1YRKA

The c2 domain of pkc<delta> is a new phospho-tyrosine binding domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
126
structure length
126
Chain Sequence
GSHMAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C2 domain of PKCdelta is a phosphotyrosine binding domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Protein kinase C, delta type
total genus 22
structure length 126
sequence length 126
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2005-02-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1yrkA00
4EZLA 3N5AA 4QAMB 3QJZA 2R83A 1E8YA 5JHAA 2WXPA 3KWUA 4WWPA 2WXHA 3QARA 4XX5A 5T8IA 2Z0UA 1W15A 2WXIA 2QZQA 4PS7A 5CCGE 4L1LA 4TV3A 3S2AA 2K3HA 1E7UA 3GPEA 3SD5A 3TWYA 4WEEA 4KZCA 3W57A 2X38A 3CSTA 3L08A 4OVUA 2LHAA 3B7YA 2Q0ZX 3APCA 4ICWA 3DPDA 2DMHA 2FJUB 2A4ZA 1BDYA 3NSJA 4NPKA 3QR0A 4TS6A 3KWTA 2NCEA 1E90A 2K8MA 4TUUA 2WXKA 4Y1TA 4HVBA 3HHMA 2ENPA 4L2YA 4ANUA 4ANWA 3F01A 4OVVA 4QJ3B 2WXLA 1DQVA 3TJPA 2CHXA 1CJYA 1QASA 4FHKA 4F1SA 2YRBA 1RH8A 2WXMA 2V4LA 2ZKMX 3OHMB 1YRKA 1RLWA 2D8KA 3ML8A 4L23A 4Y1SA 4LT7A 3ML9A 3QAQA 4PS8A 3PFQA 4FADA 2WXNA 4FHJA 3IM1A 3DBSA 2NQ3A 3M7FB 2K4AA 3W56A 4QJ5B 1V27A 3L4CA 3L17A 4NPJA 3ZIMA 5EDSA 4FJZA 4XZ4A 2DMGA 4F92B 3L54A 3PREA 4HLEA 1DJWA 4IHBA 4KZ0A 3APDA 3T8MA 2B3RA 4A55A 4JPSA 4ANVA 2WXFA 2WXJA 3P2BA 4PS3A 2CHWA 4ANXA 2RD0A 3ENEA 2BWQA 4F93B 4MJJA 2ENQA 4KITB 1HE8A 2FK9A 2KI6A 1W16A 4FLHA 2WXQA 4LCVA 3PYCA 4AJWA 1DJXA 2NSQA 4F91B 1E8WA 3APFA 3L13A 1E7VA 2Y3AA 4V11A 3FBKA 4EZKA 1DJIA 2K45A 4QJ4B 5JHBA 3JZYA 4WWOA 4BFRA 3F05A 4LDCA 4EZJA 2YOAA 4J6IA 4DNLA 3NZUA 2ISDA 3L16A 1TJMA 1TJXA 5KJ7E 3HIZA 1BYNA 2EP6A 2N1TE 1WFJA 2WXGA 5H4YA 2Q3XA 3MJWA 3QR1A 5H4ZA 3LJ3A 4FULA 3PS6A 3NZSA 3F04A 3L9BA 4L1BA 1DJZA 2CHZA 4GB9A 1E8ZA 4BGDA 3RDJA 4AOFA 2CJSA 1DSYA 1K5WA 4G11A 5CCJA 1UOVA 4DK5A 4FJYA 4WAFA 1GMIA 1DJHA 2WXOA 3PRZA 2QZ5A 4IQHA 3ZVVA 1A25A 1WFMA 5CCHE 2CM6A 4WWNA 1E8XA 1RSYA 2CJTA 2UZPA 3FDWA 4GNKB 1BCIA 4NS0A 2JQZA 3CSFA 3IBEA 4NP9A 4URKA 5G55A 2WXRA 1UOWA 1QATA 1DJYA 2ENJA 1UGKA 4ICXA 2CM5A 3TL5A 1DJGA 4XE0A 3RPBA 3R7QA 3ZW3A 5G2NA 3QK0A 2CHDA 3HN8A 4FA6A 2A5UA 3R7RA 3F00A 3OAWA
chains in the Genus database with same CATH superfamily
4EZLA 3HMXL 4A2FA 4OD3L 4R7XA 3D30A 3VXRB 2WWNA 4FFZA 4TUJB 4XX5A 1LEIA 4W1TA 4LBEB 4YBLC 5C0AA 5L88H 2V5SA 3HI1A 3G9AB 3DTXB 5HHNB 5E9DB 5EWIL 1O6TA 2FZ3A 2QADB 3U0TB 1FNLA 2MMXA 1M6OB 2ZCLH 4DEPC 1QW9A 4NSKB 1QBMH 3MRPA 3IFPB 1NGYB 1CYGA 5E6RB 4XNXH 4I4WB 4S11A 1IAOA 3IDGB 3KWTA 1QSZA 2N1KA 4ODHL 2K8MA 1K9TA 4KI5C 4XVOA 1G87A 3BSHA 5T3ZH 3RDTB 1CPUA 3CZKA 3WFDH 3ZSSA 2YHGA 5T33H 1HIML 5IROD 1MEXH 5TFSL 1QBBA 4YLQT 3WXWH 4XPAH 4HFWB 3DMMC 4LOEA 1F4YH 3D0VA 3ROLA 1UG9A 4RMUA 5E8DH 1ZLSL 4PB9L 5K9KB 5CIPB 4QUOA 4JPWL 5KJRL 4RAVB 2YD3A 5INDB 3L54A 4HPOL 4K3HA 5C0JB 2IALB 1U8KB 4HJJL 4ODSH 1JWSB 5G4OA 3LNHA 4WHDA 4DP2X 1FLRH 3CZFB 5E1QA 3KLAA 3PAUA 5I0YA 3SHSA 1EGJL 3DRTB 4WHYH 4XOAA 1T3FA 4NKIH 1AG0A 1PSKL 2JTDA 1DZBA 2IDCA 4MMYA 2FE0A 3DECA 4EN3D 3FQRB 1HNFA 4NQDB 1DO5A 2Y7SA 2IBGA 3RWJA 4BA0A 4YVUA 3IDNB 5DHXB 3TV3L 5ISZE 3LZRA 2Y1VA 5IB1B 3NPSC 4PRNA 4ZSOE 4DNLA 4GPVA 4W9ZA 3QCUL 3QDJD 4MX7B 4NFCA 5CMAA 5DHDA 9CGTA 2G4GA 3FU6A 3UTSB 5CAYB 5EUOF 1BF5A 1M2VB 1PZSA 1Y07A 4HQQH 3HS9A 1X5AA 5E00A 3K91A 4R3SA 3WUWB 5JXEC 4PRDA 4FG2A 3IXAB 2QTVA 3ZDWA 3TBVB 3A4AA 3MPCA 4HAGA 5EEYA 2AP2A 4TMPA 3F7VB 2MRYA 4MDIA 3ZKQD 1C5DA 4FQXA 5FYKE 1ZY9A 5B21A 5ITFA 3QORB 1T1YA 1HEZA 4Z3GA 1O75A 1I9EA 1ZKAA 3QDJE 2B4CC 5KSAD 4AQEA 5GJTH 1UOWA 4C8XA 2C9XA 5CKAA 2WUCL 1G94A 3S5ZA 4S1DC 4E41E 2YRPA 1A6WH 2HWZL 2BVYA 3CDYA 5HD8D 3U1PA 5KSAA 4OZHA 3GIZL 1NDMA 2NQCA 2ZYRA 3NVQA 3L3OA 3ECBB 1TLKA 2VLLB 4KQ3H 32C2B 5EU6A 2O72A 3ATFA 3KBPA 3KWUA 2WMPB 2VN4A 4XXWA 3QARA 3SCMD 3VI3A 3LYRA 4N0FB 4LLQA 4LSQL 3PWPB 4A2GA 4H8QA 1DQDL 3RG1C 3TNMA 3DUSA 5C0CD 4K9EC 4XNYL 3T3PB 3OZ9L 1EEZA 4HPHA 5TDPA 2RQEA 3BQUA 3D0VB 2IDFA 2ROYA 2YZ8A 3DPDA 3GZOA 2GC4C 3RWCB 1OZUA 3WD5H 2EIEA 2OTUB 3UABA 2LTQB 5C0NC 4KZDH 1TVHA 2QVMA 1G5AA 2QKIC 4NBXB 4W6XB 5DWUL 4EIUA 2X28A 2Y2TA 3APMA 1YMMD 1O6VA 3NCXA 2X0UA 3TFKC 3BZEB 2ZOUA 4AW4A 3GKZA 4ZAKB 1IIKA 4UDTB 4YDJA 3VD4A 3CMGA 3L5HA 4M7LT 4S2SB 1CDIA 5B8CA 3ZMRA 5EDSA 2J57A 1OAJA 1D6VL 2E3VA 2Y06L 4UIMA 1A5FH 2NYZA 2D9CA 3HUJF 2VUYA 2EC8A 2HUHA 5TF0A 1RUKL 4XBEH 5C07A 3WY2A 5KBKA 5BO0D 1IGTB 1UADC 2GK0A 2Y1AA 1FGNH 3Q6FB 4NQXB 4MJJA 2GEQA 1NAMA 3SDXA 3RGHA 1W16A 1UA6L 2IPKA 3ZKSD 4AQ8A 3QCVH 4PJXE 4HJSA 2MKLC 3MJ7A 4PG9A 3KYOA 3ZTJG 3LZOA 4EZJA 1Y18A 3KJ4C 3H7LA 1GZHA 1EXGA 2BXYA 4Z7WA 2C4XA 4EO5A 4LEEA 1IBGH 1DTUA 3LEVH 4P9HC 4CVXB 4HJ1A 5FYJE 1R46A 4UNVA 1NFIA 3QEHB 4ZMNA 2C8NA 3C87A 1Q0EA 4OAWA 5C0EB 3L4XA 3INUL 4AT6B 1XGPA 4GUPB 5E5MA 1A0QH 1HL9A 2AK1L 2FECL 2G3ZA 4YQXH 5FK9A 4OD2A 1ZVHA 4YPJA 3K2UH 2UWEA 4JZJA 4YHPB 4I1NB 1NBCA 1MCWW 4WFEE 3LRSB 5EUOE 2CA3A 3L7EA 4XGZA 1JGEB 2YXFA 3DGDA 1J86A 1CF8L 2WV3A 3LX9A 4K3GA 4QWWD 1C1EL 5DWPA 1ZHKB 4PMFA 5FDWA 4O51B 3QZWB 4NQVA 4FTVD 2APXA 4F2MB 2EDRA 4LF3A 1CFVH 2G75B 3MOBH 5AVRB 3V10A 3QRBA 5EO9B 5TPWL 1FNGA 3BIKB 3M1BA 1TNNA 1FPTL 1B2WH 5KTEH 5DK0A 5LCVL 1QPPA 2B1AH 3Q8FA 2EDLA 1OGAD 3GXFA 5C92A 1EZVY 1IC4H 3P77B 3P9MA 1F13A 4UV7L 2PCFB 5LN4A 2ZSWA 5HHPB 4H0IA 4KX9A 2IANB 4TQIA 1WZLA 3T1FA 3D34A 5J1AB 2FWOB 1RHHA 3HBZA 1TZIB 5K9QI 1DANU 1D7FA 5AW7B 1P4UA 4L4JA 4RMWA 1FH5L 3CBJB 4HKZB 2AJUH 2ARJB 4JREB 1ZWIB 1LDPH 3KPOA 4OGYH 1PLGH 2RMNA 4PJFE 3MUY1 4BFNA 3ARFC 1IC5H 4HCIA 4LLMA 1PCXA 2LU3A 1G84A 1BQLL 3KPTA 5BO1L 1MAMH 3PHSA 4PGCA 4TVPH 5AB1A 5GGVL 4M6OH 4JFFB 1Z0NA 4UTAH 3ROOB 3TFBA 5F3BA 2WYZA 4P5TC 5C09D 1BQSA 1WK0A 5ERWB 3MROB 1QRNB 5I30L 3BO8B 4BGLA 4P2OD 4UQDA 5F7KC 5FA3B 4K3JL 3EDDA 1KCKA 4JMXA 4PGBA 1KZQA 4M6AA 4OZIB 5A2FA 4E0RA 1P6AB 2AKRA 4M8VA 4RMRA 4GAAA 1HQ4A 3U9UB 4JHAH 5ICZB 3CBKB 3CLEH 4AZUA 3O9WB 4PV9A 2OSLA 4HK3N 2O6PA 2Z8VC 2IAMD 1S7WA 3LQAH 4KI5E 1DBKH 4WLCA 1ET8A 1MRDL 1NC4A 3GNMH 1YEHL 3FMGL 4Y4FB 3NJVA 4GSXA 4E9QA 4NOFA 1K4DB 5SWQA 4D0DB 4P4RA 3RZCC 3FCTA 3UO1L 2DTML 3TZVA 2YAFA 4BELD 3S4SG 4E9VA 3Q2LA 4PJCE 4ZMAT 1JPTL 2QR0A 3VRLE 5I1IH 3LTVA 1NIEA 1I7TB 2QQKH 1HDMA 4LHUA 3A0OA 3C9NB 1WFJA 4AC4A 3QFDA 1NINA 4NKDB 4JKPH 2F7IA 2ZG1A 2L3BA 4UF7C 1X6LA 4BD4A 3F04A 4IIQB 3OR6A 4YXKL 4ZFZB 3Q13A 4E9WA 3O4OC 2GIXA 4HA1A 3VFWA 2EAEA 3EG9B 1KMGA 1TEGA 4OJFL 3LKSB 2QV2A 4MAYA 4N1CA 4TNWK 1NFIB 1MCEA 3QEHA 4XP9H 4KVPA 5D7HA 4BQCA 2VMFA 3DK2A 3OHXC 1OAZH 5SWZB 1AS7A 1BECA 2XNAB 4ZPVB 5E1GA 1LE9B 1GJUA 1I8IA 2CWRA 1G7QB 2O6FA 4Z77B 3MRCB 5AOJA 3WKYA 5I1KL 3D0LB 3NESA 1JGUL 4ELDA 5F7EH 1DQLH 3QK0A 1XT5A 2A5UA 3MRQB 4XP4H 4O9HL 1VADA 1WQVT 3N5AA 4XMUA 1G9ML 4N6RA 4DK3A 3MO1B 1Q9OA 3CE1A 4KI5F 4JG1L 2APFA 1RZIA 5ALBL 3EJYD 2ODHA 4K3DL 3CMOH 1X7SA 3CJJA 4MASA 2AK4A 3O6FC 2VSMB 4PVMA 5DZOA 1DBJL 4NGHL 4XP5H 4Y89A 3O6KH 1F3JB 1KCRH 1TKWA 3O45B 3QR0A 2WBJC 2VXQA 5DD6A 3UZQA 4M3KB 1ORSA 4K73A 5KSVA 3QNYA 1WBZA 4E5XG 1BMGA 2AQTA 4NB7A 4YE4L 5F3FA 3EG9A 3V0FA 2K9FB 4NZTH 4QXTB 5IMOA 1QSFE 3KL3A 1CLZH 4F7CB 1BBDL 2X4UA 4H2AA 4X5XB 2P5WE 3K72A 3GZKA 4X80H 3RVWC 5BUAA 3CHOA 2YPLA 3OKNA 1ZXKA 5DVLA 5JIMA 1QBML 2XKNB 3L7FB 3MRGB 2QSCH 2ZCLL 1H5BA 2NW3B 4PW9A 3UEQA 4Z7VA 4NHUA 1AR2A 4WK4B 2NNXA 2WLMA 4FFYH 2A6IA 4PS3A 4W9CC 1N6UA 2WB1A 2WQSA 4MKTA 5IMLA 2R1XA 3O3DB 1P7BA 4WFHD 3ABMB 1XZWA 3ALWA 3FCTB 5F1IB 3ZHNA 1JDCA 5HY9A 5CBEB 1YEGH 4RH4A 2A73A 32C2A 5EU6B 4JO2L 1SVCP 4MD0B 2NY5L 2J8UB 4ZZFA 2VE6A 5HVGB 1L9OA 3F64A 4LU5H 5EOQH 1CI3M 2R8SL 1I8LC 5CLZA 5DEZA 2D3NA 2PW2A 3LXBA 3RWHA 1BV8A 4EKXA 3FCBA 4LVHB 4MTMA 4X6EA 1LP9A 3WLBA 2JXMA 3FT0A 5C0IB 1NKRA 2Q3AA 4PJ9B 4PWIA 5LG6A 1RVFH 2EDBA 3EOBB 1PZUB 3NZSA 1HEHC 1V3LA 1X9RA 2IPUG 1S5HB 1XF3B 5CJOH 3GBLA 4LHJB 5FYLH 2D31A 2P5WA 1T6BX 3ETBJ 1C9SA 1KXQE 4ZO9A 3TBVA 5C70A 1CFTA 2H5UA 3UTZB 3ULVH 1Q1JH 3LSOB 5IJKC 1KJMB 3HKFA 2WB7A 3P4OB 3G6JA 1MELA 4HOZA 2ICEC 3BXNA 5EMYA 1KV3A 1CLOH 7TAAA 1R3JB 3BDBA 4R9HA 4YN3A 1KLFB 4LXFA 4LQ1A 5C97A 4DK6A 3QJQB 1N64H 3OMAB 3AS0A 5DMKB 3L7FA 2R23A 4FZ8L 3TL5A 4G8IA 3MSPA 4R5XA 3C5ZB 4A7GF 2X4UB 5ANMA 4P9MH 2EH7H 4J2XA 5E6IC 1C8QA 3MVSA 3HMXA 2WPGA 1OXYA 1U6AH 1B88A 1V55B 1KNOB 5E7FA 5FV1L 1T3FB 3W9EA 2QZQA 3SY0A 1KCRL 4MD5A 2IQ9L 4HU8A 4ODBD 4NUGL 5GRWA 1T0OA 4U1HA 5HYJD 2VDRL 4HS3A 3O0RL 4L29A 5AKTA 3GHBH 3U30C 4D9LL 5BXFB 3JV0A 3MOAL 4PVLA 5MEND 1N3NA 4F80A 4L0YA 3SKMB 4LLDB 3MRIA 1TG8A 1MHCB 3V5HA 2LLGA 1WBYA 4GSQA 1BQLH 1PZ2A 1ZSDA 3ZE0B 1KWKA 3LPPA 3MV9A 2BWDA 1KGYE 3DSNB 5KYUA 2FB4H 4OM1H 3SODB 3IK2A 3RDTA 1J5HA 1F58H 3NIFE 3AM8C 2WBJD 4PB9H 2ZOOA 5J06A 1EUTA 1HHHA 2VABB 1EHLH 3ATEA 2VXVH 1AGDA 3WDHA 2VM4A 4X6FA 3VG0H 3IPEA 3P11H 1NSNL 2GEEA 2IBZY 1TQWA 1IO4C 3QEQD 3ULUC 4Y1AD 2A1WL 4LU5L 4MSWB 5HJGA 2EXSA 4XRCB 3WFEH 1GKEA 3VRIB 4KU1A 3QDHA 3SJVE 4MMZA 3CFJA 3VXSA 2OMXA 2R4RL 3V0GA 3ZGIA 3BIBX 2P80D 4LGSB 3TS8A 4WTWA 4W93A 1TZGH 3D51A 4U49A 2PXYD 3VFNA 3OF6D 5E03A 5AVWB 3ABKB 5I1AA 5TQ0L 3G7TA 3BPNC 3OB0H 4ZX3A 3RP1A 1YYLL 2NTFA 3NZ8B 4YDVB 3H9SB 5AW2B 5EA0H 4DUXA 1WEJH 2XPYA 3QRFM 2ZZUT 3X1NA 4X80L 1DL7H 4RESB 1D5RA 1V5JA 2QADC 4G9FA 4XVJH 4ETQA 3N85H 4X4ZA 4KXAA 5IROA 3UYOD 4TSAL 3MV8B 4FCAA 5FC9A 4D0BB 5A6LA 1U0QA 1G9MC 1QTSA 2VLRE 4KKLD 1TDQA 3MV9B 5F9JA 3QDMA 5I73C 5IFAH 4TRPL 5JPMA 3DYPA 3TBSB 1GYWA 3MRIB 1IFHL 5DUPL 1A1NA 3CMOL 1ZT7A 2WO2B 3ZW3A 1ZV2A 3QWRD 1N26A 2EUVA 1A14L 3ZZ1A 3AGVA 4GRMA 5HJ3A 1G1KA 1C7TA 3W5NA 3VUAA 5JHAA 2GIYA 4LHUG 1C5CH 3SYPA 4V2BA 1HHIA 2E9GA 3N55A 3QFJD 1I4FA 3EJJX 3M07A 3SY0B 4BK5A 1D9KA 2F6AA 2OL3A 2EJ1A 1IGML 2R2EA 1N5AA 3OWEA 1QI4A 3KPOB 2H6PA 4NN5C 4Y5XC 3OGCA 4N87A 4ELME 4P2OA 4HIXL 3U1QA 1KJ2H 4A2EA 5F7UA 2V8MA 5CEXB 4BA8A 1Z9MA 3TLRA 2HT4D 3NCYP 3K4ZA 5CO1A 3LNIA 4FQHA 5DD1H 5F7NC 3W11C 2EVJA 2WOYA 3CUPA 5L4FA 3M46A 1IAII 2Q1EA 1XR8B 4N6QA 4ZDHA 5L2KD 1Z9SB 2F54E 2XTSA 4QRUB 1QSVA 2BSED 4LLWB 4AKQA 3CFNA 4Z95H 2E9BA 1GGBH 4P5SA 5KEZA 5L8LB 3HE7B 3GRGA 3FFCE 3SGKA 4HGWA 4PRIB 1J5IA 2G75A 2VZVA 1M7DA 5GGQH 4G6JL 4TULL 3U79A 4M1GL 1IC5L 4I7ZC 3WLWC 4OCYL 1F90L 3TJEH 1F56A 2YA0A 5DRWA 3IJEB 2IMMA 1LP9B 3WLBB 2CO7B 4AXWA 1MJUL 4S10A 4K5LA 5D96B 5KVGE 1FDLL 3N44F 4OZ4A 1QRNE 3ES6B 1AZCA 4JRFA 3VWJA 4U6TA 5JOPD 1N59B 1T0MB 4EI6B 3ZOAA 1SDDB 5AB2A 1L9TA 3W38A 3CLEL 4PGEB 1T20B 2OV0A 4XVSH 1FZJA 3FN3A 4LO9A 3VXOA 1RURH 3D4CA 5ESQA 1F41A 4CGUB 5KTEL 1YG9A 1IUZA 3LN5B 3KYOB 1JNNH 1SXSA 3WIFB 1SJVA 3FNKA 4G8GB 2WVVA 2CLRA 5E1HB 5FHBH 3SGJA 1J12A 5DFAA 4U33A 3AS3A 4NEHB 2XV2A 4Q9RH 1JXJA 3FFDA 4B9PA 1H3VA 3EOAA 2DQTH 2G5BA 3GINA 3OR7B 1IBFA 3SDCD 2WK2A 1B3JA 4JG9A 3SKUD 3WS3A 5T3XH 2GJJA 2HRLA 1MCBA 1KC5L 4OCMC 4WWNA 3MJ6A 2A9ML 2X2UA 1M71B 3Q2VA 3BGFC 1AYOA 1JV2A 2UXGA 2X4PA 5L4JA 3QIBC 4Z7NE 4GRLB 3GBMH 2PYEB 4FXGC 2FAUA 1MCHA 1M6OA 2EYTA 1T6VN 2E9JA 1B3IA 4MWFB 3SKOB 1B4JL 2NRDA 2IOMA 3DX0A 2BIOA 4GKNB 3T3PF 4PJHA 2MQCA 1OF2A 5I1CL 3MGAA 4HXAH 4KKNA 4E9XA 3NN8B 3K6FA 3Q1SL 2XT1B 4N24A 43CAB 1U3HA 1ETA1 2DN7A 4GQ9H 3US1A 4J4PA 3I6KB 4PRPA 3RTQC 3OKMB 4B96A 3ALPA 4AMKH 4YHIA 3UC0H 4NPKA 3MA9H 2BK8A 5B1JA 5LLIC 5B3SB 1RUKH 4XBEL 4ZOBA 2HFFB 2I69A 2VIRA 1CL7L 3VXOB 3IN2A 2NNAA 4LFHD 4DZBB 4A2HA 2O93L 1JWMB 2ZKMX 4HC1H 3NACL 1MHEB 1MUJA 2X7LA 3DIDA 5EDXA 3B56A 1JK9A 2WAQA 4CN6A 1NC2B 2MFNA 5FW8A 1JZJA 3NQKA 2WD0A 2GJ6B 3QUKA 4GIOA 2WVSA 3MCLL 3D2UB 4K7PL 2ZPKL 2GSGB 3H9YA 2WZ5A 4X98B 1Q38A 3QB7C 3UG4A 2PO6A 4PHXA 3VWKC 1T2XA 2HLFC 3WXVH 1A7PL 3FQTA 3JV4B 3QQXA 3IDIA 5AYQA 3QZOA 3QORA 4Y16C 2K70A 4KUZH 4W6YB 4UU9A 2Q87A 4S0SD 5F89B 2QVKA 3D69B 3ULVE 5FYLL 3JUYA 3KPQA 1J87A 1BG9A 2X1PA 4YHKH 2WINB 4YLBA 5EC1B 4FZEH 4ZAKC 1EDHA 2JQMA 1D5ZB 3EADA 1F8TL 1Z2KA 3BYTA 2WIIA 1TJHH 1E5ZA 4P23B 2XZCH 2BERA 2DLFH 2EDOA 4JG0H 1TJGL 5IFHL 3EOYG 2Y06H 3QWOB 4DVRL 4RWYL 7CGTA 4XMPH 1TCRB 2EECA 1I7UA 1P5VB 2EDKA 1M1SA 4CKQA 4PJXF 3FUHA 5F96L 4P3CH 5IB1A 1DN0A 3IWVA 1PS3A 2Q7YB 1DSYA 3QUXD 1OCWL 2BVPB 3GK8H 3FQRA 4HP5A 2I26N 4AYBA 2BOCB 1IZKA 2P5ED 4HZAA 2PN5A 4AV5A 3LRKA 2BZCA 3G6AB 2P8MA 2QVTA 1CMOA 2XWDA 4F37F 4PGZA 4AL8H 2UY6B 3BLBA 2HTLD 1R5WA 3TASA 3QHZH 5CIPA 2AXWA 1JCKA 2FNBA 4WWID 2Z8SA 3STZB 3AU1B 2Y5EA 4PJBE 3WHE1 4GAGL 1BVOA 3UO8B 2JCCA 1FRGH 4N8VB 4PJ8A 4XAWL 2XXGA 1JG9A 1B0RB 4YHOH 2TSAA 2IH9A 4QRBA 2H32A 3DC0A 3D09A 5GGVY 3IETB 5F9OH 1EA9C 2YS4A 4HUNB 5BS0B 3VTAA 2HWZH 1LE5A 1K4CA 4PI2A 1OK0A 2JELL 3T0WA 4I5BA 3QUZA 4Y2OA 5HPOA 1NGYA 3TYGL 2V2WB 3B7RL 3I6SA 2FATL 5F6IB 5CP7B 5J56B 4FZ8H 2DH2A 1FFTB 4JDVA 2IAND 3QPQC 1IGIL 4PJ7F 3IJ8A 3WTXA 3VI3F 3UZEC 3E8UH 3JYBA 4LPWA 3WIHA 1J9QA 2YAEA 4PI0A 4BHUI 2VKXA 5DJ0A 2V4LA 3MBEB 4JPWH 5KJRH 2HLAB 3ILEA 5C7ZA 2H2PD 1W0VA 1SJXA 4IYKA 4LMQE 1HXYA 3FO1A 2JV6A 2VDLH 4BKSC 3CHXA 5HGHA 4QY8A 4N5EC 4M61B 5IEHB 4Z23A 2A0LC 1HT6A 4JDTL 2L04A 3APDA 5C0EA 1GW0A 3KPRB 3X3FL 2YBRB 2F7OA 1AYRA 1HZKA 1CXIA 4FNPA 2ZXWB 4LOVA 3UBHA 4LARL 4EI5B 2L8AA 2YD6A 4JFHE 5E4EC 3ZDYE 4EIBA 5DD5H 1KYUA 2OR9L 4DGYL 1MJJA 1SOSA 4TUKL 3TIEB 3QJVB 4V11A 4QJ4B 2FBRA 4TVSa 3OQRA 4ODVL 3W39B 1TEYA 1S7TA 2CJ3A 2AQSA 1TJMA 5D7IA 8PAZA 3SDXB 3T4YB 2ZXGA 2AXFB 1QWHA 6TAAA 1GGCL 3HMXH 1DUZA 4ZMQA 4X4KA 3DJSA 1TMQA 2X3AA 5C07B 3CH1A 1MW1A 3SKMA 1A3LH 4PJCA 3M17B 4PJ5A 2G5UA 4RFNC 4WCYH 1ZLSH 4F9PC 5I15L 3US0A 1B90A 1YEHH 4AH2B 3GMRB 3BEVA 3MCLH 3QR2A 3UBXI 4E9YA 3HE6A 4K8RD 3OM3B 1CD1B 4KI5D 1R75A 3G5VB 4RBPH 3SGEH 1G1YA 1UVQB 3ZVVA 1IQDB 5KOMC 2YKLH 4P2QD 2ZSVA 1SMAA 3GXIA 5IBUB 5T3XL 1MIMH 3BMWA 3FU7A 3P40A 4FQPA 4RAUB 4LCUB 1ZT4A 3FQ1A 5C7XL 2QSVA 3B9KD 2Q10A 3NIDE 4KH2A 4ESKA 4QNPE 1MFNA 4IOFD 3CZUB 4G7YH 1S9KC 3CCHB 2GBAA 3VFMA 4U7MA 4CNIA 5I1LB 3FCGA 3I9AA 3POCA 3TO4A 2FJHA 5ADPH 2C5DC 3T04D 4XBPA 3LDBC 3V6OA 4DTGL 4DPBX 3WN6A 5EZLB 1PYWA 3KAAA 3UTZA 4NNYA 2YUZA 4AUUA 3QJSB 4B9IA 1LK3H 1X5HA 1V3JA 3MC0A 3SE8H 4NO5A 3MRDB 5FUOH 1IGFH 1NDMB 1OGTB 2D7NA 2F2HA 1ZE3C 4OGAC 4NQCE 5ESAA 3D39A 4Z7UB 2E0PA 3ESMA 3U7YL 4Z1PA 1OVZA 3IMVA 5DJ2A 2ARWA 1QI3A 1JRHI 1BQHB 1NLDL 1S7VA 4JANB 5D2NC 3UGEA 3CZLA 3MUZ1 2ED7A 4HEMA 4R97B 2VT0A 3ECQA 4XMTA 2VDKB 1J8HB 3DSFH 2NY1C 2BIPA 1HILA 4R8WH 3W56A 2VWEE 1VA9A 3MGTB 1MCOL 1AD9A 5LBGA 3GHEH 3VWJD 4GSDH 1ADQA 4Y4KA 4DJMA 2YC1A 1O7DC 1I1CA 4HIIA 1UM5L 4OCXL 4PLJD 1G7JA 3VH8A 1AKPA 3PWNA 4KKBD 1X7QB 1L7TL 4NQEA 3ABGA 3QIBA 3QUGA 2F53E 4JRYE 4O2EA 4BEIA 2X6BA 2WXQA 3B5GA 4F27A 4AJWA 1L9SA 3TEWA 2JB6B 3H4FA 3FSWA 3VO0A 3ZLQC 4APQD 3ZHKA 3P0VH 3ZRSA 4PTTA 1NOLA 2D0GA 4ELMF 2XI9A 2IH1A 3FBQA 4WUUD 2VERN 5D7EA 1DR9A 3WNJA 4BFOA 5HYSG 5IT2H 4Q9QH 3ZDZB 5IB4A 3AJ7A 3QDGD 4WUUA 3V7MA 4CL7A 3KPRE 4M1GH 1YMHB 5CJQL 2QSQA 5HJDA 3DMMD 4KK6D 3WFHB 2BSSA 2IDTA 1JWSA 4XX1E 3BPCB 1JFQH 3GI8H 4ADIA 4HUCA 2N59A 3ZL1A 2F8IA 2KZKA 1AJ7L 4RAVA 4EXKA 5FM5M 3S9DB 3QQ9D 3VXSD 5CN2A 5C7XH 2R2BA 3L1FA 2XPGA 3K0WA 2WXOA 4CMHC 1TLMA 5I1CH 4MLSA 5IOPA 2N7BA 5ICUA 4GRWE 4K07A 1XD1A 3RL1B 5BS0E 5EV7A 2ZUTA 3MNVA 3LS5L 3HAEB 1MAML 1Q94B 3VFVA 5ALCL 3I6GB 3WL9B 5CHNA 1I7RA 2LVEA 4WV1A 3DKHA 1S9YA 4FQCL 4FMKA 1RJLA 3KE0A 3MLXL 4IDLA 4EI0A 4UT9L 4UYPA 3CX5K 2BP3A 1UA7A 5LVEA 3PPEA 5I8EB 1PDKB 4WKXA 3DTXA 5E8EA 4EQ3A 2YBRA 2UVEA 3N50A 1NAKH 2QQQA 4NRZB 1KEGL 1U41A 1PKQE 3BPOC 3P9WB 3MLTA 4M61A 3CWGA 5I1JH 5IEHA 4QDGA 4QTHA 2MHAA 5C0CE 3UTTE 3WV0A 2TSBA 2ZONA 1Z5LA 1K2DB 1W0VB 2NLJB 4UZGA 2ZWKA 5FGCE 4ANUA 1TIUA 4BH8B 3WIAA 1TQBB 3KD4A 4XOBA 5C0AD 1MPAH 5T1DL 4P59H 5DHVB 4FABL 3O3BA 3EFFB 1FDLH 2RFXA 2A9BA 4KC3B 1TPXB 3EJTA 1XGQA 4U6YB 3EXJA 4J2QA 3VRJB 3QHFL 3SSGA 3GS7A 3TZVB 4QRAA 2PMZA 3KNBB 4ZTOH 3TCXA 1L7TH 3AQDA 3AMKA 4ONHB 3QWNA 4TSCL 5GZNA 4AL8L 3ISRA 3PHQA 1AQDB 3PL6B 2JKTM 5LGKA 2PUQT 1WEJL 4TTGA 4NO2B 3EYQC 4ZFGL 1UZ8A 5J4MA 3NCFB 1Z1WA 1FL6B 3RWDB 4AC2A 2BRRH 3PWUA 4FEIA 5E6UB 3LPOA 1NLBL 3CNKA 4NAQA 4F15C 2AAAA 3QXDB 3QWRA 5FKAB 1WS7A 4PGBB 2EZ0C 2K9UA 2BHFA 3DURA 3QJHB 4MB3A 4BWTA 4NUGH 2EEFA 3VFPA 5F9WC 1PY0A 2IQ9H 1HTYA 4HF5H 1E67A 1ORQB 4J3WA 4EIZC 3TESA 5DI8B 4Y19A 3T0EB 3C6EA 4A6YA 2WGNB 1REIA 1VJSA 4M1DH 4G8FA 2H1LM 3T4AA 3QRGH 3KGSA 3EJZC 1V3KA 3F6IA 3D0AA 4OJAA 5EOQL 4OIIH 1PSKH 1QQDA 1HXKA 3OSVA 3QEUB 3W2DH 3Q8AA 5JIDA 2Q5BA 4PR5A 3H6JA 1DEDA 1UUSA 1L9RA 3KM1A 4HWEL 3SE4C 4XB8A 3TBYA 1QR1B 4YHYB 1UZ8B 3NSYA 3CPLB 1N0LA 3SCMA 4YDZA 1DDHB 1AZBA 5BOPA 2D0HA 4YIQA 3PL6D 2IDUA 3Q6GH 3L3HA 3VGGA 1G7HA 4ORGA 3IDYC 1G6RH 4I3RH 1D5ZA 1PG7W 1XH1A 3NBNA 4I8DA 4P3CL 4GINA 4PD4K 1XF2B 2AGJH 1U33A 3C5SA 2XWBA 3QQNA 4QT5B 2QJDA 3VCLA 1JNHB 2X88A 4KROC 3NJJA 4TSAH 4OM0H 3FRPB 1F4HA 3P02A 1NMBL 5GRUH 1FFOB 2XZQL 1NCIA 3GSXA 3NJKA 5EEVA 1JF5A 3RPIA 3QORC 3FO0H 4LL9A 5HHOE 1Q72H 4J8RB 1BF8A 3V4LA 1MRFL 1GGIH 3V0IA 2X05A 1NEZB 1NKOA 1M6UA 1JZIA 1EJOH 1NC2A 3EDEA 5EIIA 4K3DH 4KRPB 4PJBB 5KSBB 2H6UA 3SPJA 3HR5A 1EXUB 4G8EA 2ED6A 4IW4C 4KI1A 3IGLA 3TOPA 4HUXB 3VD3A 2V5TA 1I1AC 5DD5L 4Z3JA 5JHDB 5ISZB 5JUEH 4ATWA 4JFWA 4NQQA 4JEGB 5J6GB 5C6PB 25C8L 2XZZA 4Y5XB 1QABA 4WV1B 2X4OB 5E1AB 2C26A 1BX2A 1M53A 1BP3B 2UXVA 4XMPL 1PD0A 1FL3A 2DMCA 5IVXF 3SPGA 2DWDB 43CAA 1GZHC 2V5YA 3HAEA 4K9EH 1FVCB 1BVNT 4PBVC 5GRVK 3UPRB 1XSOA 2BWQA 4XHJD 3GC3A 3JTSA 2I85A 3UJIH 1HE8A 3L4ZA 2WZAA 3L4VA 5JA8B 3HB3B 3BVNA 2C3HA 4B3EA 3BWUF 2QVFB 1BFSA 5FW7A 2LU7A 4MNGB 2EYTB 5F21B 4IJTA 5CM1A 1OW0C 2PR9A 2G0LA 4AYID 3RPKA 3SQBA 2OX5A 2X4PB 4R4FL 2BVTA 2MQ0A 2QHRH 5IB4B 5DXWA 3GGWB 4I0PB 4Y0GA 1G9MH 3P3TA 3VXPB 5EF3A 1UZGA 3FF8A 2I5YL 4X5WB 3WSQH 4L3EA 2VLRA 3QJFA 1E8ZA 4RISL 2VZ1A 1IILE 4K3EL 3VJ6A 5CUSH 3TPKA 3PQYE 4JFEB 2D73A 4XWGL 1ADQH 5MERB 2KERA 5E9NA 5C86A 4NKQB 2AAVA 2CLRB 2WVVB 3IFOB 4AJ0A 3VD9A 3LMJH 5ISZA 1BMZA 4KUCF 3WNNA 4GIAA 5I1GL 4DKEL 2VLJB 3BUDA 3GJFH 3KPNA 1XL6A 1PL3A 2F58H 3MXVH 4FCHA 4LVNC 1GOGA 3ZYOA 5HVHC 4JHAL 3QI9C 2E7LC 2RH0A 3VWJB 1RUAH 4I1PA 4K3JH 4WO0A 1JNNL 3OQ3B 1WBXB 2G9KA 4MS6A 5E4AA 3D9AH 3VWKB 5A43C 5A7BA 2ZXCA 1ETB1 3HPLA 1H3PH 1KY6A 1HQRB 3EJUA 4XBGA 2OI9C 4UT9H 1YEJL 2QKSA 4HIHA 3UAJC 1ACXA 4LAQH 2ARJQ 2D7TH 5CSZB 1H8NA 5E2UH 3ATDA 1SUHA 1TEFA 1MWOA 3S4SB 3WGUB 1IC7H 4PJHE 4WU5A 3C8KB 2JJWA 2HKHH 1OSEA 2EO9A 4FQQB 4GSRA 5FAAA 3QDGE 5DT1H 5I8CA 1A9BB 4K94H 5IHBA 5D5MF 1BPLB 4OZHE 3HEIB 4E9RA 4HVBA 4WI7A 4L2YA 4Z5RB 4FQXC 4OVVA 4K2UL 4XMXA 2EE3A 3JWNG 2EE0A 3KLSA 1HL8A 3O2VH 4XNMA 1IC4L 3GM8A 4MMXA 3B7UX 1JZ4A 4YHZH 2VSDA 3QULB 2QSTA 2RIKA 2V7HB 5EZPA 3BJ91 3FO9B 1JNLL 2BNQE 3ZO0A 2DWTA 5DC9B 1BFVL 3U1SH 3J27A 4FQ1L 3U4BH 2IG2L 4H44C 1RU9H 4KXBA 4HHAA 4NWTH 2J12B 5JYMA 3F12B 3P4NA 2OL3B 2R2EB 3LRHA 1F4WL 4AGNA 3ENEA 2VJ8A 2MQ3A 4L4TE 4K7PH 3BN9C 5B22A 3P3YA 2FT8A 2WTRB 1U8PB 3MZTA 1JAEA 2YO3A 3TEZA 4JL1A 2VGLM 4M29A 3MX0A 5DC4B 1QLRA 1OB1B 2NPLX 5JXED 3BI9X 2XA8L 4IRJA 4TULH 1U3JA 2OXGA 2WQUA 3EDKA 1PEWA 4XHJC 1RV6X 3FTWA 3D2TA 1W9XA 4PS4L 1HWGB 4I0KA 2AXFA 3OD3A 4JR9L 1A6UH 4MNQB 2H8PA 4XH2B 3JZ7A 1U93B 2AC0A 4XNUL 2XLLA 4WK2B 2JCCF 5GRJL 2BOBB 4BDVB 5C0GB 5D93C 1MJJB 1AXIB 2OYKA 4JZNA 1J7VR 2X6MA 4OGAD 4Y4KB 5C1MB 1A4BA 4Z3HA 5ABDE 3SDDC 4GG8B 5DUJA 5ID0A 2HLEB 5PAZA 2FQEA 3MGOA 1S5IH 5C0AB 4YDVA 3UJJH 4KTYA 2FGZA 2AVGA 3FQNB 1Z9OA 3DUUA 4LEXH 1PTZA 1J5OH 2C7FA 2NY2D 1KELH 2OCFD 3LIZH 3GEWB 1FJ1B 2A74B 3HHRB 5DRNA 3M7OA 4OLZL 4XE0A 5HI4D 1OPOA 3K2IA 2CHDA 1N5YH 1EBPA 2Q2LA 1OP3K 5I28A 5AG9A 3OV6A 2BVOA 1IAMA 2J8HA 1VEPA 2NZ1A 2DIJA 4PJAA 1TVBA 3D06A 2AV1B 3BD4A 4PU2A 4G6MH 4GW1A 4G43A 5AEAA 3PP4L 4MJ6A 1KCSL 2J72A 4NZJA 5EZLA 3TBWB 3FO2A 1IVTA 3H55A 5CEZE 4OZFB 4Z7OB 4UMSA 5D1XD 4Z7QB 3ECVA 5I1LA 4P3WA 3GMLA 4D9RE 1QBLH 1RULH 1UKSA 4RMVA 1HYSC 2VDKL 5C2BH 3PFUA 1MW0A 2N56A 2VMDA 3IJSB 4PRHE 5HBBA 3LV3A 4GH7B 1DSWA 2D8KA 4AYEC 4GKSA 2IPTL 3MBWA 4N0YH 3L8QA 1JPFA 4O4YL 2Q6WA 5F6IC 2OQJA 2Y36L 1B9KA 4M7KH 2NZIA 2Z9TA 1HESA 4HYTB 3JT0A 3O6FB 4N2AA 3K2KA 3MLWL 3BPCA 4F8LA 2P52A 1YY9D 4K71C 1CD1A 2C3GA 5C2BL 1RZGA 3MBXL 1YJDC 3G6AA 1IAIH 2DD8H 4R4FH 3RRQA 3VXMA 5C9JA 4PYHA 1QHPA 4NQSA 3PHOB 4QHUB 5H2BA 1KN2H 5FUZL 4NBZB 1AHMA 4AZ8B 3FBKA 4OSUL 4CADA 1LO5B 5F71A 4H8WC 2AJZB 3BUYA 4M02A 1NM9A 2IV9A 4JZOB 5HSFA 4ORZC 2Q9OA 3ZX1A 5E8OB 1U8CA 3O41A 4G5AA 2WP3T 4N2HA 3VGBA 4LZKA 5KYNA 4U1IA 1FE8L 4JQVC 3LSOA 4OV5B 1IZJA 2YC1B 1UKTA 5I8CB 1K5WA 1DLFH 1GTFA 2Z64C 3VVVA 1A6TA 4K3EH 1ECZA 1CC3A 5EO0B 2MWCA 1I9JL 3E8UL 2X2JA 3TNNB 4M48H 1HZLA 3D69A 1RJYB 2HRPH 2YPVH 4JUSA 1RAMA 5EBMB 5FF6B 2ITCB 3A24A 3QJOA 5DA4A 5LCVH 2JCCE 3AW5A 3NA9L 2JXMB 4JANA 2XJKA 3DHPA 4ADGA 5AD0A 1CVSC 5ESAB 4OIBA 4NQCB 4X7SL 1J8KA 3HZMA 5EZOH 5L0QB 4R4BA 1IEHA 1ACYH 3QNFA 3UJIL 3U4AA 1KEML 5ECGA 2QKIA 5BVJB 4XPAL 1RCYA 4DZBA 2HKFH 4AV4A 4IU2A 1U3NA 2RQ8A 3MRKA 4MJ2A 4H0HB 2CBTA 2C9UA 3NCYS 4OZIF 4AKPA 5C0CA 4QRPD 5F97E 3UP6A 25C8H 3UPCA 1BBJB 2VR9A 3OKMA 3VFMB 2VDPH 4WI4A 5D1XB 5EA0L 1BEXA 5AVYB 4JRYA 2IFFH 4A2DA 2VSKB 4Y4HC 2K1MA 2GC7C 2YFOA 1IKFH 1AGBA 4FQ2H 4IBVA 1HYRC 3MX0B 5KSAC 3X14B 3DVFA 4YAQB 3SQBB 4JFDA 1UVQA 3M8OL 4KHTL 1SOQA 5IMKA 3SOTA 4GW5A 1F1AA 1ZAGA 4S1SL 3CDZA 3ULVD 4HUWB 4OUUB 1DLFL 5B1CA 2DIEA 2PWEA 1KTBA 2OSWA 1T4KB 3AREB 4AUYA 2KYIA 4IKIA 3BKJH 2AV7A 5GJSH 1GKOA 3SKJH 1Z32X 4L8BB 4NKMB 3FQUA 3DI3B 2YD4A 3MO1A 2ZAHA 3QQDB 4JE0A 1L5GB 5GS1B 5ELIA 5DUMH 4NPYA 1HSBA 1A9EA 2EACA 4ZNEA 4KUZL 2A4EA 2MOQA 3D0LA 1ET5A 4XMWA 1L3NA 3WFBH 1B6DA 1S7QB 3I85A 3L3GA 1P1ZB 1MOEA 4KJQD 5IGXH 2E59A 2YWZA 3C8KA 2PABA 2VO5A 2Y7QA 3BUQA 3NIGE 5SWZA 3QR1A 3VE0A 3RWIA 3LJ3A 3T8XA 1P84J 4ODTL 2X5PA 5F7EL 3FT3A 1I1AA 4NNXA 1YO4A 2AZUA 1EO8L 1XF1A 4DHLA 3O8XC 3SJVB 3WE6B 5C0BB 2J4WL 4JHWL 4LPVA 4DQOH 3Q3GB 3OAUH 4YXLH 1HQRA 3VXUB 3LN4A 1WGVA 3R0MA 1J9TA 2OFQA 1BWWA 1AGCB 1NAMH 1T4WA 5KBNC 4LSPH 1JNHA 4UAOC 3S3PA 1DBJH 3E6HB 1DJYA 5EEWA 1E9QB 2QLYA 4QGTA 2XN9D 2XVGA 3WSQL 4YXKH 3IDMA 5GZND 2ZF9A 2JJSA 5D1ZC 1JF6A 3MNZB 5ADOH 3GUTB 3S96B 3FAXA 4EUPG 1C08A 4BXSV 2X42A 2WZPD 3HBGA 4UILH 5HHQA 4WRLA 3K6SB 4PRPB 1S2EA 4J6RL 4C56A 5K5YA 2VLRB 3QJFB 4RFOL 3TJHC 4PV9B 1BD2B 2HFEA 4QRPB 1UCBL 2EDYA 2JCCB 4X9IA 5MEQB 3NN8A 1VZIA 2YQBA 4I48A 1FYTA 4S0HA 4TSBH 1KC5H 2ZWLT 4Y1TA 1MRDH 1YEDA 2FJSA 3NRPA 4M6MH 4W9LC 4J7RA 2O6EA 4N8UA 1KGCE 1ULVA 2JI1A 3BWSA 3N41B 4HAFA 4IOSD 4YLCA 4P5RA 1JPGA 4L3AA 3UPAA 5JQ6H 3MRMB 3T0EC 1FSKC 3IRZA 5FHBL 3ARDB 4DUWA 1WT5C 4N2MA 4OQTL 2X4RB 2NZ9D 5C09A 3BVXA 2B2XL 1CE6B 3HC2A 3V5DA 5B38B 1X5GA 3BPOB 2P48B 2IXQA 3NCJH 4R90L 3EOTL 2XC8A 2QQNL 3D18A 4MZ3A 4HK0A 4PY8J 1BZOA 4AQ1A 4XAKE 4YZWA 3ZL4L 2J1YA 3RUGE 4HT1L 1ZGLM 4MZIA 2PCFA 2ENQA 3C08L 1AQDA 3GTVA 4LKCA 1LXMA 4P23D 5E95B 3U82B 4C59B 5JHDA 2AEWA 4ALAC 2DWEA 3K2UL 4P23A 2GI7A 4OLZH 1E8WA 1FZJB 4WU7B 1FBIL 3T65B 3ATBA 3VRJA 3VFSB 5I18L 2YOAA 4J6IA 1PMYA 1D5IL 4QGYA 4UV4L 1ZLWK 3AUVA 4QRRA 1V7NH 2PYFA 3ZKND 4X6DA 5EUKB 3O2DA 3F84A 2RAMA 1VEOA 4M4PA 4YPGA 5DGRA 4ZMLA 4XXCC 2J8UF 2FYVA 4FULA 4LKXB 3NJLA 1K2DA 4WWKC 1JZ3A 4H88H 1QBAA 1YMME 4HJTA 3Q3GA 4JFFD 1YAZA 1P6FA 2FX7H 1NC2D 2VC2H 3N04A 5EU6E 3DDGA 1NOAA 2XTLA 1KJ3L 2X4QA 3W3BA 1XGPB 4GUPA 3NFNA 4NM8H 4PRIA 3EO1A 4JO1L 4XNZB 2CM6A 1KJ2B 3QO1B 1KYFA 5E6ID 5CCKL 4MVBD 4CAGA 2TRYA 3PDOA 4CDHA 2V7NA 3O8XD 1E9PA 5E2TL 1T1XA 4BSWB 5D1XE 4POZC 2R7EA 5IVZA 3TBCA 4AJVA 1F86A 2ZAGA 4YVNA 3E6FB 3INUH 3O8XA 3RTQA 3BDYH 5A6MA 3KGRA 4C4UA 1XB3A 4PJ8C 4IEFB 4DETA 1ZIAA 3RVXC 2A0LD 1ZVSA 3DROA 3IB4A 2EYSB 3LZQA 4KNTA 4L8BA 4NKMA 1QR1A 1URLA 2H9GB 4J3UA 1UM5H 3BESR 2AV7B 2YD8A 2Y1ZA 3E2HB 3TCLA 2CUMA 1J1XL 1DVYA 5CEYA 4FQ1H 1OHZA 3U4BL 2R2BB 5BXFA 4P0DA 4PV8B 5CBAA 3AADB 4UTBH 1UWEL 4OKVB 3MOBL 2AJXH 4B9ZA 1M9WA 3NSJA 4CC0A 4S2SA 4QHKJ 1O7DE 4LASH 1W8EA 3HFML 2BW4A 2XIDA 1JI2A 5KW9H 3W5MA 4MJHA 4OY9A 1AI1L 5IESH 4RDQG 2DLIA 5LCVA 3LHPL 4BXVA 4MAZA 3MV9D 4UV4H 2RJMA 1MIML 5TH2A 1EEUA 2CJUH 2L0DA 2OBGA 5T3XD 7PCYA 2X4TB 1A21A 2CR0A 2IDQA 1BXAA 5FCUH 1NPNA 3QUYA 3EYVA 4ZSOB 3L45A 4IBQA 5D1XA 1A3RL 1GSKA 1PAZA 1X5YA 1ZLVH 1WDAA 1UT9A 3H1ZA 1AGFB 1CXLA 1Z5HA 3AAZA 4GRWF 2WTPA 3E1ZA 2FWSA 4LESA 3U46B 5G5DA 3RI5K 5KBDA 4G1EB 4L3FA 4UM9D 2RD0A 2XFXB 2KBGA 1CGXA 1PD6A 2EXYC 5E0FA 1JZ6A 2GFBA 3QA3A 3QI9B 5DR5L 4J3VA 3G5YA 5E4OA 2CUAA 5FO2A 1T6WA 2CU9A 3ATAA 1L6XA 1RK7A 1UFUA 2FUQA 2HT3C 4HV8A 4JY5L 4HG4J 3C5JB 3SPVB 4OCRH 4RA0C 1HCYA 4JVUA 5DHVA 5EUOA 1T2QL 1M1XB 1OCCB 1E27B 3VGDA 4BWUA 3ARPA 3SE9H 4EBQH 2MH4A 4N1HB 4L4TD 3HPJB 3ARSA 4H0LC 4KWUA 2EC9U 3OLDA 5F7DB 2NY3C 1SRDA 1N2RA 1RUPH 3ARUA 3MKGA 3A5VA 3OJMB 3HNVL 4W4OC 3VI4F 2W0FA 1VGEH 2AEQL 2RCSL 3MBED 4ZX5A 4AYMC 4X7SH 5FPIA 4JJHA 4MSWA 4HJEA 4Y2DA 5CCJA 2YWYA 4U1SA 4RZCB 4AM0A 1MFBH 4DO4A 3PUCA 1MLBA 1N68A 2WO4A 1CU4H 4KKAD 4RGOL 3BWAA 4NRXB 1YEJH 2I5YH 1KCLA 1NIFA 3DWTA 3L3GB 3FH8A 1XCTB 1AGDB 2B0SH 3I2CL 3QDMD 4U1IB 1EGJH 5AOIA 4BKTC 1UT1A 4EF3A 1HYSD 3F6JA 2DIBA 2B1AL 2DOCA 3DVIA 3GEFA 1XGZA 4KRPD 1DQJB 4OFPA 3F7YA 4X83A 5BS0D 1K6QH 1KLGB 1ND0A 5IK3A 3WO4C 4F57H 3HFFA 1CBVL 5DJDB 2Q2EB 5TK2A 1KBBA 4CADB 1WZ1H 5I5MA 2AITA 2CKBA 3VNZA 3QRGL 1GXEA 3PHOA 3DV4B 1ZA6A 4TXVB 1T4KA 4ZS7L 4PJXA 4MDRA 4RAUA 3LKOB 3BN3B 3GO1H 4HUWA 3C6LA 4OQ1A 4QXWA 3CZFA 2WWKT 1RJZA 3NSXA 1DVFD 2DV6A 2WSDA 3OJDB 1N18A 3GJEA 3GPSA 4RMSA 4XCYA 4MBOA 2CMRL 4NWUH 4E9TA 2QHLA 1YJDL 4P9HH 4IRJD 3ETBF 3IJYA 3N42B 1OPGL 4OTXL 1ASOA 2NY3B 3JV5A 2L7QA 1NGPH 4R83A 1QO3A 4JRYB 3CXFA 4TUOB 4OBSA 3R1GH 2M26A 2WGXA 1ND0B 1UWXK 5IK3B 2X4NA 4KZEL 2VQ1A 5DUML 1TXKA 2Q7NA 3UERA 3LHAA 3G6JB 4QJ5B 1XB6A 3FQXB 1G7JB 3L17A 3N3EA 4MB5A 4P46C 5T1MB 3VH8B 4ATTA 1DJWA 3DYMA 4K9EL 4BKLA 2HJFA 3E8VA 2VDRB 3ETTA 4FLOA 3MGTA 5PCYA 4JCMA 5EIIG 4NI3A 5HHNA 4IOIA 2OAAA 4R4BB 5L2JB 5IHLB 2JJTA 2ZUYA 4ODUB 1BQ5A 4K5PA 5FUOL 4ODHH 4HF5L 3OX8A 3VW3L 1AP2A 3QNXB 5TE7H 4EMZA 5IR1B 1R5VB 3Q6GL 4E41D 1C8PA 4FNLL 5DRNB 1FLRL 2O4EA 2X0VA 4LAQL 3UACA 2VITB 3ZMNA 4CVWA 2XXMB 1T66C 5FOBB 3UBGA 4OZGA 5I6OA 1OAQH 2AJYL 1C5BH 4ZUWA 4NAJA 3CSYB 2LTQC 1CL7I 3WAKA 4IGBA 3KMDA 1EZVX 5FGBC 2X87A 4U1MA 2DZEA 2FEDC 4FGMA 4GB9A 4H1LG 2CJSA 2EE2A 5ACZB 4AIZB 3FO0L 3P3UA 2VERA 3WKQA 5C0RH 1T21A 2GW5A 2XSKA 1YYMH 5ALCH 4CKVX 3WEAA 4G9FD 2Q86A 3EH1A 4M1DL 1SF3A 2FD6L 3NABL 4AG4H 3QXVA 1E50A 4IQHA 4LEOB 3IETA 1WP6A 3O11B 1A4AA 1HH9A 3HC0B 4KKBC 4AZ8A 2ZOKB 1T04B 3H7BB 2VQ4A 3NPZB 4XN9A 4LSRL 1QATA 2Q8BL 4UBDD 3ARBB 5CZVH 2P44B 3EUUA 2DIAA 3MA9L 2J73A 1NBQA 2WLIA 1OQOA 3TIDB 1CICC 4HH8A 5J12B 3WJLA 1J05B 2PPCA 2WCPA 1I1RA 4FXLA 1IGJB 4YC2B 4KKQA 1WGOA 4XCYB 5ECJE 2FVNA 5HVWA 4WI9A 3EYQD 3TURA 2P8MB 1JI1A 5FS5A 4H7VA 1KDJA 3C6LB 3KCPB 5LXVA 5F7LB 3NSDA 3CSTA 3A67L 3QFJA 1OTSC 2PPAA 1GPOH 3CH1B 3HG4A 1FN4B 2IH3A 2H1PH 3VYPA 1NCTA 3K4DA 1DVFB 2OJZH 1TZAA 3KLLA 1UB6A 1VAHA 2JF1A 4OM0L 1QEWA 2F19H 3ARFB 7FABL 1ZVSB 3DJZA 3BZFB 1ED3A 2NY5C 1IEAA 1S7UB 3MCKB 1BJMA 3QAZB 2D3VA 4MS8C 3ZE0F 4RGMB 1ZLDA 4NNPL 2J1ZA 2XWRA 3MV7A 1JYXA 3FU5A 1RZKL 2WXLA 4Q2ZB 5IUSA 1C16A 5DEGA 2AMGA 1G7QA 4Z77A 1YRKA 5FUZH 2AZAA 3EFOA 3FO2B 3FT4A 4WW2B 4B5ZA 3GUFA 4FFWD 5BQDA 3IAQA 2FQDA 3BWAB 4NRXA 1RUQH 1EHAA 5F0JB 4NBYB 3KR3L 3MV01 1DYZA 4NCDA 4PRHA 4WU5B 5D2LF 1A3QA 4WFGD 1FFNA 4G6AD 1XMEB 3QG6A 3QDGB 1YN7A 5HGHB 5DEFA 2WBKA 1DQQA 3AG3B 4AMWA 3C09C 2OLDA 3GLAA 1X5KA 4EZMA 2FEJA 3KEDA 3NGBB 2W88A 1XR9A 2Z7YA 4FF9A 4N9GA 4HZLB 4XVUD 5BZWA 4FJ6A 2FO1A 1EWHA 5EUOB 2C1OB 3TA4D 4I0CC 5L2JA 1MREL 3B9VA 3FTXA 3G6DH 4JPVL 2VXUL 2KLRA 2OW7A 3B9EA 3G6JE 4LQFH 3GSUB 3PWVB 4UM8A 3ZJAA 1SM3H 4F2ME 3I9PA 1IM3B 3L3IB 3T0AA 1WD9A 2AJ3B 4JX0A 3RWEB 1Q9WB 4Z7WB 3KPMB 1KB9J 3BW9B 3PCYA 4IIQC 4OCXH 2VR3A 1RERA 1IVLA 1XF4A 2B1OA 3WS6A 4D3CH 5E94A 1FVEA 1XIWA 3V5KB 1MCOH 2X4NB 3DX6B 1T7WA 3ARYA 4NHUB 4Y5VA 4Y7MA 1RQ5A 5TD4A 3UC2A 4JQIA 4F8PA 2F58L 3UIZA 4DO5A 1IQWH 3PRZA 4PRBB 4QRRD 2BIMA 3DO7A 4EI5D 3DI2B 3RHWK 1IGTA 2FHCA 1N0XH 2GUOA 3BKYL 4ZTOL 1OB1A 3IGAA 4PJAE 4G70B 3BAYA 4BZ1A 1VENA 3WJJA 3ARDD 2OMYB 1KJ2L 4PJFB 4ZS6D 4ZUUA 5FECB 1A3RH 2VDOB 3OC8A 5KAQG 4FTVE 1GY2A 2H4EA 1U8LA 1U8OB 4LLMB 4DO6A 2WNWA 3ARXA 2CK2A 5SWSA 1S5IL 2F5BL 3O81A 2DBJA 2ZWZA 1HHJB 5JHMA 2WVUA 2OR8A 1KPRA 2Y5QA 4QO1A 4ONFH 3BHBB 4NOBA 5DO2D 1FPTH 4GRWB 3WMSA 4OVUA 3H9HB 2ZOTA 5E9AA 4QRFA 3VX0A 4PG2C 4RVBA 1SOKA 2B9BA 5DD0L 3BP6B 1C7SA 3RWCA 4KMQA 1C08B 3TTYA 1W6LA 2BY0A 5J6GA 4J4PD 1FNSH 1AQKL 4PRPD 4Y9FA 3RGVD 3LZFH 4DZ8A 3GXNA 3MNZA 5HI5D 3TC9A 3ZZQA 2ALWA 3LN5A 3ZDXE 3WTTA 4U31A 1ICTA 3RIAF 3QQ3B 3PGFL 2I27N 2EO1A 4L9LB 5I2IA 1VKXB 1OTTC 5D9SB 5KSBA 1XBRA 4UT7L 5FDYA 3ARZA 1MFAL 1PX4A 2FSDA 3EO1B 5DMJB 3VXSE 4FYSA 1AR1B 1CR9L 2SEBA 4QEGA 2E75C 2ICWI 4UT6L 1CVRA 5I5JA 3FRUB 4FKEA 5EPMB 4AXWB 5E6IB 1ZJAA 1BM3L 4F7EA 3F7PC 5D7IF 4KROD 2GBUA 5HHMB 1GVIA 4NNXB 1BFVH 4GS7B 4HJGB 4XN8A 3QORD 4UQ2B 2J6EL 1GGIL 3MNWB 1MLCA 2NXZD 2UUDK 3LPFA 2Y0SA 2QR0B 4X42A 2MCPH 3G5YB 3JYCA 4WKZA 2H7WA 1RZ7H 2HKAA 1FGNL 2V9UA 5D1QD 1YEEH 4GQZA 4I18A 5ESVA 1M4KA 2XZQH 2HX7A 3H3PL 3I02B 4P4RB 5E00B 3MUUA 5AKVA 2GITB 2DQHH 1R3LA 3RZWA 1SNRA 4Z78B 3AB0B 2EDMA 2F5BH 3I6LE 4KKPA 4OFVA 3UCRA 2PYEE 2VUKA 2WBJB 3T5WA 3HG1A 3QUYC 5H4ZA 1AAJA 1PZ5B 3QQDA 1IM3D 2AI0H 3OXSB 3PS6A 3EYVB 1RLBA 4AQ1B 5D1ZI 4XVJL 4QO1B 1N10A 3G6JF 5DJXB 1FFPA 5IW1B 1G0YR 4OJEH 5C09B 1OP5H 3DGCR 3BO8A 5SWSB 3U2SB 3NCCB 4HS6A 4I3SL 1E5AA 2SODB 4IBYA 3S8GB 5F3BB 2XX1A 2DI8A 2VL4A 4AENB 2ZX8A 4ZUUB 4JDEA 4BM7A 3EJQA 2VAJA 3FULA 5EO1B 3W82A 4YAQA 3BZEA 1BGXL 4M5YL 3DO4A 1JV2B 2DRUA 3CLFH 2FYYB 3N42F 3NJHA 2WW8A 5CU9A 5I6MA 1SJMA 35C8L 5FGCB 2C4FT 5IHWA 3X1EA 1DVUA 1J0HA 3MYJB 3R7RA 3RZCA 2V2XB 1ASPA 5KBLA 1MY7A 1WUNT 1WICA 2ADIB 1SM3L 3NJFA 4IJ3C 1XZ0A 1TZIA 3L3DA 5C09E 1FL6A 3RWDA 1MFUA 1TYEB 1HAUA 1XWVA 2VDNH 3WEBA 2EXYD 4G7SB 2BS71 3PL6A 3MRBB 4AGLA 5GSVA 3BW9A 4LLQB 2E27L 5T1KA 2HZHA 2NR6A 2Z7UA 5AW5B 3PWVA 4UM8B 4C56E 2ENPA 3U30B 1VSCA 1ZDSA 2BHYA 4ENED 4GXFA 3ARVA 5A40E 3Q8CA 3L3JA 5LQBL 3B2MA 2J8OA 2YQ2A 4YL4A 5B4MC 4Z7UF 4RGND 1KLUA 3LRLA 4FFTA 2AJVH 3OKKA 4W70A 1FL5A 4UOQA 1NFDE 1T1YB 5JQHC 3A4EA 3SE6A 1DBMH 3BZDA 3MUGA 4X4MA 5E8PB 3QG6B 1PJWA 1C5DB 5FLVA 2IEPA 3ARQA 4QT5A 3VXUD 3U7YH 1JHTB 2ATPB 3AG1B 5C0BD 3M1OA 1UYWL 4G42A 3UCQA 4P9ML 5I6KA 5HYEA 5IQLA 1JF1A 4I13B 4QRTA 5I8OL 2Y3NA 2Z35A 4JBSA 3ARGD 5FHAH 4F58L 3KJ6L 1CFSA 4M5YH 1CDCA 3E80A 1HEJC 2IAMC 5DURB 3QPQD 1D5XB 1KCUL 5JNYB 5AVTB 5GZOA 4V1DA 1LEGA 2ZUUA 1QACA 2E4FA 3VFVB 4NM4L 3NIFF 3Q6FA 4NQXA 4Y2LA 5CGTA 3OGCB 2KH2B 4IS6B 5F7YC 1RPKA 1P7KB 2OMZA 1N3NB 3L81A 4QTIL 1Z7JA 2ORBH 3K6OA 3LCYA 3CXHJ 5EBGA 1WFTA 4UT9A 4MBRA 1EHXA 3GBML 5DVMA 5FV2A 4L0ZA 3TN0C 4MA1C 1U95A 4KRNA 2ADFH 4JN2A 4KROB 1M2OA 4UDTA 4RQQA 2YKLL 1NCDH 5IROC 3QJXA 4PJIB 4ZK8A 1EJFA 4NJAL 1J88A 4I48B 1NFAA 1A7OH 2HN7B 1KGUA 3KYNA 4PJCF 2QDWA 4PWJA 3HG5A 3VFGL 2ENJA 3EH2A 4BFGA 3D85A 1T04A 2PWFA 4Z3TA 2FDBP 4DIXA 1EK3A 4L8CA 2OTUA 5AW3B 3O11A 1WAEA 2JB6A 3RAJH 1BBJA 3AQZA 1B0GB 1JIBA 1ZMYA 3WIIL 5CD5C 5F3HA 3PWPD 3ZBMA 2IPUK 4QF1A 4QYOA 3S35L 3REVB 1OT4A 3R8BB 4YX2H 4KTDH 4MQ7B 5IJCC 3OAZK 2HT2C 2VDNB 4FQIH 4QXGH 5CP3H 1KTDA 2FZ3B 2IFFL 3CFUA 4ZD3L 3T6XA 1MFEL 1GW6A 3DXAE 4I88A 3TWCH 3RWGB 2W0KA 3I75B 2ZP0T 3CC5A 3N40F 4NDMA 1R17A 2FJFA 4ADJA 2NTFB 3MZGB 3EIFA 1AGCA 1V7MH 1CLZL 4TQPA 4R7LA 3GJFK 4L48A 1DP0A 5LBSA 3MLPA 3SDDD 2J71A 1YDPB 1MVFA 1KN4L 3R4RA 4FHKA 1ZA3B 3FTGA 2XN1A 3QC6X 1T1WA 3HFMH 3HZKB 5KW9L 4JO8A 1BYOA 5CJBA 2NY2B 3DV6B 1N8ZB 4MDIB 1KB3A 3RWIB 2V3EA 1MWAL 4DFIA 4ENEC 1A6TB 3SDXE 3V0WL 3VXNB 8FABB 4WVRA 3IXAA 5B4MD 4F2FA 5JPNA 1OLZA 5CBEA 4B9CA 5JMRA 3QIUC 5D7KE 5ALBH 1YPZA 2XOTA 1LJMA 3HAEH 1MF2H 4GO6B 4YO0B 1W0YT 3WOVA 3HG1D 5IQ7L 4IU3B 4OIIL 3HI6H 3KVDD 4Q9BA 1W0WB 3SEPA 2ZUVA 4PLNC 1U92B 2F7PA 4YDLC 1FCCA 3DXAA 4ZXBD 4BCYA 4P46A 1BVKA 3B3BA 2XV3A 3K71B 1K72A 4L4VB 4XBMA 5D72L 1ZD6A 2AS5M 2DLFL 1ITBB 1KCVL 2Y9RT 4G8AC 1N0XL 3BKYH 4LSVL 5HYJE 1ZT4B 3EYSL 3DJRA 5D5MB 4P2RB 3DRTA 1MCFA 1WBZB 2OMTB 2NDGA 3JV6A 1IQDA 1WZ1L 4L1BA 2AJVL 5GSRB 4E36A 5D2LA 5C8JB 2IALA 1OTSD 3OJDA 4L4TB 1MWAA 2BRRL 3N06B 4H8WH 3B6SB 1ZVYA 5T1LD 3WKMH 4AGQA 4BCZA 1Q9LA 4PJXB 3JVFC 2V9RA 4WAFA 1Z6JT 5F1NA 5I30H 1Q0XH 4HPYL 4JGMA 4K7FB 4K4KA 4H5SB 4AEEA 3RVUD 1DUZB 3U0WH 2Y5TB 3DRQA 4R7DA 1D5IH 2VH5L 5LNDA 2AQ3A 2Z7ZA 5E2VH 5ENWB 1DEEA 1U92A 1GC1C 4WSGA 5L4IA 1PLGL 5I15H 3O2WL 4FS0A 3ZE2B 1A02N 4AQAA 4P59L 4JAMA 4FABH 1X5ZA 1KG0A 3FMGH 1XCTA 4UDUB 4EI5A 1AHKA 1ZEAH 2X6CA 5GZOD 4EDXA 1MCPH 5DMGC 3CFCL 4Y4KC 3N43F 4GW1B 5KYXB 3L9EA 4GI6A 3JWOH 3VFRA 2APTA 4X99A 5AW1B 1QW8A 3KR3H 4G80B 1R19A 3HZKA 5F0PB 3P2DA 1A14H 1YECH 1BEYL 1I1AD 2WM0A 2G5RA 4N0UA 5FF6A 4OD1L 1N6VA 5DDHB 4LDLB 4KK8C 5AAWC 5FYKU 5DZLA 3RTLA 3GXTA 1QNZH 2YGOA 3BWZA 1CJYA 1HDMB 1PNDA 4RSYA 3HZYB 2FJFB 4JDTH 4YDIH 2VMEA 3OHMB 3VG0L 3VGFA 2YAPA 2MCG1 4TSBL 5I6PA 4GO8A 4WJ5A 4HUUA 1SMDA 1YSOA 2JKLA 3GRWL 3PV6B 5I71C 1E2WA 3U0WL 3VI4A 1XCQA 4X6CE 1MFDL 3V8OA 2YAMA 3EJSA 1AE6H 1S3RA 1COBA 2LABA 1H5BC 3TO4B 5I0VA 3T8MA 4JB9L 1FZMB 3QZBA 4APXA 4UILL 4W81A 1H5BB 2NW3A 2CKBL 1AS8A 1CDYA 3B8SA 3TO4C 5KYWA 2X41A 5CJ8A 4DPAX 2X89D 1SYVA 3REWA 1GGBL 4JFQB 3DYOA 1TZGL 4QHUA 1S9WA 4JQIL 1T89A 3NJGA 1NCAH 3EZJB 1PG7L 3SKNB 2DICA 1MHHB 3TVMA 3Q1SH 4UZUA 1ILUA 3LKRB 2NYYD 5I24A 4XC3L 4W9GC 1DSFL 1F3JA 1SGKA 4ZFQA 3BEVB 1GR7A 3WFCL 5HGBA 2H0PA 1JGUH 5I18H 1CCZA 5JW3H 3M17A 3F12A 3P4NB 4R0LC 1HOEA 2MSPA 3B2DC 1A0QL 1AIZA 1PIGA 4YQXL 3Q9QA 2X9WA 4MHHI 2HX9A 1MRCL 2DQJL 2W9DH 5TF1L 3VI4E 2Q7YA 3G5XB 1LEGB 5L2KE 2W07A 3BOVA 1C12B 2OCJA 2E6PA 1BX2B 3VQMA 2WNXA 3DHMA 3FOLB 3TH3T 5KS9A 3ETSA 5T5FH 1YCSA 4AVHA 2WQWA 1BXUA 4QRSB 1FIEA 3WN5A 4ECNA 1NGXB 5JW4R 1A7NH 1PX8A 3CDGA 2EXWD 4MCYA 5MENB 4OZFA 4AGMA 1K5NA 4DGIH 3D39E 3UMNA 2ZNWA 4W9JC 4N2KA 1YEKH 2PO6D 3O0RH 3ZN6A 4NNPH 1L9PA 4QOKE 2GTZB 1CICA 5EIIB 1WJ3A 4MXQC 3KPQB 3SDDA 2J56A 2WXPA 3LN9A 3C09B 3BZ4A 4LVEA 1T0PB 4JRXB 2JKJA 3ULAB 5FDWB 4JNXA 4OT1H 3GFUA 1AKJA 5CCGE 1HHGB 3GPEA 3MOQA 1TJHL 2VXTL 3BSZH 2IV8A 2ZG3A 5K1JA 3WTWA 2BNRB 5I0DA 4MA8L 4JFPA 3KPLA 1F58L 2H2PC 3ZR5A 4JO1H 5ID0B 3MR9B 3GRWA 4K7PX 3VFSA 3V52H 3DK0A 4AMXA 5L2KA 2APWA 3BGMA 3AXIA 4HUMB 4PCYA 1XGTB 1ZDQA 2CQVA 1LO2L 5T1KB 1T22A 2ZCHL 2IBBA 5DFWH 4YS4A 4BQ9A 4N8PA 3UTSD 1GA2A 4BFIA 1MCKA 1JYNA 2K4AA 4NJAH 3CQFA 3NJNA 4N8VG 2G60L 3ME0A 2HJKA 1C12A 3DHJA 5CEZL 3O4LD 5KVFH 4HJ0D 1KY7A 2VLKB 4LL4A 4YGVB 5DFVD 4PUBL 4Z7AA 3QSKB 2FX9H 2ZWSA 3B9KB 4Z3FA 1KBGH 3RWFB 4YUEL 3ZT7A 1EHNA 3D5OF 4Z0BH 1WG3A 2FK9A 1MAJA 3ARDA 4PEEA 4HIXH 5AZ2H 3RFRA 1KIRA 4IRSC 1DJXA 1KFAH 1T5WB 3RUGF 3UZVA 3S48A 4JDZB 1QSFB 1NIBA 4PW4A 4U3SB 2DYPA 4EZKA 3C60C 4F57L 1J1PL 3EBGA 3I3DA 3SJVD 4FDWA 5B7EA 3ABLB 4Y7OC 4FL4C 1XCWA 2A9NL 4NHCH 2PP9A 2BY1A 3NA9H 4L37B 4UT6A 3T3MF 5A3IC 4AVJA 3MJ9H 4JPKL 4UQ3B 4NKIL 4FG6C 2DL9A 2BHUA 3MOAH 3PJSA 3GMNB 4HKZA 4M93B 4RFNB 2NY4B 5IEKB 1V05A 1B2WL 4XCCH 2HRHA 5J1AA 3OR7A 5IQ9B 3LRGA 2Z91B 3D25B 4R26H 2R0KL 1QLEL 3K6SA 3HC3H 2IBZX 1YY8B 4WFHE 3II1A 4NC0B 3OLIA 3S8WA 2JJSC 4AEHH 1Q4NX 3FU3A 1IBHA 1OAZL 3HUJA 5I75C 4XXWC 1OEZW 4JRWA 4H26B 1BCIA 1E4XH 2WZPA 1O9VA 2H6OA 2B1HH 4L3CA 4OCSL 1HWWA 3RA7L 1CIDA 2DEYX 2P7TB 3KM2A 3RJQB 1JVOA 4TQ8A 4AQOA 4ERSL 4FQJL 1QR4A 3FTZA 1KB9K 3NTCL 4H1LA 4RGNE 3VTTA 3X12B 4NQEE 3ZO9A 3FQTB 3JV4A 4QAMB 3SY6A 4XVSL 3A6OA 3SPHA 4AQEB 2GG1A 4JZJB 3ULVL 1BZ8A 1NCWH 1NFKA 2CO4A 3U36B 3SD5A 1AS6A 4AQ8C 4NRZA 2F08A 2ZUWA 2BIQA 5KYXA 1XF5A 4ZO6A 1XSIA 3PWJA 2X6AA 3B9DA 2QGCA 1PJ9A 4YHOL 2DBLL 3SKJL 3MRFA 1F90H 3LXUX 2ID5A 2EH7L 3LS4H 4YE4H 5D2NB 4ZMOA 5I0XA 4O02B 1HSAB 3GSQB 4KFMA 2IGFH 2R2CA 2XBDA 3EHBD 2CO6A 3BP7B 3HBQA 3IFNH 1Q0YL 5EULV 2IMNA 5JDSA 4QNPF 2DYSB 3OZKA 4OLXL 5T3ZL 3U7AA 1JRHL 4LT7A 3ZDYF 4J4PC 4L3EB 2XZAH 3V79C 3LEXA 4LGPB 5IOPB 5IGXL 4CW1A 3B2UD 5T5NG 4R96A 4A55A 2G2PA 3SO5A 5L88L 1P9MA 4ANXA 1CU4L 4KO7A 3B6SA 1ZGLB 5BVPH 1VFAB 2JKXA 4I89A 4N28A 4G8GE 1NICA 2DYPB 4WHYG 1H0DB 2A9NH 4NHCL 4F33A 1NWPA 1I9JH 2MTAA 2BDNL 1AQHA 4TTDD 3ASOB 1EEYA 2ZXAA 5C0DA 5LG1A 3B2XA 2IH1B 3RIAK 2Z8WC 4Y16D 1D6EB 3V6OC 1TQBC 5C08B 1XEDA 3SO3B 3K71A 1M05B 4FYTA 4BBWA 3EJPA 4Q6KA 3QP3A 5H4YA 3ZK0A 5C08A 4RDBA 2HT2D 5JHDD 3BQUB 4B9KC 3BWUC 4WGKA 4WO4D 1I9RH 3V4VL 2XG4A 4WO4A 1I8KA 2R0WH 3IDUA 3VSQA 3IFPA 3L3IA 4WW2F 2WMPA 5AW9B 1OZTG 2BMKA 5D71H 1WO2A 4H8PA 5HPMB 5JPNC 1MNUH 1Q1JL 4ZFFB 1B4JH 4YZFE 1QZNA 2OL3L 2ZG2A 2UZPA 3R06B 4HETA 4NQCA 4UT6H 3NTCH 4ES9A 4GBXB 2Q3ZA 1NPJA 1DBBH 4GXUN 1WA2X 1BQHG 2FT7A 3AQYA 4QHNB 3MLWH 3IGKA 3V9FA 2HT3D 4M6NH 4XWOC 4NZUL 1QFUL 3KXFA 1UQSA 2OMXB 3BLKA 2O5YL 3GLEA 1H9VA 3S2CA 3FRPA 4AITA 3HS0B 1IBGL 1BZ9B 3RL2A 5LWYH 3IVKA 4WWPA 3FUIA 3WG7B 4YDIL 1NFDA 4OLUL 1JPSL 2EKSA 4JO3L 1L0PA 4W9EC 1T2QH 3N91A 3UBXG 1BVZA 1QX1A 2CDFA 5DMIL 4AKOA 2LHAA 1K5NB 4J3SA 2ICES 4QKXB 3PWJB 1RJLB 1ZTXH 4QF1B 1JN6B 3BCDA 3INOA 5F1KC 2VN3A 4KKAC 3SPCA 4NC2B 4GKOA 1T66D 3VD1A 2H0EA 4PRNB 2C1PB 3I6GA 4JO3H 2UYLB 2WZ6A 4H1LH 5JW5B 5AENA 4A7SA 1OD7A 4WGVB 3EBHA 1MFBL 3ZYZA 2MPAH 1ZEAL 1CGUA 5DJ6A 1SEBA 4DEUA 1F11B 5IBUG 3QJUB 3F7RA 2XN9B 2HN7A 2AEQH 1I1YA 2RCSH 4K94C 5BRZD 4GUCA 3QRLA 5HHOB 5HP5A 4KGJA 1X5IA 3CN1A 4KQ0A 4KO9A 5I9QB 5KYYA 3KPSB 3IMTA 3PREA 4XPBL 2OMUB 3TVMD 4TVPD 1NCCL 3QCTL 3AT0A 1F97A 4HWBL 4GW4A 1QTYT 3EF7A 2DQDH 3AS1A 3AY4C 5IB3B 2JB5H 4TNEA 4XCEA 5D70H 3W9DA 4GAYA 1HI6B 3BMVA 3GIVB 3PGDB 4ZW8A 1ZRUA 4UINL 3BKCH 1IMHC 1E6OH 1CK0H 4ODWB 1RIVL 3DMMB 4PPTA 3SPIA 1KCSH 4YSEA 3OKDB 1U91A 3MI6A 3NEXA 5GGVH 1LGVA 1L0YA 3P9LA 1WE5A 1NAML 3GSVA 5GZOC 4OD3H 3BIAX 5LWYL 2EP6A 2DWSA 2E74C 4Q9CA 4POYA 1UUNA 4L37A 3BAEH 4I85A 4YXLL 1IM9A 4XCFL 3FHAA 1BXXA 3WI9A 2DJ4A 1S7XA 4ZBJA 4AOFA 2F53B 1XGQB 3T4AC 5DS8B 5CUSL 1A7QH 1S3KH 3QHTC 1AD9B 1YEIL 4P46D 1P4LA 3X13B 2OK0L 4ALAH 4ZI8A 2HTKD 2IAMB 1OQXA 4HX1A 2VN7A 4TOYH 2VDOH 2WQ8A 1OSZB 4A1RA 4WI8A 1OT1A 4AW7A 1R6VA 2B5IB 3E2HC 3HI5L 3EYFB 2A74A 1UWFA 1T89C 4E42A 2VC2L 3MLUH 4F3FB 4P49A 3KYMB 4U7SA 3QDME 5B3JF 5I1DA 1QP1A 2YLHA 3VRIA 3II2A 5DQDL 4NKOB 2VCOA 2OMVB 2ODIA 1FG9C 1F6AB 3T77B 3HE7D 3MRDA 5I73B 3TBTB 3MRJB 3TEUA 3FC8A 3PJNA 5D7LB 1I3UA 4GIPD 5FWQA 5KZCD 4Y16A 7FABH 2IWEA 4CMMB 3WTYA 3CFCH 4G7QB 2MOVA 2XCMC 3EYUH 1K4CB 2R8SH 1QUNB 3D3VD 5SV3A 1TQCC 2FJUB 2FEEL 2XKNA 2KHAA 3L3DB 3CFTA 2ERJB 3MRGA 3BVVA 1HOCB 2HMID 4WI5A 4KKRA 2NR6D 1KJVA 4I18C 2PCPA 2R1WB 1OGAB 4F9LA 3EFDL 2QGBA 2C9AA 2FYYA 1RU9L 4QTFA 3ZE2F 1TTUA 3ZL2A 4BK8A 1HJCA 1PG7H 1LD9A 2WJ7A 4H20L 2F1EA 3CXDL 6PCYA 2ITDB 5L9DH 4AEFA 4FHJA 2N01B 3WFHA 3S7GA 3ZDXF 5AYTA 1LHZA 4HIQA 1K3ZA 5ITBH 1SJEA 1V7NL 4YHNA 4LP8A 2PETA 1JXKA 4XMZA 3FFCA 3AQXA 2HXAA 2WXFA 2P5EB 1GZPA 2V3FA 1FFPB 5IW1A 2XA8H 5I1GH 3V9EA 3WAJA 2VLJD 1KEMH 3X1FA 4B27A 5LN8A 4KQ3L 1DL7L 4AIEA 1HZHH 5M94B 2K0RA 4GG6F 3GMMB 2NSQA 2WBJA 1U3HC 3MV8D 4XMKH 4IU3A 1A8JH 1O5PA 3SZKC 5AUMB 3LQZA 4FQIL 4WTZA 4KTDL 2KL6A 3WFBL 4XNQB 2AQ1A 1RIHH 1WCBA 3J07A 1A9BA 1IE4A 5HHMD 1LE9A 2BJMH 2WXGA 3H9SD 4Z7QF 1ZPLA 1OAKH 4WFGE 4X9BA 4U1LB 3I3BA 4GRWH 4OKDA 1TOXA 1TQSA 4OLVH 4M5ZH 3RYMA 4BGDA 4RIRA 4FQJH 2PXYB 1BG1A 4CILA 1DZ0A 5AVSB 5DMIH 3BVDB 3ILPB 3O2DH 1OAUL 2PXYC 4IHOB 3FTGB 2K7PA 3RGVC 3S3BB 1A6AA 4LFHG 4JKLA 3P11L 3ZY7A 3RWHB 2GJ6A 4OGZA 1WS8A 4TLSA 2Z31B 1RZKH 3UAJA 3KJ4B 1T7ZA 1SF5A 2GJ6D 4YBQD 3ZDZE 1BQUA 1XCQB 3KBHE 1DJGA 1CF1A 4XCCL 3LD8B 5CP7A 1EV2E 3BGFB 5CJXA 3N41F 4ZODA 4QYOB 3QIUA 3CN0A 1XBDA 3QQ4A 4OH2A 1AGFA 3U46A 1Q0XL 2DB8A 5B7FA 3RY5A 3FB5B 2P9RA 3D4GA 4ZSOA 1GH7A 3X1GA 2YPLB 3OKNB 3S36L 3SIKA 2VDRH 4X50A 4JS7A 4X4XA 3X17A 1TZOA 4Z7IA 3AFLA 3U9UA 1KPRB 3UAEA 3QISA 2DM2A 4QHLB 1CE1H 4I0PA 1WHOA 2JLLA 4O02H 2B77A 3F8UB 4YSPA 5E0QA 5BV7B 4YUEH 3IFLL 3NK3A 2JI3A 2XDHA 1U8LB 5BMFH 3LIUA 1QASA 1XEUA 1ADQL 1MVUA 2CLVB 4P5TA 4A7TA 3QUYD 2VMCA 4YSTA 3X11A 2YK1L 1LYQA 3VB8A 4U4IA 2BH0A 2OMNA 4PJ5B 4DGUA 3VD2A 2WANA 5J7CC 3KZ8A 3TCLB 4JREC 4OQTA 3BP5B 1INQA 2DQCL 3C5ZD 2HVKA 1FVCA 2AEPL 2D7MA 3NP4A 2G5BB 2Y1YA 3OPUA 1F00I 4WEBH 4JL2A 4KAQL 2DKUA 3ZDZF 2BP8B 5AVXB 4TNWF 2BC4B 1AIFA 5D4IA 4HIEA 2NQDA 4X7FC 2A6KB 3ZSTA 2Y7NA 1TTAA 3HLAA 2AJ3A 2V9TA 1JRHH 4HCRA 2OP4H 5DF0A 3FB7A 4XN5A 5I71B 3W37A 2XWTB 3WLWD 4JRLA 4BRVA 3TCTA 1KIUB 2XRAL 3QDJB 1U8NA 1GTNA 1NUGA 5F9DC 1BVLB 1MVYA 4RWYH 4DVRH 2FBOJ 2PCPB 2R1WA 3IWUA 2DQIH 5DHVH 5GRZA 3SDAB 2R0ZL 1NTDA 2B20A 3T0ED 4PRAA 5IVXA 2CHZA 2A6JB 2VDMH 5I16A 3NK4A 3D4YA 5DR5H 4KVNL 1MKFA 4NKDA 4YK4B 4OD2B 1DQQB 1E4WH 3RBGA 1OP5K 3G5ZA 1S9VA 5E5RB 2BFVH 4LGRB 3GSNA 4C4KT 3V0HA 2J1XA 5DJZA 4FI6A 3MLRL 2XWBB 3NA4A 3OG4B 3IDJB 1JGVL 2CK0L 2O26U 3GB7B 1YPZB 2JTYA 3U0PB 3UG3A 1CXHA 4DKFH 3PUUA 3V4PA 1MRCH 2DQJH 3BSGA 1BM3H 1VESA 3DLQR 4XXDA 3KLHD 3SD2A 2IPTH 4OZGF 1OPGH 1YYCA 2W94A 4OTXH 1NGXA 2Y24A 1XV8A 2OMVA 1AHWB 1NMBH 1R47A 2BC4A 3CPLA 5GRUL 3SCMB 3TN0A 5T3XE 5JW3L 5D7LD 1XSKA 2X2HA 1AHWC 3KYMA 4NP4L 1G7PB 5CEXA 2HJLA 5BRPA 3L2NA 1E3XA 3QZPA 4J3OD 1WV7T 2ICEA 2Z0UA 5HYSA 1DANT 1A7BA 1KYOJ 2ZT9C 3QIWB 5C6TH 1AD0A 3WNKA 3S2AA 3STZA 1RSFA 3QG7L 3FB8B 5LUMA 1N6QL 3VVWA 4HW6A 1KT2B 2VDQL 2ZQKA 3PPSA 4TF4A 4J3TA 1FAKT 3CC5B 4MWFA 2P8LA 5CGYC 5E2WL 2R56H 4U4BA 2R0LL 1H9DA 4K7PY 3L4UA 2VYRE 4XX1G 3F2LA 3O3AA 1ZV5A 5DUBB 1UH2A 5I1IL 5IMMA 5FYJU 1JHKH 2E7HA 1MXDA 2APBA 1QNIA 2BNUB 1YY9C 4M93C 1YEIH 4PJIF 3BRGC 3N1GC 4YH6A 4KDTA 2EC9T 3QPXL 2YEVB 1EO5A 1BD2A 5DT1L 1KELL 1KXTA