRH 1OY3B 1DQKA 1Z9PA 3QUZA 4XP4H 3QEQD 3JVFC 1FL5A 4HQQH 4FQXD 4V33A 3L3HB 4BQ8A 5IFJB 4YQXH 1R5VA 2DQCH 3HS0C 3MA7B 5B39A 2EKSB 2J56A 3T2OA 5LVEA 5E4EB 5CEZL 3C8DA 4A63A 4X5QA 2DQJH 2ZIDA 2WUBH 4JQVA 2VNCA 2BJMH 3A21A 3IKCB 2GT9B 3SJVA 2FO4B 4PRPD 2VB5A 3O3DA 4AX3A 3LPWA 1QZNA 3CDZA 2Y7MA 4IQHA 5TF0A 1U8MB 2IEPA 2H3NA 1VFOA 4ZUWB 4CADB 1PF3A 3FO1A 3RRQA 4PH8A 1BZQK 4ELMB 4H8WL 2IF7A 4M48L 4OF3A 4TSCH 3FB5A 3VWJC 3QXVA 4KHTH 5HDRA 1DR9A 4P48A 4KZ0A 1RVFL 2VWEC 4HP5A 3EOAA 4JDVB 1AKJB 1NTDA 3FPXA 3IKKA 1I8IA 3X3GH 2YRBA 3AAZA 3IETB 2DQFB 3BESR 4L29B 2V9TA 4TUUA 3ARBA 5D4JA 3QUXA 5B22A 4MXWL 5BRZD 2EIDA 3DOSA 3WBDA 5I1CH 3GIZH 3HZVA 4XOCA 4F7MB 3EBAA 1B4JL 2F53D 4M7LH 4U1GC 4UQ3B 1AGFB 5FYJE 4HCFA 4E5XB 1UA6H 4Z7WA 1NC2B 3OKMB 4A7SA 4Q9BA 1E6JL 2H2SD 3CC5A 2ZXWB 3RB5A 5FM8A 4LCWB 1KCUL 4PRIA 4ZOEA 4P5TD 5I1GH 2VQ1A 1JYXA 3NIFE 1DVUA 4UBDD 3H9YA 5I30H 1QTYT 2DEXX 2LTQC 2XKUA 3FHEA 1GGYA 4JPSA 3QDGE 4TQEL 4XVUD 4N86A 4AL8L 3O8XD 4PJ7F 2HH0L 3CFCL 4ZODA 4WUUD 2XC8A 2XA8L 4ZUUA 4NUQA 2PYEE 4BKSC 3RGVB 3CH1B 4GPVA 1N5AA 4KI5C 2QFPA 3GEWB 1L5GB 3QR1A 1DQML 1F2XK 1XF5A 4ODWA 5BVJA 5DJZB 3S37X 1UOVA 2AJSH 3QPQC 3EG9B 5B1JA 3SPIA 2OJEA 1U6AH 1WWCA 2BNQD 4LF3A 4D94A 4ISVB 2FATH 1JK9B 2XV3A 3NK3A 2GSGB 4BINA 4J12A 3K4AA 3AT9A 1YVLA 2K7QA 3L6FB 1D7CA 5D7KE 3LTVA 5CEXB 4PJEE 2FEEI 4K3DL 1JWUA 2EQDA 4D8PB 4P3DA 2VUOA 4WU7A 3EYSH 3GMMB 3WL9B 1GRWA 4PBVC 2W0LA 1N6UA 3MSPA 3CXHK 3NSDA 3PL6C 1TITA 2PN5A 4HUUB 4Y2LA 5D7LB 4WKZB 3S36H 9CGTA 4QT5A 3VFNB 2IBGA 1X5HA 2IJ0C 3MBEB 3T2NL 5FLUA 4OQTL 3ZVVA 1IM9A 2ZOUA 1BEYL 3MV9E 4NBXB 5HI5C 2OX5A 2F54A 4PJIF 3ROOB 3WD5L 2R23B 1J18A 4H8VA 1PZDA 1G7HA 4TUJA 5D93B 5TF1L 4Q6IB 3IMBA 3A5VA 3V2AR 4X5XB 3WLBB 2AV1A 1CDIA 4BFEA 5BS0A 1M42A 1I3RA 2B08A 3DARA 4OLEA 5F3BB 3EBGA 2WTPA 3ME0B 1S7TB 3MO1B 3ILQC 4E68A 3UTZB 5C09B 5ACZB 3HS0B 3VU1A 4A7TA 1I3GL 1CXIA 1R24B 4FXLA 4MSWA 5D2NB 5GRVL 4N2DA 3TESA 4JO1H 1A6AA 5CJOH 4NC1C 1O6VA 1OHZA 4UU9B 2MTPA 4YXLH 4XMTA 1IAKB 1VRSA 4D9LH 1GKOA 4JN2A 3H9ZA 3S3BB 1H8SA 4LLYB 3PAUA 2Z1KA 2UZPA 2JKLA 3V55A 5CZRA 2JELH 3V4VH 2BHYA 3PWNA 2Y3AA 5JDSB 4QHKJ 4U1KB 2AEPL 5DVMA 3A0OA 1FO0H 1QBLL 4OZHA 2DH2A 4G8FB 2GB2A 3VWJB 1X7TA 4LO9A 5KVFL 4HJ0C 4OM0L 5F0LB 3W0WB 1T2QL 1FL6A 4BQBA 3IDGA 2YPVL 3NEXA 1W8EA 1RUQH 5F1OB 2JKTM 4ZXBA 2FWOB 5T5NG 4J5VA 5K1JA 5SWSB 5IHUL 2CBOA 4M7JH 4KJWD 1JYNA 3NH7H 1DQIA 1YAIA 5C7ZA 1MCHA 2LU7A 5J13C 1G1KA 3O6FC 3SZKC 4N2HA 4RFNB 2NSXA 3H85A 3IAGC 3CTTA 3GRWL 1WFIA 1NCOA 4IRSD 1KGYE 5CJBA 4N0YH 1W72L 3CVDA 1U92A 1Q9KA 3L5XL 4LIQH 2KQNA 3SQBB 2D2CC 4WFFE 2EUWA 2Z35A 2AJZA 1SLWA 1OPGL 2HN7A 2NY7H 4YS4A 1U8CA 3LH2H 3HZYB 5HHNA 5DEGA 1J9CT 5IEKB 3GHBL 1GS7A 1AOZA 1HE8A 2IAMC 3K8LA 3ORJA 2FQGA 1CDGA 1HH6A 3H9SE 3ZE1E 1H8OA 1XGZA 1PY4A 2XIBA 3QHFH 2APWA 3QDGA 3TFKC 1LO4L 1JYWA 1IM3A 1T1WA 4KJPC 5IB5B 3RX9A 3K5SA 2DBLL 4W4NA 2YBRB 3UTSD 2J71A 2PYEA 3Q48A 4HOMA 3K0YA 5B3JF 1OALA 4JY6B 4NFBA 2N1TE 4XP5H 3LZFH 2DIAA 1BCIA 2CUIA 4K3HA 5A7EA 1MCJA 1JNHB 3PGDA 4APXB 2MPAH 3VFMA 3D3VD 1OAQL 2ZICA 3EF4A 3UAJD 5JOPE 2A0LD 5LCVH 3PL6B 1UYWL 4MA3B 1XGPB 2AKRB 1EGJH 2FSEB 2XPGB 4WW1A 5CCGE 3K2MC 3ZDYF 3H54A 2EDXA 2Y1AA 3Q8EA 4PJEA 3RIFF 1IBHA 4BD4A 1CR9L 4NQXA 4WUKL 1Q9WA 4YC2B 2P7TB 4XWOD 1NC4A 1OSZA 3FT3A 4XI5D 5F71A 4KUZH 4FFYL 5IJCC 1BGXL 3MBXH 3ZQXA 3HA0A 3INUH 3S4SA 1OE3A 3B2UD 3QNXB 3IDIA 5FHBH 3L7FB 5CZXD 2EDKA 1AHKA 1Q9LA 4FXGC 5B1AB 4FTDA 1QX1A 5IT2H 3MV9A 5C0CA 1Z3GH 5I1AA 5FIEA 3TIEA 4BH8B 4JRXE 3TO2B 1NGPH 3BQUD 1WIOA 1P84J 2APBA 5DURD 1GXEA 5KANG 1RJCA 4KV5F 5LUMA 3GJFH 2QLVB 4X6DE 2Q8AL 4HG4J 4HMDA 1GMIA 3V4PL 3BWAA 4GG6E 3L5HA 2PCPB 1O5PA 2WPGA 3VCLA 4QOKE 3P73A 5DTFA 1MIEH 1X5LA 4L5FH 5IVZA 5MP6H 2AJUH 2J6WA 2DQHH 1I85A 5JW3H 2D7PA 1E0OB 2JLPA 4X7SH 5D7SH 2D7NA 3FTXA 4AQ1C 1J1PH 4MRCA 3LKOB 3DTUB 2X70A 2ZWSA 2ENJA 4PSRA 2WOYA 4G6JL 3QYNA 2NY0D 2GCYA 1JF1B 2WLIB 1DQQB 5G55A 3TPUA 3K74B 4F7EA 2EH8H 3I9GH 4RFEA 5AAMC 5E8OB 2CGZA 2WXOA 3VI4E 5GRUH 1J5CA 4X8JA 3PFUA 4IRJC 4L4VE 4XVJL 1WZKA 3S35H 4KKPA 5J13B 1RZIA 4JG1H 3QIWD 1IBYA 1AZVA 3FQUA 3P9LB 1IO4C 3D6GA 1FDLH 3VXQA 2HLAB 3NABH 2YWZA 3PWJB 4KDVA 5LBGA 2WK2A 4XPGH 1XDTT 1U8QA 2EYTA 4XPFH 4QO1B 4CMMA 4PJHF 4AGPA 5DD1H 4QRSA 4P05A 4P3CH 1IQDA 2WVSA 1GZQB 3RWCB 3JV0A 1FNLA 4KDWA 2C3HA 5CLYA 4PR5A 2CIIB 2G5RA 1X5AA 4PI2A 4AYFB 4XP1L 3UYRH 1KJMB 3E9UA 2FIRT 4N2EA 3V52L 3V9CA 5C0BB 2JMRA 3ULVH 3H42L 4U6YB 3V0VB 3KYKH 5D1ZC 2ADFL 1UM5H 4JANB 5DJ0A 4ZFGH 4X4ME 2DWSA 3PP4H 4C58B 4FYQA 4FI8A 1INDL 3OJDA 3BZ4A 4K3EL 4Z0BL 3PDGA 4MCYA 5HYQB 5HJ3B 4QTIH 4N0CC 3H9SA 2D3JA 4YVUA 2GEEA 2Z4TA 2E0PA 4EOWH 3B1UA 3CFDA 2VISB 5DHVH 4Q9QH 4QXGL 5D7JA 4A7GA 3MFFA 3O6ML 1KTCA 1UB5A 4Y4HD 3MMEB 1W9XA 4UIKH 4HF5H 3ARYA 1WG3A 4K94L 4M5ZL 4FLOA 1F13A 3TOPA 4GXVH 3JV6A 2WBJA 3PHQA 3LQZB 3KWUA 1VACA 4G7VH 1N70A 4LASL 2C9QA 3L3KB 2MQ3A 4P23C 3IMRA 4MA1B 5E9DD 1IIIA 1KJ2B 5KVEH 3ARUA 4PGEB 1QASA 4KJYB 4RA0C 5I73C 2CZNA 1QSEB 3M45A 5T1LA 3FT1A 3UJTH 4YK4C 3O45A 4F5CE 4FXGB 4WFED 2BLFA 4JHAH 3D85A 3T6ZA 4U3CA 4H20H 1BM3H 2X0VA 4IKLA 2CLRB 3CHRA 4HIIA 4YHML 2V2XA 4ZMNA 4UM8A 1X6NA 4JFVA 4R26L 4YE4L 4DHLA 1R3KA 5C0FA 3ZE0F 3ARDC 1DBJH 3C6SB 5E0QA 5HHXL 4ODTH 1JZ8A 1OD7A 1TYJA 1HI6A 3EOTH 2A73B 4JRXA 4UQ2B 1XIWA 3MRHA 2ICWJ 5IBUB 5IEHA 4QRPD 1MCFA 5C6TH 5C0JB 5DUJA 2LFEA 5EIIG 1U42A 2DIJA 1H6FA 2OMZA 2W0FB 3TH2T 3MRNB 4E42A 1JIBA 3IAPA 4WHCA 1RZ7L 2UZIH 4NQQA 4WI3A 4GG6A 1A0QL 1UUNA 3DETC 1FIGH 3APDA 3FCTA 3CSTA 1W2KT 2QDVA 2VABB 3BPNC 3K91A 4HIJB 4QOKA 3GM0A 3HG1B 1CD1A 1TQUA 1W8NA 4NI6A 4NGHH 1A7PL 2APTA 3STBA 1OCZB 2E27L 3M1BB 2WOBA 1JNNL 2XFGB 2RHEA 3FAXA 1TNNA 4GH7B 2R69A 3MNVA 1KB5L 4KUCD 1BFSA 3KDMB 3BZDA 2UUDK 3BT2H 2IH1B 4HSAC 4NO0D 3K6SA 4P2AA 1CE6B 3C12A 2AANA 2P47B 3S98A 1YPZF 4IKKA 2XICA 4BFNA 1NAML 1IGFH 1TVBB 1YECL 3QRLA 5DZJA 3FU7A 3VI4A 3WN5B 3LN4A 2C34A 3QUYD 4H25B 3SGEH 4FL4B 4L4VA 4ZSOB 5BOJA 1M71A 3UC0H 5HDWA 1E5UI 1Q9OA 2G3XA 1YUHA 3QO0A 4DZ8A 3ROLB 3KW7A 1KV7A 3BVVA 4I48A 5GRYA 3W9DA 5E56A 4AQ8C 2WAHA 2A9MH 1TQVA 5K9JH 5EEXA 5DS2A 4R8WH 2XYBA 3CN1A 2XZQH 4H1LG 1ACYL 3TTSA 5KBPA 2P80D 2XWBB 3VB9A 4MZIA 5D1ZB 1BYNA 2LOEA 5E5UB 3MRPB 4F8QA 3TEWA 2QPFA 1V5JA 3ARFD 4N26A 2NY4B 4DVRL 2E7CA 1TF4A 3ZDXE 4UB0L 1ADQA 3BW9B 5DJCB 1BXUA 4R7VA 4MYPA 4BA0A 1T7VA 2XHNA 4TNFA 1TETL 4UWQB 3TBWB 3V79C 5IOKA 2CXGA 5IVOA 1F3JB 2Z92A 4S1DC 1Y18B 4X6CF 2CPCA 5I0DA 4X4MA 5JQIB 5B38G 1QVOB 1HK6A 5A7BA 3PP3K 2XG5B 5CLZA 2V2TB 3A47A 3U2SA 4AYGA 2BZ7A 4H8QA 3IPFA 1Q38A 4PJBA 4R4FH 2J8UF 2W8CA 1GJIA 1K8IA 4OM1L 2IPTL 1E90A 5JZ7C 5I16A 1HILB 2J25A 3C5ZC 1T04A 1CICA 2CKBA 2VUYA 2NY1D 1XCQB 4LLWA 4RGNC 3OXRA 5I73B 3F83A 1DCLA 2ZOLB 4JRFA 4YK4B 4DUWA 3D12B 5EFIB 4OLUL 4PB9H 1DJWA 2RA1A 4PTTB 4PY8J 3U9PH 2IG2H 1E9PA 5CKGA 1QFHA 5GGRY 2X4QA 5B1BB 4Z76B 1G9HA 1U95A 3BEVB 4BFIA 4FLSA 1HNGA 1DE4A 4G8AC 4DPRA 1W15A 4E9WA 4F5CA 5D1XD 5L6YH 1G9NC 1FIEA 5IUCA 4YX2H 5ICYB 1LDPH 1ONQB 4O2EA 4HUNB 4N28A 5KJ7E 2IIJA 3DX8A 3IEAA 2X6VA 4ES9A 1NCBL 1BIIB 1F11A 3NJXA 4KZDL 1KGXA 1P7KB 4N9GA 3NDYE 4GT0A 4X6FA 4KKZA 1VERA 4JREC 3L1GA 1S7XA 2X89A 1ZXKA 3MBWB 5I5JA 1O0VA 2XXGA 3T6XA 3V4VB 3WMPA 1U2HA 2ENSA 3L5IA 4DN3H 3CFKB 5IVXE 1WZ1L 3BPNB 4OZGE 4PCTA 1ES0A 5T3ZD 1FO0B 4JFDB 3QFDA 5B8CC 2HT2D 4YDIH 3HI6H 3N43F 4OV5A 2X1QA 1D6EB 2CMRL 2PP9A 2VCOA 3CDCA 2X2YA 1ZAGA 4JQIA 1SDDB 1GYVA 4LVNC 3NGBC 4L4TE 1CVSC 1FH5H 1NCIA 3FYEB 3FQTB 3EO0A 2YKKA 3BKJH 1PBYA 5CILL 1MUJB 4RGMB 3K6DA 4PP2B 4NP9A 2R7EB 3T0VA 4M93C 2CDEA 2DMHA 1CURA 3GM8A 3GK8L 3MRJA 1X3DA 3LY6A 5ABAA 4QWWC 3BGFB 3BKYH 5MERA 1BECA 4G6AC 2FBJH 3BUDA 2GK2A 3CZGA 4TNGA 2DJ4A 4F7TA 1U8LA 5TFSH 1M2VA 3GMNB 5EUOE 1MCWW 4KKNA 5F89B 3KPOA 2IMNA 3Q5OA 4MXQC 4RX4A 4GBXA 5HXMA 1F6LL 2XI9A 1MCQA 3ZE2B 5IGXH 2QGBA 2CD0A 2OXHB 3BVWA 3GZKA 2CK0L 3OTTA 4KK6C 4NRZA 4OKVA 1AG6A 1LM8V 4FEMA 1LD9A 4W81A 5E8NA 2FYYA 4I0CC 5AAWC 2DQDH 3ULVC 3VGGA 5BOZG 1OANA 1MFCH 3VFOA 2YQBA 3HG5A 2A74A 2DJUA 1A6TB 1EEUA 4X0NA 5IW1B 2Y7QB 4TNEA 2ADGA 1KCRH 2W65A 1IJ9A 3DPBB 4UQIM 3TCLA 3GXNA 3UBXB 3VM5A 1NL0H 1H15B 4U1IB 1IX2A 1TLKA 3I50L 2R4RL 2ZCLL 3MLPA 1QOKA 1ZA6A 3AREC 3KHQA 4K7PY 2D03H 4HGMA 4TVPL 2R8SL 4G9FD 1I3UA 1OP4A 4TS6A 2QSQA 4J2XA 1S5HB 5B3SB 3UACA 3L3GB 1NFIB 3FTGB 1O7DC 1O9ZA 3C9NB 3TEZA 1Q1PA 3OAYK 2IFFH 4RWHA 4Z95L 4NCDA 3THMH 5F1IA 3ZL4H 3UJIL 3O9WA 4FKKA 3D18A 2FX9H 3WY1A 1XR8A 4UINH 3MHZA 4F8PA 3TFBA 2E75C 5I8KH 2LT9A 4ZFOL 1YEKL 2GIYA 2FL5A 1AZCA 2ZX8A 3ETBJ 4BA8A 4AM0A 3FQXB 2PTVA 4RGNB 5HHOD 5I82A 1YC8A 2W5PA 3BIAX 4P9HL 5BW7C 5T3ZL 5C0RH 4MTMA 3MOAH 3VH8A 1FLRL 1XGTA 5E08L 1IC7L 2OR9H 2YN3A 4NNPL 3X12A 1YN6A 4U1SB 2B59B 2DQUL 4LSTH 3VWKB 2X41A 1GCYA 1UM4H 2O5ZL 3FTUA 1H5BC 3MACL 2BIMA 4Y4FA 3VXTB 3QPKA 4RAVA 4V2CB 1U3HA 5CUSL 3UABA 3WXWL 1NJ9A 4A68A 3ESMA 4K9JA 3VX1A 3GJFB 3JWNG 2IQ9H 4OD3L 3OGCA 3MZTA 3LKNB 3P2BA 2FDBP 2QMKA 1MH5B 3UXFA 5JOFA 2JJTC 3CZFA 5TE6H 5KJRL 5KVGH 2APVA 1YUKB 3PHOA 1C7SA 4LLQA 4P57A 7FABL 3QEGH 3ZO9A 5I1IL 2WKOA 2BOLA 3TT3L 5DEFB 4BFGA 1CGWA 4NKMB 1SVBA 3DUSA 4Y5XA 3L3OC 4JFZL 4GRLC 1CE1L 1F00I 2QR0B 5LGHH 4K7PX 4Q4IA 3LZPA 4P3WA 3R4RA 4Y2DD 5HGHB 1G84A 4RMTA 4J3OG 3DX4A 3NGBB 5E6YA 4DW2L 3M07A 4O2FB 1IGMH 1UT9A 1ZLDA 2B20A 3WE6B 3H9HA 3MYJB 4JO4L 1ZV9A 1NMCC 1YDPA 3OR6A 2W1NA 5IVXA 4QRRD 1HZHL 4M93B 4OZGA 3DRTA 4JFWA 1YY8B 2JCWA 5E8EA 4BFOA 2VC2L 4B27A 5IB3A 1XGYH 3R1GH 2VZSA 2ORBL 2XQYA 3MR9B 1Q1JL 2B0SH 3QNZB 3OXSA 3K81A 3N41B 4KRNA 4L4TA 5BRPA 1I8MA 1EXUA 4XB3A 5H37G 5T3XE 5H94B 4UIMA 3KZ8A 3QQDB 1RK0A 3SDDD 4R6UA 2H32A 1JNJA 5TDPA 2F5BH 1AI1L 4XOAA 4RIRA 1SY6L 1MFAH 2HRLA 1DVTA 1N4XH 1AXTL 2NXZB 3K0WA 3WFEL 2CJSA 4DP8X 2A6KB 3QXDB 4MJJA 3K2KA 2CAKA 2XG4B 1V3LA 2FQEA 3RX8A 3LRSB 5ID1A 2XU9A 5H2BA 1I9JL 3AXLA 3DBXB 4E9QA 3SCMC 2FLBT 3HPJB 5D1QE 4BCXA 7TAAA 25C8H 3MU3A 4LKXB 1NDGB 3J27A 1DANT 1JGVL 1G7JB 1HZKA 4YZFF 3PRZA 2IBZY 1KCLA 1R17A 2P4AB 2RB8A 2X3AA 4YL9A 5I76A 5C0DB 2VLKB 3ETTA 3BEWA 5E5MB 5KN5A 4EPSA 3P77A 1DVYA 1QFWL 1KCVH 3ISWA 2F15A 3IXAB 3LOWA 1O9WA 4FQIH 4M1GL 5I26A 3V7AG 5LGKA 3GINA 3HUJE 1A4KB 1HNYA 4IK6A 1QKZH 2JKSA 5BMFH 5DHVB 1QRNE 3GYRA 2X38A 2PYFB 4I2XB 5GRJH 4DN4L 5C0AE 4PWGA 5JHMA 1AQDB 5C70A 4XOBA 2WLMA 2ITCA 2E59A 1LQSR 1RJZB 5AVQB 1GGBL 5HYSG 1G4MA 1LEIB 2WVVB 4ALAH 4G42A 4BK5A 4BDVA 1P5UA 4QRQA 3M46A 2H0EA 4JFOB 1PZCA 5J0BA 3GTVA 5HHQA 4FOMA 4YNYB 2ZSVB 3LNGA 3QNYA 4PY7B 4LHUB 2L7EA 2XWXA 4XN2A 1QHPA 1X5GA 1C5BH 4NRYA 1S9YB 4ZW7A 3HMXH 3BN9C 3SGJA 1KUMA 4IDJH 2GBVA 1B0WA 2YQGA 4XMVA 1INQA 3UTTD 1FUNA 3G04B 4H13C 4CKVX 1CN4A 1QI5A 1H5BB 4JCWA 3U4AA 4P4KD 1IKNA 2VW6A 5EH1A 5IFAL 5ESQA 4GRWH 3KPQA 3TP4A 3RWEA 4N2OA 1QW9A 3ULUF 2DQIH 3U4EA 3V0WH 4S1SH 4JMXA 1G9MH 2D0FA 4P0DA 4HS3A 3OSKA 2IBZX 3K6NA 2C1PA 5IKCA 3HC3L 4N25A 2UZYA 2ESVB 4WGVB 2ZUYA 1B0RA 4ODBD 5DUMH 1TQCC 1OV8A 2BSSA 2Z4QB 1S9VA 3BWSA 5AVSB 5C09E 3RURA 3VSTA 4CVUA 5C2BH 3L3OB 1PDKA 1PFCA 1PTZA 5LJYH 4LPWA 3ZKND 1I1YB 3KAAA 4AEFA 2MFNA 1OOAA 4NOBA 3ATDA 1KY6A 3NRPA 4QHLA 3CZUB 4RGOH 1WA1X 4M8RA 1I75A 4TLUA 2J5WA 3G3LA 3DTXA 4FHBD 1K4DA 3FCGA 4ABWA 3L3HA 1S4IA 1NMCB 4M62L 2AZUA 3MA7A 3ABZA 4NQSB 1F90L 1FZJB 3L17A 3HKZA 3WJLC 1EX0A 4YSAA 2OI9C 1IT9L 2EDMA 5HDQL 1TFHA 2VW4A 3IKCA 3ZKMC 2GT9A 2FO4A 1Q94A 3ARGC 2EC8A 1JZEA 2M83A 3C6LC 1ZK5A 3SKJL 5FO8A 3S48A 4H8UA 3QAQA 3U82B 4LL9A 1C08A 1TTCA 3BT0A 3RWFB 1GIGH 1LK3H 1SBSH 3HZMA 4U6VH 2NYYD 4W9FC 4ELMA 4G11A 1R3JB 3RFRA 5CEZE 2BFVL 5AVRB 5IESL 2FD6H 3C08H 4CKQA 5DQ9B 5EDSA 1CQKA 1L9OA 2VQUA 3ETSA 3V4UL 2YAFA 1YNTA 2NZIA 4WWPA 3SCMB 2AJVL 3VGFA 1QFOA 2AGJH 4GAGL 5C0ND 5ES4B 5JW4R 2MPVA 5D4HA 4XN9A 2ZOTA 3IETA 2J1WA 1QLEL 1UC6A 3FUDA 4NNYA 4OCWL 4S10A 2XVLA 3WO4C 5GS2H 1LO2L 1G5AA 2WM0A 4F7MA 4WI4A 1QBBA 5E6RB 3PGFL 4UQ3A 1AGFA 3P4OB 5CMAB 1ZK9A 1NC2A 5D1QA 5DSCB 1V7NL 1RK7A 4X99A 1IV8A 1TEGA 2IDSA 4XCNA 2F74A 1BQLL 3PWPE 4LCWA 2BVUA 1AXIB 4NKOA 4RMBA 4GIOA 3MJ9A 3B9VA 3SYAA 3BYYA 3EFDL 1OAXL 1L9RA 4ZUTB 1F56A 1HHJB 4H8WH 5DUPL 1YYLH 1QRNA 1R5WB 2VSDA 3CH1A 4M4RA 4HWBA 2DLHA 1UADC 1OD9A 1RVFH 5C0AA 1J05A 4GKOA 1CYGA 1MQ8A 4NQDE 2EXWC 2ADJB 2Z8SA 12E8L 4R4ND 5DJZA 4X7CC 1QBML 4OFYA 3BUIA 3EG9A 1XV8A 1OWWA 2P8PA 3FPYA 4MXWH 5ALBL 2FYVA 3I3DA 3T0ED 1SFHA 2R2CA 4X8GA 2GSGA 3SDCC 4Z7VE 2R2EB 3KYMB 5IG7B 1B4JH 4IIQC 2F08A 4OCSL 1UXWB 3TJHD 3VYPA 4IHOB 2CO7B 3Q43A 3HR6A 4XHJC 2HVKA 2PXYA 4D8PA 3WELA 2WLNA 4MA8L 4PBXA 3GMMA 3I6KB 3WL9A 4F2MB 3WNNA 1KCUH 2EVFA 5AW2B 3TV3L 4HUUA 3BDBA 3STZB 4WKZA 4TQEH 2FT8A 5DRNB 4AL8H 3KGTA 3KNBA 2K3TA 4FFWD 2HH0H 3CFCH 3EIFA 2BP8B 4Q8BA 1S7QA 1HEZB 3MBEA 5HHVH 2B4CL 2XA8H 3NFPB 4WI6A 4AV0A 2AJYH 5GGTA 1TQCB 4JKNA 4F80A 2R23A 1HFUA 1L7IL 4FRWA 1ZWIA 5HI3C 1DQMH 3GTTA 3QAZC 2R4SL 1OLLA 1JGLL 4OBRA 1KPVA 5HYFA 3E7JA 5KBKA 2DS4A 1TQWA 3ME0A 3WDIA 4A6YA 3QFGA 5AW8B 1NCWL 1E27B 3KCWA 5C09A 2W60B 3BKML 3DRQB 4K3DH 4NIKB 5D2NA 1LLAA 1OF0A 4E5XG 2OI9B 1E5ZA 3OB0K 2E7HA 1ESOA 4EI5D 3MOBL 1M1SA 4XMUA 3FZUD 3NIFF 3C6LB 2W92A 4E41D 2AQNA 2WKGA 1EAPA 5J6HB 2HTKD 4OQTH 3CFMA 4XNAA 4YDNA 1JHKH 2LFGA 1HHGB 3NRFA 1KPRB 5DJAB 1MIMH 1MHEB 4AT6A 5JDSA 2ILLA 3DK2A 4U1KA 4MCMA 3ILPB 2KT6A 2QHLA 2K7PA 3ZTDC 2I5YL 3K46A 1AHWC 2C8NA 5C3TA 1T66D 1UWEL 3JXAA 4G8FA 5SWZB 1KYOK 3CX2A 4KXAA 5GJTL 4P2OD 2V9QA 4L3EE 3EKCA 1UFGA 1RZKH 3MPCA 1SF5A 3ECBA 4UT9A 2FWOA 5ECJE 1I3GH 3DX2A 3HHSB 3WO4B 2RFXA 4FA6A 5SWSA 4PJEF 4ICXA 2AQSA 1L4IA 4QJ5B 4GB9A 4MJ5B 4ZNCD 5DZLA 1CI3M 3H55A 1BVKA 4U6TA 2GG1A 3IPBA 4EMZA 2PP7A 4HK0B 3I2CH 1KIQA 2HRGA 1MLCB 4KK8D 1QLRA 3N42B 3MJ6A 2VE6B 5I9QC 4NX0A 1REIA 1TTBA 2OL3L 1WTGT 4DVBA 3FO2A 4HUXA 4OIBA 2AEPH 1D5MB 2WV3A 4KVNL 5D2LE 1IKFH 1PSKH 4P2QD 1CXKA 2LLGA 1QBLH 3HZYA 2HLFC 4KKAC 5IEKA 4P5SA 1KIPB 4LCIH 1MOEA 4ALAC 2JKIS 3UZQB 2GUOA 1ID5I 4IU2B 2WBWB 4B9KC 1T2QH 5BZZA 3L4TA 2VRKA 5D70L 3O2DL 3UG3A 2FSDA 3Q2NA 1KTLB 5IHUH 2QZ5A 2R15A 2YBRA 3SDCB 3MUGA 2FJUB 4IIQB 5ADPL 2PCFB 3HJ0A 1A1NA 1N59B 4H7VA 1LVEA 4TQHA 1GCFA 1E4WH 1OTTC 3GRWH 4NQDA 1OAYL 2F68X 1I31A 4PVMA 4NQCE 4H26B 3B7SA 2IOOA 1P4IL 1W72H 3P2DA 2W91A 2XWTB 3IXTB 3N44F 3L5XH 1JYVA 4Z7VA 1XGPA 1WIUA 3T8MA 1CLOH 2XOTA 1OPGH 4QHUA 1G9MC 2C9RA 3ZYOA 4LESA 1MNNA 3UBXI 2V4LA 3MV8E 3OX8B 4N24A 4A37A 4NFCA 2J1YA 5EOCL 4WJ5B 3MRRB 2G2NA 3LKSB 2AEWA 2XTJD 1ZCRA 3PWLA 3RKPA 4N8VA 1LO4H 2D31B 4BH7B 3QNXA 2EUZA 1N6VA 3L7FA 1BFVL 4WVRA 1RZGB 1CO1A 4J2QA 4RETB 3E0GA 3POCA 3QIBD 1AFVL 5FK9B 3WHE1 1SYSA 3LN9A 5DHXB 2HTLD 2JVUA 3TO2A 4HKJB 5LO7A 5EC2B 4NXKA 3L16A 3NDZE 4FYSA 5FYLD 1C1EL 1OAQH 4XTRC 5HHMD 3B34A 1UYWH 5L88L 3V6FB 5MHSE 1UOLA 4HZLB 3QIUD 1Z1WA 4ELKB 2B16A 2J2ZA 3GLDA 3T3ME 3CSBA 4WO4C 1BD2D 4ZUVA 1CR9H 4WUKH 5IVNA 1WPCA 3UAFA 4LBEB 1IBFA 4POUB 1M05B 3MV7D 4FFYH 1BGXH 4K55A 3LZOA 1W16A 3ZE1F 1AHWB 4DZBB 1EFXB 1JPGB 3NCFB 4A67A 4OVVA 4XAKE 2C1OB 4OJFH 4XBPB 5E95B 1WE5A 5A6IA 2O72A 3PJSB 1LEKB 3BD5A 2WLIA 3GPEA 4A7GF 4B0MB 4AGOA 5GS1A 1J5DA 3MRQB 3QQ4A 2ATPA 3GMQA 2AEQL 5CHNB 4LCUB 4MMYB 1I1RA 4LPTA 3TGXA 1Y07A 2X1WL 1BVNP 1YYML 4UNVA 4OV6F 1XSJA 2GJ6E 2DPKA 1G7IB 1DBAH 3RIKA 5KZCD 3P9LA 2Q8AH 2B9BA 1M6OA 3Q8BA 2VR4A 2CBMA 4JLRB 3V4PH 4L3EA 2WNXA 3PWJA 4U6XA 4GKNB 3OZ9L 4W70A 1MJJA 1BZDA 5DHYB 4QO1A 4PW4A 4PVBA 4DFHA 1SGKA 1NCTA 2AK4D 3UYOD 5DFWH 1IJNA 5I9QB 3FO9B 4JO2L 3DX6B 3TN0C 2BY0A 3TV8A 1A14H 3LRGA 1S2EA 4NQTA 1W8OA 2A99A 4LQ1A 3FUIA 4HUVB 1FBIL 2CSPA 4KFZC 3BP6B 2FO1A 3O3BA 5CD3B 3T3PE 4H8WC 3QXTA 1T83C 2YD9A 5FB8B 4G6JH 3RPIB 1ORSA 1H8LA 2WXFA 2X4PB 3G9VA 3VGDA 1JV5B 4M43L 5KYYA 1RJYA 4U6YA 3V0VA 1A3RH 2D9CA 4ZOAA 3QUMA 3HC4L 4JRYD 4RAUA 2DOCA 5D2LA 4JANA 4XVJH 5DMGD 5F7FA 3IU3B 4GLRH 1JP5A 2I69A 32C2A 3TA3C 1MHPH 2YO3A 5HJ3A 1A02N 4GO8A 2YUWA 1HOCB 2XWJB 4MGXA 5I0VA 5FA3B 1UJ3C 1RK1B 2VISA 4E2OA 1O6SA 4GG6F 3KEDA 5JYLA 1I8KA 4O00A 4GRWB 1OKEA 5FYLL 3MMEA 3EJTA 4JL1A 4WENB 3V0DA 3BO8A 3WJJA 3SDAD 4YDJB 3WFZA 4YLCA 3VXNB 2J12B 3PV7A 5DLLA 2SEBA 1VGEL 3F58L 3HE7C 5L8KB 4AL8C 2YFOA 4TUKL 4NQCA 1E42A 3S3PA 4LHQB 4FI6A 3L3KA 3DXAB 1BSIA 2QSVA 3V52H 2ZUWA 4PJ8D 2VSKB 1IVLA 1UH4A 5MENE 2A4CA 3CZNA 4LAQL 2D7TL 3H42H 3II3A 4N6RA 4N0RA 4PGEA 5I6LA 3PXLA 3O4LE 4J4PC 1YNLL 4WU5A 4P9MH 3MRDA 1FYTE 4K3EH 3VI4F 4Z0BH 3EFOA 2WKLA 2YRLA 2EC9U 3SKMB 2N7AA 4MJID 2CLRA 2HLEB 1HESA 1NZRA 4XNMB 2BIQA 3TWYA 4LEXH 5F7MC 1JZ4A 4PD4J 4QXGH 3H56A 2I07B 2JCCE 2QVFB 4JKWA 4A7QA 3O6MH 4YGVB 3L9EA 4RBPH 1J0JA 4FQJL 3NK4A 4NWTL 4OF0A 4K94H 3IAQA 3Q7JA 4M5ZH 4MD5B 4UQ2A 2FK9A 1M53A 4MMXA 4AITA 2F19L 2NY5L 1L0PA 3AACA 1A6UH 3HI1A 2Y9RT 3FU6A 3TXAA 3IRZA 3LKPA 3KLQA 4C56B 1MG3C 1ZRUA 1EAJA 3HG1A 3NRQA 3H2QA 4LFHD 2VGLM 4K9EH 3CHSA 1IC1A 2P5WB 1RSFA 2R0KL 1DJSA 1XSKA 1LJMA 3L48A 3MJ8A 2NQCA 3BN3B 4XXCA 5GIRA 3RGHA 1LE9A 3TBYA 1HH9B 4HJGB 3ZHDA 2VQTA 1WBYA 1NIEA 4K5OA 4U3HA 3VMNA 4YE4H 3VVVA 2OFQA 4PJBF 1MNUL 3DMMB 2CCVA 5CD5C 1CGTA 3N1MC 5HHXH 2G5BB 2I25N 4U6HA 4TNWF 4WK2B 3HMWL 1UH2A 1BAWA 1D5RA 1AGCB 1TVBA 1Y7VA 3S7GA 4G43B 4XMWA 2VZUA 3OB8A 1J11A 5D8JH 3WN5A 4DNLA 3F7PC 4ZSOA 2JIXB 3U0TB 1A5FL 2EEFA 1E28B 4P46C 2GJ6A 2H2SC 4OSUH 2D73A 4NO2B 3WGUB 4G6KH 1UKTA 4APQD 3UBFA 5F9JB 3MRMA 2HUEA 4O9HH 3HN5A 1P84K 2VJXA 3G5ZA 1WZAA 4H2AA 4P5TC 4UBDC 2AXHA 5E70A 1YQVL 1A0QH 3OPUA 4H5SB 4WI8A 3TVMB 2OMBA 2LV4A 1TO5A 2JLLA 2DM2A 5DRWA 2NUTA 3VXPB 4WI0A 4XVUC 4K8RL 4F92B 3O8XC 4DGVL 1A7PH 2E27H 3D06A 3KYOA 1CJYA 1F02I 2Y22A 1JNNH 1L6ZA 2XWBA 5CSZB 1MI5B 1EUUA 4FX5A 3JTTB 1QI3A 3VDCA 2X1OA 4NPYA 1MG2C 4Y4KC 4N2NA 3TA3B 2EAEA 1CLVA 5A3ID 2PPAA 3B2VH 3BW9A 4Y9FA 1D5BB 3ZMRA 2XTLA 4FS0A 1NAMH 4HC1L 4DGYL 1AR2A 4MZRA 1YECH 3TBWA 1NCAH 3OKOA 1CF1A 1FFRA 5L2KE 2ED6A 3P0VL 2VLJB 1QVOA 5LBSL 3IM1A 2DI8A 5IBUG 4MDJB 2V2TA 1UWXH 3B37A 2J88L 4PWFA 3HE7B 2B1OA 2APXA 1MCEA 3O6LL 4PVNA 4KKCD 3VXSD 2ZKWA 2LU3A 1A7RL 2XCMC 3U7YL 1GKEA 3PDOB 3EW3B 3U6XA 1R4XA 2QLYA 1HYRC 1FNHA 1ACYH 1XCQA 3RWGB 2VAAB 5DWPA 5I1JH 1E8ZA 1PJ9A 1ULVA 1PZ2A 1T0OA 3UGUA 3C60D 2ZOLA 5BO1L 2NY3C 3G9AB 4ZAKD 2IXQB 2VMDA 1CK0L 4LARH 2IGTA 2GBAA 3TU6A 2G2RA 3RHWK 4PTTA 4UB0H 3CHOA 4UZUA 2WUCL 4X6EB 2FX7L 4YLQT 4ZQKB 5MENA 3H7BB 3I75B 3B9AA 4WW2B 4Z76A 3QEQB 3WEBA 3QG7L 2H1XA 2VH5L 4FQXB 3O4LA 2K8QA 1AMXA 4Z78A 4F2EA 1EXHA 1PIFA 2Y7OA 1FYTA 3WJMB 2AAVA 2FLRT 4FYTA 5D7IB 1ONQA 3PFQA 4K5MA 3CQPA 1NCHA 2G75B 4U3SB 1UD4A 2CHXA 1UGNA 1SJHA 2BSED 1P7KA 4PRPB 3RWHA 2D0GA 3MBWA 4OM1H 2IPTH 2JCCA 3MFGB 3T71A 3QJFB 5GZNA 1MVUB 2NX5E 4HLEA 1HHHB 1U33A 3GSRB 1Z32X 4Y2OB 2DDQL 2UV3A 1YMME 1Z9MA 4FQQB 5L4JA 4B60A 3FTYA 2AQ3A 4NAMA 1FO0A 4IEFB 4EZKA 2OCCB 5JXED 1D6EA 1QI4A