3U4KA

Crystal structure of the receptor binding domain of plasmid-born adhesin mrkd1p of klebsiella pneumoniae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
163
structure length
163
Chain Sequence
GSSCWQSNSAYEINMAMGRVVVSPDLPVGSVIATKTWTMPDNNTIYVTCDRNTTLKSDAKVVAAGLVQGANKVYSTAIPGIGLRFSRKGAISMIYPDSYTTTGSSFRLAGSTFTLDIIKTSTTTGSGTLASGPYTEYGPGFTILKTSLNADAITIVSPSCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fimbria adhesin protein
publication title Crystal structure of the MrkD1P receptor binding domain of Klebsiella pneumoniae and identification of the human collagen V binding interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell adhesion
total genus 28
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2011-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u4kA00
3U4KA
chains in the Genus database with same CATH superfamily
5KBLA 4MMZA 3NRPA 3SGJA 3O2DL 4M6ML 5CJOL 5BNXD 1J0JA 2MPVA 4J4PD 1G7QB 1YY8B 1U92A 2ATPB 3VJ6B 3BYYA 3QG7H 2CDEA 1R5VA 4O2CA 1M7DB 1P6AB 5IVNA 3LNDA 1AG6A 4XGZB 5T1LA 5BW7A 3DV4B 4G9DB 1OT2A 4KXCA 1HE7A 3ULUC 3KGTA 3WKYA 3BUQA 5F9WB 3HAEG 4DKFL 5GRJH 2JB5H 3DPBA 2HUHA 5BOJA 1GGBL 5LN8A 1RK7A 1SY6H 4OQTA 4Y2NA 4UNIA 2R59A 4L8SA 4LSTH 5GRVK 5I1CL 4KKRA 4AXWB 4K7PX 1DBJH 3KWTA 3O45A 2GFBA 3UTSD 3V0AC 2FAUA 4JQXA 4K2UL 1YPZB 5FO9B 2VR8A 4CKVX 4AT6A 3QQNA 4JGJA 2DYRB 4PRIA 2APTA 2FT6A 1TCRA 1KTDB 3QZOA 3CPLA 3W38A 4JZOA 3Q7JA 3N85H 4U6YB 4QXTB 2FJSA 5HYSG 1RPKA 1QWUA 2LTQB 2IDTA 3IRPX 4UM8A 3A4EA 1CXLA 1DJYA 4CN4A 4FFZA 5ANMB 4Y1AA 1CICC 2C4FT 2D0HA 3RX8A 4ELMA 2YZ1A 3M1CA 4RCAA 3KLHD 4K94L 4P06A 4CC0A 4HPYL 1SNRA 3FUNA 3MRCB 4IGBD 3WTUA 5F7KC 4OB5L 3CZGA 4BHUI 1LO3L 4MD4B 4GSUA 5HPMA 2IJ0C 4N90E 4V1DE 3EGDA 4GSQA 3LSOB 3CFUA 3PAUA 3LKQA 5LXGL 4Q6IB 2PO6D 3FK3A 3ZGHA 4Y2DD 1IQDB 5CZXD 1ECZA 3FUKA 3BVWA 2O61A 4P46C 1Y18B 4NT6A 4RGOL 2FEEI 1A6TA 2J21A 3D0LA 2XWDA 3DVNA 3F64A 3M46A 1N5AA 3FO2B 5IMKA 5B1BB 4PJ7E 4NUJA 5I15L 3FQ1A 2IOOA 3DSFL 4I5BA 4KMTL 5IB3B 1LMKA 1PFCA 2F54D 2B15A 3QIUA 1N6QH 3N1QC 4PBWD 4XWOC 4OKVB 3X3FL 4OT1L 4JFDB 1ICTA 1NOAA 1TO4A 3PQYE 4NHCL 5EO9B 1DEDA 3NH7H 4WUUD 3JVGA 4QRRD 5A2AA 1W80A 4NRZB 4C56A 2HVBA 3KLLA 3MTXA 1WWAX 2P80A 3PJNA 4JQIH 4M5ZL 4MBRA 4JCMA 4ERSL 5KYXB 1IGYB 2KL6A 1H0DA 3EJRA 5JZ7D 1KY7A 3D48R 1BLIA 1ZT1B 4HIHB 5C0DB 1OAZL 3N44F 2VR6A 5D7JD 4XN9A 1M6OA 1MFAL 1MW0A 1DBBL 1RZKL 3G08A 1PX3A 3ARPA 4MNGB 2EDKA 4X5XA 1YN7A 2DIBA 4R7XA 2MRYA 3IXAB 3TURA 2EVGA 3WNIA 2OULB 3MRJB 3OAZH 3BZEB 1TQUA 1MJJB 5EIQA 5E99H 1WGOA 1EHLH 2P47B 5L2JB 3TF7C 4WDIB 4WFHE 1NCTA 1PS3A 2Z93B 1GGYA 3MXVL 4P5TC 3FHQA 3ARDA 4F9PA 3HS0B 4OM1H 3HZVB 2EDYA 2J5LB 1TZIA 5EMYA 1E8YA 2PWDA 4P4KD 4J8RA 4PD4K 4BIKA 3D4ZA 3H9YA 4Q56A 1OGAE 2FCBA 4QXUL 3PHOA 4PS8A 4OU3A 4PV8A 4GB9A 3QHTC 5DT1L 3TVMC 1MHHA 2JKTM 1P7QD 3VRIA 5DRXA 4P23C 1PNCA 1SM3H 1HDMA 1OAYL 5BOZG 1KTLB 1TJHH 4NWTH 2F8XC 1PYWB 2FBOJ 3FU6A 2AAAA 4O2EA 4JFEE 5BV7C 4BFFA 1X5FA 5DO2D 1ZDQA 2H9GB 1KJ2L 3UC0H 1MPAL 2CO4A 5G5DB 4B41A 1IMHC 4WO4D 1DBAH 5HHQB 3BUDA 5IM7B 3BWUC 1P69B 5EF2A 1X7QB 1JHKL 3DV6B 4JM2F 4RISL 2VMCA 2ZXBA 1MCPL 1CYXA 3K4AA 4C59B 2XZZA 2ESVB 4GQPH 1DHKA 3L16A 1P84J 5IBTH 3TEZA 1KY6A 3L5XH 4J1UB 3U4EB 5IW6B 4XI5C 2Y7QA 1SF5A 3BH8B 3NFSL 4HS8L 5EOTA 1JHLH 5F97E 3SY0B 2UY6A 4CNIB 1JF1A 1QFWM 2NY7L 5IR1B 4ZZFA 1WTLA 1KYAA 4KJPD 4NQED 2ZP9A 3P9MB 1SJHA 2VXTH 2MQCA 1MN4A 5EF3A 1TQSA 5AKSA 3WIFA 5TE4H 5IWLC 3BWAB 4NP4H 4OM0L 1P5UC 4YDIH 3WL9B 1AIZA 1KYOK 5EZPA 2ZSVB 3QZMA 4MMXA 4WHTA 1D5BB 2QMKA 2EUWA 2HJLA 3EOAB 4ORGA 5E94B 2AK4B 2UWEF 2H8PA 2ICWJ 3MUUA 3W0WD 3WIHL 5KYUB 2CDGB 2K0RA 4M5SA 4OJAA 3ZMEA 1YEIH 3APNA 4XOCA 1JRHH 5IFJA 3OXRA 3G6JE 1DUZA 4LCWD 1BFTA 3WDIA 3Q8CA 5CEZH 3HB3D 1MJ8H 3O9WD 3HS9A 1H3PL 3CVBA 4MNHB 1T83A 1YCSA 2OI9C 1JS4A 3HFML 3JVFC 3WXWL 1AAJA 2MOQA 4U7SA 1JWUA 3RZCA 3VCLB 3NMEA 5FGCB 4EIGB 4L3EA 2BVQB 1AE6H 4I48A 1QATA 5H2BB 5EUKB 5DA0B 3WO4C 5I8OL 5BRQA 3RA7L 3T65A 3NIGE 4WKXA 3FCGA 2OR9L 3TBTB 4E5XA 5HHMB 5C09A 2BVPB 5F6HJ 3R1GH 5AAMA 3FRUA 3B7UX 4H0LC 4N1CA 5INDB 3KEHA 4DESA 4R90L 1D5ZA 5D2LF 1R5WA 4QHLA 1YDPA 1G7MA 2MNWA 3HAEB 5E5MB 1U93A 5D1QA 5TDOA 3JV0A 3QGVA 5I1GL 1UWXK 4ABQA 3DX9B 1A4JA 3CFKB 3QISA 1JI2A 3DGCR 4LCVA 3CFEA 4NUQA 2P24B 4GKNA 5DTFA 5FB8A 1EUUA 5ECJE 1PJWA 2Y4SA 3NIFE 3GO1H 2Y3AA 1P4LA 5CNHA 2EE6A 1IEBA 2YXMA 3ZE2B 5AW4B 4AGMA 2F19H 3O3AA 1KZYA 2XJLA 3VFWB 3GI9H 3QFJB 4TTDD 5CZRA 5DS8B 1VKXA 4OTXL 1ZSDB 2P4AB 3GUTB 1KJMA 2FO8A 1WBXB 5F9JA 5HYSB 5BS0D 3TV3H 2DYPD 3MBEC 5GQBA 2MJWA 3F00A 4M93B 3RPIB 4WCYL 4J6RH 5F88B 2F54B 2XA8L 4JEGB 1U8QB 4KKAC 1DVXA 2X2YA 3IJ9A 2X4OB 3GDBA 3SB3A 2JJTA 2KLTA 4O2FB 4BINA 5JXAH 5IHBA 2RJMA 4YHML 1ET7A 3HHMA 4NS0A 8PAZA 1RAMA 1WEJH 2J4WH 1FG2A 3WIAA 4B9CA 3AACA 4AXWA 1V7NH 1QI5A 2G5UA 3CFTA 4TNVF 1FAIL 2CR3A 4Q52A 4LB8A 1YPZA 2F2HA 4DP7X 3MCYA 3N43B 3LQAC 2VDKL 3A22A 4JKPH 5BVPH 4EN3D 2LQRA 4YSUA 4PS3A 3GYRA 1OZUA 4RMTA 1E90A 3T3PB 4QXTA 4E42B 3FQTB 3MLRL 3TEWA 4BYHA 1T0NA 1X5ZA 1ID5I 1W72L 3VWKB 4I3SH 1JPEA 1EBPA 4IU2A 5BO1L 2WBWB 3US9A 5J57B 3SE9H 2OXHA 2CUMA 4ESKA 5C9KA 2EH8L 1MCBA 3WEAA 3QDAA 1A66A 3DRTB 3QUXC 4XPHL 2IH1B 1NGZB 1W91A 1PZ2A 4WHYH 5CEXA 4X6CB 5C07E 4EKXA 3MV8E 4Z7OF 1QSZA 2KBGA 2V6HA 1GVIA 1W8OA 2AV7B 5BJTA 4NO5B 4P4KB 3CK0L 5LGYA 1G1OA 1GYCA 5CIPB 4CVXA 4I18A 3BT0A 4XTRC 1EDYA 4GRWB 2G75A 3V0JA 5SWSA 5ID1A 1GGCH 3D06A 3UTTB 1WLHA 1AC0A 4APQC 1E30A 2DQDH 4WIQA 1J0KA 2J8UA 1RZGB 2F53D 1ZT7A 1E5UI 4ETQB 3T4YA 3AY4A 4NQCB 1P7QB 4Q9QL 1BQLH 2Y3NA 4CSZA 4PHXA 1Z1WA 1QW8A 3VGDA 3GSRA 3AAZB 3ECQA 4RESB 3ZTEA 3GEWB 4P2YA 4UQDA 3OC5A 1I9RL 2AEPH 5JW5B 5CGYC 2DWEB 4OKVA 4OZGB 1RVFH 1NBYA 1KIUB 3QSKB 4XNXL 3L9RB 1OTUC 1KN4L 1BQKA 4P9MH 2AQNA 4F7MA 1DVFD 1N9PA 5GZOD 4LSPH 4MHHI 1ZV9A 5E8EB 4NRZA 1XGTB 3VWJD 5D6CB 3TBSB 3IAPA 2BK8A 2DL2A 2J56A 3FPYA 1I7UB 4DTGL 3SDXB 5D1XB 4ZUVB 1BAFH 2AGJH 1X7TA 2VKWA 4Q6YA 4HIHA 1X5AA 1NCCL 4FYSA 3UG4A 2ZCLH 4P99A 3U1SL 5E24E 4IJTA 4KMLB 3QQDB 1DQTA 4P5RA 5T5FL 2EDDA 5DJAA 3TJPA 4FQ1H 12E8H 2ZWYA 2YN3A 3CNKA 3DX1A 3PAVA 3SYCA 5J12C 2EKJA 4WEUD 4R4FH 1N26A 1XDTT 5C0BD 1HL5A 4W9ZA 4XX1G 1T1ZB 3EJPA 5GS1B 4PJGB 4LESA 4QDGA 3V4UH 2EADA 2OL3H 2F5BL 4XCEA 3EJSA 1UCTA 5TGBA 5L7XH 2OR7A 1YEGH 1B4LA 3HZVA 4G6MH 1QUPA 3QDJD 5IB1A 5EO0B 2NY5C 3TH2T 3I9GH 3I74A 3NJHA 1AFVL 4NQVB 5A7EA 3MOBL 3GXPA 4JAMA 4KO6A 5I9QC 3E3QE 2A9NH 4PG2A 1DSFL 3GLZA 3EFOB 1MLBA 1R17A 4N8VA 4OF7A 1YC7A 2CNYA 3AZUA 3D1MC 4XP5H 1Q9WA 1UOVA 3L4UA 3U9WA 3BAEL 4DP5X 1YVLA 5I6XC 3S3BB 3TPUB 1C7SA 3EHBC 3GI8L 2YJLA 3OZLA 3OMZA 4LSUL 4Z7QB 4BWUA 1O6VA 3EYUL 4O4YH 1U30A 4P3CL 1YYML 4FQ2L 4PRBB 2FX8L 2YRZA 3VFSB 5I5RA 3S35X 5G5DA 3RTQA 4PFEA 2FGWL 1J12A 2B1OA 1KXVC 1CK0H 2FL5B 2A9DA 5LVEA 3L5WA 1HH9B 5IM7A 3I6SA 4R5TA 1A1MA 1D6EB 2I25N 3DV6A 1BM7A 2YGQA 3QFDB 3SJVE 2FO1A 4XN4A 5L8KB 1UZ8A 5C0EB 5K5YA 4N5UA 2ESVA 1BZEA 3H7BB 4HWZA 4U6VH 3WLBA 1G1CA 4Z77B 4GXUM 2ROYA 3FQNA 1T6WA 4QRQA 1MCQA 2GCYA 3FOLA 3ARBC 3PUCA 5KVEH 5FYKE 1KV7A 4ODSL 4Z0BL 1IE4A 2BS8A 2VQ1A 2W0KA 4W4OC 4YDJB 5F7MC 5GJSL 3IM1A 2P5WD 1NUDA 3T4AC 4BH8B 4PJAE 4PJDB 3C60D 4XZUA 3HBQA 3Q13A 2EEAA 1S7RA 5H37A 4PG9B 1JDAA 2AQ3A 2QPUA 2DYPB 5BS0B 1RH8A 5F7NC 2XN9A 4OF0A 1DN0B 5H8DA 1OP4A 4XWGL 3RKDD 4JPVH 3P3YA 1R3KA 5DWUH 4UAHA 1QNIA 1BMGA 1K5NB 2XY1A 4KKCD 2IANE 4FQCH 4PJIA 4H0GA 5HY9B 3QUKA 5JDSB 3GMNB 1ETB1 2DKUA 4DVBB 1AD0B 4PQXA 4Z5RA 1KLFA 2CD0A 1L0YA 1CI3M 1PZBA 1WV7T 3G7TA 4M7ZC 1NSNL 5D71L 2N01B 3WLWD 1CCZA 3MCKB 3GHBH 5J9PB 5CLWA 2QT6A 3CHOA 3V5DB 5F9DC 1A25A 3IJSA 2E7BA 5EUKA 3NJKA 1A7BA 3IDNB 1OF0A 1DZ0A 2HTLC 2X6UA 3WGUB 5B3NA 1NUNB 5IHUL 1SOKA 2BVPA 1N0XH 1Q90A 3GJEB 4CVWA 3KPTA 5JORA 5FYLH 5FGBC 2MQ0A 1NCAL 2WQUA 4R3SB 5L4IA 2OS7A 1BM3L 4NZ8A 4B96A 4LCCA 1CICB 4HH9B 3A4FA 1H15A 4LDOB 3SDYL 1NL0L 2XHNA 4DQOL 3U7YL 2D7TL 2R2HB 2Q7YB 5E2UL 1OW0A 2PP8A 1JFHA 3CFJB 2WO2B 2QMJA 4KK9D 3CFKA 2UZYA 4R83A 3K8LA 4I4WB 4XXWC 3KLHC 4LASH 1I8KB 4U1GC 4E41D 3IVKA 3QG7L 4Z23A 2B9BA 3GJFA 3QFJA 2F53B 4PRPB 5MHSE 1FCCA 1YNLH 3GZKA 3KGRA 2IOIA 4M8RA 1SFDA 2WQRA 5GRJL 4ZDHB 1QKZH 2X4TB 3IE9A 5IEKB 3ATDA 1SY6L 2AXFA 1S7TB 2BO0A 3HE6B 3N41F 4TL4A 1R4XA 4W9EC 4LSTL 5E4EC 4WGWB 5CFHA 1DBJL 1XF2B 4B9FA 4G9FA 4GUPB 4KTDH 5AFAA 1U8PB 3KD4A 2I24N 4ZAKD 4Z7WF 4YE4H 4Y9EA 2ZKHH 4KQ4H 4KZEH 4OQ1A 3AABA 4AE0A 2C9QA 2OMWB 3BJLA 3TA3B 1IEAB 3VFTA 2NX5B 1UM6L 5GIRB 5IB2A 1NMAH 1S5HA 5FHBH 3SDAC 3SPIA 1ZD6A 2XKNA 3N85L 3O4LE 4PLOB 5I73B 4MCYB 1II4E 2UX6A 4RAUB 4XPGL 3PWUA 1JWSA 4CGUB 5GRXG 2A0LD 3TXAA 5HVHB 1JVLA 5GSRB 3MJ7B 1TTAA 1PG7H 4HDIB 1FV1B 3F62A 4BFGA 1S3RA 2X89D 3LKPB 4YHNB 2ZOLB 2EE2A 5DZJA 5F1NB 1QHPA 3RFZB 3GLDA 4J28A 1T66C 5AW7B 1WD9A 4R2GC 4P5TB 1KFAH 4WNJA 5CD3B 1QQDB 2Z1KA 3ARED 3D50A 2V5RA 1MY5A 1FZMB 2Y06H 3HW7A 1FZKB 3OC8A 5HHOD 3WTSA 3QDJB 3TZVD 5G4MA 2ZOTA 3S2CA 1KSRA 1LM8V 4YHIA 1ZS8A 4AQZA 1OP3H 1KCLA 3TVMB 4ZFOL 4ACTA 4WEEA 1UWGH 5DJ8A 5AOKA 4HQQH 3ILPB 4RGNE 5MEND 2V7NB 3WD5H 1DQKA 1N6QL 4M29A 5I75B 3FO1A 3GSWB 4FOMA 4L1SA 2BNQE 4M4RA 4NQCA 5I8EB 3SZ6A 3B2UC 3U6XS 5A2KH 4KZ0A 1ETZA 1RJLA 1QAWA 4Y4HD 5JLZB 4NIKB 1LYQA 3W11C 3NH7L 4K7FB 2A4ZA 7TAAA 1YYLH 3Q5YA 3MV7B 4QOKD 3FN3A 4HCRA 4HZLA 2VISA 2V37A 1UASA 3LKNA 5JW5A 5TE6H 1KXTB 2YGVA 5FC9A 4JQIL 2PW1A 3L9RA 5I16A 5DHDA 3M6DA 4LGRB 5F3HA 3QDHA 4YAQA 5C0FA 2X1WL 4U1MB 5ES4B 2C3HA 3ATFA 3RUGE 1ND0B 3TBSA 4HAFA 5FYJE 1CFVH 4O02B 1OM9A 5MEPA 2ZWSA 3IRCA 4NN6B 1HXKA 4DAGH 3SO3C 4FX5A 1TZOA 3TN0C 2H0JA 5C1MB 5J6HB 4JGNA 3H56A 1UXMA 5E99L 1EHLL 4MQTB 3WDHA 5HHVH 3NZSA 3KPMB 4JN2A 4TXVB 5T1LD 2P5WB 1UD6A 2PTUA 5DK2B 2PETA 1MIEH 1QHQA 4OM1L 3C60B 3T09A 4BH7A 1T1ZA 2EDHA 3K6DA 5I0WA 1A6ZA 2C3VB 4G8IB 4F7EA 5JIHA 1AGEB 1NPJA 2XLLA 3DHMA 1Y6NR 2CM6A 4N68A 5H94B 1JUFA 5EUOF 4AMKH 3EOBB 2VDLB 3P9WB 3ZIMA 3OJVC 4YLCA 5I8KH 1SM3L 1A7RH 5HI4D 4NO2A 2PCFB 4ECNA 3ULVF 4IRSC 2QGBA 1OGSA 2PPCA 4GAAA 4LSRH 2V9RA 4PM1A 1F4HA 1JIBA 1LP9A 3K5SA 2P5EB 5DZLA 3WE6A 1JNNH 1DO5A 2IG2H 1NIBA 4G7QB 2WVTA 3H2PA 3L4WA 3UC0L 5DZOA 4KQ3H 1UT1A 5CSZA 1OP5K 2XNAB 1NBZB 5DK0A 2KZKA 3OKKA 2I5YH 5K39B 3AG2B 1DBAL 3AUVA 3OF6D 1U2YA 2JKXA 2CIIA 4PTTB 4PJXB 1ADQH 2A1WH 1JGLH 5DI8A 3QJSB 4W9KC 1DQDH 3G3LA 1C12B 4J3WA 2CDFB 5SWZD 2FL5A 1MFUA 3AQDA 1JGEB 4UUJB 3HRPA 5IBTL 5KZCD 4HSAC 1S9WA 3L5XL 3ZUNC 1HHGB 1F1GA 4FI8A 1JHLL 3OX8B 2BW5A 3UZVA 2LAGB 2H7WA 1URZA 4XC3L 1T2JA 3H7BA 1J18A 3QA3B 4JG0H 5KYYB 4WTZG 1NBVH 3MROA 1XWVA 3AWFA 2VXTL 2X40A 1F3JA 1E5AA 4Q0XH 1MJUH 1RSYA 4QF1B 3HG0A 2BFVH 3CCHB 2DIAA 1FNLA 4JO2H 4NP4L 5TE4L 4YDIL 4GP8B 2HTKD 3UADA 3ES6B 1ZDSA 3CH8A 4BH8A 4F33B 1AGDA 1S7XA 3BGMA 2FHBA 4V2BA 1XH1A 4F20A 3A4AA 4R97C 3MBEB 4PG9A 1YEIL 5IUCA 1JRHL 1W6WA 4C56D 5J1TC 1BWMA 3QQ3A 5ILTH 1GYVA 2K4AA 4TLKA 2XXCB 3B7RL 4LLDA 3HI1A 1XR9A 4NZFA 2P80D 3FUJA 1MJ8L 5CINH 5CEZL 2DIJA 4MD5B 2FSEB 1TPXC 3GXDA 1SQ2N 2VZOA 1EZSA 1ZVNA 1AE6L 3H6AA 3VFNA 1P4BH 3AC0A 4JN1H 5DQJA 2HJFB 3AROA 5K9JH 1OKEA 5F8RC 2AJ3A 3JT0A 3B9EA 3N1GC 3R1GL 5J9PA 2VIRB 3V5DA 1W8NA 3DI2B 2LHAA 1HI6B 4EUPG 1QX1A 2QKIC 2VLJE 5JHDA 4IMLB 4YHYC 3UERA 3I75B 3ARDD 1MCOH 2D2OA 5ICXB 2IO5A 3NGBC 1K3IA 3WTYA 3AU1A 1R1CA 1NANI 4JCLA 3II1A 4UINH 1CICA 4HH9A 4PVMA 2AK1H 3G5VA 3WU1A 3L3KB 1YJDC 3NEOA 3QEHA 1LO0H 1SJVA 1TZHB 3GO1L 3DXAB 4J3BA 2EKSB 4M6NH 2DI7A 2F19L 3LV3A 3IMWA 1T2XA 4P5KB 5I6MA 4YFEA 3GI9L 1YY9C 4NFBA 2L7QA 3WEBA 3ZE1F 1GAFH 5CEYB 3QQ9D 3MRIB 4OLWH 3TV3L 5C9JB 4P46A 2PLTA 4FE9A 3V52H 3T9WA 3OAYH 3PAZA 1J05A 3KJ6H 4PJ8C 4J6RL 3S8WA 4PP1D 4PRPA 5MENB 3KMDA 1H3TA 3RU8H 4TUJB 3ZKMD 4YO0A 4D8PA 5EORH 5E0FA 1T5XB 4X5QA 4Y4HB 5JXAL 5HVGB 2FYVA 3W82A 3SGKC 3D25B 5EZLB 2JTYA 1WEJL 4W9IC 1I1FB 4ZX6A 1S4IA 1NGPH 3NSXA 3HAEH 5F7EH 4F2FA 1XF2A 1V7NL 4QOKB 2E8ZA 4G8GD 3Q5TA 4N3TA 4YXHH 1L9QA 3PIQB 1E9PB 3ISRA 4HJTA 1PNDA 1C7TA 3UTQA 3NSDA 4JKPL 5BVPL 2VN4A 2ENQA 5DU7A 1F6LL 2WLLB 4DO5A 3O2VH 3EYVA 4Y1SA 4I3SL 4JKNA 2LU7A 1NC2D 3CFDA 3HNVH 4BHUA 4Y5YB 4PJCA 3N44B 1LWHA 2R0LH 3LRLA 5DQDH 2CBTA 4HDIA 1TZGH 2XVBA 2ALWA 3OB0K 1A6PA 4P2OC 3K4ZA 4ZSOE 2DMBA 5DUBB 1LEGB 3LZPA 5TQ0H 5F96H 2EZ0D 2ZOLA 2CKBA 3PRZA 4XN1A 4KPHH 4Q2ZB 5I1IH 3EDEA 5E8OA 4JQVC 1HNYA 4RMWA 1BX2A 1IFRA 4KRLB 3DMMC 4JY6A 2JMRA 1IKNC 1SXCA 4P5TA 3ZTJG 1GGCL 1BA9A 4FQQA 2DRUA 5KSBE 4O9HH 2AVGA 1VACA 1T6BX 5F1IB 3BSZA 2BP8B 1G6RB 3WJLC 5AKVA 4A67A 2WLZA 4IBVA 3M17A 1X5MA 3WHXA 1BQLL 4YXLH 3T3MF 1MELA 2AJVH 1K72A 5C0JB 1KLUA 2HLFC 2IBGA 4QLWA 1DFBH 5ADOH 3F6LA 1X5KA 1M1XB 1DVYA 3FFCD 3ARRA 3HG1B 1Q94A 5ENWA 4P23A 2AEPL 4NQDA 1T0OA 3GSWA 1MJ7H 4KKZA 2WLJA 4OV6F 2DKMA 1OT1A 1J9RA 2GB2A 3CG8A 1A6AA 4P9ML 4Y88A 4XNUH 3L4VA 1MWAL 3OR7A 5FUOH 5I6XB 1WIUA 1JGDA 1I7ZB 2NYKA 1V10A 4NZDA 4X4ZA 6PCYA 1PF3A 1G5GA 1JZEA 3JWDC 5CO1A 1KXTA 1FNAA 3CJJA 2PWGA 1R9FA 1O9ZA 1LNUB 2KDYA 5HHNB 5SWZB 2G0KA 1SDYA 1BAFL 2AGJL 2WNWA 2XV2A 5CIPH 4GQ9H 1KGIA 4GRWH 4KKBD 3T08A 3FO0H 2XPYA 1NCNA 3NP3A 2DTMH 3KPRA 2ZCLL 3GGWB 1ZLDA 4OLXH 2ZPKH 3DURA 2XWTA 4O02A 5KS9F 2Q86A 3QXAA 4FQ1L 1TJIH 4JM2B 2Q6WB 5J8OA 1X9QA 4OD1H 3D18B 4DFHA 1H8LA 4R4FL 1J9CT 3CDCA 1ZANH 3GM0A 2YA0A 2OR8A 2WP3O 3MFFA 4OCYH 4N5ED 3V4UL 2OL3L 2P49B 2X9YA 4Y1TA 1BHGA 4AI7A 5L7XL 3ZKNC 2HXAA 2AJZB 2YR3A 4Y4FD 1YEGL 3G5YB 2ADJA 3EZ8A 2NTFA 4KI5F 1CC3A 2E7MA 1DN2A 5C70A 4HS3A 2YA2A 4I0CC 3VMPA 5IWLA 1IAKB 1P5UA 1PTZA 2JCCE 3TNNB 3QUZB 2OMVA 5JNYB 1KOAA 5EDXA 1CYWA 3SDCD 2GUOB 4DQAA 1X7SA 1JGIA 1OHZA 2A9NL 3OG6B 2XTLA 3PWJB 3VXSA 3T6QC 1DSYA 3EOBA 4NUGH 4PJ5E 3LH9A 3TC9A 2ATKA 2ZUQC 3BVVA 3ELQA 5DS1A 1TTCA 2UWEB 4F8TA 4GUQA 3MV9D 4XP5L 2VR9A 1HCYA 4ZK8A 2ZOWA 3QR0A 4YZFF 5E2TH 2OMYB 2P5EA 4ZMTA 3ULVC 1QLFA 2E9GA 2J2ZB 3RBSA 3QW9A 4O4YL 1ERNA 1FL3B 1SLXA 2GAZA 3CC5B 5HHPB 5LNGA 4ZTOH 3JTSB 3WN5B 5B8CB 1HXMB 4RGMC 3QNZA 3BP7A 3V5KA 2AITA 3J8F7 2OX5B 1HYRC 1QRND 4GBXB 4IRZH 3V6FB 1MHCA 2AFNA 4W6YB 1EUTA 3O2WH 4LMQE 1BYPA 2HRPH 1WIPA 4KROD 2FQEA 4U6VL 3VD4A 1KBPA 2X0WA 4UUJA 1J87A 1D5RA 2HX8A 2AEQL 2HVKB 5D2LB 4TSCH 4UTBH 2HJKB 4F5CA 1CD9B 1WTGT 3MX0B 4M1GH 3WFHA 4WQOA 3KS0H 5KYYA 2H6PB 2GEQA 3VD2A 1V3LA 2AV1B 1YRKA 5DJ2A 4GT0A 4QF1A 1EERB 2UZPA 1AG0A 2CR6A 3LKOA 1TEGA 3ES6A 4JPVL 4K55A 5A6MA 5I76B 1UT2A 2W0PA 5DWUL 4EUPB 2AQRA 5I8CB 5DVNA 5IMMB 3PWNB 4FXLA 4FQCL 2F0CA 2ZP0T 3MBEA 4HFWA 1RUQH 4NKMA 4NO3A 2WQWA 4NQTA 3ARSA 3X17A 2QEJA 5F3FA 3VDAA 2W80C 3UTSE 1T4KA 2VLKA 2NW2B 2UVEA 5IHLB 2PABA 3TCLB 2J12B 4XBPB 2FR4A 5D1ZI 3LEVH 2OFQA 1FSKB 3FF8A 3GHBL 2OSWA 1FNEA 3TT1H 2W9LA 1QPXA 1Z9OA 2TSBA 1YMMA 3VXOA 5CP3H 2GUYA 3DVIA 4LLUA 1A6WH 2HG5B 3T1FB 3NQIA 5EIIA 4EI6A 1BOGA 1B2YA 1N0XL 1NC2B 4HCGA 1KLGA 2JWYA 2FBJH 2VIRA 1RZ7H 4ZW5A 3FQXB 3EO0A 3TP4A 1PD6A 2OZ4H 4IKNA 1UM4H 4IEFA 2H6UA 4I0PD 1W0WB 4HALA 5IVXA 3VFUA 4BCZA 4M8VA 4XNMA 2IQAA 5BUAA 1OTSC 4DT2A 3FCSB 4H1LG 5J1SC 3U1PA 1PZCA 1ET8A 3W3BA 3UEZA 3V0IA 3TIEB 3QUXA 3DBXB 1EO7A 4LASL 1IBHA 32C2A 5C3TA 2WXJA 1DBKL 2GSMB 4P5KA 3K6SB 1A2YB 4Z7OB 2EYTB 1I53A 1YNLL 6TAAA 1J9SA 5D1ZC 4APQA 4AYEC 3WENA 1QKZL 4POYA 3VD0A 4AYMC 4ANUA 3RWDB 3PL6D 1JF5A 3CFBA 1V05A 3CDYA 3ET9F 4G2AA 4NEHB 4P59H 3FFCB 4MMYA 2Y0SA 5LBSA 1PCXA 4OCRL 3O3EB 4EVNB 3LIZA 2BVUA 1Q9LB 4KTDL 2WKLA 3SPCA 3N42F 2VR3A 4YE4L 2ZKHL 4KQ4L 4XNDA 2CHNA 4GG8B 2RFXA 4LFHG 4WUUE 4QRRE 2R0ZH 2CBQA 1NMAL 5FHBL 2JKLA 4QI3A 4E2OA 1MH5A 2IXQB 5EEYA 2NY6D 2VZVA 2WAQA 5FCSH 4QJ4B 3QULB 1G7PA 2EXYD 2WXPA 4O58H 4X6DA 2B7DT 5JW4R 3IGLA 1HVXA 3LXCA 1PFOA 3FHAA 2A74B 4Z7UF 3AXLA 9CGTA 3OLGA 5JW4M 3PHSA 5DJ6B 3ZO9A 1E42A 1E6JH 2GEEA 1PG7L 2FLMA 2EXWC 5F7DB 1L0XA 4E68A 1JAEA 1UKQA 1VJSA 1XGUA 3ESNA 3P0YH 4HBQA 4OD2A 1C16B 5DFVC 2PYEA 5DZ9A 3BN3B 3GTVA 5E7BA 4FG6C 4H0HB 4K15A 2V3DA 1FZJA 2XN9D 2X38A 4ZOBA 2Q2LA 2GJ6D 3MGOA 1KFAL 3RDTB 3PREA 3R18A 3UYPA 4YGVB 4TUOB 2W9EH 5MERA 1Q38A 4Y4FB 7PAZA 2J8OA 1XEDA 1N7MH 3HPLB 5BUGA 3BJ91 5C0AB 3ALPA 2A9ML 3F7YA 4AOFA 1HEZB 1FO0A 2JFCA 3JWOC 3T77A 1SBSH 1J8HA 1DE4A 1EGJA 4DP6X 1UWGL 2AMGA 1G6RA 2GY7B 4HQQL 3QNYB 3DHPA 4MB3A 4WI5A 3WD5L 1EAJA 2H2SD 3BSGA 3KR3H 3OZKA 4N0UB 5A16B 3KYMB 3MV9B 4ODUB 5E8NA 3V0GA 4LCUB 1KWGA 3VFOB 3JV5A 4X0NA 4H2AA 3ZTNH 3DUUA 1YYLL 2X70B 2EDTA 2IDFA 3SCMD 2WNXA 1PLCA 5TE6L 3C6SA 2O6FA 3VQ2C 1FVCB 4MSWB 1OAJA 3KPLB 4QRPD 3WUZA 4XMWA 5BXFA 5CP7A 3TL5A 5IREA 1F6FB 4L1LA 3VFVA 2HX9A 4PB0H 5CMAB 3WFBH 4G82A 4NKDB 3US1A 1QRNB 1CFVL 2SODB 1PX8A 1UB5A 3DOSA 3BSZH 1KXVA 2UXFA 4WK4B 1CGXA 4KROB 3L5IA 1IBYA 5D93B 4ZBJA 1IEHA 4ETYA 3BZ5A 5LCVH 3B56A 1BVLB 4OH2A 5F93C 4KNUA 4B9ZA 3P30H 5HHVL 3N0PB 3DETC 2GTWA 4MA7H 1CWVA 2Q6WA 5HYJA 4JDTH 5JHLH 4NQEE 2OMBA 1MIEL 3ARBA 1I1CA 3IU3A 4PJ9C 3HNTH 3RWCB 1ZLUH 3OGCB 1INQB 5DJXB 4W4OA 25C8H 1R3LA 1KGUA 3QUHA 4Y5VB 1BV8A 3UBHA 1ACCA 4HGMA 3WKML 3T4AA 1DZBA 2AJZA 4G80A 2QGDA 4R97B 2XQYG 4LLVB 1ASQA 5D96C 1TVHB 4X9FA 3WNJA 4EI5D 2JB6A 3QZNA 3W0WE 4Q97A 4DGYH 1AGFB 4ZNCD 3UAAA 5I8KL 3TNNA 4KI5C 1A7RL 3ARGA 4LCWE 5JNYA 1GKEA 2OSXA 3VFPA 3QEQE 1CD1B 4FQIH 4H26B 1OM3H 4LSRL 4O02H 1CVSC 3JUZA 1CFNB 3PWJA 5DMGC 3STLB 3F01A 5BVJA 1OF2A 1JNNL 4PGDB 2IG2L 2QLVB 4TSBH 4FA8A 1SYVA 3S37X 4FABH 4N0CD 3UCQA 1HQRA 4KFMA 4UU9A 3A3YB 3L95B 4PV9B 5CBEA 2K3TA 2I5YL 3IDGA 3OSKA 5KSAA 4GW4B 3VSQA 4MFHA 2F8OA 1RK1A 2W0LA 2OMYA 5EBMB 1ADQL 2G9HA 1E2ZA 1WC7B 1JGLL 2A1WL 2G3XA 1EO5A 2GIXA 1DQDL 1NCBH 3EO9H 4QRAA 3S48A 5DMJB 3VXRE 5FR3A 1SJXA 1IARB 5EZOH 3UBGA 4B9PA 1P7KB 1B0WA 2X1XR 5BZXA 2QKIB 1G87A 2FEDD 2BNUA 3HI5H 5SV3A 1P84K 4YHYB 2XC8A 1BQHA 4I0PB 3V6FA 5GGRA 3S88H 5FGBA 4BA0A 3CSGA 1RUMH 1X5HA 2VDLH 3P3TA 1KJ3H 4IQHA 1I3RB 1NBVL 1UCBH 4AITA 1N0LB 1YQVL 4XCNA 4Q0XL 1MJUL 3VSVA 1S3KH 5ACZA 2WMPB 1F58H 4YDVB 2BFVL 2EIEA 3EJZC 1AANA 2VRAA 3MX0A 3C2SA 3HI6H 5ITBH 2FNBA 4RMVA 4XXWA 1E2WA 2H6PA 3L4ZA 3H6JA 5M95B 2BZ7A 3R0MA 5IT2H 3EJUA 4X6EB 5BS0E 1J1XL 1PKQA 5ILTL 4HOWA 3RGBA 4IRJD 2N56A 4GYBA 5CINL 1ORQB 4ES9A 3PYCA 3ZT7A 1SHSA 2VUYA 2YGPA 1T5WB 4WHDA 5KYWB 3BZDA 2OYLA 1S7UB 4BFIB 4HWBA 4F92B 4L8DA 4D0CB 1P4BL 1BBDH 4H1LB 4JN1L 1O6SA 2PPFA 4NZRH 3FQWB 4LK4A 2D4FA 3N41B 1QA9B 2WANA 5K9JL 1TZ8A 2BNRA 1ZLSH 1EEZA 4Z0XA 1K8DA 2VN7A 4X5WA 4AVKA 4NNXA 4PJFA 2JCWA 5HGGS 3BGFC 4Z7WB 5F1KC 3D3VA 3OV6A 3SDAA 1N12A 5EZJB 1LL1A 2BCMA 4XNYH 2QFRA 4HUXA 3MRHA 4U7KA 1MCOL 3L4TA 3ZSTA 4C57C 1EFQA 4OCSH 4ZPTA 2VITB 1PZDA 5GS0H 3MRKB 4J27A 4LIQH 4KK8D 4ZUUB 2AK1L 5AKTA 5EOCH 1LO0L 4K94C 5KN5B 1UVQA 5DLML 4A2GA 2ZCKL 4PWGA 3MA7B 4YDZA 2YUVA 4C83B 3A6BH 2YC1B 3PNWA 3ARFD 3EYQC 4M6NL 2WXHA 4K0OA 4FN0A 4HK0A 1R75A 3VGEA 3DMMB 1IBZA 2EH7H 5JOFB 1GAFL 1LK2B 4NJAH 4TVPE 4PMFA 4OLWL 3LXBA 2N7SA 3V52L 3KHOA 4AMWA 2A4EA 3VSUA 3P4NA 3KJ6L 5AYUH 2DQEH 4XPFH 3RU8L 1UD3A 4G7VH 5EORL 4ADJA 5LUMA 2XVKA 1ZTXH 3H9SD 1KIQB 3POCA 4QKTA 3ABZA 2ADYA 2Y1VA 4L3CB 4FEMA 2B1AH 1NGPL 1QD0A 3L9YA 4UQIM 3IYLW 4L2YA 5F7EL 5FK9B 5SV4A 1AKJD 3SCMB 3O3EA 5EEWA 2C1PA 1E28B 2OZNA 2WZ5A 1TOXA 4QHKJ 5LQBH 1CFTB 2F1BA 4MA3B 2R69H 4XO9A 2V9TA 3OKEB 1YYCA 1Z9PA 1EAPB 3ILDA 4WK2B 4YNYB 4PJ7F 3BWSA 2DMCA 1S7QA 4I3GA 2NXYD 3O2VL 2C3WA 3RVWD 4HLJA 3HNVL 1P7BA 2XX1A 1RZKC 4C4KO 3LZOA 4HU2A 3VYNA 4Q89A 4JFOB 2IWEA 5DJDA 4N8CH 2R0LL 5DQDL 1OAUH 3F7KA 3F05A 1YAZA 1TZGL 3OKMB 4I88A 3TN0A 5C0BE 4HHWA 4XHJC 1FN4B 1G7HB 1OQXA 5TQ0L 1OB1B 5F96L 4R7NB 1F3DH 3C8KA 4KPHL 5I1IL 2ZD0A 2ADGA 3PWLB 4NQSA 3V0VB 1NCHA 1KGYE 4ANVA 3ULUD 4R4NC 4TUOA 1BGXH 2R4SH 1G9ML 5E6IB 3MRNA 1P6FA 2IFFH 1E3ZA 4O9HL 4L23A 1MXGA 3D33A 3B3IB 1H3VA 2CBOA 4GRMB 4EI5B 3ZRCC 4HXBL 1C5CH 1USQA 4N1EA 5C0AA 4TUUA 1AZUA 1ZLEA 4M61B 2FJHA 4U1HA 4YXLL 4NC1C 4YFLF 3BKYH 3IDIA 2C5DC 1DFBL 4QHNA 5EC2A 5ADOL 3EH2A 2AXGB 2VSKB 4BZYA 3OKDA 5M94B 2PYFA 2J6EL 4X0KA 2ZUQB 4YC2C 4M5YH 4DEWA 2EDFA 5JOEA 4X98B 1MJ7L 2IPKA 5EUOB 3KDMB 4IRSA 1ZVYA 3IETB 3X3GH 4X4ME 3WUWG 2AQ1A 3DX7A 3DPDA 5FUOL 2I27N 1JZ3A 4ZS6C 5AZUA 1ET5A 5ESVB 2O6PA 1RHHA 3I3EA 3MUGA 2W5PA 4XX1E 5DRNA 5CKAA 5DHXB 5CD5C 1D5IH 3IJHB 1ZHKB 3FW6A 4AUYA 4WFGD 5GGSY 4DPCX 4ENED 3K71B 3FMGH 3KPLA 4Y5XC 2P42B 3ENEA 4FLHA 4GQ9L 3LZLA 1A9VA 3FO0L 1TKWA 2DBLL 3VW3H 2DTML 4BXVA 4FYRA 1LEIB 3OAWA 4OLXL 2ZPKL 2PW2A 4LEOA 3VTAA 5IMOA 3HMWH 3DARA 1G6RH 2FEJA 1TJIL 2NY5H 5J11C 3KVPA 4KRPC 4OD1L 4HHAB 3VFRA 3P4MB 2BPBA 1ZANL 3BP6B 2C8NA 3P3RA 4OLUH 4JHWH 2X4RA 4OCYL 1S9VA 4LCYA 3RBGA 2XG5B 2IBZY 3ZO0A 2KQMA 4AM0Q 3C5ZC 1LK3H 3QC6X 1MCCA 5K33A 2BP5M 1WRFA 5CJQH 1I1AD 2X53A 2P9RA 4HUNB 4HIXH 4XNAA 3MODH 4A2LA 3UZQA 4IRJB 2ED7A 3CSTA 4DZ8B 5C8JA 1I82A 1EX0A 1UH4A 3X1BA 4PJBA 1UB6B 3L9BA 4NUGL 2VNCA 3UTOA 4IOIA 2L04A 4FQJH 3V7AG 4KK5D 3VD1A 2Y72A 2FWOA 3L3HA 1WFIA 2ZUTA 1PDKB 5EBGA 3MLTB 1ZA3A 2R23B 4QHUB 2V2XA 4PGDA 4GUOA 2V5TA 1UA7A 5H35B 2Q8BH 1OV8A 2P28B 2W65B 3MJGX 3EH1A 4KKQA 3T2PA 5IQOA 4ZTOL 4G1MA 3HRZB 3VO0A 4YHPB 3KL3A 1YUHA 4OF5A 4IRZL 4Y19A 3F84A 2VABA 4PR5A 3RWEB 2V8LA 3G6JF 4K71C 1ANUA 3GRWH 3O2WL 2HRPL 1MRFL 5SWQA 5CHNB 2NSXA 3QCTH 5DRWA 5HD8D 5F7BA 2QQQA 4KJWC 3X1GA 4EOWL 1V5JA 1U8NA 4TSCL 1Q9OB 4UTBL 2ITCB 3ARFB 3CH1B 1QEWB 4M1GL 3VFGH 1SXSA 2NNAB 4OFYA 3JYBA 3NIGF 4AVIA 1VFMA 3V0WH 4E41E 3RL1B 4J3OC 2LOEA 4NUPA 3ZHNA 4C55A 4G8EB 5BZWA 1LLAA 4OZIA 2QPFA 4NJ9H 3OXSB 4NQDD 4FQHA 3M7FB 2ZWLT 4Z3FA 5GZNC 3JZYA 5LGHH 2WHVA 2G5BB 3F58H 4S11A 2Y6SD 3ZSSA 1RUQL 4X6EA 3ZE1B 3IFPB 3MGAA 3WMPA 1QI3A 1XL6A 3H9SB 4PJ8A 5FUCE 3RY6C 3ZE0E 4ENZA 1AKJB 4LRIC 3NIFF 4M02A 3DVGA 1QVOA 4JPKL 5FGRA 5KYWA 5C0CB 5DEFA 3IMVA 3LEVL 4FL4C 5AWNH 3TT1L 5L2KD 4D0CA 1FCGA 3VXQB 5TK4A 1A64A 3WI9A 4D2NA 1HTYA 1QA9A 2B9AA 4UDUB 2IDUA 1BJ1H 5E56A 4CN6A 1A6WL 1LO2H 3SD5A 3B6SB 5LBGA 4G3YH 3VGFA 2FLRT 4NM8H 4AGNA 3MYZA 4Z7WA 3VI4F 2WAHA 4QO1A 1KNOB 2OZ4L 3Q3GB 1KXQE 2WNGA 3MJ9A 3MLXH 2JV6A 2QGEA 1H3GA 3BFOA 3FN9A 1UM4L 4R96B 4KJQC 3O11B 1NDGB 4BSVA 1PX4A 1ZLVH 2H32A 4RLDA 2XN0A 4EUPH 1F2XK 1IIIA 1M9WA 2CHDA 2P8PA 2NNCA 4HJJH 4NAMA 2YARA 4A7GA 1H5BC 2FECL 1MQ8A 2D4DA 3NCFB 1SVCP 4WEMB 2C26A 3KPQA 3LKRB 4P2OA 3RGVC 2WWOA 1K6QL 2EIJB 3VXSD 2Y5QA 5ICUA 5I19H 5HHOE 4JQVA 1OTTC 3ETBF 3Q48A 3DMMA 3KPPB 4WJKB 1IKNA 1KIRA 3T2NH 4KO5A 3CMGA 4ZMOA 5JOFA 5AYQA 1ACYH 3KM1A 1JK8B 1AHKA 4U1LA 5I18H 4MA1B 3MRRA 3BP4B 4P59L 5IF0B 4NKIH 1C5DA 3VXUA 4LEXH 4L9LC 1N68A 1IBDA 5I26A 5ISZD 5MI0B 5B4MC 3PP3K 4CILA 4YZWA 5C0RH 1L6ZA 2VERA 5JDJA 1JZDC 3NCXA 1D9KD 4HIIB 3TWCH 2JSFA 3IBEA 5LKNA 2VUKA 3Q9PA 3T3MB 1B0GB 3CIQA 3DTXB 2R0ZL 3NSCA 2NY2B 5FK9A 4AV4A 4LXFA 3ZVVA 4E9WA 2XXGA 4WWOA 1MI5B 2BSDA 3I6KB 3RY5A 4A2HA 2Y07H 3QUMA 3ARQA 2WNKA 1IU1A 4O58L 3GF8A 4JGUA 5T8IA 3F85A 1MCHA 4G43B 1MLCA 2YMOA 1AQ8A 4K3EL 1AO7A 5F89B 2IWGA 3R06B 2CLVB 5SX4H 3QJHA 3H55A 3P02A 2BY3A 4RFEB 3Q6FB 3ETSA 1UURA 4X80L 4BJLA 3ML8A 3X2QB 3BEWB 5DHVB 4PGEB 3P0YL 1TT6A 5L9DH 2V9UA 3MKKA 3H7LA 3GMOB 5L88H 1HSAB 2MOGA 3BPOC 2Z4TA 1D7BA 4X7TB 1T20B 2GT9B 4FDWA 4GFTB 1XZ0A 3RDJA 2HVJB 1L9NA 3N6YA 3UYRH 4AYBA 2W9EL 5TF1H 2I69A 5KS9B 3WUWB 4DN3L 1N7ML 4BZ1A 3ASNB 2WZ0A 3NAAH 1ACZA 1SRDA 2EILB 3W2DH 4HLEA 2X4NA 5E4OA 1I1AB 1UQSB 2XZQH 3GMPB 3PJSA 1I3GH 4QT5A 3TO2B 1SBSL 1BIIB 2R9HD 4JRXB 5D96B 4FG4A 1IC0A 4RZKA 4ABWA 3F8UB 4S10A 4B5ZA 3K46A 1YLBB 2YAEA 3UAJC 1BVKA 3ZTJH 5GXBB 3KR3L 1DQJA 1H6UA 1X5JA 4PRIE 2DWDB 1M4KA 4AUUA 1YMMD 1MZYA 1SF3A 3ZTNL 2E7HA 3VGHA 4NENB 2QADD 5GSVB 1CGTA 3RWFB 2LLNA 3FFDB 4F2MA 1QNZL 2EDQA 2VLRA 4JRYA 4Y4KC 3E1F1 4PI2A 3DHJA 3TM6A 6FABH 2D9QB 4C54A 3EIFA 3CUPB 1F4WH 2MMXA 5DC9B 4PB0L 3RVVC 4JFQB 5MP6H 1DQQA 5DC0A 1ZGLP 3BSZL 1MWOA 1CT8B 3JT2A 3I85A 1KJVB 3VVVA 2YQGA 1BD2D 4N2MA 5LCVL 3J07A 1S7VA 1OARH 4AENB 3P30L 4NSKA 4XTRD 1OD9A 1OCOB 4JDTL 5JHLL 1QFHA 1I1YB 2CCVA 5AAWC 4APQD 3HNTL 1MCIA 1M1SA 3BP6A 5EU7E 3AJ7A 3B9AA 3VH8G 4S2SB 4DFIA 4OI7A 2BSRB 25C8L 2LGNA 5C0ND 2YZ8A 5IQMA 3N3EA 2AJSH 2WVVB 4OUUB 4XRCB 2B2XH 1OIOA 5D72H 4D9RD 1MCNA 3L81A 1A8ZA 3LB6C 3BZ4B 4NBYB 5MEQB 2WSDA 4F7TA 2DWSA 3ECBB 3PLYA 2NY3C 5IJKC 2F7IA 2OYMA 5FF6A 4C56E 1JXGA 3JV4B 1GGIH 3HE7D 3S4SG 4FQIL 1OM3L 2JVUA 2NW3B 1ZKAA 4HV8A 4TYUA 2YSSB 2BY0A 2QZ5A 3VXMB 3FYEB 4TSBL 4CU6A 4JPIB 5T1JA 1BXVA 4AYSA 3BH9B 1UD2A 1CF1A 4PJAF 3I3DA 2GK2A 2CCWA 5AW0B 4CBPA 4K23H 4WTXA 3EO9L 1NCBL 1VADB 5FKAB 3KBFA 1M57B 2PYED 3BGFB 4X9GA 2W65A 5EZOL 4WKZB 1IAIH 2PTTA 3HI5L 1MCDA 5IJCC 4U3SA 4PPTA 1WE5A 3BIKA 1IC4H 1EZVY 3LKSA 2FZ3A 4XMTA 5B22A 3S88L 3DO3A 4GS7C 5DQ9A 3BN9C 1CE6B 5HI5C 2PWEA 2UXTA 3B4NA 1RUML 1NEZG 3RIAK 2VDLL 5T5NF 4XNQB 4HGWA 1UCBL 3HJEA 1CLZH 3OJDB 1J8HD 1XL4A 2BZDA 3OAZK 4B5EA 5D5MA 2AJUH 1S3KL 3FUIA 1F58L 3AG3B 5BRZB 2ITCA 3CH1A 4BKLB 3L2NA 1QEWA 3UAEA 3HI6L 5ITBL 2Y22A 4KUZL 4PWHA 2MNJB 4MS8C 5IJBC 1OL0A 4XP1H 5EN2A 1WISA 3T8XA 3T0EC 3UIYA 2P48B 2E6QA 2PTVA 4NO0B 5ABAA 1WBYA 2OMUB 4WSJA 5DUPH 2ZQKA 3KNBA 1FYTA 5ISZB 2WXQA 5D1ZA 3MJWA 4YSQA 4YSOA 1D9KB 5EB9A 4MJHA 1AR1B 3EHBD 1MDTA 4D7PA 2Q3AA 1J8SA 2ED6A 3DROB 3QEUA 3QH3B 4JREB 1DJSA 3W9EB 1BBDL 1CGSH 4NZRL 4XPBH 4Y2LA 3ZOAA 1ZLSL 4G8GE 1DYZA 4PRDB 2FIKA 3QNXB 5C0CA 2Y23A 2Z8WC 3GPEA 4PGCB 2HRLA 5LBVA 1SN0A 2XTJC 4NN7B 4B50A 1GIGH 3N42B 3IKKA 5AZEH 1YNTF 4LRNH 2VXSH 1FI8C 4GKSA 4CMMA 3TO4C 3KBPA 4B95C 3KYOA 2Z7WA 3B9KB 4XNYL 3O3DB 4K5OA 4PN6A 2BC4A 2PCXA 1G1KA 2PXYB 4N2IA 1JZHA 4QY8B 3ARTA 4OCSL 2OTPA 4PW3A 2BCKA 2R39A 4CDGC 3OWRA 2IPTH 5GS0L 5EEVA 2M8XA 4QLRA 4LIQL 2VAAA 4MWFA 4EAEA 1A65A 4R96A 4Z7UB 4ZX5A 5EOCL 3RWHB 3W1ZA 2KPNA 3DOIA 4WSKA 3MTRA 4KV5E 2I07A 4PY7A 3B2XA 3A6BL 3HNSH 3KXFA 3O6FD 2EECA 5DC4B 4EXKA 4QR7A 1MAMH 1RHFA 4AK2A 2OYKA 4QWWD 2EH7L 1CLVA 2AJYH 1I8LC 1T0PB 3ARGD 2DF3A 3LKRA 2WCGA 2EXTA 4H1LH 3X11A 1EH9A 3MNWB 4JKWA 1XGPA 4I9WD 2CKNA 1FFRA 2HT3C 4MD0A 2DQEL 4L3EE 1HYSC 1ZLWK 1HOCB 4G7VL 4J2XA 1U36A 4LSQH 4QTFA 5KSAD 1BMZA 3QK0A 1ZTXL 4QRSB 3FSOA 3H3PH 3PGDA 5DEGA 2QADB 4AC2A 2B1AL 3NRFA 5C09E 3CMOH 2Z4QB 3D08A 4CSTA 4ODWA 3WBDA 2XWBA 4FNSA 4DZBA 2BOCB 3TFKD 2PCYA 1I3VA 3U6RA 3MO1B 1OCWH 1JPSL 2R69L 2OPCA 3LNEA 3DRQB 2IH9A 5D1QE 4UAOC 3T0WA 2WLMA 3AB0B 3FO9B 4RQQB 5JO5A 3W5NA 2BHFA 1MCSA 3BCDA 35C8H 2MKWA 4JJ5B 3TBVB 1BQRA 1BZQK 1OE2A 4IHOA 1TTUA 2AQTA 1QSEA 2D7QA 3GK8H 1BD2B 3RNQB 2Z35A 4OZHA 2B4CC 1E9QB 4RFEA 4N8CL 3PWVB 1OAUL 1JHTA 3KGUA 4GQQA 5E2VH 1BVZA 3CAFA 4X42A 4JFYB 2RTTA 4MJIB 1RJZA 4DNLA 4G70B 1E5CA 5TDPB 1DJGA 4Y8DC 2ZP8A 3OKNB 4A2EA 5DR5H 2XG4A 3FB8A 1LE5B 3PABB 5E5LA 4W9FC 1CIUA 1SXNA 1GZPB 5D8JH 1DUYB 2Y2WA 1BGXL 2R4SL 2IFFL 5KANG 4BZ2L 4PJ9A 2O1AA 2DTSA 3B34A 4EDXA 4RIRB 4L8BB 3RUGF 3QIWB 3EO1B 1C5CL 2OCFD 4I1NB 1LQSR 4P07A 5ECGA 1UQSA 2AERT 2HKFH 4ONHA 5C2BH 1AZRA 3TV8A 1BIIA 1FBIH 2J3SA 3BKYL 4NNYB 3SQRA 2OLDA 3HE7B 2BP0B 3BQUC 1U41A 2BNRD 3EBIA 1SYSB 4U0RB 3FU7A 1SDDB 4KZDH 4BQCA 2ZG2A 4M5YL 3OHXB 1CDHA 1M2OA 2ZXGA 3HN8A 3MV9E 1XIWC 3X3GL 4JE4B 1IC7H 4P2QB 2ENJA 5AD0B 3AT9A 2WXKA 1IC1A 1P0SE 3OKOB 3RWFA 2UVFA 1Q0EA 5KVFE 3FUEA 4L1BA 3VH8B 1BVNT 4ZMXA 2CJTA 3T2OA 1D5IL 1JRHI 1F1AA 3BC9A 3CUPA 3FMGL 2Q76B 1KENH 1F90H 1TNMA 1BLNA 1R3HA 4GKZB 5HVWA 2XV0A 2GJPA 3VW3L 2BSTB 4A1RA 3EXJA 2JF1A 4K71B 3HMWL 1FL6A 5HJ3A 1P1VA 3TEYA 1T66D 1XFPA 1HC1A 3S8GB 5SWSE 4P5MA 4CUCA 3S4SB 2V4LA 4NKOA 4UV4H 4WJ5A 3FFOA 4OLUL 1AMXA 4JHWL 1RL1A 4AENA 5D4HA 3C08L 3SDDC 2J8UE 4ZFFA 1R0AH 1CG9A 4MJ4A 3CZFA 2BM3A 4EPSA 5KVMC 1FC2D 1R3JB 3D5OF 5B1AB 1LK3L 1I1YA 1ZHNA 2X0UA 1E7UA 1YZZA 4ICWA 5JIIA 3RY4A 4FQPA 4S2SA 4QCIA 2HFEA 5CJQL 1LD9A 2ZUXA 3I6GB 3O2DA 5T3ZD 2CGYA 3LQMA 3ULVH 4XRCA 3IWVA 2P7TB 4HIXL 4HKJA 3MODL 3G6AA 4PJHA 5JIPA 3WS3A 2IBZX 5AG8A 4M7LH 4PWJA 2ERJB 2VXQH 3C09B 4DP9X 2C9AA 3HPJB 4ELKB 2NXZC 3LZQA 4OLYH 1Q4NX 4FQJL 5JA8B 2WKOA 3C6LC 2DW5A 1NEZB 1PSKH 3GSQA 4MJ2A 2CJUH 3KCPA 2WQAA 2OMZB 5DZPA 3GNMH 3LH8A 3NJGA 1RXLA 1X44A 1YHPA 2B16A 5AVTB 3SSGA 2Q8BL 2ZOOA 1FL5B 1U3NA 2DL9A 5LO7A 2NUPA 5ACLA 4WY7H 2DQTH 1NJ9B 4G59C 4U0QB 2QLYA 2DLFH 4OJYA 15C8H 1AI1H 3NEXA 4MVBD 4U1KA 5FDWB 2MOVA 3TN0D 5D7LD 5FKAA 1JZ6A 4HX1A 4OUOA 3LPPA 5FO7A 5A7BA 3E7JA 3D0VA 3GRWL 4ANKA 4F58H 1XD1A 5F70A 3FU3A 3DO4A 3L7EA 3OPZH 2BLFA 3BLPX 4YDLC 3QCTL 1W72B 2YOAA 4P9HH 4MZRA 3QDGD 2FX7H 3BXNB 2WSPA 4CW1B 1ZIBA 2BRQA 1XHHA 5ESQA 3NPSC 4IJ3B 3IDMA 1QR1B 4KWUA 1JBJA 1FE8H 1U95B 4C8XA 1BG1A 4ANXA 3VFGL 2I9LA 1H19A 3EJQA 3FT4B 3P9LA 3GMLB 4WJG3 5D7IF 4NGHL 4LQFH 4PJEA 3V0WL 4ODTL 2BXYA 4U2YA 1E5BA 3QXDA 2Z65C 2R2EB 3SHSA 3GLEA 4NJ9L 5I0ZA 1HL9A 3MRBB 3ATBA 5LGHL 2VT0A 4IRSD 4BXSV 3F58L 5E1QA 1IGJB 4FHJA 3VQ1C 1HAWA 3CLEL 4N9GB 4NO0A 1G7JB 3AADB 5ANHA 4XH2B 5AAPA 1ZCRA 3S36H 1KV3A 2EDJA 1PIGA 3B7TA 4JVUA 3P1VA 4GKOA 3OZ9H 3BWZA 4U1NB 3ROOB 2BWDA 3L3GA 5BQDA 4B27A 1QFPA 3GHPA 4EZLA 2OA9A 4G7YH 2R4RH 1E43A 3GBLA 4GSDH 5FAAA 4CC4C 4V1DB 1T1YB 4WEBH 3UBXI 4PRDA 5EBWB 4A55A 4N28A 3FB6B 4G3YL 3CSFA 4CSPA 3BPLB 4NM8L 3VD9A 4ISVB 3H54A 3ARUA 4A7VA 3MLXL 1AHWB 2VLLA 3W9DA 3QT2A 3BKJH 3BD4A 3EJYC 5AW8B 3ZDWA 4JZNB 1S7WB 2AS5M 4PJ7B 1LDPH 5I1JH 4LNRB 4GIPD 1GJIA 1JMZA 2ZX7A 3BPOB 3S8FB 3KAAA 4HJJL 1KULA 4P3DA 1NFIA 2XN9E 1WFJA 3ALWA 1G0XA 2CO7B 2DDQH 2GJ6E 2D8KA 4OGQC 4YR6B 2NUTA 1QLEB 4XBMA 2I60L 2BOBB 2HLEB 3PQYB 4MAZA 1Y6KR 4PJIE 5I19L 2ZX8A 4MNQA 5KSUB 3T2NL 4DH2A 1G9NL 1HWWA 2HG0A 4Z6AT 4JDEB 1ACYL 1OQOA 3FDWA 4N22A 5JQ6H 5TE7H 4L4TA 4BFNA 5I18L 1LO5A 2DWXA 3QRFM 3D2UA 4LEXL 2EUVA 4XPTH 4BFBD 3QAZC 5C0RL 2I7OA 1KPRB 2ZG1A 1SJMA 3WGVB 1KTBA 1ZHBA 1HQ4A 3CDGB 4Y2OA 3TWCL 3HG5A 3N9GH 2YAQA 3ZYIA 4Z8FH 4QYOA 1NIAA 3BGAA 5DJZB 1L5GB 4E9XA 3MOAH 2WUCL 3QBTB 3S96A 4Y19D 1NAMB 3SODB 1B6UA 2ADFH 4IKIA 3U48A 3KLSA 4YSSA 4RRPA 3STZA 5F7AA 3GC3A 4PGBA 2Y07L 1JWMB 4QRPE 5KSBF 3CZNA 1DSWA 4UIKH 1PU0A 1KJ2A 5C07D 43C9A 2R8SL 1XMEB 4JHZA 3PV7A 1QO3A 3TYFB 2Y5TB 3ZZSA 1BJ1J 4Y5XA 5DFTA 1OGAB 2AEWA 5TPWH 2R1YB 4JJ5A 4N20A 2B5IC 4XCYA 2W60B 1URLA 5HTSA 5L9DL 2WD0A 2GHZA 1PD1A 2JKWA 1WAAE 2YD7A 5C7ZA 2COQA 4K5LA 4AGLA 4ZXBC 4WW2F 3VE0B 3UYRL 1DCEA 1OCZB 2YPVH 5TF1L 3E6HA 2K6YA 1I7TB 4OLVH 4PTUA 1KB5B 4XNZB 3NAAL 4JFEB 5DD6B 1P9MC 3W2DL 1O9VA 3PABA 5A6IA 1Q9KA 2XZQL 1MSPA 2WZAA 1I3GL 1VFBA 3O3UN 3EDJA 1DUYA 2D7MA 3C5ZA 1ES0B 4G9FE 2WLIB 3VRLE 4AQ1B 3IFOB 4M3JA 2NY3B 3UMNA 1JXFA 3EO1A 2Z31B 2Z64C 2P46B 4NN5C 4M8UA 3DDGA 4NNYA 3M86A 5D9SA 4OI8A 3WIHA 1KIPA 5DEZA 3S34H 1SYSA 1UZGA 1EFXA 1VZIA 1ZJAA 4CADA 1GC1L 5DHVH 3DLQR 3MRGB 1LEKA 5EUOE 1B0RA 2NY4C 1UFUA 4Z76A 1F4WL 5C97A 1XH2A 2MKLC 3UDWC 3ZHLA 5CBAB 2WXLA 2ZE0A 5IBLC 2JCCF 4FXKC 5MP6L 1KG0B 1LWJA 4WI7A 4L2LA 2OBGA 4ONGH 2X4QB 1PD0A 2ATAA 1KCRH 1TQCC 2JKJA 4P2OD 5GS3A 5BQ7A 3CX5J 2DH3A 1HN1A 3TWYA 4BD4A 2DM2A 2XOTA 1OARL 4N1HB 2CLRA 3C5SB 1RZIB 4I87A 1MFBH 3ATAA 4L5FH 5C08D 3G6JB 2VCOA 3GMQB 5EU5B 2VSMB 4BQ8A 3HZKB 1ORSB 3ZHFA 3MNVA 1QP1A 4L37B 3VA2C 1FFTB 1NFKA 4ZMVA 4D7BA 3ZQXA 2AXHA 2AJSL 4GRLD 4TULL 2B2XL 5D72L 1NUGA 1SQMA 4G72B 2RBLA 2YPLA 4F8QA 5C92A 4LPUA 2IPUK 4X7SH 4U49A 5CF3A 5B1KA 1OPOA 3MV11 2OJEB 4PRHA 5DJYB 3T71A 3NIGB 1MNNA 3UROR 3KWVA 2GPZA 1GGIL 2GI7A 5GZNA 3T8VA 3U30B 1J9TA 2K3HA 4ELKA 4DEUA 5B38G 3QDMA 5LJYH 1E4HA 3EXLA 5AW2B 1BG9A 3MNZA 3IF1B 1SJEA 1Y0LA 5AW9B 4LRIA 3P0VH 5T5NG 4K23L 1C08A 1WBZB 3NIFB 5FYKD 3DTDA 3EUDA 1OVZA 2OJ1A 4I1RA 5DRZB 3V5HB 3P3UA 3U0WH 3WNPA 1AY1H 4AZUA 1IAIL 5I6LA 5HGDB 1T6VN 4NLAA 1FNGB 1IC4L 3HC0A 2GITB 4P4RB 3M1BA 3GS4A 3P40A 3GSOA 2RALA 5FFOA 4C4BA 2C9VA 3GIVA 2N7BA 2BSSB 2G30A 1HJBC 1W72A 5E5RB 2NZ9D 2CO1A 1CLZL 1VGKA 1YMHA 4M03A 3L1EA 3VFMA 4A68A 1XGQB 3DIDA 4JFSA 4DKFH 1EZVX 2AJUL 1XF3B 2VE6B 3T6XA 2BXZA 1S9YB 3Q05A 2X2JA 4OCXH 4NIYE 1OK8A 3S5LG 1ZK5A 4QHMA 1U3HC 1H5BA 2IADA 3FT4A 2AQSA 2LABA 3Q9QA 5EC1B 3IJEA 1TTFA 4PREB 4PP2A 3MBWA 2V0AA 2VDQB 3RGVA 4XP1L 5KVDE 4LLQB 2CIKB 2A6KA 1BSIA 2F74B 2RH0A 4OZFG 1LP9E 5J5EA 2VLRD 2V33A 3QUYD 4JRYD 4WI0B 5DUPL 4L18A 4HJ0C 4ZYKB 4D9QD 5DMKB 1A3RH 1ZSHA 2VXUL 2BHUA 4DK5A 1GR7A 3DX8A 4FAAB 1IGJA 3LX9A 5IBUG 3S2AA 5C0GB 2O6EA 2YD3A 4L9LA 1JV5B 3QXTA 4WNQB 1CGSL 4XPBL 2HB0A 1HINH 1HKLH 4G8FB 3TONA 4JRWA 3GKWL 5CGTA 4LF3A 4TVUA 2YO3A 4H25A 4G83A 2FQGA 2IDSA 3AITA 1VDGA 1XD0A 5C07B 4KK6C 1GIGL 3MV8B 5ERWB 5AZEL 1TQBB 4UAOB 2VXSL 4G71B 5HDBE 4N24A 3IT8D 5LG6A 4P2RA 2YEZB 5CSBA 1BWWA 1T1YA 5EBWA 5DVPA 2R29H 3NDYE 1ZVSA 3VX0A 1SEBA 3G5ZB 5I1EL 4U3CA 2IPTL 4K8RC 3F7RA 4M9PA 3PS6A 1YEFH 1U8LB 3KBHE 4EN2A 3ASOB 3US0A 2NY1B 5EF1A 3DK2A 2GSIB 5AVZB 3O8XB 1J5DA 2Y7LA 2A6IA 5T1KB 4X4KA 3NCYS 4M8QA 2VDNB 3HNSL 5F9WC 3T0BA 3WTXA 5T5FA 3PJLA 1MAML 1AOHA 4KMTH 1P4IH 3B43A 3HKZA 3ZYZA 5I30H 4J12A 1HILA 3IN0A 1NCWH 5KW9H 2AJYL 1E50A 4YLQT 4YR6A 5DVLA 3PNRB 3ULUE 1FGVH 1CBVH 1N3NA 1AZVA 3DO7B 1HHKB 2XWRA 2QR0A 3A5VA 2OMTA 1ODUA 4HC1H 1CN4A 4JL1A 1T7WA 1N6UA 4JDEA 3IAGC 4LSQL 3O4LD 5K9QG 1PLAA 2XQBH 3BUYB 4Q7DA 3H3PL 1F3RB 1OAZH 3UAJA 2LTQC 3F12B 1CFQB 1BQUA 1RZKH 2WOYA 1MDAA 1M7IB 4PWEA 3CMOL 1A6UH 1VRSA 1XV8A 5K1VA 4E9RA 5F0JB 4OFIA 1OCWL 3N40P 5JHDE 4DN4L 2ZT9C 3NZ8B 1TLKA 4I89A 4Y4KA 5IOPA 4ZW8A 2VR7A 3FT2B 3APMA 1KMGA 4R8WH 4FFVC 2PPAA 4OJFH 4WFGE 1JWMA 3EGSB 1EANA 4LL1A 2XWZA 35C8L 3OM3B 4Q6IC 5CR8A 3GK8L 1NIDA 2EVFA 3WJMA 1OTSD 1OLZA 1T7VA 4KO7A 2ZYHA 4K3JH 3TYFA 2Y5TA 2W95A 3D39A 1CFMA 4LVHB 4YIQA 2W9DH 5E2VL 4NZUH 4BSWB 4P48A 2DQJL 2DAVA 4AIZB 1I8MB 4UM9D 1ZV2A 4P57B 4RGND 5HI3C 3RILA 5DR5L 2WGXA 2EDRA 5EA0L 1XH3B 5JW4N 5D4QA 2W07A 1A3LH 2BNQD 2E76C 2N1KA 3DIFA 4UDTB 3UX9B 1FYTD 5D8JL 4HBCH 2Z1PA 5D1ZD 5AAWA 2FTAA 5GPRA 4AC4A 1WITA 4X83A 2V5MA 1BZ9B 4AKOA 5EEUA 3FQUB 1FFOB 4NC0B 1CI5A 3MACH 3SOBH 2CK0H 2Y7MA 3FOMB 1FBIL 3L3JA 5EU6D 1CZ8H 1TDQA 2NXZB 3FQRB 5TD4A 5IJKA 4KZDL 5D55A 3CPUA 1ZOXA 3EG9A 3SJVB 4KXDA 5FECA 4RISH 3IK2A 1PY4A 2GC4C 3L1GA 2SEBB 3IJ7A 3U36B 1XTMA 1Z3RA 2CHXA 4Q9CA 2BY2A 4BUHA 4Z3EA 3UG3A 5CLXA 2LLLA 1J0HA 2WTRA 1JPGB 3MLUH 4ZO7A 1QUNA 4H20H 3OKLA 4PJCE 3LEYH 1KENL 2NY7H 4HSCX 2RQ8A 2EXWD 1F90L 1JK9B 2ZSWA 4PJAB 3RIKA 3PPEA 3HS0C 4FCAA 4RMQA 3VU1A 4HKZB 3WEXA 4FG6D 2YLHA 3ME0A 1G43A 1EHXA 2XDHA 3GJFK 5DDHB 1XF5B 4R4BB 1ROWA 5E51A 3U79A 5IIEA 2P45B 1Y7VA 4MAYC 5FA4B 5JPMC 2VGLM 4RZCA 1SOXA 2IANB 5B38B 5I1AA 2VWEE 4GW1B 1R0AL 4KUCD 2WQ8A 1P5VA 1F41A 4QTHA 4RAVB 1F18A 4G42B 4TS6A 1QZ1A 1N67A 5F7UA 3HFMH 4MCZB 4L37A 4KBPA 3X13B 1A9EA 1VFOA 3ARYA 3U9UB 3V4VB 4HUVA 4NQDE 3KVDD 5EEZA 2QQKH 1HHJB 1UWXH 2VXQL 2A6DA 1U8KA 2X1OA 3HHSB 3T0EA 3BZFB 5JXEC 1RLBA 2OJEA 5GGQH 1JTTA 3BW9A 4E0RA 1KB3A 5A40E 4KVCL 4X6BA 4OCMC 4ALAH 5EEXA 4WF7A 1UXWA 4OLYL 5DD3H 2CHZA 2ZXAA 5E8DH 2HMIC 5TFSH 1PSKL 4I8DA 1SY6A 2CJUL 4BEIA 4HZAA 1X3DA 4G7RB 3GNML 1JPFA 2Y2YA 3BIAX 4X8JA 1QSED 3L6FB 5CN1A 5L2KE 2L7EA 3KPRE 2OCJA 4GAJH 1RZJH 3GMMA 3S5LB 4WY7L 5FO8B 1TENA 2CJSA 3QJOA 1LJMA 5JUEH 1S8DA 3LNHA 2DLFL 15C8L 1AI1L 4J4PC 1RUAL 2EE0A 4JY4B 5DSCA 4L1TA 3QQ4B 3FUHA 4OZFB 3VRJB 1ROCA 1HX0A 4F58L 4ZMZA 3OPZL 1ITBB 1AGBA 1QTYT 1TU2B 3FT9A 4JE0A 4P9HL 1PW3A 3BHBA 2FX7L 4JDZA 4UT9H 4XO4A 3RNKB 1YNTB 2RGSA 4P4RA 3BPCA 3MRFA 1I4FA 4MDJB 3RI5K 4PJ9D 2RD0A 4M7KH 5IBUB 4P3WA 3VGAB 1FE8L 3K91A 5BZDB 2FJGB 1J0YA 3PWPD 5B21A 4QNPE 2WPGA 3SE3C 3ARZA 1EZLA 1M9SA 1T2QL 1KCSH 3ZQ9A 4QRUB 4ES8A 1D5XA 4LQFL 2HFFA 4LBEB 5F7WC 1UATA 2DPKA 2VE6A 3D69A 5DA4A 3EDKA 2LV4A 5GRYA 1U8JA 2WK2A 2H0PA 3VXSE 5MEOB 3BX7C 1UD8A 1F6AB 1FFPA 1I8LA 3LRSB 3CXDH 4BDVA 4DW2H 4G6FD 4WO0A 2XFXA 4KU1A 4YHOH 5L4JA 3O4LB 4Y7MA 3MVSA 2P3YA 4A6YB 4GG6A 1PQZB 1Q72H 3NN8A 3FTGA 1OSZA 4H5SA 2NR6A 3S36L 1KGCD 2LU4A 3KL0A 3H0TA 3MRPA 4X2UA 2XWJB 5E9DA 4ZFOA 4HS6B 3V9CA 3OZ9L 1IM9D 4N6QA 1TMQA 1W72H 2A7BA 2RHEA 4NPYB 2FX9H 4G7YL 2F15A 2WIIB 4M00A 3IGAA 2R4RL 5ALBL 2FBRA 4G8FA 4GSDL 3FCTB 4Z7VF 1WS8A 4J3XA 1XF4A 1MWAB 3ZL1A 4HJGA 4WEBL 3QRLA 1K4DA 1ED3B 1IGML 2VSDA 3GXNA 3COOA 3P69A 1AS8A 3DJSA 4X99B 4JQIA 3CLFH 3PHAA 5TDNB 5I1LA 2M83A 1MEXL 3BKJL 4F5CE 2A99A 3REVB 1G7IA 1LQBC 2VC2B 2B5IB 2C1OB 2G2RB 3RP1A 1LDPL 1KGXA 5I1JL 2DLEA 2XWCA 2E46A 3L17A 5DC2A 3V79C 3F5WA 5A43C 4RGNB 2GSIA 3CV5A 4M93C 1Z3GH 3H4FA 2R2BA 3H8NA 2DDQL 3UJJH 2BNQB 4HUUA 2Q20A 5AL8A 1EJFA 1JPTH 5C0IA 5E00A 5I0XA 1P4UA 3FB7B 3V6OA 1C9SA 5CJBA 5L4MA 1TVBB 1BZ7B 5IEHB 1G9MC 1AQDB 2BSEA 5TE7L 2H0FA 2IBBA 4XNXH 1AIFB 3EOTH 4N6RB 3DO7A 3BKMH 2ZCHH 2NDGA 2VLKE 1T4WA 5DYOA 4L0YA 1E9OB 2OMXB 4TLTA 5JZ7C 4XPTL 1TG8A 1INDL 3RUGB 5D7JC 6PAZA 3UGXA 4MASA 1UXLA 1YMME 3BQUA 3N9GL 4Z8FL 2UZXB 3VWKC 4AL8H 3ZW3A 1U8IA 3UGUA 4BKTC 4NKQB 4Z3HA 2ADFL 1EEQA 1M7IA 1XIWA 2HT4C 4YPGB 2NY4B 3D4GA 2PN5A 4UIKL 4FNRA 2C9SA 2I85A 3TJEH 5IVXE 1JJUA 2ARWA 4AZ8A 1QLEH 1HSBA 3MLWH 5D7KE 3IGFA 4ONOA 4F2EA 1ZAGA 4P4KC 4RDBA 4NERA 2DQHH 4J3UA 3TEUA 3DJRA 3CHXA 5TPWL 4KO9A 1VEPA 1TQCB 2X9ZA 3Q1EA 1TETH 1W15A 2NMSA 2X6BA 5IB4B 1NCGA 2BVEA 5KUKA 2JH2A 1Y1DA 5FM4A 2C4XA 1RJYB 1OGTB 4WUKH 4DKDC 2YPVL 3ZKXC 4AIZA 5J06A 4HEME 5KSVA 3MOBH 4OLVL 4UV7H 2RCSL 3WSQH 1MUJB 2ILLA 4MX7A 3SDDA 3JQOB 4EIZC 1RULH 3Q2LA 1GHFH 3AGWA 3LOWA 4D9RE 5T33L 4N0FB 1T5KA 1NAMH 2QQNH 3DJ9A 3OR6B 2BS71 3R4RA 2Z3FA 4OZ4B 5DD5H 4WO4C 2DQGH 4Z78B 1KPVB 2FYYB 1BZ9A 4U3HA 3L7FB 4MQSB 4FERA 1AXIB 3K80A 2UXVA 4LNVA 5A2IH 2PP9A 4FQ2H 2XA3A 5IW1B 2VZ3A 4EZMA 2FGWH 4F91B 1T1XA 3S34L 4OFKA 1QOKA 3FQRA 3G5WA 3RIAF 1CGVA 3O0RL 3QO0B 4X6DE 1MVUA 4L8CA 3GSNB 3OWEA 1M71B 2ITDB 1N2RB 3C6LA 2LU5A 3T04D 1I9IH 4CKQA 2SEBA 2VOTA 3TBYB 2APSA 1HWHB 2R1XB 2X6CA 3D8MA 1CB4A 1C1EH 2W0FA 2PYEE 5FGSA 3HBZA 1KB5H 1T7XA 1U8HB 3HZMA 3MGTB 4YSTA 2EIZA 5GS1C 3TJHD 4ONGL 2EYRB 5HGBA 4RRPM 2H26A 3RE0A 4W9GC 1KCRL 5KG9B 3FUFA 3D85D 3ZYOA 2DJSA 1XR8B 5E9NA 5CWSA 4K9EH 1PPIA 2VN5A 1MFBL 5DDHA 4L5FL 1NFDF 3GMRB 4R4BA 4R4ND 2ZF8A 4KFZC 3QPKA 1J8HE 1K2DB 3MI6A 2FO4A 2OSYA 1U33A 4GP4B 4NBXB 2B14A 3O9WC 1GOFA 2IANA 1U3HB 3D2UD 5HYQA 5DEJA 3LQZA 2XXFA 1UJ3C 4CRPA 4HK3J 4JPWH 4PB9H 1GW6A 4X7SL 1S2EA 3NCBB 4G6FB 1HZLA 5EO1A 4TLSA 5D7IB 3B5TA 3JTBA 1HT6A 4UQ2B 3BISA 1GOGA 1VCAA 2Z92B 1IAOA 4FRWA 4Z7OE 2AZAA 4R7DB 4YWGL 1EVTC 2FECI 2EIMB 4B9GA 3BZFA 1YEKH 2VLJB 2YXWA 4RMUA 3U0PB 2YA1A 1A1OB 1A9BB 2FHFA 5I24A 4X9IA 4JDVB 4WFED 2UY7A 1BM3H 2ALAA 3IXTB 4YHZH 1MHPH 5ELIA 5IESH 2C3XA 4JFWA 4C58B 3S37H 3VI3A 5GGTA 2WBJA 1QSFA 2PKDA 3AXIA 3U0WL 1AY1L 5KBNC 1JZJA 5FA3B 3Q2CA 4BRJA 2IAMD 4KRPD 2QSCH 2WB1A 5GRVL 1FIEA 5HYJE 5J89A 3CX2A 2E9JA 1TJMA 2OMNA 2IH3A 1FH5H 3RWGB 4JFZH 3QQ4A 4M62H 3ZE0F 3FXIC 1XT5A 3QZBA 4WI3A 3EBAA 3MLYH 2B59B 3U82B 3EGXA 1O9WA 3FH7A 4NAJA 3U2JA 1MFDH 4OLZH 2NNRA 1M05B 3BMWA 4OCXL 4AQEA 1NWOA 3F6JA 4QRFA 5HP5A 3SGDH 2Q10A 3SPVB 1TSHA 3QORD 5DF0A 3HZ3A 2DM3A 4ZMLA 1SMAA 3MRLA 4LBEA 3F6IA 4GAYA 4I9WE 4YMPA 3QWOB 4IBWA 3STBA 2A9AA 3S9DB 3U6XA 3GS0A 2QHLA 4HYTB 5JYLA 1A3RL 1IKFH 1EV2E 1UM6H 3LRSA 4OGAD 4XVTL 3RZWA 1CR9H 2CK2A 4NPKA 4EN3C 1KUMA 2EO7A 4QRTB 3A23A 3JWNG 4WU7B 5D2NE 1CUOA 2AKRB 3KWWB 3SYQA 4XPGH 5K9OA 3RTLA 2K6WA 4JANA 1TLMA 2GYSA 3UBXA 2WKGA 4ODHH 1HINL 1HKLL 2GI0A 3B83A 4PMEA 2APWA 1XBRA 4ILDA 4HS6A 4OV5A 1GY2A 4ZMWA 1J0IA 4MBOA 1FP5A 3P4OB 4NDMB 5EFIA 3FHEA 2F8VA 4WVRA 1NKOA 4ZSOB 2ENYA 2YD4A 2A3TA 3ERXA 5JHBA 1Z2KA 2ADIB 4Z3TA 1VB9A 3FQ2A 4CU7A 2X3BA 1MWAA 3EYOA 3X14B 4PS4H 5J56B 2R29L 4J3VA 1JXJA 5BZZA 3ZN6A 3FCUB 4KRMB 4PRAA 3T6WA 2K70A 3S7GA 2VDQH 5KSBB 4MB5A 3D51A 4A37A 1YEFL 1HJCA 1VPOH 2D7OA 3HUJA 4U05A 2H1XA 3DUSB 1G84A 3GLAA 2C1OA 1DANU 2V2TB 3DVFA 2CAKA 4GAGH 4RFOH 1P4IL 2UYLB 5I30L 3HE6C 1NCWL 5KW9L 1VHPA 1PKQE 2ITEA 4XXDA 3L9EA 4MRCA 3DTUB 4ZMNA 4ZXBA 5GZND 5I17A 3H1ZA 3MR9B 1FGVL 5J6GA 1CBVL 2XCMC 1CFBA 1MCRA 2YRPA 1PZ3A 4OAWB 4WW2B 1IL1B 1KT2A 3QDMD 1P9MA 2GJZB 2OL3A 2H3NA 3CN2A 5E1AA 3TA3C 3C5JB 5GZOC 4HC1L 4TSAL 1TVBA 1K4CB 4FQXD 2V3EA 4P05A 3RWIB 1I9EA 1KTCA 3F7VA 3FT3A 5ID0B 1AXSA 2GSGB 2D7NA 2XQBL 3L1FA 4WLCA 5ACMA 2BNRE 2XPGA 5I73C 3NSJA 3ZDXE 1CDBA 1F11A 5B39A 4PJFE 1A6UL 1FRGH 4X6FB 3MLVH 3EJJX 2CO6B 5HVHC 3D3VE 2B4CH 2XV6B 3NCMA 4PYHA 1BZDA 2GVYA 1WCBB 2C7UA 4BQ6A 2A83B 1JDDA 2GABA 4LLWA 3QXUA 3CU7A 2VDNH 4R8WL 1NGXB 4YPGA 3FNKA 4OJFL 3RFZC 2EICA 2EO1A 3P73A 4W1TA 3UDWA 4BFKA 1MRCH 4N2KA 3BH4A 1W9XA 3HBPA 4FXKA 3BP5B 4WWKD 3VAEA 1NGWB 3ABLB 4K3JL 3REWB 3ZKQD 2W9DL 4ONFH 4NZUL 1RK0A 2JCCB 1KEGL 2UX7A 1Z9NA 1HE8A 3GZQA 1OP5H 4KTEH 4N2LA 3U46A 4L29B 4MAYB 5FM5O 1FNHA 5JPMB 1RP8A 3MUZ1 3QJRB 3P77B 4FTVA 2ICWB 3ROLA 2A73B 1MKFA 4HLZG 4PJ5B 5G4OA 5GGVY 1A3LL 4JMNA 5I75C 4HBCL 4ELMF 2J6WA 2Y6TE 4IS6B 1HXYA 5T1MB 3FC8A 5KTEH 4HKBB 1AD9B 4RNRB 2CLZA 1E27A 3BVNB 4JBSA 4H8WH 4JPSA 4MJ6B 5T3ZE 1FLRH 2AP2A 1BXUA 4RA3A 3IRZA 3MACL 3SOBL 2VO5A 2CK0L 5LAPA 5I2IB 2FSDA 2YHGA 4U1IA 3ETTA 4CBZA 3VYPA 1CZ8L 1KPVA 5DXWA 4KMQA 5GGSB 2JIXA 2R0KL 2ZOKA 2RMNA 5ESAB 3GINA 4S1DD 3IPBA 1XH0A 1A1NA 1NDMA 4G1EB 1ZS2A 4PCYA 4JUSA 2JK5B 3DSNA 4NN6C 4P2RD 4K3DH 4X4YB 4G6JH 5AB0A 4JFFA 3OJ2C 1L9OA 2DWTA 4O5LH 4O51A 2GTQA 3MLUL 4L4VA 4H20L 1N2RA 5ICZA 3LEYL 4AH2B 1BEXA 1PG7W 5AALA 2ZXEB 1U8OB 2JI3A 4XC3H 4F7CB 2NCMA 4WU5A 4B9YA 5IK3A 2R1XA 2IAMB 5A2LH 3B7YA 3QO1A 4JUTA 3O41A 2V2WA 2ZWZA 2XWXA 1CTOA 3C60C 5D7LE 1FC1A 3GXUB 2JJSC 5DHMC 1U8HA 3L4CA 4ODXA 3ULSA 2BMKB 2J73A 3MCLH 4LPVA 1FJ1A 1A22B 1GOHA 5KG9A 3QDGE 4U6XA 4QAMB 1FVEA 4IBUA 3RKDC 1E4XH 4AWJC 1OB0A 3HLAB 4KH2A 1U8CB 3QJTB 2B20A 4KKCC 2OP4H 4N3UA 1JGUH 2X4PA 2OXGA 3KW7A 1JNHA 1QPPA 3QEQD 3FBQA 1ZGLA 3BAKA 3MRDA 3O6MH 4PRNB 3UTSB 3MYJA 1U3HA 4NYLA 3HR5A 3UAJD 5K59F 5I74B 3RRQA 3VXPA 2Q3ZA 1NC4A 3RJOA 4OIFA 2QQKL 2GBUA 3MJ8B 4GIAA 2WYHA 3GD1C 5FYKH 4HOMA 2XVLA 5FKPB 5GGQL 5LGJA 1YN6B 3KJ4C 4Y4KD 4ALAL 5J7CC 5DD3L 1IGTB 4BE5A 2OTUB 1HH6A 5E8DL 3VXRD 2DLGA 5TFSL 2WYIA 3QNFA 5TH2B 4F57H 4LVEA 2PCPB 4CN1A 1AXTH 2Q5BA 1NGYB 4MAUH 4Y16D 2LVEA 1A4BA 5GRZA 1E7VA 1J8KA 3P2DA