2EUVA

Principles of protein-dna recognition revealed in the structural analysis of ndt80-mse dna complexes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*AP*AP*CP*AP*CP*AP*AP*AP*TP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euvA00
2ETWA 1M7UA 2EVFA 2EUXA 2EUZA 2EVGA 2EUWA 2EVIA 2EUVA 1MNNA 1M6UA 2EVJA 1MN4A 2EVHA
chains in the Genus database with same CATH superfamily
4MNQE 4N8UA 1JOIA 2A9CA 1MCJA 1D5XB 4AEHL 3KYOB 1VSCA 5I26A 4N0FA 1AR2A 1TQCC 3NFPA 5MERA 4GYBA 2IAMD 2GJRA 3DTDA 5GZND 2H3NA 3ZE1F 2DLFL 1TTBA 3QWNA 4HCRA 4HKZB 5C0ND 5JOEA 4UQCA 4LBAA 5SX4I 2Y06H 5BRZB 4P2YA 5GJSH 5JW4M 2WTRB 4JZJA 3VFNB 2AERT 4OFVA 4WGKA 3BN9C 1WBXB 1M2VA 4GEIA 5I1LA 1Q38A 2ZYIA 5EPMB 2DKUA 2YBGA 2KUTA 3UBXA 3OBAA 1U8MB 5AKVA 4E68A 4AK2A 2ODHA 4F7PA 3Q8AA 1CFTB 1P7QB 2XZAH 4QPEA 1WFIA 5LGKA 3C6SB 2NQDA 3VH8B 3PDDA 1UZGA 1I9RL 2FJSA 3MRRB 5DHVB 3HI5H 2BNRB 1ITBB 4NJ9L 1KLUA 2YC1A 3ZR5A 3H42L 2ZXAA 2NY0D 3UTQB 1X6NA 2A1WL 2OMZA 1VFOA 25C8H 3EG9B 2DAVA 4HUVB 4PS4L 4HSCX 2VC2B 3C09B 5IJBC 3Q13A 1BZ7B 1YPZE 2D73A 1OANA 2QELA 3EZ8A 3TM6A 3UTTE 4HK0B 4JPQA 5HXMA 3WEXB 3QO0B 3QUZC 4LMQE 2BS71 3SYOA 3U4EB 3C5SB 2GY7B 3WIFA 4XNZC 2O5ZL 1VFBA 3WEMA 3GXDA 2MCAA 4Z7IA 4POUB 2AV7A 1H3WM 1XF3B 3KBHE 4WCYL 2OCJA 5FYKD 3VTMA 1ZOXA 3FBQA 3Q2WA 5GGVL 5B38G 4QEGA 3WLWC 5CBEA 2NCMA 4BQ6A 2CA4A 1Q94A 5FOBB 5EU7C 4TF4A 1ZGLM 1SQMA 4PREA 5EIIA 4FDWA 1BIHA 2HFGH 5A43C 1GYUA 2R0ZL 2WVTA 4JY4B 3B7SA 1U33A 4U1KB 4M6OL 5AVWB 5AG9A 4JM2A 3RGVA 3O45A 4R7DB 2EJ1A 2AK4D 2F54E 5DHMC 3OHXA 1VPOL 5I17B 2C8NA 4TL4A 3TWCL 1W8OA 2NYYD 4ICXA 5T3XD 1XSIA 5CEXB 3M1OA 4GIOA 3TV3L 3VD3A 1OLLA 3P77A 2MNJB 4NP9A 1ACCA 2L8AA 1F3JA 3WNPA 5CGYC 4H1LA 4GXUM 5DUML 1LNUA 3QG6B 4PRPE 1WZ1H 4L8CB 4BFEA 1BAFH 4OJCA 4PMFA 3IAQA 3NA9L 1CE6A 2DD8L 1DO6A 3NZSA 4KMTH 1IKFH 3PV7A 3T2NH 5T1JA 1FFPB 1RZKH 2IOOA 1KYAA 1FZOB 2P80A 5F88A 2R4RH 1IQWL 1DYZA 2P5EB 3WFDL 3KPSD 2YD5A 1U8OA 5KBPA 3WMSA 2HFFB 2R23A 1A7RH 1EHNA 1SYSA 4K5MA 5EN2A 5FECB 3GMLA 2I9LA 1X7SA 4N2AA 2YA2A 3LKQB 1GVIA 1XGTB 2NY5C 3LS5L 4K23H 4PS7A 4G5AA 3W5MA 2OKMA 5EBLB 3MI6A 4YHPA 1LWHA 3EGDB 2P8MB 1A6AA 1MFAH 5E2WL 3IRZA 3LQAL 2D7MA 5DS8A 1XEUA 2H8PB 4XXCC 4HOZA 4YHNB 4B6ZA 3B5HA 4P9HL 3L5IA 5IWLC 3GMPA 4O5LH 4Q9BA 1G7QB 5KEZA 1ECZA 3MCLL 4GKNA 2DWYA 4GY4A 1QHQA 2XETA 4JJHA 1N6QH 2ZKWA 2WQUA 1V5JA 2OSYA 2BIMA 1Y18A 3B2XA 4GAJH 3QUHA 4Y16B 2WD0A 2ARJA 4LLVB 1ADWA 5D7LE 3W39B 2VMCA 4FFYL 4HFUH 1Z5YD 1G7IA 3SKNB 3CSYA 5DD5L 3RL2A 2HLFD 3PWPA 3ZL2A 32C2B 2W9DH 3GUTB 3E6FA 4PJEF 2DH3A 4TNVK 2W65A 2A9BA 1FC1A 3W0WA 4JQVC 4JFEE 2YPLB 3OGCB 3I02A 3PWVB 5DGRA 4LIQE 5I6XC 3NJGA 3CH8A 3GXNA 3O3EA 3Q06A 2WLHA 4F24A 2AXWA 3PL6D 1AVAA 2NY6C 1NM4A 4LOEA 5K9QI 1E4XL 3TJPA 1Q9WB 3KLAA 1KUMA 1QFWI 1JZFA 2ROYA 4LCWE 5F7LB 2DIJA 3K6DA 3QWOB 1NCDH 4ZO8A 4B0MM 3OGOE 5JOPD 4G6FB 4HLZH 4U0QB 3UP6A 2VXSH 5FHAH 1G9MC 2RJMA 2DTSA 1QNIA 5JW4Q 3GKZA 5E6RB 4FQXC 3DVGA 1S9WB 2VXTH 2RHEA 2FX9H 1JZDC 3GO1H 4JCWA 2BNUB 1ACYH 1DQMH 3U0WH 2K3HA 2ZPKL 4AWJC 3H6AA 1Z2KA 2B08A 3UXFA 2HPTA 4QAMB 3W9DB 1S6NA 2VQUA 3RGBA 4N0CD 1ASQA 4JCLA 4XZ4A 3O2DA 3QIUA 3OMNB 5I74B 2VE6A 3RWIB 1DCLA 1NGPL 1QFWH 3U9WA 2CO4A 2LTQB 5CZRA 1KZYA 3RWDA 2NY7H 3HCVB 5DJ0B 4BFRA 4U1GB 43CAB 3WE6B 4CC0A 4DJMA 3B3BA 4YXLH 1VAHA 2C3HA 5KVGL 4PJXF 4L4VE 4U05A 1A4KB 3GK8L 1I7UA 4JFEB 1DBJH 4LLDB 2B15A 5CUSL 2W0KA 2IH9A 2CPUA 1CD1B 1OSEA 4Y4FD 1YUHA 5I66A 1XX9C 3HBQA 4P57B 4LCWB 4Z18A 4FFVD 4X9FA 5IB3B 5AVQB 1HIMH 1KCUH 1NMCC 5HYJB 4IGBB 5KVEH 3KYKH 4KKQA 4ZS7H 1CXKA 2NY5H 2O6FA 2X2IA 1A6VH 4E36A 4AE0A 4G6JH 4ORGA 3D69B 3RY6C 1JN6B 5CNHA 4YHYB 5LBVA 3M1CA 1FIEA 2P47B 2IWFA 5FW7A 3II1A 1QBMH 1JNNH 1FL3B 4LASL 4JM0A 3C5ZC 1HSAA 3G6DL 3KM1A 4ZAKA 4HULB 1ZVNA 1UASA 1AAJA 2Q86B 3U6XS 4R7VA 3TCTA 5BRZD 1MHEB 1YEGH 2JFCA 3TT1L 4FJYA 5J6GA 3NCWA 3MLWH 4NB7A 1KN2H 5I1DB 1T0NA 4YK4C 3WIIL 1OZTG 1JF6A 2J72A 3OJ2C 2CDEA 3GHEL 3KBPA 3FU7B 1DJIA 4JS7A 5F9AC 4HIXH 1GY2A 3EFFB 1VENA 3MV9E 3OC5A 3KDPB 4Y1AA 4F8LA 1EEZB 1P7QD 3FH7A 2QSVA 4GH7B 1DBBH 2WP3T 1LMIA 2IMMA 4GBXB 4Y5YC 2OK0H 1D3CA 4OLYL 2BNRD 3WNLA 1RVFH 5EOQH 4CUCA 3JQOB 4JO5A 5C07D 3HG2A 5IKCB 1NBCA 2F19L 1HAUA 3MJWA 4J3OH 3IVKA 2XWEA 4P46B 1WO2A 3QB7C 4NO0D 3E80A 4YDZA 1XZ0A 3B34A 4H25B 1OTTC 5L4JA 1L6XA 5GGTH 3WNIA 5FDYA 2TAAA 3RURA 5AYUL 3F7PC 3FCSA 1RP9A 5AOMA 4HUUB 1A1OB 4HKJB 2ZKYA 3QR2A 1C7SA 2GVYA 4AEEA 1BBJA 3W38A 3OPZH 1JHTA 4LSSL 4DO5A 2WIIB 5GGVY 1U30A 4K2UL 1TQBC 3FQRB 4QHMB 2DMCA 4G5ZH 4M4RA 4UTAH 5L2KA 2JXMB 3O2WH 2FO4A 3TBTA 1KB9J 1I75A 4Q74A 5JHDE 2H0FA 2P7TA 4YDVB 2ILLA 2NDFA 3PHQA 1TYEB 4HZ1A 4L8BB 4B9KC 3NSJA 3KYNB 2SEBB 3E2HC 2WQAA 4R26H 2FHCA 5JHMA 5DC0A 1MCEA 1ZS8A 2K7PA 2IALA 2EEAA 3MV9B 4F37F 4WJ5B 3MLRH 2JF1A 1CFNA 1ED3B 1HH6A 1L5GA 1PNDA 1IFGA 2ZUSA 3QIWD 3C6LB 3R06A 4J39A 4N2LA 5LBSA 3RLSA 4QXGL 1MIEL 4MZ3A 5TE6L 4KPHH 3UIYA 1KMGA 1IC4L 4D8PB 1MNNA 4FI8A 3GMRB 3GPSA 3VFWA 1AZRA 1TVHA 1UYWH 2XKNB 4FL4C 5DJ2B 5IV2B 1IJ9A 3BKJH 4PB9H 1OQXA 4QHLA 2VGLM 3NCCB 2CBPA 1MFEL 4JKPH 4WUKH 4XTRC 1TJIL 1DFBH 3OJVC 3LYRA 4GPVA 3T0EE 3QNXB 3ARDB 4HWEL 5IQ9A 2B4CL 4BHUI 2YUVA 3G5WA 4Y9FA 4FXGB 3HVDA 4XNMA 5DVLA 3BLPX 1NA8A 3KPRE 3X13A 3IJEB 4GRMA 1HCVA 2P5ED 3EFDL 1F90L 3KPPA 4FQPA 4Z0XB 2M1KA 1Q90A 3VDCA 4FTVA 4ACPA 2GSIA 2B20A 4WEBL 5I0YA 3L4ZA 2EH7H 3FB6A 6CGTA 4FFZA 4HS6B 1N3NB 2PNDA 4YUEL 5JHDB 3UTZA 4M8VA 4B9IA 1UH3A 1K8DA 5E2VL 5T3ZH 3U2SA 1K8IB 1LK3L 1N0LA 2VZVA 3NN8A 2Y7NA 3BVXA 1HHKB 3H2QA 1JUFB 1PSKH 2NZIA 5FXCH 3I2CL 1FSKC 1KTRL 4AVJA 2ALAA 4H2AA 2R29A 4CADB 4X8CA 2BFVH 3VWJC 1I8MA 2KKQA 1GZQA 3BQUC 4IRJB 2DW5A 3X3GH 1FUNA 3BSZA 2YLKA 4PJHF 3SPGA 3MDJA 4N8VA 3HC4H 1CDYA 4NQED 4Y16D 1HH9B 4A04A 5AUMA 5EOCJ 4HX1A 3VXPA 3MO1B 4HMDA 5EMYA 4P4KC 2KDYA 1FZKA 1B0RA 1U8HB 3ATDA 4LEXH 4LKXB 1UXSB 4RGMB 4ZPVB 3T0EB 3ZE2E 2F7QA 3QUYA 1DQLL 1FL5B 1EJ8A 3QORC 4KROB 4HGMA 4YE0A 3T3PE 1RZPA 2NUTB 3ZXAC 4CRPA 2YPLD 3GRWA 3FOMB 2APXA 3LKSA 4OCLC 4A2MA 1LP9B 3KPRB 3QDGB 1A5FH 3T1FB 2GKIA 3EBHA 3IJSB 4MSWA 4PLJD 1OEZW 4UMSA 2GUOA 4AJYV 4UUJB 4JN1L 4G7YH 3TURA 1TVBA 4F8NA 1NLBL 3ARGA 3BYTA 4BRVA 5MENA 4V11A 2DB8A 3DYOA 1W6WA 3TWYA 4AYMC 4MWFA 3X3FL 4HUNB 5EU5A 3FQNA 4WW1B 4RRPA 4POZD 4QRUB 4WU5B 5IVNA 1U41A 1XF5B 4KJQD 1CBVL 5TTRA 3K2MC 4OFPA 3VRJB 4QO1A 4ZFGL 4DKFH 1OCCB 3ZIYA 4CL7A 1CXHA 1QR1A 3S4SG 2X40A 4APXB 4U6HA 2Z8SA 1E8YA 3FMGH 4NC0B 4L8SC 4WFEE 1EHLH 3C6EA 4ONHB 3TZVB 1IFRA 3DRTB 4G70B 4J3WA 4K15A 4OLWH 2YBRA 2YQBA 1ZTMA 1FYTE 4G80B 2N0KA 2EE6A 1KIPA 4NIKB 4OZ4A 4YR6A 4Q9RL 1QEWB 1RZQA 2J6WA 3GMNA 1KJMB 1HWWA 1Q1JL 3NABL 3SSGA 4Z7UF 2GTWB 2I69A 3WN5C 4B7IA 5BVJB 1DVXA 4XXWA 1G87A 3SBWA 4KC3B 4MDIA 4KBPA 3T3PB 4JFTA 3JVFC 2WXRA 5D7KD 4EIBA 4IKNA 1WRFA 3AZUA 4G8IA 4I3SH 1V7NL 3FYIB 1OO2A 3D2UB 2Q5BA 4CSZA 3MOBH 5EEWA 2WVVA 4LCWD 2VJ8A 2DQGL 1KOAA 4PY7B 4QHKI 3HZYA 4MAYB 3QI9A 1R3JA 5JHBA 1PGRB 1ET8A 4I4WB 3CHXA 1CR9H 5CEYB 5C2BL 5HYJD 4IGBD 3UBHA 3FUDA 5E1IA 1BZ9A 4OZHE 3SPHA 2MNUA 5KYYA 1MXGA 1GOFA 3MJ9H 3GSWA 1UWGH 5FKAA 2BVOA 5HGGS 2EKJA 1TETH 1B2WL 4GOSA 1FO0A 1AACA 5AOJA 4FA6A 4L8DB 5F9JB 5HGHB 1TYRA 2WXMA 5DRXB 5MI0C 1PKQE 2YHGA 1KZQA 4JFPB 3QDMB 4LNRB 4PI0A 4PV9B 4XN8A 1A8ZA 3BAXA 4PJEA 1K3ZA 2PR4L 3VX1A 5LGHL 5FS5A 5DSCA 1UVQA 3U36A 5LHDA 1FVCA 4AEHH 1L0XA 4X6CE 3PS6A 3CQFA 1F00I 1FYTB 1KIUA 1DJHA 2B7DT 3IDUA 5L8KB 2VRAA 2DBJA 4UZGA 1ES0A 1DQDL 1NAMB 2DLFH 3AWGA 5DZAA 1WFNA 4XX5A 5FO7B 2ZWYA 2YAOA 1NBYA 3HN5A 3CZGA 1XH3A 1MCPH 4Z3JA 1TOXA 4Q97A 1PZ2A 3LQAC 2ZWZA 4GBXD 4RDQG 4OB5L 3BRFA 1FWXA 2E9GA 4BSWB 1XT5A 4BBWA 1U8CB 5G5DB 4U1SA 3IKCB 4TUUA 3BUIA 2HA1A 3WSQH 1EZLA 3NUKA 5E94B 2BCKA 4BSJA 3H1ZA 5BPPA 4FFWD 3VXMB 4JFUA 2KL6A 3K0WA 3ROLA 3D25A 2DYPD 5LCVA 5EHFA 1CICB 2Y6TE 1TMQA 2EXWC 2FE0A 1ZSDA 3FTZA 5EBWB 4OZHB 4XPTL 4B97A 4OKVA 5CZXC 2L0DA 3EJYC 3U0PA 1MFUA 3INOA 4XVTH 3T4AC 2HRLA 4DP9X 2AABL 4RIRA 1CDIA 3VMOA 2YGVA 3CPLA 1R5VA 5I76A 1BOGA 3FFDB 4P0DA 2PYFA 1PKQB 3CFBA 3CQQA 5E7BA 2IADA 4C57C 2X4SB 3KVPA 4YDIH 4FULA 4PJ8B 5D8JL 3CJJA 3K2IA 4LCUA 4PJXA 4Y0GA 4XO9A 4MMYA 4Z76A 4FG6C 3UC0L 1A22B 2ZF9A 4U1IB 3WKQA 2O5ZH 2E7BA 1E7VA 3KWTA 3RBSA 2FAUA 3ARYA 3BIKA 1GW6A 2I24N 5AAWC 2NX5B 4AUJA 4K9EH 1LK2A 2FHFA 4DK6A 1CGXA 2G2PA 2V7HA 2VM3A 1KSRA 1AP2B 3QPQD 5GGVH 3K46A 3NEXA 5J3HC 1R0AH 3VFSB 2NZ9C 2Y24A 4O58L 4HHWA 3B56A 2AQTA 2DQIL 2GHZA 4LAQH 3GEWB 3B9KB 1YY9C 2EP6A 1URLA 1XH1A 4A2LA 2HJKB 3PHOA 2MHAB 4K3DH 4M6OH 3PIQB 1OALA 3ARDD 1MN4A 3TNNA 3K71B 4PP1D 5FA3B 5DJZB 5CHNB 4LLAA 2D3JA 4N2OA 4WUUA 5ICZB 4BD4A 1PZSA 3RAJL 3LKRB 2F1EA 2HG5A 4KXAA 4QJ3B 5GSRB 3VTTA 5I2IB 5EF3A 2AITA 2ZWSA 3UAJC 3FH5A 3CXHJ 3P11L 1JGDA 3OLDA 3VQ2C 4IRZL 2DD8H 3QZBA 3ML8A 4N6RB 3BW9A 1P53A 4TUJB 4NSKA 3T8XA 3OJMB 4UTBH 3AM8C 1IQWH 4HKXA 5B1KA 3WFDH 3QRFM 1AKJB 3SPVA 1OGAD 4ZMWA 1SYVA 4W9GC 4Y9GA 3BO8A 3D0VA 3GTNA 3LS5H 3BAIA 1ZT1A 2MRYA 1CYWA 4FLOA 4Z7WE 2PN5A 1TEGA 1KCSH 3DV6A 1E65A 3FT2A 3ARUA 3KJ6H 5F8RC 3SDDB 4AGNA 1WCBA 4IRJD 4XO5A 4OZFA 5E2WH 5F0PB 5FYKL 5FHBL 4AH2B 4OGYH 1R3KB 3FO0L 2CJUL 3BDBA 3L6FA 4UIMA 4P9HH 4YC2B 5EU3A 3JTTA 1MCKA 4ZMQA 4FLSA 5J56B 3PDGA 3S35X 4KKZA 3PAVA 4NEHB 3VFOB 1SLWA 2EO7A 4X7TA 3LQZB 3TJHC 4KROD 3BMVA 3PP3K 4YMPA 1JPTH 4JJ5A 3KWVA 4OTXL 1NFIA 3BAJA 1ETA1 3KPRD 3QDGD 4Z0BL 2P44B 4E0RA 2OL3B 3FULA 5IJKC 1B88A 4FNUA 5DD5H 1LGVA 1OCRB 4KK9C 5SWQA 4LPCA 1JPGA 4ACTA 5T3XL 3H2WA 3JV4A 4CJ0A 3OXRA 3VXUD 5GGQL 1BVNP 4LL1A 1WD8A 4YX2L 2HRPL 1NBZB 4I87A 1J8HB 4HV8A 2KZWA 43C9B 3KVDD 4QRRD 4N2NA 5JPNA 2E6QA 4GKOA 3Q6FA 2ZG3A 3C8KB 3FQUA 4W6YB 5E0QA 5B38B 5KBLA 2GHWB 5GGRA 5HDBB 3Q01A 3KNBB 4QXUH 3QJFB 1I1AC 3FT3B 1G7HB 3CFCH 3D1MC 3OM3B 3WO4B 4ERSL 5I1HL 2M2DA 2WXKA 4M48L 3IXAB 1JS4A 4ZW5A 3RE0A 1G6VK 2ZP8A 5E1AB 5IIEB 3G6JE 5JXEA 4FZEL 1S7UA 1XO8A 4IBQA 5CIPB 4ZBJA 5CFHA 2UZIH 3O41B 1XGUB 4Y4HC 3WY2A 2AF2A 2ZPKH 4WLCA 4HETA 5HD8D 4P2OB 4JG0L 3DOSA 3EJQA 3C8HA 2ISDA 4ENZA 2IANB 5F44A 3RL1A 1LTXA 2E4TA 1JWSA 2B9AA 3DK2A 5ID1B 3GF8A 3OAZK 5D2LF 1UFUA 4F7EA 1REIA 1VGEL 2BOBA 1NGPH 4IK7A 3TCLB 4Q6IA 4BH8B 2YD7A 3D2UD 5IQOA 3MTXA 1ICTA 1IC1A 3EJPA 2OBGA 5LGJA 1OV8A 3M7OA 1JWMA 2W94A 3SB3A 2HFTA 4IHOA 3FCUB 3UPRB 1I1YB 4KQ3L 4MAYD 1X7TA 1O6SA 3LNEA 4PV1C 4TTDC 2J8OA 4ODUB 3CX2A 3FW6A 5KVGH 4FYSA 3GK8H 5I19L 2R9HD 5CUSH 5CZVL 1FN4B 2AJVL 5H8DA 3D52A 3I85A 4PJHA 1MW3A 2CKBB 3RNKA 3TNMA 4PR5B 5D1ZI 3V7AG 3S3SA 5BVPL 4PD4K 3ZQXA 2A6DB 4Y8AA 3SDYL 4ODTL 2GIXA 2B4CC 4N25A 4DEPC 4QOKE 3QDMD 5DUJA 5IMKB 4OFYA 4GQRA 4JO8A 1RLBA 4P2QE 4B9CA 3IAPA 4QYAA 1FHGA 1L6PA 4XBPB 4QHKJ 4J8RB 3I6GA 3MLZL 2QV2A 2UUDK 3NQIA 5J4MA 1S4IA 4ZXBB 2Q76A 2VDRB 4Y9EA 1CI5A 4LASH 2BVTA 5C0AA 2AC0A 2AVFA 2BNQB 2ZJSL 3WTVA 1GOHA 1W8EA 1SJMA 4Z3TA 3TT1H 2X9YA 3IK2A 3WIIH 2Q7NA 2WO4A 3GHEH 2K8MA 2OX5B 5JO5A 3P4OA 3D34A 5FUOL 1GGYA 1JV5A 3G7TA 2DH2A 2R2BA 4FABL 4BFNA 5D7IE 1S5HA 3MNZB 4HIJA 3KEHA 3VXMD 4HDIB 3LAFA 3JTBA 1HEJC 5AKRA 3SKMA 1EEQA 1KIRB 5GXBB 1CICD 4QRAA 3OHMB 1VEPA 3BT0A 3C8DA 3SGEI 5ESVA 4EPSA 5C09B 2VDOB 1UURA 4OLYH 4QTHB 5HHPA 2G2NA 3QWQB 3SOTA 2JKLA 2GCYB 4F91B 4C56A 4HIPA 3E9UA 3OAUH 5F7DB 2F19H 4X5XB 1N8ZA 4UNUA 3S3JA 5BO0D 3BGFC 2EXYD 4HUWB 4ICWA 5D2NB 2Y7MA 1YNKL 1OE3A 1NIBA 2OMWA 1T0OA 3A67H 2QGCA 3ZKNC 4EI5D 3CDCA 1PX3A 5HHNB 2Y5TB 3CK0H 3TVMA 3HAEG 1IEAA 3OZKA 5AYUH 3K4AA 2W0LA 1MWAA 4M56A 4QT5B 5D1QA 1FORL 1YMME 5LNEA 2W9LA 4DAGL 4KI5E 2A4EA 2GJZA 1PQZA 3O4LD 2DRUA 3AROA 1CFVL 3ES6A 3HPLB 1DSFL 4NKOB 4LSSH 2ICWI 2NX5D 4PWIA 3TBBA 3FOLA 4K2UH 2UXGA 3BZ5A 3QJRB 3BVVA 3KXFD 5JOFA 4PJCE 1BJ1J 5C0EB 2NT0A 5CP3H 4C8XA 1UEYA 1A3RH 3FFCA 3QG7L 3M7FB 4KQ4L 4HT1L 4YHML 4NN5B 5I8KL 1YCSA 3HNSL 4LDEB 1NC2A 4MCYA 1R19A 2WKGA 4N5UA 5D7IB 3ZHDA 5KS9E 3EXLA 2R69H 5D1XC 2QMKA 2Z4QB 3ECWA 4IMLA 3OQ3B 1W72B 3ZDXB 3FUEA 2V0AA 4QXGH 1MIEH 5BJTA 1IC4H 3GM0A 4K3JH 2CCLA 5HGAA 5KJ4A 4J28A 3GXMA 1AI1H 3FFOA 3K91A 3UH8A 2NNAB 4F7CA 1DQJA 2R0KH 1ET7A 1TJIH 1UH4A 5KBDA 2VXQA 4OIIH 1NGXB 2ATPA 2OQJB 3VI4F 3JWDH 4HWEH 3SJVB 3PABB 2MJWA 4HUMB 5GISL 3RIFK 3V0WH 3L5WA 3GLDA 1KB3A 1MCWW 3AU1A 4B41A 3DI3B 4CKQA 3RVUD 1JSYA 5EH1A 1QW9A 1F90H 1AKJD 4UNIA 5K1VA 2NTFB 2MKWA 4EJ1C 1WFOA 4YL4A 2HAZA 5LN8A 4LBEA 1XD0A 3HZMA 3S35H 4WI3A 3N41B 2X9ZA 5C6WH 3D8MA 3VSQA 3IE9A 1IQDB 3T1WA 1BMWA 4H8WH 5E8EA 3SDDD 4BA0A 4MJ6B 4YUEH 4UANA 3UC2A 3NK4A 1LMKA 2MSPA 4HG4J 1LK3H 3DX1A 4HJ0D 1X6LA 3G9VA 5DMKA 4LFHG 2AQSA 1GGCL 1ETZB 2EDQA 2VITA 4NUGL 1GZHA 5E00B 4AXWA 3ZT5A 3OR7A 2P5WE 3X14B 2JWYA 4PW3A 1ORSA 2WPGA 3W56A 5IROD 2WC7A 3SDXE 4JDZB 2A4ZA 1V10A 1YEFL 2C9XA 1QO3A 4MKMA 4RQQA 3S98A 3BE1L 2JKSA 2ZKXA 2VLRD 4P59L 5ESAA 3Q3GB 1Z1WA 3DWTA 3EJTA 4OLEA 3U0TA 1ZJBA 4FG0A 4X98B 2AQ3A 4BDVB 3B2DC 1DQLH 4KRNA 4OCYH 4WNQB 4RAUA 3P40A 4X0KB 4F7TA 1MZZA 1KEML 3ZL4H 4CMMB 5BUAA 2XG4A 4X4KA 3TIEB 2DIEA 5L88H 3VYOA 5F97E 1J8HD 3FQXB 1IC5L 4F58L 1ZHLB 4W6WB 1WH0A 4QRSA 4UQEA 5FLVA 5DK2A 1AG6A 4J3VA 2WQ8A 1CDCA 1YPZF 2CHDA 3MRMA 1NLBH 1IGFL 4QRFA 4NM8L 2ID5A 4QWWC 3FQWA 3QJTB 5SWSB 4QF1A 1OAZL 4PLOB 5E23A 1ZHKA 5FYLD 3T3ME 4ODWB 1R24B 4HBCL 3ULVE 2LVCA 3CSTA 4KUCF 5DRNA 5HHOA 1SUJA 4NCC1 2NT1A 3GMQB 1ZWIB 3IDGB 3ARFB 2E9JA 5CSZB 1HN1A 1BW8A 1CF1A 1BQ5A 3HC3L 4R96B 4ZFGH 2CDGA 2ZOLA 1YYLH 4XVSH 2ENJA 3FUJA 4P2OD 5KVDL 3VW3L 1EHXA 3SDXB 2IAND 3NPSB 3J2PA 4KH9A 3WNMA 1IKNA 1AO7B 5AZ2L 5DQJB 3A5VA 4KKCC 1CBJA 1DQTA 4NAQA 2PPCA 2AS5M 2DDQL 2Y4SA 2YEZB 4Q9RH 3S0PA 1X5AA 1S7QB 4NRXB 3RDTA 1Q1JH 4PVNA 1JVLA 3PQYE 4N68A 4N9GB 2IAMC 5LXGL 5GZNC 3O6KH 2AJZB 3DIVA 3AS1A 3FCTA 4XX1G 3STBA 3BP7B 5C0NC 2E7DA 1JGEA 5KG9A 2HJLA 5FO8B 4ZSOE 1DN0A 1A9EA 1RK0B 1DSYA 5I1GH 4WO4A 1F6AA 2AJSH 2VUOA 1J87A 1S9YB 3PWNA 4R4ND 2FX7L 3WTUA 4L3CA 5C2BH 5INDB 2ZCLL 1I7ZB 1U4FA 4FJ6A 4M5SA 2BH0A 1UB6B 1FFNA 1UH2A 2UYLB 1G7PB 4F2EA 1TSHA 3JWNE 4D9LL 3IBOA 2FZ3A 1YN6A 4GRLA 2VDKH 1OP3H 3ZMEA 2D31B 3ARSA 1B2WH 4HJUA 5IR1A 4FQHA 5JIMA 12E8L 2QDWA 2LW3A 2YUXA 4KO6A 3GDBA 4MKTA 4XVOA 2EKSB 3OKDB 5D1QD 1P1ZB 4E9YA 1H6EA 2NY0C 3IN2A 2BNQD 3L08A 4MJ2A 5KSAA 1DUZB 1WBYA 2EICA 2PR4H 2V2XA 5LGHH 3EO1B 1KGCD 5E8DL 3CZFB 2IGTA 2XTJB 3V4PB 1DANT 4U2YA 5E6IA 3W3BA 3HR5A 3HS8A 2I5YH 3FT0A 3H9SA 1ODAA 1MFBL 1NAKL 4G8AC 4DESA 4YE4L 2YUZA 4NXSA 3EBGA 1EA9C 4HCGA 3AY4C 3RFZC 3DARA 2BMKA 1TTRA 3RTLA 4DOHB 3FU8A 2EDTA 1QSVA 1KENL 2VABB 4OB5H 1YDPB 5JR1L 2XWRA 4ZSOB 5C09D 4FN0A 4LCCA 1KV7A 3VFPB 4Q89A 3RIFF 1LEGB 3HZVA 3P4MA 5DK0A 3HNTH 5JPMC 4OD2A 3DVFA 2YAHA 3GJEA 1TENA 5D6CB 1SXSA 3IN0A 4XPTH 5CP7A 4OV5B 3U2JA 1NCIA 3L3OC 3F8UB 2DWEB 3ZDYE 1KXQA 3QARA 1OQOA 4DH2A 3S4SB 5D2LA 3ZHLA 1FH2A 3TBWA 2NYYC 1WT5A 5ABAA 6FABL 2CDFA 1JF1A 1ZIAA 1VFAA 4CU6A 1TCRA 2WYZA 1CE1L 2DQUL 3AG2B 2KPNA 1RPUA 2D3LA 2BOLA 3MUGB 5ETUA 3BAYA 3TV8A 3OKLB 3ML9A 2JJTC 3UC0H 1DCEA 4HLZG 4FYQA 3S97C 1V3LA 1T80A 5CN1A 3LH8A 5CN3A 2Y7LA 4E9TA 2VNCA 3AXLB 4DP2X 3WDIA 4XWGL 1ZT4A 3TO4B 5I9QB 4C83B 1KGYE 1OD9A 4G42A 1MW0A 3O3DA 3D4YA 4DQAA 1RPKA 1NC4A 1CG9B 1ZLWH 3RWFB 2W5PA 2F9BT 4XBMA 1LXMA 2ICWJ 2VQTA 2DQIH 4P3DA 1OLZA 2RGSA 4FNLH 3ZK0A 5IBTL 3SZ6A 1AC0A 2DIAA 3TA3D 1XTLA 3QDAA 3SO3B 3FNKA 3QA3B 1AYOA 1NDGB 2PWDA 3O3AA 4IOSD 3N06B 5EFIA 4OLXL 1JBJA 3K2KA 4EDWH 1T1ZA 5DO2D 4KV5E 3BMWA 1K5NA 3BVUA 4LEBA 4NM4L 5LG6A 3SJVD 2VN7A 4XMKL 2B77A 3DSNB 1KB9K 3MHZA 4WHCA 3ZDYB 2LABA 2WMPB 2VDMB 4TNFA 2DQTL 3MQIA 2VLLB 3QDHA 3DPBA 3IGLA 3RAJH 5C0IB 1URZA 2FT6A 5CU5A 2DOCA 3MRBA 1GYCA 3P11H 1KNOB 3EF7A 1CTNA 1U36A 3EOAA 1U21A 3CFEA 1CT8A 2HLFC 4IRZH 5GS0L 1DUYA 1JTOA 5JHLA 4BCZA 2NMSA 4AIXA 5DQ9B 2XN2A 1QOKA 4JFDB 4PW9A 3BWUF 4ZUUB 4GO9A 1IM3B 5C0RL 1XAKA 3H4FA 1KTDB 4AVKA 4CN4A 2N59A 3QDJB 4HJJH 4QTIH 2Z7YA 1MLCB 3PL6C 2J4WH 2YXFA 2WIMA 5EA0L 4FFZL 3L3GB 3DJTA 2AXGB 4K3HA 4K5NA 3QNYB 1QLRB 4H20L 4K0OA 4MLSA 1ZKAA 2G3ZA 3KYMA 3MXVL 4MAZA 1BQLL 4NQXB 5FYKH 5IBUG 4JFQB 1U2CA 2CJUH 5ITFA 3CDGA 1IARB 4PJFB 2VN4A 2NYZA 2XX0A 4FG2A 4EIUA 2R29L 5E8PA 3ZTDC 5A40E 1X5HA 5EU6E 2X28A 5EC1A 4WHTA 1C5BL 2BC4A 2VDLL 1SPDA 4YO0B 4Y89A 4N0CC 3Q6GH 3INUL 5F1IA 1YEIL 4L1TA 3DUSB 2ICEA 3LMJL 4OTXH 4L3EE 1BLNB 1HWGB 2I7SA 3HKZA 3GXPA 2HJFB 4FNRA 2CA3A 2QDVA 1IGCL 2Z31B 3LH2L 4XNQB 3WIHL 2A9ML 1FJ1B 2CHNA 5FFLA 1M7XA 3LQMA 1MNUL 2YPVA 3QZNA 5F0LB 3IJHA 4KH2A 5DD3L 2OZ4L 4FERA 1DBAL 1OSYA 3VFNA 5GGQH 5SWSD 2QPDB 4J3OG 4YX2H 3OKKA 2XC8A 3HFFA 3MUHL 5DJYB 3IFPA 4WWID 2CBMA 4D9RE 1JZJA 1JV2A 3ARFD 3EH2A 2APFA 4Y4FC 2GJ6E 4HC1L 1XF4B 1CFTA 1H0DA 4JHWH 1J0IA 5FYJU 3MLPA 4FFVC 4DSYA 2YO3A 3GNMH 1WAPA 4ERSH 5I1HH 3VI4A 2EYRB 1CI3M 3O9WB 3PGDA 1AO7D 2C9PA 3SGJC 3VXQA 2Y25A 4AMXA 3KPQA 4ADIA 1T1XA 3D50A 4G1MB 1FIGH 2GFBB 5AVXB 1GC1L 4ZMPA 1D6EB 4WU7A 5C9JB 2EDWA 2J21A 4JG0H 1JZIA 3KGRA 5EU6B 5E8NB 1JMXA 5MHSD 4YPGB 4MNQA 4HK0A 3WEXA 3QO0A 4DHLA 1VGEH 2R27A 3V9FA 3D39E 5HI3D 3NSXA 1L9QA 4JHAH 5HDOA 2F15A 5JW5A 4HJ1A 2FYYB 3EGSB 4KQ3H 4PJBB 1IGYB 3BT2H 2WV3A 1T5WB 2E0PA 2FJHB 5FOBA 4BCXA 4KI1A 3EDEA 4IM8A 1KWGA 5EEZA 5KYXB 5CZVH 4ZYKA 2AJVH 1KJ2B 2X2YA 3L45A 4ONOA 2ZZUT 5D4HA 2ADGA 2PTUA 4AQ1B 4TNWF 4LP5A 2WBKA 3RB5A 3SDYH 3PDOB 3HE6B 2GJ6B 5C0FB 3MREB 4ODTH 3IDNB 2BM3A 1SRDA 2N0MA 4HXAL 1J0JA 3UZQB 1QFOA 3C09C 2YAPA 2XTJD 3ZUCA 3G6AA 4KTDH 3ZYZA 5J1SC 3MLZH 1JVKA 1FH5L 2K6ZA 3UBXI 4ZPTB 1HOEA 3TBYB 1QI4A 4PJGE 4G83A 2ZJSH 2PWGA 1YPZA 1H19A 4N2DA 1RU9H 3CH1A 2WQVA 3UTTA 2WGXA 1A3LL 5JORB 4RISH 4GKZA 3N0PB 2B9BA 5H37A 2GEQA 3VXOA 3QR1A 1ZANL 2DYRB 4ZK8A 4FABH 3OMAB 1L7IL 2WNWA 3VB9A 3ZE2F 3BVTA 2KQNA 1FAIL 4BFJA 1NGZA 2N56A 3VSUA 4AT6B 2WWKO 1JFQL 3T3PF 1HOCA 4GIAA 3SEPA 5AKTA 4BWUA 2X4QB 3QIWC 4X4XB 4YLBA 3R4RA 1SLUA 1RSFA 1DJYA 3NEOA 3OC8A 1QZNA 1G9HA 4DFHA 3HEIB 4XNXL 4JHUA 4GQ9L 5ACZB 5E9DE 4JJOA 1IBZA 2ZAIA 5KVFL 4BFKA 1YNKH 4GB9A 5IHUL 3PG2A 2X89A 3CMOH 2F54A 4P06A 4CVXB 1SFDA 4A63A 4FMFA 2HFEB 1AGCB 2WZAA 3PLYA 3OXSB 1NEUA 4XWOC 2P8LA 1FORH 1VADB 4LLVA 4DAGH 5HBBA 3W39A 2XWCA 3SKNA 4HLEA 4KXZI 4I48A 1CFVH 1PF3A 1NZRA 1DSFH 2PR9A 1EVUA 4JZNB 1ZHBA 3WLBB 1HNGA 1KDIA 3A6OA 4PRPA 5AD0B 4LARH 4D3CL 4ODXB 5IMMB 3ENEA 3T6XA 3TO4D 3LPGA 3SBQA 2EEXA 3IGAB 4PS8A 1OB0A 5F71A 3T2LA 4QAWA 3P0YL 3QG7H 3TBSA 2RALA 5HHMB 4HT1H 5CLWA 3ZTJH 1XGRA 5I8KH 2FEEL 4PG9A 3IRPX 3O3BB 4G9FA 3CZKA 4LLMA 1ASPA 1JD7A 2UZPA 1JXGA 1M7UA 2X6AA 5BO1L 3ZT6A 1IGIL 1YC8A 3GSQB 1QPKA 3MUZ1 4YVNA 1H15B 4DERA 4YDKL 1JZ5A 2Y1AA 4JLRB 1WYJA 1UXWB 3IYLW 1RFDL 2JJVA 1UM4L 4PJDE 1EO7A 3RJQB 2YKLH 2BIPA 1TZOA 4HMCA 4ZZFA 4AM0B 4A2DA 4U1MA 4Y16C 2ALWA 4NZRH 4OZHF 5I0DA 1M7IB 3M8OL 3PFUA 3A6CL 2ODIA 2OLDA 2CSPA 4WTXA 1R47A 1BGXL 5GISH 5B8CC 2YWYA 3GGWA 2X44D 2AK1L 4OF7A 1U93B 5IVXB 1B9ZA 2Q3XA 4QRBA 4JFDD 4AQOA 4CW1A 3QUXA 1X5YA 1MLBB 1E5YA 5D7LA 1IM3D 5JIQA 5DJ0A 5FEBA 3QDJD 2MCG1 4H1LH 3P69A 4XRCB 4NAJA 4PLJC 4O9HL 4AC4A 5IHZB 1E28A 3SY0A 4XMWA 4WEUD 1CQYA 4JFEA 4Q2ZB 4ES8A 4X6CF 3ME0B 4NDMB 2OMNA 1T20B 2AEPH 4TVPL 3DVNA 3KLQA 2QZ5A 3CFJB 3G9AB 1XIWA 4X6DB 3CSBA 1GGCH 1BFTA 4NUGH 4IHBA 4POZC 2Y5EA 4KJQC 4RGNE 5I82A 2AQ1A 1TJGL 3SE9L 1CFSB 1OE1A 1JZ6A 2KI6A 4B60A 1CXEA 5TH2B 1XSOA 1JRHI 1JN6A 1I8IA 2HKFH 3BPLB 4M1GH 4PWFA 3SDAB 1OF0A 2DWDA 4P2RB 1YEFH 1C7TA 4PWEA 4FG4A 4LK4A 2K7QA 4XHJD 3V4UH 3BE1H 2Z31D 3L3JB 4WFGD 5I74C 5DJAA 4P59H 4GS7B 4MAUH 1V8HA 3GSVB 4F1ZA 1E3FA 2LTQC 5AOIA 3HAEB 3D0AA 5DYOB 4U1GC 1AHWA 3N9GL 5I30L 4JO4L 3HN8A 3JT0A 3PWJB 1IAII 3IETB 2NR6A 2AAVA 4DGIL 3B7RL 1UXLA 2Z93A 2MH4A 3WFHA 4C58B 4WI9A 4YEEA 3EFFA 4PJAB 1KJ3L 5KUMA 1IC5H 1KB5A 1UUSA 2OMBA 3IMTA 3L2LA 2Q7YA 4F58H 1I3GL 2BVEA 3HE7B 4L2YA 1OTSD 1SM3L 3EDKA 3J27A 3L4UA 3T6ZA 2K45A 4GG6E 2EIZA 1UQSB 1K4DB 1FC2D 5EZLB 5KTEL 4I3RL 4W9LC 3AU0A 5I5JA 5D72L 4AZ8A 4GAFB 1OAZH 4L4VA 1JRHH 4NUMA 3ISRA 1FVDA 1P5VA 5H94B 6PAZA 1BZ8A 4HBCH 5J1TC 4IGBC 1WA2X 1UWFA 2VDPH 4NKMA 3O9WD 2LT9A 2VH5L 1LJMA 1QACA 3RZWA 1N68A 3HC3H 4YHYC 2XNAB 4OF5A 4GMSL 4P46A 1VFMA 1RH8A 3T2OA 5B4MD 5KVDH 5HYSA 2E27L 4O2CA 4UNTA 3GXTA 4G9DA 5EU6D 3VFUA 4F57H 2X09A 1IAIH 3L3IA 4ZO9A 4C47A 4MZIA 2H26B 1YRKA 4WI8A 1NINA 1KFAL 2X7LA 3DXAE 2WXHA 1S3KL 4HEME 4UDTB 1CXLA 4Q0XL 2DDQH 4XPFL 4YSTA 1S7RA 3WMPA 5LQBL 3HS0A 1TZHB 1MHCB 1P4IL 5IP4A 5KN5B 3SE8L 2K78A 3E7JA 5I8CA 3IFOB 2ZUYA 5IW1B 3L4WA 4UV7L 5LXGH 1HYSD 3FCBA 5CCJA 2VSMB 5K69A 3SQBA 1WE5A 1U3ZA 1PNCA 2DEYX 5FW6A 1QRNE 3PF2A 3NA4A 5A2BA 3CU7A 3QXDB 1IEBA 1T5XB 4GBXC 1S9XB 4LGSB 2VN6A 3MV9A 2G3XA 4RFEB 5LAXA 4MJIE 4GG6B 2FX7H 3EBAA 4WJ5A 1ED3A 2GB2A 2X10A 3HE6D 2ZCLH 3HFML 1ECYA 1Y6MR 3C6LA 4FFWC 4XPHL 1EAOA 1FNEB 1YEDA 2IDFA 4UU9B 3OKOB 2Y23A 3MV8E 4D9LH 1RK7A 1G7LB 4CMHB 1RLWA 2EE3A 3GMRA 3IGKA 1GPOL 2ZNXA 4JPVH 5KVMC 5FYLL 2N7AA 2OSWA 1A21A 5F1SA 3NRQA 3RU8L 4Z7WF 1INDL 3RPIB 1ZA3A 3ULUE 2CLRB 3KLKA 3WFCL 4FXLA 4MMZA 5AB1A 4FKEA 3PFQA 4FXGA 2CRMA 1MPAL 5E8DH 3VI3E 4V33A 4EAEA 1WTLA 3DXAB 4Q9QL 4X8XA 1N5AB 3GBNL 4MS6A 1MFBH 1NAKH 3MLSL 3FB7A 1KXTB 3RQ3A 3DJSA 3RDJA 1WHOA 2Z35A 1AGEB 1GR7A 1OK0A 2R2HB 3JVGC 1FV1B 3HLAB 1N3NA 2KS0A 3HC0B 4G9FD 4MNHA 3TIDB 2RH0A 5AVVB 4MTMA 5JHDA 1A4JA 1AXTH 2IH3A 3QPQC 2A6JB 3DURA 4WKXA 1KENH 1K8IA 3AREA 4KVPA 4X5WA 1HHKA 3GMOB 4IBSA 4U3CA 1OL0A 1X4XA 5JIPA 1F6LL 2VSKB 4M5ZL 3T8MA 5ENWB 3NIGB 3S7GA 2O93L 2OW6A 4MJIB 1D5MB 2ZKHH 3CN0A 4CADA 3GEFA 2VL5A 4LLQA 1UJ3A 4LVOB 4F8OA 2CGYA 3AS3A 4ZW7A 4DNLA 4WHYH 1HXMB 3ZRFC 2D2CC 5FM5O 4Y5VB 4EIGB 2VW6A 3ARDC 1RUQL 3CDZA 4OLUL 4PP1C 3MO1A 1AZBA 2GYSA 5F72S 4HJIA 4F9LC 6FABH 5CILL 3CVDA 4MMXB 5C0JA 3BZFB 3T0EA 1CE1H 2YJQA 4PGCA 4Z7QE 4LKCB 1HEZA 4A39A 1E40A 2H1PL 2VQ1B 3G6JF 5JXAH 1CGSL 2VLME 5DEGB 2YZ8A 3LV3A 5HHMD 1B4JL 1QUNB 1S7WB 1UWYA 3ARGC 3MRNB 4JVUA 1PY9A 5ANHA 2QGBA 5TK4A 2R1YA 3Q8CA 2W95A 3P2TA 1HYRC 4EZMA 2C9AA 2ZXCA 4XWGH 3BP5B 3SKJL 1HHHB 1CYGA 2A6KB 3B5TA 3CZUB 4L18A 3CUPB 4KHTL 2WLZA 4WW1A 4EKJA 4TOYL 3V2AR 5C08E 4BZ2L 4MYWB 4IRJC 3QFDB 2HH0L 5TE4L 1KPRB 2NDGA 1SHWA 2C7FA 4YHOH 1RERA 1WHPA 1R3LA 2JK5A 5F89B 4I7ZC 4PTUA 5EZPA 4KAQH 5LBSH 5CKGA 4NM4H 3IBEA 5F3HA 3TZVA 5ICYB 1HSBA 2A74B 2OM5A 2UXFA 2X4PA 4RSVA 3POHA 3FF7A 1EPFA 4XMKH 4C4UA 4YWGL 1BZDA 5D6DA 4RGMC 2CM5A 4YQXL 1OW0C 2X6BA 1UWXK 2O1AA 2DQTH 1W91A 4KROC 1QA9A 2F8VA 2N01B 2RFXA 3U79A 1P6AB 1NEZA 3IFLL 2MWCA 7CGTA 4KK6D 4U3XA 1TQCB 2BZ7A 1G9NC 2FQEA 3OB0H 3FBKA 4PRIE 5GS0H 1I85A 3ARRA 2EIDA 3WG7B 1E6JH 1PAMA 1FF5A 4PB0L 5KSVA 5C0RH 3I6LE 5EU7E 3SGKC 3I84A 2CE6A 1YVLA 1UCTA 2FR4A 5ITBL 2EDRA 2L04A 3O0LA 3B2MA 2X1XR 4JVPA 5EA0H 4FFZH 4A55A 4JFSA 4V2BA 5FCSH 5GSVA 4Y4KB 1AGDB 2MOVA 3BPCB 4L5FE 5E1GA 2VR6A 2BP0B 3L3DB 5DQDH 4WO0A 3SDAD 5F1NB 3MXVH 3TBCA 4XMTA 4D0DA 1BQLH 1BX2A 4P2RD 5D7IF 4Y9CA 3CDYA 3CMGA 4AQAA 2CU9A 4L8DA 4PCKA 1AD0B 3MX0B 3S5ZA 2R29H 2YWZA 1PZBA 4R5VA 4PVLA 4WFHD 2V9QA 4LO9A 4MCNA 4PV9A 3EXJA 5HD8C 3MBWB 3BSZH 3CXDL 3SD2A 3VXRE 2VDLH 3JV6B 1QRKA 4UM9B 2I85A 4B50A 3QO1B 3I6SA 3TN0B 1YEIH 3MR9A 1FYTA 4MD5A 3FUIA 1AC6A 3QJZA 3RYMA 1IGCH 3BLKA 1M05A 2MQ3A 3QUZB 4PFEA 4NO2A 3HE7D 2A9MH 1MNUH 1PIFA 5FO7A 2ZONA 3ESMA 3S5YA 4XCYA 3T77B 3NCMA 1OD7A 2OZ4H 4HIIA 4PRIB 4BCYA 5KVEE 5KSBE 2GTQA 3GRWH 4MAYC 2O6PA 1BEXA 1YN7B 2GIMA 4XOEA 4KI5F 4Z7OE 3G5ZA 3T2QA 4OQTL 1IAKB 4L9LA 3IKCA 2UZXB 2R9HC 3BGMA 4PPTA 5F0MB 4OI8A 3VNYA 2NLJB 2K0RA 3F7LA 3HI1B 3ZW3A 1G6RA 2HVBA 5C0BD 4PJCF 2MFNA 1GJWA 1T83C 4JB9L 4M43L 2YD2A 2FDBP 5C8JA 1F4WL 2OJEA 4OZHA 5A6MA 1V55B 3DGCR 1TKWB 2Y1VA 5I1JH 3VD5A 3ZHKA 2APTA 1HZHL 1URIA 2B59A 5BS0E 3ARZA 1NDMA 2GAZA 3SYCA 2CUHA 1GC1H 3FFDA 4CJ1A 1ZTXL 3ZOAA 3MRDA 3SQOL 4QYOB 3LNFA 1V3MA 4PJ8A 1SY6L 4P5MA 2IH1B 3P30L 2VUKA 4JFYA 2W88A 5IB2B 1OK8A 1MUJA 1SMOA 2MQGA 4X8JA 4X6CA 4U1IA 4AM0Q 1SF3A 2R1WA 4OD1L 5HGBB 3UMTA 4KMLB 3WHE1 4P49A 3WFBH 2CIIB 4BRJA 3X1BA 3TH2T 3F12A 5I1KL 1JIBA 4XNBA 2VIRB 2WVUA 2ZXEB 3DBXB 3N3EA 4OQ1A 3S3PA 3VACA 1JPSL 4M62L 3QXAA 2MEJB 5IT2L 4A66A 1RZ8A 1CICC 2W92A 5C0CB 3CFDA 4ETQA 3OX8A 4NQCE 2EVHA 3B9KA 5L9DL 1UFGA 4ETYA 2DBLL 4IBUA 1N9PA 2HJKA 2H6OA 2DMKA 1O6TA 5IQLA 5E5LA 4Y5XB 2V17H 3FN9A 5IBUB 2EXYC 3DX6B 2NW3A 3IDJB 4I3GA 5A6IA 5CHNA 4HHAB 1C5DA 4DP7X 4EI5C 2PUQT 4WEMB 3REVA 4WWPA 5DJDB 1FO0H 3FU0A 1FH5H 2WCPA 3ZN6A 3PUCA 5I2IA 3EYSL 4JFFE 3SDXF 3VXTB 4NLHA 5B3JE 3NP4A 1A14L 1U2YA 3F2LA 1JYVA 1WUNT 3D30A 1IBDA 3KS0J 1XF2B 2XN1A 1H3PH 1QQDA 3LIZA 4K7PL 2XQBH 2XYCA 1HE7A 1A3LH 1A6ZB 1WAAE 4OZIE 1R3HB 3FSZA 1S9VA 2H0EA 2ZSWA 4MD0A 4PRAB 3V6OC 1L7IH 2C1OB 2EE2A 1FAIH 1Z7JA 2AJUL 4O51B 4XO4A 4L4TE 3S37X 3V6ZA 3QBTB 1JFQH 2X2HA 3CBKB 1FLTX 2JKXA 1INQB 4JDEA 4TQHA 1P1VA 1JHLL 1LEKB 3K5RA 2ZG1A 5T1MB 3MMEB 3BP6A 3D87B 4IRSB 4UT7L 1R3KA 3RG1C 3AQXA 3DI2B 3GZQA 4HJTA 3G04B 4XNXH 2R2EB 4F9PC 3D7PA 4NP4L 3D5OF 2XYBA 5LCVH 3STLA 3T3MF 1WFMA 2YARA 3KBFA 3VFOA 3ULVF 1Z9OA 2W07B 4Y19E 2XIIA 3QIBB 5B7FA 5TDNB 1CL7L 3MJ8B 3N43F 4HWNA 3GBLA 4PG2C 4E9VA 3I3EA 3WMQA 4OGXL 5HYQA 3WL9B 1FZJB 5CEZD 1U91B 5KWYC 4GW5B 2OL3A 4J3XA 3BH9B 1TLMA 3F65A 3C5JB 1GOGA 2BHFA 4JFFB 1K72A 3RVUC 3V4PL 3HI6H 3EAKA 2YRPA 1W0WB 2Y7QB 1A6WL 3D85A 3UG5A 3ZYJA 3VE0B 4IYKA 4MGXA 2NY4B 4OLZL 1A7QH 2Z6FA 3UCQA 4WI2A 2OK0L 3P0YH 1X4ZA 4HBQA 2IBGA 3OB8A 3SDDC 5L8LB 3MRKA 2CO1A 1XH0A 3FRUA 2FD6H 2DM7A 3C8KA 2AJYH 2XN9B 4HJ0C 3UP1A 5BO1H 1IL1B 35C8H 4J8QA 4ODSL 3VGBA 1IGIH 1SMAA 4YC2C 4Z7WA 3WUWA 1DE4B 5CCHE 5DUPL 5ABDE 5JW3L 3RJOA 5K1NA 2QSQA 3E8UL 2C1PA 3P02A 5E2UL 2IQAA 5IROC 5J1AB 1UACL 1T4KA 2HZHA 4Q9CA 2Z64C 1RFDH 1CU4L 4NQSA 4U7KA 2VZSA 3K2UL 3AT0A 3O41A 4ZOCA 1TO4A 4WI0A 2FSEB 4U1HB 1BQHB 5HJBA 2WM0A 4GI6A 4PBXA 4N8CL 4ZZKA 5KYWA 1NFDE 4NJAL 4ZFFA 1OAXL 2B1OA 2DJMA 3M8OH 4JFHD 1Q0XL 3A6CH 1EXUA 3H9HB 3RGHA 1ZRUA 4MCZB 1VJSA 5EO0B 4P23B 1BGXH 1QP1A 4X99B 4LP8A 3MZTA 2BY3A 4P2CG 1AOZA 2LFGA 2AK1H 3FUNA 2FLRT 2Y7OA 2RCSL 2YSSA 3GTVA 3RWCA 3BN9D 4YK4B 1FG2B 4P5KB 5TGBB 5FYJE 4B27A 4I9WE 5D5MB 4O9HH 1QKZL 2V7NA 4ODUA 1BV8A 1UD8A 1G1KA 4XXDA 5KYUA 4ZNCD 4LVEA 4W68A 4Y4KD 4XCEB 3G3LA 1P4LB 5E95B 2PW2A 1QFHA 1LE9A 3MGOB 4PWGA 4TVPH 4HOMA 5BRPA 4BH7A 3WO4C 2J7LA 4WV1A 1ZIBA 4B9PA 3BPNC 1TJGH 1ZV2A 3O8XB 4OM0L 3RBGA 2B1HL 3L95B 4Z3FA 3VTAA 2P48B 5ESQB 4HZLA 4P2OC 5IMKA 2CGRL 4NGHH 5EDXA 5TJWK 4UM9D 3QUMA 3TN0D 1QFWM 3G6JA 2UXTA 3N0AA 1NGQL 4FXKA 5F9OH 1NFKA 4ZXBA 2EDEA 3LDBB 4FNTA 2ENPA 5J0BA 3QS3A 4YSEA 4ZMYA 2HWZH 2JNZA 4NPYB 3ZHFA 5KJ7E 5C71A 3ZDYF 1T2QL 3N9GH 5I30H 3IXTB 3ZO0A 1AQMA 2C7UB 2QFPA 3MGTB 5I8EB 3A6BL 3U1SH 4DGIH 1I3RA 1PLAA 2QHRL 3R18A 1MJ8L 4F20A 5IUCA 3WLWD 1BZOA 1U58A 1I3GH 2FNWA 3LJ3A 4MA8H 1SM3H 4BHUA 1CIUA 2YPVL 3WS3B 5HHQB 4UWQB 1UD5A 4RMRA 1U8JA 2FVNA 4IDJL 2CK0L 1IT9L 5C0DB 1KIRA 3TYFB 4R4NC 4WF7A 5IJCC 4ESKA 5KTEH 4BFGA 5D72H 5EBMA 1A9VA 2GC7C 4HWZA 3DA0A 5CJXA 2D0HA 2EIMB 3FPYA 2B2XL 1IGTB 1YC7A 3HPJA 4NT6B 3S8GB 1KTCA 2YLHA 3P2BA 2B3IA 1CD9B 5IEHA 5CAYB 2VH5H 3NIFE 4H7VA 3ARVA 2GCYA 1GHFH 1MEXH 4LPVA 5DMIL 4FQ2L 2VR8A 4QCIA 4GMSH 2IV8A 4HMEA 5T1KB 3F5WB 3ZE0E 3CSPA 2E27H 1W0YT 2V4LA 1NOLA 4NLAA 4QOKA 4S2SB 5D1QC 4HAKA 5JDSA 1USQA 4FP8L 3BH8A 3T5WA 4P2QA 2FJFA 3EJUA 4DWHA 1S3KH 4XPFH 2W60B 4Q0XH 3WAJA 3PV6A 3S36L 5LQBH 2CHXA 4NKOA 4R0LB 3TJEL 2KDGA 5H35B 1P4IH 4KV5F 3SE8H 3M17B 2C26A 4UV7H 1GGTA 1PJ9A 2YGPA 1BWMA 1WDAA 2LR4A 5C0EA 4AQEB 1PS3A 1F4AA 2BIQA 2UXVA 4LRIA 4HHGA 4FMKA 4WNSA 5ILTL 4DK3A 2ESVB 5C0CD 1MCQA 5D7IA 2EUZA 5MEPB 1DEEB 3VFMB 2R4SL 4LSUL 4AC2A 3HFMH 4O02A 4G7RB 5TDOB 5DHXB 3DMMA 4N90D 1CLOL 5BUPA 5D2NC 5IW6B 4NPJA 3BUPA 3ELQA 3NESA 1FDLL 3KCPB 3X1EA 5FO2A 3NIFB 1IM9A 1GPOH 2X05A 4HAFA 3OKEB 1DQIA 2BVYA 1YMHA 4WW2F 1QBLH 3A22A 4LGRB 3CGTA 3AXHA 4G59C 4N2KA 3S37H 2A38A 2OTWA 1GW0A 4K7PY 2R0WH 4N3TA 2X1PA 2FBOJ 5GRJH 1RAMA 1D5RA 2QGEA 1F97A 1NOFA 2IDTA 3MRPA 4IEFA 2H6PA 5I71B 2EC9U 1YMMA 4MB5A 5CR8A 2AP2A 1E4KC 1LM8V 2EILB 2Q1EA 3MLSH 4ADGA 3M45A 1OAQH 5AW4B 4NN5C 2QQKH 4J3OD 2AANA 3EYFB 4PJCA 2XTSA 1SJHB 5DD0H 4U4BA 3RVXD 2ADYA 5DVNA 3O6FA 4AYEC 1LL1A 4IRSD 4F8QA 4MJJA 4M5ZH 3WTXA 1X9QA 3X12B 4WTZA 3HRZB 5JQIB 1LD9B 2YK1L 4ZUTA 4L0PB 4NCC2 2CO7A 3B9VA 1JGLL 1KJ2L 2OMUA 3TA3C 5ADOL 5LJYH 1MCNA 2UX7A 4OGQC 2DQDL 4HEPA 1WIPA 3OMZA 3QIBD 5DO2C 1CXIA 4YHZL 5G4OA 4LSRL 3UJIL 4B96A 4UT9A 2YEVB 4ZJ9A 1MAML 1U8IA 4QI3A 3KWUA 4AY0A 2N7SA 4Z7AA 4YIQB 1XFPA 4OKDA 3PWLB 4UOW1 1WITA 2BINA 2KMWA 3Q3GA 5CILH 4MXWL 1BF2A 3D3VB 1M57B 2COQA 2DLHA 4I0PA 1NIDA 4BDVA 1JGVL 1RZGA 4X0KA 3ARBA 5HJ3B 2UY6A 2H1PH 4X8GA 4NERA 1MWAH 2E56A 1CGSH 3PY9A 2NY4D 2NW2B 1G43A 4AJVA 1SDAB 3TEZA 4LLWA 4BE6A 1B4JH 3F7VA 1J9QA 3IPFA 2CLVA 4RMBA 2YGOA 1F2XK 4IOIA 1SEQL 1TJMA 3WDJA 3ECBB 2NOYA 2XN9D 3GSUB 4BXVA 5JMOC 3BVNB 3SKJH 1J5HA 2Z1KA 4JFWA 4KHTH 4Y2DA 4M6ML 1WC7A 3EYOB 3Q7JA 4XMVA 5DJCB 3EJRA 1JZHA 4BUQA 2YGNA 4UM8A 4GW4A 3PXHA 2HH0H 2DMHA 5TE4H 4HGWB 3VJ6B 4ALAH 4N6QA 2J1WA 2P5WA 3DIFA 3US1A 3FU3A 2X41A 2OXHA 1WEJL 1JYNA 4EXPX 1W0VB 4JANB 3SDXA 4F15B 2CLZB 2Y36L 1A2YB 1R17A 4P23D 4RWYL 3QAZB 4KK5D 2OMTB 3L54A 4YWGH 3CN3A 4YQXH 2FRGP 4B9ZA 2BVPB 3A4EA 5J7CC 4IMKC 5T3ZD 4JREB 1UKSA 1CD0A 3IFLH 3QFGA 5I1AB 1OHZA 4AE1A 2VXQH 4FQIH 4MQXD 5E08H 1D9KB 3KDMA 4MS8D 2DKMA 1KYOJ 4LLUB 1JF5A 3UAEA 5FO8A 3LN4A 4IBLT 5D4JA 1EANA 4BA8A 4FKHA 5AVRB 3IS0X 4KZ0A 4I18B 3LZPA 4L1HA 2X6CA 15C8L 5IG7A 4PJGF 1KBGL 2D4FA 5ITBH 1WFUA 2CD0A 3MJ7A 5EZIL 1A1NA 2HYMA 5I5RA 2MOGA 3BXNB 1P4BH 3ARFC 3M07A 1NTDA 1KV3A 3F6JA 2OFQA 3O8XD 4X5PA 1G7PA 2YOAA 2W80C 4LIQL 4AENA 4JPWL 2H5UA 4KXDA 1ZSHA 3VWKD 3D18A 4YBLC 1TTCA 1UM5L 2ZCKL 4ZMAT 3BYYA 1TG8A 3LZOA 1I1RA 2P42B 1FNGB 5D7HA 5CBAB 1KTKE 2NSQA 3B3IA 1BXUA 4K5LA 5MP6H 1O5PA 4DEWA 4PJ9B 1PDKB 4X83A 1N7ML 3MNDA 4EXKA 3MRHB 1XVSA 1NL0H 1PX4A 5AW5B 5KVGE 4JEGB 2TRHA 2BVQA 3EO1A 4FMVA 2JKIS 5J6HB 1PCXA 2XWJA 1EJOL 3U9UB 4IIZA 1WIOA 1KT2A 3VXNB 4NN7C 5AW2B 3LXUX 5DC9B 2FECI 5FV1L 5DUBB 5I6PA 1MCFA 2BXYA 1E2ZA 3PQYA 1YJDH 2C5DC 5HI3C 4I9WD 3QEQB 2APSA 3UBXG 3V5KB 1ZLVK 3WD5H 2VUYA 3THML 1RJZB 3QWRD 3CQPA 3DK0A 1B4TA 3IMUA 4JR9L 3R0MA 4ZT1A 3PCYA 5HVHC 5IB1A 4D0BA 4ZSOA 5T8IA 3O2VL 4OQTH 4PGBB 1KB5L 2EYTB 2D3NA 3DTXA 3G5YA 2FTAA 9CGTA 1XMWA 2XWXA 1LQBC 2H9GB 2EEDA 3QCUL 1MFCL 3RB7A 4JB9H 3MRJA 4M43H 5T1KD 2HMID 4M3KB 1G7JB 3FS9A 1BM7A 1BYPA 3QRLA 1MVUB 5INCB 2XJLA 5FGCE 4NQUA 3X1NA 4ZTOL 4MB4A 3R19A 2J6EA 4JRLA 3WFEL 2BSDA 3SCMA 3IMSA 4L9DA 4UT6A 2WB1A 2DMGA 4F93B 2CPCA 2XTJC 3MKGA 1OM3L 2DM3A 5MEOB 1RJYB 1T22B 1YECL 1ZTXH 4W4NA 4ZOAA 4OZGB 1U8PB 4PJ5B 3ZTJG 3MXWL 4P48A 2GJPA 2WOYA 3P30H 3NIDE 3MUGA 1OB1B 4R7XA 2N1TE 4BFIB 4PJDF 2DTML 1A1MB 1WZLA 4EN3A 1PKOA 2KZKA 3Q8EA 3BZ4B 5DRWB 2ESVD 4G82A 3QAQA 3ULAB 2O26U 4OD1H 1C1EL 4R7NB 5E70A 1T1YB 4WWKA 3HG0A 4WSJA 2O5XL 3S8WA 1RD6A 5EIIG 5GS2D 3IE4A 1MI5E 2FSDA 4C83A 3BUYB 5D7JA 1QYGL 3B9AA 5I23A 5IOPB 2HB0A 4M62H 1QSZA 8PAZA 1CG9A 3V6BR 4ZX5A 5F3FA 4YGVB 4NHUB 5AWNL 1PYWB 4LPUA 2Z9TA 1Y1DA 2DBLH 4WSKA 4H8UA 4IKKA 4IOFD 3FT4A 5TDPB 5E5MB 2X3BA 2N3JA 4EVNB 3N42F 4GKSB 4BUHA 1TU2B 1L9OA 2GJJA 4H1LG 4WDIB 2JIXA 5FGCB 4M00A 1ADQA 3PHSA 1KTLA 4JGUA 4OFQA 1AQ8A 1VEMA 4JFOA 2AGJL 2CQVA 2LHAA 4FS0A 1EBAA 1OSPL 3DX8A 3EYSH 4EDXA 1QSEE 2QR0A 2WGNB 1KCRH 1A14H 1CDHA 3KPLA 2WZPA 5IY5B 5BW7A 3MV7E 1TZGH 1K85A 1J88A 1P7KB 4S1QL 1RZIB 4IS6B 5EO9A 3TO4C 1C16B 4ZUUA 1SUHA 3OQRA 3EH5B 1KTDA 1OF2A 1S7XB 3HG5A 4F3FB 3NJMA 5L0QB 2IPTL 3RTQD 2Y22A 2O6DA 5GRVL 5IHLB 3ZDWA 4PHXA 1VKXB 5I1EH 1MI5B 4S1DD 1T04B 3IMVA 3BX7C 3LKOB 2FWOA 1FNSH 5B1JC 5KAQG 1T3FB 4NQXA 2AKRB 2ZOWA 4FGMA 4U1JB 4DZ8B 3TS8A 3Q8BA 1BVOA 3HZKB 2CCVA 3HG1E 4GG6F 5B39A 3BESR 1FPTH 1SHSA 3GSRB 1IGML 4BUGA 4F5CE 5I6LA 5FM5M 4NP4H 3EFOB 3FQTB 3R7QA 3PPSA 1XD1A 3D3VD 1KGUA 2X1OA 4WTWA 1T7WA 2I25N 3L3KB 5D1ZA 1CL7H 3ABKB 3K1DA 5KANG 4BEIA 3D08A 5DT1H 1ITCA 4EF3A 1J05A 1QVOB 2BW5A 1XB8A 3QNFA 1E2VA 2Y06L 3EYQD 3MYJB 5GJSL 4PIRF 3MA7A 1EO5A 4N4YB 5J5EA 1RURL 3DROB 1GTFA 3V4PH 5PCYA 2YMOA 4GJTB 1ROWA 3QEUA 5DZLA 4I89A 1A6WH 3K72A 4MNGE 2XUWA 3GHBL 1AOHA 3V0GA 5KSUB 4H0HB 1MKFA 4YFLF 4OLZH 5KS9F 4QJ4B 2XPZA 5DJYA 1A9BA 3P3YA 4H8HA 4PRHB 2QKIB 2XZAL 3VVVA 2BIOA 3K4ZA 2CM6A 4Z78A 3W37A 3U7YH 3SDCB 4FCHA 3U46B 2FT7A 2ICWB 4JFVA 4TNGA 4ODSH 1MCIA 4WW2A 4A7UA 5DUPH 5JW3H 4F92B 3T65B 3B5GA 3E8UH 1WS8A 1J7VR 4LQFL 3QT2A 1UACH 1RUKL 4H26B 3UO1H 4M9PA 1CU4H 25C8L 3EOBB 1JXDA 1RHHA 3K2UH 2PCPA 5IVOA 5J9PA 2GFBA 1ZLUK 5LAPA 3KEDA 5DI8A 1XGQA 4JRXB 1FLRH 4N8CH 1CFQB 3BPOC 3SE4A 4IBVA 4XHJC 5ADPL 1G1CA 2XI9A 4WFFE 4POYA 1MJ7L 5SWZB 1Y6KR 1JDCA 1PG7W 2Z31C 3BAWA 3S5LA 3VRIA 1D9KD 1NJ9A 4ANWA 2E9WA 4NENB 4NWTL 4U4IA 3MLUL 2GK0B 2RCSH 4NYLB 1CK0L 2SODB 1HC1A 3FO2B 4L3EA 3Q2NA 3ULUF 3S88L 1SQ2N 3EGXB 1BD2E 4M29A 5LBGA 1AXSA 5IM7A 1QKZH 3DX9A 4CC1A 1JERA 4J4PD 5CEZL 1OTSC 1T5WA 3WKML 1KIQB 4XAKE 3VI3F 5JHLH 5AFAA 3EF4A 4WEEA 1Q0EA 5KYXA 4R4BB 3BUBA 2GT9A 2P9RA 2WLJA 2ZX7A 3RA7L 3PGFL 2GY5A 2XWTB 1CCZA 3HUJB 4NZ8A 3O9WC 1M4KA 3MNVB 2GJ6A 1SDDB 5EO1B 3V0IA 5GPRA 1RZFL 5HDLA 1FA4A 2GITB 2G75B 1MCHA 3QQNA 4OM0H 2B1HH 4HQQL 4N1EA 2ADJA 4PJ9D 1O9VA 4WQOA 3WJJA 2G5BB 3LRHA 5B4MC 2CGRH 4OJYA 4HJEA 1KY6A 1PZ5B 3B6SA 1LEIA 2XDHA 3D51A 1NGQH 3RUGB 3VFVA 4JZOA 5J8OA 3H2PA 1TIUA 2X2UA 4ZPTA 1HKLH 5E0FA 3TBYA 4NO5A 4N0RA 4LSTL 4YHIA 1OOWA 1IKFL 1ZV9A 3T2NL 4NQDB 1RZKL 3FRPA 4JHVA 4MBOA 5F1KC 3QEQD 4E9WA 4OF3A 4WWKD 1T2QH 4GI8A 2AQRA 3B1TA 2F1AA 1HYSC 1AJ7L 1MSPA 1K5WA 1J10A 1MJ8H 3LXBA 4W9KC 3D39A 2XVBA 4K23L 4WHYG 2H32H 4Z7QF 2YPVH 2GBTA 1YA5A 3GLEA 3JWOH 5JTWA 3ROOB 3HB3B 3CDFA 4IDJH 3PP3H 1IT9H 4AQ1C 1MFAL 2J1XA 8FABA 4ZTEA 1HHIA 4U6VH 3HE6C 4X4XA 3DUUA 2X4OB 2B2XH 2XA3A 2WLMA 4TV3A 4KY2A 3QH3B 4W9JC 5CS7A 3DO7B 4BZYA 4FAAB 3NJNA 2HP4A 3FO9B 4FLQA 3MBED 4IIQB 4UB0L 4Z23A 3S3DB 1IU1A 4ENED 2AEWA 4YSOA 4FQ2H 3N1MC 2AXFA 4P5TA 4LDLB 2J55A 4L29B 3P4NA 3S9DB 4PJ5D 3IFNH 1E4HA 5IJVA 4V1DE 5GS1A 3QFJE 2VLJB 3BHBB 3KG5A 4ABWA 4FP8H 5HPMB 1A7PL 5EOCL 2AQQA 3JV5A 3V0EA 1B2YA 2X4RB 4X9BA 2X3AA 4JZNA 3F05A 4NUJA 3TJEH 4K9JA 3CFUA 5ANME 1RULL 4PJGA 1HU8A 4RFNC 4OBSA 2QLVB 4ELME 2VISA 2ZUVA 2NUPB 1QSFD 3KWWB 1L9RA 4HUXB 2WVSA 3JT2A 2VAJA 4XNDA 2BSTB 2ERJB 3ILDA 3NCJL 5ILTH 3NEEA 1HHJB 2IOMA 2PYEE 4QRPB 4UQ2B 2GSMB 2VDKB 1IJNA 3MOQA 2VXSL 2R4SH 9PCYA 2X4UB 4R3SB 3BI9X 4XP6H 3ASNB 2D9CA 5T1LB 5BV7L 1YY8B 2WLLB 5B21A 2ZSVB 2VXTL 3OAZH 2XWBA 4GSQA 1CLOH 3GO1L 3MBXL 4JLRA 5ECJE 2UZYB 1UXWA 5KZCB 2APWA 3LHPH 1DQML 4LMQI 4JQXC 5JQ6H 1AG0A 1W80A 1JG9A 5E9DA 1P84J 3MLTB 1UA3A 4BFBD 4G8EA 3P9LB 4HXBH 1GSKA 1TT6A 3NBNA 4UI2A 5CWSA 1O7DC 2RMNA 1QFWL 4WIQA 1JL8A 3C60A 4DZBB 4CVWA 1IAOB 4XVJH 1M6OB 2C3GA 4ELKA 4YXLL 1I8KB 1TZ8A 4XB3A 2OXGA 4JPSA 3CVBA 2PXYB 4XRCA 1KPUB 1E30A 4HPYL 1DBJL 5FA4B 4ELMB 4DP0X 2UWEE 5K9KA 1DO5A 2CJSA 2UV3A 4HFWB 5IVZA 4C4BA 2UUDH 2IJ0C 3K8MA 5H37H 3IDIA 5ISZE 3TT3H 3WJMB 1IGJB 3HG4A 4Z7VB 1U8KB 3NCBB 1NGYB 2CR6A 3DKHA 5CLZA 4DO4A 1KCUL 2VQ4A 3IGFA 3L1EA 4GFTB 3KYKL 2AXHA 4N8VG 4PV8B 5DHDA 2IFFL 3LXCA 2YK1H 4XP1H 1A6VL 4E41A 5KSBF 1JGLH 5ADOH 1KN4L 3WV0A 4Z77A 1IIIA 4Z7OF 2DQDH 1MRDH 2OMXB 3CVHB 4LGPB 1JNNL 1RZJL 3CVIH 3IMRA 3UJIH 4LSRH 2VW7A 3M46A 1JZ3A 1LE5A 2ITCA 4PJDA 3WY3A 4FNQA 2O6CA 4G8FB 2HVKA 1SBBA 4DETA 1MAMH 1JNJA 4ORZC 1L6ZA 4K8RD 3OLIA 4I9XA 4CSTA 3HAEA 1KBVA 2B14A 3AXIA 1T2JA 2C4XA 4YNYA 1N59A 4YXHL 4R8WH 4M7JH 2QMJA 3ZLQC 2TRYA 3CFQA 2E6JA 4KK6C 4S0SD 4HIXL 3FUKA 5FV2A 4KJYB 5GRYA 3IETA 2IVFC 1KLFB 5FYKE 4PRHD 3I50L 4RRPG 2R0LH 3T0XA 1DVTA 1SEQH 3L17A 3SDCD 3UTSA 1DBBL 4JN2B 1K4DA 4K55A 4AYBA 1ZCRA 2IOIA 4TLSA 4GIPD 2F6AA 4FQLL 2UWEB 4NWUH 1CFMA 3BVWA 1A65A 1CPUA 4F33A 3HBPA 2DIBA 4LEOA 1UT2A 4S10A 3L81A 4I1PA 5ISZB 2FQDA 4D7BA 3C08H 1U8QB 3X11B 3UROR 4J23A 1ESOA 1J5IA 3FAXA 4PP2A 4X9HA 5E99L 3SDAC 2AK4E 3G08B 1NUDA 3TPUA 3BZEB 3D33A 2HLAB 3RY4A 4JRXD 4MQTB 2KC0A 5ICXA 3W81A 4PU2A 1S8DB 5AAMA 4OY9A 1WEJH 1R5WB 3QEHB 1F11B 4WGWB 1WA1X 1JZ2A 5CCKL 2APBA 5SWZD 5HHVL 4KO5A 2Y36H 5T3XE 2AV1A 4GS7C 4M3HA 4UILH 4DVBB 4RWYH 2H26A 2PO6A 2QTVA 4Y2OA 1I1FA 1L9TA 4UCFA 1A7NH 5CINH 5M7QA 2P3YA 1BQRA 1I7TA 2NZ1A 1MHCA 2XIDA 2J8UB 4G6KL 5FM4A 2NSXA 4P4RB 5IW1A 2AI0H 2GC4C 3ZDZB 1JNHA 3HE7C 4CU7A 3KPSE 3H6JA 3ATFA 4M7ZB 4R26L 2FEDD 3ILPB 3QQ4A 2ZUXA 4G1EB 3RFZB 4OI7A 1RPQA 3MROA 4KZDL 2J20A 3CC5B 5B3JF 1U3HA 5EZIH 4GG6A 3E6HA 3HHMA 2VWEC 2XQYK 4GSDL 4JRYB 5E03A 4GRWH 4LPTA 4NBYB 2ZXDA 1WAAF 3UYPA 1QAWA 4LIQH 3RZCB 3U25A 4OZIF 4HUKB 3CIAA 4UU9A 1UYWL 4DP4X 1ZE3H 3M1BA 1QI5A 4LCVA 4Z5RB 4PB9L 4J2XA 2FCBA 5T5NG 3BEWB 4TKWA 2XSKA 3I74A 3L3OB 4G7VL 1DFBL 2X0UA 2HX9A 2IPUG 4UQ3A 5DD6B 3GT6A 2CLRA 5JLZA 2ZP9A 4NQDD 2H0JA 1EEYB 1E5UI 2K3TA 3CVCA 1N7MH 5JNYA 4WFFD 1P2CA 3KPTA 2Y69B 3H0TA 1AQDB 1EJOH 1P5UC 3T0DA 3DXAA 4HEMA 5KS9A 3TASA 1N5AA 1XGYL 3GSXB 1A6PA 1A6TA 1AGEA 3IF1A 2MQ0A 2R2HA 4ZO6A 1FV1A 3HLAA 3HB3D 1FZMA 2OP4H 5T3ZL 2CMRL 3TIDA 3THMH 5FB8B 4JKNA 2CO3A 4JR9H 3EBIA 1ZGLB 2FUTA 1NGWA 1QRNA 2FLBT 2WWNA 3O2VH 3CNKA 3IJYB 4M5TA 5I16B 5JOPE 1KB5H 3QPXL 2EO1A 3LY6A 4YL9A 5AW8B 1E0OB 5C97A 1MHHB 2Y3AA 4KU1A 1C12A 4MJIA 4CMHC 1I3UA 4RCAA 3WTSA 1Q9LA 3MRCA 4AJ0A 5C7XL 1MFCH 3EJJX 5DGQA 3BDYL 2G3NA 4X7SH 2FQGA 3LD8C 4AW4A 5IMLA 5DHEA 2VLJD 1BVKB 4LE8A 2FL5B 3L4TA 3MV8A 3V4VA 4ZTOH 4KX9A 4D9QD 2BSED 2F53B 4KUZL 4LOVA 3WFEH 3B9EA 1U2HA 1JZ4A 4LSVL 2A7BA 3ABLB 1OM3H 1TQVA 3MU3A 4GAYB 1YECH 4KQ0A 3OF6A 5EU4A 1HEHC 3PJSA 2Q6WB 1OCWH 4DKDC 3F6LA 2I7OA 2H2PD 2NSMA 2IPKB 5F93C 2ITDA 2ZKMX 1J0YA 1A5FL 1Z66A 3F85A 3QCVH 4LKCA 5DEFB 4DCQB 3CCHA 4AITA 3F7YB 2DTMH 4IU3B 3VI3A 1JWUB 2V2TA 2P46B 5DEGA 1DZ0A 1QBBA 4QRPD 1RJLB 4G7YL 5E2TH 3MRNA 1NFDF 3O11A 3VD2A 3MRGB 4MD4B 2O5XH 1R6VA 3LNGA 3T8VA 1T0PB 3GFUA 4WENB 1M7DB 1N8OE 5T1LD 1AH1A 2WLIA 1HHHA 5IUSA 2V8LA 2A6KA 5C86A 1QYGH 1OT4A 3DRQA 1GGIH 3BWAB 5EULV 4E41D 1XGPA 2ENYA 4LVOC 5KZCD 2EE9A 1T6WA 1PAZA 5HY9B 2WYTA 5AWNH 4W9FC 3UACA 4O4YH 3FMGL 4Y5VC 1DDHA 2WUCL 4GUPB 3DGGA 5C0GB 1QHOA 3QUGA 5AOLA 4JAMA 4NO3A 4YSQA 1E9PB 3ZYIA 1HHGB 2X87A 4MMXC 4APQD 4H44C 4QRTA 4L1BA 4N5ED 4G8GD 5A2CA 4U1NB 2AGJH 2K4WA 3GSNA 5BRZE 1OSPH 3U7WH 4TL5A 3GRGA 3QZWA 2H3NB 2PXYD 5F70A 3WKNA 1H9DA 3QJXA 1NQBA 3OSVA 2X4NA 3BKMH 2NQ3A 4I3SL 4DO6A 5I28A 2OCCB 4JZJB 3VD7A 1C8QA 2FIRT 5IBLD 3VGEA 2VZ1A 3MOBL 1G5GA 2ARWA 2F7OA 3GMMB 1M2VB 5ECGA 2CRZA 5I1LB 2WXLA 4GG8A 4AI7A 3KGTA 5GGSA 2A6IA 1CR9L 5DD1L 3UBXB 4E42A 1QEXA 4B0MB 2FATL 5D93C 4F7PB 4YSRA 2BNRE 3BPCA 1UWGL 1DVFD 1EV2E 3OKMA 5C07E 3RFRA 1GGUA 5C08A 1SNRA 4DGVL 3BKYH 1UTDA 3LZRA 5EZOH 2A74C 1EAPA 1I4FA 1N26A 3DJ9A 3GIVA 1Z9MA 1RZKC 2OMZB 2K6WA 1EJFA 1JXJA 4DPRA 2AZUA 3L4YA 3S3CB 4FEMA 4YDMA 1J1XL 3NCYS 4A68A 1OY3B 2AJ3A 3NIFF 1AGBA 4RA3A 1ZT7A 3LNDA 3WIFB 3MACL 3NPZB 1R5IB 1VFBB 3QUZA 4ONFH 1MRFH 3ZE0F 3SN6N 1MCPL 1RURH 2AV7B 4MZ2A 2X1QA 5E6UB 1BIIA 3DIDA 4QGTA 4PRIA 5D9SA 5E6ZA 3GHBH 3H3PL 4FJZA 4XPBH 3RILA 3ZMNA 5CBEB 1Q94B 3WSQL 2OJ1A 5ISZD 4Y4KC 4PREB 3GI8L 5EIIB 2AMUA 3DV4A 1BVZA 5ALBL 3WHXA 5I6KA 3IU3A 1EAQA 3QNZA 3V0DA 1YEEL 3MV11 1JFHA 2CWRA 2ZUQB 1VDGA 1GYWA 3GZKA 3O45B 3RGVB 4BM7A 2C3VA 5C07B 1TKWA 2PTTB 2ZWLT 4XVTL 3OHXB 4LQFH 1RUKH 3ZL1A 4AIOA 5SX4H 4NO0B 1F3DJ 2ED8A 4JO1H 3TN0C 1UM6H 1UOKA 3P77B 4YDIL 1F3JB 3PWPE 4H1LB 2YXMA 5ADPH 4E5XG 1LNUB 4B7LA 2ZICA 4TTGA 1MJ7H 5TK2A 4KDWA 2OULB 2WBJD 2IH1A 5EEXA 1CE6B 4K4KA 2I26N 2P5EE 3VXRA 1OAJA 4HZAA 1G94A 5F96L 2EDKA 4NWTH 3MLUH 5F88B 4K9EL 4S0TD 1CK0H 3BUDA 3ZKXB 1DJXA 1FCCA 3ALXA 2Z8RA 4GLRI 4XB8A 1U8OB 5BV7C 3S88H 2R23B 1XB3A 2CIIA 3GMLB 3PNWA 1R0AL 1EZVY 1OCZB 2JJSA 2VIRA 1BMGA 4PQXA 4Q6YA 5DVPA 5CEZH 1AR1B 3WKMH 4UTCA 3DBXA 4JRYD 4PGDB 5DFVD 5DYFA 3P9MA 5KSBA 4X7DC 5KVDE 1SXAA 4LAQL 3RZCD 4W9HC 4OUOA 4YHPB 5I6MA 2AW2A 2I60L 4OCXL 3H7BA 3RA7H 3W9EB 3PGFH 5DS8B 1OAYH 1RHFA 3QIWB 4K3DL 1NMAH 1ZVSA 3L4VA 2ZXBA 4WTQA 4XXCA 3GMPB 1H3UA 2A5UA 1RZFH 2IXQA 1IIKA 1VZIA 3PJLA 1XCTA 5IWLA 3KGUA 4NQEE 2A0LD 4HQQH 4N2EA 5AVTB 1KYOK 1A6UL 3MFFA 3V0VB 3EADA 4BQBA 1Y18B 1G1OA 4GLRH 5BS0A 2ARJB 3IJ9A 3NJFA 3IDXL 2H3XC 2A99A 1IE4A 3WOVA 1X5XA 4B3EA 2E7CA 1JYXA 3CSYB 3RL2B 2XHNA 3QUKA 3FQ2A 4LSTH 2YPLE 5TPWH 3PWPB 2OCFD 5IGXL 3E6FB 2BW4A 2OR8A 4UTBL 1EZVX 3W0WB 2EVIA 3MRIA 3UYRL 3JZYA 2BXZA 3I02B 4OVVA 4DW2L 1AJ7H 1BQUA 2EH8L 4JQVA 2BHYA 3O3EB 1R3HA 2VDPB 4MHHI 4QY8A 3L2NA 1ZHNA 3CFKA 4CN6A 1I8LC 2WINB 1DVQA 1K3IA 3AAZA 3KLAB 1IBFA 1KCSL 3KJ6L 3E8VA 3FQ1A 2KPWA 4XT1C 1INQA 3RIAF 1KBPA 1RZJC 4OGYL 3OKYA 1CWVA 1HCFX 5T1MA 3TBVA 3DVGB 4Y5XC 4AKOA 2F53D 2LU7A 4NQCA 3QJHA 4ZUWA 4FQXA 4UB0H 2Y2YA 5EC2A 1G6RH 4F37K 2OR9L 3WNJA 5L7XL 3DO3A 1JPTL 4NQEB 5HDQL 2Z65C 4UTAA 1A8JH 2YGQA 3NAAL 4ZFOL 3GQFA 5IB5A 3VQ1C 2ADIA 4A1RA 2J6EL 3QIUB 3R8QA 1GZPA 1A7PH 5EOCH 2JMRA 4UT6L 5GZOD 3IMWA 1U91A 4GW5A 4NX0A 4RWHA 5B8CB 1OWRM 2N4IA 3BH9A 3RWDB 1HXYA 1HAWA 4MA3A 4Y2NA 1THAA 4JFFA 3NZ8A 1RULH 1KJVA 5D7KE 4UMGA 2L7QA 4ZODA 1I7UB 1UEMA 4J3OC 1PG7L 1FL6A 1VGKA 1B6DA 2V5MA 3NCJH 4O2FB 5T5FA 4OZIA 2X3CA 2P24A 1SBSL 3NFSH 5HYJE 1YUHB 1BXAA 1KXVC 1F86A 3DC0A 1KELH 3RVXC 3U30C 3ZU8A 4QXUL