1YRKA

The c2 domain of pkc<delta> is a new phospho-tyrosine binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
GSHMAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C2 domain of PKCdelta is a phosphotyrosine binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein kinase C, delta type
total genus 22
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1yrkA00
4FADA 1YRKA 3L08A 4GNKB 2K3HA 4FHJA 4DK5A 4PS8A 3PREA 1A25A 2YOAA 3RPBA 4ANUA 3IM1A 3S2AA 1E8YA 4FLHA 3QJZA 4BFRA 4FJYA 3DPDA 1W16A 4Y1SA 2DMHA 2CHXA 2NQ3A 2FJUB 4IHBA 1E8ZA 2ENPA 2NCEA 3F04A 4WWOA 3P2BA 4F1SA 5CCGE 2K45A 3DBSA 3R7QA 3TL5A 2DMGA 3T8MA 1CJYA 4LT7A 3L13A 2D8KA 3L17A 3KWUA 3CSTA 4ICXA 2K4AA 4JPSA 1DJGA 4L23A 3APCA 1WFMA 1E8WA 2FK9A 3F05A 4F92B 1DSYA 5CCJA 2RD0A 2WXNA 2WXPA 3PS6A 5G2NA 4QJ3B 4QAMB 5JHBA 4PS7A 4ANXA 3NZSA 4FULA 2WXQA 4KITB 5EDSA 4OVVA 2Q0ZX 2KI6A 3HN8A 4L1LA 4EZJA 2WXOA 1RLWA 4FHKA 2X38A 1E7UA 2LHAA 4IQHA 1TJXA 4KZ0A 4MJJA 3W57A 2ISDA 2QZ5A 4F91B 1W15A 3APFA 3OAWA 4HLEA 3TWYA 4FJZA 2CHDA 2CM6A 3LJ3A 2WXFA 4WWPA 4WWNA 4L1BA 3R7RA 2A5UA 4WEEA 2YRBA 3ZVVA 2CJTA 4FA6A 5KJ7E 2WXJA 1DJZA 2A4ZA 3FDWA 5H4ZA 3NSJA 3M7FB 4LCVA 3CSFA 2JQZA 1GMIA 3PRZA 4L2YA 3HHMA 2BWQA 1QATA 2CHWA 3IBEA 1DJIA 2ZKMX 4ICWA 2WXGA 4Y1TA 4EZLA 3HIZA 2NSQA 1DJXA 4J6IA 1E90A 3PFQA 3QR0A 3ZIMA 2K8MA 3F00A 3L4CA 4XX5A 3OHMB 1BCIA 2V4LA 3QAQA 3FBKA 1RSYA 2CHZA 4A55A 1DJYA 4URKA 4DNLA 2CJSA 2ENQA 2Y3AA 2B3RA 2CM5A 1RH8A 3F01A 2WXKA 4QJ4B 4XE0A 4AOFA 2R83A 4TUUA 1UGKA 1UOVA 3ENEA 2WXHA 3JZYA 2Q3XA 1HE8A 2WXLA 2QZQA 4LDCA 3QARA 3L16A 2ENJA 3ML8A 2Z0UA 4G11A 5CCHE 4AJWA 2UZPA 3ZW3A 5JHAA 1V27A 2EP6A 2N1TE 4TV3A 1DJWA 3PYCA 3MJWA 3N5AA 1E8XA 5H4YA 3RDJA 1TJMA 3L9BA 3TJPA 4HVBA 2WXIA 4NP9A 4NS0A 4QJ5B 5G55A 1BYNA 4KZCA 3GPEA 4ANVA 5T8IA 1DQVA 4XZ4A 1DJHA 4GB9A 1K5WA 3B7YA 3L54A 2WXMA 1E7VA 4BGDA 1BDYA 4ANWA 4WAFA 4PS3A 3ML9A 3QR1A 3QK0A 4NPKA 1UOWA 3APDA 4NPJA 3NZUA 4OVUA 3KWTA 3SD5A 4EZKA 4F93B 4V11A 4TS6A 3W56A 1QASA 2WXRA 1WFJA
chains in the Genus database with same CATH superfamily
4WTWA 1AIFA 1FGVH 5HGBB 3VWJC 4AI7A 4OCNC 4RAVB 1X5AA 4GRLC 1EGJH 2FBJL 3SZKC 3HZKA 4OTXL 5C86A 3HFFA 4YVUA 3CVDA 2B16A 4YIQB 4UTCA 4PGCA 1JZ3A 2FJUB 4X6EA 1UWFA 2BSSA 4WW2F 4Z7OB 1A22B 1KT2A 3KPSB 1XB6A 5IT2L 3V8CA 4EOWL 3WIAA 1M1XB 4MQTB 1NH6A 2ICES 4DKFH 1KIPA 1AXSA 2JB6B 4NKOB 4JPSA 5I6NA 1DJGA 1TSHA 3OB0H 2AEQL 1EMTL 4GRLB 2CNZA 4EI6B 2V0AA 1KXQA 3PUCA 1FVDB 3C5XA 4HD5A 4OD2A 5DJDB 4ODBD 4ZW8A 1J12A 4HCRH 3S3DB 1SOQA 2X38A 4QO1B 3O3BB 1KELL 1PTZA 2GJZA 1GA2A 3QS2A 5LG1A 3IFNL 4JN2B 5KW9H 5C07D 5GRVL 2MPAH 2APTA 3CN2A 1IGYB 2UVFA 1JZ7A 3ARTA 4JKPH 5DK2A 2P8PA 1I85C 5I0VA 2ZCKH 4J3OH 3ULVE 1FLTX 3HZYA 1M42A 3DJRA 1U8IA 2GHZA 4JFFE 1N7ML 2YA0A 2W0LA 4UM8B 2P26A 5F3HA 1FHNA 5B7FA 4PJ5A 1XF1A 2IIJA 3QR0A 5I6OA 1H9DA 4JY6A 4HMDA 4HUNB 3WNKA 1BWWA 3MJ8B 2AERT 3H3PL 2VN7A 1D7BA 1T4KA 5D7EA 4BV1A 4FQ2L 4AKQA 1OP9A 1KZYA 1UUNA 5CR1A 4IOFD 3QPQD 3FT2A 2R2EA 3HUJF 2VMDA 4FFZH 3IFPA 5IW6B 4Z7UA 1DN0B 2E9BA 3UTSB 3WV0A 4HZLB 5CN2A 1KJ2L 5CEYA 2OLDA 3NIDB 2F58H 4NC1E 3MBEC 1CG9B 3IDMB 4PV1C 4M4PA 4DP1X 2X6MA 5KBDA 2DQGL 3UEZA 2FH6A 1N12A 2H32B 3ZMEA 1QKZL 1P7KB 4TNGA 1VGEH 3FF8A 1U8PA 3Q8BA 4QTHB 4S1SH 2D7QA 1HQRB 4HT1H 2FYVA 4N3TA 4NNPL 3S6CA 2XZQH 4W9JC 5D1ZA 1HZKA 3LSOA 4H0HB 3IXTB 2ERJB 1N8ZA 4LLWA 5CP3H 1PD1A 4OFIA 4QRPA 32C2B 5FHBL 4OZHE 5EEZA 3QWOA 1E30A 4MD4A 4S11A 1HQ4A 3NCBB 1YQVH 1PLBA 1RZFH 2H6UA 1SY6A 2ADFH 5B4MD 5C09A 5ID1A 3GQFA 4AW4A 1VERA 4D8OA 4W9FC 4N9GB 3WNJA 4LASL 4N8VB 4WSGA 4OLVL 4ZDHB 2ZKHH 4L8CA 1DUZA 1WBYA 3A5VA 5B7MA 1BOYA 2EDFA 4KK5C 3P4MB 4LF3B 2OSWA 4XO8A 3T0DA 1GC1C 2G30A 3FTVA 1T0MA 2XN0A 2YPLE 3RLSA 4D9RE 5HYJE 3T6QC 2BSRA 3O9WC 2NXZC 1TQUA 4YXKH 3NN8B 4V1DD 3OZ9L 3QDJE 5C0AB 2XIIA 4F2MA 1IGJB 2A6IB 4UOW1 1J11A 3ARRA 3C6LB 5DJ6A 5DQ9B 5I1LB 3I02B 3PWPA 4ZS6C 4LOFA 4Z7VA 5I0XA 2QADC 4PN6A 2YBGA 3KYMA 4M4RA 1UZ6E 2QGCA 4PRPB 4YWGL 5I1HH 3VSVA 1EZVY 4NAQA 5DD5H 2CG9X 4XNZB 5E5LA 4EZJA 3WTVA 2RCSL 3HB3B 5KANG 5IMOA 4GT0A 4DHLA 2Z7ZA 3OHXC 2Y5TA 4OLUH 1M7XA 2KZWA 3AM8A 3O6LH 4PWGA 1NCUA 3FFCD 4JDTH 3QG7H 4E41B 5CD5D 2XTLA 1O6TA 2E6JA 4HHAA 5FGCB 4RA3A 1RUMH 5IB3A 1SXCA 2WWMC 1R5IA 4X7DC 4GW4B 4W9ZA 1VHPA 4JUSA 4PRAA 5F70A 1BZEA 3HLAA 4XNZC 5BXFB 4MB1A 1EZSA 4XVUC 4J8RA 4WI5A 1I3UA 5D5MA 2AI0L 5IB2B 4WKZB 3OHXB 1DSWA 1OANA 2F8XC 3C2AH 3BKMH 1JP5A 3PFUA 4NJAH 4X7FC 2PWEA 4NO2A 3FSOA 4U1MA 2RMNA 1XBRA 4YX2H 5BRZA 4YDMA 1JD7A 1ZLWK 3QARA 4LPCA 3EFFB 4TTGA 3F7QA 1JZ5A 2D7OA 2EEDA 3ALPA 4J2QA 5CHNB 1UWGL 1WUNT 1ACZA 3UTTE 2B59B 5G55A 1JYNA 1EFXA 4JHBA 1ZHKA 4KFMA 5I26A 1NCNA 2QQLH 4HFWB 1G4MA 4B9YA 3BP7B 3GLAA 3KPLB 4LP5A 2OW6A 1QVOA 1GZQA 2I5YH 1D9KB 1A6TA 3OR7A 3UJIH 1CR9L 4X8JB 4CADB 4FAAB 5DHXB 4H8VA 3GZQA 1QRNA 8CGTA 4N2LA 3TFBA 2I9TA 2JCCA 5DJAA 4EN3A 5FM8A 1C5CL 3X1EA 3IMBA 4PGEB 5AEAA 1IGCL 4JJHA 3V4VH 4LSRH 4OIFA 1AE6H 5IVOA 1YPZB 4H1LB 4JFVA 2AJUH 3ILQC 2J8HA 4V1DB 4ERSL 1BPLB 3ULUE 1A1NB 1DDTA 4EI5A 5DS2A 3ME0B 2NXYC 1RK0B 3O45B 3T0EA 1RQ5A 1MVUA 5E5UB 2VXQH 4R4BB 4WFHD 5HGDB 1QNZL 2MCG1 4LT7A 2E8YA 3FB7B 1CFTB 5FIEA 2AF2A 1PG7W 2G3XA 2BSCA 4TM9A 1WEJH 1IT9L 5DQJB 4ADGA 1LO5A 5I2IA 3ZE0F 4P48A 5C0RL 4EN3C 3EF7A 4KNUA 3ZE1E 2EAEA 5LGHH 3MFGB 5TH2A 3SYPA 5CEZL 4PJFB 1K8DA 4NB7A 4IOIA 3VI3F 5B8CB 4Y4KA 1J88A 2VIRA 5ICUA 4DETA 1FH5L 4X6DB 1AXTH 4IM8A 1MJ8L 4UINH 4Z7QE 2PKDA 5C9JB 1F1DA 2N3JA 4AIOA 5HDOA 4LVOB 1NGQH 4WWKB 3D48R 2PO6D 3EYSL 1I3VA 3OKMB 4PFEA 3NJXA 2UWEB 3MLSH 1COBA 2Z8WC 5TE6L 1E5BA 4WHYG 1MLBA 3OC8A 4BFFA 4NUMA 1YN6A 3FUJA 1UA7A 4MAYA 4KJPC 3P9LB 4PJEE 3SE9L 2ALWA 3WBDA 3GBEA 2JJTA 4ZUSA 5GHWL 2BWQA 2JE8A 4FI6A 4LXFA 2YD7A 2OMVB 5EU4A 1X5LA 2IDCA 5I1LA 2I07B 1S9XB 5IMLA 2CK2A 1LE5B 4HCRA 4MA3B 4LNVA 3T08A 2QSQA 5BS0E 3L5HA 3IDIB 3KS0J 1MG3C 4ZMQA 1ZJBA 4QXUH 4XP9L 1D9KD 3CH1B 3SYOA 4U1MB 5E1IA 4P4KC 5HHPA 5J1SC 1AJ7L 5IMOB 4OTXH 1OARH 3Q48A 1T7VA 1DQJB 3VVVA 1OV8A 1QKZH 1SUHA 1HXMA 3KEHA 5HVFB 3NEOA 4WI2A 4L4VD 2B4CH 2X6BA 2CBTA 2GSMB 5KUKA 2UY6B 4WU7B 3RWEA 1U4EA 3BVXA 3HMWH 1QBBA 2XZQL 3CZKA 4Y1AB 4U1LB 1BSIA 2P42B 3QI9A 4PRHA 3M8OH 2YN5A 2QKIA 3CUPA 1CLYL 3NCCB 3HPLA 2X1XR 3NCJH 3K5RA 4K3EH 4CMMB 1YG9A 2UY7B 3SDXA 4ANVA 3FU3A 3MRRB 3OQ3B 4KVPA 1QUNB 1YN6B 2N59A 4G7VH 1X6NA 4ZPTB 1RK1A 4ODXA 4A38A 3PNWA 1J8KA 2BVUA 3Q01A 2E4TA 1MHEA 2WBJC 4JFZL 1PVHA 3NH7L 4OR1A 4RMUA 4JB9L 5IROD 1GSMA 1MJUH 4NQVA 3BFOA 1MW3A 4IKIA 1HOEA 2EDDA 1Y6KR 1RZ7L 5L2JA 3KPSD 3C75A 3DPDA 1PIFA 4UT6L 1XMWA 4FYQA 5B3JE 4IS6B 3MREB 4U3HA 1QX1A 5E2WL 4KKCD 1Z5YD 2J88L 3CU1A 1N0LA 2Q86B 5IB4A 3H9SB 2GTQA 4F8OA 2BMKB 3WEBA 3FN0L 3LKPB 5FCSH 3S88L 4BQBA 4R2GC 3UP6A 2M2DA 4PJBB 3QULB 4LQFL 4Q74A 4D9QE 4XP4H 4JG0H 5F3FA 4A04A 2ICWI 1AO7A 2AEIT 4X6FA 2K3TA 1L9PA 4NOBA 4OCSL 5TD4A 2JI1A 5BQ7B 1BA9A 4PRBA 5DRXA 4AMWA 3KDPB 1SMDA 1DBKH 5A6IA 1GJWA 1MCWM 1IBDA 4HU8A 3V7AE 4BRVA 1UXMA 2YPVH 2CH8A 3GTTA 3BP7A 3MLYL 4C56B 4I9WD 1MXDA 3LNFA 2ZWZA 4Z0BH 3DECA 5DS1A 4AC4A 1AZBA 1UXSA 3GSOB 2JJUA 3DX4A 4A66A 2R59A 3O4LE 2B2XH 3DX7A 5DQJA 5IVZB 5DRZB 2VLLB 3IDJB 4L4TD 3QZNA 4JUTA 4U1SB 1NBQA 3JV4A 4Y2OB 4ZPVA 4L1DA 5D7LB 1L6XA 3HVNA 5KYYB 1GYWA 3UC0H 3ZTNH 3QQNA 4YBLC 4OZFH 2XFXB 1VEPA 4QGYA 4BH7B 4N1CA 2RIKA 3APNA 4GRWH 4F7MA 5CBAA 4JZJB 4QO1A 5LBSA 5FYKU 2IALB 3FN3A 4BK5C 3L4YA 2ZCHL 2DKSA 1UJTA 3BAJA 2YXWA 3PXJA 3QHZL 3QUZB 2P5ED 3CN0A 1WZ1H 1QFHA 4MJ6B 3HHRB 1NCDH 3QO1B 4ZQKB 5IREA 2DWDA 1DQDH 2VDNB 5GS2D 2YAEA 4PRDA 1BZQK 1KYOJ 1RJCA 1Z0NA 3FTZA 3OZ9H 3UJIL 3B9KC 2GG1A 5F96L 5BZDB 2J1XA 2XN9D 1VIWA 3C60D 3GGWB 1UT2A 3LSOB 4WI0B 4GBXA 4JHVA 3T0WA 2EDNA 2B4CC 2FDBP 3NIFB 1VFOA 1CXKA 4HJ0D 4RNRB 3UBXB 4UM9A 4U6YA 4WEBH 4RMTA 5ACMA 3PGDB 4BEIA 3QUZC 5IJDC 3POHA 4P23C 4IU2A 1GC1H 2GT9B 1JK8B 2F1EA 2ZX9A 4FQXB 4HHWA 3G6AB 1TT6A 2XT1B 1YEGH 3L3DA 3APMA 4BK8A 4FNLL 3UMTA 5DJAB 1A4JB 3FT2B 1ZHBB 2OZ4H 4IJ3B 5T3ZL 3SN6N 4KAQL 4NCC2 3HE6C 4PJ8D 1ZS2A 1QSED 1ZLUH 4F1SA 3BQUD 2AQRA 2KDGA 4MHHG 5CD3B 1ZVNA 3TCTA 3L1GA 3L17A 1AS7A 1CK0L 3DO4A 2EDKA 2WPGA 1Z5LA 4FQXC 3ZKQD 2F61A 4I0PD 2BNQA 1EERB 3MO1A 3PQYA 3EH4B 4JFXB 3QDGB 3HBGA 1IGIL 2O5YH 3TVMA 3QIWA 4U1NA 2ZF9A 1A0QH 1MEXL 5CJOL 3MTRA 4FHKA 4TLKA 2A9BA 3V4UH 4JANB 4PSRA 1E28A 2JIXD 3Q8CA 2ZUYA 4KJWD 4QRTB 3T3PF 5CLTA 4BUQA 5E8PA 4ZYKA 3MJ6A 2V7NA 3GSQB 1ZANL 2PP9A 2YO3A 3H2QA 2I7OA 4X5XB 1AZRA 3VH8B 3FONB 1KIQB 3MBEA 4KHXL 3HC0A 4DP9X 5HDQH 4R8WL 2VERA 1D5XB 3VACA 1JV5A 5F89A 3UZEC 4XN8A 1IE4A 2WZPD 2VISB 4Y88A 2YLHA 2GCYB 4L9LB 4O02A 4BDVA 4KRPB 2IFFL 4Z3GA 3Q2LA 4BH7A 2ZUXA 2J44A 1A6UH 4FZ8H 4Z0XA 1IGCH 3V4VL 1XTLA 3ZUCA 5KYYA 4N0CD 4IRSA 1KGWA 4DN3H 2HKFH 4LB8A 3SE4A 2HSIA 2VC2B 4NZRL 4DEPC 3NZ8B 2VM4A 4RMVA 4RMWA 5EIIA 4XNYL 3STBA 3TNNB 4UQ3B 1KGCE 2A6JA 4F15B 1F3RB 2H45A 3IU4H 1HI6A 3QQDA 4UIMB 5E1GA 5C6TL 4QYOA 3HMXH 2E7LC 4MD0B 1LP9F 4PG9B 1HYSD 4QDGA 2Y0SA 1INEL 5IGXH 2CDEB 3HAEA 2DLGA 1B9ZA 2NZ9C 4YPGB 1DQIA 4KRPC 4UT9A 4XCCL 2LE9A 1E0OB 4D0BB 3ZHNA 2ZAHA 2ZXWB 4MZIA 3BFWA 2V7NB 3QUYA 3A6BH 4JB9H 5BZDA 1IQWL 2EDTA 1MI5B 4AQAA 1JNNH 3CE1A 3HS9A 1T22B 3T09A 4JE0A 3V4VB 1KB9K 4LP4A 2QTVA 2XWEA 1L9MA 2R27A 3N40F 4JR9L 3MGOA 1ACYH 1A6VL 3H42H 5IMMB 3HE7C 2PO6A 4OGXH 1SF3A 5SWZA 1T03L 2BSDA 5EOCH 4NKMB 3IXAA 3VXRD 3UAJA 1E5YA 3H7BB 2JQMA 4NQDE 1JBJA 2IALA 2VN5A 3IVKA 5IF0B 4WFED 1F4YH 3AU1A 3H1ZA 3IETA 1A9BA 2AHIA 5KSUA 4AV4A 2DF3A 4OFPA 5J11B 4JKWA 4YDIL 4N2NA 1NGXB 3LQAL 4BH8B 3TS8A 3VD9A 4JFYB 2VLLA 1D5ZA 3RFZB 2C3HA 3QUML 1H5BB 3II1A 1CTOA 1Q9LA 4AZUA 1C8PA 2KC0A 3RBGA 4G83A 1S46A 2X87A 4LHUD 4KZEH 1UWEL 3DUSB 3LKOA 4I18C 3VDAA 4GQQA 5EOCJ 2XIDA 2QKIC 5CCJA 1I31A 3ROOA 5J3HD 2NY7H 1F3DJ 3FC8A 1DBKL 3V9EA 2VRAA 4QOKE 3WFHA 3ARPA 3RWCA 3RIFK 2C4FU 5I6KA 4RGMC 4GSQA 3IFNH 3RFZC 5I5IA 1XIWB 5K9KA 1FFNB 1XV8A 3MGTB 4ZX5A 1UOLA 5H2BA 4L0YA 5IOPB 4N0YL 4DFHA 2A5UA 4GRWE 3BEVB 4GEJA 3SBWA 4I18B 2YJLA 2X44D 2ZXQA 2QKIB 2NNAB 3RWFB 1Q72H 2J8UE 3HS0A 3I6KB 4QRAA 4TRPL 2ZKMX 3GSRA 3V6BR 3FRUB 1J9QA 1WFNA 3IJHB 5GRZA 5IROA 3PFQA 3ALWA 4DTGL 4RGMB 4NRZB 3IKCA 4UB0H 4ES8A 2X4RB 1ZDSA 2VDLL 3QH3A 3ZTJH 2WN2A 1RPQA 1SXAA 1WZ1L 1SQ2N 2H1LM 2ZYSA 1OAQL 3O2DL 1RH8A 1PLAA 4O2CB 3VWKD 1VDGA 5A1AA 1OT4A 3O6FB 4WV1B 1CTNA 3IBOA 3TCLA 3KWVA 4P9MH 3UBFA 5T1LB 1OAXL 4M62L 1VSCA 2N01B 4TNWF 2VR3A 4TUJB 3KPSE 1G87A 5BZWA 3D2UA 2G75B 1T89C 3TIEA 5A2AA 3FK3A 1VGEL 4MYPA 4XPAH 5GISH 4BQ9A 3MQIA 3SPVB 3CDCA 1DVTA 2BDNL 2CKBH 5LKNA 1MRCH 2VSKB 1IAII 1TJGH 2K70A 2OX5A 1ZS8B 1Q90A 5D2NB 2IBZX 2WXMA 3ZE2F 1F97A 1VEOA 1XGTA 4DKEL 2AV1A 5JOFB 4IK7A 5T1JA 4FZEL 5PAZA 1DVFC 2J2ZA 4OVUA 2AJ3A 5F3BB 3EZ8A 4A6YA 5D1ZI 3O6ML 4QMEA 3WEAA 1DANT 2BC4B 4AYID 4DF9A 3CZFB 1X4YA 5TDOA 4DK5A 5FFLA 3N04A 5TE4H 4PGDB 1S7VA 2AJYL 3PDGA 3UGUA 3QO0A 3BUBA 4G6JL 4HIPA 5DZLA 2K9UA 5FYKD 3WUWG 4QRBA 1FIGH 5GGTH 3BKJL 1G6RH 1I8KA 4G8IA 3FQXB 1TVBB 3U30B 4HX1B 5CSBA 5LQBL 3ULUF 3GI9L 4JCLA 4PJ7E 1ZIBA 5DVKA 5CLZA 4ZFFA 5BRZD 4FG6C 4JO2L 5MENB 4XNXH 3CSBA 1B3JA 2GEEA 1PS3A 4JRWA 4P2RE 1DSYA 1WD9A 4E9SA 1WFTA 3CFCH 3DX0A 1XFPA 1FLRH 3PDDA 3ULVD 5SX5H 3IDXL 1GW0A 3K72A 1KCSL 3OR7B 4TKWA 1U92A 3BD3A 1SHWA 3OAYK 3UTSE 4Y4KB 5CSZB 1GGIH 2AP2A 1YEDB 4Y2NA 3VWKC 4N2OA 3MRKA 1UH3A 2FHFA 3E9TA 3KG5A 3MLWH 1TZHB 4L0PB 4OT1L 4WO4A 5DD0H 3X2QB 3P73A 2R56H 3FT4A 4DEWA 3H7LA 2WAQA 1DVZA 4H20L 3UPRA 5T1KA 4G6MH 5B39B 1AQKL 1U30A 4GAJH 4ZOEA 2WMPA 3ZDYF 2EABA 4JY4A 2OSYA 4AE1A 4UYPA 1PZ2A 3FTSA 3L1OL 4N8PA 5I0ZA 1NUFA 4XVTL 2P4AB 4WY7L 3II3A 4PEEA 4AQ8A 3EJJX 5C0BE 3HG1A 2ERJC 3P0VH 1CE6A 1B4LA 2GHWB 2ZWSA 4H8WH 4G72B 2OA9A 1LO3L 1JUFB 2CR0A 3SDDB 2EDOA 4KAQH 5KS9F 1HOCA 2J6EL 3L6FB 3BXNA 4FFTA 3U83A 2WP3T 2ED9A 3OB0K 1QACA 3WSQH 2E76C 4FTVE 3TPUA 1IAIL 2YWZA 3RX8A 4JPIA 1A9EA 1UXWA 2VZVA 3MNVA 1HNGA 2X4NB 5JR1L 3MNMA 4PWKA 1YNTA 3WY3A 1NL0L 3QJRB 1EO5A 2B9BA 2PR4H 4AC2A 2CK0H 4JKMA 1KC5L 5ICYB 2HVKA 3S36L 2PPFA 3KPOB 1EEYA 5C3IA 3FO2A 3FHQA 4W81A 3VXTA 4JPWH 1T0NA 1MPAH 3UBHA 3C08L 3C6LC 3SDDC 2RTTA 2DMKA 3FCTA 1OOWA 4IOIB 3H4HA 2WNWA 4OGYH 4YHOL 4FFVC 4AX3A 1NIDA 2G3NA 5C0BD 5HY9A 4XCEA 4BFOA 4HKZB 2P7TA 2BSED 3ASOB 4P5MB 4PCSA 3T71A 1RCYA 4PVMA 2IJ0C 4K55A 1EHLL 4NM4L 1E5UI 1SEBB 4Y1SA 3X11B 4X6CF 3P73B 3ULUL 4F2MB 1UB6A 5DK3A 4E9QA 3P2BA 2AXGB 5AB9A 3BUYB 3OJDB 4XI5C 2VJ8A 3OL2A 5ANMB 5IHLB 4JKNA 5EC1A 3U4KA 3DX9B 3ELQA 2YPVA 3ZXAC 3SE3A 5KAQG 5JW3H 4RESB 3D69A 1WFMA 4ISVB 4MWFB 5EUOF 1DFXA 2WO2B 2NW2B 4HXBH 5G2NA 1R3LA 1J0KA 1CL7L 1U3HC 2OJZL 2KLRA 4U2ZA 4K3DL 4UAOB 2DDQH 4NUPA 2Y5TB 3EGSB 1QFPA 4BWUA 2PW2B 1NFIA 3MRNA 4QIRA 4A68A 2VW6A 3ILEA 1BVOA 4X6CA 1W72H 1D7CA 4LKXA 3T0AA 3F85A 1BD2B 2OTWA 3ZMNA 1EHAA 5DFTA 5KW9L 3BMVA 3RTQB 5GS2H 4Z5RA 2WCSA 4YHNA 3NRFA 2D31B 2GI7A 1QSVA 2XTJB 3FQXA 4M8QA 1SFHA 1Q9OA 3FDWA 3PXHA 1D6VH 1SEQL 4YLBA 3UTTB 1NGPL 5DRNB 1B6UA 2ZNWA 4Y1AD 3U2JA 3VX1A 4D3CL 1U3HB 1HXYB 5L6YL 4G1MB 1TMCB 3QNYB 4HCGA 4JN1H 2FT7A 2Z6FA 4PI2A 3D52A 4MCZA 4UQEA 1N4XH 2V5SA 3U6RB 4QXUL 4BFBD 2BNRD 2COVD 1IKNC 4X99B 1P7QD 3DO7A 2O61B 3TN0D 1AJ7H 1ITBB 3WFDL 4XVSH 5IEHB 1NDMB 3B34A 4UNUA 1D9KC 4V1DE 2ZKYA 2ZYIA 3B5HA 4HBCH 1NEPA 5CKGA 5GIRB 4Y4HD 1FQ9C 5GS0C 1W0WB 3RKDC 4U1KB 1F0LA 4KKZA 5LAXB 3T4AA 4D0DB 1KTBA 3BPNC 3TPUB 3BZ4A 2WKLA 5MENA 3VH8G 5I1AB 1PNCA 1DJWA 4NEHB 4UT9H 4DZBA 1AOZA 5T1LA 1LO5B 3U1QA 3BXNB 3WHXA 4YDZA 2V5MA 3BZ4B 2ITEA 1RIUH 3ZE2E 1A3RH 5D1ZB 2AJXH 2O5ZL 2ZF8A 2R4RL 4AQ8C 2FIRT 4BZ2L 4FQXD 1THAA 3WEXA 5DMYA 1PY4A 2TRHA 3M45A 1KGXA 2NXYB 1F11A 3X1GA 2GJZB 3AAZA 1GVIA 3MV7D 2VWEC 4RCAA 4DVBA 5B39A 1J0JA 4P5TA 5HY9B 3OPZL 3BPNB 1KJ3H 4HKBA 3VD4A 4O02L 4Z7QB 1RV6X 1S7UB 5A7BA 4FYSA 3HC2A 3GBMH 1CD1A 1H6EA 5HHNA 1ZGLP 2QPSA 3KR3L 3KPRE 4BSVB 5JZ7C 4AH2B 1PU0A 3BEVA 2C9AA 2ENPA 3EFDH 4N24A 2R23B 3K8MA 3P9MA 5JORB 3D85B 3MBWB 1NCTA 1RVFH 3BWSA 4LVOC 4WWKC 1UXWB 3EJUA 1E4KC 3MUUA 4NM8H 5F9DC 4D0CA 2Z9TA 4LSTL 4NO0A 4NAJA 2GSIA 4TUJA 4ZFQA 5IR1B 1DQTA 1ULVA 3IJ7A 5LAPA 4PJAE 4HWBH 4U0QB 5TDNB 4PJIB 1HHKA 5AVRB 4LZKA 3U2SA 2H26B 1TEGA 2XYCA 3F83A 2ZXEB 5AW4B 5SWSD 2OS7A 5IBUB 1KB5A 3SYAA 2PPDA 2XN9A 4OCSH 4MB4A 1UWYA 2BNRB 3B2MA 1AQDA 1YNLH 1TPXB 2VMJA 4MJJA 2NY6D 1EJ6A 2QZ5A 3O4LD 1SUJA 2R0KL 1U58B 3G9VA 4WHTA 3KCPA 3QBTB 1FC2D 2XQBH 3BUQA 4KI5D 2DKUA 4DGVH 1NCWH 1JTPA 1JZGA 5KOVC 4ZO9A 5DXWA 4G42B 5BRQA 2NNAA 4NENA 2K8QA 3AXLB 3IJYB 3LH2H 3H0TB 4N2DA 5JXEC 1P4BH 2CMRL 2A1WL 3LPGA 3BP5B 5BO1H 4YHYB 4YFDB 3TU6A 3BQUB 1DJYA 3BPOB 3MXWH 3EO1A 3BN3B 1MFCL 3T3MF 1BXVA 1VCAA 2H3NB 1U8OA 4HLJA 4NKDB 5J5EA 3N06B 3KHOA 2DIJA 1CU4H 4WU5B 3ENEA 3MGAA 1S7XA 1CIUA 2WBJB 1FWXA 1ZV9A 1PFOA 2CKBB 3B9AA 3G5XB 3GTVA 3RNQB 2YEZB 4M6NH 1LWJA 2EC9U 5CD3A 3BDXA 3DXAA 1DBAH 1KDJA 3C6EA 4KZCA 5GRJH 3BPOC 2VN4A 4FL4B 3NUKA 5INCA 4MS8C 1LDSA 4G8FB 3EGXA 5JXAH 2I5YL 3NP3A 1J5OL 2Z93A 4K71B 2X4PA 1V05A 5IB1A 4E5XA 2CBPA 5DJ0A 2H1PL 4ZQTA 1S9KC 1AGFA 3X3FL 4PBWD 1P4IH 1MHHA 4JY4B 4PM1A 5E24E 1XR8A 3MV8B 3RVWD 3ECBB 4HS6A 2H2PD 1BVLB 1G84A 3N43B 1G7HB 2CLZB 2FNBA 4W4OA 4QNPE 1ILUA 2EDXA 1QA9A 3DWTA 1J48A 2QADD 4HJGA 2DJSA 2V9TA 4OKVA 3GFUA 2PPEA 1R3HB 2NY4D 1Y6MR 1TMQA 1Y1UA 5DWUL 2XV6B 3EDDA 4UZSA 4ZMLA 5IQOA 5EN3A 4PJXA 2WUCL 2JQAA 2JV6A 4MNQA 1MJ7L 4LMQE 3L2LA 1IEAB 4JO5A 4LLQA 3HFMH 3OX8B 1WIOA 5ICXA 3CFBA 3WFHB 2PTTA 3HG0A 5GPRA 3QXAA 4G1EB 4G8AC 2LVCA 3BP6A 2APWA 3BQVA 1DFBH 1V7ML 4GH7B 2ZWKA 4FFVD 5GJSH 4ZOCA 3FTYA 2VRKA 1CXLA 1OE2A 1J7VR 3E8UH 1E27B 3AVEA 2VJXA 4A6YL 4X0KB 4ILDA 3VFMA 1AGCA 1PMYA 3GJEB 4MXWL 3SY6A 2R2HB 4M7JL 1NGQL 4MQXD 4XNQA 1HSBB 3W0WB 2V2XB 4XPHL 4DCQA 3IDNB 4JZJC 5E8EB 1M7IB 4H88H 3GSRB 3BLKA 1N4XL 4MBRA 3PRZA 4XN4A 3B5GA 1AC0A 5KN5A 2X0UA 2GEQA 3RY6C 1I4FA 1DJXA 2VAAA 1CXEA 3NCWA 3UXFA 3VSUA 1JK8A 3ALXA 3HI5H 5CJXA 3EYUL 4OF6A 5JLZB 3H9YA 3KLSA 2ICEA 4JFOA 3VTMA 4CN6A 4LEBA 5DURB 4C54A 2OI9B 1FORL 2ITCA 4X7CC 4F80A 4JREB 4JHAH 3JYBA 4BE5A 3CN4A 3CHPA 4YHKH 3VDCA 3SBRA 5BCAA 3O3BA 3CSPA 3LMJL 1KXQE 1UM6L 4TQIA 1OARL 1T1ZA 2IAMC 4BHUI 5JYLA 5JDSA 4TSCH 5F1OB 3GZOA 3V6ZB 3G04A 3HAEB 2UXTA 3V0JA 5LN4A 2IFGA 4AMKH 3S5LB 3IS1X 3REVA 4D9RD 3EO0B 3OB8A 2GB2A 1JNHB 4MD0A 1URZA 2AANA 4L18A 1N0LB 2Q86A 3M8OL 1NC4B 1J9RA 1HSBA 4I77L 4IRSC 2VO5A 5JW3L 1T5XA 3FFCA 5EZLA 1LE9A 3IFOA 5CKAA 1WIPA 3GD1C 3QGVA 1LK2A 4JFPA 5KSAB 1KXHA 2XI9A 2JJSC 3H3BC 1ECZA 3EYFB 4HC1H 1V7NL 3RNKA 3HN3A 3QEGL 3HZKB 3SDXF 1JWUA 4N0UA 2JCCF 4KUCF 3RX9A 5E99H 3D39B 1TOXA 3H55A 5EO1B 1KJVA 5I1EH 4YLCA 1XSKA 2NUPB 3OMZA 4R97B 2BP8B 3MTXA 5ISZA 1P7BA 5EO9B 1RJYA 2QQKL 4FQ1H 1BLIA 1JYVA 5FO9A 3OZKA 3UZQB 1AHMA 1HNFA 5DWPA 2ED8A 4L4TE 3ULSA 2A4EA 3AQXA 1E9PB 5ESAB 1EGJL 2WW8A 3JWNH 1CFSA 2CZNA 1CUOA 2YMOA 4HKJB 1GOGA 1YC8A 2FB4L 4IKNA 5E2VH 4Q58C 2DWDB 2FEEI 3FT9A 4HT1L 3TN0A 5SX4H 2D0GA 4JAMA 1M2VB 4JPKH 4KKBD 4P4RB 5IT2H 1DQJA 3ARGC 4N6QA 5JW5A 3WJJC 2Y7MA 2E47A 4UQ3A 3S5ZA 3LN4A 1Q38A 3LY6A 3QDGA 4NRXA 1TSRA 3LNHA 4XX1E 5C2UB 3MZTA 5D6CA 2AMGA 1CGVA 1MCRA 2CCLA 1RP8A 1MCOH 3ATDA 4G8EB 4KK8C 3K4ZA 4AT6B 1DVFD 2HYMA 1I7UA 3TC9A 3T65A 2CHDA 3ZVVA 5D6DA 3QPXL 4MAUH 1NUDA 3IMUA 5DZOA 4JDEA 1ZLSL 4KDTC 1I1FB 5D1XD 1EVTC 4MMYB 1I9JH 1SN2A 3E3QE 4YFLI 1I1YA 4OJFL 5D7JA 1LD9A 4EZLA 2VXUL 4K5LA 1M7DB 1UT9A 4BSJA 3TBWA 2WWMD 2X42A 5ICXB 4M5YH 5C0IA 4OCYL 5K1JA 1TLMA 3D07A 1BQKA 3U46A 1LP9A 4JG1H 5ELIA 1BZ9B 5D1XE 2G5BA 5J9PA 3HNTL 1U8LB 2Y72A 3D50A 4FF9A 4JQVA 4JFED 4LDEB 3SBQA 4P9ML 4TVPH 1EQWA 1I8AA 3RIKA 3VTAA 5GS0L 4ODVH 5FB8B 4IKJA 1DVQA 2P48B 2KT6A 4PG9A 1BEXA 1KIUA 1N0XL 2XUWA 3WY4A 1EWHA 2OMYB 4KKQA 1A7QL 4J3VA 5J11C 1OPGL 2A9CA 2ATKA 4GB9A 3WELA 4BBWA 3D5OF 4JY5L 2E6QA 1CXIA 4S2SA 4GG6F 3C5ZA 1R5WB 1F5WA 4LVHB 1H5BC 3JTTA 2P8MB 4XN1A 3FS9A 4YDLB 2YBRA 3GSUA 3LRMA 3DSFH 1BVKA 2CA3A 5DRWB 4O00A 1QRNB 5EN2A 2VISA 2BIPA 3O6FD 1YEGL 2GT9A 3PREA 1E43A 5DRNA 1OGPA 1LMIA 2C1PB 1Z9SB 5T33H 1MRFH 4QGTA 1FNSH 5L4JA 2GSGA 5A7EA 5F0MB 3L3OC 5AENA 2EYTB 4NKQB 1V3JA 1U91B 3ZL4H 3WNNA 3SPIA 1XIWC 2OK0H 2VMCA 1ES0B 4LVHC 5H4ZA 3LQZA 2I27N 2C34A 3T6ZA 4QTIH 1TZIA 1FYHB 1F13A 1RXLA 3WO4C 1SLVA 5AVVB 3V0IA 1HIMH 4ISVA 3K8LA 3QUZA 2YS4A 4DVBB 5EUOE 5T3XL 1QHPA 3RWGA 2VLRA 1KCVL 1O7VA 4ZMZA 2KI6A 1GZHA 3L3OB 4HJUA 3CCHA 5IFJA 1A8JH 2KUTA 3A21A 1DSFH 4IOFC 2VW4A 5LCVA 4U1HA 3FB5A 4XPTH 3EDJA 4N90E 3L4UA 1L7IL 5DD0L 2F8IA 2YHGA 1BYOA 1DLHB 2YRPA 3HB3D 3KGRA 4XMKL 3RDTC 4Y2LA 2CJTA 4NNXA 3NIGE 1AFVH 1IAOB 1JGLL 1R5IB 2X6AA 4DW2L 1QBML 3O6FC 4MHHI 5LGJB 1ODAA 4WV1C 3WO4B 4NQEA 5D2NE 3ELAT 4AEEA 3PXLA 2H0FA 3TVMD 2V5TA 4AZ8A 2LR4A 1IGMH 3PWPD 4HK3J 3EIFA 3ZDZB 5DJCA 4GSDH 2XVKA 1OHQA 3U2SB 1BV8A 5AD0A 4WUKH 2O61A 1QEWB 2H3NA 2FLRT 1ZLVK 4V2CB 1IC5H 1SY6H 3W9DA 1PDKB 2BZ7A 3RDTB 5B8CA 3BQUA 5HDBE 2OMTB 1FO0B 2YQBA 4DN3L 4K23H 4GEIA 1UGKA 1DVFB 4ZG1A 1RPKA 2ZUVA 4HS3A 5JORA 3DGDA 1XF3B 3LX9A 5DA0B 3BKML 4QRRA 1E50A 2J6EH 2ICCA 5AVTB 3C5SB 1ET8A 1SXSA 4JQIA 5I18H 3WSQL 1YA5A 2GFBA 3VQLA 3EFFA 3AJ7A 1EVUA 5H4YA 3S3JA 1GMEA 4BCXA 4ZQKA 4FMVA 2BIIA 5MP6L 3H9SA 2XFGB 1LTXA 2IGTA 5E00A 4DQAA 3BI9X 1AANA 1V7NH 1SJEB 1CICD 3U30C 4HP5A 4IU3A 2F53B 1HL9A 3OPUA 2X05A 4OFVA 3UADA 2OYKA 4PJDB 3NJFA 5F7WC 3LRLA 4GAYA 3VQMA 3QR1A 3RA7H 4ZX6A 5GZOA 5IB5B 3ETBF 5FYLH 4U1SA 4Y2OA 4ZPVB 2WQUA 5F7AA 1BGXH 3ZYZA 3GM0A 1CR9H 4IRJA 4WJ5A 2FHCA 25C8H 2ZXBA 4FLHA 1WAAA 4JM2D 1J8RA 3GXFA 3IKKA 3WMSA 5E2VL 2GUOA 2R0LH 5H35A 5L8LB 4E41A 1H8NA 4HETA 1VFBB 4B9IA 5DHEA 3LRSB 4Y4KC 4E9WA 4F37F 2NPLX 3ZE0B 2V37A 5C0IB 4L4VA 1A66A 2WTOA 1QBLL 1FRGL 2IANB 4R5TA 5CHNA 3FH8A 4LMQI 3MROA 1E8WA 4JPVH 1KXTA 2WC7A 3VU1A 1T83A 2L8AA 3L1FA 4NRYB 2P8MA 2WYHA 2Q20A 2HKHL 3PWJB 3OC5A 2JJTC 3QEHA 5J6HB 2P5WD 4Q4IA 3VCLB 3D4YA 3IE4A 3K0WA 5IBTH 4F7PB 3T65B 2EICA 4PJ8C 1WDAA 3LKRA 3VRJA 2JKTM 2VN3A 3QUYD 3BDYH 2BOLA 4X80H 3WJMB 3MNVB 3B3IB 1BVZA 2G60H 4FHBD 3BT2L 3ZY7A 2MH4A 4RQQB 5EMYA 2V9RA 3WHXB 1NIAA 4M48L 1V8HA 2J7LA 5E6RB 3S35L 4OLZH 4YHZH 4JVWA 4WNSA 3SE8L 5F1NB 2ZWNA 1OM3L 3M88A 1A6PA 1AG6A 5F9JA 3O81A 2HG5B 3QNZA 2N7AA 4NQVB 4EE2A 2NW2A 4PJ8B 3IJSB 4XXWC 4XMZA 2Z7UA 1OL0A 4XRCB 1J9SA 1CXFA 1QZ1A 1PSKL 1I1AD 1P6AB 4OD2B 3MUGB 3OJDA 2FAUA 3ARGA 3FB8B 3WS6C 3W2DL 4OZFB 1TYRA 1THCA 2VM3A 4JM2C 4MCNA 5F9WC 3VI3E 5DJZB 2XQ0A 1UVQB 3I02A 2QMKA 4UBDD 2VXVH 3JV6B 5EBWA 2WINA 4KKLD 3FTUA 5ESVA 5CEYB 3ATBA 1KT2B 3KPSA 3MLYH 4AT6A 3Q06A 2LFGA 2MQGA 3RUGB 4XCFH 5AG8A 1BMZA 1H9VA 4U6TA 4FA7B 5T8IA 5D6DC 5AW1B 5E1AA 1MZYA 1EEQA 2X4OB 1T0NB 3TOPA 2MSPA 1BDYA 1H0DA 1V5JA 5DO2D 2E56A 2A9AA 4FLQA 5HGBA 3OPZH 5EBGA 3RB5A 1MFDL 3EH5B 4N0FB 2IWFA 3OKEB 5T3ZD 4KRNA 1FL5A 1EHKB 4OD1H 1BD2E 3WJJA 3MV9D 4BK4A 1YYLH 3JUYA 4DUVA 2WTRA 1PJWA 4MA8H 3V0GA 1CFNA 3MLRL 3QJZA 4GIPD 3ARDB 1JS4A 4RX4D 4UQAA 2B0SL 3P77A 2V9QA 4PLNC 2G5BB 3ILPA 4WHCA 1G7IB 5FO9B 4DGYH 2HRPH 4PJGE 1F4AA 5BV7B 4KKAC 1TVBA 2ICWB 5TQ2H 2O5XH 4LSPL 1NAML 3WN5A 2IPUG 5K9OA 2PUQT 1CG9A 2UUDH 3U0WH 3ZTEA 5BUAA 2BVYA 4IBQA 3IN0A 1RIHH 1FC1A 5EFIA 5IK3A 4XNUL 3MCKA 5IEKA 4PP1C 2DJ4A 3PWVA 3ARDC 1E2WA 4OVVA 4JO3L 3SQBA 4NJ9H 4B9CA 4NBXB 1ORQA 4KQ0A 1RLWA 2KH2B 1YNLL 1TUPA 2H9GB 1JGLH 4DW2H 5KANI 4ZXBB 3GHBL 3CQPA 2W65A 1TJXA 2MCPH 4IKKA 3UAFA 5J89A 4TN9A 5KBNC 4GP5B 3NIGF 4Z3IA 3REWB 5JHLA 4HUVB 3N55A 4NQEE 5BV7L 1FJ1A 4AM0A 4AYFA 1F42A 4EO5A 1YEDA 4P5KB 3UG3A 4Z3EA 1B0RA 1D2PA 4LQ1A 1U8IB 3QPKA 3AU1B 3GI8H 5FW6A 4HF5H 2QDWA 3FQYA 4WHYH 4Q9QL 4A7SA 1JHLL 2I60L 1CGUA 3HIZA 4KUZH 1XCXA 3LPPA 3MUY1 4GAJL 1NSNL 2C9UA 4ZXBC 4NQDA 4AYMC 3GMNB 4O2CA 1V54B 3V4PB 1RMFL 1JDDA 3D3VA 4Z0BL 3NAAH 2DYPD 2RALA 4XZUB 3QB7C 4OB5H 1FFPB 1E9OA 4YPJA 1KBGH 4Q97A 4DUXA 3ABKB 4LOVA 4UM9D 1FL3B 3CDGA 4AOFA 4XPBH 5ABZA 3KPRB 3QYNA 4GMTH 2P5PA 4TSAH 5I66B 1BVLA 1CCZA 4R5XA 4N2IA 3W11D 4GYBA 1NCCH 2H2SC 4OCRL 4QXVA 3B6SA 4NKOA 5HYFA 3QIBB 4C58B 3BCFA 5IFHH 3WHE0 1XF5B 3L9BA 4LOUD 5A2JH 1NAKL 2HJLA 1IGJA 5GRWA 5BO0D 1H3PH 12E8L 1BAGA 4JRYB 4KI5F 3NGBC 4OGQC 3PL6D 2W60B 2C9XA 2GCYA 4L9LA 4O02B 1NC2D 4BDVB 1PF3A 1IC0A 1RFDL 3K71A 4NGHH 2BVQB 2ZCHH 1B4RA 1T80A 2IFFH 2BNRE 3DRQB 1P1ZA 4UTBA 4QHKJ 2CGRH 2R4SL 4HK3N 4KJPD 2KHAA 1J5CA 3QIBC 1NC2B 1XB3A 4OF0A 5C09B 5ID1B 1R4XA 1B2WH 2SEBB 2DQFB 3NTCH 1U3JA 5I8CA 4JBSA 4OAWB 2PNDA 4PLKC 4XMKH 3O8XB 5JIQA 3CLWA 2PW1A 3B7UX 4AW7A 5IHWA 5F96H 1OALA 1N6UA 4DPAX 3QNFA 3CZJA 4FNLH 4ABUA 1TPXC 2HX8A 3I9PA 4F37K 2CAKA 4XP5H 2GJ6E 2DWTA 2R69A 3QQ4A 2KMWA 2XWJA 4TNEA 1EXUA 1M71B 2ZJSH 4DKDC 4M6AA 2EEXA 2OV0A 1T2QH 2VDKH 4YO0B 5HD8D 4I89A 2WXPA 1MCFA 3I75B 4OBSA 5FUOL 4R26L 1IM3D 1MFMA 4PW3A 3U9UA 3VYOA 4OFYA 4K3DH 1A6VH 1KACB 4IMKA 5CGMA 2DYPB 1J8HB 3KJ4C 3U7AA 3GMQB 2D7TH 5D8JL 3BKCH 4M48H 3S35H 5HHMD 2V2XA 5DUMH 1CFQA 1MCHA 3KL3A 1MCPL 2VZSA 1F4YL 5JZ7D 4D0BA 1A0QL 5DJYB 4QEGA 3C9NB 4KK8D 5EORL 3S5LA 3OSVA 5I19L 5EEUA 3S5LG 4UDUB 3Q1EA 4PGBB 1WWBX 3HCVA 3SGEI 2BZDA 3FRPA 1XH3A 3S8GB 4ZUVB 4TVSa 5SWQB 1JE6A 3MODL 1N5YL 4TNWK 1XH2A 1BBDH 3ETSA 5AOIA 1H8OA 2WCGA 3GYRA 1TNNA 4KZDH 4F58L 4XCNB 2VR7A 3BUDA 2IAMA 4KKPA 3QAQA 1C5DB 1WUZA 4M8VA 3GUTB 1IM9A 2UZXB 5C71A 2XG4A 4DKTA 2DQTH 2DI8A 2WQRA 4BM7A 2YJQA 4G6FB 4MASA 4K71C 5JXEA 4BINA 2VC2L 2WYIA 4J1UA 4CC4A 1XEUA 3HE7A 2VJ0A 4X6BB 3N1GC 1L0QA 3KGTA 2VGLM 3LKSB 2BWDA 2JKLA 3D51A 3PJNA 1D6EB 4KX8A 4A7QA 1EXUB 1M71A 2YXVA 2V9UA 3IE9A 4YHLH 2WLHA 4ZMPA 2XWBA 3VB8A 4KV5F 4AK2A 5F7KC 4MJ5A 5INCB 3IFOB 4ZTEA 1UOWA 2ZPKH 1GKEA 3TM6A 2YUVA 4NHCH 1OGAD 2GITB 5FWQA 3W56A 4K3GA 3S34H 1AKJB 3NFNB 4M29A 4ZTPL 4EIGB 4OAWA 1WA2X 2IDTA 3DMMB 1DDHA 4LHJB 3S5YA 3GNMH 5BPPA 2CRYA 2FQGA 2UXGA 3ZKSD 2R23A 3MJ9A 2R1XA 4CVUA 5EOCL 1AR1B 2ZG2A 3BMWA 1ZEAH 1Q9LB 2JJSA 3CXDL 1MSPA 1TFPA 4RFOL 3PPEA 1RVFL 5AQ0A 4FKEA 5DQDH 1G6RB 2NY1B 1U8MB 4JO3H 3K6DA 4L5FH 3WHE1 5F7UA 1RZGB 2F08A 4DQOL 2IBBA 1LMKA 4W4OC 2GBVA 3X3GH 4DKEH 1I8IA 2D3LA 2YD0A 1QSEE 4IBYA 4AGMA 2YD8A 4AGNA 3QZMA 5KVEL 4FQPA 1M9WA 1KEML 2BHZA 3VO0A 1YEWA 2O93L 2H0PA 3WL9B 1DBBH 2WGXA 4F2EA 1FZKB 4J3OC 1W0YT 5ID0A 1ADQL 1WGOA 2EXSA 2NY7L 1DO6A 5DFAA 3V6FB 2F58L 2OI9C 4NZDA 2MIZA 3C87A 3QEQB 4BQ8A 2NY1C 3ILDA 3HMXA 4NN5B 4I1NB 1BM3L 3DJSA 4YJZL 4ODWA 3GO1H 3UYRL 2PTUA 2QPEB 3EHBD 4N0YH 2EUWA 4AV0A 4P3WA 2GK0A 2CO7A 5C92A 4X99A 2ADJA 4RAVA 4JFXA 2L0DA 4IRSB 4MCZB 5E8DL 5EH1A 3D39E 4D7BA 4K4KA 4NZ8A 2ATPB 4JHWH 2DKMA 5KVFE 4NDMA 5I1CL 5CINH 1TETH 5KSAC 5IJKC 3E1F1 3OLIA 4G43B 4MYWB 3W3BA 1U21A 5DURD 1TXKA 3BAEH 4KNQA 5HI3C 2DQCL 3P0YL 5ANHA 2QVFB 2CBOA 3AUVA 1BAWA 1G43A 3VG9C 3VXPB 4JFSA 4ZJ9A 1C5BH 3QORD 2EP6A 1XEDA 2LU7A 2VDRB 4FQJL 1J5HA 4ZFOA 3MJWA 4YXHH 5C0CB 5FYKH 3FO9B 4R97C 3P3RA 5KG9B 1EK3A 1DBAL 2F18A 4LLDB 3PJSB 3KCWA 2XWRA 1A7RL 4M62H 5I1IH 3UPAA 4GRWF 1UZ8A 2Y22A 3CZNA 4U49A 2CGRL 1Q1PA 1E7VA 5B1JC 4YN3A 3ORJA 1B2WL 3E3QC 4PYGA 2HH0H 2LQRA 2CKBL 1KTDA 1NCBH 1Q0YL 2FL5B 4I85A 3RHWF 2NCMA 3FU5A 5FFGA 4F8NA 5HYJB 2AKRA 3L1OH 4UILL 3O8XA 5E1HB 3QDJB 5EU6B 5C0AE 1JPGB 3OKKB 1IUZA 2JLLA 3FO0H 4LLVB 4DGIH 5BV7H 3WTXA 1FNSL 2RFXA 3RGBA 1OP5K 3FZUC 4AM0B 2R9HD 4Y5XC 1S9WB 2WKOA 4RSYA 5IBLD 1ZWIB 2LVEA 2G9HA 1NDMA 4XOCA 3KAAA 5CCGE 2YXMA 1U8CB 4NO3A 4PRPE 5EO0B 1E3FA 1F02I 3QWQB 4RRPA 1OKEA 2FD6H 3OJMB 2AJVH 4DP7X 2CNYA 4XO9A 3RWDB 1GS6X 4B27A 2DEWX 4NRYA 4XHQA 1JERA 3G5ZB 3GMLB 5EIIG 5IHBA 5F7EH 2PR4L 3V6OC 3VJ6B 1Z7JA 3E9UA 3FN9A 3S48A 2B3IA 2HJLB 5K33A 1JGDA 4AQ1B 3JTBA 4FQHB 2IH3B 1CGYA 4P57B 5AYTA 3U6XS 3WKML 2Z35A 4E41E 4G6JH 3KJ6L 2CE6A 4YDJA 1F11B 3I85A 1YLBB 5TK2A 3DVGA 1REIA 3TA4D 1OAUL 4YL4A 3HE6A 4NYLB 4RMBA 1G9HA 1XGRA 3G5WA 3L5XH 5TFSH 5I1AA 3C5JB 1L6ZA 5HYSB 1WIUA 2A2QT 2N0KA 1GMIA 2WQSA 2IAND 2FSEB 4N1EA 4N1HB 3V4PH 3BVNB 1TTGA 3A67H 1EJFA 4Z18A 2VERN 1WJ3A 2WJ7A 2FUTA 2HFFB 3UFIA 4KK9C 5C0EA 4CU7A 4Q9BA 3TFKC 2G5UA 1QRNE 2F7OA 1AQKH 3QZOA 4PJAA 4E0RB 5TK4A 4K7PH 1QTPA 2DDQL 4YHKL 1UB6B 2LABA 4IK6A 6PCYA 1HCYA 3EAKA 5AZUA 4ABVA 4YDLC 3KLHD 1XGQA 3QHFL 1JZ8A 3ULUD 1M57B 3H2PA 2UZYA 3VXNA 3OV6A 3ULUC 1A2YB 4Y7OC 3OQRA 4BKSC 4GKSA 4KVNH 1KYFA 3W39B 3M1CA 3CFTA 4YBHA 5JOFA 2HCZX 4HS8L 2Y5EA 2NTFB 1YPZE 3JYCA 4TUOB 3LTVA 5D2NA 2JKJA 3GIZL 5D5MB 3ULVF 2WNKA 3QJSB 3VGHA 3KPPB 5TH2B 3AW5A 4LLYB 4RAHA 1NL0H 3BPLB 3M46A 2MTPA 4FMFA 4PY7B 4E42B 2CK0L 2K3HA 5A40E 3ARDA 3CFJB 4NWUL 1KY7A 4C4KO 3LPOA 3WYRA 2F6AA 5D93C 2M8XA 2R0LL 4X4ZA 3F7PC 3VU2A 4BCYA 1YY9D 2WYZA 4P4KA 4XVJH 5JHMA 5EUOA 5JR1H 5C0JA 3NACH 1X7TA 3X11A 3MRJA 3MR9A 1MCQA 1CLZH 3ME0A 3T2QA 4ALAL 1I7TB 3MREA 4LCCC 3L2NA 3RVTD 3RI5K 1IAKA 3PGCB 1FNFA 5LBSH 1KPUB 1CYXA 4JPVL 5DDHA 4L23A 1MCJA 1OGTB 1M53A 2R29H 1YMMD 3PWVB 1PL3A 1RAMA 3FULA 5TQ0H 5GGVH 3P9WB 4YE4H 1C08A 4M8UA 2HTLD 1RHHA 2XV3A 3PIQB 3VQ2C 3WDIA 4X5WB 5F88B 4OI8A 2JNZA 5D1QD 3W37A 4YSUA 2DH3A 3I50H 5IOPA 4Y5VA 4LLUB 1MCOL 4Q7DA 5E94B 4WO4B 3RTLA 2QV2A 3L95B 3PWPE 2ISDA 5LGKA 2RFXB 3APFA 3IAQA 1H3GA 4Y5VB 3L5JA 1HL4A 2YA2A 1MRDH 2NDFA 1NBVL 4EDWL 1U95A 2K7QA 2IH9A 3UDWC 4OLZL 4Z95H 3CHSA 2AW2A 2XBDA 2PR9A 3SE8H 4J8QA 4WI9A 4MMZB 5F9JB 2HZHA 1SDDA 2PP8A 4X6CE 5A2BA 1KWGA 4G8GB 4Z78A 3C5ZD 1FO0L 2LTQB 1QW8A 3QWRD 4LEXH 5DMGD 2XNAA 3CSYA 2BOCB 2FGWH 1YECH 2IOIA 3IKCB 2EDWA 4Y5VC 1C12B 3L48A 3IPEA 2XWZA 4ZTPH 1XGZA 3WE1A 4BWTA 4OLYL 1HKLL 3BN9D 2IEPA 4Y2DA 3DRTB 5FOJA 1UZ6F 5E2TH 1MVUB 1TF4A 3MRCB 4U6VL 3O0RL 3S98A 1KB9J 2Y1VA 2IOOA 1WYJA 3IDMA 2CIIA 4RFNC 5D1XA 3U7WH 1U41A 3GLDA 2XV2A 4I3GA 3STLB 1V27A 3WFDH 5JOPE 5DHVH 4ODVL 4MAYB 2OSXA 3MGTA 5AW0B 43CAB 2ZONA 5D9SB 2DQMA 4IBUA 4RFEA 3C6LD 1GGTA 3V4VA 1UGNA 1DQVA 3UGEA 4DPBX 5BZZA 2HN7A 3T0XA 3QUYB 1RK7A 2AQSA 3NSYA 3CHRA 3CVHB 3ZRFC 1TZGL 1AHWC 2DH2A 2W94A 1BAFH 3OXRB 1KBVA 3JWNG 2YLKA 15C8L 4LLVA 3GSNA 3HPJB 1GCFA 1J18A 1DUYB 4MFHA 4WQOA 1PZ3A 5DO2C 4NUGL 2Q7NA 5PCYA 2A6JB 2PPCA 3EJZC 1BX2A 1L6PA 1MAMH 3VXUD 2J1WA 3NN8A 4N5UA 1EZVX 4J3TA 5DJ2B 4PMFA 2F1AA 2FLBT 3DV6B 3BWUF 1HJBC 1PQZB 3O3UN 3DARA 1PBYA 1PEZA 1AHWB 5HYEA 4HOXA 4P2QA 3FQRB 5AKSA 1OK0A 2C7FA 2HUEA 3NJKA 1S7TB 5T1MB 1NCOA 4TVUA 2FO8A 4X6DF 4JMNA 4KQ3H 1HQ4B 4YK4B 4R83A 2NQCA 2N0MA 3AG2B 3KPTA 4W9HC 2DWEB 3UO8B 3ZTCC 4X8JA 4JCWA 1RU9H 5ISZE 2DI9A 3DVNB 4NZTL 2R9HC 4WGVB 2H6OA 2KS0A 1X5GA 1E28B 4PR5B 3DVGB 5AAMA 5HDLA 2NR6C 2WO4A 4KJYA 5AOZA 5DR5L 1KJVB 2GY7B 3RUGE 4OZGF 3J7HA 1FZMB 4H25A 3KPMB 1BEYL 5FS5A 3PHSA 2ZSWB 4BA8A 3RIAK 3VXSD 3GKWL 4UOZA 4ZOAA 1AZZC 4PGBA 2FLMA 1D7FA 5IWLC 2PN5A 4AZ8B 1IKOP 3CZGA 2GY5A 1YMME 4TUKH 1DQQB 3KYMB 4M4RB 1NOLA 1A6ZB 5D71L 4XT1C 5H8DA 2V4LA 5DI8A 3GF8A 3QHFH 3VRLE 4ZO8A 1N6QL 5C0FA 1BYPA 2Z4QA 4XPBL 3EYVB 4PGZA 1GZHC 1T1XB 4XNMB 5K1NA 2R83A 1JPFB 4PVNA 3L4XA 5TF1L 4A39A 1G94A 3OM3B 1UD2A 3ZOAA 4PJ9A 4WWID 6FABL 4FFYA 4HS8H 3WNMA 1GAFH 3RY5A 3ET9F 4I18A 4JO4H 1ETZB 1I8LA 1ZE3H 3TT1L 1E6OL 1NAKH 4PRNB 1LYQA 4K8RH 3AGVA 3RL2A 1PEWA 3H3KA 1QWUA 3HG4A 5FA4A 1R3JB 4PWIA 4POYA 4XZ4A 2J2ZB 3CX5K 4WI0A 1IGIH 2E86A 2O5YL 3KW7A 5BV7C 1F3JB 1AR2A 3MV8D 1IBGL 2GPZA 3RA7L 2WNGA 3EBIA 9CGTA 1C5CH 1HS6A 3MMEB 5J12B 4XAKD 5JPMA 1OAUH 1JXFA 3RWIB 4LLAA 3CZSA 2HXAA 4M6NL 4OI7A 3D39A 2NY1D 4C4BA 1NBZA 3S4SA 4HYTB 4FJYA 3H9SD 5LBSL 3NZ8A 3F04A 1KTCA 2NX5E 5DC0A 4OJYA 1P5VA 1VENA 2B14A 3C60B 1OP3K 3OR6B 1PKQE 1PPIA 1JZFA 1ZLVH 5IQ7H 4MQ7A 4PJBF 1URLA 5EZLB 3FKUS 1UWXH 1Z3RA 4WW2B 5I15H 3MNZB 2WUBL 3DOSB 2XKUA 3F58H 3G5VB 4KGJA 4PJXE 3BGFC 4M5ZL 5DWUH 5TJWK 5FLVA 3VFWA 3PGDA 2WUCH 2WWOA 3MX0A 4ZZKA 2BO0A 2IWKA 1E4WH 1G0XA 5JDSB 1AXTL 4H8UA 3C2AL 2HTKD 2OCCB 4LE8A 3SDAA 3QEQA 2LHAA 1NICA 5DVPA 3BZEB 2ALAA 1V3MA 3OXSB 4KBPA 2UVEA 1QSZA 3OAWA 5EZIL 1AH1A 5LCVL 3UIYA 4GKOA 3VRIA 3ZYOA 3ZQWA 4YX2L 4M5SA 3GXTA 3MV8A 2BS71 3IGAB 2WV3A 4GJTB 4PRNA 1EIBA 1LL1A 2A9DA 1HHIA 3LEYH 5EZOH 2A9ML 4CN4A 4ELMB 5HHQB 4HIEB 3K71B 1U93A 4XHJD 3TBWB 3IK2A 2WLIB 1UCBH 3EOYG 3FRPB 2EVJA 3LEVL 3IF1A 5J3HC 3HB3C 3EH3B 5C2BH 1DO5A 1F86A 2OKMA 1Z9NA 3B8SA 4AVKA 5CWSA 4NFCA 3GHEL 3GRWA 4RMSA 4EI6A 4A2HA 1QQDB 2Z4QB 2E9IA 2WQVA 4ZFZB 1E65A 1HDMA 3C2SA 5LNEA 3MHZA 4MJ4A 4XE0A 2WGNB 1PSKH 2C3XA 1GGBH 2WAHA 4XWOD 1GHFL 5IHUL 4AKPA 4NNYA 2MNUA 3D34A 1QPPA 1DDHB 3INOA 3S3SA 3CD4A 2XPGA 4OCMC 1R24B 2E9GA 5J56B 2QLVB 5LLIC 2BVPB 4Z6AT 4PREB 2P8PB 4YO0A 1OB1B 1DQML 1FZMA 4EXKA 5HHXL 4HIQA 1CGTA 3EYUH 3WN5B 2F8VA 5FKPB 3QXDB 4DP5X 2ESVA 4CGTA 4U6YB 2Z8RA 1WFOA 4X8XA 3S3PA 3VXOA 4FQCL 3QCTL 5LXGH 3NP4A 4DZ8A 4WGKA 3QQ3B 3BCDA 1MG2C 1HX0A 3O0LA 3NDYE 4ONFL 1OK8A 3GLZA 2V2WA 1I4FB 5IW1A 2D7MA 1NOFA 1TCMA 1WZAA 3X1FA 5I8CB 5FK9B 3OGCA 4BXSV 3U1SH 4O4YL 2ZX6A 1OQXA 1YYLL 1U2YA 2G9KA 3S37H 2FSDA 2QPFA 4HUVA 2D7PA 3WS6A 3TA3D 1PX8A 2PO6C 3HJEA 4UINL 5D1ZD 1BG9A 3FCUB 3RZCA 3GXDA 3T8MA 3L9EA 2ADIB 2Y25A 2ZICA 4L5FL 1L9TA 4MMZA 3VM5A 2R29A 5ADOH 4UQCA 2IH1A 2H47C 2A9NL 4JCMA 4HSAC 1UG9A 4HDIB 3IMSA 5IVZA 1X5FA 3HTLX 4XXDA 2DM4A 3KLHC 1FL6A 2PWFA 3ARBA 1XF4B 4TVPE 1KENL 2A6DB 3AROA 1DBBL 4EIBA 3V10A 2FHBA 2CALA 3VTTA 1NMBL 3OKMA 3T0ED 1CWVA 5F88A 3FSWA 3GSQA 4UV7L 2MWCA 4XP1H 3CUPB 2MHAB 1B4JL 2G2PA 2NY0D 4KTEH 4KROB 3NJHA 2MRYA 2Z34A 5CBEB 4JFUA 4FQLL 3QC5X 3UIZA 1GYAA 3QJHA 1TCRB 5CF3A 3DPBB 1CVSC 4FNRA 3ZL4L 1MRCL 4QRPD 5E08H 2NDGA 4KO9A 1FSKB 1F1AA 4AENA 4WNQA 1ZAGA 3VFOA 2VWEE 2YC1A 3QIUB 4G42A 3ESVF 3NCJL 5CGYD 1XD0A 3CH1A 1HTYA 2IG2L 4WW1A 2R2BA 3CJJA 1R9FA 3PF2A 4HU2A 4KROC 1HH9A 1ZSDA 2WBKA 2BNQE 1YUHA 2EH7H 2HA1A 5FYJE 4WJG3 4IS6A 2QFPA 3P30L 1FYTE 5DHVB 3UMNA 5K9QI 1R1CA 2WXHA 4WLCA 4V1DA 5DLML 4D0DA 4QTFA 3Q44A 2YAQA 2XN9B 1W0WA 5CCHE 4PRIE 1OCRB 2VXSH 3ZK0A 3ARBD 2VR5A 4AL8L 4WWKA 1HHGA 5IJCC 5J7CC 4HAGA 3BAWA 5AALA 3VFUB 3T0EC 1CIDA 5IR1A 3PNWB 1QAWA 1CDUA 3NSFA 2HFGL 4RISH 3KLDA 1HZHL 4H1LH 4AUJA 3VUAA 1QYGH 3WAJA 1A6AA 3BP4A 2DWEA 2APSA 1NFDE 1SY6L 3D9AH 1NGZA 3MRDB 1FPTH 2FTAA 1BJMA 3LZOA 3CGTA 5FGSA 1OQOA 1RK0A 1WQVT 3O45A 1JPTL 4RGOL 3T0EB 4F7TB 2XTJD 5GZNC 1S7WB 1HU8A 3VE0A 4IRSD 4FXGA 2W0PA 4Q6YA 2F74B 4HJSA 1QFWL 3HG3A 4L05A 3C60A 4NN5C 5C6WH 4LLMB 1XF2A 1U3HD 4Z7WA 1LDPH 3BX7C 3V0VB 2AQQA 4MRCA 1K2DA 3F05A 2RR3A 5TTRA 3WN6A 2F7RA 2RA1A 2ZUWA 3ZDWA 5JW4R 2Y9RT 1SLWA 2B2XL 3ZKMC 4QRRB 3FSZA 3KWWB 2OR9L 4ZPTA 1MRFL 3EH2A 4QRUA 5JPNA 5H37A 1FJ1B 2LU3A 4Z8FL 2UWEA 5DYOB 3H4FA 4NC1C 1ZA6B 5HJ3B 5I17B 5C9JA 1USZA 4X9FA 5DTFB 3WUWB 1WZKA 4U1LA 2QPUA 3L5IA 1RZ8B 1AMXA 2E7HA 3RL2B 4APXA 1KB5L 1RZIB 4EIZC 5C0BB 3M1BA 5E6ZA 1Q1JH 1RURH 2EDYA 3MXVL 4G1MA 1EEYB 2R39A 2ZWLT 3UYPB 4GSXA 1OXYA 4GFTB 1RZKC 1ND0A 1AO7E 3BSZL 3V5KB 2EDMA 1WLHA 3DGCR 2DQJH 3DRTA 1ZLDA 4HIIB 4NZRH 5K1VA 1HH6A 2IPTH 3OKNB 2ZUSA 4I3SH 5C07B 4B96A 5LVEA 2HLAA 3GMPB 3HG1E 4RMRA 4U4IA 3L16A 3RURA 1CT8B 3B2DC 1AGEA 2YKLL 3RVWC 4F2FA 3NJMA 1KXTB 2Y1YA 1JIBA 4HVBA 4UWQB 3LS4H 2YRZA 5FEBA 2VAJA 4OQTL 5I1JL 3IXTA 1JD9A 1MCNA 4L48A 4ZI8A 2TSBA 5CZKA 3DDGA 1QLEB 4YHLL 4BGDA 2VIRB 4RFEB 1H6TA 4HULB 2NY6B 2B15A 3SGDI 3EG9A 3MKKA 3PAZA 3APDA 1F4HA 5MP6H 1NDGB 2ZPKL 3TIDB 4W9DC 1XB8A 1GW6A 3ZX1A 4ETQA 2IC2A 5I1KH 4GO9A 1KLFA 5ANME 4N2GA 1SHMA 2OMXB 3OWRA 3B9KB 2EXTA 5LCVH 4PW9A 4U1HB 3MOAL 3EUDA 1O0VA 2QVKA 3GNML 3QDHA 4XVJL 1MJJA 4JX0A 3NCEB 1QLRB 3NACL 1E8ZA 3B43A 4IGBD 4TPRH 4DKAA 3N43F 3KD4A 4POZC 1G7JB 1HAUA 2GK2A 4OIIH 2J6EA 2BIQA 3MJ8A 4P2RA 3SKOA 1UYWH 2PWGA 3L13A 5CZXC 2RAMA 5BXFA 3SPGA 3OSKA 5D7IA 5DD6B 2DQHH 3FO1A 4XO5A 5JXED 4OJAA 4IYKA 3L4ZA 4PG2C 1HEJC 1SN5A 4Y9FA 2ARWA 5ALBL 3AQYA 1ACXA 3E6FA 1QBLH 3G7TA 1JV2A 2Q0ZX 2X7LA 1WHOA 4XVSL 3HE6B 2UYLB 4DP0X 2DQIH 4LCCA 1A6UL 4FZ8L 3TO2B 3LCYA 3OXRA 2KZKA 2QGEA 2C1PA 1UJ3A 3FQUB 3NSXA 1MRDL 1SEBA 1ID5I 1IFGA 4CILA 1M6OA 5B38A 5ICZA 1S7VB 1Q72L 2ROYA 3LN5B 3P4LA 3TH2T 1LD9B 1DBJL 3LXCA 4OV5B 2Y2TA 1OTTD 3HHMA 4G7RB 4QRSA 1G6RA 1MIMH 4FEIA 3RUGF 1HINL 3US9A 3WIHH 4PRIA 5DZJA 1HL5A 3KPQB 4F20A 3FQ2A 4L4VB 5KBLA 4ZTOH 2A77H 4PJEB 3IN2A 2AQ2A 4URKA 2MTAA 2XXCB 1ZGLB 3CK0L 4CVWA 5GZNA 5K9JH 3CFIC 1WHPA 5GRYA 1U3ZA 3KR3H 1JFQL 5IIEA 3BW9A 2X0WA 3H3PH 1BECA 4KKNA 1RZKH 3TO4C 1JZ6A 3R06A 1IAIM 1U8LA 3BPLC 1ZPLA 2VDRL 1CB4A 3CC5A 1T2JA 2XLLA 4M7ZC 2A74A 1JUFA 2B9AA 4P5TC 3FCSB 4Z7WB 2Z92B 1N26A 4RIRB 4X5LA 2BHUA 2ZIDA 2ZX8A 3F8UB 3N42B 2ZKXA 4F9LA 3B9VA 4FG4A 3SDCC 1QYGL 4PJDA 1N8ZB 4LLWB 1D6EA 3O2VH 4CADA 3NFPA 4XOEA 2CBMA 2OMNA 4HKXA 4P3CL 3LKNB 2OJ1A 3U6RA 3JT0A 4J5VA 4F15C 4WCYH 1KTLB 3FU7A 1AYRA 4Z77A 3L95A 1JYWA 3TO4B 5F7BA 3LQAC 3LVEA 4NLHA 3BLPX 1J05A 5D4JA 4B60A 2OMXA 2FYYA 4OCLC 1RJLA 3QRBA 1NCJA 4Y5YA 3QZBA 5CZRA 3MLTA 5GJTH 4GUPA 3UJJL 2F7PA 2R0KH 5TDOB 3RIFF 2P24A 4WJKB 3SDYH 2Z65C 4PJAB 2X6CA 4QOKA 1NCWL 3MOBL 3WD5H 4S1SL 3ZSSA 5FW7A 3V5DA 3IPFA 4D8PA 3ZHFA 1EANA 2FVNA 1K6QH 2ADJB 2XETA 1OOAA 2R1WA 3EJZD 4P0DA 1QEWA 4H13C 3MRJB 4KXDA 4QHNB 1VLXA 4P4RA 4PRHD 1EEZA 5IOKA 5FM4A 3R1GL 2FJSA 3EGDA 4GXUN 5IESL 2K6ZA 3C6SA 1EUTA 1BPVA 4Y4HC 5GS0D 1X5YA 1T20A 4F8PA 2RQ8A 3BZFB 5J1TC 3BO8A 4LFHD 5CGBA 1A1OA 3MA9L 2YSSA 4LO9A 5HPMA 2OP4H 1KULA 2HRGA 5AYUH 2AKRB 4HHGA 4MZRA 3ECVA 5F7FA 3V6FA 1B6DA 4LHUB 1C16A 1K4DA 2E7DA 2AGJH 2QBWA 4OZIB 2DYPA 2UX6A 4LSQL 4YSPA 5FYLD 1CDHA 5KWYC 1OLZA 2XZZA 3U36A 3CCHB 4JN2A 5CEZD 5IFJB 2R2CA 1RSFA 4I2XE 5JTWA 1JTOA 2EDLA 4NFBA 1TYJA 4XHJC 2FQEA 4QYAA 5DUBB 4YXLL 3R19A 4U33A 2E7LA 3MKGA 1NLDH 4HBQA 3LZLA 3QQ4B 4YWGH 1H3UA 2ZTBA 1O7SA 3DV4B 1N68A 4MJIE 3UTQB 5D71H 1KXVC 2BDNH 3G6JB 1S9YA 3V6OA 3EJPA 1AOHA 3UBXG 1XXFC 4JFDD 4G6AD 1XZ0B 3I9GH 4Q9QH 1OGAE 2VQ1A 3PL6A 3N1QC 4Y19B 1BQLH 4BD4A 3TCXA 2LU5A 2ZOKB 1RP9A 1KN2L 1NEZA 4NQXB 3DMMA 2ZQKA 3GPSA 3DTXA 2Z91B 2Q6WA 4BQCA 3QHTC 1YYCA 2JMRA 4M1GL 5I30L 4LHQB 3RWCB 3NZHL 3BEWB 2Y07L 4KDTA 4MMXB 2G4EA 5C9KA 1L9SA 1GTNA 5I82A 4PJAF 2Q8AL 4JW3A 4F7CA 1MHPH 5I19H 3KLAA 4ABQA 4XAKE 2FSEA 1ONQA 2IOMA 5K69A 2BNUB 1G7MB 2JCWA 2AI0H 4S2SB 3NJGA 1KC5H 4KK6C 3MV8E 4ODSH 3BIKA 2DBLL 1E6JL 4A2MA 1BBDL 1CGSH 2HTLC 6TAAA 4Z7QF 5IUCA 3WFZA 2O30A 1NEUA 1H3PL 2P8LB 4QRPE 5F7LB 5IUSA 2CQVA 2OR9H 1MAJA 3MUJA 3LH9A 4AEFA 4F7KA 4MMXC 3MRDA 2XA3A 3QA3A 4WGWB 4GNKB 2VXQA 3IETB 4N8CL 4APQA 5AW3B 3OLEA 4OCRH 4UBDC 5DZVA 1BZ7A 2HPOA 2WKOF 1YEKL 3GJEA 1FFPA 3BE1H 4XWGL 2FX8L 4HZLA 3SGKA 2XA8H 2ATPA 4HFUH 3O11B 5FOBA 1M05B 1G4RA 1TTAA 2Q87A 3GRGA 1JDAA 4ONHA 3VFPB 4PGCB 5JIDA 5HYIA 1EGJA 3L1EA 1U2HA 3W5MA 3PAVA 3BVUA 1MW2A 2DS4A 4PREA 3ZKXC 1WWCA 5MERA 4E68A 2LW3A 1PYWA 3U4EA 3RL1A 4G6ML 4M7KL 5J4MA 3SPVA 3UOAB 1KY6A 5HVHC 3U4EB 4GBXD 3LIZA 3AQZA 4H8QA 3KNBA 5BQDA 3TZVD 4PIBA 3F62A 3LMJH 3L2MA 4G6KH 3IAPA 4GXVL 4NSKB 4XB7A 4XVTH 5FUOH 4AGLA 1UM5L 4TSCL 3QDGE 1G7HA 3QDMD 3RP1A 1KIRB 2NY5C 4PGJA 4LGRB 3Q05A 4HUXB 4HOMA 3CFEB 2EUVA 1E40A 4ZMYA 4LEOA 1OAZL 2I69A 4HMEA 5DD3H 3BVWA 3HC4L 4RAUB 4JNXA 1XF5A 1U93B 1VPOL 1RZJH 2YA1A 5DUBA 4FXLA 4JGMA 2VABB 5ILTL 1T89A 1HNYA 4RWYH 4Y1TA 4J28A 2R0WH 5I6PA 1E90A 2X2HA 5G5DB 3SE9H 4HC1L 1II4E 4FP8L 3B83A 3QEGH 1P2CA 4F1ZA 2YSSB 5KVMC 5I1KL 2BRRH 1N5YH 5FYJU 4QJ4B 3IMRA 4Y4KD 1VCBC 1HKLH 1PD6A 1U8JA 1Q94B 1EEUA 2GAZB 3PP3H 3GUTA 3K6SA 2IWEA 2GTWA 3G5XA 4N0UE 5DO8A 2HMID 3FCSA 3RI5F 4F7CB 4WU5A 1KWKA 1YMMA 2ZD0A 3VGDA 2EXWD 1BJ1H 3MA7A 3NPSC 4JRLA 3P4OA 4CVXB 1DQMH 2YFOA 1SHXA 1EFQA 1RIUL 1S9VB 2FWOB 3U1PA 3HS0C 4F58H 2W60A 1Z32X 3CFEA 2YD3A 1XH0A 3O4LA 5JUEL 1FN4A 1X5IA 3PV6A 1FNEA 2VLJA 1LO2H 1LE9B 3LNDA 3QH3B 4HUWB 4O51A 4K3EL 5LWYL 4ZFZA 3SGKC 1WFJA 5F6HJ 3ZHKA 3FF7A 4HS6B 2EZ0C 2OJZH 4ECNA 5F93C 4Z77B 1A9BB 1MI5E 3BGFB 2GIXA 4YHPB 5F8RC 3GJFK 2VUYA 3RWFA 1OTSC 3QZLA 4QHLB 4EI0A 4POZD 1CLYH 2XG4B 1W72L 2I9LB 2BPBA 2H7WA 4ZW6A 5M94B 4N6RB 1C5BL 1JWSA 3KXFA 1U8MA 3UTOA 3FZUD 4NQDB 4NBZB 3I2CH 2WOYA 2C3WA 4MX7B 2NY5L 2OYPA 2R8SH 2A9NH 4GBXB 3WIFB 2AABH 2OP4L 4ICXA 5E95B 2VL5A 3ZKNC 4CSPA 3TVMB 5I0YA 3BO8B 2J88H 3SKUD 2DTML 4LSQH 3LKPA 4DP6X 3DTXB 5GRUL 3EOBA 4KITB 4U1KA 4MA7L 4L1LA 2V8LA 4MJ6A 4P04A 2MJWA 5F0JB 4JGUA 3O9WB 4GAFB 4KOBA 4UT6H 3RU8H 3GMOA 4UILH 4GI6A 3NPZB 4HWUA 2H9GA 1W15A 4FG0A 2BNUA 2K0RA 9PCYA 4JZNA 3LPFA 5T1LD 4LVNB 3TVMC 2Y1ZA 2Z0BA 2P24B 4PJHB 4FS0A 3AAZB 5GZOC 4H25B 1CF8H 3O2VL 4UAOC 4LAQH 3SDXE 7FABL 5KVEH 1JPEA 3U0TB 2CMRH 4WUUD 4AEHH 4KVCL 2NW3A 1JNJA 2UXVA 2Y6TE 3RX7A 2J8UB 3JWOL 4LIQE 1MF2H 1JV2B 2X7LB 3NCYP 5JMOC 2ZX7A 2CA4A 1XIWD 3TBCA 4TUUA 2BCMA 5BVJA 3QDMB 2FZ3B 3D87B 5FKAB 5IP4A 5T33L 1FP5A 1PZSA 1JNLL 2DJUA 5HYQB 3B56A 1ZVYA 4C55A 3PPSA 3KZ8A 1TQWA 1P4UA 3O8XD 2CWRA 3GMPA 3CZEA 1E9QA 1G7LA 3ETBJ 2F5BH 2X2JA 2Q10A 5GRJL 4Q0XL 3AXIA 1YSOA 3WGUB 1J5IA 3S4SG 5D1QB 3V0EA 5I6XC 2VLRD 1DJHA 1TKWA 2HFGH 2FATL 3O3DA 4JFDB 4P5RA 3DBXB 4H26A 5ABAA 4K9EL 1I8MB 1A7NL 1HZHH 1JXDA 3VI4A 3FU0A 5I9QB 4HW6A 5KYNA 4PJCB 5CINL 1C7TA 3BE1L 1X5MA 1A1OB 1BIHA 1ORQB 3ZJAA 3UTQA 3F65A 4G6FD 2ED6A 1AY1H 3KPNB 3B37A 4DAGL 4WEBL 4JFEB 1QPXA 3KBFA 5KSBE 4GXUM 4JHZA 4BFRA 1AIZA 3KMDA 1WISA 1GL4B 1W16A 4LEEA 2OR8A 5DTFA 3BIAX 4AE0A 3CLEH 2HT3C 1BQ5A 4UQ2A 4ZMTA 3F12B 3LXAA 4IMLA 1F4XL 1SDAB 5C0JB 2JKIS 5JIMA 3I9AA 5HBBA 2DM3A 5DEGA 3RVXC 3UCRA 4ZNCD 3SDCA 2HH0L 3X14A 3KLQA 5I15L 1CBVH 4BFJA 1NJ9B 2ILLA 3L9YA 3QCUL 2DIEA 3LEXA 4QJ3B 1S7SB 4LDLB 4MVBC 2VDPB 2BNQB 3EJQA 3VGFA 2VUKA 4LLYA 2Q7AA 1G9MC 2XJKA 4AKOA 4KTYA 1L7TL 4YC2C 1FYTB 3D0VB 5KTEH 2HRHA 2ORBL 3PABB 4QR7A 5JW4M 4P99A 4Q8BA 5GIRA 1A4KB 1E7UA 3QZWB 1LK3H 5DUPH 2XN9E 1I53A 3L9RA 1INQA 4AIZA 2I85A 2JCCE 1DJZA 1YPZA 4TXVB 1KFAH 3IDYC 1ZHBA 2JQZA 3HC3L 2IWGA 2W81C 3HNVH 1UC6A 2OTUA 2RGSA 1LEIA 4L4JA 4MA3A 1CLZL 2CSPA 4ALAH 1F4WH 3GDBA 5DRZA 1RERA 2L7UA 3SSGA 3KPMA 5IVNA 3HI5L 3L5XL 5TFSL 3DURA 2J1YA 1XSIA 1CGSL 2ZOLA 4I0PA 3KJ6H 8PAZA 5ACLA 3SKNB 1F8TH 4LSVH 3GHEH 4AGQA 4JFHD 2XVBA 1ZCRA 3FQ4A 5CD5C 3JWDC 1MAKA 1NFDB 4IGBB 4YE4L 5FYLL 1BZDA 3SKNA 2IPTL 3P77B 1PG7X 1WBXB 4IIQA 2P3YA 3R4DA 1NIBA 4P2OA 5IVXF 2EINB 4M43H 4KKBC 3TA3A 4JHUA 2E9WA 2ENJA 2C4XA 2F53E 4K2UL 1N5AB 1U8KA 4MCYB 4G3YH 2OYLA 2XKNB 3LKQB 4KNSA 4XMLL 5G4NA 1CT8A 1JVKA 1TQBC 3N5AA 4WUUE 4CU8A 2VSDA 5I8OH 4MWFA 4W70A 5AW9B 3AWGA 3STLA 1KJMA 4YHYC 3HNSH 4NHUA 1GIGL 3L9RB 4PJBA 1XO8A 5EZJB 5FGBA 4LNRB 5DJ8A 3AQDA 3WFEL 4N20A 5BUPA 5HHXH 4M93C 4NO0D 4CW1B 4IGBC 2QFRA 2EE2A 2VZ3A 1HYRC 4OLEA 4FJ6A 2BY0A 2ICWJ 5CUSL 4MRBA 1IC1A 3FOMB 4MKTA 3ML9A 3QK0A 5D7LA 2BHFA 4NPJA 1ND0B 4FTVB 2WANA 3QUHA 1IE5A 2NLJA 2NNXA 2Z35B 2WLNA 2X53A 3A6OA 4MB3A 2FEDD 4ONFH 4YGAB 2J57A 1J86A 1T83C 3X12B 2NMSA 4JE4B 3TJHD 3Q9QA 2DL9A 4G6KL 4GXVH 4YSSA 4GFXA 3MDJA 4OM0H 3S2AA 3MOAH 4TQEH 1ZTXE 4E9XA 4BKLB 3KBPA 1LP9B 4TMPA 4B9PA 1OAZH 4M93B 2H6PB 4C59B 1CN4A 1T3FA 5AOMA 2ZP9A 3QZWG 1MHCB 1QEXA 1T3FB 2KKQA 1ZK5A 2EYTA 3BESR 3ERXA 2QVIA 3Q1SL 4NZJA 4EQ2A 3SGJA 4HFWA 5MEPA 2IGFL 1DJSA 4PRPA 1KEGL 3MLZH 3UTSD 4YDIH 3F6IA 3Q5YA 3MACL 4F2ME 5AAWC 3KHQA 3QUMH 2DI7A 5I2IB 1XMEB 4JM2F 3S7GA 3AS2A 3ABGA 4AGPA 3TCLB 3QJTB 1KTRL 5FM5O 4ETQB 5JHDB 3PWUA 2C3GA 2W5PA 4IRZA 4KO5A 1TU2A 3GEWB 3JTTB 1KN4H 4CNIA 3OAUL 4M6OH 1HXMB 4XO3A 4KK5D 4IBVA 3ETTA 3L3OA 5HHOD 1EHNA 4JDVA 3IMWA 4LKXB 5KVDL 1A1NA 1OW0C 1Y07A 4G82A 5F7DB 3ZRSA 2WXJA 3UERA 4GAGL 1AQ8A 4OZHA 3O3AA 1Q0EA 3ZDZF 3QJHB 4L2YA 1MIML 1MIEH 5F3BA 3X13B 3TBSB 3VXUA 4PWJA 5F72S 3UPRB 1TJHH