3U4KA

Crystal structure of the receptor binding domain of plasmid-born adhesin mrkd1p of klebsiella pneumoniae
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
163
structure length
163
Chain Sequence
GSSCWQSNSAYEINMAMGRVVVSPDLPVGSVIATKTWTMPDNNTIYVTCDRNTTLKSDAKVVAAGLVQGANKVYSTAIPGIGLRFSRKGAISMIYPDSYTTTGSSFRLAGSTFTLDIIKTSTTTGSGTLASGPYTEYGPGFTILKTSLNADAITIVSPSCTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fimbria adhesin protein
publication title Crystal structure of the MrkD1P receptor binding domain of Klebsiella pneumoniae and identification of the human collagen V binding interface.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell adhesion
total genus 28
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2011-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3u4kA00
3U4KA
chains in the Genus database with same CATH superfamily
2X2HA 3B7TA 5BRQA 1RJLB 1FE8H 1XMWA 3ABLB 3IXAA 1A14L 4HIJB 3JV6A 5IQOA 2X09A 3HLKA 2UX7A 2CK0H 4GSXA 2VN4A 2VM9A 2X2YA 3L2MA 3OC8A 2JB6A 3WIFB 4N5UA 2BPBA 4XBGA 4EN3D 1AKJD 3FT0A 4P48A 2WNXA 1XF4A 3IGFA 1SVZA 4FMKA 2FQGA 3UBXB 4MLSA 4Y19E 6TAAA 3PNWA 4QCIA 4HJ1A 3L1EA 4A2FA 2G5UA 1YY8A 2DLGA 2NQ3A 4M8QA 3SDCA 3Q05A 3VD9A 4L29A 1HH6B 4BH8B 1PKQA 4U7MA 4Z7NF 4TN9A 4ZXBA 3V7AG 3MTRA 3BZEB 1YNTB 3VRJA 1IAOA 3LS4H 5GS0D 2P5WB 3VX1A 3QR0A 3SKMB 1OAUL 1U2CA 3Q8CA 2CDFB 2P52A 1T2XA 4C56E 1J1XL 3NFNB 2D7MA 2DN7A 4O2CB 1JDDA 4R90L 3W11D 4J5VA 1SLWA 4X4XB 5FCUH 2UZYA 4OGYL 1G7QA 3MRIA 2I24N 3RVVD 1MIEL 4Y5VB 4HUWA 3IGAB 3GHEL 1T1YA 1GKEA 3BUBA 1KEGL 3EHBC 4KVCH 1A8JH 3OLIA 1YEKL 1MW2A 3FAXA 2XA8H 4QXTB 2X89A 2QHRH 3EDFA 4HWBH 2YK1H 3ARBA 3SCMB 3ULSB 2Z3FA 5JOFB 3Q1SH 5SWZB 2H41A 2P7TB 5C0JB 2BDNL 1AXIB 1X4YA 5DWUL 4GKNA 4HGKC 4JN2B 1DJZA 2V2TB 4MJ5B 5CD3A 3D50A 3VFNA 2B4CL 2PTTA 4Y2LA 4YVUA 2IGTA 3TCTA 4E9VA 1E6OL 5MEOB 4JE0A 3BKJL 5CJBA 2OYPA 4U6HA 1NUDA 4LSRH 1L0QA 4PYHA 5C0BD 3UGXA 2Z93A 4X8XA 5I5IA 5L8KB 2QFRA 4GYBA 5EV7A 4FLOA 4ZDHB 5FK9B 1F6AA 3TOPA 4BFBD 4NFCA 4DPCX 2P5EE 5I19L 4W1TA 4APQB 1DZ0A 4QXGH 4FQIH 2IVFC 3U4BH 4ABVA 1OCWH 1JPFB 4TKWA 4EMZA 1MNUL 1MWAA 1NANH 2WUCH 4J28A 4LDCA 1OQXA 5DHXB 3WMSA 3VXUD 3ESVF 5D1XD 3RIKA 2EIBA 4GOSA 3EADA 5J13C 1T2QL 1PCXA 1QKZL 1R3LB 3TVMC 4F7PB 1MCKA 4PJAE 2PP7A 2XVGA 2CRMA 4Z95L 3HS9A 1XD0A 1IM3D 3K72B 1XSOA 1UJ3B 1AMXA 3KPOB 5C9JA 1D2OA 4NQVA 1N64H 3OZLA 4X98B 1OE1A 3OHMB 4B41A 4C59B 5BRZE 3LVTA 2YA0A 1AGBA 2ICWB 2ZKYA 3U0WH 3G04A 1TXKA 4LGRB 3V4VA 3TPKA 3IDXL 3MFGB 3MC0A 2ADGA 5EUOF 5DFVD 3CBKB 4GXFA 1NC2A 4BXSV 2E59A 3JTSB 1U36A 5KSAA 43C9A 1MFBH 1A7QL 3HG1B 5IJKA 1QO3B 2YD5A 2DDQL 1IZJA 5HYIA 4LO9A 1C08A 3MRBB 4Z7OE 1NIDA 1NWPA 1ZV9A 3MCLH 4G9FB 3AACA 4XPGL 4K7PY 4TNWF 1I7RB 5CR8A 4PH8A 4ZUVA 3L5XH 1RJYB 2OCJA 4X7EC 5GS2D 2VLKB 3MSPA 1SJMA 2HKFL 4K55A 4QWWD 2C26A 3MNZB 4FF9A 5DJ0A 3WXWH 3G5WA 1MCQA 5LBVA 4OZHE 1QBAA 1IU1A 3HFFA 4DK6A 1A9BB 5DGQA 5C0NC 3WIHL 2FR4A 4XP4L 2XWBB 4LAJH 1IGTB 3FKUS 3UCQA 1JPEA 2YXWA 3SDDC 2XPYA 4EOWL 2ZUUA 1X5LA 3OB0K 1E4WH 3IDMB 2VTFA 1FFOB 1MQKL 2I32A 2L4OA 4K23L 4P3CL 2GSIB 4XVJL 1P4BH 2VLRB 4NWUH 2OTUA 4K94C 4ZBJA 1AC0A 3MRRA 1BLNB 1I1CA 2A4EA 1DEEA 1M6UA 2X4PA 3MBXH 1YPZA 5C09B 3MGOB 1S7TB 4OU3A 3MGAA 5I74C 4BCYA 1DDHA 2V9UA 1X5IA 3GPSA 5GZOC 3VD5A 1SJEB 1HOCB 4ZOEA 1NSNL 3WNOA 3QRFM 5I6PA 2J5LB 3OM3B 4G9DA 5B38A 5L0QC 4N8VB 1QEXA 4ONGH 1EBPA 2F19L 2EYRA 2WWMC 3BQUB 4ESKA 1OPGL 2VIRA 2F8XC 4OZFH 3B8YA 4FDWA 1ZLWK 4B9FA 1PZSA 2K3HA 2W65B 4LLQA 1CZ8H 2OXHB 4TXVB 4ANUA 3ATDA 2DZEA 2OX5A 5F9DC 3UFIA 1TJIL 2Q7NA 5I8KH 1T5WA 1IEHA 4WO4D 3QXTA 1GJUA 2X4TA 3TZVA 3LIZL 3BRGC 3DX8B 4QRSA 2YAMA 1YEIH 4RFNC 4FRWA 3IMSA 3NP3A 4PRIB 2NY2B 5BJTB 5IB1B 4HT1L 3FN0H 1B0WA 3IDUA 2V7NA 3GHPA 5I1HL 2F5BH 1HHHA 2D7TH 2HXAA 4U2ZA 4XMLL 1L9SA 1DHKA 4QHKI 2PXYD 3L1OL 5EOCH 4E68A 2VYRE 5HYSB 3UZVB 4UQ2B 1UA7A 3FUJA 3WTTA 2VZSA 4OM1L 1N8OE 3KW8A 3QO1A 1FFTB 5T1LD 3JWNH 3NG5A 1CDBA 1RL1A 4R7DB 4NN5B 4PJ9A 3VSTA 3RVUD 5HHNA 1MCSA 4OI8A 5INDA 3C5SA 2DYPB 3T65B 1H8LA 4AJWA 4KKPA 4AGPA 2CA3A 3HLAA 2ALWA 2YBRB 2YQGA 3M1OA 4KHTH 4YLQT 2XFXA 3KPQA 4KO6A 2HLFC 3ZUCA 2DTML 4MAYC 2YGQA 1WZMA 1QW8A 4G42A 4TULL 4D8OA 2AEWA 2WQ8A 4F7CB 4W9IC 4P5KB 5AOLA 1NFDE 2UZIH 1CL7H 1F86A 1BIHA 4NKMB 4NN7C 4QKTA 4TLSA 2VDNL 3W9DA 2G3MA 1AO7D 1LK2B 2XVLA 3VCLA 3QCTH 5T8IA 3GSRB 1CTNA 1D9KC 5MP6H 3I6KB 1BZ7A 1GS6X 1P9MC 2BHFA 3QG6B 1HC1A 3RILA 3FFDB 1MOEA 5F9WB 1DQQB 3V5HB 1UADC 1PNDA 1I1YA 5TGBB 5DD3L 3D48R 2IG2H 4D9QD 1U3HD 5DLLA 2BSDA 5B39B 4J12A 5T1JA 4LOVA 3WDHA 2YXMA 1JYNA 1TTUA 2WYIA 3QQ3B 4Q89A 1SOQA 1VENA 3CQQA 4P2OC 1QUNB 2EIZB 1TVHA 2DQEL 1K3IA 2QZQA 3T8XB 3ETBF 1AHWC 4YXHH 1PSKH 1S6NA 2IDQA 4ODTH 1T4WA 4WSKA 4GFTB 4WO0A 5DMKA 3CHXA 3W0WE 3MRPA 4AY0A 5JZ7D 3DRQB 4CVZA 3GI9H 4IRJA 1PY4A 2H4EA 1W0WB 4XCFH 1MDAA 1T1ZB 2RAMA 1F0LA 1M7IA 1QSEA 4GRMA 5IQLA 1BJMA 3LB6D 4UBDC 5IBTH 8PAZA 3THML 5HVWA 4DN3L 3IS1X 1ZHNA 5F7EL 5EU6E 4DGYH 2YD9A 5E8PA 1CFMA 3ROLA 2ADJA 3KVPA 5E5LA 4FXGC 2Y24A 4L4TB 4UQ3A 2F61A 3Q8EA 1EA9C 2IH9A 4KXDA 4Z7WA 5IHZA 4FQ2L 2NY6C 3MLVL 3OAYK 1T22A 5F3FA 3KLHD 3CVHH 1WHOA 2G60H 1IBFA 1D3CA 4PV8A 4YSRA 3COOA 2Z31A 1IARB 1SLUA 3QIBB 5TDPB 2EEAA 2E4FA 2CGRH 1NL0L 3WNJA 1DVXA 1E8ZA 1FE8L 4P2RE 1P84K 4UUJB 5B3NA 4CDHA 3BPCA 2CK0L 1KLUA 4LCWE 4IMKA 2MHAA 2X10A 4MJ2A 1ORSA 1ASPA 3MUHL 4G9FD 1Z9LA 1JHTB 4MXVF 1QSFB 2WGNB 1W80A 2OMTA 3KL5A 3VG9C 4N0CC 4JFDE 2Z0UA 5IV2A 4H25B 3RGVA 4BELD 5LHDA 3F00A 4NKOA 3O0RH 4KH9A 4F91B 3SPCA 4R7NB 3DBXA 3KCPB 3GIVA 5HDQH 2H0PA 4TQPA 3R7RA 2J20A 4IRZH 5B7EA 5KZCB 3QUXD 1BVOA 3OKKA 3UG4A 3FCUB 4JO4H 4M7ZC 4PJDB 1YYCA 1OAJA 2N1KA 1T04B 2IXQA 3CLFH 3GZKA 3LS4L 3MRJB 1KNOB 1Y07A 4K9EC 4N28A 3S5ZA 1DJIA 5CP7B 1VGKA 3S88H 2Z9TA 2HP4A 4M00A 4M6MH 4XH2A 1NCCH 4IDJH 5FCUL 2BS8A 1PZ5A 3DV4B 4NZDA 1MHHB 1BP3B 4WTWA 4QNPE 1R5IA 1WWAX 4HX1A 3D07A 1QFUH 2X1XR 3GJEB 3HS0B 2XA8L 5DLML 1G7PA 1FH5H 4L3EA 1HH9B 2QHRL 4HWBL 2YK1L 3C6SB 5FAAA 3BT0A 1RD6A 3FQXA 3Q1SL 4H8PA 5FYLD 5GZND 2FZ3A 2WXGA 4JFQA 4PRBA 2P80D 1HQRA 1FL6B 1FZJB 1Q9LB 2SEBA 5I5MA 3WL9B 3RBSA 1D5MA 2OMZA 2A99A 1XR8B 5F89B 4BEIA 2CLRB 4LSRL 2EICA 2QDVA 3RDTB 4CA4A 4EI6B 3MYJB 4GMTH 4JO5A 1CIUA 2V3DA 3GZPA 1EAOA 3QR2A 4EUPG 3DXAB 1I8LC 4P9HH 5DMGC 2WQRA 1BOGB 3ZHDA 2QQKH 3MV01 4CKQA 3ZK0A 1Q0EA 1YVLA 1ZDSA 5KBPA 1IE5A 1O6VA 4F2FA 4QXGL 2GJ6E 4FQIL 3T3ME 3RWGA 2RCSH 3P0YL 3CHRA 3VWJC 1NDGA 4K8RC 3V0IA 1OCWL 3MXWH 3TBVB 4YFDB 5K1NA 2WUCL 4P46A 2IPKB 1SEBA 2WQXA 1E5AA 1VPOH 2GJJA 5AUMB 3PE9A 3NJNA 4AGNA 1GVIA 2B1AH 2XBTA 3BO8A 5T5NF 5A3ID 2HVBA 3QQ9D 3MJ9H 3HZYA 1OAXH 5HGGS 4XZUA 1ZY9A 4N86A 4FTVD 2NXYD 2Y7OA 3MN8A 3O3DB 4EXPX 3ATEA 5JW5B 4JANA 5DHMC 1N64L 3EYQC 1UD8A 3L3JA 2CR6A 1SN0A 3BH4A 5DJDA 5JIDA 1Y6KR 4OKVA 4XXDA 1UZ6E 3U0WL 4M1GH 4DP9X 2H32H 2BXYA 4S1RH 4DK3A 2IADB 3MV9A 2LVEA 2NYYD 5FC9A 1XGRA 3K6FA 2BSCA 1Z3RA 2LFGA 2WIIB 2OCFD 3LMJH 2CIIA 4GI8A 4FFTA 4O9HH 3UTSE 4K7PH 3DJZA 4JZJB 4TNGA 1MFBL 3O11A 2UV3A 4AYGA 4N2FA 3GS4A 3WJMB 2UYLB 5B1AB 3W11C 3FB8B 4ONHB 2XX0A 4NQXB 1DSWA 2CO1A 3N40P 3LRKA 1N0LA 4M6OH 1CR9L 1UOWA 3OJMB 3OHXA 3MCLL 1FL3A 1OD9A 2H1XA 4P06A 5IF0A 1TTAA 3FH5A 3UZQA 2I07B 3UAJA 4DP1X 4XC3H 1O9ZA 2IPTH 5IBUB 3IEAA 1DVYA 2NQDA 1BMWA 5TJWK 4R83A 4LSSH 4XAKD 3WKNA 3WXWL 4V2BA 2DWDB 1QD0A 2C9VA 2AJXL 2MNJB 1IAKA 1QZNA 4L1DA 1UWEH 2X6VA 1FVDA 2A6KB 4X4ZA 2QLYA 5BS0B 4PW4A 5ISZB 2R2CA 4QRRA 3SYQA 2Q2LA 1KGXA 3ZYJA 2FBOJ 2Z92A 3NCYP 1QSZA 5H4ZA 5LQBH 2L3BA 4Y1AA 5EUOB 4LP8A 3RFZC 1OB0A 2EDMA 4H8HA 2Q8BH 1AS8A 1ADQA 5I1GH 1HSBA 2H3NB 3ZE2E 2CHWA 3KLDA 3DPDA 1P4BL 4V11A 2CGYA 3POHA 3T04D 3BVDB 3IF1B 1YEFH 3F84A 2WXNA 3MBXL 4JN1H 5KJ7E 4HK3N 4WRLA 3VXTB 2V3FA 3SJVE 4FS0A 4WV1A 5D1XC 4LLDB 2G3NA 2ZKHH 1D5ZA 5EB9A 2KERA 3GS0A 5D7IF 5DRXA 3IXTB 3L3IA 4G43A 1N59A 3DECA 2VR6A 1LO5A 3FB5B 4ONGL 2J1WA 3V9EA 4OFYD 1WFJA 3ULVD 1W16A 1U4EA 1XIWA 3AXLA 2BCMA 3FTSA 3SZKC 4HIXH 5JPMA 1CU4H 4G59C 1CZ8L 2VUYA 2ZZUT 5TF1H 2H9GA 1B0RA 3RUGA 3HEIB 3WDJA 3QIWA 2JKWA 5I8KL 4C57C 1RZ8B 5A2AA 1WEJH 2P44B 3U2JA 4Y9GA 2IALB 3LH8A 2JCCB 1YEIL 1U8KA 3D85D 4PJEA 3QDMA 3WTYA 2HG5A 2Y1VA 5KVGE 3H55A 4W9EC 2A83B 3QDGE 4DGVH 3D39D 3E6FA 1XZWA 2F5BL 2D7TL 1T89A 2YUXA 3ILPA 3MRKB 1X5XA 5EBGA 4XWOD 5L4MA 1DBBL 1KTKE 1KCLA 1ZIBA 1KT2B 2VLJA 3ZHFA 4P5SA 5IG7B 4KQ3H 3N43B 3LZOA 5D5MF 4QWWC 3RTQB 5F70A 1WFIA 4KKBC 1H5BA 1CFSA 1CN4A 4RFEA 3FOLB 5J1TC 3D4YA 2HJFB 1MCNA 1U8OB 1OP9A 2YD6A 2IFFH 3RWFB 1R3JB 5IR1B 4KPHH 3V0WL 4LF3B 1UGKA 4WUUB 2M26A 4F8OA 1TQVA 2P45B 2DPKA 4KHTL 4Z8FH 3NEOA 4HOWA 3MRLA 3S2CA 2Z4QA 3B3IA 3DSNA 1JDCA 4OI7A 3L5IA 1ACYH 3PWPB 4N9GA 5GGUB 4JJ5B 5AL8A 4P23C 5ICUA 1GH7A 2JJVA 2UZIL 1CL7L 2I26N 5T3XH 5DU7A 4Q6IC 4NT6B 2C4FT 1GAFL 5F3HA 4YHKH 2VR9A 5EO9B 1SUHA 4YDKH 1S9XA 4JG0L 3S36X 2OYMA 3O2DA 3QCTL 4Z3EA 1UQSB 5MP6L 4F37K 4ENZA 3V6OE 4EQ2A 2GBTA 1FYTE 2GT9A 2JJSC 3MGTA 4IU2B 4CSTA 3FT4A 2NX5B 2R69H 4HXAH 4D9LH 3VFRA 2IG2L 4P49A 2V2XA 1EFQA 5D1ZC 2F7QA 1N6QH 3ZTJH 3DX6A 1XCTB 3BFOA 4OF5A 4APXB 4PLKD 2X0WA 4KAQH 2OMVA 3ZKMC 4ODTL 3HC4H 3QPXH 3NJVA 1K8DA 1Y0LB 4U4IA 3GI9L 4UU9A 5BZXA 5JOPD 1RERA 4WO4C 3TEYA 1IC5H 4AYEC 3DHPA 4XCFL 1ET7A 7PAZA 1J8RA 2PLTA 4U05A 2K1MA 2PF6A 5IBTL 3NGBC 3JWNC 5FF6B 1Z9NA 3L3HA 2VZVA 1H8NA 4DGYL 1ECZA 4XPAH 3ZL2A 3ZTEA 1YRKA 4JM0A 5AAMA 3BGMB 3HBGA 1S7WB 2BOCA 4HUXA 2PXYC 2BP3A 4HAFA 4MTMA 4UTCA 1X6NA 5E1AB 3UACA 3VGGA 3B2XA 2JNZA 3QR1A 1J05A 4F7TA 1Z9SB 4I0PD 2ZXDA 3CVHL 3HRZA 2G60L 3CSBA 4JFXA 4C4KO 4MAZA 2GSGA 2EXWD 5KJRH 5ID0B 4FA7B 3PL6D 5C0DB 1IAIH 3DK0A 3DMMB 4HV8B 2QDWA 2RD0A 3IJSA 3Q48A 2CGRL 4F1SA 1ETJA 4JY4A 2F9BT 5ICXA 5K1VA 5TQ0H 1HHJA 4QHPA 3VI3F 1UD6A 3J07A 3N1GC 4I5BB 3L3KA 4F7MB 3WXVH 2P5EA 3DTDA 2XX1A 4FLRA 2D7PA 4ZUWB 3ME0A 1THAA 2Z1KA 4Y5VC 2X4NB 3LQMA 3ABGA 4RRPG 2ZXAA 4M8UA 3DTUB 1O0VA 3QUKA 4NSKA 1YNLH 1YSOA 2FHCA 2NZ9D 2VQ4A 3PY9A 4TUJB 2F53D 4YSTA 5FHAH 4WNQA 4PJAA 3O0RL 2EE6A 5IB4A 1AZBA 1AGDA 3N06B 2FSEB 3NYKA 5EU7C 3F58H 4DZBA 5BPPA 5HDQL 4NO5A 1AGEA 4H1LH 4IRZL 2GITA 4DP8X 1PU0A 4IGBB 4JO4L 4U1GB 5KVGH 3FO9A 1WUNT 5C86A 2VDQB 3CLFL 1WISA 4MMXA 2VJ0A 4XCEB 2A6JB 5BRZA 2AJUH 4YHYC 3SE6A 3MLRH 4M7LH 4LPCA 1B4JH 3S88L 3CPLB 1OL0A 3U48A 1J0IA 4L8CB 4M6ML 4ISVA 2YSSA 2RA1A 1KGCE 3D0LA 1CFVH 4IDJL 5E8OB 3FU5A 1H3WM 4APQC 2C3VB 4DAGH 3C2AH 3SDXA 5IB2A 2NMSA 1NLDH 5HGBB 1MW3A 4LPXA 1NMCB 4DOHB 5BOJA 2CKNA 2QVMA 4RISH 1FH5L 1Z0NA 4WU5A 1J5HA 1KYDA 3BH8A 1CD9B 4JGMA 2HT3C 5EIIB 1VIWA 1XR9B 3T0EB 5FUCC 4CMHC 2HRLA 1CLCA 3H4FA 5AG8A 2HT2D 4RMWA 1N5YH 4OJEH 4X6CB 5AQ0A 3VVVA 4KXBA 3B37A 1EAQA 1PEZA 3GPEA 3UH8A 1UJ3C 3MAWA 3QXDA 4DO4A 1NGYB 1WVZA 3LN5B 4JFPA 4OZHA 3ARQA 3EJJX 2NW3A 3IKCA 4GMTL 2VCOA 2WO4A 4KK9D 3OQRA 4Y16B 1VZGA 3HZKB 5D7EA 5F1SA 4YR6A 5C2UB 3EBIA 1KJMA 2O6FA 3B9KD 1SMOA 4FNSA 4P9HL 1R17A 2QQKL 4Q2ZA 1CT8B 1KXTB 3F7VB 4G8GA 1I3RA 4L3CB 4PI2A 4WEEA 2VR4A 2NZIA 2VMJA 1KLFA 2RCSL 4GG8B 4OZGA 3SGJA 4FQXA 5HHVH 1ID5I 3MXWL 2EDTA 4TLUA 5IJBC 4Z7VA 4U1JB 2BIIA 3OD3A 4ZG1A 1SEQH 5DURD 1EEQA 1TQWA 3QG7H 4TLKA 5DA4A 4NO3B 5SV4A 2VISA 3P77A 1VPOL 5DMIL 3BKCL 3GMNB 1OGAD 4XCNB 2B1AL 3AREB 3DX9B 3UPAA 4JFOA 3PWNA 1E9OB 4NKDB 1OAXL 1DJWA 3EYFA 3KWXA 4RBPK 5I76A 3HUJB 4FQQA 5AVTB 3ZW3A 2TSBA 2B5IB 5CLTA 4URKA 1BBDL 4DFIA 1KCUH 3GSNH 4M1GL 4ZFOA 4S1RL 1BBJA 4NIYE 4PWKA 3RE0A 2XPGA 1U3JA 3DX4A 3L9RA 1A4BA 3PRZA 4HK0A 3NIGE 4PGCA 4X4YA 4O9HL 3LMJL 4AV5A 1UKSA 1FFNB 4K7PL 4LCCA 4NENB 3ESPA 4UB0H 4YX2H 1M42A 1HWGB 3ZXAC 3TO2B 5C70A 5AVWB 3QGVA 1HILA 5C6WH 3I3DA 2FX7H 1KPUA 1TNMA 4WHTA 4U3SA 2EADA 2A9AA 4OGQC 2X3CA 1YEHH 4XC3L 1MXGA 2IPTL 4X5PA 3S35H 1UB5A 4OKDA 1LEGA 2IH1B 2WCPA 3PDOB 2W80C 4MB1A 4LSSL 4BZ2A 2MFNA 4AGMA 3UTTB 3KD4A 3BP4A 4N0FB 5EU4B 1DSFH 2BK8A 5F3BB 3H3KA 1QTSA 1UWEL 2DWXA 4FXKC 3CC5B 4GBXD 4YBLC 1EAPB 1R5WA 3RRQA 1SBSH 5K1JA 4UM9D 5FDWB 3CK0H 2AV1B 4QOKA 5SV3A 2VMCA 5KBLA 1UD2A 4GKZA 3O9WB 2F54B 3WEXB 3TFKD 1NEZG 2Q8BL 3CN3A 5FO2A 1VZIA 2WYTA 3HJEA 5FWQA 5HJBA 4W9DC 2LW3A 4ZMYA 1B2YA 2WLNA 1F4YH 3O4LD 1YEFL 3SDAB 1R0AL 2XZCH 2XWDA 4DGUA 2YKKA 2XETA 2YD8A 4JN1L 5AVUB 5I8CB 3CE1A 1TETH 2X70B 2XG5B 2EYTB 2XZQH 2JELH 4X0KA 3DOIA 3VSUA 4OUUB 5HDWA 5CJQH 1E50A 4NJAH 2XN9E 4ZI8A 3JSSA 3WN5A 2QPDB 5JHDE 1FVCB 5F6HJ 2XQYG 2DMKA 2QTVA 3DROA 3K0WA 4JL1A 3HR5B 1Q9OA 5GSVB 4HIXL 5T1MA 4CSSA 5HHXH 4O02H 4HMDA 1CU4L 3GZQA 4LDLB 2Y23A 5TF1L 5I1IL 5MHSE 2IV9A 3QPQD 4Y4FD 2WZ0A 1F3RB 2P49B 3REVB 3FPXA 5C0IA 1QW9A 5I6NA 1XGUA 4W6XB 4BHUA 4KDVA 1WEJL 3GTTA 4BM7A 3K71B 2W0KA 2HJKA 2NYYC 4I2XB 5FCSH 2Q76A 2I9TB 5D7LE 3W0WA 3VFPA 2Y3AA 1UWYA 2KDYA 4DGVL 4KZ0A 2PO6D 2IDUA 2PWHA 3H0TB 5FGSA 5BW7A 3TBYB 2PPAA 1H3PH 1JF1B 1CTMA 3S7GA 2C9XA 5I73B 5L7XH 1XTLA 4FG0A 2FNWA 4NQSA 1HHKA 3MRGB 3DX2A 1CYGA 4KQ3L 2MMXA 2F15A 4UNUA 1WBXA 2VLLA 4LFHG 1J11A 5GRXG 1KXVA 1A6TB 4UIMA 2BJMH 4W70A 2ARWA 5DUBA 5EC1B 4QGTA 3VTMA 1KPRA 4GO8A 1UJTA 3BIBX 4ODUB 5F9WC 3U2SB 5DD5H 4K71B 2NDGA 2ZWNA 1IQWH 4ZYKB 1RHHA 2IFFL 1MRFH 4LLUA 5J6GA 3GM0A 2WNGA 4ZX6A 5EUKB 1C5DA 1OT4A 4Z8FL 1A6AA 3P3SA 4P2CG 5DD6B 1ROWA 1R75A 5LJYH 1ACYL 1ZPUA 2XY2A 2BNRE 1WHPA 5IUCA 4NCDA 4P2RA 4QHNB 2XWTA 1PZUB 5T3XL 4G7VH 3KXFD 1WLHA 3MV8A 1YC8A 4QAWA 1JGVH 3L9EA 3QW9A 4L5FE 1OSYA 3CFBB 5DTFA 4YDKL 4KK5C 5C0AE 2P1YA 2AW2A 1Z1WA 2AQSA 4JFDA 2R0LH 32C2A 2WUBH 4JHWH 4JRYB 5FFLA 4PBXA 5E4IA 2MCPH 1FIGH 5CP3A 4NZ8A 5IM7A 5D5MB 1JUFA 3QZNA 2R69L 4HXAL 4PY7B 1NIEA 1KACB 2C9RA 2W0FB 3ZHNA 2O6CA 3PJSA 4WWKD 1D7CA 4Z7WF 3ULVC 3ABMB 1N6QL 2CLZA 4WZ9A 3P9LB 3BZFB 5EFIB 1K2DA 4QRPB 4KAQL 1HESA 4RETB 1OP3H 3QIBC 4KZDH 1UB6A 1IGMH 1ZHKA 3DHUA 1ZD6A 3WE6B 3HC4L 3QPXL 4KJPC 1EZSA 4NRYB 3VGDA 3HBQA 4TTDD 3R19A 3QRGH 3BWAA 4AEHH 1MJJA 2D31A 2P24A 2XY1A 3HZMB 3FH7A 3CHOA 4P5TD 3PWLB 4LOFA 4XPAL 3PWVB 1T83A 3KPNB 2EDXA 2OMWA 3G5ZB 2AJSH 4WDIB 1U8NA 3GF8A 3L5HA 4JE4B 2X38A 5E6IA 3VXMD 1NDMB 2EVGA 3P73B 1Q72L 2EDKA 2UVEA 3UP6A 3BWUC 2DWYA 3RHWF 4TOYH 2DLHA 2OR7A 4HOMA 2HSIA 3TS8A 3W57A 3C09B 1N68A 3K4AA 1ZHBB 4WWID 5FV2A 5KJRL 2PPDA 4N2KA 3KGRA 1IAIL 4N3TA 3V7AE 1LE5A 4AENA 3LSOB 3U4EB 4H0HB 1T7XA 3WXVL 4LLVB 5HYJD 3C8KB 4OZIB 3H9SB 1BJ8A 2GJ6A 3GSXB 3VGFA 5A2KH 4LMQE 3N9GL 5J1AB 3QXAB 1UA6H 4GIPD 3PUCA 3VFWB 3GRWL 4P07A 5FEBA 1TVBB 2FVNA 4B9IA 1I8AA 2QGEA 3BIKA 4NHUA 2BSRB 3IU3B 3G5VB 3PXJA 3HS0C 4LPYA 1F8TH 1YNLL 5FHAL 2N0MA 1BQLH 3VDCA 2PCPB 2IPUK 3RKPA 1FNEB 1WBZA 5C0BE 5IKCB 3F58L 1SDYA 2CR3A 2XJKA 1ORQA 3FQWA 2Y9RT 5I0WA 4U1MB 4U0RC 1KYOK 3MPCA 1OTTD 1N9PA 2NY5C 2ESVB 4M6AA 3U7WH 5KVGL 5BQDA 4Q9RH 1II4E 2DY2A 2AJUL 3CDGA 4G8EB 5M95B 3MLRL 2UWEF 4Y2DA 1B4JL 2FWOB 4MZ2A 1RZQA 5IW1B 1J0YA 4PJFE 1SN5A 2J5WA 3VXUE 1OF0A 1QRNB 5D1XE 3NOIA 1BXXA 1CFVL 3CVDA 1QA9B 1ZOXA 3UTSA 2AKRA 3QIUB 3QUYD 3VI3B 4EI5D 1ZTXH 1LE9B 4DAGL 2ITFA 3C2AL 2XWEA 1XCWA 3GMOA 4HISA 1NLDL 2EDRA 4B5EA 4LSUH 4NKQB 3MLXH 4PJ5B 3GWJA 1JZ5A 3WKPA 3VFSB 5IROD 5CKAA 4LHUB 5CEYA 5DYOA 1W0VA 5IOKA 2Y2YA 1ADWA 3G5XB 2L7QA 3QQDA 2LU7A 4HBQA 4JPVH 3ZT7A 1N5YL 5FECA 5HXMA 5EZLB 2MKLC 1MVYA 3T3PB 2ED9A 3I3BA 4XNMA 3C5ZA 1LYQA 5HJ3B 3LZFH 3WNNA 1XH1A 2YGOA 2JB5H 1UZ8A 1LD9A 2LU4A 1ZS2A 1CLOH 3BP5B 3TJEH 4ZUUB 5IEHA 4L5FH 1XB6A 2DYSB 2V9RA 3CFCH 5FM5M 3WTSA 1U92A 3NN8B 1M4KA 3PL6C 2BZCA 2LAAA 3QEQB 3ZZ1A 4NNXA 4BZYA 5HHVL 4J3OF 3ZE0B 2GQHA 4F3FA 2NNFA 4X0NA 3BUPA 1U4FA 1GZHA 3QG7L 4Y4HA 2VC2H 3NIDF 1H15B 2VL5A 4NM4H 3N1PC 1VACB 3CXFA 4OV6F 4PGBA 1B9ZA 4H2AA 1G1YA 1OT1A 1PYWB 2ATPA 4FMFA 3SJVA 1XCQA 3S37H 3QEHB 3BVXA 3FQRA 5DZ9A 1HXKA 2YQBA 3VX0A 2DKSA 3FHQA 4LHQB 3WJJA 2NZ9C 2W92A 4NEHB 4WW2A 1JZFA 4R7LA 3BMVA 3FSWA 3GRWA 5T3ZD 4V1DB 5CLZA 1KCUL 3GSNL 1VDGA 1AGCA 2KZWA 2VDKH 2VXUL 5C71A 5EBMA 2DLFH 4MMZB 1BQHG 2UY7A 3ZMNA 2W8CA 2APFA 3BPLB 2WJ7A 4UT7H 2NOYA 1GGBH 3CX5K 1FNFA 3B2DC 2IBGA 3BE1L 3FOMA 1ET5A 4YQXH 2W60B 2KZBA 2XTSA 3DV6A 4GQ9H 2BVOB 2J57A 4LU5H 4UB0L 3BSHA 3ZKQD 5GS0H 4W9KC 5LGJB 5KYWB 4KKAD 3WKQA 2JLPA 3BHBA 4EI0A 2FX7L 1ZT1A 4GY4A 1YEGL 4UT9A 4YDMA 5SWSA 1U93B 4ZSOE 2C1PA 5GIRA 2XUWA 5IEKB 2AAAA 3ZRCC 1YEHL 3QZPA 5F7WC 3S35L 1ZA3B 3TEXA 5FO8A 1IO4C 2MTPA 4ODWB 5HGAA 3UIZA 3WHE0 1X9QA 4MD5A 4N8CH 3H8NA 5E4AA 4X9GA 1LNUB 35C8H 1E2VA 3DX0A 5EU3B 4KRNA 4HKBB 1DSFL 1JFQH 3ZHLA 4D2NA 1BYNA 3QFDA 1SBSL 3LRSA 2I7SA 3L08A 4P5MA 4NLAA 4FP8H 1I75A 5CBAB 4IJ3B 5JDSB 3HC3L 1SVCP 3QZBA 1OB1A 4MBRA 2OPCA 5F72S 1GPOH 3APDA 3B9KC 3SY0B 3GXIA 3QEUB 4NRXA 3ZKSD 4N2GA 5DS1A 3ZDWA 2JKLA 3HCVB 3ZDXB 2GK2A 4PGDA 4F9PA 2DM2A 3IJHB 5BUAA 2JK5A 2N56A 2XZQL 3CZUB 4HS3A 5EZIH 5CWSB 2LVCA 1AZNA 1ODUA 4I1RA 1B4TA 3RY6C 1G7JA 1VKXA 2ICCA 5CJQL 4NJAL 4C55A 5L4IA 2NXZD 4IRSD 2QTEA 3FQTB 3Q43A 2E8ZA 3TBTB 1JK8B 3SPHA 3TT3H 2X6MA 5KANG 1BFTA 2EH8H 3V6OA 3TIDA 1ASQA 1BQSA 2R1YA 1FYTA 4O02L 5HHXL 2ZONA 2WN3A 4G1EA 5CR1A 3OR7B 4NPYB 4XMVA 2R39A 3C08H 2WXFA 1EXUA 1AXSB 4KRPB 5E7FA 1YMHA 4TNFA 1DVFB 5DS8B 5C08B 3U46A 4GAYB 4L23A 4DP5X 3VD4A 3IAQA 1U8JB 5KEZA 1INEH 3WCYA 4JRFA 3TVMA 4PJCE 3GO1H 1DSYA 2ZYSA 3P4OB 1AO7E 4BDVB 3DC0A 3O4OB 3C60B 3II3A 3PWUB 4FL4B 5IQ9B 2DW5A 3GSNA 4U1SB 1H3PL 3JV4B 3CZFA 4NKIH 3KCWA 3FFCA 4KNSA 4XNAA 1GGTA 5L7XL 1J12A 5EOQH 1Q0XH 4XC1H 4NO0A 1JZEA 1NGPL 2XIDA 4YO0B 4OF0A 3D25A 3SYPA 4D9QE 5GGSA 4AZ8A 4QHLA 2BJML 4WI6A 3NRFA 4DCQB 3BAYA 2ISDA 1FYHB 2QADB 3D51A 3HMXA 2J6WA 1QFOA 1IQWL 5AW3B 5GS2H 1OSPH 1MRFL 4GUPA 2DWEA 4WHYG 4ZXBD 4LNRB 4NWTH 2LU5A 4GBXC 2B59B 4PRNA 4RIRB 1NFKA 1PZDA 2FWLB 5AKVA 4PJ8B 3DLQR 4R4NC 3DOHA 2Q8AH 4OVUA 5FUCE 2VKWA 2Z91A 2K7QA 1NINA 1J9SA 4KKRA 4X6EA 3TFKC 3LTVA 4U1NB 5JW3H 4G7VL 3L81A 5HYFA 4IHOA 1JGVL 1YY9C 5K59F 1RAMA 1A7NH 3KLQA 3GS7A 4HIHB 5CEZD 5IREA 4JFEA 1IC7H 1N10A 4PCTA 1A47A 4IBZA 1OTUD 3FQNB 2R0LL 4FG6D 4JHWL 1EHKB 2WUBL 4UDTB 2MCPL 1FIGL 1T0NA 3QYCA 1A3LH 5FO9B 3SDDA 3WNLA 3IDIA 3PCYA 1XD1A 5JPNB 1IL1A 2Z35B 3H3BC 3FHEA 1WSST 5C0GA 1WTLA 2V9TA 1K5NB 3PYCA 4E9XA 5DT1H 3G5YA 5D6DC 4QRUB 3RL1B 2DM3A 3L4CA 2O72A 1DLHA 3HPLB 4PMFA 4QLRA 4G7YH 4KZDL 4OQ1A 3AU0A 1IGML 4P4KD 3FU8A 2EDNA 3DMMC 3BFWA 4Y4FC 4G9FE 3WLBB 4H5SB 1E4HA 1D7DA 4KTGA 2K45A 3VRIA 3IFNH 2J88H 3EDEA 2BVQB 4L0PB 3QRGL 4R2GD 2J21A 1H3XA 3K0YA 1HI6A 4AEHL 3L2LA 3MV7B 1G9MH 4XB3A 3VU2A 2GTQA 2ZCLL 5E4EB 3I50H 3KVDD 2P8LA 4R8WH 3NH7H 5IMLB 2WBKA 1XGPB 1W91A 2OSWA 3ES6A 1FUNA 1HAUA 5E00B 1H3UA 2G4GA 1RIVL 1KLGA 2MNWA 5FA3B 1KIRA 4MXQD 4G8IB 5H2BA 3S5LA 4JQIA 3EYOA 5F7FA 4GQPH 3D34A 1DCLA 3EG9A 3VMOA 2J44A 3PP3K 4TOYL 2CKBL 4MQTB 4U1GC 1FVEA 2HRHA 1G0YR 4PJXE 4FFYH 1UM4H 2WBJD 1J5OL 2GEQA 4JKKA 1PLCA 1S4IA 4H20H 3ZYZA 5LUMA 4I3RH 3L7FB 4HXBH 4FOMA 1KB5H 3MNVB 4UILH 3FCSA 2R83A 3KL0A 4BCXA 1RZIA 3DUUA 1EH9A 5F6HI 5JORA 1NC2D 5EPMB 5FUZH 5FYLE 4GRWF 1UA6L 4JO3H 5KSAD 5KANI 5HHPB 2UZPA 2C9QA 3BLBA 4JZNB 4RAVA 3A6OA 3SDXF 1F8TL 3LKSB 1RZKC 1BQLL 5AENA 5F93C 3JQOB 3N41B 3TA4D 1MG2C 1PDKA 3K3QA 1IVLA 3BH9A 3BPOB 5IW3A 5JA9A 1PD1A 4CADA 4HG4K 4BBWA 2JJWA 2R7EA 3TV8A 1YJDC 3A21A 3KWUA 3FONA 3WS6C 2XIIA 1ASOA 5HHMB 4UQBA 4BE5A 3S34L 1MFEH 3U7WL 3QWNA 3EJZC 1EGJA 4DZ8A 4PAZA 1OM3H 1FFRA 4NDMB 4DP4X 2ENYA 4GW4B 4MQ7A 1X4ZA 3L9BA 3BWSA 4QEGA 3FYIB 3QFJD 4WTZA 4WWKC 1ML0A 3O45A 3KMDA 3K6IA 1E8YA 2G9HA 1S7QA 4G7RB 1MHEB 2A9BA 1E5YA 3EH5B 1UURA 4M61A 1TKWB 4ODXB 1KFGA 3GBMH 1D9KA 2OQJB 3PP4H 2CCWA 5PCYA 1L0YA 1P9MA 2GUYA 4P57B 4LSUL 5B38G 2H0FA 3MLXL 2HKHH 4JFFB 3Q2LA 4R84A 3VFTB 5BUGA 1KIQB 4FTVE 1FH2A 4Z7VF 1I8KB 2YLKA 1JV5A 2R59A 4JDVB 4X6DB 3FU7B 2CIKB 3ZR5A 4FYQA 3VAEA 4R3SA 3SYOA 4HAKA 2HFEA 1AMYA 4JPVL 4M6NH 1FORH 2WXKA 4FKEA 5KTEH 3NK4A 3L3OC 4P2OA 1OHQA 5I0DA 2F68X 3IS0X 1AHWA 4ECNA 1GZQB 3LZFL 1TENA 4K3GA 5HDBB 5EF3A 2MWCA 3QYMA 1XF5A 2JB5L 2BHZA 3NEEA 2B5IC 3AVEA 5JUEH 2HTLD 5C08D 3S36H 1LQSR 2KS0A 5CMAA 1ND0A 5DK2B 3TJEL 2EO7A 4Z7UE 2UWEB 4L5FL 1A4JB 2X1WL 3DWTA 2PTUA 3CFCL 4WEBH 4PJHF 1A1MA 4AVKA 2NT1A 1UUSA 4LBEB 5BVPH 3OR6A 1TG8A 3KGSA 1MFVA 1T3FA 3MBWB 3MLTA 3ML9A 5IQMA 4FXGA 3MLPA 3DIFA 2YD7A 3MO1B 2CKBA 1UXWA 2VC2L 4I48B 4U1HA 4NM4L 3HNVH 4XAKE 1Q90A 4NI3A 4AW4A 1LEKA 3U7YH 4I4WB 3P69A 2EDOA 4P2YA 1RZ7H 1SUJA 4ATTA 4CW1B 3S37L 2DBLH 2H26A 5IHUH 4WKZB 4LLWA 3OZKA 1HE8A 5D7JA 1JFHA 4KMQA 3FO0L 3LEXB 4KKCC 3Q2CA 3VUAA 15C8H 2CPUA 2YMTA 4IBYA 4FYRA 2FEEI 4WTXA 3EAKA 3NZUA 3PGCB 1L9MA 4PJ9D 1F4HA 1OSEA 2VDKL 4H2CA 4LB8A 1OTTC 2DLFL 3X14A 1INQB 2R0ZH 3UERA 3GJFA 3KEDA 5E2TH 3PU7A 4UT7L 4CMMA 1FG2B 1LLAA 5AB0A 4QT5A 4R4BA 5LNGA 5IB3A 3H9YA 3O9WC 4YQXL 3E38A 4GXUM 5SX4H 4GQ9L 1E4KA 4LU5L 3UDWC 2WLIA 1Q1JH 5GS0L 2GEEA 2VW7A 3TYFA 4H44C 2FDBP 2B16A 4BRJA 2UY6A 1JF5A 1MN4A 1JTTA 1MLBA 3IDGB 3VJ6A 4EI5C 4FABH 5J89A 3WY2A 4BA0A 4HP5A 1NICA 4U7KA 1B0GB 3ULVE 5IROC 1HAWA 1RPKA 2YUZA 4OR1A 4MKMA 4N8CL 4LCUA 3STZA 2H5UA 3L3GB 3OKEA 4FA8A 2OZNA 2J73A 35C8L 4MX7A 4D0DB 5DUMH 1KCRH 1R46A 1PS3A 1QABA 1FL5A 2QFPA 2XWRA 3V2AR 5KBDA 4CU8A 4YJZL 1BFOB 1HHIA 4RGND 4YDIH 4FP8L 4Q9QH 5DJ2B 3KWTA 5EZJB 3B9EA 4UF7C 3D39E 3DURA 3MROB 2NCMA 1GPOL 4M5YH 3CFKA 3NTCH 1I1AD 3O8XB 1SJVA 2ADFH 4QAMB 1MHPL 4AIEA 1R33A 2BNRA 2WLHA 3RI5F 2OKMA 3U30C 4RDBA 4GIAA 3GKZA 5DO8A 1D6VH 2WV3A 2XKSA 4Y2OA 1O7VA 4PJGF 2O5NA 5ESAB 4PU2A 4NERA 5EZIL 3VFMB 3VGBA 5J5EA 2VQ1B 5I73C 4Z3HA 3GB7B 4LIQE 1JSYA 1R5VB 3MOBH 3TT3L 4JNXA 3T0BA 5EOCJ 1S9WA 5DUPL 1UOLA 2E74C 2EH8L 4G70B 4L1LA 4TSBH 4XHJC 4EZKA 2AS5M 1KGWA 2HKAA 4EUPH 3MUZ1 1YN6A 2VAAA 3FB7A 3C08L 4A6YB 4DP2X 1Q0YH 1DUZA 1IKFL 1PJWA 3J8F7 1LL1A 3V6BR 1X5MA 4L37B 3JBG7 4WHCA 4NRZA 5JHLH 1WFMA 2A9DA 3DX7B 1N3NA 3WUWB 2ZG3A 1VERA 2Z31D 1INEL 3GO1L 4M9PA 3LHPH 1OSZB 2V4LA 4BINA 3LQAH 3P11H 4HDIB 1AKJA 2B7DT 3KWWA 3GSOB 4DETA 1JVKA 3CSYA 4XE0A 5CM1A 5AW9B 5EEVA 2X1QA 3TBSB 4LRIC 4MA7H 2VM3A 1X6LA 1JXDA 4NKIL 3BN3B 1L9QA 2OULB 3B5HA 4I87A 4Z7NE 5ANMB 5EOQL 1Q0XL 2FATL 4XC1L 4AYSA 1UCTA 1AP2A 4FMVA 4JHZA 5CHNA 1U95B 4EKXA 3X13A 2BHYA 3L95B 3X1GA 4MS6A 2A4CA 4KC3B 3RGVD 1SPDA 2OZ4A 1YMMB 5F1NB 3Q0HA 2KKQA 1DQKA 3I02B 2AEPH 2EDWA 5D9SA 3TGXA 2MCMA 5DHVH 5TD4A 3TH3T 3NJIA 3TURA 4KXZI 4N6QA 4BUGA 2XWXA 4NWTL 5LBSA 3LXBA 5JOPE 2P9RA 3PQYB 4O4YH 2IANB 5KVDE 3ARGB 1WPCA 3D18B 1ZCRA 4UTBH 4UYPA 2CD0A 2GBVA 1VLXA 3BZ4A 2EE3A 3OJDA 2Q8AL 2C9UA 3X3GH 4Q8BA 3K6SB 3WEOA 1MI5D 1J0KA 4PJ7F 5I8EA 4OW6A 4MS8D 5JW3L 1NAKH 5GSRB 3LX9A 3KLLA 2CE6A 5I82A 4B9ZA 2WINA 5FKAA 1S5HA 4LQFH 5AZEH 3TCLB 1ZT4B 4W9ZA 5HI4C 3GGWA 3I6GA 4D0BA 1IC7L 3SBWC 3D87B 3OJ2C 3U6XS 4DP0X 2AF2A 4F58H 5GGTA 4E5XA 1AD9A 4OZ4A 3S3DB 4AM0Q 2ZOUA 2QPEB 5C0BA 2EJ1A 2ZUQB 3DGCR 2X2UA 1O9WA 3RFZA 2VUOA 1EJFA 3JWOH 1C7SA 3MA7A 3VO0A 1JD9A 3DVNB 2V5RA 5DT1L 3FMGH 4X42A 3C09C 5J0BA 5EOTB 3CVCA 4G7YL 3NRPA 4BFFA 4NUPA 4KTDH 4ODVH 1A7OH 2GIXA 2ILLA 1MVUA 2NYZA 4ZS6D 4PJFA 5ESQA 1ET8A 4F8TA 1NKGA 1DN2A 3VXUA 5D1XA 4DGIH 1KYOJ 3IFNL 3L4WA 1NGWA 2J88L 2WD0A 4NC1E 1WAPA 3AM8C 4OLEA 2HN7B 1JN6B 5DJYA 4JFYA 2MTAA 2F53E 1FBIH 1G9ML 4L4VB 4CC4C 1RJCA 2ICWJ 1LP9F 4AK1A 4AH2A 3O2WH 1IM3A 3I50L 2PR4H 5JW4M 4R8WL 3NH7L 3MREA 1DVQA 4ZMZA 1AH1A 1OGPA 4PV9A 2LGNA 1WITA 3FTWA 4EF3A 5JYMA 3W1ZA 1BPVA 3EGSA 3U6XA 4KI5F 2OTWA 1A6ZB 2CPCA 5KSBB 4J3OG 3BLKA 3MJ8B 2R29H 4XZ4A 3WYRA 1JYXA 1Q38A 4FFYL 4AKQA 5MERA 4A68A 3GK8H 1UM4L 3RDJA 3Q9PA 4KV5F 3MTXA 5L2JB 4H20L 1JNLH 4I3RL 1G7LB 2R4RL 4HXBL 1CB4A 2YC1A 5E0QA 1KB5L 2G0LA 2Z7YA 3ECUA 4UILL 1DN0B 4YDVB 4LIQH 2OMYA 2XTJB 3MDJA 1WZKA 3KPRD 3QIUC 4J3OD 2EEXA 1U3YA 3KPMA 4JO3L 4KOCA 5FUZL 5C3TA 1BMZA 1ZXQA 1U58B 5CLWA 2QHLA 3HTLX 1H3TA 3Q2NA 4F7EA 1E9PB 4FULA 2C34A 1WS8A 3DRTA 3UPRA 2BP5M 4JRLA 1MCLA 3CFQA 4JG1H 5BVJA 4QGYA 5EH1A 4NZRH 1J48A 2VSCA 1X7QB 4WGKA 1S3KL 5I16B 4NQEA 3UAJD 3DARA 4I18B 4E9LA 3D2UB 5E5UB 5HGDB 4J3XA 2L7EA 4ZX5A 2F2HA 4MMYB 1MFEL 1F2XK 1HK6A 1T7ZA 3FT3A 2ZF8A 5BQ7A 5TDOB 3MNWA 4R6UA 4ZW8A 1U8QA 1OM3L 1AIFA 1GGIH 3R0MA 3WKMH 1F4AA 1SXBA 3W81A 1UEYA 1PEWA 4Q6IA 1L6PA 4AQOA 4DEPB 3AT8A 4WI0A 1BXAA 2EILB 5TK2A 3GMQB 1IGFL 4XBPB 3GQFA 2BNQD 1J9QA 1IBBA 2E9JA 2OXGB 2VB5A 5E51A 1OGAE 3RL2B 3VXPA 4HOXA 5GXBB 3GBML 1G6VK 3PP4L 4Y1AD 1IT9L 4PB9L 1MVFA 4YFLI 2C4FU 1BM7A 2HKHL 4F2ME 4WW1A 5ITFB 4R2GC 2R2BB 2JJSA 4MWFB 5A7BA 3KLSA 3DVGA 2LQRA 3CX5J 2FK9A 4LL9A 1FNGB 3GMMA 4FHBD 1MHCA 4ZSOA 1I7UB 3ARSA 1PX3A 3OMAB 1O6SA 5D1ZA 1JMZA 3FT9A 3QDJD 1SDDB 4MDIB 1FORL 5KVDH 5IGXH 4LSPH 4BZ1H 1NEZB 5KTEL 5J4MA 2W9DH 2CO4A 2BWDA 5CZKA 3V6FA 1VADB 2NY0B 3F3HA 4W6YB 3F8UB 4E41B 3MZGB 1ZHLA 4HBCH 1W2KT 2WXHA 1Z9PA 1RJLA 5JUEL 1QI5A 4WO4A 5F0MB 4WW2F 3S36L 3IN2A 3EJYD 3WFZA 1KELH 4LASH 3RWEB 3VWKB 4GIOA 2ZSWA 4WEBL 4MMZC 5CINH 2EUZA 1CLZH 4PV1C 2WBJC 2A1WH 3BPLC 5BVPL 3AC0A 3O6FD 3CH8A 4A6YH 3VDBA 2D03H 3UBXA 2PXYA 2HLEB 3VNZA 5IT2H 1Y18B 3I9IA 3VD1A 3V10A 2ZD0A 5IFJB 4J6IA 4KROD 3HNVL 4FFYA 4A39A 4YSSA 2DQFB 1PG7X 3B83A 3GT6A 3U7YL 4BH8A 4K9JA 5T1LA 1ZXKA 1RZ7L 2FO8A 1VEMA 3EOTL 5F9JA 4N0UB 2DBLL 1J9RA 3ZE1F 1AC6A 1KB5A 1YNTA 1CE1L 2QSTA 2ZPKL 1RUMH 3JUZA 5IHUL 5DK0A 3QEGH 2P5WA 3A67H 4JJOA 3CNKA 3Q8BA 3KHQA 1NGXA 3EH1A 2CDFA 1A6PA 4XMUA 3ARRA 5FHBH 4D94A 4CJ1A 15C8L 1NA8A 3H53A 3LD8B 3IMRA 2LV4A 1AGFA 5K69A 1A2YB 4X4XA 1EDYA 3A22A 2VSKB 3HE7B 2E7LC 1KTDB 4A7QA 2PCYA 4Y5VA 5E2TL 5E2UH 1FFPB 4M62L 3KH3A 4IJ3C 3O4LE 3P02A 2CO7B 1TFHA 3GXTA 2QGDA 5IW6B 1J0HA 1NGZB 4PJCA 1Q1JL 3WFBH 2HWZH 1AO7A 3MFFA 2JV6A 2XBZA 5SWZA 4ELME 2FQDA 2X6UA 4FABL 1CF1A 3FF7A 3NPSB 3T0XA 4BSVA 4X5WA 3QHZH 4NAJA 3IGUA 4R97B 3F5WB 3LZPA 5HVHB 4JKPH 1YYLH 1F45A 1T21A 5C07D 2FJHB 4UM8B 3KGUA 5I24A 5LNDA 4GMSL 4ZFFA 1CBVH 3OC5A 3PJLA 4FZEH 5DUML 5ID1A 1KCRL 3MRHB 1WFOA 5K39A 1MCPH 3HPJB 4AZUA 4WJ5B 2E86A 4N1CA 1N2RB 4NBZB 2VGLM 4YDJB 4UOW0 2APVA 2H3XC 4APQA 4HA1A 1XCXA 1H19A 4YDIL 2AK4D 4Q9QL 1HDMB 1XGTB 1LM8V 3AQYA 1TSHA 3L48A 2A6IA 4M9OA 4Y88A 1YQVH 3MJ7B 2FEDD 1YAIA 4KRPC 1DVFC 4PRDB 2HTLC 2YEZB 3IDNB 2QPFA 1BZ9A 1L4IA 2RBLA 4JPKH 4M5YL 4QO1B 3VFUB 3NTCL 4BH7B 3LKPB 1R3LA 1WCBA 4F7PA 2HZHA 3G6AB 4BK5C 1J5CA 3JTTB 4Z6AT 2FAUA 3T0DA 2KUTA 1P5VA 4GINA 3A23A 3VXQA 3K72A 3C6LB 2AJ3B 5GS1B 3MBED 3JT2A 4KKLC 4X99B 4N4YB 4LSVH 1OP4A 4EXKA 4X98A 2CO3A 3A6CH 3H42H 2XRAH 3QJHA 2VN5A 2V8LA 3MOBL 4OLXH 4AMKH 4DFHA 1JGUH 2DWTA 4L1TA 5EO0B 1GW0A 4TSBL 3RWCA 3VDAA 1XF2B 4PP2B 2IQAA 3WFCH 4FX5A 3GLZA 1TMCB 4RVBA 2OTPA 4FNRA 5TQ2H 1Q0YL 2O5YH 1A4KB 3HHMA 2UXTA 3ZTCC 3ULUH 1P0SE 4HQQL 4ZTPH 3HG1A 5JHLL 3U1SH 5TE6H 4S2SA 5DD0H 4WHDA 2W9EH 2WTRB 3KXFE 1ES0B 4KVNH 3LHPL 1CXFA 1BIIA 2G5BB 1C1EL 2YJLA 3T1FB 2I9LB 4G9FA 3LQAL 3P11L 1I7RA 1DZBA 4MXVE 1RJYA 2AJZB 4XMKH 1BLIA 3GXNA 4Q4EA 1IFGA 5CJXA 5FO7A 2FYYB 2BVYA 3SPVB 1JDAA 3UYRH 1BAGA 2WNWA 4AGOA 3GMLB 3I9GH 4HU2A 4I1NB 3SN6N 4PSRA 1GCFA 1JPSH 3FUEA 4KJYB 3F2LA 5I1LA 3LZRA 2XWBA 4HOZA 2ARJQ 1IGTA 3UROR 4O2FA 1ED3B 2VQTA 4FA6A 2X4SB 3FZUD 2AEPL 5T1KB 5TPWH 3MZTA 4PVLA 5JPNC 3VYOA 3IDMA 2NUPA 3FT2A 1IRAY 1FFOA 1ZWIA 4YGAB 5F2FA 4A2HA 5MEND 4AEEA 3QJUB 2GSIA 4O4YL 3KWVA 4B6ZA 4UTBL 2VLRA 1HJCA 1J8HB 1Z5HA 3CFMA 1BLNA 1HZHH 4HIPA 4XP9H 3X3GL 5C09A 2XDHA 3MGOA 4N22A 3DUSA 1T2JA 3E8VA 4HWEH 5EWIH 1A7RH 1HOCA 1NAKL 5D2NE 1I1AC 5E2JA 5TH2A 4FHJA 4QF1A 5GZNA 1OF2B 3GYRA 1QFWH 3CZNA 4X7TA 5AZEL 3KE0A 2MIZA 4N8VA 4JMNA 1IEAA 4U1LB 3VXME 4FXKA 1NIBA 1KCVH 3B34A 4F58L 4S1DD 3P4LA 3V0DA 1TTGA 3ARDB 3TN0B 5C0EB 5CSZB 3VXSB 2OXHA 5D6CB 3FCBA 4HSAC 5IVXB 4ZFZB 2B77A 3GSVB 3KM2A 4LRNH 5H94B 1ODAA 1JVLA 3JWOL 3OKLB 4TTGA 4Y5XC 2FIKB 4HJIA 2OJEB 4JLRB 4OY9A 5HYJE 3FMGL 2J6EH 2IPUG 1JZJA 3N2JA 1E6JH 3SE8L 4HG4J 2LT9A 2Q86A 4KTDL 4PRIA 4ODVL 1A7OL 3TPUB 1JCKA 4HF5L 1NC4B 2YN5A 4UNIA 5ICYA 3TTSA 4R96B 4DGIL 4K3DH 5I71C 4KTYA 3OLDA 3BEVA 1SXZA 4G8GD 4Y4KD 5E2WH 1GZPA 1SYVB 1Y1UA 3V4LA 5HYSA 1FBIL 2KDGA 1G43A 1TNNA 3HHSA 4Y1SA 1TTBA 3E6HB 3ERXA 3O2WL 2PR4L 3ZKXC 1E7UA 3MCYA 4N0YH 5DR5H 5IP4A 4JY6A 1DJXA 5JLZB 1O7SA 5CZVH 1AFVL 3W9EB 1KIPA 4GH7B 3D8MA 3KYNA 3AS3A 1DVUA 4GSDH 1R24B 4X8JB 3NFSH 1Q4NX 2DOCA 4PG9B 4AC2A 1NPJA 4OCXH 1JGIA 2YBRA 4H8WC 1HEZA 1HSAA 2NY1D 2FJFB 5HDRA 2R29L 2VXVH 1P1ZB 25C8H 2YUWA 1KJ3L 3F7LA 4ZUSB 4WK4B 5EORH 4TSAH 4Q9BA 2H1LM 4R7VA 1N8ZB 1JNLL 3II2A 4Z7UA 4OFIA 4FQJL 1IBDA 3OWRA 5JO5A 4L9LC 4LIQL 1LK2A 3SE3C 4XX5A 2YEQA 5DJAB 1P7QB 1UH4A 4YZFE 3E80A 3IFOA 4Z78B 3UCRA 1FO0A 3BFQG 4GXUN 1CDGA 5DHVA 3LQZA 1Q9KB 2AXJA 4PJ6A 3FFDA 3HZVB 4MS8C 3SKOA 4UTAH 1UXLA 1BQHB 4JG1L 5AKTA 4NZRL 1U42A 2K8QA 5EBWB 4G11A 4LKCB 5AW6B 3L1GA 1SRDA 4WVRA 3WV0A 4YDLB 1UOKA 5FGCB 5B39A 2J3SA 3S9DB 2WW8A 4P2QD 1LHZA 1RLBA 2DI9A 3OPZL 5HJDA 1JNHA 2E6PA 4GW5B 1IQDA 3T8XA 2G4EA 3LKOB 1COBA 1DVZA 1AR1D 2QV4A 4Y1TA 1GGIL 2W91A 3WKML 1TUPA 3QULB 1C12B 5F88A 3BAIA 3UTQA 1Y7VA 2X87A 1CL7I 1T1ZA 4BFRA 2FGWH 1AQMA 4XVSH 2C7UA 4MCMA 2N4IA 4QOKD 4PTTA 2VR7A 4ACPA 1E27B 5ETUB 4Q0XH 4ZS6C 3TNNB 5K9OA 1S9KC 3VQMA 2CLVA 2HVKB 1AOZA 4G80A 5D7IE 4EDWH 1MCRA 3QAZB 1FI8C 5BOZG 5F7UA 4R7XA 4F37F 3OSKA 5DRNA 4OFPA 1E28A 4L4TA 5JA8B 3U36A 4OFYA 3BUDA 4U6XA 2ZOKA 3DPBA 3Q6FA 5KVDL 5T3ZE 3FL7A 5IGXL 4LSPL 1SY6A 4PLOB 4BZ1L 5AOKA 4AYFB 2F6AA 2JWYA 2W9DL 3QIBA 4UZGA 1RFDH 1WO2A 5DJCA 4CSZA 2PYEB 4HBCL 2Q5BA 2UZXB 4RFOH 1OO2A 2X4RB 3FO1A 4Q14A 4UUJA 5F0JB 4DEUA 1OGTA 1KELL 3PXLA 5CCJA 3CDFA 3D85A 4GAJH 5CINL 5DFAA 2AXWA 2HRPH 1CLZL 5ALCH 2A1WL 3D39A 5ERWB 5DQ9B 2XKNB 4YBQD 4A6YL 1QSFA 3OAUH 3RWJA 2D03L 2C9SA 3BAKA 5IT2L 5FB8B 2R29A 4M7JH 1PQZA 3DK2A 1HKLH 1OAZH 4R7NA 3JV6B 1JGDA 2HUEA 3U1QA 4JDZA 1IGIH 2VDPH 1DJYA 4ZZKA 1EUUA 3VFOA 4AT6A 1X5GA 5D1QD 1AS6A 2JB6B 1KENH 4PJDA 1FAKT 1RUML 3EFDH 1ROCA 1XF4B 1Q8MA 1KNOA 3QCUL 3QEGL 4PS3A 5LAXB 1U6AH 3ROOB 5FHBL 1E2ZA 1E7VA 3PNWB 5JNYB 2DQGL 3QUMH 4LT7A 1CC3A 3EFOA 4OQTL 4QCIB 1DQMH 1YY8B 4M8QB 3SDCB 1GKOA 4JM2F 4L29B 1I8MB 4N2DA 1PKQB 2J1ZA 4O58H 4WY7H 2CAKA 1J8HD 5E2UL 4MJID 5DVPA 1GSKA 2RFXB 3VRJB 5AZUA 3D3VD 4OF8A 3NVQA 3GJEA 4NP9A 3K8KA 2DQCH 3WSQH 3IMBA 1HH9A 3WFBL 2HWZL 3C6SA 1CFNB 3O8XC 5ALBL 3G6JF 4MA3B 2DQDH 3CLEH 1S7SA 4RMQA 2GBAA 1P4LA 4MDJA 1FSKC 3L6FA 1G7QB 1FZJA 4HUWB 4UT6A 3QHZL 3WL9A 1MXDA 1T1YB 1OM9A 2ZXCA 3ZO9A 3BEWB 2DI8A 3MV8D 4JKPL 1YYLL 4K5NA 4POZC 2VZ1A 3BSGA 5F89A 1M3JA 4PS7A 4EI6A 2EKSB 3P3UA 4PCKA 1HXYA 1CBVL 4FZEL 3RNKA 3TWCL 1P1VA 4YSAA 1MCPL 3ARFD 4JQXC 3NSCA 4LVNB 1H6TA 3M86A 3K2KA 2RALA 2WXLA 2G75A 4J27A 1NUNB 3OF6A 1J9TA 2XYBA 5CD3B 3VFNB 1WZLA 4XGZA 2PTTB 5H37A 2K4WA 3RX7A 3TBVA 4PCSA 1YQVL 4PRHD 2Z93B 2W95A 4JPKL 2EP6A 3L9YA 4KXAA 1I9IH 1UWGH 3B7SA 1XDTT 2JXMA 3BOVA 3H6AA 3WMPA 5D96B 4S0TD 2EECA 5JR1H 4X7DC 3HB3B 2VM4A 2E5EA 4ANVA 1MCCA 1SOSA 2JIXB 3KYMB 3O3BB 1MWAB 2WN2A 3S96A 4KROC 2F5AH 3AY4C 5F97E 3H42L 3A6CL 4I8DA 2XRAL 4BYHA 4DKDC 1VFBB 4OLXL 1GRWA 2OMBA 4I0PA 4AMKL 1JGUL 5EA0L 2IADA 1L7TH 4I9WD 3NQKA 3W5NA 5B3JF 3PL6A 2I60H 2OSXA 2YQ3A 3AQZA 4GRLB 4FI6A 5E6ID 2MEJB 2WIIA 2P8MA 3RKDD 4ADIA 1EAJA 5TQ2L 2O5YL 4NQVB 5C9JB 1T20A 3MKGA 3ULUL 1IM9D 4ZTPL 2NY7H 3HAEA 1EHXA 2XT1B 5KS9F 5KOMC 4OTXL 3IN0A 3IDJB 4XVTH 1PX8A 4ZZFA 3PAVA 5TE6L 1AGBB 4HZ1A 2KBGA 2WXOA 5DD0L 2W9EL 5DZAA 1RCYA 3G04B 4KVNL 4YSEA 2Q3XA 4NZJA 3V4VB 4FNLL 5T3ZH 1PLAA 1JMXA 2ADGB 2K7PA 4EDXA 3EOAA 5CEZE 3ECVA 4JY5H 4XMKL 1F90H 1A3ZA 4OQTA 4BHUI 3UYRL 4N1EA 4DO5A 43C9B 3VH8A 3HKZA 3I9GL 2GHZA 4XAWH 1M2OA 3LDBC 4IHBA 2VABB 3P9WB 2I27N 1C08B 3US0A 4G8FB 5L9DH 1WA0X 2RR3A 5ISZA 2DS4A 1DQLL 2UUDK 3VXRB 1HT6A 1G9NH 4KI5D 4ZFQA 5E08H 2C1OA 5CD5D 4FCHA 4QTFA 5DJ0B 5TPWL 5B1JA 5EUOA 3L3DB 2XXMB 4G7QB 4D9RD 3UTOA 5KW9L 2H3NA 4XXWA 3E3QE 1ZLWH 2DV6A 4KTEH 4LVEA 1DR9A 2CCLA 1Z9OA 3ZTJG 4ADGA 1HZHL 3M8OH 5DVOA 4XP9L 3EO1A 2A77L 2PWDA 4RMUA 3VXTA 4XVUD 4HWEL 4L3FA 5DEFA 1A7RL 1U91B 3OPUA 1EXHA 4PJBF 4JKLA 1EEYA 1QFWL 4ICXA 4PWGA 1TEFA 1T7VA 1KCVL 3ZDYB 4PR5A 4YLBA 5T5FA 2OTUB 2Q9OA 3MRRB 1BHGA 1DEEB 2X4PB 3L13A 5I75B 1YPZB 1UC6A 4JR9H 1EHLL 2XYCA 3QISA 2CBPA 4LRNL 3DYOA 4G9DB 3B9KA 1I85C 2Y5TA 4W9JC 3X11A 4WNSA 3P54A 2EYRB 2J6EL 2YIHA 5C7ZA 2IAAC 3LN4B 3MOAH 5EZOH 2DLEA 4LLQB 1ZRUA 4EEEA 3VRLF 3RY6A 4K3DL 2OX5B 1HS6A 3SPJA 1N12A 3NIFF 5E2WL 4FYTA 1T5WB 2CCVA 4E9QA 2XXGA 1OGAA 5GGRY 3WJLC 1XX9C 3S8FB 2XTJC 3L4YA 2X4TB 1BYPA 3TZVB 5IG7A 5DQJB 2FBRA 2J8UF 4BE6A 5IJVA 3UIYA 4F2MA 2ZP9A 1O75A 4N0YL 4Y4HD 4P3DB 5CZRA 2YWZA 4TM9A 2V7NB 3HBPA 2NY3D 5CZVL 3VNYA 3I6SA 4GSDL 3RWFA 4LEBA 1BPLB 3NFSL 2XN1A 4NHCH 5HDOA 4OCXL 3QFJE 4I18C 3GSUB 5AOZA 1JWUA 1M2VB 4JQVC 1AQ8A 2VXVL 3QO1B 25C8L 4RGOH 2GUOA 3BRDA 3FZUC 5EORL 3H6JA 4TSAL 1G7IA 3ARWA 3SDYH 2EE2A 2Y7QA 3PV6A 3LEVH 3VGHA 5KVFH 5HHNB 2WLZA 4MASA 5MEPB 3S48A 3G08B 3C5SB 3HN3A 3UAFA 1F3JB 4CAGA 3OKNA 5I23A 5F9OH 4GS7C 4DEPC 3UC0L 3HLAB 4DT2A 5EO9A 2YPVA 1ITCA 3Q13A 3KPQB 2NW2A 3VMNA 1CG9A 2VXTL 2WWNA 4G42B 1U41A 3BKMH 3TBWB 3OKDA 1P6WA 5FYKD 4G71B 4P99A 4IU2A 3K5SA 4X80H 1FCGA 4ANWA 5SWSD 5E5RB 1BMGA 3AUWB 3VI4F 4FLSA 3W9DB 1UACH 4GBXA 5C0CD 1YEJH 3VCLB 4G6JL 3VTTA 4DQAA 3ARXA 3OWEA 3WELA 3GRBA 2AAVA 5A2IH 3LKQA 3ECQA 3WN6A 1BAWA 5JHAA 1KBPA 4JHUA 4Y8AA 5DEGA 4BIKA 1KDIA 1M71A 3OAYH 2CNZA 1ONQA 1E4JA 4HD9A 2FGWL 1C7TA 4XVSL 4FQ1H 3QZOA 3O4LA 3RJOA 4P05A 1ZGLA 4Q0XL 3I74A 3RWIA 2AEOA 4YGVB 1TVHB 1OAKH 3SBQA 3GUTB 2MOQA 3FSZA 4EDWL 1S7WA 1JI1A 5DMKB 4HIIA 3MRPB 1RPQA 4Y4KC 1UM6H 3NUKA 1E4XI 1QOKA 4CVZB 4HJEA 2BY2A 5CCHE 4GRMB 1M7IB 1QSEB 5AVRB 2X05A 3AG2B 1Z9SA 1J0JA 5D6DA 1PLGL 5IFAH 3SO3B 5E70A 1ZHNB 4NQCD 5ID0A 2E7CA 3IRPX 3SO5A 5C0DA 3N50A 5E8PB 1RFDL 4Y4FA 1MWAH 2A74A 2ADJB 2Y7MA 3QH3B 3N04A 3NCBB 5AOJA 2IDCA 4RFOL 3CN2A 4JAMA 4I5BA 4UQ3B 2IQ9H 5IHZB 1TCRA 2Y4SA 3GXUB 1T22B 4C47A 3HE7C 4GAJL 3IVKB 2HRPL 1SFHA 5ALCL 1CMOA 4PV8B 5E03A 2X4NA 3ZT6A 2NSQA 3V0AC 1QQDA 3OAUL 1YDPB 2N7BA 4YIQA 3TVMD 1NFIB 2WVUA 1SVBA 1BD2B 4M7JL 5EMYA 3FCGA 1HKLL 1OAZL 2FSEA 4LBAA 3BPCB 1IGIL 2VDPL 5IMOA 4MNGE 4AYMC 3V4VH 1KLUB 5AL0A 2OFQA 2V5TA 2MHAB 2KZKA 3T9WA 3WEAA 3NPSC 4HETA 5M7QA 2BC4A 5I1EH 4PJIB 2FEJA 3VGAB 3E7JA 1MCFA 4R97C 4YHOH 3FFCD 3EFDL 3AAZB 4RGNE 3VMPA 1AYRA 4BFOA 5KAQG 5HTSA 2OMTB 4LESA 4Y5YC 1IAII 4HZAA 1MCOH 5JQ6H 4N2CA 3QUML 1ZANH 3DBXB 4JJHA 3GIVB 1DQML 4ZJ9A 3L2NA 2EVHA 1MAKA 1OAUH 4O58L 4WY7L 3TF7C 3TF4A 2WKLA 3OKKB 4YSPA 2VDOH 4N6RA 1XH3A 2VDNB 3MNDA 4PW3A 1PGRB 1TZAA 2FECL 3F64A 2ZTBA 3KXFA 2DQCL 4OGYH 4U4BA 1RXLA 4RRPM 3QJQB 5IWLA 1KULA 1RSFA 4PN6A 3ALPA 1XR9A 3K1DA 2DQDL 2QKIC 3CLEL 1RIHH 4NOFA 4NZUL 4XX1G 1YEKH 1PZ3A 4N2IA 1R5IB 2AV7B 1VEPA 3V0VB 4Q6YA 5GS1C 4F27A 3E2HB 2ID5A 3QCVH 4L3EB 4Z7WE 4JFED 1NM4A 3HZKA 1JXKA 4J3WA 4WWKA 3OMIB 2WKOF 4M7LT 2CHNA 4FFZA 1JK9B 3HNTH 2GFBA 3F7RA 4PRBB 1HQRB 2F7OA 1SJHA 1ZIAA 2SEBB 5IHWA 4GG8A 3RBGA 5CJOH 1D5MB 3VVWA 2OMZB 4H26A 4JM2B 2P3YA 2QPUA 4U1JA 2FX8H 2XVBA 1U33A 3FW6A 1AIZA 4DERA 2CGZA 1UWGL 2ITCA 3QZWA 3OXRA 1AI1H 3F85A 3N40F 4OD2A 4XCNA 1MNUH 4XN7A 3DX9A 2N7AA 4YSDA 2DIBA 2L7JA 5JR1L 4MNQD 4YBQC 5GZOD 3L3OA 5HSFA 3RWGB 1CFTB 3S5LG 1NDGB 3HG2A 3WO4C 5I30H 1ZLVH 3MRMA 3OGCA 3CVIH 4P46B 4NS0A 2F5AL 4HWZA 1JWSB 2WWMD 5FYKU 5DRZB 3D05A 3H9ZA 3KPSB 3OX8B 5IB5A 4OFKA 4MSWA 4TNWK 1XAKA 4DVRH 4DNLA 3MJWA 4YPJA 3VB9A 5D1QC 3BO8B 4NX0A 3WUZA 4DPAX 1QWHA 1LWRA 3HZYB 2I60L 4J6RH 4BKTC 4XZUB 4L4JA 2CXKA 3U7AA 4Z0BH 4NCC2 4ES8A 4JANB 1L9NA 2CJUH 3L3JB 2ED8A 1MI5E 4HW6A 4XVTL 3RYMA 3TO2A 1J9CT 1JXJA 4U1KB 5I6XB 4OKVB 4XXDB 4NQDB 1Z7JA 2ALAA 5K9JL 5DA0B 2NT0A 1DQVA 4KXZH 4ZUTA 5T3ZL 4GP5B 3MV9B 4Z3JA 1FZMB 4JY5L 1XGRB 1F90L 4LCYA 2CIIB 3RX8A 3IETB 2CHDA 3O11B 3PDOA 5F1IB 3OMNB 2AABH 3DVIA 4XAWL 3UTTA 4HUVA 5D7KD 4N0FA 1OZUA 5EU4A 4X9HA 5F3BA 1N0LB 4OF6A 1FL3B 3Q3GB 4IMLB 5L9DL 5IF0B 1D5XB 1KXHA 2K78A 4M5TA 3UZQB 2UWEE 3W56A 5FDWA 4WTZG 4FZ8H 5E08L 3BW9A 2QEJA 3ARDC 4LGSB 3TN0C 3P4MB 3IJYA 3O9WA 4XP4H 3UDWA 1XBDA 1PG7H 1PD6A 3O3EB 4S10A 5GRVL 4MAYD 2WQVA 5GGQH 4UI2A 4UYQA 1BX2A 1IAKB 1XEUA 3NABH 4KTEL 2X0VA 2VDML 3BWZA 5CGYD 4EI5A 1FVDB 4EOWH 1WWCA 5CUSL 5I1JH 3M8OL 5D2LF 2HT4C 4IIQA 4QRRB 3ALXA 3DI2B 2FBJL 4P3CH 5IROA 4KZEH 1T5XB 3BXNB 2D0GA 1BXVA 3OXSB 1RPUA 4PREA 1RZJL 4OUUA 1RMFH 2DM7A 1QX1A 3TNMA 2BNUA 1HSBB 3KPLA 2PCFA 1D9KD 5HY9A 4OCNC 1DJGA 1KZQA 3WAKA 3MMEA 4XVOA 5D4JA 1WFNA 3A4AA 3H3PH 3HR5A 1E8XA 3BVWA 1EO5A 3QUZB 4JR9L 1H9VA 1EIBA 2EEDA 1MCEA 4WV1B 1C5CH 1HZLA 2BOBA 4UNTA 3REVA 1D5ZB 2B20A 5DRXB 1OAYH 4G43B 1N59B 5K9QI 1LO5B 5CN3A 1XIWB 2VQUA 4ZQTA 5EZOL 3MOAL 3DJRA 1IVTA 3TEUA 5I17A 3KPRE 5JPMB 2E76C 2X44D 3QWOA 3CN4A 3LV3B 5LN8A 3H0TA 3NIDE 5DVMA 3TBYA 2H9GB 1PZCA 4KXCA 3RUGB 3B7RL 1XZ0B 3UO8B 1KBBA 3QIWB 4UBDD 1BD2D 1WIUA 1MJUH 1YN7A 4GKLA 3DO7A 3W82A 3MRGA 1VF5C 4J3UA 4LOUC 3UZEC 3QWQB 4PJEB 1U8KB 4XMLH 5D7IA 2JTYA 1KC5H 2HG5B 2OW6A 3O6LH 3QDMB 4PJBB 4QRTB 5ILTH 3BVUA 1KTLA 4HH8A 2F58H 1BF8A 3EBHA 5EC1A 2ATAA 1G9NC 1ZLDA 1CE6B 1DO5A 3CFIC 4AMWA 3Q01A 4NLHA 4ZYKA 2NY6D 3ILPB 2WO2B 3FO2A 3EOBA 4P2AA 4JVWA 4NHCL 4ILDA 4YDLC 4K5MA 1A02N 2VLJB 2EXYD 1S7VB 1PMYA 5J9PA 5TDNB 1VFMA 4RGOL 1MFDH 1OLLA 2BNQE 2LE9A 2QJDA 3D0VA 2VSDA 2YAOA 1H5BB 1CFSB 3SDYL 4RFEB 3GSWB 1F4XL 1RH8A 2DQIL 1OALA 3LEVL 4LLMA 4Y1AE 4LRIA 1WC7A 4PS8A 3U9UB 2VRAA 1DEDA 5F9OL 4ZMTA 4X8GA 2YRBA 4X6BB 1MAJA 1NCWH 3MUUA 3MRLB 1VEOA 5B4MC 3B3IB 3PGDA 3DSNB 3QDJE 4OJAA 3UYPA 4N0CD 3BKML 4XVUC 4FFVC 4LSQL 2B9AA 3EZJB 2JFCA 4JUTA 2FH6A 3QAZC 3V4UH 2EABA 3ORJA 5I1KL 2NNCA 3U79A 4K3EH 2ED6A 5D5MA 3KNBA 4X80L 5F7DA 2H3KA 5G5DB 3FCTB 4C83B 1C5BH 1CLVA 2Z0BA 4EZLA 5F3HB 1UACL 2C3GA 1S9XB 1YEJL 3HZ3A 2HVJA 4ELKA 4G3YL 2HFTA 3P9LA 3BZFA 2H0EA 2D7OA 5BZWA 2AQTA 3TO4B 4DSYA 1HFUA 4D7PA 4Y19B 1NUGA 4C58B 2COQA 2OL3A 3MGTB 2CHXA 3FT4B 4QJ4B 2P46B 2EDEA 1G1OA 2I25N 4QRFA 4BD4A 4XBEH 3VFRB 5B1BB 1EZVY 2V2XB 4FQ1L 3PFQA 5EC2B 3SBWA 3KYOA 1JOIA 3RGHA 1NDTA 2FWSA 2WAHA 1OAKL 2OMVB 3LKRB 4LHJB 3VM7A 3EFFA 4C56B 3VFVA 1VA9A 3QJZA 1CGWA 1DE4A 2D3VA 1LWHA 2L0DA 3G5ZA 1K8DB 1UM6L 4HKZA 4UU9B 4DN3H 1OARL 1I1FB 3ILDA 1NDMA 3FAWA 5CBEB 2EDQA 3P73A 4F8NA 1ILUA 2H7WA 8FABA 2BZ7A 5IFAL 5C6TH 5AVSB 5A2FA 3MVSA 3VXNA 1UA3A 1RVFH 3L3HB 3WNPA 3PF2A 4PJDF 4HWNA 2Z7UA 1H6UA 4FQ2H 3MLVH 2XACC 4HUXB 2Q3AA 1INDH 1GIGH 3X1FA 1T4KB 1X9UA 5DMGD 5A16A 1DL7H 3AM8A 2IQ9L 3U4EA 4LLVA 2D73A 3C8KA 4LEEA 3SDCC 1YZZA 3GSXA 4CC4A 4F7TB 3VWJD 1NL0H 3SQBB 3S35X 4JFXB 1UZ6F 1LK3H 4GEJA 4A2LA 2YD2A 5A6MA 1TVBA 1CI5A 1CFQA 3Q5OA 4QXVA 4JPIA 3IU3A 2V7HB 3SYCA 1GGCL 3IJSB 1HQ4A 2BFVH 1HHJB 3FSAA 3C87A 2PCPA 4ALAL 1TF4A 2IMMA 4MDRA 2P5EB 5HHOD 5C07E 3TIEB 3V4VL 1UTDA 6PCYA 3V52H 1P7BA 4ONFH 5MEQA 2DEXX 3ME0B 4OGXH 2I7OA 1T80A 4YHOL 3EYQD 4J3OH 4RWYH 1JE6A 4I0KA 1WBYA 4MKTA 4NBXB 3BYTA 5DUJA 1TO5A 4G8EA 2QSCH 2AK4E 3WIAA 7CGTA 2BCKB 3QUKB 5I0ZA 1X5KA 1MCOL 5IW1A 1C9SA 1VB9A 5IB4B 4PJAB 1BEYL 2ITEA 5JQ6L 4EBQH 3FHAA 3PREA 1AGDB 1ZANL 4TQEH 4LVNC 3R0NA 5E8EB 2OLDA 1GW6A 3QIUA 3VI3A 2ZNWA 2A6DA 2VN3A 5TF0A 2VDOL 1SFDA 4AEIH 2CU9A 3FO9B 1RURH 2P4AB 5BRZB 4MMXB 5DF0A 3QRLA 3ZDZE 4LHUA 5K59E 2N7SA 4PBDA 1RJZB 4ISVB 4E5XG 5KG9A 4HUNB 3G5XA 4X83A 3D0LB 1RIHL 3F7QA 5D96C 5DLMH 5AW8B 4UQCA 1K9TA 1T0PB 4PW9A 43CAA 5IB2B 4Q6KA 4UV4H 3KR3L 2FWUA 3QCVL 4WU5B 5EF2A 4Z7OB 4RSVA 1ADQH 3BH8B 4XOCA 4ZUUA 4PRPD 4XWGH 1YAZA 1HWWA 3HNTL 1PD0A 1YC7A 3OZ9L 3CSTA 4RBPH 4P4KA 4MCYA 4GRLC 3OKMA 1CTOA 2VXQL 2EDHA 2E7DA 2IH3A 3B2UC 5CJOL 5EF0A 3BD3A 3QXDB 2VWEC 1H0DA 2FX8L 4JFPB 4OZHB 1TFPA 1E5BA 3MUJA 2NW3B 2ITDA 5E9DD 2W1NA 4PVNA 4AJ0A 3P0YH 1KJMB 1VACA 3TH2T 4BQBA 1AI1L 1TJMA 4Q2ZB 4MAUH 4RX4D 3QEHA 2Z34A 1KLFB 4FQXB 1E90A 1MWOA 4ETQB 1NBZA 4H40A 5I30L 5FYJD 1FCCA 3CVIL 1QUPA 1EWHA 3CVHB 3EJQA 1G7MB 5GGVY 1FLTX 1I1RA 2CRZA 3WFHB 2VISB 3QI9D 3P77B 4V1DA 4DVRL 4WQOA 2K6WA 3MRQA 4RH4A 5MENE 4XP5H 1GOFA 1UD3A 4JFOB 3PWNB 5LCVA 2WBJA 4J6RL 3PAZA 2AJYH 2G3ZA 4BWTA 4Z0BL 4R5XA 5EN3A 5I76B 2W60A 4QPEA 2OJZH 1MFNA 2CJUL 4FQQB 3VA2C 5KYWA 2YPLD 4GFXA 4NPJA 2HUHA 4GRWE 2VR3A 1B3IA 3ULAB 1D5RA 3GSQB 5F7KC 2A9NH 2ORBH 5KSUA 1KPVA 3SBPA 2ERJB 1U93A 3OMZA 3JWDH 3SDXE 4L8BA 2FYVA 5IEKA 3L9RB 3BD4A 4HK0B 4PGCB 4X4YB 1XL6A 3NJFA 1AJ7H 1MCDA 1CR9H 4HCIA 1NCBH 2AABL 2DYRB 2Y5QA 2RH0A 1N0XH 3LPFA 4OM0H 1RP8A 2EVJA 4M1CC 1W6WA 2B4CC 3FJTA 4UINH 4X5LA 1HILB 4KKBD 1KPUB 2W07B 1DQDL 1YCSA 2GW5A 3C8HA 4WHTB 5I75C 4U3SB 2ZP0T 4FZ8L 2WVVA 2AJXH 4H13C 3L54A 4R26H 1LEGB 4Y19D 4KH2A 4NQED 1QP1A 1RZGA 2EIKB 3QFJA 4BUHA 2WHVA 1PG7L 2NNRA 5KVEE 4YL9A 3SY0A 3QEUA 1F1AA 4FFWC 4RQQA 2ENSA 4EIGB 5GGQL 4G8GE 1QVOA 3NABL 3ABZA 3HCVA 3O2DH 1MREH 4JRXD 1KEMH 1R3IH 1R5WB 2JCCF 2VOTA 4P23D 4OZGE 5I1JL 1VAHA 2NR6C 2X9ZA 4I89A 4Z7VE 5BV7H 3NCCB 4KZEL 5I0YA 1A7PH 1B88A 4M3HA 2BSTB 1RMFL 4QYAA 2KLRA 4N2OA 3TBTA 1JK8A 3ENEA 2IAMD 2VXQA 4WI9A 3KBHE 2I85A 3N43F 3H3PL 1F58L 3K1KC 2Y6TE 2K70A 3ZU8A 1NFDB 4ETYA 3QSKB 2IFGA 5CGMA 5DVNA 1SXCA 4LMQI 1ITBB 2HMID 4N87A 1RP9A 1AXSA 1C5CL 2AMGA 5D55A 1OT2A 1BQ5A 2CDGA 1EDQA 2R1XA 5D1ZD 3FFOA 1DVFA 5GRVK 5C08A 3AROA 3SOTA 2BZDA 2BP8A 1OAYL 4NXKA 3WN5B 4PJHE 2FTAA 1CGTA 4F57H 3PJNA 3FBQA 2NPLX 3A0OA 3ZKMD 1PLBA 3UBXG 2IWEA 1IE4A 2WCSA 4MJ4A 5E1GA 1CF8H 4HH9A 3PWUA 4OCLC 4HHAA 5IQ9A 1Z66A 3ZQXA 3M07A 5D2LB 5C0IB 4A2DA 4BSWA 5I0XA 3HA0A 1MJUL 4O2EB 2ZKXA 2PWFA 4JGJA 4YO0A 2D8KA 4AM0A 4YK4C 1KC5L 3O6LL 3W0WB 3VFPB 5ILTL 4P2QE 1DBBH 2AI0L 2J55A 2F58L 4A7GF 4RWHA 3NBNA 2H32B 2UX6A 4DHLA 4J3VA 4AL8H 1K4CA 4LNRA 3QYNA 1HHKB 1VGEH 2B59A 4RIRA 4WWPA 2X4UB 5EU6B 4HZLA 4POYA 4KMLB 2P5WD 1WBXB 2BIMA 2VLLB 3B9AA 3CFJB 1KY7A 2AK1H 1MFDL 4A04A 2OP4H 4QOKE 3B2VH 1U3NA 4UIMB 3RX9A 4RA0C 3V0WH 5DUBB 3GBNL 3V4PH 4J3SA 1MW1A 2O6DA 2YRPA 1RHHB 4GG6E 4LLUB 5I26A 4ONOA 5J6GB 2QVFB 2AGJH 4RAUA 1AOHA 4EQ3A 3P3RA 2APXA 1NCWL 1OWWA 5CGYC 1A6AB 3RIFF