1YRKA

The c2 domain of pkc<delta> is a new phospho-tyrosine binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
GSHMAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, delta type
publication title The C2 domain of PKCdelta is a phosphotyrosine binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1yrkA00
4WWOA 2WXJA 3FBKA 4FLHA 2CJTA 4L1LA 3R7RA 2EP6A 2Z0UA 1E7UA 1HE8A 5CCJA 1DQVA 2ISDA 3QJZA 4PS7A 4ANXA 2DMHA 2K8MA 5G55A 4QJ4B 4IQHA 2WXIA 4FJZA 4KITB 2Y3AA 2CHXA 2WXQA 3IM1A 4EZJA 2Q0ZX 4KZ0A 1DJXA 4LCVA 4L2YA 1UGKA 2A5UA 1YRKA 3PREA 3RDJA 1UOWA 4URKA 2WXOA 3DBSA 4A55A 1E90A 1RLWA 3QARA 4Y1TA 1K5WA 3ZIMA 4AOFA 4F1SA 2DMGA 1BCIA 2WXHA 2ZKMX 1QASA 4HVBA 1TJXA 3L4CA 3M7FB 3ML9A 3W56A 4ANWA 3KWUA 2ENJA 4JPSA 2WXNA 3IBEA 4ICXA 4PS8A 4QJ3B 1E8YA 4FHJA 2FK9A 3KWTA 4LT7A 3NSJA 3PS6A 3OHMB 1QATA 4F92B 3HIZA 3ML8A 4GNKB 1E8ZA 1DJIA 2K4AA 4DNLA 3PRZA 3QK0A 1E8XA 4NS0A 4XX5A 3T8MA 3QAQA 2NQ3A 3ZW3A 4G11A 3F01A 3P2BA 1WFJA 1DJGA 2UZPA 1W16A 1UOVA 3JZYA 4V11A 4GB9A 3PFQA 1CJYA 4L1BA 2Q3XA 3L16A 3HHMA 4IHBA 2ENPA 4NP9A 3L08A 4DK5A 5H4ZA 2YRBA 3ENEA 3HN8A 3PYCA 4F91B 3MJWA 1BYNA 1WFMA 3F00A 3L13A 4KZCA 3TWYA 4WWNA 4ANUA 2CHWA 2WXKA 4AJWA 2WXLA 2CHZA 4WWPA 3W57A 3QR0A 1GMIA 3OAWA 3B7YA 3ZVVA 4LDCA 3FDWA 4TS6A 2WXGA 1BDYA 2B3RA 4EZLA 3APFA 4FA6A 3F04A 4BFRA 4XZ4A 2CJSA 4OVVA 2A4ZA 5EDSA 2WXPA 4J6IA 4L23A 4WAFA 2N1TE 4BGDA 3RPBA 2RD0A 1W15A 4QAMB 4HLEA 3R7QA 2QZQA 4FHKA 4TV3A 4EZKA 3TJPA 2X38A 3NZUA 1RH8A 4OVUA 2D8KA 1DJWA 2CHDA 4PS3A 3SD5A 5T8IA 3TL5A 2JQZA 4FADA 2LHAA 2K45A 2V4LA 5G2NA 4NPKA 3F05A 2WXFA 5JHBA 2K3HA 3GPEA 3LJ3A 3S2AA 2R83A 2WXRA 4WEEA 5H4YA 2CM5A 4Y1SA 4NPJA 3L9BA 1V27A 5CCHE 4MJJA 4XE0A 1DJZA 4ANVA 1DSYA 1DJHA 2NSQA 2KI6A 3L54A 3QR1A 2BWQA 1A25A 2YOAA 3DPDA 4FJYA 4TUUA 4QJ5B 1DJYA 5CCGE 4F93B 2ENQA 3CSFA 2CM6A 3NZSA 4ICWA 1RSYA 2QZ5A 1E8WA 3N5AA 3CSTA 2NCEA 3APDA 1TJMA 4FULA 3L17A 2FJUB 5KJ7E 2WXMA 5JHAA 3APCA 1E7VA
chains in the Genus database with same CATH superfamily
3TT1L 4FLRA 4PRBA 4DKEH 5C09B 3KPSD 3MV8B 3OR7A 3FK3A 3MACL 5F7BA 1KBGH 3EF4A 3H9SA 3EOBA 3P77A 5C07D 3NPZB 4MZRA 4D7PA 5A3ID 5DMYA 1VJSA 2HUEA 4M8QA 4D7BA 3ATBA 3RPIB 5EOCL 2KLRA 4K3DH 3Q2WA 3V4VB 2WZ0A 3FONB 1WITA 4MNQB 4ZX6A 3MR9A 3O9WD 2R29H 2YQ2A 5E0QA 3TN0B 3ZSTA 4U7SA 1J1PL 1SDAB 2NNXA 4JE0A 2E47A 3VFWB 3QZBA 2MIZA 2A9ML 3RBSA 3GI9H 3UROR 3EYUL 4M6ML 4I0KA 3LPPA 1NGQL 1BXAA 4AQ1B 4HK0B 4DN4H 3HBZA 1ADQL 3ARGA 4LSQL 3W56A 4YR6A 2FEJA 4UOW1 4OTXL 2Z4TA 1KGCD 4HWBA 4QJ3B 3KBFA 2VM4A 4PRDA 5DMGD 4E9LA 5DA0B 1GYWA 3QIWC 4JRXE 2XPGA 1BFVL 1JPTH 4P5TB 1EO5A 4UT7H 3LVTA 1R33A 3WD5H 3LRSA 25C8L 2Q7AA 5J6HB 4RQQA 1EDYA 2GTZB 4H40A 1HQ4A 3NYKA 4FG0A 4G80A 2XHNA 1VIWA 4JR9L 3M6DA 5JHDA 4M5YH 2WBKA 1JZ4A 5DD3L 1A8JH 5BS0B 5KBLA 2AQNA 3MXVL 2ZSVA 1KTJA 3VE0A 3WS3A 5LDSA 1VFAA 1RUQL 1RMFL 4W9LC 5IHHA 4Q7DA 3WIHH 2QQLL 2J8UF 3CDYA 2LE9A 1VCBC 4LPCA 1F58L 4GEJA 3I85A 4AEIH 4QHNB 4ZMAT 5EZIL 2YPVA 1HI6A 4GG8A 4WTZG 3UTSD 3BQUB 3UL4A 2Z31B 5FDWB 2J3SA 1A14H 2HTLD 3ZXAC 4Y4KB 1MHHA 4AQ8C 5ITBH 3FRUB 1JXFA 3RWIA 2D3LA 4UM8A 5AW3B 1S5HB 1IAIL 2LGNA 1KCLA 3D85B 1A6ZB 3DIFA 4FFWD 5HYJD 5I8OH 3V0AC 1YDPA 3TO2B 3FKUS 1TEFA 4CN6A 2X89A 4BH8A 4CW1B 2IJ0C 3WN6A 4PSPA 4P49A 1TZOA 3CHSA 5FYKE 2EYRA 2I60H 3NESA 1NIEA 3IDJB 5JPMC 4NZRL 3Q3GA 5DVMA 4XPBL 4I89A 3MLZL 4PJAF 4FXKA 1JZ8A 1WGOA 4KXZI 4QXUL 4BBWA 3GB7B 1NMBH 4PRPA 3G5WA 4WWOA 4DP8X 3OHXC 5TE6L 4DT2A 3BC9A 4X4ZA 4HWBH 3ARBD 1SJMA 4LCWA 3C2SA 3IS0X 4PLJD 3QZWB 1F97A 2D3NA 1MFDH 2PKDA 4GG6A 1M05B 1A7NH 3GSQA 1P84J 3TCTA 3LKNB 1F11A 3G5VA 1B4RA 1VGKB 1EEYA 5EOQL 2W07B 3MBED 3NRQA 4CUCA 2B14A 2UY6B 4IEFB 3KXFA 3H7BB 1ZWIB 4G42A 4R7DB 2CO7A 5IOKA 4JPVH 2ESVE 5D9SB 1UTDA 1QLRA 2KMWA 2WNGA 2GHWB 4AZ8A 4FG2A 4R2GB 5C0AD 2A2QT 5HGBB 4F1ZA 1U92B 2ADGA 2QSQA 3DJZA 1XGRA 3HB3C 3BH4A 3TNNA 1IC1A 4PTTB 1T6VN 3CFCL 1HINL 3IDNA 1T5WB 5D7KD 4F7MB 1IGML 3U7YH 4JKWA 1NMCB 1WFOA 2YPVH 1TJIL 4AVHA 3SGKC 3NP4A 1O7DC 2HJFB 2OSXA 3NJXA 5TFSH 4G6AC 4KRNA 1IM9A 1SXNA 2H0EA 3HAEB 3BP7B 1S9XA 3HFML 4CMHB 4D8PA 3FB7A 1IGYB 1N59B 2ITEA 3GXPA 4UWQB 4HIEB 1GMIA 1B3IA 4QOKD 1OE1A 2WXGA 2EXWC 3FUFA 4NPYB 4EZLA 3O4LA 3APMA 4G9FD 2B4CH 3GO1L 2EIZB 4R4NC 4GRWE 4IRJC 5DVNA 1JN6A 1F02I 4KNTA 1GKOA 2X88A 4J3WA 3FN0H 4F8QA 4U2YA 3DMMA 4ENZA 3X14B 5DFVC 4FHKA 4JDTL 3UP6A 1BVKA 4FKHA 4FTVE 4O4YH 2J5LC 2Q7YA 3U6RA 5ICXA 1FAKT 4APQA 4QXGH 3CSGA 3PUCA 5DHDA 2DQCH 3VXRA 2FX8H 3QDMB 1BF8A 4CILA 4NO2A 1E6OL 3PAUA 4PHZA 1JHTA 3SPVA 4L29B 1WWCA 1SOSA 3I75B 4WK4B 3O2DL 3NIDF 3MTRA 3IDGA 1NWOA 1FZKA 2NT0A 3L9RA 4NYLB 3L5WA 4YSQA 4RX4D 5HVFB 1PU0A 1SEQH 4LVHB 3KPMA 4CKQA 3ZL2A 3O0RL 3GMRB 3U4KA 4Y16A 5DTFA 3M45A 3ZE1B 1QW9A 4B6ZA 3GJEB 2XTLA 3MNWA 5KWYC 1MRCH 1UJ3C 4PJDF 1S7XA 4U7KA 4ZO9A 4AKOA 4AIEA 5MI0C 2ADIA 4O58L 4HAFA 1CFBA 2CDFA 3FBQA 5DC4B 4APXA 1YYML 3E3QC 3M7OA 3QIWD 4KJYA 4DP6X 4PJGE 1VRSA 3IFLL 2IANB 2ZX6A 4KQ0A 3QORC 1PLGL 4GW4A 4IU3A 4R5XA 2J6EL 4Z3IA 4ZFOL 2AV7B 4ONOA 2HFFA 1M7UA 2X87A 1BQHG 2WXHA 3MTXA 1BAGA 1KELL 1ONQA 1MOEA 1JRHL 4KKCC 4O02B 3EYVA 4G2AA 2GSIB 4LLVA 4AT6A 4A37A 1QBLL 5B7EA 2BOBA 4XC3L 4OLZH 3WJJC 2UXTA 3NJIA 1QPPA 2XN9E 4LRNL 5LBSA 3RI5F 3FRPG 4YSAA 1ICTA 5EU6A 1X9RA 1IGCH 4L4VA 1ZPLA 1F3JB 3BEWA 4G5ZH 4I3RL 4CC4A 1R34A 2X6UA 4HWEL 2UWEA 1O7SA 3QDGB 1AKJD 1QSFB 4DW2H 3J2PA 4XRCA 2VLRB 5IB3A 3EW3B 4N2BA 4XXCC 1OP9A 3U30B 4Z1PA 4MRBA 4HG4K 1N26A 3QQNA 3KR3H 3FO0L 1AZNA 2PCFB 3HRPA 3FDWA 1U58B 3B9KA 3KGUA 1TVHB 4HBCH 1F8TH 2D2CC 2GG1A 2R23A 4LEOA 2PW2A 1JPSL 4XVTL 4X5XA 1CGSL 1L9SA 1KJVB 2APBA 2GJPA 3CDZA 1DUZA 3IU4L 5J9PA 1U8JA 3EHBC 1QSVA 3BKYL 4MMYB 5IJCC 5EPMB 1KB9J 1MFEL 4HLZH 4K7PX 3KLSA 2K70A 3BRDA 5L88L 3I6LE 3UJIL 3LJ3A 2JIXB 3HNSL 3X1BA 3OAYK 3A4EA 2CK0H 2IAMB 3RZCC 1ZSDA 1C9SA 3O41A 3QR1A 1MCBA 4LPXA 5DRWA 3KYNA 3SIKA 4C4UA 1MAJA 3HPLB 4BYHA 2WVVB 1QKZL 1SHXA 1AIFA 2XWTA 4S1DD 3OKDB 1X44A 3IDXL 4PGZA 4EBQL 4KI5E 1RUKL 5HGAA 2JV6A 1V54B 4N25A 3HC3H 4HUCA 4ZMVA 3N0AA 3FO9B 5A7BA 4OM0H 1TJHL 5E9DB 5ISZE 2C9PA 4ODXA 5E6IA 4D9RD 5C3LD 3FH8A 3OKOA 4I3SH 2CXKA 3HMWH 2EEAA 4MMXB 1J5DA 4YDVB 5GJSH 1AJ7H 5T5FL 1FN4A 4AVKA 4PB0H 1PKOA 5LBSH 3CMOH 4KRPB 1SYVB 43CAA 4BFNA 1GVIA 1B90A 3JWOC 3PL6A 5DFTA 1RCYA 5FGCE 5I1DB 4ODVH 1QLEL 5H2BA 1KWKA 3JT0A 2IWEA 3I02B 4MZ2A 3CNKA 3GIVA 4OIAA 4GUPA 3VYNA 3B8SA 4G6AD 3KPRA 5I66B 2R9HC 4GMSL 3AJ7A 2V6HA 3ML9A 1I9RL 1XGQB 1U3HB 3AAZA 4HKZA 5ETUA 3LS4H 2G2RA 4MMZC 3RAJH 3EH1A 3W82A 2VLLB 2Y7QB 5DHVA 5J13B 3PXHA 3W5NA 4FCAA 2QVKA 3A4DA 1JZJA 2EXWD 3OLIA 5E00B 3FQWB 5B38B 1K4DB 3WY2A 5KW9H 1R24B 3HUJB 4IYKA 1TNMA 4F15B 1E4WH 2JJTC 4R4ND 2IXQA 4IRJD 1SQ2N 5L0QB 4PJ7A 1LJMA 4U6XA 2ZYHA 1MVUB 1IKOP 2WOBA 3D6GA 5K1VA 2HRPH 2YMOA 1EFXA 1TZAA 3T4YA 5C0BE 5FR3A 1I3RA 4FOMA 5T3ZH 2R0WL 1HL5A 3I2CH 1GW6A 1J5OH 2AVFA 2EQDA 4NKOA 3IAQA 5I5IA 1C5BL 2JJSA 4PRAA 2XN1A 3ZVVA 1KIUA 4LFHD 3ROOA 1PYWA 3PJNA 5IFJA 5FM5O 1CFMA 3T0AA 2P5EB 3FUIA 4KI1A 1Q8MA 1KTLB 4IBZA 4PBDA 2ZYIA 4XNAA 4BFRA 2X10A 2Z7WA 2A6IA 3D51A 1LO4H 1OEZW 1XDTT 4LXFA 4NWTH 4TQPA 2XZQL 1PAMA 5LNDA 2AQ1A 2B0SH 2D8KA 2WQSA 3IDIA 4N0YL 4W9IC 5AVQB 3PABB 2ZXWB 1Z3GH 2R4SL 4P2RD 1JNNH 3FQXB 1NCIA 1R3JA 3MPCA 4LZKA 4UTCA 3NIDE 4CBPA 2R7EB 1KPUA 3CDGB 3NCEB 2VDMH 1QVOA 1SBSL 4JJ5B 4Z0XA 1NDTA 2ICES 3MCKA 3NGBB 3TNMA 4OLXH 2QZ5A 3UBXI 2X4QB 1SJEB 1GZQB 4NDMA 4CDHA 1KB3A 3Q8FA 3WI9A 3FTGB 3IFOA 2Y06L 2OZNA 4LPVA 3TS8A 1N8OE 3BPCA 3QUMB 2Y1VA 3MRQA 2EIMB 2HFTA 5TJWK 4BHUA 5JIQA 3ALWA 4I9XA 4PJDE 2DRUA 1BG9A 5DYFA 4KKCD 5F7KC 1SBBA 4EQ2A 4YSSA 3KYMA 4PJIA 1MW1A 3K7UA 2GUOA 2J57A 4EOWL 3KLKA 1UVQB 5F7LB 3SKJH 3BIAX 4GAFB 1ZV5A 3VFRB 2Q0ZX 3HE6A 2I7OA 1XF3B 3GSOA 5HSFA 1FL3B 1PG7W 1O75A 3MRHB 1ZLVK 3PF2A 4NKQB 3WEMA 5B3JE 4X7TA 2ICWJ 4BQ9A 3LH2L 1OTUC 2ZAIA 1YYCA 4JUTA 4BRJA 3W5MA 1FFPB 3JSSA 4JMNA 4EN3B 5ERWA 1J48A 3IPBA 1PLAA 3VGHA 5BOPA 1VKXB 5KSVA 3WNKA 3JWOL 1OCWH 5L2JB 5DJ2A 4E9WA 4K8RL 4AQEB 3V9EA 4PD4J 5C0JA 4JK0D 3S5LA 2FNBA 1GGIH 1T83C 5MP6L 3QHTC 3AU1B 2F5BL 1EEZA 5HVWA 2N0KA 3AQYA 4YHYC 4NC0B 3K2MC 3WE6B 2G30A 2DL2A 3EHBD 3EG9B 4N0UB 3AREB 5BRZB 1UWGL 3QFJB 4QRPA 1SLUA 5IMLB 2YRBA 3S35X 3ZKXC 1AH1A 4PGDB 1C1EL 1I1FB 1A1OA 5CJ5A 4YQXH 1IGIH 1PLCA 4PJ8B 4JFPB 3SBPA 1Y0LB 3RZCD 3C5SB 5A6IA 5CZKA 1FBIH 5I17A 5DI8B 4FQ2H 4BE6A 1KXQE 5JDSB 4N90D 4AGLA 2VDLH 4YMPA 2WP3T 4WI0A 4JM4L 1B0WA 3FT2B 4YBLC 1ZT1B 4N2EA 2NOYA 2P43B 4OFVA 2FLMA 1KIPB 4UQIM 5AB1A 1QYGH 3VMPA 4RCAA 1P5UB 1SFDA 4LLMA 4B97A 2CO6B 2CNYA 4OGAC 3QEUA 5KYNA 4AJVA 3AB0B 5F9OL 3V0FA 1FO0L 3O3BB 5C6TH 4Y1AA 3FB6B 3OLEA 4DQOH 2PXYB 4EXKA 1P7HL 1KEMH 3QO0B 4AXWA 1T4KA 3HR6A 4DH2A 4OCWH 1DEEB 5F3HA 1AFVH 3VTAA 1SLXA 2CRMA 2NQDA 4W1TA 3U36A 3GMNB 3SDDC 3F7VA 2MHAA 5KANI 4OKVA 3SY6A 4Q0XH 3Q7JA 2WYIA 2R9HD 1MJJB 4EIUA 5L9DH 1NC4A 3ZTEA 1J1OH 5DEGB 5EZLA 3DXAE 4GP5B 3U46A 3NMEA 4TUJB 4ZMLA 1AR1B 5TQ2H 2YGOA 1BF5A 2MPAH 1KENH 1F4WH 3FYEB 3WEXB 3CZLA 2KYIA 3THML 2XA8L 3T2QA 4KUCF 3MBXH 1HKLL 1S3RA 2A5UA 2WAQA 3GHBL 4L8DB 4PMEA 4RMRA 5HJ3B 4AVJA 5IM7A 1HWWA 2XZAH 4P3WA 3TCXA 1ZS2A 5I8CA 4X4ME 4WHDA 4JFDA 3RL2A 3G6JA 5HTSA 1WS7A 2EH8H 1MIMH 3GXDA 3HOGA 3IS1X 2BSRA 1U8NB 1AXSA 4GW1A 3ZYZA 2VH5L 4RMVA 3F58L 4KHXL 4G6FB 2R4RH 4RA0C 5TH2A 1CCZA 3C5JB 1JWUB 5CFAA 4XP9L 4JN1H 4LVOB 2DTML 4DFHA 4JCLA 1OLLA 1YEDB 3QEQB 1DL7L 3MLRL 2W9LA 3MNZA 4JY5H 4WQOA 1RP9A 4UM9B 2NXYC 1Z9SA 1TTFA 1OAXH 3BAEL 4ZTOH 4AMWA 2VZSA 1RK1A 3CBRA 4GB9A 3RHWK 3KPNB 4JFWA 5A2LH 1T7YA 4PY8J 5T1LA 5EZPA 3QH3A 5FECB 2X0UA 3VYPA 2NDGA 4GSUA 2XWCA 3IJ8A 3KS0H 1NCCL 4ABVA 4DK5A 5I1EH 4DSYA 3NTCH 5EOTB 2R8SL 4ZFZB 4HQQL 5H94A 3IMRA 3K1DA 5T5NF 3SDAC 3DX7A 4PRBB 1P7QD 2OM5A 1A1NA 3OR7B 4UB0L 5FAAA 3H9SB 3EOBB 3K80A 3P77B 2CJSA 1FNHA 1RURH 5F6HI 4M8QB 1BOYA 4ZUUA 2C1PA 3GJFA 4FP8L 5B1JA 4Y2DC 5TF1H 3VFUA 3IAGC 4KROB 1SHSA 4B9IA 3MR9B 1OOAA 5L2KD 1Z9MA 5I19L 3V4PH 2FO8A 2E76C 4IK6A 2EH7H 3LZLA 3TL5A 5BMFL 4FN0A 3IDMA 2IG2L 5TQ0H 4YOKA 1FF5A 4KPHH 5KYYA 2XU9A 3HNTL 5DQDH 1CS6A 3ARGB 1AKPA 4YR6B 2V8MA 2P5WA 2WLJA 1FAIL 4PRDB 5CGBA 2O26U 1WDAA 4BEIA 3TEZA 2E75C 1B2WL 2DL9A 1IFGA 2XPGB 2ZQKA 1Z0MA 1MWAA 5IB1A 3LRSB 4B9FA 3DVFA 3KPOA 4U2ZA 3GK8H 4RQQB 1P9MA 3CN3A 2C7UA 1AXTL 3BZFA 4FQCH 1HQ4B 4G80B 5B8CA 1KJ2A 1QRNA 4ONGH 5B7FA 5FW6A 1OTUD 2I27N 3LZQA 5JHDB 3TOPA 4AUJA 2Z0UA 1E3XA 3VDCA 1SY6H 2ZSVB 1BHGA 3K2IA 3Q43A 3VE0B 3WS3B 5I6OA 1VFAB 4LHQB 2M26A 4PGCA 1X7TA 1NUDA 2LT9A 2AF2A 2DI9A 5DWUL 1GIGL 2DJMA 3OKLA 3ZT5A 2AQ3A 4LGSB 1JGUH 3RDJA 3JWNG 4NM8H 4HJJL 5CGMA 5D1XC 1Q94A 2CSPA 4PRID 5KVEE 1HI6B 4GG8B 1NAMA 2BOLA 4AOFA 4FZ8H 4AY0A 2ZCZA 1G6RH 1QHPA 1M7IA 1MHHB 3EGXA 4FTDA 2YAHA 2FB4H 5DF0A 2N7BA 3RWIB 3FH5A 1BYOA 1BAFL 4JG9A 4OFQA 4UM8B 1CFQA 2JKXA 4H0LC 4NJ9L 2VDRH 4LEXL 3DIFB 1YDPB 4U49A 5GS3A 3QNXA 2YA2A 1MF2H 2ITFA 2PYEA 4HSCX 4BH8B 1I82A 4PPTA 3BSZL 4I5BA 4WO4A 2OP4L 1RUPH 2V0AA 2EYRB 1I4FA 2K7QA 3BAYA 3GJFH 3GQFA 4BUHA 4DPAX 1ET7A 2EC9T 3Q3GB 4YLBA 2AK4E 4XPHL 4OD1H 4ZW8A 4FXKB 5B1KA 2BVOA 4KMTL 3OKEA 3OPUA 1Z0NA 1PZ5A 4NJAH 4OGAD 2W60A 4PRPB 4DP7X 1OWRM 4BZ1H 3LZRA 4EIBA 4LCWB 1J9TA 1PBYA 4NNPH 4LSVH 5E99H 1W72L 4WZ9A 3FQ2A 1Z32X 1YEJH 4GG6B 1OANA 3CPLA 1MWAH 1LNUA 3GSQB 5ACLA 1F11B 1RU9L 5HPOA 3G5VB 3SDDD 4PLNC 1EEYB 2OK0H 2WUCL 4KWUA 2WLKA 1UA6H 4J6RL 4YZFF 4L1DA 1KJ2H 1AHWA 3KXFB 4OV6F 4FQIL 4UZGA 4G42B 4B0MM 2CO7B 1DQMH 3WMSA 1QLRB 2N0MA 3ZKQD 2XWJA 5T3XH 4AZ8B 4MA1C 2ADGB 2FIRT 5GSRA 1XGRB 3LIZL 4XNYH 1J8HA 2IQ9L 3WNIA 3TNNB 2YOAA 3IDNB 4OFIA 3L3OA 5DZPA 3V6FA 5DVKA 4NB7A 3V55A 3W0WE 3EOTL 2Y7LA 3T71A 3DPBA 4EMZA 4PVBA 1NAMH 3CH8A 3TPUA 4R5TA 3A6OA 2LW3A 3S98A 5KJ7E 1E6JH 2G3ZA 2DWEA 1IM9B 5J89A 3A0OA 3FO1A 1S9XB 5IJKC 4WFFD 2UVEA 5ID0A 4D8PB 5IK3A 3QJZA 1NFKA 5G55A 1DANT 2CDEA 1XTMA 5AOIA 4GAGL 1MI5E 4U6TA 3GHEL 3IGFA 5IT2H 3DIDA 1U33A 3BN9C 4GAJH 1G0XA 4WV1C 2NXYD 4DVRL 2VXTL 2BERA 1E5BA 3N50A 4RSVA 3CFDA 4NUQA 2ODHA 3O4LB 3DBSA 4G7VH 2WY3B 1FFRA 1JN6B 3DHJA 3CWGA 2IGLA 3LD8C 2J5WA 2NCMA 5K9KA 3UAFA 4KVNH 2YBGA 5I8KL 1BVKB 3SCMC 1MWOA 2Q7YB 3U6RB 4GIPD 5ICXB 5IROC 2RIKA 4APQB 3T0EA 2G3XA 4NGHL 3VXRB 4XB8A 4YX2L 2Z9TA 3SDAD 4NO2B 1UWXH 2EVHA 4X99A 4P2QD 1JHTB 3LDBC 4X5RA 5IB4A 3SPVB 2DPKA 3IJSA 5FF6A 2GSMB 2M2DA 1O7VA 2E27H 4KTDH 4Y2DD 3LKRA 3SE8H 1FZKB 3L9RB 3L5WB 5SX4H 1BZEA 2FATH 3FCUB 4ISVA 4AX3A 3ESPA 3KPMB 4L3FA 2IBZX 2FJGA 4GXUN 5SWSD 3L4TA 5ACZA 4RZCA 2RQ8A 4NQDE 3FUNA 3NN8A 4YGVA 4Y16B 5DTFB 3W57A 3VJ6A 3W38A 3KJ6H 3MNWB 4TKWA 3IDYB 1NTDA 1L0XA 1S7XB 3VGBA 1PG7L 2ADIB 3ZX1A 4APXB 2GTQA 2CDFB 4KJYB 5FCUH 5DURD 4D9LH 3RY6A 1TTCA 3PHSA 1NOAA 2NW2A 2Y6TE 4PVMA 1NFDA 3QUKB 4PJ9C 2YD9A 5LG1A 3VQMA 4LNRA 3FU3A 4GW4B 4IU3B 1KCSH 4L0YA 2VGLM 4Q9CA 3WYRA 2HFFB 1ZLWK 2VN3A 4JM2A 5AW8B 4JB9L 2ZAHA 4Z95L 5GGRY 3ZRFC 3BZ5A 4ZS7L 1ONQB 2YGPA 4LQ1A 4WEEA 2Q87A 1IARB 2YKLL 5IQNA 5IVXA 3EYVB 3QRGL 4MJJA 3DUHA 4LLVB 4BK5A 4AT6B 2YPLA 4KQ4H 2KQMA 2PWGA 1JPEA 2BOBB 3OM3B 4JRXD 5BUPA 2CMRL 3J7HA 1OP3K 1AOZA 5D1XD 3KPQA 3KW7A 4WJG3 4AV5A 5EU6B 4IHOA 2NCEA 4L4VB 3ECWA 5EU4A 3BEWB 5CM1A 5A2IH 3MLSH 3LPOA 4N1CA 2UWEB 5IFAH 4DGVH 3FAXA 4XRCB 5DFAA 1SYSA 3ARPA 5IB3B 1X5MA 3UJJL 1JMZA 3COOA 5I0ZA 3IGKA 4WFHE 1MEXH 2X6BA 3N44B 3PHQA 3B5HA 2BXZA 1JNLL 3UC0L 4JHZA 2X4UA 3B9KB 4LCVA 1O5PA 2ZOLA 1F4XH 4ZQKA 4UOQA 3RGHA 2R23B 4LEOB 2PW2B 2ATAA 4Y89A 4EIZC 2BVPB 4X5XB 3K91A 2XX1A 3CDZB 5IREA 1DUZB 2ZUWA 5J9PB 2WOYA 1U8JB 3EJRA 4DTGH 3MLWL 2UUDH 1MPAH 3LEVL 3UEQA 2ICEA 1KCUH 4X9BA 5J1AA 3BH9A 2FWOA 4B95C 1A7OL 1CBVH 2QV4A 3WKPA 1RZFH 1ZSDB 3O41B 3T6VA 3CHRA 4L37A 5DRWB 1HE7A 3KYNB 4J1UA 4OZFA 5JYMA 4P2YA 2BHFA 5IHUL 1OT2A 1IO4C 1XCXA 1AIFB 1JFQH 1USQA 2XWTB 3A5VA 3OMIB 4WI8A 3WOVA 4QYOA 4ANUA 2DQIL 5HGAB 4PJEF 4Y9CA 3WTVA 1XZ0A 3GUTA 5E1HB 3EBIA 3KGRA 5F7EH 3D4YA 5A7EA 3OGCA 4HIPA 4ODXB 2L7JA 5E6IB 3OKOB 2XCMC 4R0LC 4NQEE 2QKSA 3Q0HA 1U30A 2CCWA 1Q9LA 2IADA 1FN4B 2VDMB 4JQVA 4UTAA 2KPWA 5F2FA 3P2DA 5AOKA 3SJVA 43CAB 3VVVA 3HG1D 1GC1L 2H26A 3K2KA 2J1WA 3PL6B 4PV9A 4YZFE 5I74C 1NCHA 5H2BB 4L1SA 3BDYH 3T4AA 4GUPB 3MRKA 3F2LA 3ZRCC 4XBMA 4KI5C 4NPKA 3KPRB 1JZHA 3KPPA 3BAJA 4XNDA 2Z92A 2F54A 2ESVD 4GW5A 4HKZB 4XP4H 5ETUB 2OW7A 2G2RB 5SWZA 5DHVB 2J7LA 3BN9D 1N8ZB 3HC4L 3O2VH 4KHTH 2WTPA 3CLFL 3CU1A 5BNXD 4HC1A 4TMPA 3NCMA 2FJFA 2OMWA 2IXQB 4XGZA 4PJ7B 5D5MA 4U6XB 1MREL 3MUUA 3UMNA 2JKLA 4JGUA 1EFXB 3T4YB 5JOPE 1SM3H 1XQ4A 1I3RB 4GBXC 4LAJH 5DEZA 4PJ7F 3SCMD 5CCJA 4BZYA 5IROD 5I0YA 2J8HA 1U8QA 2ADFL 4AG4L 2WXQA 4NKOB 1A7PH 3EO9H 4TNFA 4PRAB 1M56B 3VI4F 3MV01 1KIUB 5D2LE 3ROOB 1PYWB 5IFJB 1PTZA 4DFIA 2G0LA 4L8CA 5BO1L 5ABDE 1NPJA 2A6IB 1DZBA 3NJHA 4OZFH 3BZ4A 3RIKA 3SGEH 4PG2A 5FYJL 5I73B 3NJJA 3IDIB 1F42A 3SYOA 3VNYA 1QWHA 3ZY7A 4Z6AT 3OZ9L 1SVBA 3EZ8A 3B37A 4F7TA 3ML8A 1WZAA 2F58H 1XR8A 5K69A 4M02A 2DEYX 4EI5C 4N2DA 2J88L 1R3JB 3AXLA 1XEDA 3F01A 4Y2NA 1DO6A 5FUZL 3FOMA 2V5MA 1MCPL 1KPUB 2VXVH 4W4OA 2E5EA 1QVOB 4UTAH 2NTSP 4W70A 3UTZA 3VXME 4Z0XB 2VDLB 4I13B 4PJ9D 3MCKB 3TNMB 2VMJA 4FABL 5AD0A 2DKSA 4NDMB 5FDYA 1BZDA 3IFOB 4M6NL 1CXFA 3NRFA 4XCEA 3ARWA 3BPCB 3MRQB 4KY1L 1TENA 2AABH 5HJGA 3I3DA 3HC0A 1B6DA 4E5XA 3KYMB 5DZAA 2XQBH 4PJIB 4F8NA 1YEWA 2GUOB 2WZ6A 4LSTH 3ZTJH 2O5NA 2QQNL 3HE6B 3R1GL 4XWOC 5HI4C 3S3PA 4HEPA 4JFSA 3GSOB 3JWNE 3NPSB 3MRCA 2EUXA 2B7DT 5FYLL 2IC2A 1E50A 3UPAA 4NN5C 4X7TB 3CG8A 1GPOL 1IC4L 4KZEL 4NKIH 2QJDA 3VU2A 4P57A 2JF1A 5ERWB 5C0CE 1GHFL 5EC2A 3H3PH 5KSVB 3TH3T 4HIXH 4ICWA 5DJ2B 4ZX5A 2XN9D 3ZE0F 1RJCA 5C0JB 2WYTA 3S5LB 3MLUH 3F3HA 4HETA 2ZXDA 1EEZB 2MCMA 4UV4H 3AT8A 2YD6A 1E7VA 4NKMA 3BAIA 4QRUA 4QRPB 5IY5B 3KM2A 3NCBB 4PCSA 5I6KA 3LHPH 3U0PA 1WHPA 4YDNA 3RA7L 3F6LA 1A1OB 2IWFA 2WLZA 2RFXA 4WTWA 1Y1UA 5EBGA 3L45A 5MEPA 4RGMB 1TG8A 2J55A 2V2XA 1ACCA 2VSCA 4ABUA 1ROCA 1TXKA 3UFIA 4AKPA 5I17B 3KPLA 4HWZA 3IDUA 4PQXA 4HMCA 5CEXA 3TZVC 5D2NA 2O72A 2DQTH 4WI0B 1SN5A 6TAAA 4U1LA 5TPWH 4F9PA 4LLMB 2DQDL 3TU6A 4RFOL 3L6FA 1BPLB 4MZ3A 4S2SA 3X3GH 1JK9A 3QEUB 3ASNB 5JQ6H 4XMLH 3HE7C 1YNLL 2BNUA 3UERA 1SGKA 4Y1AB 1J0ZA 2JKNA 4LSRH 5E8EA 3BN3B 5CN3A 4AXWB 1T4KB 3EGDA 1C16A 3WN5C 2HAZA 1KWGA 5F3HB 4HUWA 1DQIA 3M88A 4LU5L 4JPWL 4QHMA 4XNMA 4BXSV 3S34H 5B21A 4PW9A 2WLLA 4XTRC 2ZOUA 3U36B 4UQBA 4J7RA 5H4ZA 4XMUA 2WZPD 4FXGC 1C7TA 1QBBA 2LU3A 3F00A 1FYTA 3NSXA 4PJEE 4Z7UE 3F7VB 3MA9H 2F8VA 2MHAB 4KI5D 4H26B 4OKVB 4LCUA 4J2XA 1NC4B 3R19A 5GGUA 5EZLB 3U46B 5IB5A 5IOPA 4G6ML 3NSCA 3TVMC 1XD1A 5ISZD 3QJHA 2VL4A 4B27A 1VPOH 4OIIH 4AZUA 2WXPA 2CRIA 4KMQA 1CR9H 4JUSA 5JORA 2ZSWA 4HPYH 4Q6YA 3BGFB 4FI8A 5FK9A 5IM7B 5I8CB 3TYGH 4FQLH 1VB9A 4JFDB 3RL2B 3G6JB 4YHKH 1C5CL 2BSRB 3VD7A 1AXSB 2A77H 4GW1B 3W9DA 2DM7A 4AEFA 3QWRA 4GBXD 4FFZH 1CYXA 3VXOA 4WKXA 5TH2B 3G6JF 3QJXA 3DHMA 4M1GL 2VO8A 1BECA 2ZWLT 3MNZB 4PB9H 1RZJL 3CSBA 3EJTA 5I6MA 1I8UA 2AEIT 1NIAA 3G5XA 1Z9SB 3FTZA 5DGRA 4CJ0A 3B2DC 2YQ3A 1IC7L 1RK1B 4OFPA 1MW3A 2BDNL 5FFOA 5BUGA 1NC2D 2ITCA 3D07A 5T1LB 2GBVA 4F24A 3QH3B 4ONHA 3WU1A 1AOHA 5EZOH 5CD3A 3CC1A 3A23A 1G9NC 1OGAA 5C0BD 5F7MC 5HDQH 3VI4E 3BT2H 2B2XH 2VDRB 2J73A 4X8JB 1DJXA 3DX7B 4L2YA 1C8QA 3GKZA 1XIWA 1A1NB 3U9UA 4Z7AA 4E42A 1AE6L 3OB0H 3ULVL 3OAUH 3QC5X 3NJFA 4ALAC 5ADPL 4ZUUB 4WRLA 2C1PB 3GJFB 5FHAL 3BZEA 3VFUB 2Q2LA 3QYNA 2NX5E 2G9HA 2W94A 3M7FB 3WY4A 3P30L 4NUMA 1J18A 4YLQT 4XP6L 3IDMB 1FVEA 1LK3H 4O02L 1Y1DA 4MAUH 1KJ3H 4BFKA 5KYYB 4OZGA 3QK0A 1Q9KA 4ZD3H 3FPYA 4QF1A 3D1MC 3P2BA 4C56E 2P5WB 5DK0A 1W16A 3ETTA 2G9KA 2J2ZA 4JHAH 1D2OA 1NDGA 3H9ZA 1ETB1 4MJ6A 3QG6A 2HJKA 4RGNE 4WGVB 3AS3A 1P1VA 4XWOD 3GDBA 4MAYC 5F93C 1MWAB 5HI4D 5IB1B 3DSNA 1CDBA 3KPOB 1N12A 3FFCA 1WFMA 2C7UB 3IGAA 2CR0A 4YBQC 3BZFB 4GMTL 5J11B 5B8CB 3QDJD 3H4HA 1QFWL 1KJ2B 1QRNB 1PIGA 4I0PC 1DN2A 5C7XH 5I0XA 3KPSA 4BCZA 5C07A 4LEEA 1SHWA 3LS5H 4PGCB 5CJQH 5KSBF 1UUSA 4Y19E 2AEPH 4XMKL 3OKLB 4UQAA 2AXGA 4NX0A 2YOCA 1HXKA 2AJXL 3O9WA 5JA9A 3C75A 1RH8A 3CFEA 4LBEA 1Q94B 1RFDH 5BW7A 5MEOA 3U0WH 1DDTA 1KLUA 1NAMB 5B39A 2LTQB 5G2NA 3NGBC 3O6KH 1ILSA 4JY4A 1M7IB 1TQBB 3EGXB 4IBLT 4PIBA 3VI3A 5I1LA 5F72S 4FNSA 3HI5H 1AZCA 1CQYA 1QACA 1CFQB 4GFXA 3U4AA 4ZFQA 1M6UA 3X12A 2DIEA 2CH8A 5DR5H 3QNXB 4B9PA 5BVJA 3T65A 2PYEB 5KZCB 2A6JA 3LN9A 2AEQH 4I5BB 1YEFH 4WO4B 3SOTA 1RZKC 5D1ZI 1J5HA 5IJDC 4KDWA 3V0VA 4YHNA 1EHLH 1I4FB 1QBAA 1ETJA 4AV0A 1FI8C 3FU0A 5AENA 1UM6L 3ZDZF 1G7JA 1MCOL 3R18A 1BX2A 1I7ZA 4M93B 5I6XB 3N55A 4MFHA 5E1IA 4QJ4B 2BVOB 1UADC 3ARDC 1YSOA 3OKEB 3VWJC 1PZ5B 1V8HA 4L0PB 4XPAH 4P3DA 5CZXC 2W60B 4CVXA 3HE7D 5D6DC 3OXRA 1GMEA 4BKTC 3RWJA 3CTTA 2RHEA 1UHVA 4FKKA 1OHZA 5E2UH 2V17H 5SV4A 3UTSA 1AQKH 4G82A 2X0VA 3BJLA 2EDEA 2ZP0T 1BXUA 5K39A 3OC8A 1QPXA 5DZOA 3O6ML 2ED8A 5A2JH 3CPLB 4XTRD 4HHWA 1R0AH 1LNUB 2WN2A 3MV9E 4FD0A 3CZSA 4G3YH 1DJSA 1NCNA 1QD0A 2K4WA 4M1DH 5CINL 5DU7A 3RX9A 1CK0L 5CEZE 4JRWA 3AM8A 4KX7A 3ARYA 5I9QC 2XKUA 5L8JB 1AHWB 4N2AA 5HYJA 4S1QH 5JW5B 4BZ2H 4M7ZC 4MA3A 1L7TH 3OJ2C 2XWJB 4PCKA 3TVMD 1NICA 2DLIA 3UO1L 3NQKA 3K8KA 5GSRB 2X4SA 5A6MA 1QZ1A 5E5RB 1J8HB 4YXKL 4P05A 3PGCA 5I15L 3V6FB 3K6SA 3L3OB 3OMAB 4G6JH 2ZE0A 3DPBB 1QWUA 3L3JA 3TPUB 2J8OA 3VD5A 2ERJB 2GJRA 1HOCA 2DWEB 4YHIA 3FO1B 3ABMB 4J3VA 4L4TE 3GSUA 1RVFL 3ARBA 5C09E 4XPGH 3SE9L 3DXAD 5IK3B 5I6NA 5ID0B 1JCVA 1U8PA 4G7YL 5CU9A 1CI5A 2CDEB 2N1TE 5IMKA 4MGXA 3T6ZA 2X9XA 4F2MA 1FYHB 1I1RA 1W15A 2PXYC 1LP9F 5AEAA 1BVLA 2XI9A 3AQZA 1F90L 1HHIA 1KTRL 3CFDB 4AH2A 3DGGA 5E4AA 3MBEA 1C12A 1TKWA 3IEAA 2CU9A 4XPFH 4JVWA 5K9KB 5BO0D 5C0AA 2B1AH 2A9DA 1DLFH 1JGLL 1UB6A 2YRZA 4PUBL 3RWGA 5BVPL 3T0EB 5F97E 2YD8A 3BPNB 4WW2F 1F1DA 3QFDA 4X99B 4YDLB 5IB4B 3BP5A 3MACH 5DGQA 5CJXC 4NUJA 3IJSB 3BDXA 5FF6B 5HHOE 4S11A 1PZDA 1PX8A 5EOCH 3LKRB 4HSQA 3DWTA 2OJ1A 2IGFL 3VD0A 4ISVB 3EO1A 2WAHA 1J0YA 1N9PA 3STBA 2P80D 3CE1A 2FJGB 1J1PH 1CB4A 4RZCB 5ACZB 3NN8B 4YGVB 2A9MH 1DZ0A 3EYUH 4M6MH 3TASA 3VJ6B 5JPNA 4PSRA 4QOKA 2XXGA 3U1SL 1NGQH 1UM5L 3O6FC 4LSQH 5ESVA 1RZKL 4X6CA 3ZSSA 4G9FA 3JV4A 2GIXA 4H1LH 2ZKWA 4GO9A 1YO4A 2Y24A 4ES8A 1O6VA 1BFVH 4TLTA 2NW2B 4MAYD 2JSFA 1NFDB 1ZLSL 3SGJA 1YEEL 5TE7L 5EWIL 25C8H 3VDAA 3B4NA 4LNRB 3UEZA 4YBQD 3AROA 4O2CA 1QATA 3EFOA 4XX1G 1KSRA 4JM2B 5EA0L 4JR9H 4I0PD 5DMIH 3MNVA 1CD8A 2GC4C 3U2SA 5DD3H 3SBQA 4JG1L 3MXVH 2L7QA 1DJGA 1N64L 5IVXB 3NJKA 4TULL 1XB8A 1RUQH 4PIRF 2YPLB 1IKFL 1RMFH 2QQLH 4UINL 4RX4A 2VJ8A 3HMXA 3WV0A 3KPQB 1AR2A 1CURA 1T4WA 4IHOB 5EZIH 5EU4B 4A04A 5I30L 4ZW6A 2LU4A 4NN7B 3U4EA 4UQDA 2VZ1A 1JZ5A 1SYSB 5J8OA 3B7TA 3TBCA 5KSBE 4TQHA 5FUOH 4BFIA 3QIWA 1IAIH 3PHQB 5FO7A 4LLAA 2J1YA 1KNOA 5EU7E 2QMJA 4QAMB 3QHFL 4ACPA 2X4UB 1OIOA 5CD5D 3CFNA 2ZT9C 2ZOLB 5CAYB 3IAPA 1TNNA 3MV7D 4ZQKB 3V7MA 5CEYA 4Q8BA 1R3KA 5CILL 1WQVT 1DVQA 1CF8H 2VLME 3G5YA 3H56A 1ETZA 4NZRH 3KM1A 3LNFA 4XPBH 3RLSA 2CM5A 3MLZH 3NDYE 1LILA 1NCDL 4FJ6A 2ICEB 4M6OL 1XB6A 4LOVA 3ARDD 3GINA 4H8WC 3BD3A 4QXUH 3VWJD 5J1AB 4M3JA 3BH9B 1SXBA 3HNVL 5CZXD 2FWOB 1WCQA 1KBGL 3SBRA 3GUFA 1UCTA 1GY1A 4BQBA 3DX8A 5TE6H 1WWAX 3CX5K 2A74C 1AYRA 5C2BL 1TSRA 5KN5A 3L17A 4DPBX 3FN3A 2GBUA 3JVGC 3WIAA 3EBHA 4L37B 3ZDZE 1AKJA 2NR6C 1LMIA 1E0OB 4OJFL 1ED3A 4J1UB 4OZFB 3WGVB 4AQ8A 3P3SA 5D8JL 4QYOB 5JMOC 2AK4D 3ABLB 3TT3L 1Z3RA 5EOQH 1GH7A 3S6CA 4EZJA 4HX1A 4DUVA 1XZ0B 2FBJH 3GUTB 1PF3A 5JQHC 3FQTA 3RWFA 2V9UA 2BP3A 1PMYA 3OGCB 1O6SA 4X7SL 1M71B 2CLVA 5AW4B 2DKMA 1BAWA 3B7UX 3LQMA 4N87A 1UD8A 5CSGA 2A9NH 3WD5L 1FNSL 5JPMA 2BZ7A 1Q9LB 2IADB 3TO4C 3ARQA 1HEHC 3VVWA 7TAAA 2W91A 4WNQA 4DWHA 5IG7A 3HMXH 1KCRL 1HINH 3CFCH 3RVTC 4K94L 3SJVB 1IGMH 2X1WL 3PGDA 2H26B 4PV9B 4KY2A 4XVSL 5AOJA 3VXSE 5HBBA 2HLAA 3T4AB 3MRKB 1J12A 2DYRB 2IDSA 1JXKA 3OHXA 4N2IA 3KPPB 2Z92B 5CJ8A 3HFMH 2F54B 3WCYA 3R0MA 2CQVA 4GW5B 2RACA 1YECL 1TZIA 5HYSA 5SWZB 3WY3A 2LVCA 4O5LH 1ZTXE 2C9SA 2IAAC 2MWCA 3LXUX 3UBGA 4Y5XC 4XN2A 4BINA 2EDTA 2OR8A 4ZW5A 2FJFB 3GJFK 1TMCB 2OMWB 5DHYA 3GO1H 3QIUD 4XGZB 5D5MB 4AENA 3BOVA 3CK0L 1GL4B 4QRQA 1X5AA 5L8LB 5D4IA 1ZVSA 4RSYA 2WYHA 4JDTH 1IBGL 1QQDA 2YMTA 2APWA 3KL3A 5I8OL 2APXA 1U8QB 1U8OA 5DHEA 1ZGLM 5E2WL 5BV7C 4ZZFA 4KUCD 1MI5D 3DX9A 4TQEH 4N6QA 1E6OH 4DOHB 3SGKA 5JXEC 3QQ4A 3LPWA 4XO9A 1XCWA 4CL7A 4L8CB 1RULL 2LHAA 3MRRA 3O2DH 4XMZA 1A02N 2R56L 1TDQA 3BZ4B 3GPEA 4TPRL 2ZAGA 5EH1A 3EDKA 2AMUA 3CFJA 3O0RH 1YQVL 4F7TB 3ESMA 1BLNA 2X9YA 4H25A 2PNDA 1XR8B 3DC0A 2YD1A 2OSWA 3Q8BA 2H6UA 3O6FD 2BINA 4YUEH 1IMHC 4J3OF 1S7VA 1Z5LA 3AXLB 1BVZA 3MCG1 2XQ0A 4L3EE 5F7DB 3SE3C 3AS1A 3FOMB 4IRJA 4O58H 1WBXA 1UA7A 2NZ9D 4RVBA 4XOEA 5DJCA 1VEPA 5BZWA 4F9LC 4TSAL 2B1HL 5SX5H 3IFLH 4YJZL 5D93B 3UTZB 1MCRA 1QFOA 4FERA 1E43A 5AD0B 1PLGH 5LN8A 3J27A 1P0SE 3LNGA 1G7PA 3DMMC 4XCEB 3QC6X 3ZQWA 4NQDD 2GK0A 1ZLEA 3S3CB 1ZDQA 1KELH 3HC0B 4HDIA 4C4KT 4E5XB 5A40E 1GOHA 1JRHH 4LVEA 1O9ZA 4DN3L 1B4JL 4OGYL 2CKNA 5E95B 2JB6A 3VGDA 3ZDXE 1SXSA 2WWKT 4XC3H 3LSOA 2DWTA 4IBSA 4AIZA 4JFFE 3ZUNC 4Z0BH 3OTTA 4NLAA 3KGSA 3MRCB 3FCTA 1SOKA 4I3RH 4DZBA 4HWEH 4WLCA 4P2RA 4R26L 4FDWA 2NY2B 1UJ3A 3SHSA 3KVQA 1TTGA 4Q56A 1K85A 2ZUTA 1D6VL 2YK1L 4OI8A 1ASQA 2AERT 3P40A 4YDKL 4P57B 4IKJA 1UWXK 2AFNA 3FO0H 5EC2B 4OQTL 2Q3XA 5KUMA 5ELIA 4AQOA 3TBWA 3GSXA 2J1KA 2F15A 1EPFA 5CP3A 5FC9A 1JPSH 4XVTH 1IBYA 1CGSH 1FSKC 2C9VA 3IU4H 3RL1A 2OMBA 4QKTA 4NKMB 4HF5L 5D4JA 4QRUB 4QXGL 4XODA 4JG5A 3UBXG 2H4EA 3BKYH 2FX8L 2A4CA 3NCXA 2WSKA 4H88L 1YPZF 1MFEH 1B4LA 4B0MB 5F7UA 3U0PB 3QR2A 1R6VA 2G60H 3GS4A 4N1HB 2CCVA 1N6UA 2H47C 4MAZA 3WJJA 5L88H 2OBGA 1ACXA 1PFOA 4JZNA 1HL4A 3UJIH 2RFXB 3HNSH 5ANME 1PVHA 3BPOB 1LYQA 4PAZA 1SXCA 5MEPB 2W92A 5EEZA 2V2XB 5I75C 4PRHE 3KPLB 5C0RH 1SEQL 1EAJA 2NR6D 4HIQA 4HWZB 5AVZB 5CEXB 2A73A 3UOAB 3CHPA 5D2NB 4XXCA 1SMAA 1QKZH 4HEME 5HY9A 3O4OC 4L3CA 1ZT7A 4U1LB 4OUUA 1N5YH 4EBQH 1KB5L 2EEBA 5BV7L 5C08E 1MRCL 1SDDA 3L6FB 3U0TA 2RCSL 4S2SB 1JK9B 5TK4A 4XR8C 2BNUB 4ZYKA 4CSSA 2A38A 4DUWA 5E8EB 4X0NA 4FULA 3EGDB 2KERA 1C16B 4NLHA 2AKRA 4HUWB 5AVVB 4QHMB 1HC1A 4XNMB 5F8RC 2WZAA 5T5FH 3TO4D 4UOZA 2FX7H 2ZCLL 4A2HA 4POYA 2H6OA 2B8OT 2WLLB 2GSGA 4ZQTA 4WO0A 2BMKA 2JH2A 1AGEA 5DEJA 2FWLB 1DQVA 1GYUA 2ZWSA 1QLEH 3QUYC 1FYTB 3WEOA 4CSZA 2H45A 3LTVA 5GJTL 4NHCH 4LCUB 3V6ZA 1T0MA 1T7ZA 2XWDA 4GMSH 5GGUB 4YDZA 5IB5B 5IOPB 1KTBA 2IOOA 1I9RH 3RZCA 2O5ZL 2VLKE 3QJHB 3M46A 5IEKA 5EF2A 5I0VA 1CMOA 1JXJA 1WICA 3PWLA 4KKPA 4NQED 5JORB 1JERA 2NSMA 2ZSWB 3HS8A 4YSEA 4G5ZL 4J39A 3EAKA 2BCMA 4XP5L 3G6DL 5FK9B 5CP3H 3H6AA 1MFAL 1JI1A 3QJUB 4CA4A 2ETWA 2Y7MA 1NANI 3W9DB 2UUDK 3JXAA 3CXHK 3H85A 1ZMYA 3VXOB 3ORJA 4E0RA 1TCMA 1L9NA 2R0WH 1BXVA 3KR3L 3LN4A 2W8CA 4EEEA 2F68X 1OPOA 3AZUA 5EB9A 1OALA 5DUBA 3CVIL 4HBCL 3SEPA 1WK0A 5I2IA 4WY7L 1C5BH 4BQ6A 3GS0A 1PDKA 3BUTA 5KOVC 3IMBA 1A4BA 2VW6A 3G5XB 1JF5A 3L4YA 5JXED 3RJQB 3PWUA 4HLZG 2C3GA 4RMBA 3EJJX 4XCCH 1CIUA 3IT8D 4OJDH 4UANA 1Z5YD 2GVYA 2H6PA 2ITCB 4OI9A 2NY1B 1BREA 2XZQH 4ONHB 1KACB 2FECL 2YHGA 5CD3B 3WJMA 2JKRM 5JOPD 4MMZA 1OGAB 3PJSA 4N0YH 2CGRL 2CAKA 1MCWW 5K1JA 2R4SH 3HCVA 4OCNC 4Z77A 1QZNA 2ZUQB 5AQ0A 2XIIA 3GZPA 1G4RA 1PSKH 1XIWB 3U9UB 4OVUA 3OD3A 2JJTA 4K3GA 4E42B 3P1VA 4MB1A 1SEBA 1UT9A 2ZTBA 1EXUA 1S6NA 1F00I 4ZSOA 1KYFA 1AYOA 1I9EA 1SBSH 3BZEB 3UPCA 3BVUA 4PWFA 2G9HB 2EICA 5EN2A 3QJVB 3WHE0 1HEZA 1PCXA 4M03A 2VZUA 4OM0L 1G1YA 2Y06H 3EOAA 3MRBA 4X6DF 1FVEB 2L4OA 3U83A 4F37F 4XX1E 4YWGL 4Z7QB 4OZGB 1Q9KB 3MRGA 3MUJA 4QF1B 2H7WA 2RBLA 4LARL 1AJ7L 4ATTA 2BNRD 5LCVA 2WYZA 3BD4A 5DK0B 2A1WL 3ZU8A 2YARA 1YNTF 2J2ZB 4Z7QF 4MJ6B 1NDGB 5DC2A 2R2EA 4ORZC 4EOWH 3QG6B 2HJKB 5IEHA 2D4DA 2VDPH 1ET8A 1KJMA 1U8LA 4U1GB 1I8AA 4NAMA 5EV7A 3DSNB 2WO2B 3VXMD 1NQBA 2TAAA 3FFCB 2XV3A 3IGAB 3ZMNA 1TPXC 1GR7A 2G5RA 4LL9A 1X4XA 1URIA 1P7QA 1UGKA 3MLPA 3KPSB 1T2XA 2F7OA 5C07B 3O3DA 5D4HA 4AQAA 4ZFFA 4M43L 5KW9L 3CFUA 1PLBA 1G9MC 2EIJB 2AXGB 3JWOH 2YXVA 3O9WB 5L2KA 3CFEB 4LBEB 2ENJA 2HG5A 3IBEA 5MP6H 3SDXF 3JTBA 1JRHI 5F6HJ 2HRPL 3E9TA 5MEOB 2F5BH 1KLUB 5B39B 1NBQA 4A7VA 1L9PA 4JY4B 1MFUA 2V2WA 4TNWF 4YEFA 3VI3B 5JHLL 5I1LB 1T1YA 1UWGH 3AW5A 4LLUA 1G7HA 3Q8AA 4TVPE 2W38A 4EUPG 4R97C 1KG0A 1QWNA 2DD8L 1C1EH 2I7SA 2WSPA 1NUFA 3SDCC 2E9WA 4U6VL 5HDWA 4GT7A 1OF2A 3X12B 1F13A 2F8IA 2XWZA 5C0CD 4OZIF 1IKNC 4M00A 4XI5C 4QR7A 5BVJB 3BUBA 3DJSA 3CCHA 3T65B 2A6JB 3IKCA 2ALAA 4NWTL 1UACL 1UT2A 3V0VB 4YHNB 3IMVA 4X8GA 2M83A 1FNAA 4PVNA 2VMDA 4G8AC 3GS7A 1G7JB 2YGNA 1BX2B 1I7ZB 1YPZE 4YL4A 3MAWA 4JM4H 5F1KC 4FA6A 4UNUA 4XZ4A 5BQ7A 3C09C 3ZKMC 3TJHC 1MCDA 1H8SA 3RWDA 2WP3O 2X28A 3IPEA 3V9FA 4HIIA 2YXFA 4CVXB 3C8KA 1E27A 3LRHA 4HFWA 4P3DB 3VH8A 5MENE 1WZKA 3OXRB 5F9OH 4EZKA 3RWJB 2X38A 2VDNB 1T83A 4PRIA 5LCVH 3N6YA 1KF9B 3NIFB 2GPZA 3L7FA 4M29A 3UTSB 4JS7A 3I6GA 4PLOB 5K39B 3LAFA 3NZHL 5FM4A 3CIAA 3NIFF 1MNUL 1N0XL 1P6WA 3QUYD 1YA5A 3VSQA 3GWJA 2CIIA 1RUAL 1G6VK 3OMNB 1D2PA 3L95A 1WUNT 4YAQA 5HYJB 1SLWA 3DTXA 2Q76A 4MRCA 5HGHA 4R4BA 4MA3B 3SO3C 1X5KA 2VR6A 3SKJL 3B3IA 3L3GA 4ZO7A 2X4SB 3ULUF 1V10A 2WMPA 2QHRH 4DGIL 2V7HA 4HK3N 4HOMA 3THMH 2XA8H 3DV6A 3PGCB 4M7KL 2VIRA 1VF5C 4GIOA 4J3BA 3K6SB 3GHBH 3DOHA 1EEQA 3I84A 5K59F 4QDGA 1ODAA 2HN7A 5DYOA 2O6FA 3L3JB 4MS6A 2QKIC 2HX7A 1XSOA 1AS7A 1HOCB 1OGSA 4YHIB 2VH5H 3F58H 4KHXH 2HT4C 3VG9C 1JPGA 3GSUB 3ARBB 1YYLL 4YSDA 1ZHKA 1U8PB 4XP9H 4Y1TA 2DTMH 3OF6D 3UCQA 1Q1JL 5IMKB 4PWHA 3ARTA 4OB5L 4F2MB 1DL7H 1P1ZA 5FM8A 1BVLB 5GPRA 4MKTA 1B0IA 3SDDA 3U25A 4AH2B 1HHIB 3Q2VA 4GKZA 4BCXA 3JQOB 3BAEH 2AXFA 3DGGB 4JFUA 3MBEB 1OAKL 4WFED 1IBBA 1C12B 4G8IA 1TKWB 5HGGS 2VQTA 1KN2L 4LK4A 2IPUK 4XX5A 1FC2D 3HZYA 5E8NA 2O93L 2R15A 5TGBA 5C0AB 1NCCH 2ZD0A 3V95A 3RWGB 1UB6B 3QEGH 3MJ8A 1EJOL 4HQQH 2EIKB 3ISYA 5FWRA 4ZRGA 3QXAA 2G3MA 3QFDB 3BP5B 4JQIA 2EDOA 4NUJB 2JCCF 3UXFA 3LMJH 2F8XC 1OB1A 1IGFL 1S8DA 4FP8H 5D7LD 2DV6A 1ZEAL 3ATEA 4E68A 3EO1B 1SRDA 4NERA 4Y4FC 5I19H 2XV0A 1T5XA 1TTBA 3QUXC 4YDJA 5BMFH 1O5DT 3HRZC 1IQWL 2IG2H 3LPGA 4DQOL 4X7EC 5JPNB 1NCWL 4H44C 4QOKB 4ZPVA 2FSEA 1PQZA 3HNTH 2F7RA 3WTXA 2BPBA 3KE0A 2BSDA 3DNKA 5CWSA 5ESVB 4X6CB 2ZX5A 2X2HA 4G9FB 4J23A 4U1IA 1PNDA 3JV4B 3D4ZA 3RVXC 2WIMA 4HWUA 2VSMB 3DV4A 5JHBA 1XBDA 4X6CF 3GBEA 4HFUL 3VRLF 1YN6A 1IZKA 4HZLA 4Q0XL 4X6DE 1DVFC 3D0LA 4N26A 3EIFA 4O2CB 1AXTH 3WFDL 1WT5C 3EFOB 1WVZA 1BQ5A 2EINB 4JL1A 3SPCA 4YPGA 3SDAA 3MNVB 4JG0L 4OFYD 1OE2A 3LRKA 3U2SB 4P2QA 3V79C 3AG4B 3KHQA 4OF0A 3S5LG 3WELA 5T1JA 4LSSL 3MBXL 2C1OA 4C56D 2XV6B 4XVJH 3WEBA 4EDXA 4Y2DA 5DWUH 3C60C 2XZAL 4BRVA 3BGMA 3DX1A 1GIGH 1B6UA 3FT4A 4UAOC 3LQZA 4NSKA 3PV6A 5KUKA 4HJJH 3WKYA 3B9VA 4AGQA 5SWSA 5KBDA 4PJFA 2J12B 4NP4L 2BSBA 5IESL 2B39A 1KTDA 2EDDA 1XGUA 2X09A 3U4EB 3WDJA 3RP1A 4JN1L 2FEEL 2W59A 2OA9A 1BAFH 1M2OA 4BFIB 3QCTL 3SDCD 3QIWB 3QQDA 5FO7B 4NJ9H 1R46A 4H8HA 2D3VA 1AZBA 1JL8A 1KNOB 2Z4QA 4LEXH 4XI5D 4ZTOL 3RE0A 3L4CA 3SDXE 2O5YH 3OB0K 1I8KA 2GIMA 4ICXA 4PS8A 1T66C 5CEYB 1CT8A 1R3KB 1NSNL 3G5YB 5I1EL 3B6SA 4DP9X 2VCOA 1ETZB 3L4ZA 3T8MA 3EFDL 3O11A 4OT1L 1N10A 5HDBB 4JW3A 4XPHH 1JE6A 3JYCA 2XV2A 5FGSA 3TJHD 3ZKMD 4KMTH 4OZIE 4XMWA 4U05A 1G43A 4ZXBC 4JRXA 4N20A 2GEQA 2MNUA 5EU7C 3DX8B 5D1XA 4Q9QL 3LQAC 1S9VA 4NQUA 1RPKA 2AJYL 3GC3A 5KN5B 2VQ1A 3RKDC 1W72H 4NNXA 1AKJB 5FYJU 1ED3B 1MVYA 1JDDA 2VERN 3WLWC 4BIKA 2XLLA 1NGYA 1RU9H 4KPHL 4TQIA 2A0LC 2WW8A 3CX5J 4J6RH 4KO7A 1MLBB 5L7XH 4HX1B 2YBRA 2B15A 3HBGA 4FQIH 4BSJA 5DQJA 1E2WA 3FQTB 5E94A 2BJML 3RWFB 2DYPD 1NAKH 4DK3A 2PCPA 1O6SB 1UGNA 2CLVB 2VR7A 3EO0A 3SE4C 1GS7A 4MS8C 5JPMB 1HH6A 2IQ9H 3ZTNL 1IAKA 4WNQB 4YFEA 5IG7B 2BIPA 2X1OA 3NCWA 4QTHA 4NNYA 3PGDB 3MV9D 4ONGL 3EOTH 4CU8A 4D0CA 2CBTA 2HLAB 5CEZD 4N24A 4I48A 4F8LA 2G2PA 3VXRE 2B9AA 2NYKA 3OHXB 2HT4D 1R3HA 5I0DA 1Q0YL 1KFAL 1NCTA 1TUPA 4HUUA 3ULUE 4V2CB 1NJ9B 4KNQA 5HYSB 1TZIB 1S7WA 4QYAA 4HU2A 1JGUL 4GSDL 4GAGH 3QUHA 5F21B 4ZI8A 5E8OA 3GHEH 2Y2WA 4FGMA 2BZCA 4HCIA 4DVRH 1ZK5A 5K59E 2VXTH 4Z78A 4W6XB 1WIUA 4IBUA 3WDIA 5JW4R 4J8RA 5DHYB 4BFJA 4HU8A 2J1XA 4AENB 3TBSA 4W93A 2AEWA 1OAYL 2WBXA 4QRQB 2EILB 4HUMB 1ZVSB 2V9TA 1UOWA 5I8KH 4PCTA 1QQDB 4L4TD 1IGTA 1T7WA 3CVCA 4W68A 4ZZKA 1SMOA 1EVUA 1RZIA 3HB3B 1XCQA 1U8OB 4ZJ9A 5IF0A 1HU8A 4V2BA 4NGHH 4YX2H 1ZAGA 1E4XL 2V3FA 3DX9B 2OMUA 5E03A 3KG5A 2NT1A 3HG1A 5I6PA 4Z3GA 1JZEA 2C4XA 2KS0A 3J07A 4M9PA 3QQ4B 1MDTA 2W9EL 5EZJA 4KOCA 2EDBA 2NYZA 1HZLA 3MRRB 2V5YA 4OD1L 4L8SC 2P44B 1MCQA 1MH5A 2OL3L 5IJKA 1Y6NR 4L5FE 4Y4FD 2ESVA 3VQ2C 3MRIA 3N0PB 1TQUA 3MYJA 3GLZA 1XH3A 1ZV2A 2DF3A 2G75A 1U6AL 3CFJB 3QUXD 4KZDL 2VABA 1BLNB 4H25B 4WV1A 1GGBL 4P5RA 4OD2A 4CU6A 2JCCE 1S7VB 1Z5LB 1PG7H 1YQ2A 3QZNA 2WNWA 5E8PB 1MWAL 1SF5A 4IRJB 4L4VE 1WBXB 5BZWB 3REWA 3RVXD 2VTFA 5DJCB 5I5RA 5HHOD 4ZNEA 5HHXH 5CS7A 3D18A 4ZNCD 3D69A 1SXZA 1UA6L 3K2UL 4KKLC 3SCMA 3WBDA 2J5LB 4W9DC 1DVFD 5IROA 1OWWA 1QO3A 1H9DA 2WNKA 4OFDA 2CNZA 1G7PB 3LKQA 5CR8A 1JZFA 4HLJA 2E7CA 2GK0B 3I6KA 3IXTA 4JB9H 4WW2C 4Z95H 4ZS7H 4HDIB 1WIPA 1EO7A 2ZCHL 2NY5C 3QRGH 1TTAA 3AMKA 4XE5B 3TA3C 1MCFA 2JB6B 5CGTA 4LSUH 1UA3A 3C60D 4AEHL 1IEAA 3HN3A 3LSOB 3VRLE 5I1IL 5LGYA 2XX0A 1ASOA 1DYZA 2CMRH 4OCYL 4AIZB 1FZJA 1DQQA 2OV0A 1GZHC 1F45A 4A7GF 4NI6A 5F0JB 1QLEB 4DZBB 3FCTB 3VSTA 2H1LM 3GMMA 4IRSC 4BE5A 1GAFL 4I1RA 4P2RB 3TF7C 2R59A 3DVNA 3KBEA 5D7IA 1UJ3B 3MN8A 3FN9A 5MI0B 1RSFA 4DHLA 1KXTA 2IWKA 3UJJH 5L4JA 4YSUA 1WZ1L 4MD5A 1OAQL 4Q58C 2CA4A 1WEJH 1JNLH 1OSPL 3UC0H 5D96C 3KWWA 2CR6A 4A1RA 1GZPA 3GLAA 4PJ9A 2VXSL 1LD9A 3QDHA 3TBWB 2J6WA 2O30A 3PWPE 1T66D 3GSXB 3WHE1 4YFLI 1IEBA 5CUSL 5DJXA 3WKNA 4B5ZA 2EIEA 2H32A 3G04A 3H2QA 4QRBA 1JJUA 4UZSA 3RL1B 3VGFA 4HIHA 3Q44A 4M56A 4URKA 2FNWA 3MLWH 2CGYA 3QXUA 3LEVH 2GIYA 3JT2A 1YVLA 4ZXBD 4A38A 4LLDA 4JZNB 4PJGA 4BFEA 3DX4A 3MUY1 4P2AA 5F1NA 3KWUA 2EO7A 1VFUA 1YEKL 2H3KA 3AXHA 4FHJA 2VLJE 3RKDD 5F6IC 3T3PF 4BK4A 5F0LB 3AY4C 2VLMD 4OCLC 2A73B 4XAWL 2FIKA 5DD6A 3WLWD 5IHUH 1UH3A 4KJWC 5HY9B 3TTSA 2XKNA 3INOA 1AO7E 4L3CB 1ZT7B 2A0LD 5EBMA 4OUUB 4FLSA 4P04A 1S4IA 1SDDB 4WW1A 3U0TB 4MD4A 4FMKA 2XN9A 4ZYKB 1CFTA 3ENEA 1YC7A 4A39A 1MUJA 2O6PA 3UJTL 2AKRB 3WFBH 4TSBL 1JXGA 4U3SA 1G0DA 2EUWA 2QTVA 5FFLA 2GSGB 3EHBB 3QZMA 2BMKB 2MMXA 1O9WA 3EUUA 1AGEB 4UQCA 5FB8A 2F7PA 3FU8A 1E9OA 2J8UA 5JW4M 1VSCA 3QEHA 1PFCA 3V6ZB 4PBVC 2IMMA 3V0EA 2R51A 1T0MB 4KQ4L 2R2BA 3RZCB 3DLQR 5EIIG 5IEKB 4C47A 3PWLB 2OX5A 2V3DA 3HVNA 1BMGA 2VDPB 3HC4H 3S8GB 3CLFH 4Z7OB 3U7WL 1DQDL 1CLVA 3V52L 3L54A 3VXSD 1VDGA 2AGJL 1MEXL 5CCGE 2NY5L 4XNUH 4E0RB 3OLDA 3LN4B 4P3CL 4R0LA 2NUPA 2ADFH 2V5TA 4P59L 5DUBB 4AG4H 5I2IB 3OSKA 1AQHA 1ORSA 5JOEA 1PDKB 3TFKD 3QO1A 1WBYA 4PJAA 2WZPA 5C92A 2AEOA 3PWUB 2MFNA 5F1OB 4Z7NE 1EAPA 35C8L 4MB3A 2CRYA 1BBDL 5BO1H 4NOBA 3A4AA 5ACMA 1MPAL 4P99A 3MRNA 4HPHA 2H6PB 4JFHE 3JZ7A 4EDWL 3OWRA 1CDHA 3WJMB 4XN7A 5ISZA 4E9SA 2XWEA 2R39A 3PJSB 4MMZB 3ZLQC 1SZNA 4E9YA 2FQDA 5E6UB 3OZ9H 1N6QL 2A9AA 1R3LA 5ES4B 3HCVB 4Z77B 2JWYA 4J12A 1RZFL 5I1KL 4IIQA 2PTVA 1KGUA 5F7FA 3UCRA 3UAEA 3D52A 4LAQL 5FUZH 1SEBB 1EXUB 2V2TA 1MCPH 2PWHA 4ZSOB 2XWXA 3RX5A 2ITDA 5J7CC 1ZVHA 4G59C 4K7FA 3ME0A 4KKLD 4GBXA 2PWDA 4FXTA 5EN2B 5E8PA 5IMOA 4FABH 1HEZB 3RIAK 2GCYA 4NBZB 5LB1A 4M6NH 5C8JA 2ED6A 3EOAB 3MRBB 4N3UA 4PJXE 3RURA 1D5IL 3MZTA 4KY1H 1F0LA 1JK8A 3MRGB 2WVSA 5ADOH 1L9RA 1E4HA 4JKMA 5E2VL 2E56A 3T3MB 3TA3D 4L3ED 4FNLL 3ZZLA 2R2EB 1XSIA 3H7LA 5CP7A 5IEHB 1NC2A 1V5JA 1U8LB 1KJMB 1NGZA 2AZAA 2EACA 4KH9A 4XO3A 4YN3A 1E4JA 3PFUA 3R1GH 4KKZA 5CFHA 3CZUB 2ZJSL 4OCXH 5C0BA 2LQRA 1GJIA 4IRSD 5E5UB 3VD2A 4L4JA 4KNUA 5FYLH 1ZHLA 3WEAA 3WFCL 2QL1A 4PG2C 1SUJA 4UOJA 5DRZA 1IC4H 1P7QB 5EF1A 4KZEH 4J3OC 1U93A 4R7VA 1DSWA 2WLIA 3O3DB 3O2VL 3B8YA 4AQAB 2CPCA 4ZFFB 1GHFH 2F2HA 2YSTA 2IO5A 4H2CA 5CLZA 4JFFD 5L2KB 1BQUA 2HG5B 4TUKL 4GRLC 3V2AR 1DJHA 4JFEE 1SM3L 1DVTA 3UTOA 2XQYA 2WCSA 1U8HA 2LFGA 2V2WB 1MJ8L 5J3HC 1F3DJ 1T1YB 1UXLA 3K6FA 4LLUB 1G7HB 3S36L 1KG0B 2QGDA 5CJBA 1FZMA 3RA7H 2ROXA 4IRZL 1OF2B 2OYKA 3AC0A 1XO8A 1I8MA 1E7UA 3CCHB 5A16A 3A3YB 4JEGB 3IKCB 4J27A 4AYFA 1YJDC 4BV1A 2DQFA 4RFNC 2CKBL 3QIBC 4B7IA 3QDJA 5GISL 5AB9A 1L9OA 4KJWD 4PJDA 3VUAA 3F7PC 2PR4L 1AZUA 2GB2A 1FWXA 2F58L 2X3CA 4XNZC 1ADWA 5BQ7B 4KO9A 5KS9F 2YAQA 4OSUL 3RWDB 3WLBA 2DQDH 4NQSA 4PCYA 1WWBX 3FCGA 3MRPA 3Q8CA 4HIIB 4RFOH 1GYAA 3C8KB 1E27B 4HFWB 3VH8B 2WO3B 1QASA 1JVLA 8FABA 1YNLH 3E1F1 2G3NA 4PRIB 3T3PE 4X42A 3L7FB 4D0BA 4PGEA 3HIZA 3L3HA 4H0IA 4YHYB 3I6GB 4LU5H 4JPWH 4PRHD 5JO5A 3TEWA 1KBWA 5JR1L 2DICA 3D34A 4I85A 4Z3TA 1BP3B 4LRIA 5FFGA 5JOFA 4FNUA 2JJWA 3NCCB 2YUVA 2KLSA 3FW6A 2WQ8A 1CLZL 3ZKXB 4TM9A 4P2OC 3FTSA 2CIIB 2QVMA 3GSRA 4G70B 3PP4L 2E8ZA 3ZTJG 3L95B 4YAQB 5C08D 2VSDA 4YVNA 4K55A 4LVNC 3DTXB 2Q76B 1M1XA 5HGHB 4R4BB 2CPUA 2XWBA 2WB7A 3S37L 3HN8A 4G6MH 3B3IB 5ABAA 4B9YA 1RI8A 2WMPB 2E46A 2V7HB 2ZXEB 4HC1L 4YVUA 4CC0A 2XG5A 3I74A 3TZVA 3BWUF 1CDCA 2VIRB 3NIGF 3ZHKA 2JNZA 1VGEH 4YBLB 4K5OA 4P46C 4IDJL 4ZMQA 3MJ9L 2HN7B 5DYOB 5C9JA 3UX9B 1C5CH 2AV1A 5IW3A 1UH4A 1Z9PA 1M4KA 3HE7A 5E6RB 3QWNA 4HLEA 3NSFA 1QR1A 1LK2A 2BVTA 2DQEL 2VDOH 1JD9A 1JPGB 1JHLH 3VB8A 1PY9A 2YAMA 2X2JA 3V7AG 2IH9A 3WN5A 4A6YL 1R1CA 4M1GH 2VLKD 1ZHKB 4TVSa 1D5ZA 1X7QA 2VSKB 4X2UA 1P1ZB 2CE6A 1KXQA 4JDVA 2BRRL 3HS0C 1RZJH 1WE5A 2ZXGA 3BUIA 3SDDB 4F58L 4FXGA 4CN4A 4GKZB 1KIRA 2AXFB 4P5MA 5BZDA 2B08A 2PTTA 1KYUA 1JXDA 1OTSC 4G8IB 4ZMTA 3DX3A 1VLXA 4KK5C 5E8NB 5F70A 5I6LA 3TPKA 5TGBB 3TVMA 3NK4A 3UGXA 3RB5A 5C0FA 1ZA3A 1HNGA 2BH0A 1P4IH 4X83A 3MJ8B 3QFGA 2WSDA 1DSFL 4FLHA 1DLHB 3QXAB 2IPUG 1I1AC 3WKQA 2JQAA 3ULVH 5DD5L 1OB1B 5ADPH 1T20A 4XN4A 2CBPA 1S8DB 2H5UA 4PP1C 3ILDA 4U0RC 1Z9OA 5B22A 3UIZA 4Z3FA 5KBMA 3EXLA 3DXAA 1T5XB 4I3GA 4GXUM 1AHKA 3DOIA 5JQ6L 3VW3H 4YDJB 4XP6H 2X44D 3WIIL 1PZSA 3D30A 4O02H 2YJLA 4D94A 4PWJA 5EEWA 1AGBA 4ZPVB 2MCPH 2FSEB 2NXYB 4X7CC 4XOCA 1PQZB 4L8BA 4NKDA 3TBTA 1YJDL 5CWSB 2L8AA 3A67L 2AQTA 2HFEA 4DJMA 1P7KA 4NZJA 4U1IB 4X8XA 4F92B 4G8GE 2HFGL 1H5BC 2AMGA 2EDRA 4X4MA 2C3VA 1ESOA 3DV4B 3S88L 3MNMA 4OF3A 1Y07A 5KEZA 1GGUA 5DZLA 4Z7IA 4DCQA 2Y22A 1YN6B 3HFFA 4HGMA 4HZLB 2NY6C 2BM3A 4KTEL 4OJCA 3BIBX 2WVUA 3D0LB 3ES6A 4OZHF 1JI2A 4N0RA 4GMTH 3LRLA 4JFOA 1QFWH 5IFHL 3BEVA 4YPGB 3SDAB 3FHQA 3TF4A 2J71A 5E5LA 1WBZA 1WISA 4P2QB 4J3OD 2PYEE 1TQVA 4LDEB 3S8FB 1G87A 1S7QA 4Q6IC 3FZUD 2C1OB 3QCVH 4EDXB 3CLWA 4AYDC 1S9WA 4Y2DB 1WAPA 3OAWA 3BGMB 4XMKH 3B2MA 4FQLL 4NSKB 3PV6B 2AJXH 2B3RA 2P1YA 4YHKL 1XVSA 2P80A 4GRLD 5SWSB 3EFFA 4FC3E 4PJFB 4HWNA 1YAZA 3D5OF 4IBTA 4N1EA 2COQA 2XY2A 3PLYA 1KTDB 3LKPA 1XGUB 2QFRA 3SZ6A 3IFPA 5J3HD 2ZZUT 3VFTA 4ESKA 4XHJC 2VAJA 3KYOA 2YLKA 3AG1B 5KVGL 2OMZA 3HR5A 3QQDB 5DURB 5TTRA 3VD3A 1MW0A 3IJ7A 3F65A 4MAYA 2Z4QB 4YE0A 3C5XA 3BD5A 3TIDA 4P48A 1I8KB 4ODHL 2J44A 3V4UL 2WQXA 1CT8B 2X12A 3MODL 3QIBD 2DAVA 4HCGA 4OH2A 4XXWC 3RTQC 3B6SB 1I75A 4I0PA 4TLSA 1UM6H 2WBJC 3O11B 2GJZA 2BP5M 2Z8WC 2X4TA 1BOGA 4H8UA 4R90L 1K8DA 4WI3A 4YLCA 1KPRA 5MERB 1OGTA 4TVPD 5SV3A 2VDQL 2MQ0A 5E08L 4K3JL 2FUTA 1BFSA 2QSCL 1ZJBA 1AANA 4JRXB 3S5YA 1EMTL 3DHUA 1A3ZA 4LDOB 4B3VA 1CWVA 5D1XB 5KYUA 1S9VB 1NEZG 2GTWA 2PW1A 3B9AA 1HJBC 2VQ1B 1OVZA 4RNRA 4NNXB 3O6MH 3QISA 2Q7NA 5ESAA 1OK0A 1NGYB 3L2NA 5KS9E 1JWSA 4P2OD 1KJ3L 1CK0H 4N2GA 3ARRA 2B20A 2YBRB 4HS8L 2HVBA 4I18C 4OGZA 2W80C 2P46B 5DQJB 5E94B 1A6WH 3BCDA 3R8BB 4RFEA 5MEND 4JHAL 2YAOA 2PCPB 5CLTA 3MV7A 1S46A 3UO1H 3EO0B 2CALA 2VWEE 4NN6C 4M4RA 4QRFA 1HH6B 1TQSA 1HILA 1N18A 5GRXG 4NS0A 1IAKB 3AXIA 1E67A 5B3SB 4JZJC 1B4TA 4JKKA 4QTHB 2F1EA 4NNYB 4AUUA 2CBMA 4P46D 2YRPA 3KPTA 2XDHA 2YN3A 3W2DL 3ARDA 4D0CB 3VWJA 3AUVA 4I48B 2RGSA 5D6DA 4EXPX 3UZQA 1R3HB 2GAZA 3C9NA 3F64A 4C4BA 2ZOTA 1RVFH 4HUUB 3PUUA 3SE9H 2PP9A 4GEIA 2FT6A 3Q9PA 1S7WB 2Z3FA 4G7YH 3G9AB 4HSAC 4GRMA 2WXLA 1YN7A 4NCC2 5ALCL 5F7WC 3T77A 3ZHFA 4AYEC 1Z6JT 1ODUA 5E8OB 3NIGE 2OQJA 1MG3C 3ROLA 3VD1A 5E2JA 1UZ8A 4Z78B 4NO5A 1F90H 4PBWD 3S96A 2AK4A 2C3WA 3CN1A 5E4IA 3CFMA 4QHPA 5K33A 1OP4A 1OTSD 4J8RB 3R4RA 2ZXQA 4OJYA 5EDXA 4KK5D 3TBSB 2WM0A 4G7QB 2DW5A 2FWUA 5HJBA 4MA1B 2EXTA 1IGTB 1JGLH 4FZEL 5BVPH 4PUBH 1RZIB 4MNGE 1XCQB 5I1GL 3ULUC 3H3KA 4HA1A 5IF0B 4A66A 1U42A 2PP8A 5LGHL 2EIBA 2AEQL 3EJQA 2OMUB 3HG4A 2F7QA 5FHBL 4BKLA 5BRQA 1I1AD 5AVUB 5B1BB 3HG1B 2HKAA 4CNIA 4OUOA 4FYTA 1T2QL 5EZJB 1FPTL 2Q10A 4TTDC 2NUTA 4PP1D 2BOCA 1MH5B 2EDMA 1RERA 2IGFH 2AZUA 3T6WA 2ESVB 3MRIB 4U0QB 2YUWA 3MYJB 1EFQA 4XPAL 1XH3B 2G75B 1HIMH 2RH0A 4FI6A 2Y4SA 3HI6L 4TYUA 2VABB 4TXVB 1QLFA 2KUTA 5K93A 4WV1B 1RP8A 3UG5A 4Z3HA 3U1SH 1UM5H 1F1GA 4OD2B 5F3FA 1Q0EA 3WNJA 4KK9C 2X4NA 1RZKH 4DGUA 1NPUA 5DUPL 2PCYA 4IKNA 3QIUA 3REWB 2Q8AL 5LWYL 2EC9U 1FL5A 3LD8B 3D18B 2DJSA 4JFYA 3D69B 1ZLSH 3F12A 1YEEH 2JB5L 2ZYSA 5AZEL 5TE7H 3SCMB 4Z3JA 3U82B 1WF5A 4FCHA 3EDEA 2NY6D 3L2LA 1AD0A 4GI9A 1QO3B 4IKKA 1X4ZA 2KC0A 3N43F 1L7TL 3LKQB 4W9EC 1MI5A 5EA0H 3I6KB 3IXTB 4KQ3L 3LDBB 1CTOA 1DUYA 1N64H 2X3BA 4FMVA 4WJKB 4TULH 2QSTA 3HHRB 1IKFH 1QNZL 3BXNA 4QY8A 5ITFA 1EHNA 1IEAB 1JVOA 4UINH 4AYID 3ARFC 1FZJB 4ANKA 4OZHE 1DQQB 4MJIE 3BWZA 1WFJA 1TFHA 4B9CA 4GRWF 4HV8A 4KDTC 1EUUA 3JZYA 4AITA 5I30H 3GMMB 3DVNB 1AMXA 2ZOOA 5D7IB 3WO3B 3O6FA 4XHJD 1KXTB 5J6GA 1H3PL 4MD5B 3GZQA 3QR0A 2R0ZL 3IJEA 4Z7VF 3KWWB 3QHFH 1GZPB 4PJ9B 2FYYA 2G2NA 1HSBA 4XMPL 1ORQA 1LD9B 5DUMH 2ZXBA 4XPFL 2Q8BL 5JUEL 1IEBB 1ZSHA 5CILH 5DJXB 4N8VG 5JQIB 3RTQD 2H32B 3G04B 4NQDA 1UQSA 2NRDA 3BH8A 4HIHB 2WBJD 2W0KA 3CD4A 4HGKC 3PNRB 4FQ1H 3NZUA 5DJ6A 1DANU 4QTFA 4J8QA 4JFVA 4UF7C 4YK4C 1FH5L 4JY6A 4R7NA 4PHXA 1NCDH 3GHPA 1GA2A 2VDNL 4CBZA 3HNVH 1AC0A 4LLDB 2NY3C 4PJGB 3HBPA 3FCBA 5F1NB 1NZRA 3P4OA 4MLSA 4UI2A 2NZ1A 5C2BH 4PJGF 2QELA 1CGYA 4YDMA 3V0JA 2IIJA 4OJFH 3VD9A 5DD6B 2FIKB 2APFA 2ICWA 5D8JH 3GMQA 3N5AA 2XKNB 2WB1A 3U1PA 1EJFA 3LYRA 3ULUL 2UZXA 1SF3A 5EBMB 3TT3H 2XYCA 2FO4A 2P9RA 4H1LG 2E7HA 2EYTA 4WW1B 1I8LC 4ZMZA 4F7CA 4MD4B 4ZUTA 4X9IA 4S1SH 1KCKA 2DH3A 2XN9B 1CFTB 4X7SH 4LMQE 1QHQA 3EUDA 1X3DA 3SBWC 1MUJB 1UG9A 2IFGA 4LPTA 5KVDL 4KITB 3OKYA 1FNSH 1I3UA 4U3SB 1IILE 3DSFL 4KC3B 4NUGH 3VTTA 2E59A 1KCRH 4K94H 4Y4HC 5FB8B 3FUEA 4XVSH 5DMIL 3RFRA 1DEDA 1E9OB 4FQXC 2J8UB 4N2KA 5LGKA 3QEHB 1DN0A 5D72L 2X42A 3WTYA 1RZQA 2NYYC 4KRMB 2A74A 2H3NA 2R2BB 4DOHE 2WXNA 2EDQA 4D8OA 3CBKB 1YECH 3JVGA 5AW9B 3V7AE 2AK1L 5DWPA 2NR6A 2OX5B 2QMKA 3ILEA 3R06A 4GNKB 4HCRA 1SJVA 3PP3K 4Q97A 2OZ4L 3CLEL 5HVHC 1FVDA 1Q4NX 2K6WA 1OP5H 4L5FL 2APSA 1XTLA 2IV9A 1M57B 3BFOA 3RY4A 4K9EC 3B9DA 4WUUE 5DLLA 3CK0H 2F19L 4JPQA 5HJDA 5F7HA 3T6XA 5FUOL 3VXRD 4EJ1C 5ECJE 1IBGH 2AJUL 4R0LB 3BSHA 2DMCA 2NUPB 3NACL 3PQYE 1MCSA 5DS2A 3PWVA 5HDLA 3ZDYF 1OAJA 1CD1A 4X4YA 3ULUD 2N3JA 3LZFL 2C9RA 2FRGP 5E2WH 3TO4A 4NQVA 1ORSB 4NQXA 4OQTA 3QO1B 5HYEA 1CF8L 4FFYL 4KKRA 4ODBD 5GGVL 1WBYB 3CUPA 1H6TA 4FEMA 4PJAB 5I74B 2EDLA 5AAWC 3VRIA 4AJ0A 3VWKC 1R3IH 2Q6WA 2QR0A 1EAPB 4TTDD 3QNYA 1BSIA 1RULH 4ZUSA 3TCLA 1X5HA 3MRNB 2R56H 2I9TA 4TPRH 3O2WL 3LCYA 4YSTA 1MQKH 4OLUL 4LQFL 1XAUA 4KI5F 5ISZB 2WLYA 2IWGA 4GP8B 4OV5A 1RJLA 4B9JA 3IPFA 3KEHA 1YQVH 4NQEA 1R3LB 2CCLA 4OF8A 3ZT6A 2EABA 5AW7B 4Y5XA<