2EUVA

Principles of protein-dna recognition revealed in the structural analysis of ndt80-mse dna complexes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
303
structure length
290
Chain Sequence
VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
molecule keywords 5'-D(*TP*GP*CP*AP*AP*CP*AP*CP*AP*AP*AP*TP*AP*C)-3'
total genus 79
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euvA00
2EVHA 2EUVA 2EUXA 2EVIA 2ETWA 2EVJA 1MNNA 2EVGA 2EUZA 2EUWA 2EVFA 1M7UA 1M6UA 1MN4A
chains in the Genus database with same CATH superfamily
5I6LA 1SEQH 3ATAA 1PD0A 2NLJA 5DUJA 1RL1A 4HHAB 5FW8A 4HZAA 5CEXB 1MHEA 1YEDB 5L4IA 3OX8A 3CUPA 3L48A 1HSAA 2DICA 4HXAH 4B60A 2W1NA 4YDJA 1F02I 4OCXL 3D0AA 4NQEA 1FNHA 1P5UC 4X2UA 4QGYA 3WL9B 4N8UA 4A37A 2HFFA 5FWQA 4AUUA 2DH3A 2D2OA 3OF6A 4I9WD 5LBSA 4WJG3 1P5VB 4ODSH 2GW5A 2G5UA 3EGDB 2RGSA 1P1ZA 4WFHD 1RJYB 1UD6A 1YQ2A 1OY3B 5JW5A 5JXAH 1X4YA 3IDIB 4AEHH 1DUYA 1EFXB 2PF6A 3I84A 2MTPA 3RTQC 2P24B 1NMCB 1UM4H 4ODBD 4UT6H 2WVVB 3JV5A 5BS0D 1DBAH 1QUNB 4OCWH 2P8PB 3V0VB 3GF8A 4WJ5B 1SGKA 1VSCA 1HXMB 3FFCD 4HH8A 4RMRA 3TA3B 4ELMB 2LHAA 3UCRA 2A9ML 4GS7B 2I07A 3R19A 5DD6B 4ES8A 1P4BH 1KBGL 5ALBH 2HJFB 3L95B 1I75A 3KBFA 4HOZA 3GKWL 2IQAA 2JELH 3VDBA 5PCYA 5DZOA 5IY5B 1NOAA 1Q1JH 4XPTL 4D3CL 2ETWA 5IFJB 1FG2A 1W15A 2DY2A 3QCTH 3T2QA 1ZHLA 3FT0A 4JFDD 1DYZA 2YD1A 1G5GA 2FATL 3QDHA 2CHDA 4C57C 4DZ8B 3NRPA 4MQSB 1HWGB 1NAKH 5CGBA 1MCLA 2VDPH 4OLVL 3VI3F 3P73B 4WJKB 4ZG1A 4JPIB 3MBED 4P3CL 3QAQA 4YSRA 3A6CL 3B9KB 4NC2B 3FQTA 5LGYA 3SGKA 4Z7QE 1U92B 2EKJA 1J9CT 4F7PB 1M9WA 4KK9C 1BREA 3IDMB 3ZR6A 4U4IA 4Z7NF 1N2RB 1IEBB 1UXLA 4PJ9B 3LKNA 2G2NA 2IH1B 1MCHA 2BVPB 5L6YL 2WGXA 2X4SA 3MOAL 4UIMB 2OZ4L 1ZA3B 2Q3XA 5GZNC 3LN4A 2J88H 1SOXA 4PJEA 3H2QA 4IU3A 3WI9A 4WY7H 2E7HA 3JWDH 3QYCA 2ESVE 3DWTA 1TZAA 5C0GB 3LKRA 1A4BA 2OL3H 2F8VA 3CN0A 3QCUH 3K7UA 4KUCF 4CRPA 3NSYA 3QEQB 3KPMA 1HHHB 4XCCH 3ARWA 4GI9A 2YZ8A 4RFOL 5ALCL 4U1NA 3GXDA 3O9WA 4OZ4A 3MOAH 4JDTL 2HG5B 1SZNA 4GW4B 1LXMA 2CNZA 4BRJA 3WTYA 1MKFA 1VFAA 5F89B 1TJMA 1SLWA 4YSPA 4X8JB 3SE3C 4S1QH 5L2KA 1EHLL 3AREB 4LARH 3H42H 1EEZA 2BNQE 3PV6A 4YC2C 4AW4A 5I5IA 2BRRH 2MMXA 5BZZA 2XN9D 3EH4B 4TUJA 1S7QB 1P7HL 2BNUA 3RIAF 4UUJA 5DMYA 3HZMA 1QHPA 2BCKA 2ITDA 1TZHB 4E2OA 1TNNA 2YXWA 2I9TB 1TQSA 43CAA 1AIZA 2MTAA 3A6OA 5CIPB 1XQ4A 1N5YL 4BWTA 4HT1L 1BOGA 1KLFB 2VDRH 4FZEH 5AVXB 3L3JB 1FYTE 1F56A 2F18A 1BZEA 3FAWA 2KI6A 4QOKB 3RWFB 3UJJL 4RFEA 1N18A 1AFVH 3TJPA 3DX8B 3IFOA 2ZKWA 1I85C 1ZT7B 5KEZA 4Y1AE 3TCTA 1J8HE 3ZDWA 3LQZB 4CBZA 4YJZL 5I19H 4HWBL 4H25A 2R9HC 2Z8SA 3DUHA 1CXLA 1HQ4B 3PP4L 3ZTCC 2W81C 4P57A 3WUWG 2XX1A 2V17H 3AGWA 3V7AE 1YUHB 1HH9A 4G8GD 3MRBA 2AQ1A 5IB3B 3FSAA 1S7RB 2AGJH 3UTTD 5IHZB 1S5HA 1CPUA 4KTDL 4XNBA 1F4YL 4GIPD 1OSZA 4GY4A 3LH8A 2Y5TA 4D9LL 4LSVL 4DPBX 5TQ2L 4DP5X 5GISL 3MRNA 5KN5A 3HMXA 1VFMA 2A6JB 1A7OH 5T3XD 3IDGA 4OFQA 2E9IA 2V7HB 1EH9A 4B3EA 3ULUC 3SQBA 1EUTA 4C8XA 4WI7A 5IQOA 3VDAA 1TF4A 3WY2A 5G5DB 5DI8A 3EYSL 3FQTB 4F93B 2XN1A 2FYYB 3QI9C 3D51A 1I85A 2QQQA 5E8NB 2O6CA 4KTEL 4F37K 5HHOA 4NQTA 2AEWA 1XCTB 4W81A 1JXJA 1BGXH 1RZIA 5ICZA 2JTDA 1SQMA 5CN3A 2VDQH 2VL4A 4U7KA 5GRXG 1JDCA 4M5ZL 4EXPX 1BWMA 3H9SD 1M7IA 3L3OB 1BLIA 4WCYL 5JO5B 2N7AA 3E7JA 2A1WL 4EUPH 3PWJA 5IJVA 3FUMA 1UWFA 4GIAA 1NC2D 5FYJL 2GPZA 2C9QA 3TT1H 3MYJB 5IF0A 1ML0A 3FMGH 3O3DB 3CD4A 3W3BA 2WLZA 3CX5K 5HHVH 1HHIA 1FYTA 3E80A 4NJAH 1CFSB 2B0SL 2NTSP 3N2JA 4PJ8D 1ODUA 2H6UA 3M07A 4EQ3A 4PJXE 4QD2E 3TJEH 4P2AA 5FYLD 4EIUA 2ZUQB 2KDYA 2OTWB 4YQXH 2LV4A 3OL2A 1GC1L 3I3BA 4E9SA 4YLCA 3U6RB 4J39A 2WXOA 4H0HB 5DD5L 1JGLL 5FYKE 3LZLA 5JR1L 5DJ0B 3VXMB 3TFKD 1QX1A 3OPZL 1F97A 3IGKA 1QLFA 2BC4A 4M48H 3GSNA 4RFNB 3D0LB 3IVKB 2A74C 5DRZB 2A3TA 4K9EH 5JPNB 1I9RL 5LLIC 3VTTA 1Z1WA 2D4FA 3U82B 4KZEH 3CFCH 5T5FL 4I18B 2PYFB 4W9CC 3O6LL 3R7QA 2LU4A 5AVWB 3HUJB 1XFPA 5M94B 4O9HH 3IXAB 2WLJA 1GYVA 4ELMF 4RMQA 1C5BL 3V0JA 3BUDA 4H25B 2GTQA 1E3ZA 3O6FA 4XNUH 3KYKL 4QDGA 1I9RH 1IGFL 3GSRB 3T1WA 3APFA 3LNDA 1OGAD 3TBSB 5CILL 5MP6L 1DBJL 3VFOA 2B4CH 1FGVH 2EE0A 3HS0B 5CFAA 2FX7L 3LZOA 1C5BH 1M57B 3JV4B 5C86A 4EF3A 2UV3A 4OLUL 5KWYC 2H32B 1BP3B 4F1ZA 3RTQB 2VAJA 2IAMB 1XF3B 3VQMA 2PABA 3CSTA 1MFCL 1NFDF 1G7IA 2DF3A 1A6WH 3FU8A 3S34L 3UFIA 4FNPA 4MHHI 2WINA 1UM6H 4HS3A 1IBDA 4OF7A 4PJ5A 4XMKH 1KTLA 5DWUL 3QXAA 3T8MA 2VN3A 4F8NA 3MRGA 1MAMH 4V1DD 4N6RA 3BIKB 3ZY7A 4XNMB 2BY3A 3C8KB 3CFBB 1SXNA 2XIIA 4PJ9C 5FGSA 1UA6L 1UEMA 3ARZA 1RUPL 3K2MC 1RURH 5K9OA 1WG3A 2BNRB 2AK1H 4LL1A 3MV8D 2WQVA 5HHOB 4C55A 1MW2A 3ML9A 2K3TA 1PW3A 5TE4H 3RGVB 5A16A 5DC2A 2OP4L 3RTQD 1MVYA 3LYRA 3JBG7 4KRPD 2BO0A 4IMKA 1JFHA 5D7HA 4ZW8A 4ADIA 4EOWL 2HUEA 4KQ3L 2V9RA 2QGCA 4PG2C 5MENB 3L7EB 2EDRA 5HVHC 2LTQB 5CP3H 1NGXB 5E2WL 5K9QI 4AGOA 2D7TH 3MHZA 3OC8A 4MJ6B 4XBGA 3ARGC 1AS8A 3EOTH 2XN9A 3HNSL 3H0TB 1L3WA 5F1NB 2IDFA 1XSKA 3MQIA 2J44A 3LY6A 1DL7H 4X7DC 2BP5M 3S96A 3SGJC 1LNUB 1S7VB 3SGKC 4G7VH 1T04A 1UKTA 2NPLX 4ZUWA 2IANE 3T5WA 4QHNB 1T22A 2QVKA 3QCVH 4LBEB 1OOAA 2CM5A 4UU9A 3BZEA 5JHLL 3CCHA 1AS7A 1Z9SA 1BFOA 2WXJA 4DGIL 4CJ1A 5EZJB 4YHKL 3WU1A 4HQQL 1UGNA 3M45A 3ZMRA 4P9MH 2EEDA 4WW2A 2B20A 3R4DA 5T33H 1KPRB 4P99A 1QQDB 1RERA 5IFAH 1U91B 1A9EA 3JWOC 4RNRB 3HC4H 1BVKA 1K8IA 1S9WA 3NJFA 3HZVB 4WHTA 2G4EA 4WFGD 5EZIL 4JHVA 4XH2B 2PYFA 3K2UL 2H0JA 2YZ1A 4PGEA 3MJ9L 4JPVL 5IW3A 3IJ7A 5GRUL 2BIIA 4JO3L 4OIBA 4P3DB 2PWFA 5DMIL 1T21A 2TSAA 1VGKA 2G2RB 2VJ8A 4KNQA 5FOBA 2O72A 1DBKL 4QT5B 2EACA 4RLDA 3HB3B 2HX7A 3RWEB 3GIVB 2YGVA 3VFOB 4YHLL 3GMLA 3ZXAC 1BQHG 3IU4H 2EKSB 3NFPA 4BQBA 1LEIB 4HKXB 2PPFA 1J9TA 4N2KA 3EDKA 1EDYA 4JFPA 4FL4B 5IM7A 3A67L 4X7SH 4DWHA 1P5UA 1N8ZB 1D9KD 1Q9LA 5AZUA 3T0EE 4HMCA 4YL4A 1F45A 1B2WH 4XWOD 1BWWA 4MYWB 4B0MB 4CSPA 4WWNA 5ISZA 3MRGB 2WY3B 1OAJA 5IBLD 5DS8A 3MV7B 2DQJH 2V6HA 4RBPH 4Q9CA 2O6PA 3QZBA 3BPOC 4K5OA 4MJHA 4O2FA 4Y4FA 3TH3T 3TPUB 3ULAB 3EHBC 3VNZA 1YEKH 3CC5A 1A6UL 1XB6A 4F2MA 5FYKH 3CX5J 1QNZH 3VFTA 5EIIA 4XBPA 1MY5A 2X70A 4PV1C 4Y1AA 1AO7D 1N6QH 3F7VB 4S1RL 2FT7A 4LK4A 3RX7A 3WS3A 3ZMNA 2AZAA 2EE3A 4JFEB 5C71A 2X4PA 4M7ZC 5DYFA 3DIDA 5FYKL 4F27A 1U8OA 3TWYA 2K3HA 3FYIB 4TVPH 4MJ6A 4XBGB 3PQYD 1KYAA 4LSDA 4HHGA 4BZ1H 1GC1C 3IN2A 2DI9A 1PSKL 4J23A 3SE9L 3STLA 2IDUA 2C9SA 2IFFL 3U9WA 4DGWC 2UWEA 3PJLA 5KYUA 3CIQA 2VQ4A 5I74C 4WSKA 3GTVA 2QQKH 3PJSB 2GBAA 3SY6A 4HWBA 5JDSA 1VHPA 1W16A 5H37A 2EP6A 5B7FA 1DQQA 1TFPA 2E0PA 4IBTA 1Z2KA 3SPCA 4XI5D 2C3HA 2IPTH 5AOZA 5F9WB 3GSNL 2GUYA 4M03A 5TGBA 3TASA 4B6ZA 4CUCA 4LPWA 3O3UN 3BZEB 4KQ4H 1SDAB 4PRAA 2IFFH 3TO4A 2H1XA 4J3OC 2CCVA 3Q0HA 5D7IE 5C97A 1LE5B 2QQKL 2HKFL 4PRNA 3MLVH 4JZOA 1JV5A 3T0BA 5FFOA 3VXMD 5A2JH 3RFZB 4QYOA 1ZIBA 3L3KA 1J9QA 2PXYD 3DHJA 1A4KA 3DO4A 4KRMB 3O11B 4FFWC 3QIUC 5C09B 1IBZA 4PG9B 2WUBL 1RIHL 1Y7VA 2R4RL 5I9QC 2B39A 2VDKH 3O2DA 4XXDB 2WSDA 5F6IC 4AEIH 5IBUB 4IDJH 1U2YA 4DEPC 1KFAH 4JR9L 2ZOLB 4V2CB 3VD4A 4RH4A 2Y36H 5E0QA 4OKDA 3WXWH 4XN8A 4ZS6C 2BZCA 3O8XC 1PEZA 2CZNA 2F54A 3BE1L 1KTBA 3IKKA 3MRCB 3N1GC 3GIVA 3PWPE 4HUUB 4JG9A 4K3JL 3VXOB 3RPKA 4A7GF 3ARDD 3LXBA 5BJTB 3MRHA 5JZ7D 2GJRA 2HPOA 2HRPH 1CT8B 2Z65C 3QG7L 5AQ0A 3TIEA 1RHFA 3QEHB 5DZAA 4ZT1A 1GPOH 3GS4A 5BRZA 1AGBA 1KJ2B 2Z92B 4NQSA 2B7DT 5C07D 4G83A 1QFWH 4E9WA 3DETD 4ZW5A 2A7BA 3A21A 2CHWA 2J1YA 2PYED 1QD0A 2V2TB 2WXKA 2XG4A 1QBMH 2OMWB 3QUMH 2K4WA 5I5RA 4F8QA 3F04A 4JZJA 2MQGA 1IX2A 3J2PA 4M7LH 4OFYD 1KN4H 1X9RA 5AL0A 1FFQA 1GCFA 1LJMA 4R7NB 4XPAH 3K4DA 3VB9A 1MRCH 3PHOB 3GXNA 4YFLI 3DKHA 3QORB 2E7MA 2P1YA 5KVFL 5EO9A 1SHSA 3HR5A 4AMKL 2ZXQA 4I0PC 1T1YB 4Y1AB 2RHEA 4GW5B 2NCEA 5E99H 4M29A 4WI9A 1JZ6A 1A9BA 2BY2A 2CD0A 3PS6A 2AI0H 2P43B 2GBUA 3RVTD 1H5BC 2AJXH 4DT2A 3QAZC 1OSPH 1IGCH 2XQYA 1JFQL 4LGRB 3GWJA 3MXWH 5F7BA 2VM9A 5D7JD 3BZDA 4P9HC 1P1ZB 1U95A 1V3LA 2YHGA 4NERA 5E99L 2EUXA 3D7PA 4NWUH 3ZN6A 4AL8C 2OXGB 4YIQA 2R2BB 3EH2A 1TQBB 5F7KC 5K5YA 3LIZL 1WIUA 1DDTA 3CE1A 1COBA 1EFXD 1OM3H 1A1OA 3KL5A 1RUAL 1BD2A 2VLRE 1E5ZA 4EPSA 3F7YA 1M6OA 3DMMD 1I7TA 3DIFA 1JV2A 2DBLL 3F7QA 4XOEA 5SX4I 5FDWB 1Q9WA 5D1ZI 1UCTA 3FO9A 1GSMA 3CFDB 4J3XA 3RDTD 3I9PA 12E8H 1MOEA 3LHPL 1A25A 5L88L 1L7IH 5MENE 4PS8A 1B4JH 3VSVA 3CC1A 4FQCL 2CBPA 1OM3L 3TV8A 5IHHA 2BSTA 4N0FB 1LD9A 4JDEB 3LQAL 5J13C 1QP1A 1MHHB 3DSNB 5I1IH 1NCDL 3NSJA 4AQ8A 1KYFA 1ULVA 3CVIL 3PIQB 5I8EB 2ITDB 3NJHA 4XXDA 2I9TA 1TKWB 4JPIA 2ALWA 2DQIH 2O30A 5IFJA 3C12A 4MX7B 4PJ5D 1G9MC 5F9JA 5JORA 3RY6A 1GTNA 3BIBX 4X4YB 5DJCB 3FQRB 1W72H 3NJJA 1SVBA 5I1CL 4RFEB 3Q06A 1G6VK 1UOVA 2H1PH 4RWYL 3EGSB 4XMWA 4V11A 2XTJD 4CSSA 3ECVA 4L8SC 2FLRT 2YD8A 3S5YA 1OGTA 2XPYA 4UOQA 3LQZA 1NLBL 5L0QB 1BJ1J 3GMNB 1YECL 3BSZH 3HS9A 3PQYB 4XC3L 3MRRB 1ONQA 4EBQH 2QPDB 2Y24A 1CZ8H 3KVDD 2YPKA 8FABA 1OK8A 5GGQL 3TEZA 1ZEAH 2XPZA 5EU6A 4AG4L 3FT4B 1TJHH 2BHZA 3L2MA 4IRJD 4UZGA 5ACMA 1CCZA 1FAKT 2RCSH 2VDMH 3PHOA 3KZ8A 2NSQA 1U0QA 1BBDH 1WC7A 4RQQA 2A38A 5F7LB 1JYVA 1T7XA 1KSRA 3IMRA 3P4NA 4HCRH 4QNPE 4HKBB 5LNDA 1RSYA 2R7EA 3KPMB 1J1XL 5DJYA 4RSYA 3TPKA 3L5JA 2VXSL 5LQBL 1AGCA 3VRJA 2RCSL 5BW7A 3CN4A 1TMQA 2Y6SC 1NBYA 4FLSA 3LN5A 3E38A 4GRWB 5KSBA 3HZMB 5F89A 5FDYA 1PZUB 2W0PA 3SPIA 4YFLF 4CADA 3OWRA 1OE3A 5EC2B 5E6UB 5GS2H 3HE7C 1TYJA 3QH3B 5EHFA 2FEJA 3VD2A 3P1VA 1LO5B 3QQ9D 4AYEC 4HGWA 3PWJB 1JSYA 2D31B 5DS2A 1KBKA 4E9QA 3BN3B 3WGVB 4NO5A 5D2LE 1DJSA 4NCDA 5CBAB 4TTDC 1ZJBA 1UFUA 1X6LA 1YJDL 4P05A 4RGMB 4YX2H 1WBYB 1KDJA 4YDKL 1BZ7A 4KDWA 4CMMA 4XHQA 4NQXB 2RH0A 3H7BA 1IAKB 4D0DB 1UWYA 1IQWH 1C16A 3DX8A 1UWXH 2WVTA 3OM3B 2XVKA 2ZG2A 1GTFA 1CQKA 3W9EA 1JWMA 4ODSL 5AYQA 4BIKA 1J5DA 1MCKA 3CVHB 1Q1JL 4XPTH 4PTTA 3TS8A 4YDKH 3S88H 4JDEA 5T3XL 1SY6A 2XVBA 5G4NA 2EVFA 4GXFA 3U7AA 4RMSA 2R69L 2UZIH 2YD0A 4UB0L 2Y1ZA 5D96C 4GG6B 1CIUA 3P30L 4ZAKA 5GS1C 5CBEA 4FA7B 3MUUA 1B2YA 4N90D 4X99A 3SBWC 4JY5H 4MRCA 5ANMB 1B3JA 2Z7ZA 1E7VA 5J12B 4ZUVA 1DO5A 3HHRB 1WISA 2NY4C 1QI4A 3MRNB 4U1HB 4JN2B 5AG9A 3IWUA 4KVNH 2VITB 1SBSL 5DHVA 1GOGA 2VDOB 1CFQA 4HLZG 3T4AB 4EEEA 5EF2A 1IL1B 1NDMA 2F53D 1DBMH 1TYRA 4G59C 4KY1L 5DI8B 5FGBA 3NIGB 4DGUA 1QFWI 2QSTA 1M7IB 4OD2B 2YD6A 3GMQB 3HHMA 3BKMH 3D8MA 3N42F 5E8EB 1JGEB 4JPKL 2B1OA 2QKSA 2JJSC 2M2DA 4PBDA 4X9YA 5DA0B 3RVVC 2YPKB 1XZ0B 1E4XI 4H8WC 1UJTA 2PPCA 1KBPA 1NGQL 3MYJA 2GJ6A 1BAWA 2F8IA 3QQ9C 1H3WM 5E6SB 2CR6A 1DEDA 4H0IA 3U2SB 1GGUA 4XN2A 1JN6A 4OJEH 4X8CA 2MPVA 5A6IA 1IFRA 4HXBL 4HALA 2PCPB 4FXTA 4LSTL 4Q56A 3GB7B 3SYAA 4Z3EA 2JTYA 4NN6C 1T2QH 3K5RA 3WTWA 1UFGA 4RETB 2WLYA 1RY7B 4A55A 4QXUH 1RV6X 1RUKH 3EFDL 3N04A 4Y7MA 4UBDC 3LKOB 3ABGA 1D5IL 2CRYA 3ARDB 3GSNB 3LPPA 3QCUL 4K07A 1WFNA 1WFIA 4FQIH 5BS0A 4PJGB 1W91A 5BZDB 2PUQT 4KDVA 2MFNA 4JM2F 2IBGA 4POZD 4YSSA 1OWRM 4NXKA 3VACA 4ICWA 1RU9H 1YNTF 3RWJA 4PGZA 4IBWA 1H8LA 1MWAH 3CDFA 1MF2L 1G0DA 5E2TL 3KG5A 1XIWD 2NY3C 4TUUA 3IXAA 4X5XB 1CK0H 4UQ9A 2DQMA 3QFJA 2AXGB 3DJTA 3EGDA 3FKUS 4QF1A 2Q5BA 2JI3A 4BXSV 1AIFA 1WBYA 1JRHL 5IHUL 2WQUA 4Q8BA 1HHKA 1NUDA 2ZOOA 4K2UL 3WD5L 2GSGA 1LNUA 1S7VA 3TYGL 2P24A 3GC3A 1Z5LB 3KLDA 1ZV5A 3MBWB 1UACH 1FSKC 2XXFA 3BN9D 3JTSA 4M4RB 1F4WL 1S6NA 4OZGE 1LP9B 3GFUA 3VFGH 4PEEA 3IJSB 3TNNA 4YK4C 4HS8H 2CWRA 4JMXA 3VW3H 3CCHB 4H44C 2IBBA 4LHUB 5HDOA 2EXYC 1FF5A 4O02B 4HETA 2MHAA 4QLWA 2RQEA 5EB9A 3MUHL 4MTMA 5ILTL 5DVLA 3IJYB 4QRFA 3BUIA 4JM2C 2BJMH 2F19L 2NZ1A 1BQKA 5AOJA 1TPXC 1T1WA 3NACL 5FGCE 2WINB 1BFTA 2ROXA 2Y9RT 3E3QC 3SZKC 5KVEH 4HS3B 3RI5K 1NAMH 4YC2B 5FYJU 5KSUA 1NDMB 4R3SA 1NBVL 5SWZA 1MZZA 2OJEB 4M5ZH 1SF5A 4UQ3A 2K0RA 5BRQA 5DS1A 4OD2A 4B53A 1JZ4A 2A1WH 3NFSL 1F6LL 2B59B 3B9AA 4X9IA 4XMVA 2Q3ZA 1GAFH 1Y6MR 4Z7UA 2B8OT 2CDEB 4GKZA 3S3DB 1NINA 4BFKA 1E4XL 2EICA 2FQEA 4QY8B 3UL4A 2Q8AH 1U21A 2FLBT 2J2ZA 2IXQA 2JKTM 2GJPA 4FTVD 3FMGL 4WGWB 4RMVA 2OTUB 3LPGA 4XOBA 1HHGA 3FQNB 3IJEA 4I4WA 4PGBA 5DLML 2WZPA 5CJQL 4HF5L 3LRSA 3PHQA 5JUEL 1Y1UA 1A64A 3GLDA 5H2BA 1FFOB 1FFNB 2W0LA 4M7KL 5T1LA 3EJUA 1J8HD 1X5JA 2DKUA 4ZXBD 1YJDC 2A73A 1U8MA 2HKHH 5EBMB 4BYHA 4WGKA 3KYOB 2P45B 3MV7A 3LKPA 5F1NA 4GQRA 4LEBA 1B3IA 1WTLA 4J3OF 3ERXA 3X3GH 4DH2A 3WTVA 2JB5L 3SHSA 3UZEA 2H2PC 3C2SA 2MJWA 1NFAA 1OSYA 4PM1A 4TNEA 1PG7L 3E9TA 5I2IA 3V4PH 4OCLC 1ED3A 2VLJD 3KAAA 1JL8A 1RK0A 2EH7L 3BC9A 3PABB 3PJNA 2YOAA 3QXTA 4OGYH 2Q8BL 4PR5A 1UH2A 4MJJA 2X0WA 4NRZA 5T5FH 2GTWA 2YUZA 3OHXA 5IMOB 3NCYP 2WXMA 4D0CB 4B27A 4ZSOE 3NZ8A 3V2AR 4P3DA 4G42B 4Z0BH 3CZJA 1NPJA 3HI5H 4YQXL 2OMYA 5FOBB 4YUEH 2KYIA 4EN3C 3HJEA 5JA9A 1EZLA 4NZFA 3BKYH 2Y0SA 4RA3A 4EI6B 1AGFA 2GITA 3IYLW 4R7VA 3RVUD 1DVXA 1B88A 4ZO7A 4B95C 1WA2X 4M5YH 3EOYG 5C70A 1YG9A 4OV5B 1PGRB 1JYXA 4FNSA 2NY5H 3QO1A 1J5OL 1G7QA 1HQ4A 4AVJA 1VIWA 5E4OA 3VFRA 2FO1A 3FU7B 1CF1A 1NCCL 4NGHH 5IVXA 1DFBL 3DBSA 2XZZA 4PJEF 5ES4B 4ENZA 1NFIB 1QSFA 5LN4A 4XWGL 4NUGH 3AFLA 1Z0NA 5D7SL 1QAWA 4BBWA 3RPIB 2DN7A 3QZLA 1UQSA 3MPCA 4ZRGA 1BVLA 3BSGA 3CWGA 4MXQD 1HYRC 1T20A 1CDUA 2KC0A 2W9EH 5TE4L 1BYNA 1X9UA 1F3JB 1CFNA 3BD5A 1OAYH 1YQVL 3SQBB 1E9QA 4KITB 1QLRB 5C0CE 2UZYA 5K69A 1I8LA 5FYKD 3DDFA 4MAUH 3HBZA 1N26A 4KQ3H 4RAVB 4R5XA 4DVBA 1U3JA 4DK5A 2QLYA 2WLIA 5ECGA 2X4PB 2NY1D 1ZK9A 3J07A 2PW2B 5DC9B 1DDHB 5BJTA 5D7IA 1DE4A 2R1YB 2X0VA 4YDMA 1KUMA 3N1MC 1FL5B 3WKMH 4GW1B 1G9ML 2DIJA 5BRZB 2G3ZA 1FVDB 3KPRA 5B38B 2FD6L 3LRSB 1NOLA 1MCSA 1JZHA 4G8GA 3BKCH 2LLGA 4NLHA 1J86A 3H6JA 5HDBF 2C8NA 1IO4C 2VISB 4KMQA 1HZHL 3GDCA 3QHZL 5CINL 1L9OA 2VLKA 2XV0A 2OCCB 3NRFA 3WFHA 3GHBL 4K4KA 5E9DA 4C56B 3CU7A 4EUPB 2OYPA 2N0KA 3SDYL 4NIKB 1GGCH 1F8TL 1HXYA 3A3YB 4OCYL 1FZOA 4J12A 2MCPL 5HBBA 4R6UA 2AXFB 5JLZB 5GHWH 3QEGL 1A4KB 4M4PA 2EYSB 5DEGA 1A9BB 3D3VA 4DESA 1GVIA 1LHZA 3EW3B 4ZMNA 2IDCA 4JKNA 5JHBA 4UT9L 1ZLVK 4LLMA 4JPVH 2VR3A 4JCWA 2VDPL 3DTXB 1CE1H 2ZTBA 2KDGA 4KXCA 1GHFH 4AZ8A 5JPNA 5LG6A 3IAPA 4APQB 1MREH 1SJHA 3N1QC 4LQFL 2HZHA 2YEZA 4DPRA 1KTRL 2FHBA 3TF7C 2F54B 2R1XA 4TNWF 1JHTA 3DX9B 4Z7IA 3IU4L 4UAHA 3GLZA 2YA2A 3PDGA 3ECBB 4CKVX 5E1GA 5GS0D 3BGMB 1R3JB 4Y0GA 3P4MA 3O41B 1KB5L 1Q0XL 3GO1H 4PJ8A 2IOMA 1KXTB 2WSPA 3UTZA 2H47C 3W56A 1AKPA 1J0IA 4M6MH 2FECI 2BERA 5J0BA 3MJ9H 4QRRD 3JWNC 1GOHA 3WO4C 2XTJC 2E7CA 5IVXB 3TESA 3LB6D 3PUUA 3NH7L 4Y2OB 3FPXA 2YGPA 2CGZA 3OR7B 1QBBA 4QHKI 1NQBA 3BN9C 1KJ2A 4BRVA 1FO0A 3SPVB 2XBZA 4P04A 4M8QB 2BH0A 1M2OA 4JE0A 1HNFA 1MHHA 4Q0XH 1M2VB 2BS9A 1A6UH 3ILPB 3LEXA 5E1AB 5F6HJ 3QISA 4AWJC 3BWUC 3LH2H 4WU5A 5D1QB 3S36L 4H1LB 4AE1A 4CVZB 2FZ3A 3ZTNL 5FIEA 2EDJA 4DUWA 4KK8D 1MFAH 1WAAA 4WI6A 3B7TA 4NQVA 1CU4L 3EGSA 1BG9A 4ZXBA 1RVFL 2R1YA 4HA1A 1AZNA 4WTWA 4XMXA 4L3EB 2GI7A 2FX9H 2XWDA 5HHQB 1KYDA 3CXDH 1SEBB 1H3UA 4JKPL 1TEFA 1OLZA 1ZLEA 4HWNA 3WFDL 4FCAA 3B2VL 4DP0X 2C3VA 4D2NA 2AQTA 4I0PB 4W9FC 5ICXB 2N59A 3EOAB 3CGTA 5DU7A 3TF4A 4QI3A 1PQZB 4FD0A 3AXIA 2YR3A 5EU6B 2YSSA 1E9OA 4LKXA 4UMSA 4KO5A 1VF5C 2H6PB 4UIKH 4E41A 1QTPA 4UTCA 2R2CA 3FTVA 5J9PA 3N5AA 4HKBA 4IMLA 4WEBL 1KWKA 2AZUA 1SXCA 2X4UB 1XR8A 4N2CA 4QAWA 3RUGB 4MAZA 5FS5A 1I7TB 1E43A 1EHAA 2H4EA 2RBLA 3EADA 4D9LH 2WUBH 3G9VA 3BAIA 1OF2A 4OGAD 4CMHB 5EC1A 4QO1B 3FQWB 4Y2LA 4ZSOB 1WK0A 1MQKH 1AG6A 2NT1A 5DJ8B 3R4RA 1KIUA 5LCVH 2W92A 5BV7C 1UVQA 1HHJA 3QUXD 4BE5A 3MCG1 3C87A 3LVTA 2FL5B 2WBXA 1JF5A 4J3UA 2ICCA 2IPKB 4AGPA 5JQ6L 3HAEB 2YEZB 3FQUB 3HOGA 1S9WB 1HZLA 4ADGA 5G4OA 2IOIA 1EXUB 1AJ7L 1OLLA 3HMWL 1MI5D 4HIXL 1HCYA 1QRNE 4HOMA 1E27B 1G6RH 4D0BA 4KNUA 5LCVL 1P5VA 1I4FA 4YBHA 2DBJA 1AO7E 4XVUC 5C6TH 5DMGD 1NCOA 4PB0H 5EA0L 5I1DB 3LJ3A 3DUUA 3FQRA 5KVDL 1I3GH 3ZL1A 1SN5A 5GGRA 2NNAB 5MERB 1BFVL 1A6TB 1ZSDB 4OLXH 5D2NE 5EF3A 3OXRB 3WEBA 1LQSR 4AEIL 3V52L 3OR7A 1YEEH 1JNHA 2DPKA 4ZOAA 2DL9A 1C7SA 3N42B 4PD4J 5D5MA 2YJLA 4XCEA 3UC0L 1F11B 1B0RB 3BJ91 1CC3A 5DFWH 1PJ9A 3G6JE 4RVBA 3WUZA 2JF1A 1JVKA 4P4KD 2VM3A 3GLAA 3VG0L 4QXGL 2AXHA 4H1LA 3WTSA 3LXUX 4TLKA 2EC9U 3VRJB 4U3XA 2O5XH 1AYOA 1NBYB 2ALAA 3SDXA 2D8KA 5JR1H 4R4ND 4HD9A 5D7LE 4WV1B 3ZYIA 2E46A 3ZMEA 5INCB 3OV6A 2R7EB 1AE6H 4XXCA 3LNIA 4U3HA 3AG3B 4K94C 4RAHA 4NOFA 1NDTA 4UTBH 1E4JA 1HSAB 1AGCB 4DVRH 4NLAA 1CDJA 1CTMA 3BDXA 3TLRA 3IDJB 3H54A 3OKEA 3PRZA 4PLOB 2XV3A 2ZPKL 5TJWK 4Y4KA 3BPLC 3DTUB 1CLZL 2V7NA 4S2SB 4EI5C 4KMTH 4QRSB 3SKOB 3VXNB 5MEQB 5B7EA 3DO7B 1KTDB 1WS7A 2C3GA 1KULA 4XNYL 1V27A 4ALAC 3VCLB 2B3RA 4A6YB 4QRAA 3N06B 2H5UA 2QQLL 1J5CA 3V6ZB 2R1WB 3FF8A 5T3ZD 2ZCKL 3O4LB 4HLZH 1NIBA 3VFMB 3BQUC 4YS4A 5KG9A 4DKFH 1VFUA 3CV5A 4RDBA 4NWUL 5JIPA 2V5SA 1UB5A 3I9GL 4G6KL 3NJIA 4G8FB 2WANA 3MNDA 5LO7A 2F1AA 2EIZA 3NCYS 3S34H 1Y18B 3L4TA 3QEQD 4KX9A 4HSCX 3ARDA 5KANG 3AB0B 2BOCA 4NSKB 5F3HA 1KIPA 2BVTA 4HAKA 5C0AB 3D12B 4U1KB 4ATWA 1EBPA 4QAMB 5LNEA 5DD1L 5DK2A 3BKJH 2AQNA 2DBLH 1CFTB 2BNQB 3KPOB 4AI7A 1GIGH 3AUWB 3ROOB 3LKSB 1EX0A 3B1UA 5CHNA 4A7SA 4JN1H 3NMEA 1JF1B 3O45A 4I85A 4MNGE 1D7CA 1I4FB 5D6DC 5A7EA 2CJTA 3LIUA 4OW6A 5I1DA 3ELQA 3FONA 2XWEA 2P52A 3C5XA 3INUL 5E8EA 4FFZH 1X5KA 1DQLH 4P5TC 1CZ8L 2CJUL 1A6TA 1U8CA 2OKMA 1S7SB 2Z8WC 4BH7A 2VDNH 3TZVC 5T8IA 2Y1VA 4ODVL 4LFHG 3D69B 3GMQA 3HG1B 1JG9A 4JQXC 1MCWM 4JFDB 4Z0XB 5ID1A 2BMKB 2K6WA 1CDYA 1AKJA 2NNFA 1EJFA 4ZDHB 3BSHA 2YPVA 2QADC 2ZYHA 3BZ4B 4JLRA 3G6JF 1KJ2H 3WHE0 5JHMA 4EKXA 4IKNA 1I8UA 2QKIB 4QXTA 4BELD 2P7TB 1FLRL 1FE8H 3O8XD 2R56L 1AC0A 1CFVH 2DWDB 1KLUA 1U93B 3MRJA 3NK4A 3HFFA 1DCLA 5KZCD 4MNHB 3T0DA 2R23A 2HJKA 3JV0A 5BS0B 1ZGLB 2Z91A 1U8HA 4XXWA 3V4VH 5D93C 2P8MA 2V2XA 4LVHB 4YSDA 4PWFA 3OZ9L 4MMYA 2Q86B 3VD0A 5L2KE 2EABA 1X9LA 2O93L 4KJYB 3Q6GH 2C7UA 4ZUTA 1QASA 2ZXAA 4M1DL 5B1JC 5E94A 5ICZB 1TJXA 4P9HL 5IB5B 1D5ZB 4TQHA 2PP9A 2X88A 4EKJA 2PYEA 3BPNB 4MB4A 1CXFA 1S7XA 4YNYA 2FT6A 3P3YA 4FULA 5LBVA 3L3DB 2DYRB 1KB3A 3HE6A 3CDCA 3D39E 1TJGH 1N8OE 3BZFB 4P9HH 4OBRA 5DXWA 1T2JA 1QPPA 2FO4B 4I8DA 4NO0A 1OARH 1ADQL 1HHKB 4Z76B 3N91A 1M05A 2GHZA 3V0FA 1XGYH 4EZMA 5FDWA 1J48A 4X4KA 4UT6A 1L5GA 5E2VL 4L4VA 3V5HB 4O02A 4PVMA 3P30H 5KVDE 3LX9A 4KV5F 4YHIB 3A22A 2JJSA 3EDEA 2QZQA 3LPFA 3IJHA 43C9A 3UYPB 1HQRA 1JGIA 1ED3B 3HI6L 5DDHA 1LD9B 2CIIB 2A77L 4KX7A 5AOIA 1SN0A 2VMCA 1ZVYA 2APXA 3F5WB 2AEOA 2XVLA 1GYCA 2ADIA 4ZBJA 5B39G 4WUKL 3I75B 1ITCA 5FUZL 2GABA 5E95B 4C4KT 2OMUA 1JK8B 4ETQA 4JPWL 4X4YA 2XWBA 2ZUUA 5HI4C 4OLWL 2A9BA 5HVFB 5FHBL 4OUUB 1T1WB 3WMSA 4MD4B 3CQFA 4LCYB 5F2FA 5JHAA 3TN0B 2WQAA 4KKAC 2QSCH 3FUDA 3QUGA 4LU5H 5F7EL 5LGJB 4GAGL 5BUPA 5ID0B 3UO8B 4JPSA 3HG0A 1H15B 2LT9A 4RFNC 3LV3A 1HHGB 1G7QB 2D03H 3K6IA 1KCUL 4ESKA 1U33A 5FHBH 1IBGL 4Q6IB 3GTTA 3ASNB 2CKBA 3L8QA 1TR7A 2BIMA 3QNXB 1T7ZA 2R29H 5FYKU 1JGUL 3QDAA 1R0AL 2A83B 3Q6FB 3HS0C 3G7TA 3K1KC 2QADB 4R8WH 1WQVT 2K8QA 3ECWA 1BBJA 2ORBH 4P23B 4X0NA 4Z7VE 5I76A 1TIUA 2R8SL 1WIPA 5JIHA 4D9RE 2OL3A 3G5ZB 1MWAB 2DB8A 4L4VE 4OAWA 4Z78B 3WFZA 4FQIL 4PJ5B 4C47A 3EDJA 4PJFF 1ZS8A 1QLRA 2LAGB 1M42A 4GSXA 4JRYB 5CIPH 4N25A 1MDAA 2ZICA 5MEOA 2JJVA 5HDBB 1WT5C 2R8SH 5GS1B 1T5WB 1FDLH 1YPZE 3GZKA 2X4RB 2LFGA 2BC4B 1DDHA 4LPUA 5FW6A 4ZUTB 3MVSA 4E9YA 1JYNA 1LM8V 3WDIA 1S9VB 3MUGB 1MPAL 4BFBD 4A6YL 2BNRD 2NY5C 3QSKB 2XPGA 4WHDA 4LRNH 4GRWH 1FZMB 2YUXA 3L1GA 2EEXA 3L4ZA 4U0RC 4ZPVA 3TBTA 5IMOA 5I75B 2XYBA 4U2YA 2D0FA 3L7EA 4XVTL 2IGFH 1X5AA 1HK6A 2VT0A 5J3HD 5CBAA 2WYIA 4JFYB 4H8WH 1K8DA 3QXDA 1TEYA 2H0PA 4XVJH 4CN4A 1ANUA 4R0LB 3VW3L 4OGXH 2F61A 5IMKB 2VWEE 1KXHA 4PBVC 2F1EA 4KUZH 1E8WA 4N22A 4X50A 4XZ4A 1MVFA 2JB6A 5EU5B 2CDFA 3QUML 1RZPA 1C8QA 1YEIL 4FQXB 1AY1L 3GIZH 4MBRA 3QNZB 4PTTB 3UP1A 5CXPA 4L37B 4H0GA 4LZKA 4V2BA 4F1SA 4UNVA 1ZV2A 3D3VB 4BGDA 1BMGA 2JH2A 1IT9H 1VACA 2AKRB 2KLRA 3GMRA 4TPRH 2B5IC 1KWGA 4Q74A 1UQSB 1YMME 2J71A 1VB9A 3PWUA 3HLAB 2OL3L 1H8NA 1KIRB 3LKQB 1NBVH 2BIHA 4G6FD 4Z3GA 3MREA 1JK8A 4ETQB 1E8XA 5J11B 3F01A 4OQTA 2WQ8A 3D2UA 5IJKA 1Q0YL 1OO2A 1JPGA 4XP9H 3QQ3B 3BXNA 3EDDA 4YE4H 3FTSA 2ZAIA 2W5PA 1JHTB 2NXZD 4WQOA 5DK0B 4LIQH 1T20B 4QHMA 4LDCA 3I9IA 4S1QL 4MCNA 4JKWA 2Q0ZX 1YDPA 1BQHB 1T21B 2EZ0C 2FJGA 4HSQA 2UZYB 1CVSC 5DLMH 1UZ6E 5IESL 4U1LB 3ZSTA 2B16A 2BHUA 4G8GB 1ZDQA 1YC8A 4B9PA 4NRYB 3X12B 1K4DA 1KYUA 4PGDA 5K39B 4HVBA 5I1HH 2Z93A 4PJFB 3VXQA 1CTNA 3AQXA 3BWZA 3HB3C 4NHCL 4HWEH 5L4FA 4PVLA 1FL5A 2MKWA 3LKNB 3BLPX 4U3CA 2VZTA 2OAAA 3MROB 1G9HA 1YYLL 4KJWC 5E9DB 4C56A 3H0TA 3RB5A 2ICWA 4ZW6A 2NOYA 1F3DJ 2DEYX 1YEHL 3DSFL 1M71B 4P4KB 3QRFM 4N8CH 1N0XH 3DBXA 3I6KB 4L8SB 3T71A 2J6EH 2FBOJ 4HK0A 2UZXB 3GSWA 2ZYSA 3EJCA 4TSCL 4PJXB 5DVPA 3WFHB 3ZKNC 1SPDA 1TTFA 5C08B 2OQJB 1IGMH 4P8QA 5CJQH 3MLRH 2R0ZL 5CKGA 3GMMA 3IMSA 2G75B 2VR7A 4X6DE 2FB4L 3SY0B 4BH8A 4PUBL 4HS6B 4HJJH 1PNDA 4XGZA 1HE7A 4RZCB 4LSPL 3O2WL 2P5EE 2IADB 4TUJB 4F2ME 4H26A 3R0MA 3AM8A 4ZMWA 3AITA 1ZVSA 5BQ7B 5IHBA 4I0PA 1ETA1 1XF5B 2FQDA 3O0RH 1TCRA 3UOAB 3TONA 1MCEA 3KM1A 1L9RA 4B9KC 5ADOL 4BFRA 1CFBA 1I1AC 2EADA 4MQTB 1WCQA 3FFDA 1UUSA 2BW4A 4OY9A 4QOKA 2G0KA 5GS0H 3T0EA 5C8JA 1FG9C 4KTEH 2W9DH 3GTNA 5AW2B 4AJ0A 4G9FA 5C9JA 3O0RL 4YXLH 3HZYA 1S7WA 1T0MA 4F58H 1U8KA 2ZXEB 1XWVA 4IMLB 4KK9D 3CTTA 5MI0C 2VKWA 5TGBB 5SWZD 5IM7B 3FL7A 4UV4L 5C2UB 4J4PC 1QFOA 4U1GC 1GY1A 3DETC 4YDVB 3AADB 3BKYL 4XVUD 3OD3A 3GK8H 1VZHA 2QV2A 3RDJA 1S7RA 5CEYB 4BKSC 3GBNH 1AO7B 3IFNL 5EBLB 3FUEA 1I9JH 2V0AA 2W0FA 4XPBL 4ANVA 2LR4A 4JY4B 5E8PA 3MLPA 4FTVA 3MLTB 3ULVH 2B1HL 4CVZA 1T80A 4F80A 2L7QA 4ZS6D 2YMXL 3BT2L 3V5DB 1ZRUA 1RZJC 4NO2B 1FSKB 2FIRT 5HHXL 4D7BA 2DQHH 4G1EB 5KSUB 2AK4B 4JRLA 4ELKA 4HFUH 2DLGA 1J8HA 5JHLA 3E2HC 1EHXA 4HU2A 3WS3B 1V5JA 2ZP0T 2CO7B 2Q20A 5INDB 4JRXD 1RZGA 4UDUA 1U8OB 2ZF9A 3BJLA 4TULL 1CT8A 1R75A 1C9SA 2IXQB 4P2OB 5EO0A 1VFBB 3MA9L 3ISRA 3Q5YA 3MRMA 3ORJA 2JSFA 4PJ8C 5JXAL 1UA6H 1OW0A 2ZZUT 1VRSA 1DLHB 4JQIH 2E6PA 2AK1L 3OKLA 3U46B 2CKBH 3B7UX 1GGCL 1LP9E 5F7UA 1HCFX 1CBVH 4U33A 3ARQA 2E27L 3ME0B 1X4XA 2RFXB 3WBDA 3C5ZA 4QNPF 1I8AA 2E7BA 2D7PA 4KKLD 3RY4A 1ZHBB 4GQ9L 3VD3A 5KTEL 5DLLA 5FLUA 5E0FA 1KXVA 3X11B 4AQ1B 1R5IB 1OF2B 3F6IA 4P0DA 2B4CC 2QVTA 5CGTA 5DHYB 2WN2A 4K55A 2X9WA 1ZTXE 3D07A 1FH5L 3KH4A 2D0HA 3FTYA 1II4E 4PRIE 1ORSB 2QVFB 4MB5A 2ATKA 2F7PA 4EDWH 3CDGB 5CD3B 1C5CH 3Q05A 1RJCA 1A7QL 4J8RA 4MMXA 1KEGL 2VJXA 5SX5H 4HIIB 1OT2A 4JX0A 4FG0A 2AJZB 2LVCA 3JT0A 3L4XA 3ZT7A 3AVEA 1A14L 1MI5B 3HBPA 3L4CA 3CVDA 4XMKL 5DWUH 3KH3A 1O0VA 4GLRH 5AYUH 2NXZC 2ZOLA 3MV7E 3VXNA 4EDWL 4V1DA 3PAVA 4YZFF 2Q76A 1WUNT 4XX5A 3FU9A 3ZJAA 1RURL 3ZUCA 2X4TA 1KEGH 4NP4H 5EEYA 2EE6A 5F8QC 3GGWB 2P26A 2WAQA 3BFQG 3FN9A 1AQ8A 5EEZA 2VUYA 1TTBA 5IKCB 3IFOB 1CE1L 5IJKC 3WFEH 1GS8A 4WU7A 3EXLA 3HNTH 3V6ZA 1U30A 1I7ZB 3Q9QA 5I6KA 2EDMA 2OZ4H 1CLOH 5CF3A 3UTOA 5DJAB 2YD3A 5I23A 1BQSA 1HTYA 4QTIH 1DEEB 4JFED 4A39A 1JPFA 4HXBH 4H13C 3VGDA 3VXPA 4MJ5B 5AW6B 4AVKA 3BP6B 1DVFD 1XZWA 2Y7QB 3SPGA 4JDTH 3FRPG 3QIUB 3MRLB 1LO2L 4AQOA 4NO2A 3BWSA 5EO9B 4R5TA 4AYGA 1CU4H 3NZHH 5I8EA 1NFDA 4Q2ZA 4V33A 1ZLWK 4H4NA 4NN7C 5F9JB 4PCYA 1KJMB 1QW8A 1RPKA 2Q9OA 3SDXB 3TA4D 3ZE2E 2OR9H 2Z9TA 4XODA 3BWAB 3CSPA 3TX4A 1NCNA 1JMXA 4TQ8A 4UYQA 1DSYA 3KWWB 3DVGB 3PGDA 5GGRY 2KQNA 2UUDH 4EZJA 3QUXC 3UADA 5IB4A 5HYEA 3T77B 4WO0A 5JNYB 3IGAA 4WFGE 4MS6A 1OF0A 2JKWA 4FL4C 5GSRA 4JFZL 5LAXA 4NQEE 2XLLA 4MD5A 4HJGB 3QZPA 1AFVL 2WCGA 3I3DA 4RMBA 3EOBA 1ZCRA 1MJUH 1F1GA 5F6HI 5IJVB 1M1XB 3DOSB 3NJLA 3CX2A 5DQJA 1S9YB 1I3UA 3KEHA 3K74B 4PJ7E 3P77B 1ZHBA 3O4LA 1XGQA 2CBOA 4JKPH 4MJIA 1UM5H 2DKSA 5IB2B 4F3FB 3CFTA 4JL2A 4CSTA 3C5ZC 3MRJB 4TMPA 3S2AA 3P4NB 3P4LA 1NBCA 2WAHA 2ZQKA 2IH8A 4JJ5B 4ERSL 4YHYC 2ADJA 4AENA 2IANB 4JFTA 1MFEH 3X3FL 2J5LB 3T0ED 5CP7B 3L54A 1WEJL 5GISH 1QSEE 4M3KB 4PJCA 2Z4TA 5I1IL 1E28A 3EBAA 4FQHB 4HOXA 1TUPA 1ACZA 4B96A 4DCQA 1TOXA 3X14A 1BIHA 3F12A 2XQBH 1A7OL 4LSRL 2OV0A 1D6EB 3OKDA 5DO8A 1JF1A 3O45B 4GRWE 1JZEA 4L3FA 4U1SB 1MHEB 2X05A 3L5IA 2QPUA 4YGAB 1PD6A 1MFDL 1TQWA 2YD2A 4W4OC 3ES6B 4IBLT 1CFTA 1WFOA 3CBKB 4KOBA 1S7XB 2DEXX 1SXSA 3IAQA 5FCUL 4GUOA 2C3XA 3MLVL 2P8LB 4L0ZA 1I8KA 2RD0A 2WXGA 2Q8AL 4K7PL 4QCIA 1KCLA 2XTJB 4YDIH 2HT2D 5EOCJ 1VJSA 2P5WE 1AQKL 1QKZH 5HXMA 1Z3GH 2KZBA 1I82A 4XPFL 4NZUL 4ZFZA 3KXFB 2V8LA 2WVVA 4PWEA 4AITA 3HZ3A 5A6LA 2NUTA 1AHKA 1G9NL 2YAHA 2CLVA 2DMKA 3VXRE 4IDJL 3VM5A 5IROD 1P4LB 2WXHA 1EAPB 4U6XB 2YK1H 4W93A 35C8H 1UWEH 2WGNB 4MASA 5E9NA 5EU7E 2BM3A 1PLBA 2ATPA 3SE9H 1H3PL 4C56D 2L0DA 5HI3D 2G5RA 1EXGA 4YLBA 3ZK0A 4JHAH 1MG3C 1HILB 1XGPA 2GT9A 4BK4A 4JKLA 1E8ZA 5IQ7L 2JK5A 5D1XE 4UM9B 4UZSA 2NY7L 1LO3L 2HFTA 2AS5M 2MEJB 3UPAA 3RWIA 3QK0A 1GCYA 5FK9A 3E9UA 1WICA 2CBTA 4KOCA 3JWOL 2CK0H 5BCAA 4FQLL 3P73A 2C7UB 3B4NA 1KB9J 1ORQB 2YXVA 1PBYA 2X1QA 2BHFA 3FQ1A 3T77A 1NEUA 1NM9A 4MJIE 5B1JA 4OT1H 1U92A 5CJXA 4PMFA 3TZVB 1FVEA 1KB5A 1RZ7L 2DWSA 2HN7B 2QHRL 1MQ8A 2IDSA 4J4PA 4AJYV 4ABVA 3GJEB 4M62L 3MLXL 2ZKYA 3DC0A 4M5SA 4FKEA 2AV7A 5HHPB 3W11C 3FBQA 4AMKH 1XZ0A 1NGXA 4DK3A 1PQZA 5F7MC 5IB5A 3RU8H 1DVYA 4OIFA 2BVPA 1XGQB 3L17A 1MUJA 4NNYA 4Z76A 3H7BB 3D4GA 3HLKA 3RGVC 2BZDA 3E0GA 3Q2NA 3LNHA 1YN7A 3BQUD 4PLJC 4NGHL 4WNQA 4N2HA 3U4KA 2V4LA 3MXWL 3ULVC 4X6EB 5IVXF 1ID5I 3P0YL 3DX0A 4OZFB 3BRDA 1UHVA 3PAZA 4ZNCD 1RUML 4UU9B 3U6XA 1QPKA 2X6UA 1H8OA 2HH0H 3DMMB 4XHJC 4DCQB 3D09A 4AQZA 3QC6X 2EDNA 4D8PB 3N1PC 4UQEA 4Z7UE 4JG1L 5DT1L 1RUAH 5GIRB 2Y5QA 2DI7A 1IJ9A 2DQDL 3I50L 2QLVB 4BWWA 2VDNB 3ES6A 4YSOA 3IPFA 5F1KC 3UAJA 4ZTOH 4LCYA 4ABUA 2ADIB 5AW8B 3GM8A 12E8L 4KXBA 1KCVH 2A5UA 2EDFA 2E59A 4FQCH 4KJPD 1E0OB 1ZWIA 4HIQA 1DQKA 2X3CA 3NJKA 4OSUL 2VW7A 4KHTL 1VESA 4F15B 5DCCA 3QRBA 1PX3A 2A9AA 2DQDH 4O5LL 4R2GD 5DD1H 4RGNC 3RURA 3D0VB 1JPEA 4OUUA 5EBWB 2AJXL 1G6RB 5KS9E 2GSGB 4DAGL 3BKCL 3KLLA 3ECUA 1N4XL 5CZKA 5GRJH 4JE4B 1WO2A 1P84K 5HGDA 4FABH 2ZCLH 3HMXH 4OFPA 5EOTB 3VD1A 3QEHA 1PEWA 3S48A 4PI0A 3HNSH 1FPTL 2X4SB 5D2NA 3VRIA 3EG9A 1UT2A 1R5WB 1THAA 1W8OA 4DKDC 2PN5A 1F8TH 2XG4B 3L13A 3QUXA 4M6AA 3V4UH 3H2PA 5IB3A 5KS9A 1NLBH 3SO3C 3GB7A 2FR4A 2PMZA 3QCVL 4LKCB 3SGEI 4FFWD 3MOQA 1AD0A 4OGQC 5I26A 4DKEL 3EO1B 5HYJB 1CICC 1IGYB 1JUFA 4F33A 1U58A 3PL6B 5TQ0L 1FV1B 1VFAB 4R7XA 4TTGA 1QRNB 5I0WA 2YUVA 4GRLA 1ORQA 4NPYB 4F37F 1A3ZA 4HMEA 3UBXA 1BQHA 2GY7B 1L0PA 4HEPA 4MZ3A 4WENB 5FECA 4WI3A 2Z35A 4PJ7B 4ZPTA 3GRGA 2PR4L 3M17B 4DP7X 4TRPL 4I3RL 2PW1A 1G1CA 1HEJC 4NO3B 3EYQD 3H7LA 4NNXA 4HC1L 1JJUA 1HJBC 1F86A 5F9DC 3RVWC 3NFNA 4WUUD 3GQFA 3N40F 2IDTA 3SOBL 4JFHE 4E9VA 5MEQA 3DURB 4MJ2A 1SOSA 4APXB 3AW5A 3MZTA 3TBTB 4P4KA 4TTDD 2OW6A 5KYUB 1ID2A 4M6ML 3CSGA 3B7YA 3WEOA 3PJSA 2OCJA 4HK0B 3FUHA 3UAAA 3V9FA 5EU3A 4FQXA 2X7LB 1IE4A 4IW4C 4PJGF 1O6VA 3E6FB 5SWQA 2HPTA 4HJSA 3RVWD 1QR1A 2Y2WA 1TLMA 4WSGA 2BW5A 4IOIA 4WUKH 4X7FC 4FFZA 5FKAB 2ODHA 3KPPB 5DHMC 4MAYC 5AUMA 5D2NC 3L5WB 5DO2D 1I31A 5HJ3B 5CFHA 4LVOB 5AB0A 1AHWB 2VDML 4JFFD 1U8IA 2Z31C 4TNFA 1XGYL 4HUWB 3WJMB 1YC7A 1A66A 1MY7A 2OMTA 3EBHA 3EJRA 5IB1B 1YEKL 3QWRD 3K8KA 1XGZA 2QSCL 5F7EH 5EO1B 5CCGE 5D71H 3MREB 4F5CA 3OGOE 3ZKSD 3WIAA 3ZX1A 1JPGB 1A7RH 2GIXA 1XIWA 1XGUA 2HT3D 2PCXA 3QIWD 4CVXB 3H3PL 4NRYA 3X12A 3ARXA 5JW4R 2FVNA 2X41A 3NSFA 1P6WA 1SM3H 4LHJB 1RZFL 2NX5E 1IGIH 1W0WA 4ODUB 5DVMA 1RIVL 3KLQA 1OW0C 3C8DA 2OJZL 3BAEL 3MRKA 1K4CB 5IEKB 1FORL 2ATAA 1R5WA 3EJSA 1SLXA 3PHQB 4Z0XA 3S35H 4YPGB 1ZHKB 2Z31B 4HIJB 4XPGL 2B77A 3F7KA 5KSAC 2N7SA 1W9XA 4I88A 4N0RA 1DVFB 2CO1A 1ZPUA 3CFJA 3GSNH 4LEXL 2YPLA 4R7NA 3C2AH 1QWNA 3UYRL 5JMRA 1PNCA 4GO9A 3ULUE 4YE0A 4N28A 4UQCA 3SZ6A 1BVLB 3QFJD 4WRLA 5DJDA 1E90A 4DSYA 4L4JA 4B9CA 2F7QA 1JGUH 4D7PA 3KXFD 3WJJA 3L1FA 5IT2L 5DJYB 3O8XB 1G9EA 3V0WL 3OXSA 2K6YA 3T1FA 2WWOA 4DVBB 3V79C 1PYWB 2TAAA 1JHLL 2F53B 4XMLH 3I2CH 2ED7A 3ULSA 4KI5C 2VLKE 4OZGF 3UP6A 2GJZA 2XN0A 5A16B 1MCNA 3V4VB 4FNTA 1OAKH 3NFNB 5AAPA 5CKAA 3NPSB 4G3YL 3WEMA 4D3CH 1REIA 1U95B 3ZHLA 5C6TL 3HG1D 3EO0B 4H26B 2J20A 3WY3A 3QP3A 4QRRB 1DLHA 2XOTA 4ONGL 3QXVA 3BOVA 1OP3K 1RUKL 3ARGD 2LOEA 3EFDH 3QWNA 2YFOA 3GMOB 4KI5F 1TMCB 1XCWA 3OSKA 1NMCC 3QZWA 3KPQB 2UWEE 4ISVA 4K8RD 1MPAH 2OULB 1OP3H 1X7TA 3KS0H 1LQBC 3LS5L 1CLYL 1DVSA 3SODB 5ESQB 3BGAA 4I48B 1P4BL 1IAIM 3LOWA 3QQDA 5I15L 4RDQG 4BKLB 3HZYB 5JW3L 3QIBB 2FEDC 4A68A 4HFWB 2Y7SA 3P2TA 4ZQKA 4H8WL 5H94A 4AOFA 3O9WC 3CHRA 3JWNE 4IJ3B 3VWKA 4BFJA 1S9KC 1T5XA 4HCIA 3MNZB 5TF1H 3RTQA 3CDGA 1MHPH 1Z9SB 1MRCL 1BJ8A 5CS7A 3WKQA 1KC5L 1U8IB 5C0AD 1BQLL 2NZ9C 2DMGA 3WMQA 4D9RD 2MQ0A 3RL1B 5E4IA 2VABA 4KH2A 5GQBA 2IPUK 3CBJB 1JGDB 3ARYA 1QYGL 2JIXB 1GJWA 4KKRA 1IM9A 4P59H 5AKVA 4AJVA 3QPXH 4LP5A 1FFPA 1QUPA 4PHXA 2JXMA 1XBRA 1TQTA 2A4ZA 3B8YA 2EDWA 4BKTC 4M43H 5EN3A 5GGVY 1JDAA 1W0WB 3GPEA 3V7AG 3HFMH 1J8HB 3BWUF 5DQ9A 1PIGA 1OGTB 3ZZ1A 1R3JA 1BHGA 5LB1A 3O41A 4KMTL 4G7YL 1BXVA 2Z31D 3ARFA 4ZMPA 5FYJE 4M5TA 5T1MA 3V0EA 1CMOA 2X1OA 2WWMD 3NOIA 3ZDYB 4F15C 2DTMH 3GBLA 1F5WA 4ANKA 5JPMC 3VXPB 1G1OA 4KH9A 3V8CA 3FT4A 3IFPB 3MLRL 3BQUA 4UTAA 5EU4B 5AYTA 3NIGF 2COVD 3QUKB 4R2GB 2DRUA 2O26U 1EO8H 1ROCA 2QT6A 1NCBL 1M56B 2I5YH 2WKGA 4LARL 3X1BA 3CIAA 1QZ1A 2A9CA 5FC9A 2BXYA 4JO1L 5HJBA 2GY5A 4EN3D 4Q9QL 2GSMB 5KSBB 3KGTA 2JCCA 1FUNA 1T5WA 3T08A 2ESVA 2VR4A 2X2HA 1M7DA 2EUZA 1JZDC 3QA3B 3DTXA 4TS6A 2K7QA 2V5RA 4CNIA 3BH4A 2GTZA 1XL4A 2I5YL 4J3OD 1QQDA 4TSCH 5IB4B 4R84A 4PJDF 2YLKA 5AEAA 3QI9A 4HUVA 1NEZG 3US0A 1WZAA 4PTUB 5DMJB 3QPQC 5F7HA 5L0QC 4IGBD 3PLYA 5F0JB 3Q1SH 1EEYA 1LO0L 1C1EL 3JXAA 4JFQA 4X5XA 3AQDA 1DQIA 1UXMA 3FB5A 1OP9A 3OJVC 4YHZH 2W8CA 3WLBB 1OTSD 4ZFOL 3PG2A 2CRZA 4MXQC 1A7PL 3CVHL 2VUOA 3DPBA 5ESQA 4JGNA 3FOMB 3NQIA 1EA9C 1IAKA 1T7VA 1PD1A 4BFFA 3LMJH 4P46C 2WUCL 2ZCHL 3W0WB 4E9LA 4WWKC 1HL5A 3MRPB 2BSED 5DQDL 1LP9A 1T3FB 3TIDA 3VFPB 3U0PB 4YHPB 4U1MB 5L4JA 4LMQE 1D2OA 3Q1EA 5EFIA 4WI0B 4ONHA 2YMXH 2B9AA 3BT2H 5DJAA 1QBLL 3GJFA 3BPCB 1AANA 4NM8L 4ENEC 1IEHA 1E5UI 4MDRA 5CN2A 4JHBA 4OI9A 3CLEH 5TFSL 3HLAA 4GG6A 4ZAKB 4R7LA 2VZOA 4QYOB 5D1QA 1IGTA 5I66B 1UWXK 1WAEA 3WY1A 2C9PA 5EDSA 5I6XC 1J5OH 1V7NL 3POHA 1NGZA 4YDLC 1GGIH 3QULB 4PJIB 1PKQE 5HTSA 3TT3H 1EXUA 3TBYA 1E4HA 4WO4C 5LHDA 1YY9C 5DK0A 3KDMA 2J1WA 1E4WL 1TTAA 3O2VH 1DQDH 3QDME 1I8KB 4XBPB 3CMOL 1MLCA 1YDPB 3ULUL 3GYRA 4QCIB 3DV6A 4PP2B 2HMIC 3C9NA 1Q0EA 2CGRL 2ZAHA 4P5RA 4U1LA 2B59A 2CKBL 3B9KD 3NSDA 5G55A 1N5AA 4HUUA 1CBVL 3MGOB 3TO4D 2BWIA 3KXFA 1KPVB 2JV6A 1DQDL 2IH9A 3KGUA 2VAAA 1ZHNB 1XGRB 5JNYA 1IC1A 4J5VA 3U1PA 3D33A 4P2QA 3NP4A 3R06A 1T5KA 2Z92A 4NQSB 3BQUB 3RZCB 4W9ZA 3U2SA 3WSQL 2EXWD 5C0RL 4NAMA 4ODWB 1JNNL 4XN5A 2B0SH 3GXIA 3ARED 4S1DC 2VLRD 4U4BA 2X4UA 5BVPL 4YGVA 2M1KA 4U1NB 4FQXD 1CGXA 3P4OB 1S3KH 4PJBB 2EDOA 3GHEL 3RA7H 4ANXA 5IB2A 3V6BR 2FDBP 2K78A 1UTDA 3BO8B 4NZRH 2PO6A 1W80A 1CD9B 2J21A 4FXKA 4WV1C 4G9FD 2EILB 1IRAY 1FNEB 3PV6B 4ZX6A 4JY5L 4P48A 1R3HA 2NY3D 5AWNH 4ONFH 3PDDA 1ZLDA 4RGNE 3BP5B 1URIA 5JIDA 3X14B 4Y5XC 3GJEA 4G1MA 2YQBA 3HC3H 4ZOBA 1G7JA 3GSOA 3NZSA 4LU5L 1UWGH 4I0PD 3QJSB 3K46A 3QWQB 3BAJA 3V55A 4A7QA 4BDVA 4R4BA 4NWTL 5FKPA 1RH8A 1RUPH 2C5DC 4H2CA 4JMNA 4UT9H 6FABH 4O2CB 3L7FA 3VXUB 4KO9A 5A43C 2Q2LA 3VCLA 3JTSB 4A6YA 3H9HA 1KY6A 4U6YA 1P6AB 2O6FA 3S3SA 2D4DA 3TIEB 3TIDB 2QTVA 1I7UB 3ZE1F 2Q3AA 2VR6A 4UILH 3SDCC 1YAIA 4KGJA 4N9GB 3WIIL 2OMWA 1AD9B 1NFIA 5FM5M 3UZQA 3UBHA 3WFEL 4FA6A 3MNVA 1Z5YD 2XWJB 2WYHA 3G9AB 4Y9BA 4Z7WF 5GXBB 5ALCH 3ARDC 4LHUG 2XHNA 3G6JA 5ACZB 1AXSB 2JCCF 1X7QB 4PJIA 5E9DD 1YNLH 1HC1A 3TBYB 1VEMA 4NKQB 2VMJA 3GSXA 3G5YA 5I17A 2X40A 3JUZA 1ZVHA 1HILA 2WQSA 1XGPB 4F5CE 4E0RB 4JFVA 4HJUA 5I9QB 1T1YA 3H42L 4PMEA 2MCPH 3HR6A 3IETA 4MX7A 3MXVH 3DHPA 1JZ2A 5IOKA 4FNUA 6PCYA 2W80C 1G9NC 2HT3C 5I1EL 4IKIA 3RWIB 2F5BL 4KXZI 3MRDA 1G6RA 3MGOA 5E2TH 2MKLC 1WA0X 3D25B 1R6VA 1BYPA 4LOVA 2NXZB 3IU3B 2NZIA 4TXVB 4WGVB 3C5JB 1UB6B 2WP3T 2WK2A 2YBRB 1MUJB 3TZVA 2AJVL 3FO1A 1KGIA 1TZOA 4W6YB 5T3ZL 2Q6WA 5HGAB 3ME0A 4DQOH 4FQQA 3JWNG 4OFYA 3CPUA 1A1MA 2WCSA 4TNGA 4K23H 3FCBA 2BX5A 5SWSA 1HEHC 3T6XA 3G5VB 2A73B 3IRCA 1F2XK 3C5ZD 4UTAH 4GAAA 3UIYA 1ZK5A 5KYYA 1G43A 3PPSA 1T03H 5BV7L 1Z7JA 5L8JB 4X0KA 4QRRE 2ZD0A 3NIDF 3E1ZA 1S3RA 3O0LA 4WNQB 1TQCC 1W72A 4ELDA 2OJ1A 4S1DD 2ZAGA 3H53A 3KYNB 5JOEA 5HVWA 4QXWA 5C0AA 4GB9A 4AC2A 3HJ0A 2F8OA 1Q0YH 2J43A 1UM5L 3DX4A 4IOFC 3UC2A 2APTA 1E30A 1MG2C 2BNQA 3KPOA 4M02A 4XCYB 3U7YH 4BZ2H 1MIEL 3BMVA 4E5XB 4GSRA 3QFDB 2VYRE 1U8LB 5IW6A 3VFSB 5E94B 1D7DA 1IB5A 1ZANL 1HJCA 1BIIB 3S36H 3BPLB 5HY9B 5JHDE 3EYSH 2DQJL 4V1DB 3N3EA 2X2YA 1Q9OB 2KH2B 4HGWB 3RUGF 2ITFA 5CO1A 4NUJB 3B2MA 4OM1H 2NUPA 1H5BB 2BDNH 1RP9A 4UZUA 1MQKL 4BZ2L 3QYMA 4NZTH 4G2AA 4HISA 1G1YA 1TSHA 3N85H 2ZG1A 4GP8B 4NKIH 1YY9D 1K2DB 1N68A 3SKMB 5I6XB 1YEFH 4HH9A 4LAJH 4TM9A 5JUEH 2NY2D 5ID1B 4MNQE 2BDNL 3FU7A 2BSSA 1OVZA 3VMOA 4I87A 2N7BA 3OLIA 1IKNC 1MXDA 3PE9A 5KUMA 5F71A 4MYPA 3EFOA 4OZGA 4ZO6A 1QA9A 2XYCA 1X44A 2PTTB 1T2XA 4NQCD 1NSNH 1NANI 2ICEA 2R0ZH 1ETZB 2QFRA 3PWLA 4U2ZA 5J1AA 1IGYA 1BVNT 1DSFH 2ADFL 3ILPA 3LEXB 4QR7A 1DQJA 3ABMB 4F7TA 3FC8A 4PREA 2YJQA 3EH5B 4YHOL 3IETB 2YK1L 4WFHE 4Z7VF 4UQAA 4BCXA 3X13B 4DUVA 3NP3A 5DUMH 5JQIB 3GD1C 4TUKL 3BWAA 3B3IA 4HUMB 5EWIL 4P5TB 2K7PA 1SN2A 3T4AA 3BT0A 4GRLB 1SXBA 5HGGS 4L3EA 5BS0E 2Z7WA 2NXYD 4GRMA 3UAJC 2ICWI 2JKRM 1D5ZA 3UAEA 2WO4A 3ZDYF 5A2CA 5L9DH 2PYEB 1K4CA 4IGBC 1ZXKA 5LVEA 1Y07A 2EDXA 2V5YA 3Q43A 4IBYA 1N2RA 5D7KE 3OTTA 3HE6B 2AQSA 1D7BA 4ZAKD 5JW5B 3LQMA 1BFSA 2X7LA 5EULV 3A4FA 1RUMH 4EUPA 4N0CC 4NQXA 2VQ1B 3KMDA 3NT0A 1FRGL 5I76B 4OU3A 3V10A 4G8IA 4IRJC 3REWB 1O7DE 4JBSA 3N43B 4IOIB 3POCA 1G7LB 4EUPG 3KPPA 4GNKB 2H26A 4AENB 2NY0B 2MPAL 1ZS8B 4LBEA 5D7SH 1IV8A 3KPSE 4K5PA 5IJCC 4N1EA 3AGVA 3T1FB 5EZJA 1CIDA 4IKLA 1UOLA 2ARJQ 1WZMA 3ULSB 4NQDA 4S0TD 2A9DA 3IE9A 4FG6C 4MZRA 2R0WL 1JWUA 4MXVE 3NBNA 1CYWA 3QJUB 4ZUVB 1TJIL 3VVWA 4TV3A 4UF7C 2OMTB 4YDZA 2R1XB 2AQRA 3KPRE 3T0WA 1XX9C 2K9UA 4XB8A 1SY6L 4MJID 3QXDB 2XG5A 3B9KA 4FEIA 4L0PB 4Z7OB 5GZNA 3L3JA 2XTSA 2OLDA 4QT5A 1HIMH 3IMTA 5C7XL 4G6JL 2P48B 2ZUXA 3HVDA 5FF6A 3F62A 3MOBL 5JPMA 4YOKA 4MMXC 2ZF8A 1XH2A 1HZHH 4ODUA 1LO4H 4HFWA 1ACXA 5CINH 3LS4H 4CC4C 5JIMA 3IJSA 1P4UA 3G3LA 5D5MB 1QA9B 4JG5A 3ZYJA 3VGGA 1J0KA 3QHFL 1E6JL 4LASH 5I0ZA 3GZOA 1OCWH 3SYQA 4CJ0A 5ENWA 1VACB 2AKRA 2IV9A 4DAGH 5EF0A 1J1PH 3MACL 4AQAA 1UD8A 4UINH 3AY2A 1K72A 4NCC1 1WWWX 3VQLA 3L1EA 3FRUB 1EGJA 3FSWA 3MUJA 5IOPA 1CD1B 1YSOA 4AX3A 4ZMLA 5T1KA 4F7CA 4HLEA 3MBXL 4OCNC 3X13A 2X3BA 1DQVA 2PR4H 3F6LA 3WO4B 4G6KH 1EQWA 5F0MB 1J0HA 3IE4A 2F53A 3FAXA 4ZXBB 2UX7A 4WIQA 2LW3A 1N3NB 2GJZB 3V4VA 2VLJE 4ZNEA 2OJEA 4G72B 4MCZB 2XDHA 2AEPH 5BO0D 2ITCB 4A2LA 1GYUA 5T1MB 1N19A 4JQXA 4ZTPL 3T8XA 1JCVA 4PW3A 1QW9A 5IROA 4IEFB 1NIAA 4G8GE 4QF1B 4DO5A 1H9DA 4ODTL 3D18A 4KVPA 4QJ3B 3B56A 4N68A 4Q6KA 3EO0A 2BZ7A 3FB6B 2QKIC 2CPCA 5IVZA 2BFGA 4K8RH 1KN2H 2QPSA 2BFVL 3NCWA 4YHLH 5E5LA 4N85A 1ZT7A 4BKLA 4P3WA 4Y4HD 5E8OB 1JGVL 2WW8A 3BUPA 2XXCB 4J7RA 3V6OA 5C0FA 5C08A 3MNZA 3BRFA 4HDIA 2MNUA 2YAFA 2R0LH 4NPJA 2IWGA 5F7AA 4DN3H 5E7FA 3EZJB 1CF8H 3DYMA 2IEPA 3MFGB 4D8PA 1HL8A 4HS6A 1OTTD 2E9BA 1KIRA 4PS3A 4RISL 4N8PA 4L1BA 5F93C 1CDCA 1U36A 3ZZLA 3LH2L 2WB1A 1MRFH 3L3HA 3QI9B 4EIZC 5DK2B 3AJ7A 3QGVA 1FFPB 2BVQA 4X4ME 3ZTNH 1LWRA 1LILA 5DJ0A 1QSVA 5BQ7A 1J0YA 5IVXE 3WKYA 1G4MA 4MNQB 4P06A 1NMAH 1SHWA 1Z66A 5K59F 2H2SC 2DAVA 3F00A 3HI6H 5IUSA 1KCRH 1BOYA 2FIKB 1ESOA 5GGVH 3ETBJ 4LF3A 5ERWA 2O61B 4MRBA 2QADD 4NHUB 1BECA 4C4UA 3OSVA 1U8CB 2CDEA 1HVXA 4GKZB 4JKMA 2ARJB 1DZ0A 2NR6A 2YGQA 3Q6GL 5HGDB 2ZYIA 4UOW1 2OMNA 4M1DH 4PSPA 5EOTA 3DARA 4K73A 4AYID 4JPWH 4LSUH 3EO9H 1TJHL 3QS3A 1O5PA 4OD3H 3NEOA 2YUWA 3A24A 3VD9A 3TZVD 1M71A 3CXFA 4LL4A 2H6OA 4N2BA 1AKJB 4ZDHA 4LOUD 3SDXF 3WUWB 5E08H 4I2XE 4F7MB 4FNRA 3RNQA 1U8MB 5EBMA 5I0DA 5HDQH 1E42A 2IPTL 2WXFA 2GYSA 3HE6D 3EO9L 4HEME 3RRQA 4PWIA 2MSPA 2VXQA 2QGEA 4K7FB 2DL2A 1QSZA 5KBKA 3F3HA 4HIPA 1F3DH 4Q9RL 4I89A 1QRNA 3SY0A 4BH8B 3ZHFA 2RALA 4P2OC 4YFEA 4ELKB 1Q94A 4XAWH 4WO4A 1GW0A 5DFVC 4MXWL 4N6RB 4RGOH 3KDPB 4MJ4A 4MVBD 1WFUA 1KB9K 2P8MB 2QSQA 2FBJH 4GRLD 4PB9H 5F7DA 5SV4A 4KZDH 5K9OB 2PPDA 3UTQB 2IWFA 4NO3A 1ET5A 4IRSB 5BRPA 4YXKH 2X4OA 1G6RL 4WNJA 1LL1A 3IK2A 4L05A 2FAUA 4NAJA 5FO7A 3QZMA 2EH8H 3K91A 3QR2A 2ZG3A 3OLGA 2V7NB 2XZQL 4S2SA 1TO5A 2JQZA 3QCTL 5JA8B 2JIXD 2Y06H 2FJUB 3P0VH 3T4AC 4EI6A 3EJYC 2NX5B 2OXGA 4KK6D 4MVBC 3BPNC 3HN8A 4N2MA 4K71C 1SBBA 2RFXA 1PY4A 4LOFA 4UT6L 4QGTA 1S7WB 1T0MB 3L45A 3IKCB 4BZYA 5GGSY 35C8L 2J1ZA 4MLIA 3ATEA 3OKOA 2DM2A 3FT9A 3TBSA 3U4BH 1H3PH 3GRWA 1E5YA 3TNMB 1JZ5A 5B1KA 1JXFA 4JUTA 1T04B 2ZSVA 4PJIF 5E51A 3UBXG 4UB0H 3QDJE 3AT8A 4PRPB 3GSVB 3MTRA 3WNNA 2BVOB 2HMID 5JQHC 2EYSA 5A3ID 4ONHB 3KPNA 4HKJA 2F54E 4CGUB 5CGMA 3ULUD 3DSNA 5FYLH 3KNBB 2DQFB 1EZVX 3O2DL 5DR5H 4PGCB 2A9NL 3HI1A 3WFBH 4M7JH 5AB1A 2VKXA 1J12A 3HFML 4X83A 4D8OA 4JANA 3WIHA 1I1FB 2I27N 1MLCB 4Y5YA 1IGTB 1E9QB 3QDGB 4YZWA 4HG4J 2FK9A 2WIIA 1FJ1B 1SDYA 1AS6A 3UCQA 1XF4A 4C83B 4DTGH 1FIEA 1G0YR 3UXFA 3X1NA 1WDAA 3BX7C 3DOIA 3MLSL 3O2DH 4L3ED 5DR5L 3WFBL 1JP5A 4KNSA 2JE8A 1MCQA 2R0KL 1S7TB 3ZUNC 4XVSL 3MV9D 4KJPC 5LGJA 4WU7B 1K85A 4RWHA 1VFBA 1NJ9A 4F2EA 1I7UA 4TL5A 1A3LH 5B38A 3HE7B 3R06B 1L9MA 2UYLB 4LRNL 4DTGL 4ZFFB 7CGTA 3UTZB 4CGTA 3RZCA 3RWEA 3GT6A 4XNZB 2BMKA 1SJEB 4HIJA 5CZVL 1WT5A 2MQCA 5F7FA 5GSVB 1KPVA 3II2A 5E2UH 3C5ZB 1LDPH 2QQLH 1INQB 4IDLA 2MOQA 4XCCL 4YPJA 3JUYA 3LHAA 4DO4A 1O6TA 3V0GA 2PWEA 4XVOA 3OB0K 5I8CB 4FQ2L 2HH0L 3PREA 3MAWA 3SDCA 1PZDA 2QQNL 1MWAA 4KKPA 4YK4B 1VKXA 3E6HB 4WO4B 4N24A 4N1HB 1ZGLA 1H6UA 1R3HB 4ZMAT 4PJBA 2J72A 4MCYA 2FZ3B 1OWWA 5EOCH 4FMKA 4G80B 4FKKA 4UI2A 5IWLA 1C1EH 4F2MB 4HIIA 3MLUH 1BVOA 1NL0H 2EAEA 4AVHA 2DJUA 4TKWA 4XCFH 3RJQB 3VXME 4CADB 3SKUD 2E8YA 2W60A 4H8UA 3TBWA 3UGEA 4OGAC 5T1JA 4NPKA 5DZNA 2YBRA 2NNXA 4DEPB 3TFBA 4JO1H 2HVJB 3BP5A 1RJZA 1MI5E 2IV8A 2VO8A 3NACH 3NAAL 2D31A 2N3JA 3D9AL 3VXUA 3STZB 2YQGA 4I77H 5DQJB 1K5NB 4AKQA 1GS7A 1SFHA 3J8F7 1NLDL 1RJYA 6PAZA 5L8KB 5KYXA 2BOLA 4R26H 1YYML 4L48A 1HI6B 2X9ZA 4BUQA 4MJIB 5TDNB 2EDLA 5IESH 2H6PA 1ACCA 1EFXA 4DW2L 1HWHB 3QQDB 1K9TA 3ESNA 3OC5A 3GMLB 1OE2A 2YLHA 1L5GB 2YIHA 3DJSA 1FBIL 3N40P 4KX8A 5AVZB 5BZWA 3H9HB 4MA1B 1JNLL 1WYJA 2FSEB 5I6MA 5J9PB 3FYEB 3HG5A 1MSPA 2IJ0C 4LIQE 1NAMA 4R9HA 1NLDH 1DFXA 3QORD 1DJXA 1WCBB 3VFVB 1IC7H 5C07E 3HRZB 3L4VA 1CTOA 3ARBD 1FLRH 3L6FA 5EN2B 4EI5A 3MBEC 3OKMB 1BBDL 4I1NB 3FQWA 2AJ3A 5I18H 3W2DH 1M2VA 3QORC 4PGCA 1DJZA 4NM4H 4CVWA 2X6MA 5LXVA 3F12B 2IQAB 3C60C 4NI6A 4Q2ZB 5B4MC 4YHMH 2XWJA 1PMYA 4GEIA 4XNQB 3V4VL 1TTGA 1OAXL 1OZTG 3ARGA 2IQ9L 3FTWA 2SEBB 4R96A 3FQ2A 4Z95H 1GAFL 4OM0L 2V2WB 1L3NA 2QDVA 4PW9A 2ZOTA 1AGDB 1KJVB 1J87A 1CFQB 1OCCB 3S0PA 1PG7H 1E4KC 3CHSA 1HL9A 2DYPA 5KBMA 1HKLL 2HWZH 1KV3A 3DUUB 5LUMA 1PZAA 4ZFFA 2IGTA 5G2NA 3WSQH 4HUXB 1YRKA 4FC3E 4Y19B 4DFIA 2PXYC 2B08A 4PY8I 5HGAA 3NABL 5D4QA 1A6ZB 3L2NA 3DRQA 4HFUL 1JVOA 4LEOB 2PTUA 2CO6B 2V9UA 1CYXA 4RGNB 1QI5A 4NOBA 4PWKA 2VDOL 4PJ9A 5KVMC 4Y9CA 3P77A 3EFOB 4OZGB 2WWKO 5CWSA 3V4PA 4L1DA 1ZA3A 1WD8A 4F3FA 2XBTA 2E6QA 1F1DA 2LLLA 3QR1A 4K8RC 4NZRL 1U3ZA 3OAYH 4QOKD 5GJTH 4DHLA 5B1AB 4DGVL 2BOBB 1KOAA 1PDKA 3ATDA 2ZP9A 4LCVA 1LVEA 1D5RA 1TCMA 3E2HB 2HRLA 4Z7OF 3TO4B 1VERA 1ZDSA 2D9CA 3FH7A 4AYFA 1AOZA 4R97B 5CJ8A 5JOPE 1SEQL 3PXHA 4TOYL 3PYCA 2K9FB 1UH4A 4OF6A 3ULVF 4XR8C 3EF7A 3NA9H 3OKDB 4KKCC 3IDUA 1OEZW 4LPYA 3TN0C 5DVKA 1YNTA 2W38A 3IPBA 3SKJH 1XR9A 2YSTA 3DVNA 1S3KL 4KZEL 3RB7A 1B90A 4PJDB 3S36X 2HN7A 4OCXH 1VZIA 2EEFA 4PCKA 3QC5X 1OHZA 3B5GA 5J12C 3WGUB 1PAMA 1UM6L 4IGBA 4PS4L 4QWWD 5HHXH 1TCRB 2LU5A 4TNVK 4NZJA 4M5YL 4PJ5E 1E40A 1BIIA 2BSDA 3E3QE 1K8DB 3VA2C 1AQDA 3CDZA 4FI8A 1A9VA 1TVDA 3FFDB 3FTUA 2FEEL 4WHYH 1IBGH 4IBUA 4JPKH 2GBVA 1R3LB 4A2FA 1BV8A 2ZXGA 2LVEA 3CLFL 4XC1H 1KIQB 2RR3A 1XCQA 6TAAA 4OCWL 2OP4H 2QPEB 2I25N 4L1LA 4IU2B 1W0YT 4XCEB 4P2RB 4AV4A 4L0YA 1XSOA 3OKMA 5KJ7E 4XN9A 5HGHA 5C7ZA 5ESAB 4U1GB 2X9XA 4RX4D 3TYFA 1U42A 2VN5A 5I66A 4Z7QB 1IBFA 2VZ3A 2H9GB 4Y7OC 5JYLA 1A7BA 3QJOA 4P2QD 1DR9A 2V3EA 1HFUA 2CA3A 5FK9B 1RFDL 2FJSA 2I69A 2AK4A 3VDCA 1VA9A 3PGFL 5J6SA 4F9LA 4I1PA 5KYNA 4IBQA 4G3YH 3VWJB 1XB8A 4MA8L 3MV9B 5FUCC 1MFNA 5F0PB 2J73A 5IBUG 5TPWL 4PFEA 2FD6H 3OAWA 5IIEB 2JNZA 3B3IB 1X5XA 4DQOL 4WW2C 1BZOA 1HCZA 2A6DA 2VRKA 4OCRL 4PJFA 5IW1A 1D7FA 4OJYA 4DK6A 4GRMB 1FL3B 4X4MA 3NPZB 4UTAL 3DO7A 4FLQA 7TAAA 5TE7H 5ENWB 2EUWA 4NP4L 4XAKD 4AIOA 1A7NL 4K5NA 4GP4B 1YN7B 3QHTC 4QHLA 3S6CA 4AEFA 1ZT4A 3MMEB 5CZRA 1P7KB 3F2LA 3D3VE 4JEGB 2H26B 4TNWK 2GAZA 3QEGH 2HX9A 1PCXA 2CJ3A 3KBHE 4N2NA 1QFWM 4JFZH 1AD0B 3BUYA 5FR3A 3KR3H 3BVNA 4LCWD 4TPRL 4QRUB 2FUQA 1IKFH 1A7NH 1Y18A 1FV1A 1U8PB 4AUJA 4QTIL 4GKNB 4JO5A 4PG2A 3VD7A 3OMZA 3UBXB 5ADPL 3FCGA 4URKA 4RIRA 2V2XB 2F19H 3QIWB 5E9DE 3M8OH 5I8KL 2IADA 3HPJA 1D2PA 1P9MC 2PW1B 1IKFL 2WXNA 3EGXB 3OLEA 4G1MB 3G6DL 4D0CA 5B1BB 4IIQC 3NZ8B 4JO3H 4BFIB 4NKIL 3GSUA 3LCYA 4EVNA 1N5YH 1VAHA 3LH9A 3GXMA 5DJCA 3U4AA 5BRZE 4JK0D 3M8OL 5I8KH 3CQPA 3D0VA 3FB6A 4WSJA 3F58L 4B5EA 1QWHA 3FZUD 1R3LA 4OZIF 1UT9A 3Q3GB 1RPUA 2P47B 4S0HA 2F53E 4E68A 4KXAA 1L0XA 3OF6D 2ZONA 2AJYH 1A22B 1UCBL 2M83A 1EAOA 3SE3A 1IE5A 3DIVA 2OSXA 1HL4A 3DDGA 4PRHE 4GRWF 3MA7B 3RI5F 5FYJH