1YRKA

The c2 domain of pkc<delta> is a new phospho-tyrosine binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
GSHMAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, delta type
publication title The C2 domain of PKCdelta is a phosphotyrosine binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1yrkA00
3QARA 3OAWA 2WXOA 5KJ7E 1TJXA 2CHXA 4KZ0A 4ANUA 2CM5A 2K8MA 2WXPA 4L2YA 2CHDA 4AJWA 3QR0A 2RD0A 4KZCA 3FDWA 5JHBA 5CCHE 3DBSA 1DJHA 4NPKA 2CJTA 4FHJA 4FA6A 4L1LA 4F93B 2WXJA 3IBEA 2ISDA 3ZIMA 4FULA 1DJXA 2WXFA 3QK0A 2DMGA 1CJYA 3HHMA 2R83A 2CJSA 1RH8A 3RDJA 2Q3XA 4GNKB 4PS3A 3S2AA 3ZVVA 4HVBA 3L13A 4G11A 1DJZA 4FJZA 3RPBA 4F91B 2LHAA 3APFA 3PREA 3ML8A 2FJUB 3ML9A 3L4CA 4GB9A 1DJIA 4QAMB 4BFRA 3NZUA 3KWUA 3W57A 2DMHA 1K5WA 3QJZA 5CCGE 5G55A 1E8ZA 1HE8A 1W16A 2B3RA 4EZKA 2WXMA 4L1BA 4PS7A 2BWQA 3F04A 3M7FB 3L08A 2NCEA 3NZSA 3SD5A 4WEEA 1BCIA 1E7UA 2NSQA 1WFJA 2WXQA 4V11A 4IQHA 3R7RA 2JQZA 2YRBA 1DJGA 3OHMB 4WWOA 1DSYA 2K3HA 3PFQA 2NQ3A 1YRKA 2WXLA 4ANXA 2D8KA 3P2BA 4NPJA 2WXGA 3MJWA 1E8YA 5CCJA 3CSFA 1UOVA 3APCA 2ENPA 4ICXA 1E7VA 2EP6A 4PS8A 3N5AA 5H4YA 3IM1A 3JZYA 3GPEA 4NP9A 3KWTA 3ZW3A 4LCVA 1QATA 3L9BA 4WWPA 1DJYA 4FHKA 5G2NA 1UOWA 4TV3A 3TL5A 4F1SA 1E8XA 4Y1SA 3NSJA 4BGDA 4KITB 5JHAA 2FK9A 3DPDA 2CHWA 2X38A 4NS0A 1WFMA 1BYNA 2WXRA 2N1TE 2K4AA 4DNLA 1TJMA 2YOAA 4FADA 1W15A 3CSTA 4F92B 1RLWA 2WXNA 2A4ZA 1RSYA 2V4LA 1BDYA 3HN8A 3L17A 5T8IA 3PRZA 4WWNA 3TJPA 1E8WA 4QJ3B 4XE0A 2K45A 4HLEA 1A25A 4Y1TA 1E90A 2WXIA 2ZKMX 2Q0ZX 2ENJA 3TWYA 2CM6A 2UZPA 4OVVA 5H4ZA 1QASA 2A5UA 3F05A 3FBKA 2Y3AA 4L23A 4XZ4A 1DQVA 2CHZA 3R7QA 4A55A 2WXKA 3ENEA 5EDSA 4AOFA 3PYCA 4JPSA 3F00A 3HIZA 2QZ5A 4LDCA 4EZJA 4LT7A 2ENQA 1UGKA 4IHBA 4FJYA 3PS6A 4QJ5B 3APDA 4WAFA 4OVUA 4QJ4B 2WXHA 3QR1A 3L54A 2Z0UA 4ICWA 4ANWA 2QZQA 4URKA 4ANVA 2KI6A 4FLHA 3W56A 3F01A 1V27A 4MJJA 4EZLA 1GMIA 4XX5A 4J6IA 4TS6A 3T8MA 1DJWA 3L16A 3LJ3A 3QAQA 4DK5A 4TUUA 3B7YA
chains in the Genus database with same CATH superfamily
3IFPB 2D9QB 3BZFB 1I7UA 2R9HC 3RILA 2XZZA 1U6AL 3LNDA 2W94A 4X6DE 3C2SA 3GYRA 4JBSA 4QRAA 3NABH 1FSKB 1BXAA 3PWPD 2CLRB 2PWDA 4PJXF 3VXQB 1JZGA 2L8AA 1FL6A 3QRGH 4NFBA 5DA0B 1DVFA 3C60B 4ENED 1EO8H 1EERB 1PF3A 4EUPB 5DJ6B 3AM8C 5I1LB 2PW2A 1C16B 3C2AL 4LE8A 2YO3A 1W6WA 3EHBC 3QI9D 1S9VA 4PY8I 2J3SA 5B1JC 3V4LA 2DMGA 3DX3A 3OAZK 1OO2A 2D7PA 3NDYE 4K8RC 1S7XA 3RB5A 5BW7A 3CVBA 2IGLA 1OM3L 1GRWA 3B7TA 4F7EA 7FABL 3RWFB 4R7NA 1U8OA 2NPLX 1MRFL 1J9QA 3FMGH 3JUYA 1CFVL 4NBZB 4WZ9A 5F8QC 2Q7AA 3ETTA 1KJ2A 1CTNA 4KQ3H 2XWJB 2JQAA 4PPTA 2WWOA 2RQEA 2A9ML 2K7PA 1NAMH 1HZHH 1HAUA 4KOCA 5DMKA 1ZT4B 4D0DB 4N0UA 1UGNA 3BXNA 2OLDA 4AQEA 4AYFA 2IH9A 3BD5A 3FU5A 4XVOA 1TYJA 5KOMC 4L3FA 4AZ8B 3WAJA 1FHNA 4G7VH 1B9ZA 3KPSD 5FKPB 5HHNB 5T3XL 3MLVL 3UTZB 2F9BT 2WQWA 5DVLA 1J0YA 2VLJB 3L2MA 4FYSA 1X4YA 2LAGB 3AWGA 1P4LA 4IKLA 4F7MB 1KEGL 1W72H 5TD4A 2VLKE 1UZ8B 4IHOB 1SJHA 5AVZB 5KSBA 1QHPA 4YSAA 3ZTDC 2NY4C 3T0ED 1D5XA 4B5ZA 3DPDA 1T1XA 1YSOA 3G6AA 5CM1A 2OMNA 2LU5A 4I4WA 5AZ2L 3OKLA 4DKDC 2I69A 4FQ1L 2APXA 1RJYB 2PXYB 4IBQA 5T5FA 1XF2A 1E65A 2EIZB 3F5WA 1CDCA 1E0OB 4H20L 2X4TB 4RNRA 2F5AH 1Q9WA 2EKJA 2B59A 2GFBA 2FH6A 4GXFA 3I6SA 3VGFA 3WTUA 2AK4D 2W9EL 3DYOA 2ZP9A 4TKWA 1HEZB 1QWHA 5EZIH 5J6SA 3W82A 3WFEH 2E7CA 1ZPLA 4MMZA 1AQHA 2FATH 1DP0A 2DEXX 3L4XA 2WQUA 5DZVA 4OV5B 3S35X 4OCSH 1IIIA 4GO8A 3FCTB 2R15A 1FAIL 3Q1SH 4M7KH 2R8SL 1MFMA 1I9IL 5ISZB 1IEHA 4FEMA 1LJMA 3L3OC 3LZFL 2VDPL 2KI6A 2CK0H 2IH1B 2G9HA 3BKYL 3W81A 1XD0A 5LLIC 3ATEA 2ERJB 5IHWA 3WY1A 4EQ2A 3SN6N 5BVJA 2YWZA 4G6ML 4MS8D 1FZJB 1R19A 4R97B 5DURB 5DK3A 5GJSH 4J28A 3ZDXB 5JHBA 1LK2B 3FQRB 3GS7A 2ZKWA 1QQDA 2OJ1A 2V7NB 3LVTA 2OV0A 3X1GA 1F3DH 1M7DA 2UV3A 4LBAA 5KVDL 4DAGH 1OM9A 2O6EA 3MRGA 3T0EE 5BNXD 4HUMB 2L04A 5I75C 3CJJA 1MEXL 4YDJB 3T4YB 5MP6L 2JCCE 1P7BA 1U8JB 1L9RA 1VFBA 3WY4A 1N18A 1WFIA 1EAQA 1PZ5B 4HJJH 4JDVA 2D3NA 1ORSB 4ORGB 5SWSB 1NCHA 1M7UA 3U1SL 4ZPTB 3D2TA 4AEHL 2ADFH 4QHKI 4G8EA 1TNNA 1CYGA 1ZJBA 3UZEA 4YVNA 4KZDH 4O2EB 4ABQA 1F11A 4WEBL 4LSQL 5FHBL 4NIYE 5SX5K 5C0EB 1QAWA 5CMAA 3QVAA 3GBNL 2A6DB 4R6UA 4WUKH 3NA9L 2VC2L 4G8FB 3AXIA 4NDMB 3TH2T 1XQ4A 1OF0A 1IGTA 4U7MA 1DSYA 3U4KA 3GSVA 1K2DA 1USZA 3MOBL 5AENA 2A0LC 2JV6A 4P2YA 1N64H 3HHSA 1Z3RA 5TGBA 3D6GA 1H5BB 3IB4A 3QIBB 1AJ7H 1U8PA 1QLFA 2X70A 4MDIB 4HMDA 4M6OL 1G1OA 3VQMA 1FGVH 2K6WA 1H3TA 4HUKB 5ESAB 3UL4A 4MJIE 3OSKA 1SY6A 2JTYA 3I9IA 4LK4A 1WPCA 2ZOLB 4MA7H 4OF6A 5D70L 1BM3L 1F41A 5F7AA 3J2PA 1KSRA 9PCYA 1RLWA 2VKWA 1WF5A 2V7HB 2WLLA 5DJ8B 5HJDA 3B5GA 3IDYC 1EEYB 4PRDB 2V2TA 1YUHA 1VGEH 1IIKA 3APMA 4AC4A 3QWRD 2E8ZA 4U1HB 2VYRE 1R46A 3BWUC 5IG7B 1RZJH 5D2LE 4OM1L 1MHPH 4DVBA 2ZWNA 1QPXA 2X2HA 4AVIA 1A6ZA 1S46A 4JFFD 3T0BA 5T1JA 4HHAB 1FIGH 4OVUA 5I1AB 3MA7B 1BZEA 5IOPA 1KJ2H 5CD3A 3PL6D 1AQDB 2WKGA 2XN9A 4UTCA 4W9LC 2ZUYA 3D0VA 2WANA 2B3IA 3KVPA 2YXMA 4D7PA 5EU7E 5KYYB 3WKQA 4L2YA 5CXPA 2FJHB 2CA4A 1RIHH 1EMTH 2ADIA 5IFJB 2WVVA 2X7LA 1KBBA 1CI5A 3UTTB 1EIBA 3AC0A 2BCMA 2G30A 2ZYSA 3TU6A 2OFQA 3QJUB 4PUBH 4AITA 2E75C 3GB7A 1G6RH 3T8VA 4KH2A 2K78A 5E6IC 4ZFFB 4OJDH 1X6NA 4U3SA 5E2TL 2UZXB 1D6EB 1IILE 4PV9B 4CMMB 3UX9B 2Q3ZA 3KJ4C 4HUXA 4UB0H 1BIIA 4IKKA 4O02H 4E9SA 4A2GA 5CEXB 3QFJB 4LVOB 1T04B 4JO1L 5LDSA 1OGTA 2H6PA 3DYPA 5KUKA 2Y22A 4GMTH 4RESB 1BWWA 4ADJA 4GH7B 1S7TB 4BH8B 4LFHG 3UGUA 4Z7WB 4KXDA 2X4OA 3A6CL 4XMKH 3IJYB 4P9HC 5BS0B 3H0TA 5DR5H 3HLAA 5EG6C 3SE3C 3RVTC 5DLML 1A7OL 2EH7H 3D1MC 3VD5A 3HFFA 1CG9A 4DO4A 4JG1L 4FD0A 5EOQH 1JHKH 4Y5YB 5E2UL 6CGTA 3IDNB 4R3SB 4K7FA 1SXNA 4WU7A 3VM5A 1H8SA 4PRPB 1I1YA 4XBGB 2V0AA 3MJWA 1JIBA 2HP4A 3GUTB 3D9AH 2BSED 3EGDB 4H40A 5D7LB 3D39D 1S78D 3LSOA 1P9MA 3D05A 3SJVA 1UA6L 4WW2C 4FQJL 5HHPB 4FABH 3NACH 1B0RA 4MNGE 4UNUA 4H13C 3GSNH 4LF3A 2QGDA 4RISH 2WYTA 5DD0L 1IGFL 5IESH 1BV8A 2GBUA 3CLEL 2H5UA 1XMEB 4LLDB 1WQVT 3L4ZA 4KO7A 1YEFH 4NENB 5EO0B 2VLKA 4NC1C 5J6GB 5E4EB 2GTWA 1P7KA 1PD0A 4HK3N 2A74B 4PBXA 5AB0A 5M95B 1TVHB 4TLTA 4IDJL 2YRZA 4L1SA 5E6ZA 2NNAA 4HC1H 3O4OC 3TIDA 2P8PB 4Y1AB 4FNLH 1MH5B 4X6EB 1HHJA 1SLUA 4LSTL 3W39B 1KY7A 3MNWB 4Z77A 2H8PA 2WINB 1Z9MA 3O6MH 4QHLA 5ESVA 4ICWA 4QEGA 3DK0A 5D1ZC 3ZTEA 4NQXA 2WP3T 3WLWC 4D3CL 3AMLA 1GMIA 4CSTA 2JJWA 2VXVL 1OSYA 3KVQA 2BWDA 3HMXA 4FCHA 3QA3A 3BEWB 5F7YC 3LKNA 3F83A 1G9HA 3RWCB 1KJ3L 3BAXA 3ZE0B 4DP5X 2BY3A 3LRKA 1XT5A 4LSPH 4MKMA 4HUVB 2KH2B 5MHSE 5J1TC 1WH0A 2OR9L 5A3ID 4M48H 4JPQA 4K23L 1OQOA 4I77H 3GNML 2V2XB 3KPMB 4OZGF 1O0VA 1E5BA 1UT9A 1PNDA 3P9MB 4X9YA 4LCYA 5CLZA 4A6YA 4BK5A 1X3DA 3P0VL 4A7UA 2JELH 1U95A 4WWKA 3QXWA 5D4HA 4DN4H 1SOKA 5AG8A 2APSA 1HDMB 3HN3A 4FFVD 2IQAA 4OQTA 5EUKA 4JRYE 1NPNA 3OXSA 4P46C 2YLKA 1BQ5A 1D5IH 2AEOA 4G11A 3IU3A 3GO1L 3TO2A 4NJ9L 5EOTB 2CUMA 2WV3A 5I18L 1YN6A 1NGYB 2OK0L 4EMZA 2LU4A 2JCCA 3QDHA 1F4XH 2BK8A 4JM2B 2GSGB 3EO0B 3K81A 5C0BB 1A7QH 3MRIB 4HF5H 1NCCH 1S5IL 3RWHA 4K3JH 4Z7OB 4ADIA 2EKSB 3LXBA 2P5WB 3WFDL 4JFHE 5I9QC 5F1IA 4KKAC 1JZ7A 1IEAB 1UJ3B 3C6LB 4NNYB 1JVLA 3TM6A 5T33L 3HFML 4S1SL 4AQAA 1QA9A 4HHGA 3X1EA 4K73A 4FXKC 1HVXA 1OSEA 4Y0GA 5TDNA 3OZKA 3POCA 4ERSH 1IC5H 3ZE1B 1FL3B 4UT7H 3WG7B 4GXVH 4WY7L 2VZUA 1JZ8A 5EWIH 4AJYV 4EVNB 3HUJF 1LO4H 3HG2A 4QXGH 3V0HA 4HU2A 1CDIA 2NY5L 4FQCL 2ZJSL 2XTJC 4JPKH 4M7JL 2A73B 5L6YL 3TXAA 1CXHA 4HG4J 1GHFL 4M3HA 4Y5VC 3X2QB 3LMJH 4ODVL 1UYWH 2EO7A 3GMLA 4GT7A 3VFUB 4AWJC 3H8NA 3V0AC 5JQIB 4JFEE 1QLEL 1M2VB 1WFOA 2ZWSA 1EDYA 3A4AA 5I16B 4KVCH 2GW5A 4ZK8A 1EJ6A 2YRLA 3C8DA 3TJPA 1K8IA 1QVOB 5F21B 4BM7A 3W1ZA 3O8XD 1JZFA 4MJIA 1A6WL 3HS8A 4X6CB 3G5XB 4E42B 2BINA 4Z7NB 1J18A 2LVCA 4F80A 2PR4H 1ETJA 5T3XE 4PSRA 2CJ3A 3VFOA 4DKFH 2XKUA 2KERA 4ALAC 1C8QA 1FV1B 1GL4B 4QTFA 3LS4L 4NUJB 3ALWA 3NEXA 3SO3C 1C1EH 4AYDC 2KPWA 3SYOA 2E9IA 1VEOA 3U36B 2IVFC 4Q8BA 4BZ2H 1RJZA 4FXGA 5CKAA 4M93C 2X4RA 3DDFA 2XWTA 1R3LB 4R0LC 5D2LA 5HD8C 4LCCB 5ID1B 2CBPA 2XKNB 4KI1A 3BVVA 3LS5L 2EVGA 1U58B 3S6CA 4KDTA 1ZDSA 2NY7H 1OCWL 5I0YA 1HILA 1JWMA 2AJSL 1ND0A 3IU4H 5DVNA 5CEYA 3NP4A 3KCPB 2VDLB 1BBDL 2Y7QB 4LSUL 5I1CH 3RGVB 3FJTA 4LHUG 5LCVH 3RKDC 3IWUA 5KSVA 1PBYA 3MQIA 2NMSA 2G5BB 2XZAH 4OLZH 5JNYA 2FIRT 3HI6H 4KTYA 3ZKSD 4DTGL 4LKXA 2B0SL 3TH4T 4Y4HB 1R6VA 3JWDH 1JZ6A 2MQCA 2R27A 5HYSB 5K9JL 5AALA 3X14B 3O9WC 3NZ8B 1D7CA 1E2ZA 4TOYL 2YD9A 3SDDA 1CICB 3VFTB 3VB8A 3NCMA 1AZVA 5CN1A 2P49B 4GRMA 4APQB 1S7SB 3ARFD 2ZPKL 1URLA 3PP4H 1I7TA 2Q76B 2D7OA 4E9QA 2FNWA 3E0GA 1OSZA 5CINL 5KVDE 1HH6B 2R0WH 1Q4NX 3EGSA 2DLGA 1Y0LB 4GY4A 4A7GA 3BZEA 1Z9SA 4UUJB 4HT1L 1K4CA 1YNTA 3OMIB 3QORA 3QUXC 3MV7B 4I48B 3A22A 4EI5D 5ITFA 1ACZA 4A38A 4IBZA 1FVEB 4IIQC 3HMXH 3IE9A 3MXWL 3PJSA 4QCIB 4X4KA 3SO5A 2UZIH 4QMEA 2F8XC 3ZT5A 4I0KA 3OB0K 4IU3A 5SX4I 3G6JE 2BHYA 2IDSA 3LQMA 2R23B 1CLYH 5JOFB 2H9GA 2XOTA 1WFMA 5LWYH 5TE6H 1KTBA 2WUBL 1XD1A 4HFWB 1RZKH 1E27B 1R5VB 3QDGE 4DGYL 1XZWA 5K9KA 2BZDA 1HEJC 2A77H 2PTTA 1U3HA 2XZCL 5B38G 2YK1H 2WN2A 4BA8A 4ZTPH 1SYSB 3NFNA 4KKBC 5D7KE 5FWRA 2EAEA 3DUUA 1HYRC 2P46B 2VDRB 3ARSA 4CU6A 4CC1A 3D3VE 4PJEE 5LGHL 4MNGA 2YBRA 3LDBC 2VDQL 4IOSD 5I0XA 4MAUL 5KYWA 3LQAC 4G6AC 4WIQA 3FT4A 3DX4A 2JNZA 3V6OE 4WAFA 1I7UB 1UXSB 3IJHA 2R1YA 3DK2A 1H0DA 1CLVA 4UNVA 4Y4FA 1E6JH 4WHDA 5EZJA 3DVGA 2NNCA 2AI0L 5JW5A 4KY2A 1FG2A 4PJIB 5JXED 5HYJB 3MRLA 4MSWA 3SE4C 2Y5EA 4MKTA 5EO9A 2FEEL 2F58L 3T77A 1CLCA 3HC3L 4Z7UB 2HJKA 2CMRH 5F1KC 3ULSA 5E1GA 3HPLA 2QQNH 4HX1B 4LGPB 2X0UA 4X4XB 2JWYA 1E42A 4X5LA 1UWGH 1J5OL 4W4OA 3SPCA 4CVUA 1AHWB 5LBSL 2A7BA 1UM6H 2IGTA 3V0WL 4OCYL 2XCMC 3PPEA 1SBSH 3V0IA 2IXQB 1QSEB 5D7IB 1CFMA 5F7KC 2YARA 1ZT7B 1N8ZB 5FLUA 3AADB 4X5XB 2C26A 3MCLL 4F91B 2UX7A 4IRZA 5E99L 5SV4A 4BDVB 3PREA 3VACA 3PQYE 1GZPA 4AQEB 3L3GB 2VERN 2AGJH 2GJJA 3KS0J 1ZWIA 3EYSL 3MLTB 5JO5A 3RZCD 3L1FA 5HVHB 1AXTH 4JRYA 2J55A 5IB4A 3T4AC 2XVGA 1XB3A 1PZ3A 3CFEB 1N6UA 2EIMB 1RUAL 3ROOA 1CZ8H 1BJ8A 1FYTB 4JL1A 5CJXC 4OD3L 4RMSA 2NLJA 1MOEA 1OAKL 3E6FA 4OFYD 5EN2A 5J12C 3S5LG 3VG9C 3ZO0A 3G6AB 2YJQA 5I1DB 3CHPA 4QJ5B 4OZIE 3VCLA 3ZL4L 4TXVB 5LQBH 3FTZA 2QSQA 1A2YA 2CK2A 2J6EA 3MPCA 1YMHA 4PJXE 5KVFE 1XF2B 3BH9A 3L9BA 3WFZA 3DURB 4GUOA 3RL2A 3ZRCC 4QHUB 4RH4A 4W81A 3K4ZA 2NSXA 4EN3A 5C0JB 1ZHNA 1MAJA 4MNQA 3UC0L 4BJLA 2YXVA 3DETC 4M62H 1YEHH 4MMZB 4HFUL 1WCQA 4OIIL 4X9IA 4DVRL 4YPGA 3SDAC 1H8NA 5IQOA 4X5RA 5L4JA 4LVHB 5GRJH 1FFOA 4NO3A 3BKMH 3F6JA 4UT6H 5HYQA 1KFGA 3EBHA 4F1ZA 4XP1L 1DVXA 3CX5J 2ESVD 4NAQA 4JFEA 1AC0A 3CFDA 5HYIA 1CXLA 1JGVH 3VFNB 3Q6FA 5DVMA 2PUQT 5GS1C 1BLIA 2VLMD 5F0MB 2P24A 4TNEA 2ZOWA 3PXJA 3WY3A 4J3BA 2UVEA 1EZUA 2ZX5A 2CNZA 4U4BA 5IUSA 3V5KA 4KKLD 5CGMA 2V33A 3TO4A 1BD2E 2BOCB 5E23A 3HR6A 4BIKA 1RK0A 4NKQB 2ZWKA 5I0DA 4YS4A 3DMMD 1NLDH 2DL2A 5JHLL 4M3JA 4MFHA 1FL5A 1EAOA 2B5IC 4JO3L 5IJVA 4N2IA 1A1OA 3FRUB 3N91A 1BOGA 3DGGB 3AWEA 3RTQC 2C7UB 3NK3A 4IYKA 3OKEB 4YK4C 2IANA 3BSZL 3DUSB 3FOLB 4LCUA 3SPIA 4QTHA 2FSEB 3LV3A 2XX1A 4XMTA 2FO4A 4LOUD 4LDOB 3DUHA 1MCOH 4H2AA 5LUMA 3BPOC 1TSRA 4CL7A 3F85A 5I74B 1UATA 1OAYL 3GIZL 3QJHB 3ZVVA 3LNIA 4JPWL 4DPRA 3D33A 3DDGA 4Q9QL 1Z32X 2D31B 3MCKA 1G7HB 4L37A 3SOBL 2P48B 3DHMA 5D1XC 1LE5B 2I9TB 1GGIL 4TSCL 4HSQA 1J11A 3CVHL 2XIBA 1BLNA 1XAUA 3OPZH 2ZUVA 2CDEA 5KSAD 4TNWF 4UIMA 4B9PA 4EDXB 2OXHB 3HHSB 5IM7A 4FQQA 3QUZB 3U7YH 4PYHA 5DUMH 3O3UN 2OA9A 1GY1A 4YSTA 5E9AA 1SNRA 5AD0B 4F20A 4A39A 3KLAA 1G9NL 4J3UA 3TPKA 1WZKA 2FLMA 1NUFA 3GJEA 3LRLA 2DM2A 3QUKB 2RB8A 1K6QH 3PDOB 4TUJB 4G9DB 4GAGL 5DJXA 1V7MH 3ZZSA 2HB0A 5J4MA 3MRJB 2HTKD 4HK3J 5IVXB 3WNPA 1PLCA 1LNUA 1CXEA 4JZJA 1TXKA 3REWA 3W0WD 2VMJA 5HJ3B 1TJIH 4MJ5B 2JKSA 4JREB 3ARGD 3IDGB 1N6QL 4RFOL 1UD3A 4GUCA 4ZO8A 3G6JA 5AG9A 4NRXA 4OVVA 3T0DA 1RFDL 3KYOA 5PCYA 5E8PB 3GLAA 1AO7D 3PXLA 4N0RA 3I6LE 4ZAKC 4UM9B 2D7TL 3DRQA 1OTSC 3MRPB 1GGCL 1U8NA 3QDGA 3RIAF 1N0LA 2OCCB 4UQ2B 3LTVA 1JK9B 4LLMB 4Z18A 1H15A 1O75A 4UOW0 4WFFD 4GUQA 2X9ZA 1XBRA 4KDWA 3CMOH 5BV7L 3DXAD 3RURA 3FTGA 4AUYA 1G5GA 1ADWA 1U36A 3LB6D 1NIFA 4JM4H 1S5HB 3D3VA 4LXFA 4RZCA 4L8SA 4YFLI 3NH7L 1YJDL 3BSHA 3KXFB 4M43L 4MAYC 5JW4Q 2ITDB 3Q8AA 4L9LA 4YDVA 3V6OA 3SGJC 1YEWA 1T7YA 1UM5L 1AOZA 1TITA 1KYOK 2VMEA 4H1LG 4X6DB 3VWKC 1ACYL 4Y16D 1T1ZA 4NQCA 1JYXA 3QQXA 2RFXA 1SVCP 1TU2B 2L0DA 1EEQA 4PB0H 1FAKT 3LKQA 3HRZB 3KH3A 2F7IA 4U1JA 2JJSA 4GSXA 3A21A 5EOCH 1PZCA 5KN5A 2H2SD 2Z91B 3G04A 4QT5A 4MRCA 4N2OA 3WTSA 2QSVA 3VXTB 4AIXA 1E50A 5KZCB 1XAKA 4IM8A 4N0YL 4E2OA 4NWUH 1N4XH 2N7SA 1ZDQA 2X4UA 3CXDH 4QF1B 4ACPA 3OGCA 1ZS2A 3LXAA 1FNEA 2A1WL 3MGTB 1SMOA 5CN2A 1D7FA 1L7IH 2MOGA 3IMWA 4HGMA 2D0GA 4ZX4A 3GKZA 3O45A 4EUPH 5DYFA 4K7FB 4HEME 4N8VA 4YQXH 1E4XL 1AZBA 4Y2LA 2VUYA 5MEPB 3FQUA 5GZOA 3VQLA 1TTUA 4MQTB 4WSJA 1WA0X 3H7BA 1QSZA 1XF4B 3PQYA 2Z31B 4G70B 4MDRA 4QHMA 1ZTXE 4F8NA 4KX7A 2DIAA 4DSYA 1B0RB 1F90L 4IJ3C 4LF3B 1P7QB 4U6VH 5EF0A 4F2ME 2LQRA 4WO4C 3SSGA 2YPKA 3S7GA 4YXHL 3DO7B 3G08B 1TUPA 5F7LB 2Y4SA 5EO1B 1GS7A 3MLZL 4XNXL 4MMXB 5JPNB 4R26H 5IIEA 5C0IA 1A9EB 5F9OL 4X4ME 4PJ9C 1T83A 2GEQA 4EOWL 1UASA 4DUVA 1AIFB 1Z9NA 1P0SE 4PJXA 2ZOKA 3A4FA 1QFWM 3QI9B 1KNOA 3KJ6L 4X98A 2QDVA 3ARDB 4S0SD 1TZOA 1WT5A 1HXMA 2XG4B 2YD8A 3G9AB 5CJ5A 3B6SA 2EXSA 4KUCD 1T6VN 1MF2L 3K1DA 5L9DL 4K3EL 4O5LH 5CZVH 4NKOA 3VH8G 3QA3B 3ALXA 4Q6YA 3LKNB 4JKWA 4ES8A 1HFUA 4JGJA 2DWTA 5HI3D 2MPVA 4FI7A 4UQ3B 1EGJA 3X13B 1GSKA 4MMYA 3JTTA 4URKA 5B7FA 2XWEA 4FKHA 1DQKA 3UCQA 2HMIC 1A0QL 1ZLUH 3LHPH 4PHXA 1T0MA 2VM4A 1UD8A 3E3QE 3FT2A 5FA4A 1F3JB 3ULUH 3EFFA 4PGDA 4JRXA 1VEPA 1ZVYA 3T0XA 2OS7A 3BZDA 1FVCA 2Q8AL 3O3BA 5C7ZA 5H37A 4G6FD 3GPSA 4DQOH 5EUKB 1BD2A 1I8AA 4K71C 1SN0A 3IBEA 3LHAA 4I5BB 3OMNB 3TO2B 3QC6X 3HCVA 3HS9A 4B9YA 3S37L 1A7BA 3T0EB 3HI5L 3FUDA 2JCCB 4Y2NA 4ZTEA 5BRZA 1ZSDA 1KWKA 1L9TA 4J6RL 3QNYA 2XWXA 5DRNB 3UYPB 3RWHB 2G2PA 4K8RL 4MYWB 3DROA 4JFZL 2AK4B 4XC1H 3V2AR 3RWJB 3FONB 1SLWA 3SQRA 1QHOA 2PKDA 1IKNC 1ZSHA 4LSVL 4NZFA 1RIUL 2JIXA 4WHYG 1QA9B 4GRLD 3CN3A 1A4KB 1OCZB 1T5WA 5M7QA 1OF2B 3L08A 3NZSA 1J0HA 3UBHA 4OIFA 2VUKA 5HY9B 3MRNB 3CDZB 4JUSA 4MXVE 4BSWB 3TVMD 4FFWC 4I7ZC 5C0RH 1SJVA 4O9HL 4AG4L 3LN5A 1GYUA 4NPYA 5HDRA 1HESA 3HG4A 3O2DL 2YGNA 4D9LL 3J07A 3QJOA 1BQLL 1EXGA 2VCOA 4BQ9A 2XA8H 1K8IB 3W37A 4R90L 3LEXB 4HJUA 4OZGE 4MA3B 3U30C 4JO4H 3TJHC 3RFRA 3K5RA 1Y1DA 2GT9A 4L8DB 5DWPA 5MERB 2VZ1A 1SDAB 3BOVA 1KIQB 2XKSA 5FOBA 2WLNA 1RVFL 5F3BA 2GG1A 4XBMA 3IRZA 2Q86B 3FO2B 3HG0A 5EFIA 3O3DB 4RMVA 4N5EC 1RZIB 1OGAD 2EXWC 6FABH 1BPLB 3ME0B 3HC4H 3GBML 4AQ1A 4AMWA 3ECWA 3MO1A 3GXMA 4Y7MA 3GSXB 4XMLH 2LR4A 1MFNA 4OLVL 1DE4B 1X5HA 2JKTM 2X3BA 1AHKA 1UXMA 1V8HA 1NFKA 3APNA 5EU4B 1U4FA 3J7HA 5E8EB 2WM0A 4Y89A 4ANWA 3BW9A 3MV01 2COQA 2QQKL 5IROD 3VXNB 1KCUL 4N2CA 1ND0B 2AZUA 4LCUB 4GSDL 1FO0B 2OTUB 5FO8B 1X7TA 1PY0A 2G3ZA 4QXVA 3COOA 5HHOD 5D1QE 5EIIA 2YAQA 1MRDH 3CSYA 1WE5A 3HUJE 1I3RA 4MB1A 5JNYB 3UTQA 1ZIAA 1DQLL 1KN4H 1F58H 2NR6A 2R2BA 4IMLA 1YMMD 3ZXAC 3FQYA 3SGKC 3ERXA 5INCA 1KJVA 4XNZB 2NOYA 2BNQE 1IZKA 3LH8A 2N3JA 5E8NB 2XJKA 4M7ZC 4KBPA 3SE6A 4G8GE 2EEAA 3ETSA 1W0WB 4FJ6A 1P6AB 5IB1A 2LW3A 3RVUD 2FJGB 2E4FA 4IOFC 1Z9PA 5HSFA 1FORH 3K2IA 1PAZA 2F1EA 4I0CC 3UP1A 3U9PL 1J0KA 1OGAE 3S2CA 2APFA 4G6JL 3EGSB 1CN4A 1OARL 3GEFA 1KLUB 3L4WA 3OXRA 4WENB 1QTYT 3T6ZA 1CGVA 3F7LA 4TN9A 3U0WH 1YDPB 2EDOA 2QADD 3F65A 3IKCA 3O0RL 3MNZB 4ZOEA 3Q06A 2QR0A 3ROLA 4BK4A 4QXUH 1K9TA 2VLRD 5F0PB 1UXLA 2NUTA 1FIEA 1K3ZA 4PS4L 4PU2A 2D3VA 4ZDHA 3VSUA 1OAUL 5GRVK 2C4FU 5LVEA 3O11B 1MJJB 4J3OH 4HEMA 1FBIH 3ARED 3GHEL 3HPJB 2ED7A 4IRJC 2EP6A 1GGTA 1G9MH 5DK0B 3JBG7 5F7DA 4Z5RA 1AR2A 3N2JA 2LLNA 5CBEA 4DKTA 2AMGA 4Q58C 4PBDA 4Z3EA 1NCBH 1BEYL 4U1SA 3B7RL 1JS4A 3ZHKA 3KYKH 3K2UH 4KKQA 5IWLC 4DNLA 1JE6A 2HWZH 2LFEA 3F8UB 4F92B 4MJ2A 2J1ZA 1Q94B 2YBRB 3JWOH 3N1FC 3PP3H 4PJCF 3VGBA 5E94B 4F37K 2AJZB 1BZ7B 1R5WB 3HE7A 1GJIA 2Q0ZX 2A6KA 2OTWA 3AY4C 2NY1B 5TE4L 4G43B 2E7LC 5EZJB 1QNZH 1DBBL 2B4CH 3DVGB 4K3HA 4LDCA 4BQBA 2ROXA 1FG2B 2WBJC 3IDMB 4HQQH 1KGIA 2Z4TA 3RWGB 5CEZH 5EBGA 3B3IA 5F96L 2EABA 5A7EA 4TTDC 3FT3B 3WHE0 1YEEL 2VL5B 4GOSA 4ANVA 3JVGA 5DTFB 3CVIH 1JFQL 4LP8A 4MA8H 3QEHA 3ULSB 4AIZB 1CDUA 3UJIL 1W0VA 4XPFH 3GKWL 3CX2A 1V10A 2QKIA 4PJ7E 2VOTA 3QFGA 4UU9B 1U8MB 2H0EA 4V33A 1FNFA 5JUEH 4YE4L 2XG5A 2P5PA 2DBLL 1V05A 4MD4B 1KPVA 1J9TA 4G1EA 1J5DA 1CFQA 3L3IB 1TTCA 4OF0A 2KUTA 3QDMD 1KF9B 2WZPD 2VDNL 4MD5B 3QCVH 5LBGA 1CYXA 3C8KA 4MJ4A 3RBGA 3UIYA 4AKOA 3NCBB 3DX2A 4JANB 4YBLC 2I26N 3M8OL 1AOHA 4JGNA 2RA1A 3N1QC 5FO9A 1HIMH 4CC4A 5I0WA 5IB4B 3E8UL 1I8KB 3EYQC 3WIHH 2HH0L 4ZX5A 1A3ZA 1RZGB 3K6IA 3MXVL 4FQXC 3VB9A 3NCCB 4RFEA 1MIEL 2O5ZL 3DX8B 1LTXA 4PFEA 1JDDA 4PBWD 1SJXA 4YHKH 3TCLB 3ARPA 1DBAH 2ZUQC 4M03A 5EN2B 5ID0B 1ORQB 4N24A 3VCLB 4UV7L 5LDUA 1YY9D 1F4HA 4P9HL 4YNYB 5IHZA 1A2YB 2PW1A 1BBJA 1R3HA 2WVTA 1KXVA 2GAZB 4NCDA 3US0A 4M1GL 2CGRH 5DUPL 5EZLA 3LKOB 1BFSA 5C0GA 2GCYA 2D7QA 4Q14A 5IMMA 5ICUA 3U4AA 4C8XA 3Q0HA 2P47B 1MWAL 2VZOA 1V55B 1PNCA 5CS7A 3RHWF 4FHKA 4F1SA 1R3IH 1JOIA 2VQUA 2NYZA 1XSJA 5GGRB 4AQ8C 1YC7A 1U3NA 1BGXL 1CFBA 2WP3O 2BIOA 1WIUA 1XIWA 4LLQA 1G9EA 4J8RB 1NOFA 2R7EB 1KB5L 4NQTA 3A5VA 3QRBA 1MFCH 2J25A 4I0PD 2W81C 4P4KB 4UINH 1SJMA 4JFOB 4Q2ZB 4E9LA 3U25A 2CCVA 2VM9A 3OLIA 4JFDD 2NDFA 4AYGA 4GG6F 5DD5L 1ADQL 2J2ZB 5GZNC 5IK3A 1J9CT 1INDL 4XPBH 3N04A 4NZTL 4DERA 4R2GD 2DQJL 5IQ9B 2R9HD 5CGYC 3SKOA 5KJRL 2XWZA 4FFYL 3O2WH 3T09A 4RIRB 1LQBC 4QLWA 5TDOA 4KRMB 4U3CA 3X1BA 4CA4A 4NO2B 1NDGB 5C07A 5KVEE 5DC4B 1A1OB 1UADC 2PTUA 4GW5A 5I6NA 1IBZA 1N8OE 1RUMH 2BFVL 1E9PA 1JGLH 1P1VA 3QEGL 4FNSA 1XGQB 4GSQA 4NZRH 5F6HI 4EZMA 5J13C 4FTDA 2GBVA 2W65A 3EHBD 4X80L 4XWGL 3C5ZC 3WS6A 4ACTA 4KX8A 4NHUB 5T1DH 4FTVE 1TQCB 1CL7L 4K8RD 4N5UA 5E4EC 1OW0A 5IEHA 1OVZA 5H2BA 5DFVC 4NM8H 4IW4C 2NZ9C 4P9MH 1NICA 1KTRL 4M7LH 3ATFA 2IPKA 1TSHA 1WA2X 3DOSA 5KW9H 4OF7A 1T7ZA 1FFRA 4U1GB 3MRBB 1TEFA 3B2MA 2ZWYA 1AR1C 5HI5C 5I2IA 2MCMA 4UV4H 3VFSA 1N3NA 3EOAB 3MREA 3NIGF 5D1QA 4PI2A 4UQIM 3BDYH 1SVZA 4UDUA 3T6WA 4KNTA 5ETUA 1TZ8A 1B4LA 3PUCA 3QQ9C 1MFEL 2WWMC 2YD2A 2VDPB 1FFNA 4M61A 5EPMA 1OANA 4R96B 3BAEL 4ZXBA 4PWJA 4QKXB 2BOBB 3MMEB 3SDXF 2IMNA 3MJ7A 3KLAB 1K5WA 4DP0X 4G8GA 5CLWA 3TFKC 3IGUA 4OW6A 3FUKA 4N8CH 4PV8A 5GRYA 3VI3E 3HRPA 3CK0L 3ZQWA 3F04A 3ULVH 4CVWA 1PS3A 5CJBA 2J8HA 4ODXA 2NY4D 1DJGA 1MG2C 3L7EA 1MW3A 3SY6A 2JQMA 2X1XR 2N56A 1MG3C 1Q1JH 4Q6IA 1G7JA 4NNXA 4N0FA 3REWB 2X2YA 2EILB 5LN4A 2ZCKL 4FP8L 5GJTH 4CC0A 1XR9A 4BQ6A 5SX4H 4FYQA 4PRNA 4ISVA 3H55A 1UOWA 2ZUXA 1ZHBA 2KBGA 3IDJA 5E0QA 3ZZ1A 3HG5A 2ZCLL 3GZPA 5CZXC 5DCCA 4NO5B 4M3KB 5IVZA 4NRXB 4R8WH 2AQ3A 1IAII 1FE8L 1I9JH 5AVUB 4Y19D 4JM2C 2ODHA 1R24A 2KL6A 3B43A 3GMQA 4FQIH 1D5BA 4YSQA 2VAAA 5L8JB 1IO4C 4FQLL 3OJ2C 2VC2B 2FWOA 3DVNB 1AXIB 3FQ2A 3CLFL 3VXRE 4BFIA 1LDPH 3CFBA 2YD0A 4HHWA 4QRUB 2CRMA 2DBJA 4XN4A 4AENB 1RMFH 3PHAA 1KELL 1LO2L 1KG0B 1VPOL 3AS0A 2W59A 3GBLA 4L8SB 4PJEB 4TSBL 1KIRB 2F1AA 4XO8A 2CBMA 1A3LH 5A1AA 2F54D 1DSWA 2KS0A 4QO1A 1VENA 2Q5BA 4FS0A 1BMZA 3D4CA 4ALAL 3E6HA 3H53A 3ARFB 5JW3H 4H8WH 4JDZA 3DECA 2N0MA 3NSYA 4LLUB 3N55A 1LO0L 3FFCD 4NSKA 3MRRB 3EZJB 1GZHC 4HOWA 3LNFA 4DK5A 2Z8RA 2VDRH 5I6XB 1DQDL 3UZVB 3II1A 1UT2A 4JY6B 2PP7A 1FH5L 1HCFX 3FO0L 1RURH 3JWNH 1QW9A 3MODH 1GS6X 3QR0A 1YEGL 2RD0A 5GGRY 1L7TH 3RZWA 4WF7A 3DBSA 2O5XL 2HRPL 4QRPA 1F1GA 3S35H 2R2EB 5DHEA 4BXSV 2X4UB 4WUUE 1JL8A 2WNXA 1HT6A 3EYUH 5JORB 1I1AA 5E1HB 4NZJA 5JMOC 5CSGA 1HQRB 3EF7A 1ZGLM 1E9QB 3CZFA 4LQ1A 1TZHB 3O6FA 3QZWA 4ELME 4HPYL 2KZKA 4YHPA 4AW7A 1TVDA 4LCCC 3L1OL 3UBXI 4PG2A 4BFFA 4BFRA 4LMQE 4MWFB 4U1LB 4F9PA 5GGSA 2A0LD 5CCGE 2AXHA 2QBWA 2Y1AA 4WI3A 4XX1G 1FDLH 1MJ7H 3ZPDA 1X7QA 2VO5A 2V37A 4LASH 1U8HA 3IVKB 1BCIA 1NEZB 2O5YL 1IGML 1HKLH 2VN5A 4P2OA 3BPCA 4UT9H 1ULVA 5T5NG 2OSLB 2DTML 4YFEA 2WQVA 2WZ5A 1OSPL 4Z3GA 2YEZA 4IBUA 1EFQA 2FL5B 4XGZB 3MR9B 1JD7A 4PS8A 2ENPA 4YR6A 1S7QB 1UT1A 4UQCA 5T1LA 5IIEB 3WNMA 2CO1A 4UM8B 1PZDA 2G0LA 3VJ6A 3STLA 1HWHB 4OZIB 1YYMH 3BWAA 4PJHB 3ZX1A 2ZOKB 4F24A 2DRUA 4D8PA 4Y4KA 1IQWL 2EIBA 5I30H 1ZJAA 3KR3H 5EEWA 3RX7A 3JV4B 2Y36L 2XIDA 3K6OA 2XFXB 5T8IA 4WWNA 3TZVB 3VRLE 4UTBA 5T1KA 2PCXA 2HT4C 5CJQL 4TUKL 3UYRH 5EC1A 5BOPA 5I26A 1I1FA 4D2NA 4K5MA 1G1YA 3JTTB 3TJEL 2EZ0C 3ES6B 4ZPVB 3KZ8A 1FFQA 4EZJA 1J88A 1UKTA 1T03L 2LTQB 3HE6A 2F61A 2R69L 5C86A 2DLFL 2VR5A 3MGAA 4PHZA 4P5SA 1T0MB 3UJJH 3BKJH 3MROA 4LPXA 2Z0UA 4PGDB 3DHPA 1JTOA 1KTLA 3LQAL 5I8KL 3DYMA 3RZCB 3W2DH 2WTRB 5DJZB 2UXFA 4G42A 1UC6A 4PVBA 2IBBA 2YN5A 2DQIH 5CHNA 4CN4A 3GRWL 3B7YA 4NQSB 4HJSA 2QV2A 2W8CA 1SHSA 5EUOF 2CHXA 1DQQB 1BXUA 2AJYH 3WO4C 2KLRA 1YHPA 1ZIBA 2P3YA 3SQOH 5D7HA 3OKDA 3MBEC 3HS0B 3GGWA 4QRRD 5H35A 3VD7A 3B9AA 5EZOH 4OY9A 1ZGLB 1P5UA 2AEIT 3DI3B 5FHAH 4X9BA 5HJGA 2WD0A 2Q8BL 1DEDA 1M6OB 4B3VA 2UZYB 2E0PA 3MUZ1 3RVTD 1NGQL 2Q10A 4YAQA 4QXWA 2R0LH 1B3IA 1GOHA 3PWPA 5FUCC 2XPGA 2D2CC 2W07A 3PHOB 1DVFC 5DZJA 3GSWB 2JVUA 1FJ1B 4NT6B 3KYMB 3PGCB 4XVSH 1A3RL 3MLYH 3V5DA 3VG0H 1GGBH 5C0CE 1QEWA 4MQ7A 4OZFB 3KMDA 4DZBA 4RMQA 2VRAA 1TFPA 4OM0L 2YPVL 1B90A 2XQYA 5D7JA 5C2UB 4JO8A 5BW7C 2M1KA 4H5SA 4MXQC 3R7RA 3VM7A 5DI8A 4HPHA 1S7UB 2ZSWA 3QQ4A 4GT0A 4IU2B 4JKMA 3TBBA 3IRPX 2GT9B 2AJXH 5AKTA 3DMMB 4TLSA 2Y23A 3PAZA 2ICWJ 3RX5A 2OW7A 4LSRL 1IKFH 5EMYA 1KB9K 5GS2H 4EIGB 2IWEA 4S11A 4KXAA 2K4AA 4QRRE 3BP7A 1SMAA 4YHIA 5AVWB 4AQ1B 1ASOA 1T6WA 3MO1B 3HAEB 1Q72L 2PPEA 3FPYA 3SD2A 3TBSA 3ZHLA 1MHHA 3L4UA 1JXFA 1N7ML 4PTTB 4TVPH 1ZA3B 1HE7A 3IFNH 4TUOA 5D1ZD 1NGXA 4XP9L 3F05A 4GS7C 1B3JA 3WLWD 4DEPB 4I8DA 3UJTL 2BSRA 4LRIA 2AABL 4IEFA 4O4YL 3EG9A 1UFGA 1MZYA 1S9XB 3S3BB 3THMH 4QGTA 2GPZA 2D73A 4WJ5B 1E4HA 3EOYG 4KTGA 4MB5A 3KBHE 4F57L 3BP5B 5BMFH 2D3LA 1KJMB 3VXRA 5KSAB 5L7XH 3CQFA 5FC9A 1SDDB 1CB4A 1F18A 3L7FB 4YEEA 2VXTH 1D5RA 2QMJA 1PLAA 1QLEB 4HS8H 3LKSB 4ZFOL 3JTSA 4TQEH 4MMZC 3RLSA 2AQ2A 3ZUCA 4S1RL 3WU1A 4KKCC 5AVSB 3UO1H 4GAAA 3ASWA 3WYRA 5E9NA 2BO0A 1U2HA 4P46D 3TEYA 2Z35A 1MCQA 3KW8A 3P11L 5C7XH 3QRFM 3GEWB 4NC1E 3DTXB 1XB8A 4Y9CA 4A68A 1YNKL 3F3HA 1EJOH 2YBGA 4GBXA 4JGUA 1AHMA 3LIZA 1CF8H 3IDIB 1MCWW 2HXAA 4KXCA 4ZD3L 3HHMA 5FM5M 2BJMH 4K3GA 3W0WB 5F88B 3SEPA 2OQJA 1MLCA 1N59B 4GSRA 2Y6TE 5AOJA 5E8OB 3V0VB 3RFZA 3CFKA 4ZRGA 1RUPH 1ZLUK 4D7BA 1EAPB 2P28B 1WO2A 2QR0B 2Y7LA 1O7VA 4KKAD 3C9NA 4MZ2A 3QPKA 4QDGA 4UTAA 1IEBA 1BMGA 3QXAA 3DX9A 3W11C 1KGWA 5DD3L 3FZUC 1AO7B 4MXWH 4NKDB 3DOHA 3EJSA 5AW6B 5L88H 2BWQA 3NRPA 5KG9B 4OCWH 3ZE2F 2PCFA 4JDTL 1EXUB 3NGBB 3QJFA 3L3OA 1XB6A 4OTXH 1CIDA 5JXAL 3S37X 1XF3A 1I3VA 2B8OT 3UZEC 5I1IL 4NP9A 1G43A 1YECH 4GW4A 1DL7H 3HNSH 3JV6A 2F6AA 1GOFA 2DQTL 2PLTA 1QI5A 2AJ3A 5K33A 2G5RA 4F2MB 1SM3L 4DP4X 1XH3A 4PEEA 4UIKL 1G7PA 4FAAB 1QBBA 4Y16B 4RAUA 3L5XH 2ADGB 1NCAL 3NFSH 1GIGL 1Z5LA 1A6TB 2X2JA 1A21A 3E1F1 1JGEA 3STBA 2ARJQ 3HN8A 3VGAB 3VFGL 1ETZB 3WGUB 3F7QA 3FQWA 3BZ4B 4NQEE 2BDNL 1IC7L 2FT6A 1Q0XH 4KFMA 5E8DL 3S3PA 3NTCH 1Q9LB 3NJKA 4LFHD 5CKGA 3SGDI 1XV8A 4ZS6C 4BE5A 4NAJA 3OJMB 5HD8D 3QEHB 1QBAA 3VWJD 5IB2A 3TN0A 3HVDA 1VGKB 3MOQA 1OE2A 2OL3L 4XPTH 3TBCA 2CKBA 2Y7SA 4N1CA 3VD2A 1TCRB 4NJAL 3SKMB 5C08E 3CLWA 3WL9A 5BQ7B 1NDMA 1CGUA 2Y06H 1OE1A 2XZQH 1W6LA 3FQTA 3GK8L 1LK3L 3O0LA 5E4IA 4FLQA 2EO1A 1XTMA 1JTTA 2UUDH 3IS1X 4WI7A 4N8UA 2XTJE 4LSDA 3RKDD 3PFUA 3ARBA 4BFBD 4JREC 1FPTL 2R2HB 1E5ZA 3N1GC 3EDDA 2C9QA 3U6RA 4AYMC 1WFUA 4N20A 5CLTA 3LNHA 3K80A 4BEIA 3V4VL 3LZPA 4JFFA 4HXBL 1A1MA 5E2WH 3Q9PA 3ZKMC 2PP9A 1JPGA 1INQA 4KK8D 2EYRB 1T0NA 4XNBA 3HMWH 4JJ5B 4HCFA 3CZLA 3O9WD 4MHHG 2VDQB 4EJ1C 5TQ0H 4PJCE 1TQTA 1YYLH 1X5IA 2APWA 2ARJA 3N0AA 3WKMH 3WDIA 3PWNA 4JPVH 5AW3B 1KTKE 1ZA6A 2WLKA 4TM9A 1DBKL 4RGMB 4KTDL 3FRPA 3OLDA 5BQDA 3TTSA 4KPHH 4N9OB 4OGYL 2YAMA 3KNBB 4PLOB 4FA8A 1Z5YD 4WHTB 3K6SA 3KLDA 5IHZB 1QSFE 2PW1B 3DV4B 4S1DC 2TSAA 3BVXA 1A14L 2WUCH 3QUXD 5AOLA 2KZWA 5AW1B 3KLLA 2GCYB 1NIBA 1ACCA 1HL9A 1TKWB 4TSAL 2X6VA 2DMKA 2GJ6E 2MNJB 2X89D 4XVUC 2BY2A 1IQDA 2IV9A 3HOGA 4HIQA 4QTIL 1E4KA 5DVOA 2YRBA 3QIUA 3BUIA 4DK3A 1EHAA 5PAZA 4B9FA 4GRWE 3KPRE 5CWSA 5GGVL 5HGHA 8FABB 4PD4K 2IEPA 4RFNC 4MJ6A 3H42L 3NPZB 2ZUUA 1HOEA 1AGEB 3DO4A 2WO2B 1QI3A 1QATA 2OP4L 4ZMLA 4HIXL 4MCMA 3G5YB 5EU6E 4A04A 5FM8A 3MHZA 1E8XA 1SYVB 3WFHA 2YD6A 1C7SA 3EBGA 4PJ6A 1UB6A 3WAKA 3MLSH 4H4NA 5IR1A 4OZGB 3OX8B 4BKLB 4JY5L 3SY0A 2C4FT 5E6IA 4HIIB 1RHHA 5TE7H 4NN5B 2CLZA 2WWKT 3GSOA 4G6AD 2FGWH 5BO1L 1YNLL 5I1EH 3NMEA 1NH6A 1RSFA 4XE0A 1N5YH 1OB0A 4JFXA 3AB0C 5IHUH 2X1OA 4HXAH 1NL0H 2EE3A 1S7RA 3D39A 3I02A 1P9MC 1KGJA 4WGKA 2E3VA 5KOVC 2K6ZA 3BSGA 3KYNB 4X9GA 2ICWA 3K8LA 3QQDB 4AJVA 1QFWH 2ZAHA 1CE1H 1TR7A 4KXBA 2EDXA 2FQGA 4NM4L 5CJOH 5BZWA 2W65B 3MUGA 4LU5L 4HLZH 4U2ZA 4UZGA 1MVFA 2DQMA 2QSCL 3LKRA 4YIQA 5JHDE 1AY1H 1NM4A 3TTYA 3GMNB 3PP3K 1KN2H 3CAFA 4ZG1A 4FZEH 4MCYA 4WGWB 4M1CC 4DOHE 4TUUA 1Z66A 5E5MB 4H88L 2IPKB 4OAWA 2C4XA 4Q7DA 1I4FA 1X4ZA 1YEKH 3FN0H 1JDCA 3TS8A 3TVMB 1YEIH 2IFFL 5GS3A 3WS3B 5I2IB 3VFSB 4R83A 4YSEA 3CHSA 3ARUA 5AVQB 4MASA 4KHXL 3EBIA 3HUJB 5CUSH 4N0CC 1VFAA 4JZOB 4KNUA 4HSAC 3VFMA 4XI5C 3INUL 3DX7B 3AU1A 2BP0A 1FFNB 3GHBH 1SEQH 4OLWL 2A9BA 3RTLA 5T1MA 1R1CA 1FO0H 2BNQB 4OUUB 1DLHB 3CPUA 5GISH 3UADA 4HIHA 4OJCA 2UYLA 2Z7ZA 1QKZL 4KMTH 4GG6E 3ESMA 1FNGB 1EHXA 2IC2A 5IV2B 2FR4B 2D03L 4FFYA 1OGAB 3VGDA 3PUUA 1J8HA 4BK5C 3BCDA 2BOLA 1XFPA 4Q6IB 4WWKC 3FTSA 1G7JB 4NNXB 5DHVA 2XWRA 4N0FB 4NHCL 3ZTNL 3T6QC 3RPIB 3ZTJG 3QHFH 4NN7B 4AGMA 1OAXL 5AKVA 1B4JH 2XY2A 4HD5A 2FX7L 4ISVB 2KHAA 5LXGH 4YGAB 1ZHBB 5BXFA 1BG1A 3DTDA 3N40P 5FDWA 4AVJA 2GBAA 1CBJA 1DQML 1FRGH 1TYRA 3OR6B 2ADJA 1LVEA 3DETD 4KI5D 3TURA 5IKCB 3ZRFC 3RJDA 2O61A 1VKXA 1CXIA 4TPRH 4LKCA 1T1YB 3P3YA 3SDAD 3QAZC 4LLYB 5HHOB 2HJLA 4WW1B 4Y5XB 5DJDA 4ILDA 5J7CC 4LHUD 4ZMPA 2CHWA 3BVWA 4CW1A 4YDZA 1KBVA 2FWOB 3Q8FA 3WNOA 4JVWA 3CVHB 1LP9F 4UDTA 2G60L 3NIGE 4P5KB 4LSSL 1JN6A 1YMMB 3F7YB 2IADA 5AYUL 3MJ9H 2YSSB 4M6NH 5HI4C 4D94A 2LU7A 1LEGA 2VISA 4AE0A 4QO1B 2QVMA 3AG1B 2IWKA 3AS3A 3BDBA 3A23A 2FLBT 4XC3H 2H32A 1LXMA 2DQUH 2Z8SA 1R33A 5B3JF 3E38A 2YAPA 1P5VA 5F7WC 3CCHA 2XHNA 3P4MA 5KYXA 3DO3A 4KVPA 5C09E 1NMBL 4NQEA 2QQLH 4NP4H 4X5QA 1E28B 2QADB 2EIDA 3FCSB 2XACC 2V3DA 3FXIC 3WE6A 3DIVA 2XQBL 2QL1A 1BVLB 2XN1A 3V8CA 4OT1L 1MW0A 3GIVA 1YEJH 5GSVB 1WWWX 4YO0A 4PJ7B 2WKOF 1NFDF 3ESOA 3HZKB 4HWBH 4PTUA 4L4TE 3RGBA 2EIJB 4OD1H 2Y24A 3BC9A 1XGUA 1FZMB 5C08A 2CO3A 2YFOA 4F58L 1INEL 3TT3L 3CZFB 4Y2DA 3EW3B 3TT1L 5B39A 4FXGC 2AS5M 1GYWA 1WD8A 2HTLD 2PPAA 2WYZA 2P7TB 3CPLA 4YHPB 4PJ8A 3I50H 3CD4A 3AG3B 4G6KL 2ZG2A 3S4SB 3S8GB 1TJHH 3RDJA 4JQIH 2HG5A 5DT1L 2NX5D 5E6YA 5BV7B 4KDTC 1OPOA 4FQHA 4POZC 1RULH 3I9GH 1RPUA 3L13A 3BUDA 1AD0B 1X7QB 1U8HB 5FB8B 4P2OB 3ABMB 1OAJA 4K5LA 5H94B 4XVJH 4ZZFA 4OR1A 1WCBA 2HFEA 3MACH 3QW9A 2YEZB 5DU7A 3SE9L 2IGFH 3TC9A 1E5YA 2DLEA 3VMOA 1LYQA 3QQ3A 5SWQA 1KLGA 1U92A 1RZ8A 5AB9A 3U2SA 2P5EE 5GRWA 2JF1A 3OKOA 3STLB 3UGXA 4APXA 4U6HA 4WI8A 3QZOA 1QSFA 2VXUH 4IGBD 5KTEH 2Y6SC 2ALAA 4NPJA 4X0KB 4M02A 3SDDC 3UMTA 5CCJA 3CSFA 1MIMH 1WGOA 3N44B 4LPWA 4MLSA 4D0BA 4K94C 4EBQL 5C3LD 1CO1A 3FUMA 3MA9L 2GJ6A 1HJBC 4HK0A 5DYOA 3VE0B 2AV1B 4B3EA 4BHUI 5ADOL 2AQPA 5EC1B 2OZ4A 1U91A 1FH2A 3FNKA 4ZAKD 3KPRA 1OTSD 5D1XE 5DJ0B 3UFIA 1TVBB 3QORC 5I17B 3UBXA 4EI5A 2FVNA 15C8L 1SXSA 5EU6A 3FQNB 3QCUL 4HZLA 3HJEA 1BVNT 4AMKL 1FN4A 1YQ2A 4HS6A 3TCTA 3JYCA 3MRFB 5AQ0A 2O93L 4MAYD 4XNUL 1MRFH 1WZLA 4S2SA 2RHEA 1CFVH 2RH0A 3BFWA 5IBTH 2OJZH 1YAIA 1P2CB 1MAML 4QJ4B 1U8LA 1U3HC 1JHLH 4XVTL 12E8L 3VWKD 1KUMA 1BZ8A 4DT2A 4JZNA 3CH1A 2DJ4A 2LLGA 3IETA 3MYZA 4JK0D 3CN0A 3TX4A 5HHQA 3GSRA 4IOIB 3KLKA 1U2YA 3B5HA 3BIBX 4U6XA 5JIQA 2Q2EB 2TRHA 3FYIB 3KWWB 1DVTA 1UB5B 5T3ZL 3FFDA 3MLVH 5JHDA 1NEPA 5AVYB 5EB9A 3BJLA 1MNNA 4FTVB 3KDMB 5I8EA 4BXVA 1KEGH 4CMHB 4RDBA 4Y4FC 2QGCA 3IXAB 5CSBA 1QFOA 2OR8A 2YQ3A 1DJXA 2XPGB 3BAYA 2W07B 1A7NL 4JN1L 1ONQB 5AZ2H 2R4SL 3CBJB 1JGDB 2JCWA 4FQ1H 4S1QL 2AV7A 4N90E 4NN6C 2OX5B 4MQ7B 2HPOA 4L3CA 4N2EA 4H20H 3FHEA 2VN6A 4I0PB 1CF1A 3D85A 4WDIA 4N2MA 4DEUA 2W9EH 3BAKA 3MUJA 4JFDB 3FTYA 1MHEA 1D9KA 3GTVA 1PZAA 4YHYB 5L8LB 1IAOB 1TLMA 1QPKA 3QISA 4Z0XB 3QJTB 2H32H 4W4OC 2OMTA 4G7YH 5E56A 4UAOB 2ZKYA 3DV6B 3CDGA 4R2GB 3VI3B 3VXPB 4CUCA 2BVPA 1OCRB 3B37A 3PXHA 4WO4D 1FAIH 2R8SH 1G1KA 1I9IH 1KIUB 2IG2L 2F8OA 2Y07L 3LZFH 4FQ2H 4I18A 2VDPH 3CG8A 2CDGB 3MN8A 3VRJA 3P1VA 5EUOE 1DO5A 4ZNEE 1A9VA 4FFZL 1UCTA 3QUMH 5GRXG 3MLPA 4DZ8B 3M1BA 4G6MH 4I89A 5F89A 3PNWB 5DRZA 1IAIH 4U1KA 4TUOB 1JGUH 5DS2A 4Z7VF 2IOOA 1CR9L 1FZKA 2JXMA 5FCSH 3GSQB 2FQDA 2FH8A 4ODBD 5F9JB 1XCTA 5B7MA 3QUHA 4PB9H 1A6VL 2IV8A 2NXYD 3NVQA 4OCLC 4E9VA 5KANI 5DEGB 3LRGA 5FAAA 4H8QA 3VTAA 1HHIB 5AUMA 5F72S 1MFUA 4ZO6A 4HYTB 3U1SH 4PW3A 3VXRB 4A2LA 4AEHH 1BECA 2HMID 2KQNA 4JHZA 4K9EH 4OLYL 4AYID 2B16A 1PEZA 2PYED 4Z7QF 2EYTA 2ZE0A 5GGUA 4TNVK 1TT6A 1H3PL 1IAKA 3L6FA 4ZW6A 4C57C 4EN3C 1R4XA 2FZ3B 3WHXA 1B0GB 1S9WA 4LSQH 4WEBH 4CBPA 5FHBH 4N8VG 3ILQC 2ICEC 2WC7A 4GXUN 5FYLL 5B4MC 2EYSA 2G75A 3EO9L 4GLRI 4BV1A 3BFQG 2JB6B 5C9KA 3EOBB 4LAJH 3GBNH 3GXNA 3P73B 3RWIA 2VC2H 5DZOA 3SDXA 5DMIL 5KWYC 1CGTA 1G7LB 5F1SA 1DZ0A 1JNLH 2ESVA 1PIFA 2NY4B 3HB3B 3MOBH 5C09A 2WXPA 4GBXB 4PR5A 3GTTA 4YMPA 5JA9A 1X44A 2K6YA 1L5GA 5ANME 2XRAH 1ACXA 2YXFA 3TCXA 2WJ5A 2E74C 1FA4A 2EDLA 2C3XA 2X1PA 3WNKA 3M46A 4L8CB 2YZ1A 2ZKXA 5AWNL 1C5CL 2VL4A 2ISDA 4WUUB 3TO4C 4OI8A 5D70H 1BM3H 4PJ5E 3V5HB 1QUPA 4UZSA 1B2YA 2X4QB 2ZOUA 3Q48A 2G2RA 4P3WA 1ECYA 2EE6A 1MCDA 4KROB 2H7WA 4QRSB 3WI9A 3RQ3A 3FL7A 3FQXB 5D7SH 5CR8A 4DN3H 4ELMB 1BZ9B 1GPOL 1MI5E 2HX8A 1HINL 2NY6C 3L3OB 3IDUA 3Q3GB 4OI7A 3HKFA 3JUZA 3QEQE 4OM1H 4X7CC 4Z95H 4YLCA 5B1CA 3IJSA 1BEXA 3NUKA 2G4GA 1RLBA 2JKXA 5DZAA 4FYTA 3UCRA 2OXGA 1DQJA 3GMRA 2JQZA 2AJ3B 3TJHD 1DN2A 2HKHL 1OGPA 4XP4L 5JQ6L 4ODSL 3FFCB 2W9DL 4BZ1L 5KVGL 4P59L 3BHBA 2BP8A 3VYNA 3VGEA 3F7VA 5FR3A 3ZW3A 4U49A 1WZMA 4XHJC 1K72A 1R0AL 2P5EA 1QLRB 5EBWA 5I75B 2NY2C 4N5ED 3WJMB 4DO6A 1AZCA 5HPMA 4XXCA 3QIWA 3MV8E 4P3DA 3S9DB 2EXWD 2K7QA 5JOPD 5MEQA 3CV5A 1BIHA 3M86A 2MCPL 3B2DC 3FCUB 1IB5A 5H37G 3CSTA 1FUNA 2GITA 2LU3A 3VGHA 4XZUB 1YY8A 5E2TH 1CE6A 2J8UF 4Y9GA 1CFTA 4F7KA 3TN0B 4ZFZA 1YC8A 1NCUA 1B0WA 2ROYA 1WITA 4IS6A 1X5FA 4WK0B 3C6SA 5CP7A 5DC2A 2W9LA 3Q7JA 5FECA 4JO1H 2W0FA 3V6ZB 3ENEA 2WQSA 3QRGL 5ELIA 1KZYA 4BUGA 4OZ4B 3FQTB 4JZJC 3RIFK 5GRUH 4KGLA 4G5ZL 2VZVA 3QNZA 3A6CH 4ZQKA 1YEDA 2DWDB 4YZWA 3U4EB 4W93A 4Q9CA 3MRQB 4KTEL 1HSAA 4PREA 5HGAB 4KGJA 2CH8A 3ZE2E 2CCWA 3VYPA 2ZWZA 1JPTH 3ZDZB 1QYGL 4MBRA 1A1MB 25C8L 4FI6A 4AT6B 4JG1H 4PQXA 2ZXDA 5E2UH 4C55A 4HGWB 4E41A 3PGDA 2FLRT 2A83B 3FMGL 4HLJA 4LAQH 4ZUWA 1D5MB 2ARJB 1RZ7L 5K39A 5ISZD 4JFYB 4IOFD 1WTLA 4MYPA 3KWVA 3TEUA 2OMXA 4I3RL 1QG3A 1FWXA 3DXAA 1UZGA 1HZHL 3IDYB 3G5ZB 3NN8A 4X4YB 3TESA 3EYVA 1JXJA 2WMPB 4FQJH 4ZOBA 2ED8A 2GSMB 2WNWA 4ODWB 1MCPL 2CRYA 1PD6A 3JV0A 2NY3C 4NBXB 5KSUB 1JV2B 5DD0H 1CVSC 1IGFH 4G7VL 4L9LC 5DURD 3V6OC 4ODUB 2VDKL 3NIFB 4WEUD 4WO0A 1DJZA 3VXUE 4YZFE 5AZEL 4OGAC 4L0PB 5INDA 4LOEA 4I88A 3RE0A 3GSUA 4TQ8A 5GHWL 2JJSC 4IRJD 3RWDB 2GK0B 4DJMA 5C0CB 3T0WA 2VZSA 2GSIA 5HGHB 4LSTH 4D8OA 1BHGA 3HZ3A 2CPUA 1MFBL 3D18B 3NCWA 3QG7H 3DVIA 4NNPH 3H54A 4AKPA 3ILDA 4ZMZA 5LB1A 5J1AA 2VDNB 4OCRL 4JKLA 3K6NA 4D3CH 2M2DA 2QEJA 1HQ4A 2VXVH 3MDJA 1T1WA 4URTB 4C54A 5IZ7A 3D48R 3QE5A 5F9WC 4NO0D 4C47A 3L1GA 5E6IB 1RHHB 2I07A 5CD5C 1KJ3H 5D6CA 2FATL 2R1XA 2Q3AA 4MCZA 4OZFH 5FWQA 3B83A 3UROR 5EIIG 5LG1A 2OR9H 3KJ4B 4IRSC 4M7KL 3V6BR 5GZOC 1IRAY 5EHFA 1G7IB 4K23H 3L3KA 3WDHA 3D0LA 3GNMH 1JD9A 4CJ0A 2FWUA 2VW6A 3I02B 2MKLC 4UYQA 4XCEA 5EUOA 2X41A 4PV1C 5IEKA 4L5FL 2WBJD 2Z93B 3P0VH 4QRRB 2H1XA 3V0FA 4QNPE 4JFQB 3Q44A 2OMYA 4P5TC 4WSKA 4HKZA 5IFAL 4TTDD 1MFDL 1OCOB 1YPZF 3R1GL 4AIOA 3BIKB 3LKRB 4U7SA 4UBDD 2PCYA 4E0RA 2GC7C 4NJ9H 2IPUG 3P3RA 2DW5A 5I18H 2VQ4A 1DLFH 2VJXA 2WQ8A 2YD1A 4G1MA 1QFUL 2H6UA 1EA9C 2BNRE 2GUOB 3UTPD 1MWAB 3VXME 4L3EE 2OK0H 4GAYB 1T83C 2K9FB 3HAEH 4AJ0A 2ATPB 3BEVB 3QSKB 4XB7A 3UYOD 1S5IH 1SJEA 4W9IC 1Z5HA 1RHFA 3WFDH 3AAZA 4XT1C 4WHCA 1WT5C 1VFAB 3OLGA 1KCSL 4J1UA 5T33H 1DVYA 3U0TA 4WW2B 3VD3A 2VH5L 1IE4A 1KB5B 2QVFB 1F6AB 2XVKA 4QHPA 3TWCL 4G80A 2YUVA 4RRPA 1Y18B 1NCOA 1KPUA 2VDML 3BQUA 3J8F7 2I9LA 1SF3A 1VFOA 4WY7H 4G3YH 2F53D 2WWNA 4H0HB 2OW6A 3CIQA 1CK0L 2FYYB 4BH7A 2NY5H 4TNFA 4FQCH 1D6VL 4WUKL 4FQXD 4M7JH 1S8DB 4YSSA 4NQUA 2EUZA 3OM3B 3O4LD 1GHFH 2LTQC 3Q13A 2WXFA 1JYWA 4ODVH 3MZTA 1I3GL 2OMVB 4PJ9A 1QLEH 4ZYKB 2P45B 2CHNA 1NMAH 1Q1PA 3O4OB 5EF1A 4P23A 4DW2L 1UXWA 1AZZC 2UUDK 1HI6B 4Q0XL 2FB4H 2MCG1 1JMZA 1FP5A 1MSPA 3I6KB 1A6WH 4KJWC 5F9AC 3CBKB 5FYJE 2EVHA 2UY6B 3B2VH 5D1ZB 1IM3A 3EAKA 2PPFA 3L4CA 1SOXA 4PJ5A 1P1ZB 2JTDA 3KWUA 5T3ZE 3BVNA 1GW6A 2XLLA 4GIAA 3LS4H 1LE9A 4HJGA 4WFED 3QFJD 3KPOA 3BH8A 2O61B 4I1PA 1FF5A 2C3VA 4LKCB 2B4CC 2HJFA 4ZUSA 2LAAA 2R29A 2ZP0T 3GMPB 3VI4F 3QEQA 3S5YA 1EX0A 5TDPA 5AKRA 3FU7A 5CP3A 1RZJL 2XWBB 5BS0D 2YEQA 3IM1A 2MQGA 1EFXA 3QNXA 5F3HA 3LPWA 2EE9A 8CGTA 1UCBL 2FDBP 2AJSH 5DEZA 3AWFA 4HOXA 1AP2B 3ARRA 3ETBF 1KJ2L 4ZUUB 1BBDH 4GP4B 4P46B 3V10A 4LSUH 2CJUL 1MJUH 3BN3B 1BFVL 1TMQA 4UILH 5FYLD 5DZNA 3U7AA 1T22B 1ETB1 1K85A 3P4OA 3MV8A 3SGDH 3MLXL 4HAGA 2HN7B 3UG3A 1NFIB 2B0SH 1AVAA 3TOPA 5K9JH 3ARYA 2QZ5A 3T2NH 1KV7A 5I9QB 4TOYH 4FJYA 4M5YL 4FLOA 5DD1L 4TNWK 3OR7B 4Z76A 3C5ZD 3GS4A 2B77A 4FXKB 2ZPKH 4UB0L 3EKCA 5DFVD 4KKRA 4G9FE 4LEOB 2NZ9D 3TA3A 5CINH 5C08B 2DIJA 4YFDB 5T5FL 2BNUA 4D9RD 1JRHL 3ABKB 4AQ1C 3QDJE 5HI5D 1AR1D 3HEIB 1F1AA 2XTJB 4HT1H 5DJCA 3VFVB 3WEBA 4Y5VB 4HH9A 4XO4A 4GO9A 2EDEA 3MV9D 5EBLB 2CD0A 3OMAB 3MXWH 1JFHA 4DGIL 4DO5A 3BJ91 3QQ9D 3UDWA 2WWMD 4ELDA 1SFDA 3RUGF 1F00I 1Q9OB 2QVTA 2IPTL 2EH7L 1WV7T 3MYJB 4LB8A 4Z9KB 2CLVA 1B0IA 4NI3A 4RBPH 3DSNA 3F84A 2WUBH 1K5NB 4BSVA 3EJRA 4PJCB 1VACA 5F1NA 1WS8A 3P4NB 4DGYH 1OGSA 1FGNL 2HFEB 3FU0A 4X6BB 2XZCH 3VNYA 3D9AL 3MRCB 1T0OA 4QPEA 2V5YA 3SO3B 1D5ZB 3TIEB 5B3JE 5GGTA 2HT3C 5LGHH 1JGIA 2NR6C 4M00A 2VDQH 3IJEB 4M93B 2JK5A 4FABL 3NACL 3EJJX 3ELQA 4R0LB 5IMOB 4L1BA 3GSNL 4C56A 1BAFL 4WV1A 2EIKB 4HCRA 3VXUA 3U1QA 3PG2A 3PWVB 2NSQA 2MNUA 43CAB 1DEEB 2ZXBA 4K2UL 1HKFA 3IXTB 3RX9A 1XF5A 4PGEA 4FG6C 2VE6B 2EDKA 3WN5A 3DIFA 3CIAA 4WJG3 3HG1E 2A6JA 4D9RE 1T66C 5G55A 4JM2D 1GJUA 5JR1L 4GRWB 5IF0B 1JWSB 5I19L 1X5ZA 1XGTA 3SBQA 2F58H 1GKEA 2YPLE 2XTLA 3ORJA 5C0BD 2DM3A 3HC3H 3U4BH 1BVZA 3PLYA 5DRWB 1Y6MR 1PGRB 1PKQE 2YKLL 3BISA 3MV9E 1I7RB 5MENA 1M71B 3W9EA 3C6LD 4CNIA 2AEQH 4P4RA 2VLRA 4HZLB 2A4CA 1FN4B 1XCWA 2ZYHA 3AITA 1J5OH 2OMZB 2RAMA 3O9WB 3AREA 4XNQA 4OCYH 4QRBA 3BESR 2CXKA 2I85A 4P2RD 1RJLA 3LRHA 4LSPL 2A5UA 3MNMA 4AEFA 2MQ0A 4G72B 4JZNB 3MCLH 3HIZA 3AGVA 3BI9X 5KVGE 5E99H 1WYJA 2VT0A 5HHQB 1DZBA 4NOFA 2H0JA 3FB6A 3BE1L 3EYSH 4AH2A 1SY6L 2Q2LA 4HAFA 4XPHH 1PQZB 4MNHA 3CWGA 5GRVL 4DN4L 4JKPL 4IIQB 2NZ1A 1JPFA 2X4SB 3I84A 3KW7A 3HE7C 3ZT6A 1L3NA 3GXTA 1IE5A 1A4CA 2X12A 5I8EB 4YN3A 1HC1A 1RUAH 1EXHA 2QMKA 5KJ4A 2DQFB 5FGCB 3STZA 4OD3H 2BNRA 1D7BA 4GKZB 4LHJB 3VXMA 4DKAA 4L3EA 1JV5B 1OAKH 1OP9A 3SKJL 2AVGA 5J6HB 4PP2A 3F12B 3KPPB 1WBXA 4YBQD 3ZL4H 5ENWA 2FX8L 1QNIA 2PCPA 4PG9B 4YVUA 5D9SB 2Z65C 2AV7B 2HX9A 2IFGA 3N9GL 4UOW1 5EORL 5ALCL 5ADPL 3JVGC 3VSQA 1KYUA 1CTOA 3WKPA 3D85B 1YLBB 2QKIC 2R51A 5E1AB 2UXTA 5IB5A 2EVIA 5D96C 2YGOA 3OKYA 4L29A 1JK8B 5AAPA 1J1OH 3LDBB 3UC0H 1A02N 2P9RA 4DVRH 4HFUH 4OIIH 1A4JB 1TOXA 4Z6AT 2XI9A 4YWGL 3HBZA 5EWIL 3CDGB 3X11A 4GG6B 1A1NA 3D2UA 1JUFB 4QXGL 3RGVD 2EXYC 3QWOB 3UO8B 3QDMA 4X99A 4L4VE 4QAMB 3NIDE 3ESNA 4HCIA 4JPKL 3LEVL 3E3QC 4HAKA 4J5VA 1QPPA 1N19A 5D8JL 2IALB 5KEZA 3MNDA 5F70A 3L4TA 3M1BB 3QRLA 1ZLVK 5EU3B 4CC4C 3BT2L 2WVUA 4FMKA 4X7EC 4Z23A 1FFPA 3LNGA 3W9DB 5DRZB 4W4NA 4X9HA 1M7IB 2CG9X 3APCA 1XZ0A 2Y2YA 3LXCA 5JHLH 1E2VA 4J3SA 1Z2KA 4RGMC 5AOMA 35C8L 2W91A 3VTMA 4Z3JA 2HT4D 3HR5A 4JO3H 2O72A 4ONHB 4ZSOE 3OHXA 1BYNA 1KXVC 3NEOA 2EZ0D 3BSZH 1J8SA 3MV7D 1RIVH 3FBQA 5LAXB 1IL1B 1U3JA 2V2WB 2AXFA 1KYOJ 2MHAB 4F7PA 1OAYH 3GIZH 4YL4A 43C9B 3T4AB 3L3JA 4FEIA 3IU4L 4Q9QH 1MHCA 4PRHD 2Y5TA 4HIJB 3QUYA 3SOBH 3QZWG 1ZT1B 4GKNB 4HV8B 1GGIH 5I1CL 3A0OA 3O3AB 4TSCH 3CVHH 5CSZA 5LCVL 3RNKA 3DJRA 4H26A 4JFPB 5AW5B 1XIWC 5FO7B 3WLBB 5KAQF 3WSQH 5J12B 5C09B 2VLLA 1CFSA 4OLZL 4X7TB 3DGDA 5FA3A 3VG9B 3HI6L 3HNTL 4XH2B 4BFOA 3MBED 5FUOL 5IP4A 3LJ3A 3T1FB 4L5FE 3TBTB 2DN7A 5K93A 4EIZC 3OV6A 2NW2A 2P8MA 4V1DE 3T2OA 1VESA 4IBVA 4JE4B 3KPLA 4YDIL 1BQHA 1F3DJ 2WCPA 3FDWA 3MJ8A 4H8VA 4L4TB 1ZLWH 3SBWA 1NTDA 4G9FA 3PNRB 1BA9A 3PP4L 3LX9A 4KH9A 3MX0B 4NUGL 5I5IA 1NINA 1M1SA 5C0AA 5DEFB 4F7CA 3QDJA 1M2OA 1DVFD 2R0WL 2XBZA 5EZPA 5MEOB 4BKTC 1VADA 3BT0A 4LHUB 3W5MA 1JSYA 4YHZH 1IFHL 1AQKL 2VXQA 5BUGA 5I71C 1X7SA 2BVYA 1RERA 2W0LA 1N6QH 3IGFA 4RFOH 3QGVA 3HMXL 2OMUB 4HS3B 3X3GL 5GS1B 1OW0C 1AGCA 4NQDE 2NTFB 2E47A 4P2QE 3VFRB 2PYFA 5A16A 2HAZA 2WPGA 1LP9A 1IFRA 2H1LM 1JJUA 4MXQD 4HW6A 4C59B 5K9OA 5KS9F 1RFDH 5FF6B 5IQ7H 4PJBF 1CLYL 5ESQA 4ZFOB 3FN9A 4Y2OA 4Z7QE 2F68X 2D7TH 5LAPA 1GGCH 2CDFB 5TE6L 5LWYL 2RBLA 5D1QC 3GDCA 3L8QA 3QO1B 2DB8A 3KPNA 4A6YL 1OTUD 2HFGH 1WBZB 1SEBB 4XTRC 2BVOB 5BV7H 2YMXL 4LNVA 1E3XA 2B5IB 3SE8L 3CMGA 3S97C 3VFPA 3IDXL 1YRKA 3CVCA 4F8TA 2Y69B 3JV5A 4OQTL 3NH7H 1YJDH 3RTQB 4M43H 4ZXBC 4PY7B 2CR0A 4K0OA 3V79C 4YK4B 1HAWA 1I8IB 2GITB 1TF4A 4PJAB 1MUJA 1NUNB 1ACYH 5FYKD 1KIPB 1ZCRA 2N0KA 3BPOB 3GLEA 3H85A 4PIRF 5DHXB 5ITBH 1FYTD 1JWUB 1BPVA 2VQ1B 3JYBA 3HG1A 4PSPA 2WKOA 4G71B 1NFDA 3OJDA 5HGGS 4DP7X 4Q6IC 3NFPB 2YPLA 1EZLA 4RAVA 5D1XB 3RX8A 4RSVA 2DQDL 3QNZB 3HI1A 4LCWE 1YEDB 5B38B 5L0QC 2CXGA 3LEYH 2UWEF 4N0YH 1T89A 3Q9QA 5I5RA 2CMRL 1O7DC 2NX5B 4C4KO 2P42B 1Z3GH 2A1WH 2HLAA 3ARZA 5DJYA 3BAJA 1XCQA 5B8CA 3RDTA 1NFAA 3V52L 4EN2A 1U21A 1XMWA 2FJFA 4Y19A 2H1PL 5CIPB 1U0QA 4KKCD 4Y8DC 3PGDB 1GTFA 3K71B 1E4XH 3QQNA 2BIPA 4HWZB 1DBJL 4UNIA 4HIEA 2Z64C 1UQSB 3EH3B 4I13B 2D4DA 5HGDA 2XQYG 4ES9A 1ZVSA 2IO5A 4N0UE 1MWOA 3TFBA 3FUFA 3QH3B 2AGJL 3AT9A 3K5SA 5CCHE 2DLIA 2W5PA 2BFGA 1AD9A 4GG8B 2X1QA 4NKIL 3NSCA 4LPCA 1AXTL 3CC5A 2OSYA 5EA0L 2H0PA 2ZIDA 1OAZL 3N85H 4AGPA 4EQ3A 3MLRH 5CILL 1UWYA 1NBVH 1EEUA 1IGIH 1Y07A 3C5JA 1ZAGA 5F7HA 3MLZH 1QUNA 3UZQB 4XNXH 1C5DB 1CZ8L 1JHTA 1MQKL 2DL9A 2FRGP 5LGJA 1T4KB 3FZUD 5F9OH 2OL3B 4OJAA 1AG6A 4ZAKB 4TRPL 4DP2X 4EOWH 5I8CB 4ZMXA 4NCC2 2FIKA 4GYBA 3RJQB 3KJ6H 2J1KA 4L0YA 1IGJA 3GQFA 4KZEH 4A63A 4B7LA 2D0FA 2YAHA 3FFOA 1UD2A 3W57A 3QJZA 6TAAA 1MF2H 4U1NB 3A67L 1HQ4B 4MAYB 3BP4A 3V4VB 1I1AC 4XX1E 3WEAA 5LXVA 3AT8A 1P53A 1DVZA 1WZ1L 1AGBB 5FFLA 2V8MA 1I8LA 2N59A 2VRQA 3O6FC 3VWKB 4C83B 1R3KB 3FB7A 1L6XA 5CF3A 2JJVA 4KAQL 4RMUA 1N5AA 3PABB 4PG2C 1A0QH 3D50A 3QR2A 4KHTL 2R0ZL 4RGNC 5EUOB 4F9PC 3ULUF 2H3NA 4LL9A 5FO2A 3S5LB 3TNMA 1NAMA 3SBRA 2FCBA 1EBPA 4NWTL 5FGBC 3A6BL 5JDSA 2Q8AH 4K94L 3MNVB 1UEMA 4P2OC 4ZS6D 5I23A 4FADA 5C6PB 1BXVA 1HWGB 1M05A 4F3FA 4R7LA 2XNAA 3R8BB 3V0EA 3UG4A 1NLDL 1TQVA 3IF1A 1W72A 3NEEA 3L9RA 4H25B 4WI0B 4QOKE 3WNIA 5BZZA 4FYRA 1GMEA 2VXQH 3G6DL 3IGKA 4J6RH 1OD7A 3ZDXF 2Z92A 4JFUA 1CT8A 2XFGB 4Y4KC 4K8RH 2F74A 1MRCH 5KBNC 4JFZH 3WKYA 2GUYA 4LSVH 3AABA 4GLRH 5HXMA 1ZXKA 2P80A 5GIRA 1M56B 3TP4A 3ZKMD 4IJ3B 2P8LA 5HYFA 3N43B 3PWUA 4TQIA 1AGFB 3POHA 3QAQA 4WO4B 1KMGA 3R0MA 3UTSE 1HH9B 3JZ7A 1QBMH 4AUJA 3ABZA 4AG4H 4LP4A 1J1XL 1HNYA 2NDGA 1U8CB 3HE6C 2FT7A 2ORBL 3O2DH 1DR9A 5GS0D 4KK5C 1BQLH 4PJ9B 2EDWA 2FT8A 2X88A 5ANMB 4BCYA 3NA4A 4HKXA 1XGYH 1UH3A 3WHE1 1WUZA 4R90H 4Z0BL 4DCQB 3H2WA 4LLVB 3QZLA 3NZHH 3OKMA 4V1DA 4S1DD 4GP8B 4P5MA 3NJVA 1E9OB 1AIZA 3S3SA 5HDLA 1VHPA 4PJ5B 2W60A 1YPZE 4JG5A 3TA4D 1VF5C 3LN4B 5AOIA 4XVUD 3CC1A 4MVBC 3ZYOA 4Z7VA 1V7ML 1MREH 2QJDA 3GBMH 3NZUA 2ITCA 2W1NA 1MI5B 5L4MA 2R1WA 1EEZB 1P5UC 1IBYA 2QSTA 5ACZA 3EH1A 1IC0A 3HZVB 1PDKB 1NSNL 4O2CA 4OU3A 5KZCD 5I1KL 4FQPA 2HZHA 1TJIL 2DEWX 5K1JA 4PGCA 4ZMVA 2A9AA 1L4IA 3CZKA 5D2NA 4NQDA 1E7UA 4CMHC 5ICYB 2Q87A 4P2QA 2QQKH 3VXOA 1KCUH 4WLCA 2C1PB 4R4BA 1KT2A 4OKDA 5D5MB 4OF8A 2WXLA 3RAJL 3CFIC 3K7UA 2HRHA 5GXBB 2XN9E 4GSDH 4K71B 1U8KB 3MLUL 4LESA 3T3MF 4PVMA 3TBWB 4IRZL 2EH8L 4N8PA 1KWGA 2QPUA 2BSSB 4ABUA 2WO3B 4QRQA 4ZTOL 3CMOL 5D7JC 3P4OB 3T6VA 1S6NA 1DQLH 4FRWA 3SJVD 3C87A 2ZONA 1L9SA 2EEBA 1JF1B 2YC1A 4JM4L 4M29A 1O6SB 1VCBC 4UAOC 5IQNA 5I15L 1LEIA 2R2CA 5C0DA 4E9RA 1YN7B 4GSUA 5E1QA 4XRCA 5E6RB 3EYOB 3PGFH 1G0XA 5I5JA 5ICXB 5H4ZA 2EE0A 1ZD6A 2VLKD 1JVOA 5DQDL 1KGCE 5CGBA 2Y25A 3OC5A 5GGQL 1J0IA 3U9PH 3U6XA 2APVA 4PB0L 4JCWA 3FRPG 3TNNA 1OARH 2J6EL 2QPDB 1OHZA 2D7MA 1PZUB 4A2FA 3X12A 4A66A 4P07A 1TTFA 4LCWA 5EOCL 2Z7YA 2WZAA 1MQ8A 1J9SA 3TEXA 5IW6B 4NQVA 3BGMA 1CFNB 4R7DB 1BWMA 1DDHB 3ARDD 4B95C 4N0CD 5FYJU 3ZE2B 4DPCX 4TL5A 3CXDL 3D34A 4XI5D 3VI4E 5I66A 5EU5A 4R84A 1OAUH 3CUPB 4ZW8A 4WTQA 3V7AG 3RVXC 3KGUA 4LRIC 4WWID 2Q7YA 4J3OF 4R5VA 3BKCH 3MTRA 4K55A 4KZ0A 1F6LL 1IGYA 3ETBJ 3GHEH 1NBYA 3TH3T 1LEKB 1UWXH 3B2UC 1MPAL 1H3XA 3FO9B 4CAGA<