2EUVA

Principles of protein-dna recognition revealed in the structural analysis of ndt80-mse dna complexes
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
303
structure length
290
Chain Sequence
b'VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESHTGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLKSSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVCPLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLLFSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGIPYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*CP*AP*AP*CP*AP*CP*AP*AP*AP*TP*AP*C)-3'
publication title Principles of Protein-DNA Recognition Revealed in the Structural Analysis of Ndt80-MSE DNA Complexes.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell cycle/dna
total genus 79
structure length 290
sequence length 303
ec nomenclature
pdb deposition date 2005-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05224 NDT80_PhoG NDT80 / PhoG like DNA-binding family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1390 Mainly Beta Sandwich Immunoglobulin-like NDT80 DNA-binding domain 2euvA00
2EUVA 2EVFA 2EVJA 2EVHA 2EUZA 1M7UA 2ETWA 2EUWA 1MN4A 1MNNA 2EVGA 1M6UA 2EVIA 2EUXA
chains in the Genus database with same CATH superfamily
1WV7T 1JJUA 3MRPB 1MUJB 2BSDA 4XX1E 4Z7AA 1P4BL 4D9LH 5I8CB 1DQVA 1I1AA 2PF6A 3DO4A 4OZFB 3MLWH 2L4OA 2ZWLT 4J3OF 4Q89A 5CLZA 1SHSA 2V9TA 3EGXB 2AJSH 1BM3H 3OPZH 5IJCC 1A1OB 4FFVC 3L9RB 5FUZL 1CJYA 1CLOH 3HE6D 4K8RD 3T4YA 3D39D 4DAGL 3H9SD 4HDIB 2N1KA 5FA3B 3D1MC 3HFML 1JV2A 4D9RD 3TTYA 1VENA 1P2CB 1H15B 1ZVNA 3G9VA 4Y8AA 3D9AH 1I4FA 1WCQA 3GNML 5F9AC 3AITA 1BFSA 3PREA 2ARWA 4MXQD 4WI0A 3X11A 2ZG3A 5CU5A 2BXZA 1QUPA 1WZ1L 1YMMA 3QO0A 4G6ML 4R0LA 4XNYL 4POYA 1YEWA 4TVUA 4HKJA 2ZZUT 3SGKC 2YSSA 3QFDA 4K7PL 4L8SA 3BZFA 4HIXH 3T8XA 1BWWA 1HDMB 5FDWA 2UXFA 1NPNA 1A9BB 2I5YH 4ADGA 4LF3B 5EMYA 4Y5YC 3Q05A 1QLEB 1GMIA 3CSYA 3P4OB 1DSWA 4L48A 1WSST 4M4RB 4UYPA 5JQIB 4YDNA 2IH3A 2OI9B 3FB5B 3GIVB 5J11C 4ZNEA 2KQMA 1P7KA 3FAXA 3GI9H 3ARDB 4ADJA 4WTQA 2N7BA 4DGVL 2QHRL 2NXYD 4HJEA 4BCZA 4UV7H 3AUVA 3MBWA 4ODWA 2X0VA 4JFDD 4PJHF 4QXTB 1TMQA 1ASPA 4ZS6C 1AIFB 4NERA 4ZW7A 5I1HH 1V3LA 4N2LA 1G7LA 1NA8A 2LU3A 3GSQB 3Q9PA 3N04A 4UDUA 1OSEA 2EIZB 2JK5B 4X6BA 2W60B 2RFXA 3BHBA 4GRWB 5E2WL 4GAGH 4I88A 4Z3HA 1EANA 3SOBH 3MOQA 5AL8A 1GGYA 3U30C 5I1KH 1ZTXL 5D1QA 5HHNA 1CF8H 2P8LA 3IFLL 5FYKD 5FYJE 1I8IB 1ZWIB 2CRIA 1TTCA 1DQML 3PWJA 3QHFH 4B9ZA 1L9TA 2FVNA 2RACA 4NEHB 4GRLA 2AQTA 5KZCB 1HWGB 2J7LA 4M48L 1QFUH 4FNQA 4MA3B 4QI3A 1INQA 1OLLA 3STZA 1EZSA 1KBPA 3PGFH 3UG3A 1I8UA 5ACMA 2NY6C 1IL1A 1G7MB 1S9YA 4EN2A 1FFQA 2HX8A 1SJVA 2Y2TA 5GGVY 4MXVF 5K9OB 1DUZA 3GXFA 4ICWA 2BNQB 3BXNB 2F08A 3HI5H 1AZVA 3VXPB 3Q7JA 1FDLL 2AFNA 4H1LA 1QHOA 3EDKA 2HRPL 2XWDA 5T1DL 4RZKA 3CBKB 3SDAD 1TUPA 2WLIB 3EYOA 3O9WC 4R5XA 1Q9WA 1TPXB 4KRMB 2JVUA 4OCXL 3UC0L 2XWCA 2ZSWB 4HWZA 5J6GB 5HI3D 2R2BB 2A6IB 3IXAB 4WCYH 5ESAB 3R8QA 2UUDK 2OMXB 1TKWB 3GINA 2IAMC 4IMKC 2ALAA 1R34A 1EEQA 3P30H 1QFWH 5EUKB 5LGHH 1CFVL 2CO7B 3ECQA 5F0MB 5A7BA 5DLML 1FFPB 1S7UA 3AG3B 3S37L 4K3DH 4POUB 2HFEA 1CICB 4GJTB 2ZAIA 4PRHD 4XXCA 2GTWB 3DUSA 3HR6A 2W9DL 4ONOA 3F64A 2OMWB 1JMZA 2EC9T 5D5MB 5K5YA 1I3UA 2J5LC 1YY9D 1ZXQA 4JKMA 4JGMA 4KTEL 2FX7H 4DQOH 1W6WA 4CVZA 5AW1B 1I8KA 3VFPB 4GG8B 2B1OA 4EBQL 3QDGB 2HKFH 2R56H 3SE3A 1XZ0A 1E2WA 1DVFA 3PXHA 5D2LE 4KKAC 2G9HA 3G6DH 3RUGF 2EIKB 1UOKA 2XIDA 1HAWA 5FIEA 3WG7B 5DO2D 1M7XA 2FK9A 5C1MB 4GQZA 2IFFH 3WKQA 4HPHA 1AZNA 2Q3ZA 3QAZB 5H4YA 2VTFA 4N24A 4QJ4B 1Y7VA 5E9AA 1QMUA 1TF4A 4WV1C 1TCMA 1VFMA 2WQUA 2DQUH 2I07A 1HC1A 3CVHA 1YDPA 1Y18A 2CUMA 3TLRA 4NOBA 3KXFE 2VDQH 3ARFB 2XKNB 4GINA 5DJCA 2F9BT 2NNAB 5LO7A 4OD2B 3HZVA 7PAZA 4X6DA 3QDJD 1ZA6A 5BQDA 1RK0A 2DIAA 3K5SA 1ZHNB 3QUYD 4MAYC 3N85L 1KIPA 2MQ3A 4P46A 1A4KA 5FB8B 1H3TA 1RD6A 4FQQA 5LBSH 4LQFH 1CXHA 4PJ7B 4IHOA 3ZE1F 1HHJB 1DJWA 1A3LL 4KVCL 1H3GA 4Z78A 3MNDA 3FQRA 1C5BL 2YGQA 2YRBA 1MFDL 1G6VK 4FQHA 4G6FB 1D9KA 1WAAE 3DMMB 2C9PA 3N55A 2JKJA 3L5JA 3DXAB 2GW5A 2J5WA 2XACC 5EBMA 4MA7H 3BEVB 5ID1B 2NMSA 4PJDA 3CV5A 2IANE 1ETZB 2RH0A 2BCKB 3C87A 3ZK0A 2DMGA 2UXGA 5CJ5A 5IEKA 1K4CB 2CLZA 1AANA 2JTDA 3EH4B 3MV8D 4IBSA 4K7FA 4BZ2L 2Q2LA 3O0RL 2YK1H 4HUNB 1A9EA 4NZDA 3RJOA 3EGDA 3NK3A 1R19A 3IPBA 3PUCA 4RFOH 1A6UL 1IFRA 3HAEA 3UJIH 1PY4A 2Y1YA 1JIBA 5HYFA 2YGPA 4GKSB 2CRYA 5T3XH 4DN4L 1EAJA 2ICEA 4UF7C 4XMKL 5INDB 5KVEH 5MI0C 3ULUH 4IU3B 3O8XA 4WW2C 3NT0A 6CGTA 2P42B 4GSRA 3N44F 3EFDH 5K9QG 2D8KA 4N2HA 1WFOA 4HISA 1QSZA 1NCUA 3SN6N 3QNXB 3X3FH 5IROA 3ETBF 1AGFB 3MLZL 3SKOB 2ATKA 1S3KH 3D6GA 4H8VA 4KDTA 4QEGA 4TOYL 3PYCA 3DO7B 4YHMH 4BFEA 2B0SL 5CKAA 5EOCJ 2DYPB 4HWNA 3RWEA 5IIEA 1HCFX 2YQ2A 4IOIA 4LP5A 4TTDD 4XWGH 2KC0A 5CUSH 4DTGL 3EJTA 3TWCH 2A6JA 3D30A 1S7WB 3CIQA 3F5WB 5GGTH 3QIWC 5ETUA 5ADOL 5JOFB 4HJSA 4ONFL 5DS8A 2C3VB 4JG0H 5DQDH 1O9ZA 1T21B 1ZPUA 3VQMA 4DP9X 5F0JB 4XMVA 5I1LA 4NWTH 1Z9LA 5DZJA 4QHMA 4U4BA 1L7TL 1YEIL 1GOFA 5GRXG 1TTAA 2YRLA 1D7BA 5TE7H 2C5DC 4I85A 3K2MC 4FCAA 1I3GH 1NGXA 4G43B 1I7RB 3VE0A 5IQMA 3U46A 5HHOD 3INUL 4M7LL 3PGDA 3Q3GA 1H6FA 2J8UF 4WKZA 2ZXAA 1N18A 3FNKA 1ZPLA 1CUOA 3GIZL 2EDFA 1FNEB 1OQXA 3QR1A 5I6OA 5IWLC 4LLDA 5C0BE 3RY6A 3POHA 1RZ8A 2WGXA 5E6SB 5EEYA 4KV5F 4NBYB 1KPUB 2NNCA 1FGVH 4HEME 4PGDA 4L4TB 2R4SL 5IBUB 1A14H 5SX4H 4PIRF 1T1ZB 4KZEL 1A02N 4WFHD 4XP9H 1RPUA 3DX4A 4P2AA 3WCYA 2FJGA 4K9JA 3CX2A 1XGTA 4PAZA 2VKWA 3C6LA 5EBLB 3V0WH 3FMGH 2W0FB 2DQFA 5B39A 4X0KA 2P8PA 1DSFH 2WOYA 2VDPL 4IW4C 5DEJA 5I6KA 4Q2ZB 5DZNA 2G3ZA 2VSCA 5DJDB 1MNUL 3MV01 3S3JA 1GOGA 3BSHA 3GKWH 3ZKMC 4OI7A 4O58H 1T6BX 2J1XA 4ZW8A 2HFTA 3D18A 4RGMC 3V4PL 2DWEB 3US1A 3WN5B 4G7SB 3DHUA 5JPNA 5B1JC 1IGYB 4MDJB 5FK9B 2VLJA 3VTMA 3MPCA 2IVFC 3MYZA 4KI5C 5BZZA 2WWMD 3P0VL 3SGEI 3ZUCA 3OKLA 3M7FB 1IBGH 5ICXA 2FJHA 1R17A 2ZG1A 4E2OA 3ULSB 1BZ9A 5DTFB 5FFLA 2Z92B 3U0TB 2NLJB 3G5YB 4PRBA 4K5OA 4HH9A 4KJWD 1DDHB 4NCDA 4YL9A 2H7WA 4PS4H 2A83A 3CNKA 4OZIE 1QRND 3PAZA 3RYMA 1XVSA 5DWUH 2ZTBA 4XPHL 3G5ZA 4PJXA 3D33A 5D96C 4LHQB 2VUOA 2ZCKH 3CZUB 3IM1A 5IHUL 1I8LC 5BJTA 3VFOA 3CK0H 1ZMYA 5ICZB 1XH2A 1B0RA 3WHXA 1P6WA 3GO1L 2CGRL 2JIXA 4HBCL 4FADA 2IOMA 2W91A 4TNVF 1J0IA 3TBCA 1XF4B 2BWIA 1AGDA 2NOYA 4P9HC 1QBBA 2MRYA 4OIIH 3SKMA 2VWEE 3VGAC 1XWVA 4TLUA 1QW9A 3MRNB 3HUJF 4XOAA 1NOLA 4E68A 2J8OA 1TJHH 4OU3A 3IMTA 4TS6A 4X9BA 1ADQH 1NGQL 1M7DB 4HWUA 1OTSD 1BYNA 3KYOB 3T6WA 4Y16A 1J8HB 4XBGB 2FO4B 2OXGB 3TEWA 3N43B 2LTQB 4DGWC 5EC1A 3D2UA 3V52H 3Q1SL 3GRBA 1A7PH 4OB5L 5D1XD 2P4AB 4IOSD 4NO5A 5EO1B 4FJ6A 3VXRB 1FNSH 4JUTA 3NDYE 5I17A 4MA1C 3EYSL 2EIEA 2FB4H 2X2YA 1FH5L 1Y07A 4WTZA 1NCDH 4M5SA 5GRUH 5I5IA 4ZXBC 1NIFA 3CPUA 3WNLA 3LXAA 2EDXA 5FF6B 3ULUC 1LHZA 2OSLB 4DKEH 5J89A 2OMUB 1RPQA 5I66A 4ZS7L 5D55A 5C0RL 1UM6H 3C2AL 1UD8A 2OBGA 4AQ1C 4KTGA 3CLEL 3JV4B 4LHUG 4DUXA 1DANT 5CZKA 1TJIL 4WWNA 5IJDC 4I18C 5IFHH 1KC5H 3NZHL 1OGAD 4YUEL 4FNSA 1DBAL 3N1GC 3ZGHA 1O9VA 3U4BH 2AK4B 3MZTA 2YARA 4OV5A 5DDHB 3QQDA 2E7HA 5E99H 1FO0L 4LIQH 1Z7JA 3F65A 3ISWA 4E9WA 1IM3A 4FABL 2Z93A 3RDTA 4NQCD 1KEGH 5JMRA 2WZAA 4XNZC 5DC9B 4OZGB 2AQNA 2OXHA 4G9DB 4NKMB 4Q97A 2VDLL 3P3YA 1GJIA 1NFIB 4U2ZA 3BP7B 5CWSB 3QJTB 1H3UA 1IQWH 4KHTH 3BD5A 4MS8C 4OBSA 3MLTB 4WHTB 2ETWA 2C3GA 4NAJA 4BFIB 4MMZA 2QQKH 4AGOA 4J5VA 2Q6WB 3TURA 3MRJA 4H25A 3UYOD 2K6WA 3RWFA 1MJJB 4I7ZC 4LLYB 3UTQB 3GHPA 3QUZC 4LAQL 4WO4B 2ZCZA 2ZNXA 3GXMA 4JFHE 2HG5B 4PJ6A 4YFDB 2IJ0C 2ILLA 3GBNH 3DI3B 2QADD 1CFMA 5CMAB 1G9ML 3F12A 4X99A 5J56B 2A0LC 2DL9A 4DPAX 3FCTB 2PYED 5LLIC 5IMMB 5JNYA 4W4OA 3QXDB 3HHSA 4FFYA 5IW6A 2JB5H 3L1OH 1JXKA 3WFEL 4NENA 3MMEB 1RZQA 3OLGA 4ZD3L 5GZOC 2FIRT 2ENPA 5HHMD 2X2IA 5FKPB 5F8RC 2YMOA 2X5PA 1DVTA 5E8OB 3VXSB 4JFOB 3MO1A 4PJ8A 4A7UA 1KFAL 3K4ZA 3K71A 1D6EA 1UFGA 3LKRA 2FAUA 1L7IL 2VDLB 3MLUH 5D2LB 1SN0A 4LGSB 4Y4KB 1HOCB 2CKBB 2BY1A 2DLFH 1MHPH 4IBZA 4X6FA 5I8OH 3GS0A 3O6LL 3I3EA 2CKNA 4EDWL 3FOLB 1IAIL 3ULVE 2V3FA 4ZSOA 1Q8MA 3T3PB 1EHKB 3L5WB 5D2NC 3CBRA 2IGLA 3OR7A 2X4QB 1HQ4B 1AHMA 4UM9B 2VLKA 4LE8A 1QSEE 2CHNA 2EQDA 4QRQA 3HEIB 4X4XA 3ILPB 4M1GL 4Q7DA 2H1PL 1UJ3B 4PJFE 3WEXB 5B8CA 5C0GA 1WLHA 3AB0C 4HFUL 4NZUH 5FKAB 4HS8H 3RILA 1H3XA 1BJ1J 1PPIA 3L3IA 1MCSA 2QZQA 3B1TA 4HMCA 3JTTB 4WY7H 1GGBL 3C60C 3DV4A 4B53A 3N6YA 3BPOC 3K8MA 3ARBA 4Z7WE 5F96L 1IGCH 4JFEA 4Y19D 1ID5I 4OF0A 4PJBA 5F7EL 1JWMB 4NNYB 4P2RB 3CMOL 5I1DB 4HPYL 5DJXA 5KYXB 1NGZA 5D7KE 2YPLA 4NQEE 3K7UA 1MCIA 3BVTA 3MRMA 2IBGA 1AQMA 7TAAA 2N56A 2JCCA 1B4LA 3A67L 1GY2A 3V4VL 3X3GL 5IG7A 3FRPB 1CDCA 2IGFL 5G2NA 5LAPA 2XZAL 1EFXD 2FIKB 4M3HA 2GJ6D 1D5MA 3DX9B 1YYMH 4FDWA 3TBYA 3VWKD 5AAPA 4JM2A 4EVNA 5E8EA 1OQOA 2OX5A 5EU6D 2D7PA 2P49B 3SD5A 3HG1D 2O5YL 4DVRH 3HCVA 3VXNA 1QZ1A 1IMHC 4OLUH 5JOPE 1DLHB 4CSZA 2ADJA 5TQ0H 2V9RA 3SBRA 2SEBA 2KDGA 2I25N 2A6DB 5HVGB 3WO4C 4DVBA 2DQCH 2HCZX 2VDMH 2AABH 2LGNA 4KJPD 4LT7A 2WBWB 1CWVA 1U92A 3P73B 4W70A 4ZAKA 4MS6A 4AZ8B 1WQVT 4QTHA 4HUVA 1NMCB 1CDBA 2VYRE 4G7VH 2HMIC 5LXVA 4F37K 1BMWA 4L29A 3LPPA 2WIMA 5F1IB 1NM9A 5CSZB 5GRJH 2F7QA 1T20A 1KGUA 3V4VB 5HYJE 3WIHL 1JF5A 1UH4A 2QQLL 2VXUH 1JPST 5I1GH 2DMHA 2CO6A 4PJIE 3O3BB 3BYYA 4BE5A 1I3VA 5C6TL 4NN5C 2CXKA 1TQCC 1RLBA 3K5RA 1UZ6F 2WLMA 1WFMA 5CSGA 4PCTA 1RIVL 4YPGA 2DJUA 5E2JA 4K5PA 3S97C 2Q86B 2V2TA 4WWKB 3LH2L 2WJ5A 4JRYE 5KW9L 4JY4B 3OQRA 3MA9L 3KCPA 3A24A 4KXZI 3NSXA 2OZ4L 5IW3A 4U49A 1GZHA 3WI9A 4AITA 3CUPB 1EEUA 5DJYA 4E9YA 3EXJA 2P7TB 4G6KH 3AQZA 4YHYB 4PRPB 1HXMB 1P6AB 2W8CA 3FUIA 3WFHB 2YLKA 1TTRA 2OYKA 2ATPB 3BKMH 1BMGA 3UO1H 3C09C 4X83A 1A5FH 2O30A 1NFAA 2VM4A 3U0PB 1FUNA 2EE3A 4GSDH 3MV7B 4A1RA 1Y1DA 5GS3A 1QUNB 5AW0B 5B38A 2H45A 2PO6A 1V8HA 1IAKA 3UG4A 4AGNA 5G5DB 4Z0BH 2E6PA 4FXKC 4NYLA 3FB6A 1JZEA 1X7SA 2BXYA 3NRFA 3U9UA 3GLZA 1VB9A 2CXGA 2AV7A 2ZD0A 1F58H 3TO4D 4G70B 3FQNB 3FS9A 2WWKT 1HIMH 3CDCA 4U1IB 4B3VA 2X4NA 4GG6E 4TVPL 1M9WA 3DURB 1KYOK 1Z9PA 1ZDQA 2MOGA 1ZS8B 4FNRA 4GW5A 5HYSA 1AGBA 4YOKA 5EU5A 5FYJD 4FNUA 5C09E 3MODL 2VLRD 3EAKA 3FQ2A 1NBCA 2WLJA 1NCNA 3GT6A 1C7TA 2VN3A 4PJEF 4UQDA 2I9LB 4NM8H 5F8QC 1GXEA 3WDHA 4PJHB 1MWAA 3OZ9L 1W72A 4TUKH 1TITA 1ITBB 4JL2A 4X7EC 5TH2B 3VX1A 5DK0B 3LNFA 4Y9EA 4L3EA 5KSBF 2CR6A 1SYVB 2E75C 3AQYA 4BKLB 3VFWB 4GT7A 1KJ2L 4IBUA 4XBPA 3BMWA 4FC3E 1JZ4A 1N2RB 3U0PA 3V79C 3T5WA 4TSAH 1I9IH 4EXKA 4OKVB 4J2QA 3TN0C 1JP5A 4AGMA 2FEEI 5I8CA 4WFGE 1NCTA 1WC7B 3FUJA 4RRPA 3DWTA 1NL0L 2VM3A 2NY4D 2IPTH 2OSXA 1BEYL 1SBSH 4L4VE 1TZHA 3DX7B 3KS0J 4Y5XB 4KY1H 4X7TA 1OTTD 1JGVH 4OGAD 5E9DE 3MCLH 1KGCE 1MVYA 3JXAA 2NY2C 2Y69B 3NJFA 3SSGA 1SXSA 2X53A 1W0WB 2EDBA 4NBZB 2OR9L 4RMSA 5MEOA 3DPBA 3FUHA 5SWZB 4NDMA 1CGTA 3IN0A 4MCZB 3RVUD 2DDQL 1MCRA 2HVJA 5D70H 2XT1B 1YYLH 5I8EB 1JBJA 2HT3C 3DVGB 2ZP8A 4Z5RB 1I9JH 2C7UA 1LP9E 3P0YL 4CC0A 3QJZA 4ZMPA 1TVDA 4KU1A 1CFSB 1FG2B 3IRCA 3FN9A 5BUPA 4DP7X 5IOKA 3CN1A 1KY7A 4EN3B 1ET5A 3LXUX 1NAML 1TEFA 4XPGL 4U2YA 1OEZW 4ZFFA 1Q4NX 1A9BA 4ZDHA 1OD7A 1P5UB 3QI9B 1K8IA 3V5DB 5B21A 4RFEA 3HC4L 5F9JB 1I9RL 3DOIA 5EDSA 4JM4H 4M4RA 2EXWD 3KPRA 3O6ML 4YHKL 3OAYK 4H8WL 3NG5A 3HZMB 1HCVA 1MCBA 3L81A 5HYQB 3LX9A 3QHZL 3ARDA 5L88H 1N7ML 3WJMA 1CBVH 2DQGL 3BQUD 5BPPA 3TEXA 4Y9CA 1I8AA 1GYAA 4YS4A 2G9KA 4QXTA 5F9OL 4HXAL 1U8HB 4K2UH 3OAUL 4J2XA 2VUKA 3OC5A 5T1LA 1PJWA 4AJWA 2OW7A 3HNSH 1NDMB 4KHXH 2EIZA 4FCHA 1LK2B 3PL6C 2W60A 2WOBA 3GRWH 4Q58C 4PG9B 3OD3A 1IGIL 3KXFD 3AWEA 3NPZB 4P4RA 4BA0A 1LO2H 5CILH 3TYGH 2F7RA 2WD0A 2CR0A 2YD7A 5DHVB 2J1WA 2Q5BA 5BRZE 4KZ0A 3VB8A 3RZCA 1XIWC 1AZBA 3DIFB 1UASA 4G80B 1NJ9A 1VESA 1C12A 3CBJB 4JMXA 4R2GD 4MA3A 1MW0A 4DFIA 5HHQB 4HLEA 3WJJC 1P9MA 4G3YH 2AMGA 3T4AA 2CGZA 2XVGA 1G7MA 3EYVB 5SWSB 4A6YB 4WUKH 2QVFB 3IE4A 5A43C 3EHBC 1XD1A 2E56A 3FFCA 1NAKH 2P45B 5JHDB 5K9OA 5ISZE 3HS0C 2ZYSA 3BXNA 3SEPA 1SY6L 4DNLA 1PLGH 3FHEA 3HE7B 3VXPA 4JB9L 4Z1PA 4P49A 5LG6A 4H26B 2HTKD 5C7ZA 3I9GH 4HH8A 2NY1D 2FBJL 1ITCA 1TZOA 4OV6F 2WLIA 3T0XA 2OMTB 5C0JB 1E3ZA 4PG2C 3S34H 4XZUA 5IBTH 1WF5A 3U4AA 3UO8B 3MLRL 3P4NA 2Z3FA 1RZIB 4LPUA 3MRKB 2UZXB 4WWOA 3F7RA 1SHWA 2EDNA 4EF3A 2Y72A 3ML9A 1ZAGA 5EUKA 1DJGA 1EGJH 5IMKB 2BOCB 3EG9B 1OW0C 4MKMA 2CO7A 1UKQA 2FWUA 1A6AB 4NC1C 4JPKL 3DOHA 1AHWC 4N6QA 1GVIA 4H13C 2PPCA 4M93C 3CHXA 8PAZA 5HI4C 1CICA 1TJGL 1MRFH 5KJ4A 2OMWA 3BN9D 4M1CC 4RMRA 5D5MA 3MLYH 2A4ZA 4UT6L 1XH0A 4YWGL 3OG4B 4NRYB 4HS6A 2OAAA 4QRPA 5JPMB 4PWJA 1EZVX 4AEEA 4F20A 4R9HA 2R0LL 2Q3XA 5IFJB 3VFPA 2BZ7A 4K8RL 4JPWL 2BSED 4XNXL 2ISDA 4ZFOL 1C5DA 1WT5C 4IMLB 3ZHDA 5E08H 1KULA 4QRSA 4WSJA 3IU3B 4U0RB 3LHAA 3SDDD 3W11D 2XQBH 4NQSA 2X9YA 1JSYA 1SJEA 1G5AA 3VWJA 1GHFL 2KI6A 4XP1H 1D5RA 1QG3A 1J5CA 1PTZA 1F3DJ 4PJFB 2D7NA 4APXB 3AJ7A 3QJVB 1RL1A 2NT0A 4F7EB 2XCMC 2FZ3B 2D0FA 3LEYL 2YAHA 4Z3JA 4Y4HD 4WFEE 2XPGB 4NM4H 2A4CA 5LJYH 2OL3H 4XP6H 4XO4A 4F91B 4NAMA 4Q6KA 4Z7WB 3UZEC 2G5RA 5EZOL 3UACA 3GFUA 5DSCB 1L9OA 1PYWB 3SGEH 3VXOB 2ZCHH 4NLHA 3AWFA 3FFDB 1DLFL 4NQEB 4NZJA 5EPMA 4Q6IB 4G42B 1J05A 3TVMC 2VN6A 5C0CA 5E56A 4YSTA 2DIEA 4HUCA 3VU2A 3CD4A 3IRZA 3FPYA 3SQBA 2NY3C 2C7FA 4IS6B 4UM8B 2GC4C 1SLWA 4ZFOB 4KZDL 5E5LA 4F3FB 4BXSV 3N42F 1QABA 2DQEH 3ZL4L 4LSSH 4R4NC 4M7KH 4P5MB 1F5WA 5C0BD 2EC8A 1AY1H 4OCSH 4YNYA 4A2LA 3KWVA 1YEGL 3LPWA 4HK0B 2D4DA 3KLQA 5DJ8B 3SDXE 5EN3A 3IFPB 3ZZSA 2P43B 5AB2A 5GJSH 4MVBC 1F18A 1YEEH 5ECGA 4HHAA 3L08A 3GS7A 5IVZB 5ALBL 1WFNA 2XN1A 4FRWA 4PVBA 1U8CA 2BCKA 3IMWA 5FYKL 1DQDL 3RY4A 4TQPA 4U4IA 3AGWA 2J56A 2R9HC 1ZLVK 4D7BA 4GIAA 1TO5A 3IETA 3NBNA 2VC2L 4LRIC 4ALAL 4NQVB 2HTLC 2NSQA 1OK0A 4P2OB 3HB3D 5HI5D 3NZUA 3QFJA 2XC8A 4CSSA 1NOAA 4NQXB 4DGUA 2IDSA 1Z3GH 1Z1WA 1F2XK 3SZ6A 4S1DD 35C8L 2YRZA 5I16A 4N90E 3TXAA 1TVHB 3OB0K 4JCLA 3JWDL 4X42A 4G1MA 5DQ9A 3KLLA 4AGPA 5I1AA 4IU3A 3RRQA 2ZUWA 1ORQA 2Y36L 3MRHA 3AXHA 4XNMA 4ODBD 1ZCRA 4JFFE 4IKIA 1PKQE 4LLWB 3GQFA 4JHUA 1KYFA 4ZFQA 3PGCB 3U7AA 3N1PC 1X7QB 4E36A 4JFPB 2EVFA 2A9BA 3BOVA 3GJFH 5MENA 2PR4H 3FYIB 4AYDC 3OLEA 3U79A 3NH7H 3RX7A 2PWGA 3DO7A 2ALWA 3U6RA 3CSTA 1AQHA 3O3AB 1NGPL 5AKSA 1INDH 5ENWA 1T7ZA 4OF5A 1S7WA 2XVBA 3O3DB 3F5WA 2X7LA 4OF7A 3H7BB 3OKNB 2WTPA 4CRPA 4IIQC 4BZ2A 3B9DA 5JOFA 3C5ZD 3WLBB 1N5YH 5CN3A 1T21A 4DN3H 1I82A 3VQLA 4I5BB 4WI7A 4OCWL 7PCYA 3BO8A 1OPGH 4X9YA 3Q2LA 2KDYA 4ZK8A 3DETC 1KCWA 4RA3A 5CHNA 2JE8A 5DUMH 3FU5A 4M61B 4G43A 4TLKA 5EEZA 1S4IA 2AXJA 2WCPA 3QO1B 4LNRA 2CUHA 4KI5E 5FHAH 5I1IH 1BZEA 3AXIA 3W2DH 3NPSB 4XMLL 3BD3A 1HZKA 3M86A 3CVDA 4NQTA 2ZP9A 5I0XA 4E41D 4LQ1A 3ZKNC 3OSKA 3QJRB 1LD9A 5E6IA 5DHYB 3DOSA 1CD1B 2PWFA 1QSFB 1IFHL 3QZOA 4JY5H 4CDGC 2D9QB 4KTDH 1KPVB 3CHPA 3Q2NA 3IMBA 2WQRA 1T1ZA 3QJFA 2AEQL 4YHLH 1IIKA 4XRCA 5K39A 3SE4A 1FYTD 5HY9A 5DS1A 4OQTH 5GS0H 2X6VA 43CAB 3IPEA 5ACZB 3CQFA 4HZAA 3VRLE 1RURL 3LRLA 5F9WB 3ZKXC 2JELH 3ARPA 3MLPA 3AT8A 3UBGA 1RHHB 2W07B 5DJDA 2J88L 1OSYA 2N0KA 2JF1A 3DGCR 2CHZA 2RJMA 2VUYA 3T09A 4BQ8A 3NIFF 3VFNB 4IBTA 5B3JE 2DWEA 2J25A 1KB5B 2ZAGA 3CXHJ 1PG7H 4M7LT 4HXBL 3CX5J 4N8CL 3V0IA 3WN5A 1MJUL 1IGYA 3VA2C 1BD2D 3ARUA 1Y0LA 5I18L 1A6PA 5IMLB 2MJWA 3KNBB 4XCEB 3LD8C 3QAQA 2NYZA 4I1NB 2KLSA 3MUZ1 3ILEA 2NQ3A 5DTFA 4HCRL 1R24B 5EC2B 3DTXA 2NLJA 3G5YA 3HC3L 4R7NB 5EBGA 5GZNC 4JO2L 3HIZA 5IESL 2PWHA 5C0AE 3MOAL 3NCJL 2FT8A 5T3XE 2DKMA 2Z91A 5KVEE 4LLQB 3ULUE 2FWSA 2OKMA 5D1ZD 4ERSL 2WBJD 1XL6A 1WAAF 4GBXC 2EEBA 1RH8A 3LY6A 2HKHH 4XNUH 1O5PA 1S7RB 1S7VB 2YMXH 3V7AE 3E6HB 2DI8A 4XO8A 1DE4A 1KXHA 4GFTB 4P4KB 4DK3A 3QUML 1FZOA 5HJ3B 4B60A 3B2DC 1M71B 3WENA 1ORSB 3O6FC 1DQLH 4LPCA 5AOZA 4FQCH 4HF5L 4X4YB 4BZYA 4OFIA 3WL9B 4F15C 5CZXC 4F57L 4H88L 4NUPA 2ZWYA 1FFOA 1D5BA 4RGNB 3V4PA 3WMSA 3TZVD 1M7DA 3KYOA 4HJGB 4YBQC 4R97C 1J8HA 4UV4L 3ES6B 4PY7A 3F01A 4H8PA 4UT7L 5EO1A 5E9NA 1G4MA 3Q8EA 3VXRA 2V17H 5IBLD 2EH7H 4LGRB 2H32B 1T22B 4PEEA 3EH2A 3O4LE 5KYYA 1RPKA 3GB7B 4MMXA 4ECNA 3RVXD 5DD5H 3EOTL 1OPOA 2I69A 4YXKL 2EKJA 3SO3C 4KGJA 4WENB 4NUMA 5DZAA 4JQIL 1GOHA 1FL5A 3VXQB 1F4XH 1TEYA 2NX5E 2E7LA 2J44A 4QF1B 5BRZB 3MKKA 5DZ9A 5KG9A 4K5MA 5D7KD 1E7UA 1CIDA 1RUAH 1JDAA 1WBZB 4JPSA 1DVUA 2AQ3A 1EXUA 4W81A 3ILDA 3OKMB 2DPKA 4KK6D 2GAZA 3VFRA 4HKBB 4XMWA 1A6WL 3QUMB 4E42A 1U30A 3W0WE 2CJUH 2AK4A 2WLKA 3R18A 3E1ZA 5D8JH 2BIPA 2X88A 5DMKA 1NCCH 4MNGE 2ZUQB 3KYAA 3U1SH 1NWPA 2HZHA 2X6BA 2R29L 4OZGA 3NFSH 4G9DA 4R4FL 5JOPD 3DJZA 3APCA 1IVLA 1NFIA 4WZ9A 5CWSA 3BP7A 3O2DH 3VXUD 3NJHA 5AYQA 2W94A 3MLTA 1KLGB 4WHTA 5DURD 3DX8B 5D2NE 3QRBA 1TTBA 3VGGA 4JUSA 4PRID 1DQTA 3QS2A 3CH1A 3GZOA 2BVTA 3QG7L 4NO3B 4YSPA 2CR3A 5C0IB 4NGHH 4WO4A 1JTTA 2HKAA 3GHEH 5GIRA 5CJOL 3G5WA 4P2QE 5E03A 2YIHA 2NUPB 3TPUB 3UAAA 2LVEA 2FDBP 2BVPA 5BV7L 2VM9A 2FGWL 1C1EH 3FCTA 3FTUA 3FSWA 3SKJL 3QXDA 1KCUL 5T1KD 4Q4EA 2IF7A 2X4SA 1TZ8A 4GKLA 3OKOB 2VLLB 2KLRA 1HQRB 4UTAL 5F7YC 2VXVH 4MJJA 2FHBA 3APFA 5CXPA 5FW7A 1NCAL 2XKUA 3CZFB 3SPIA 3W39B 3ILQC 4JREC 4NT6B 4JRYD 2ORBH 2Y7QA 4Y4KA 3MBEB 3BSGA 5KVGH 1FZMB 3T1WA 4L5FL 1NZRA 4FQ2H 1QRKA 4LSVL 2APWA 3S8WA 4I3SL 1X5IA 3MTRA 4HGMA 2XOTA 3UADA 1TOXA 4BFRA 3L5WA 5AFAA 2X4QA 1HQ4A 5DUPH 1E5AA 1C7SA 4NP4L 2QMJA 4OD3L 5LUMA 2P5EE 4BFGA 4PV1C 3H2QA 1UJ3A 4OM0H 5CNHA 2R69L 4JRXE 4R0LC 2FLRT 5FKAA 5CBEB 4AMXA 4HIEA 2NYKA 1FJ1B 1ZVYA 2IPUK 3PP4L 4GSQA 4L8SC 4EDXA 5DEZA 3IF1A 3WFCH 5BV7B 1BQKA 2A9CA 3ZO0A 1KEML 4RNRB 2MHAA 5FWRA 5TD4A 4PGEA 2P47B 3VH8B 5D7JC 3TFBA 4J3VA 5GSVB 3WKNA 3SDCC 4EEEA 4F2ME 1SDYA 1N64L 2WQXA 5I75B 2ZOKB 2VAAB 4FFVD 2MPAL 4NNYA 1TETH 2X6AA 4QR7A 5I1DA 3WOVA 3X17A 3BIKA 2HA1A 5KYXA 3QDMB 1NPUA 4U1NA 4XH2B 2C9XA 4Q0XH 2IOIA 1UOWA 4U1HA 1UB6B 1CLZH 4Z3EA 3EBGA 1P0SE 4EUPA 4AG4H 3QUKB 4MDIB 2FIKA 3WEBA 4AE1A 2OFQA 4OTXH 2X1WL 1GGCL 2X28A 5ADPH 1K3ZA 5HGBB 4S1QH 3MGTA 4MFHA 2YD3A 2Q76A 2GFBB 4R8WL 3CZGA 3IVKB 1FAIL 3FT3B 3WY4A 4LVOC 1R3HA 4AV4A 1FIGL 1RV6X 5HVWA 3QZWB 3GBDA 3QH3B 2ZWZA 3H9ZA 1Z5HA 4O5LL 5IQ9A 3WS3B 1NGWB 2H2PC 2ZOLB 4KPHL 4LIQE 4Z7OB 3OWRA 1AKJD 3B37A 3CQQA 3WIIH 5I5RA 1E4XI 2OMZB 2OTWB 3UMNA 3DJSA 4GRLC 3BVWA 3QIBC 3EFOB 3BPLB 4B5ZA 4PJCA 1ACYH 1INEL 3L7FA 1S7QB 2R23B 3ZRCC 1ASOA 5CEXA 3RE0A 3FU7B 4L4VD 2D2CC 1J8SA 2BNRE 4AXWA 2BVQA 4NX0A 1JNJA 1H6EA 3CLFH 1KGCD 2LAAA 2ODIA 5CSZA 4PJEB 5AB0A 2KERA 2IMNA 2YLHA 3V4VA 1T83A 3PWNB 4JL1A 3P69A 3VCLA 1BDYA 1BQSA 3BFQG 1UURA 1EBAA 3ZUNC 3WTXA 3O3BA 1HHKB 3VFTA 1G0YR 1MHHA 3REVB 1R46A 1KELH 5EULV 1H0DA 4ELMF 4KQ4H 2A7BA 1QFPA 1XZWA 3LSOB 2VISA 4HAKA 3TA3D 4I0PD 2Q86A 3UTSB 1IM9D 5FX3A 4AUJA 2FATH 2EXTA 2J72A 1MCWM 2WO4A 3E1F1 2LU4A 5BQ7B 1CTMA 5HVFB 1S5IL 3HMWH 2A4EA 3EOBA 4JDZA 3V0AC 1IBBA 1RJZB 4LCCA 4OM1L 4UDTA 4XBMA 5GJTH 3TIDB 4XXCC 5L7XH 1OCRB 1XF1A 3O4OB 1J8RA 1MCHA 5DJZB 5KSVB 4QRAA 4LCWE 1G5GA 4P5TA 3MKGA 3VVWA 3UTTE 1DQIA 3LZRA 2BVEA 4UQ2B 5H37A 3WIHA 3KJ6L 1MI5D 3CVIH 1AQDB 2F68X 3COOA 1A4AA 1L4IA 3O9WD 3KWUA 4CMMA 4Z77B 3S36H 4KKLC 2X2HA 1M56B 1QFWM 2Q8BH 3RWJA 2IAMD 4U1IA 3T77B 1WH0A 5E2TH 3FN3A 1ZXKA 3DURA 3QDAA 2V37A 4O9HH 4ONHA 4U3HA 4AUYA 3M8OH 1IC4L 3QQ9C 3LHPL 5HGAA 2JJUA 3QIUD 3PIQB 3AVEA 4BIKA 2OZ4A 3TC9A 2CJTA 4ODHH 2VDKH 1YA5A 1UD2A 2FQGA 5E2VL 2ED6A 4MAUH 3VXMA 1NCOA 3BRFA 1XB8A 2LFEA 1U8KB 1B4TA 3CFDA 4M7ZC 1BPVA 2I9LA 1DBKH 1QHPA 5TH2A 4Y4FA 1DL7L 2X0WA 1BBJB 4P23B 1SYVA 2DQIH 2BDNH 1S7XA 3VFWA 3BKJH 3FTSA 5ISZD 2VZVA 4P46C 5JHBA 2LVCA 4LSUH 4MKTA 4OKVA 2DBLH 3BT2L 1EFQA 4IRSB 3TBVB 3HNVL 4KKAD 1S9XB 1HEHC 5E95B 3ZDYE 3VDBA 3EYFA 1T1WB 2G75B 2RMNA 1UWEL 3DYMA 3D8MA 2XQYG 4J6RL 4NQDE 2ARJQ 4KJYB 3SYAA 4PRAB 2VAJA 3MFGB 5MHSE 1D9KC 4A67A 3K3QA 5I15H 3FO2B 2ZWKA 4JFXB 4KX7A 4PHXA 3D0AA 4MA1B 1UGKA 1QLFA 1W0WA 1ETA1 3WGVB 2BX5A 5HD8D 5FGBA 1UT2A 5SWZA 2QFRA 3V5KB 5C0AB 4MCZA 1QFOA 4QRFA 4EI5B 5KS9F 3RWDB 3IGUA 1UM4H 2AJZB 1VGEH 1OCWH 2UWEF 4C56B 1XSKA 1WBXB 1ERNA 1KLUA 3AY4A 3ZHNA 4K94L 3BDXA 2ESVA 1VZGA 2L04A 5I1JH 1MFEL 3ZPDA 3T8VA 2W88A 4PJGF 4BBWA 4EN3A 4MAYD 2C3XA 1JOIA 4YFLF 1HTYA 3T2PA 1RZKH 3RIAK 3RJQB 4I89A 4BWWA 4IBVA 5C9JB 4H0IA 1P5UA 2VCOA 1GZQB 5FYKU 3V5DA 5IJVA 1Q90A 4K3HA 2ICEC 1A0QL 1U3HD 2XN9A 4I48B 4LCIH 3UAJA 4XNZB 3UH8A 3VD2A 1R5WB 3DJTA 5CS7A 4CU6A 4JVPA 4P05A 2DB8A 5I73C 1OZTG 4YDIL 3WE6B 4KVNH 2CDFA 2IQAA 1G1CA 3TCTA 3TNNA 3KM1A 3HG1B 2ZICA 5LAXA 4ZMWA 3S35X 1DVXA 4M00A 3EYUH 3O4LB 2GT9A 5F97E 3EOAB 4EPSA 1YNLL 3FBQA 4KDTC 1J0HA 4LVHB 3X1BA 5E8NA 4BFFA 4OFPA 2Q8AL 3QDHA 3QUZB 4W9LC 3GI8H 1J11A 1GY1A 4GQRA 4ZYKB 3I6LE 4JHAL 4UT9L 1E9OB 2MQ0A 1OALA 5C7XH 1RUQL 1G43A 3U7YL 1NUDA 5F6IB 2MQCA 3LN5B 1RP8A 2ZAHA 4HGWA 1LE9B 1L0YA 4W9CC 2HFGH 4I87A 1PU0A 2IBBA 2X89D 3RUGA 4NC1E 5DHVA 2FUQA 1HILB 4KUZH 4FQXB 3QUXD 5FW8A 4JFYB 25C8H 1JGEB 1JRHH 2ZXBA 4L8DB 3RL1B 3DIFA 5E8PB 5HDRA 4AL8L 1MIEH 4L3CA 1F90L 1P53A 1RIHH 4E9VA 5DRXA 3TJEL 1G6RH 4RISH 3EYVA 3HAEG 1V27A 5SWSA 4A6YA 4XPBL 5IZ7A 3QC5X 1SEBB 3VI3A 2QVIA 3U2SB 4K73A 1UM5L 3WBDA 4PLKC 1F4WL 2IH1B 3W82A 3L48A 4HUKB 2FT6A 3ETSA 2D9CA 3FTXA 3FH7A 3N0AA 4O2FB 3GTVA 5IB5B 5KUKA 3QWRA 1QWNA 2BWQA 2YQ3A 4A37A 3DRQB 3EJSA 4NKDA 4EAEA 1U4EA 4ZPTB 2ZYRA 5EZPA 3RY6C 3V6FA 5I6XC 3GJEA 2QVMA 1R3LB 4MHHG 1RZIA 3O81A 4RMVA 3EF7A 1RIUL 1ZJBA 2HSIA 4D0BB 3QIWD 3AB0B 1JHKH 2JTYA 4GG6F 4NQQA 1D7DA 3N42B 4U1GC 3C6SA 3ATDA 3MRDB 3VSTA 5AWNL 3QJSB 4Y2DC 4HC1L 3MV11 3C6LC 1Z9MA 2VKXA 3L4ZA 3D0LA 1R1CA 2V5SA 4POZC 1CGVA 1WAPA 2VR4A 2J6EL 2BIHA 4M3JA 5K9KB 4N90D 3B7TA 3L6FA 2M2DA 3NCYS 4QXUL 5D6DA 5IQ7L 3OM3B 5T3ZH 2J71A 1AMYA 3L9YA 3EBAA 2IDFA 4WGVB 5CP7B 4NRYA 3TU6A 2FX9H 3OAZK 2OW6A 4U3CA 2BHFA 4JFFD 3QNYB 2VXQL 1A2YB 3IJ9A 5LBVA 3IDXL 1U3JA 3E8UL 5JPNC 1BP3B 3RTQA 3MNVB 3T3MF 1BQHB 3RIKA 4F37F 1SY6A 4PJ9C 3IU3A 4JO1H 3F83A 1PGRB 2AJXL 1XX9C 4F8OA 4OI8A 3IGFA 2D3JA 2DICA 5EORH 1FLRL 1NBVL 1YNKH 1Z0MA 4XGZB 4RIRB 1S7SB 4S0TD 1GRWA 4CMHC 3UJJL 4H8UA 4ZMQA 4Z7UA 2VLRB 2XA8H 4N0YH 3A6CL 2WUCH 5E94A 1U8OB 3LRSB 1P7BA 2EDDA 3ZYJA 3DVNB 3F3HA 5F7HA 4JS7A 4DKTA 2OJEA 5H35A 1USQA 4ZUVB 3Q6GL 1X5HA 2PTTB 1XB3A 5AW7B 5EO9B 5TF0A 2HVKB 3N50A 4KUCD 4PRDA 2AXGB 4V11A 4IRJB 1CS6A 1PYWA 1T1XA 1YCSA 1QBLH 2DWSA 4OCYL 4A39A 4IRZL 4UT6A 3EXLA 2Y6SC 3FFDA 4OLVH 4XVUC 3PY9A 4IU2B 3LAFA 4PSRA 4G42A 4ZZKA 1IFGA 3O0LA 2YQGA 1BOGB 1OM9A 1NBQA 2YAEA 4JHVA 2ZXEB 1IB5A 4KI5D 5B39G 4Y16C 2EICA 2EYSA 3CZNA 4IS6A 3HE6A 2WY3B 2WZ6A 4M8QA 4UM8A 2EEXA 4ZFOA 3D39A 2WXGA 4JDEB 2G60H 3P11H 2MPVA 3TH2T 5AZEL 1RFDL 4LHUD 1M42A 5CAYB 3NN8B 3IGLA 1ZK5A 2ITCA 3T2NH 1GSKA 1WWBX 3MRLA 5IB1A 2RALA 2BY0A 3FF8A 1DVZA 3OV6A 2AQRA 3LPGA 2FSEB 4PU2A 1KN2L 2Q0ZX 2X9ZA 4UQ9A 5KVEL 2NPLX 1KYDA 3VFSB 4WW1A 4X5XB 2J8UA 4G7RB 1IGJA 5FO9A 3LS5L 5IT2H 1OARL 1W0YT 5C07B 3H3PL 1HYSD 4UNUA 1KCSL 1P1VA 1BFOB 1WZAA 3I2CL 4P2OA 3IB4A 3ZTJH 4DP6X 5ILTH 3JZYA 4H8HA 3ZDZE 3ZZLA 3MUJA 2CK0L 2NY5L 1IILE 1JGDB 3KGUA 3MFFB 1L9MA 4JY6B 1YZZA 1K2DA 1TVHA 2BZCA 3EJCA 1KB3A 1AS7A 1C16A 1QEXA 3ELAT 3BQUB 1U6AL 1XEUA 2V0AA 3OAWA 4ZXBD 2CIKA 2HLAB 1A7RL 4NZFA 5T3XD 4F7PB 3FH5A 1EEYB 2VDRH 3K8LA 3ULUD 2IQ9H 1X7QA 3W3BA 3FU6A 5EO0B 3QPXH 4JFPA 4M6OH 2O5XL 3BD4A 4XMTA 1H5BA 2F53E 1EHAA 4I77L 3ESNA 3STLA 3V9FA 1NMBL 2XFXB 3VI4E 1DDTA 3KYMA 3NIFB 5HSFA 4R7DB 1HKLL 5E23A 3DA0A 2TAAA 4PI0A 3SKNA 1MN4A 4WTZG 2XWRA 3L16A 3ZE0F 4QRBA 4NZRL 3RNQB 3O3AA 1YEDB 2PWDA 4K5LA 4W4OC 2XTJD 4WQOA 3DECA 1J9TA 4PS3A 3BPNC 1ZA3B 4XN7A 5DD1L 1SN5A 4HSQA 5DD3H 4RZCB 2PYFB 3UTTB 2WYHA 3D5OF 3QPKA 3LPOA 4KFZC 4PJ8C 1J8KA 4L1DA 4B97A 4K9EL 3BLBA 3L5HA 4Y2LA 2ICWB 3V6OA 4MS8D 3UDWA 1M6UA 3AU1A 3O2VL 1MWAH 1G7HA 2CZNA 4AEFA 3O41A 2IV9A 2XLLA 1TCRB 4X2UA 3SDAA 2BRRH 1CE6B 3ZKSD 5E4EB 3RFZA 4ZW3A 1TQWA 3QJXA 2AV1A 3TBSB 4F33A 4GOSA 1WA1X 2R4RL 3HUJA 2NX5D 1BBDL 1Y6NR 2PW1A 1OWRM 1FV1B 3HHMA 4OZFH 4TXVB 2A0LD 1M3JA 1CD1A 4XAKE 5DHYA 5FO7A 1CFQB 1EDHA 4ZMLA 3QORD 2F2HA 4LARL 3OVUB 3C08H 3PS6A 1KPVA 3B9AA 1KIRA 1SFHA 2EYRB 3JYBA 4YGAB 3ARBC 5C08D 5DMIH 3TV8A 1EDYA 3W0WD 1MIMH 4DO5A 4PRHA 1KB9J 3ESPA 5E70A 3FN0H 3BP4A 5GZOD 1M4KA 3NACL 2K7PA 5ACZA 4MXWH 3MJ8B 3CPLB 4GQQA 4WO0A 1MFBL 2A2QT 5JDSB 2E8ZA 4B50A 4N25A 4DW2H 1CB4A 1JDCA 4YXHL 2CHXA 1LK3L 4R6UA 3ZBMA 2YUWA 3Q8FA 5CZVL 1VPOL 4R83A 4OFDA 5CJQL 3UG5A 3NQKA 2VQ1B 5KAQF 3QZBA 4O02B 3QJOA 2PCFB 3KL0A 1KN4L 5IMLA 3KNBA 2FH8A 4O4YH 4KAQL 4NXKA 3KLHD 4R4BB 1BZ8A 2DLIA 4WJKB 4WNJA 1QLEH 4HG4K 1R24A 4JHZA 4MBRA 5J3HD 4R7NA 4P2QD 3NCMA 2RCSL 3C60D 2A1WH 4WW2F 5KYUA 1AH1A 4UOW1 4LLQA 3GHBH 4Q52A 2KS0A 2D7OA 4KY2A 4Y4HB 4N2DA 2AEIT 1FC2D 4DAGH 4UQAA 2OLDA 2NY7L 3KL5A 3MXVL 1NCWL 4Y2OA 3VFGL 3HFMH 1XIWB 1A3RL 1FWXA 3GDBA 1OB0A 4OLYL 3WTUA 1LEKB 1CZ8L 2BINA 1PZ3A 3SDXF 1XTMA 3LIZH 1DQKA 3D50A 4U1SB 2Z31B 3BW9B 1IC5H 4UILL 5B7FA 5AEAA 1OTUC 3ARGC 1ZJAA 2WUBL 4Z7QF 4ZFGH 3QDJA 5HJ3A 3PWLA 3LB6C 2A77H 1M71A 3RG1C 2ENYA 5DHEA 3UTZB 4GRWH 3OJVC 4YZWA 3EHBB 3CVCA 3N1MC 5FWQA 3V4UL 4ZQTA 3KDMB 1E4XH 4HJGA 4K7PH 4QNPF 4BH8B 1DJIA 3IJEA 1ZT7A 5DZLA 1AXIB 3VFMB 2P5ED 3VYNA 4Z7VE 4JKPH 1RP9A 4JRXD 1UTDA 4N2FA 4HCRA 1ZSDB 1UKSA 3GB7A 4DCQB 5I0VA 3VXTB 5L4FA 4I2XA 1GZHC 5TGBB 1N6UA 1U95B 2DOCA 2Q1EA 3QS3A 2FTAA 2VN5A 4PCYA 4UINH 4PJ5E 3QQNA 4CW1B 2A73A 4I3RL 1SOXA 4DGVH 2F1BA 4FQLH 5DVNA 1AHWB 2K6ZA 2HMID 5DVMA 4RGOL 1UD4A 5D7LE 3MV8A 1C08B 4AQAA 4HU8A 2X4PB 2CBTA 2JNZA 3E38A 2BHZA 3L4CA 3OKMA 1JFQL 3QRGH 4MJHA 3QUMA 1QI3A 5E00B 1OB1B 4XPFL 4Y7OC 4D8PB 3KYKL 5E2WH 2PCPB 4F5CE 1EJOL 3AS3A 4NP9A 1ZTXH 1NANI 4LL1A 3MRCA 4UQ3A 4B96A 3ASOB 4U3SA 1SVCP 3TT3H 3U6XA 3NJNA 1MCPL 4KITB 1TO4A 3BKCH 1IE4A 1PZDA 3CDZB 3SJVD 5KN5A 2HWZL 3H42L 4KUCF 2CHWA 3V2AR 1KLGA 4Q9BA 4JZJB 5FYLE 1HH9B 4JFQB 3LN9A 2MMXA 3B3BA 3N40P 4G8GB 3TFKC 2GK0A 4ZBJA 2NZ9C 1NGYB 4JQIA 4LLAA 5GGUA 1B6DA 4XNQB 1YMME 2PTUA 2QQNL 3OLIA 4NO3A 5C0IA 4IBYA 4JEGB 3ZMRA 4K4KA 3ZTJG 1OAQL 2WW8A 3O6KL 1ED3A 1HHGB 1LO3H 2HRPH 4IYKA 5MEQA 4JKLA 2NUPA 4MNHB 3TPUA 2BNRD 4MJ6A 4P57A 2W95A 3AT9A 1J18A 5IREA 2EDHA 3UC0H 4JQVA 2NNXA 4OCXH 2O4EA 4HUWB 1YJDC 2C9AA 3C5ZB 3LKPB 3VYOA 4HX1A 3HZ3A 1XGUB 3DRTB 3GXTA 4B95C 2G2RB 5EWIL 3TVMB 2BMKB 5EOCH 2WLLB 1I7UB 3RKDD 2VLME 4BFNA 4QXGH 3M1CA 1N5AB 2VXSH 2WWOA 3BH9A 5A2IH 2VLLA 3B2XA 4ZNEE 5IFAL 2F61A 3HI1B 2LW3A 2ZUUA 5FCUL 5B38G 1TSHA 2R29A 1PZSA 2JKLA 3LEVL 3V0GA 5IR1B 2VL4A 2JSFA 3OQ3B 3NTCH 2R2EB 1ZIBA 2HH0H 1EXHA 4RDQG 1FZMA 3QWQB 2OSWA 3WTSA 4L4JA 1N10A 2I27N 4ETQB 3FDWA 3RU8H 4E41B 3S88L 2L7QA 3G9AB 4GUCA 4FA7B 1N8OE 2AP2A 4QAMB 1GIGH 1TZAA 3NIDF 5HYSG 3HA0A 1ANUA 2GSMB 4QHKJ 3RVWC 4BZ1H 3FSOA 1JNHB 4ELMB 4F8QA 2B59B 4LCWD 4RSVA 2EIDA 4MQ7A 4HWBL 5JQ6L 1DUYB 5D7IF 1RZ7L 1UFUA 3AREB 3TN0D 5CBAA 1IKOP 1PQZB 1Q72H 3ISYA 1VACB 5ALCL 5KVFL 4FTVB 4U1LB 3QRFM 4KK8C 2XG5B 5DJ2B 1UXSB 2HG0A 5K59E 1YEKL 5EF1A 4KRPB 1Z66A 2BFVL 4RMQA 2G2PA 1WZMA 4A7TA 1FORL 1MG3C 4HQQL 1OK8A 1UB5A 4XH2A 4YN3A 2UY6B 2PXYB 2WK2A 4UTAA 5JXAL 2NY2D 2MKLC 5D93B 5E0FA 4ZTPL 4R5VA 1HWWA 3ARDC 3EYQD 1UB6A 3LV3A 4CC4A 1NEZA 2TRYA 5ELIA 2W0LA 2ERJB 1BD2B 4YDKH 1KTKE 1FVEA 1E27A 3STBA 3GUTB 3IMRA 4GLRI 3EZ8A 4M29A 2W81C 2ADIA 2GFBA 2V7HA 4X5WA 2ADYA 2HT3D 3FT3A 2PCXA 2QSCL 3B6SA 1R5IB 4GPVA 1XDTT 4M5YH 3V55A 1X5XA 3QZWA 3QH3A 3IN2A 4FYRA 4XC3H 1QRNA 2OYLA 1JXFA 5AW3B 3U48A 3WS3A 5BCAA 4QLRA 3LKOB 2R69A 4FGMA 4B9PA 1AI1L 1KPRB 2IADB 5J1SC 1KMGA 4KVCH 5FV1L 2WBJB 2OTWA 4HS3A 5E5MB 4MQSB 4PGCB 3TYFB 3NFPB 4RWHA 1J12A 3BAJA 3GK8L 5F7DB 5JDJA 2Y7LA 1OAKL 1U8IB 4MTMA 2R23A 3TT1L 3ZDZB 3FQUA 3T4AC 2WLYA 2OA9A 5AOIA 4NQDD 2YPVH 3OWEA 3Q5OA 1RJYB 4BFOA 1QKZL 3S7GA 3WJLC 4PJEA 3RVVC 3FT4A 4IK7A 3EO1B 3UERA 1B9ZA 5KSBA 2UX7A 1O7VA 2OQJB 4NHCH 5D1XA 3VACA 4Z7NE 4IOSA 2K3HA 1TPXC 2CM6A 1UATA 1LGVA 4YDLB 3LSOA 5E1QA 2GIMA 5FECA 1SHXA 1SJHA 1SRDA 2QPDB 2WXOA 4MA8H 2MOQA 1IRAY 1WRFA 5AVXB 3UTSA 5D72L 1PY0A 4ZPVA 4E9RA 1VGKB 4K55A 1M05A 3IFOB 3FKUS 1FNLA 2OSYA 3GTNA 3QEGH 4CILA 4J3UA 1KIQB 2AXFB 4X9FA 2B4CH 2X3CA 3BUIA 5FYJU 5FO2A 1UD3A 2E3VA 3TIDA 3MLSH 1CICC 3VD5A 2XJLA 5D1ZI 1RLWA 4G1EA 1JXGA 2O26U 1AOHA 1OGAA 2AEPL 1I7ZB 3MNZB 5I30H 5DJZA 3EUDA 4X6DE 5KS9B 1G94A 4WUUB 5DCCA 2OTPA 2UWEB 1CL7L 2ZP0T 3E8VA 4LKCB 4KMTL 3OBAA 4LSQL 5FHBH 3ZHKA 4AK2A 4ELKA 2XA3A 4UQ2A 1PZ5B 4DTGH 1JHTA 1LLAA 2DD8L 1FRGH 2X10A 1BVKB 3DPDA 4NQCA 3RWIB 3C8KB 3H6AA 4G5ZL 4HLJA 4PJGB 5AW6B 4Z77A 3O2WH 5GGVH 2ZG2A 5ADOH 3VXUB 3MXWL 3PJNA 3B3IA 5D4HA 1KG0B 3VWJC 3T77A 4BM7A 3D25A 3I6LD 4QTFA 3D0VB 3FXIC 1A4JA 1VRSA 2P5WD 2CH8A 2DLTA 4XCYB 3VUAA 5LWYH 5M7QA 1L6PA 3SCMB 1XMWA 3QAZC 1L7TH 3PIQA 4PS8A 1UZGA 4PJDE 4UBDC 1EBPA 1EERB 2M8XA 3FQTB 1H8OA 4JN1H 1YECL 3RHWK 1RMFL 4HIHA 1V5JA 1WFIA 5HI4D 3V95A 4Y88A 5AZ2L 1XSIA 1W16A 3HW7A 4XAWL 5IGXL 3NABL 2PYEA 3JV0A 3ARFC 3IDIA 1D5XA 4C83B 3KWWA 1CE1L 1MY5A 3ABLB 3INOA 2NUTA 3SDYL 1ZS2A 4I3GA 4GKOA 1R3IH 2P80D 3HLAB 4E9SA 1MJ7L 3EFFB 5LCVL 3UBXB 5CR1A 1GMEA 3TBVA 2WINA 3B56A 4QJ3B 3S35L 1AE6L 1R5VB 3OKKB 4PBVC 1J9QA 4KZEH 4R97B 5CFAA 3K1KC 3QULA 1Q0EA 4NUGL 1SM3L 1P7QD 3GMNA 1FSKB 1IGFL 4D3CH 4PRAA 4CU7A 3AMKA 2HRHA 3DMMC 3F05A 3FO2A 1JWUB 3IDMA 5C0DA 1DBJL 2H1LM 3TIEB 1G4RA 2Y3NA 5AW2B 3BVVA 4WEBH 3V5KA 4BH7B 3HR5A 1YQVL 5IVNA 3WNOA 4GAFB 5FW6A 1JZFA 1XB6A 4C56A 2VH5H 4TUOB 2XX0A 3FOMA 5KVMC 5HJBA 2F5AL 2UXVA 1FNAA 3AG4B 4OJDH 3P0VH 4APQB 4Y2NA 2W65A 3IJHA 4X7FC 5T33L 3FONA 1E4WL 4P04A 1JNNH 4Y19A 3FULA 4N8VB 2Z65C 4OGXL 3MR9B 4TSCL 1AGCA 2Y4SA 3MLXH 4WWID 2NY3D 4ODVH 1TSRA 1GZQA 3QQ3B 1LEGB 3U1PA 1CR9L 1M6OA 4J28A 4NWUL 4ZO6A 4TUJB 4QGYA 3NDZE 5AYTA 4RBPH 3LZQA 1BJ1H 1CL7I 3KG5A 3X13A 3KEHA 3AACA 4AH2A 3KPSE 1R5WA 5BO1L 2GJ6A 3VWKA 3TEZA 1R6VA 1PNDA 5KJ7E 1T2QL 1VCBC 2CGRH 2KZWA 2Z35B 5EU6A 4PLOB 3HG1A 3MACH 3NGBB 4MVBD 3FT0A 5I0YA 3WAJA 3ORJA 2LHAA 2VJ8A 4C47A 3FO9B 3MREB 4OVUA 3GYRA 3F7KA 1NGQH 3MRIA 1AKJB 5E4OA 3T3MB 3ET9F 4ZYKA 5CEZD 4DPCX 3VGBA 1ZT1B 4WRLA 2R9HD 5EH1A 4M7JH 3LN5A 5B1KA 1N4XL 4W9DC 3C75A 4OB5H 4PWKA 3W11C 2CO3A 3QCTL 1AXTL 5FO8A 1I85A 4O51A 1ZY9A 1HILA 3IDYB 4FQXA 1LYQA 4JFYA 1JGEA 4FMKA 1I1AB 3B83A 2ZKXA 3I75A 1HH6A 3F8UB 1KCRL 1ND0B 1UOLA 3N0PB 5E8PA 3CFNA 3FUDA 2Q20A 1RULH 3TBBA 2N01B 5JIPA 3T4YB 4ZS7H 1BAFH 2YAPA 1AACA 2B4CC 1LWJA 2HP4A 4JREB 3ZDXF 5AG8A 4GKZA 2APBA 4P8QA 2DLGA 1JV2B 2VLJE 4U6YA 3GBMH 3QNFA 3KJ4C 3V9CA 4N8UA 4L1TA 5K1VA 1PDKA 4JO4L 4CN6A 4Q74A 4DEPB 3HMXH 4XX5A 3CJJA 4I0PB 1XHHA 4NN7B 1SXNA 1I4FB 3HOGA 5FV2A 3DRQA 4WI0B 4J1UB 2FWLB 2HRLA 4OJAA 1DQJA 2UZIL 1ZHBB 3QO0B 3HS9A 5DJ0A 4UT9A 1NIAA 3HRZB 4D0BA 4R0LB 4BEIA 1HVXA 4CBZA 4HKJB 4TL4A 2RIKA 2N7SA 2VDLH 3BZFB 5F7KC 2CKBH 3SE4C 1A8JH 1SOSA 4DZBB 4JFSA 1PD6A 5H2BA 1TENA 4RWYH 3KLAA 4UYQA 4CVUA 5JQHC 4M3KB 3CSYB 3A22A 3TL5A 4ZOEA 4PGJA 3DETD 1CGSL 1NFDE 2IH3B 3QEQD 3WUWA 3TPKA 4AMKL 5J13B 4LAQH 1P7KB 1YEFL 4FXLA 3OX8B 4WTWA 3SO5A 1UT1A 3QNYA 4K3GA 1A2YA 3T0EB 1CMOA 2EAEA 4M5ZH 3WN5C 3HG2A 1BXVA 1LWHA 1T0NA 3MBWB 4ODWB 2YA2A 5GSRB 2Z7UA 3OB8A 2F53D 3DGGA 3MZGB 3Q01A 3MLWL 3ZKND 1L9SA 3W57A 1BM3L 3WFEH 4UDUB 3FTVA 4DFHA 3QZLA 4JN2B 3ZDYF 1CLOL 4XGZA 4RIRA 3JWOH 4ZD3H 3BKYL 2VLRA 3ARSA 5D1QB 5HHNB 4YSQA 2GJPA 3IK2A 2P8LB 3QHTC 5AVRB 4RAUA 3DUUB 3PWJB 2ZCLL 4JJ5A 3PF2A 3D9AL 4HC1A 5FLUA 1PF3A 3N41F 3STZB 2R1YA 2Q7NA 2HVKA 2OYMA 2DKUA 2AXGA 2J6EA 3HG4A 4FNTA 5EFIA 5IBUG 2I7SA 3WNJA 2NXZB 4RMWA 3TBWA 1IL1B 1X9QA 3K6IA 2BP0B 2QGDA 3AW5A 1JPFA 4IU2A 2A3TA 2H1PH 2VDOB 1DUZB 2VW7A 4G9FE 3ZE0B 2VXQA 4HIXL 3PE9A 3R4RA 2BY2A 2O6DA 2OM5A 4X9HA 2I5YL 3GMQB 3TGXA 3ZE2E 4ES9A 4H1LB 4HK3J 3N9GH 2LTQC 2FUTA 4U7MA 4L3AA 5L2KE 4JDEA 3U7WL 1Q9WB 4WI5A 5GZND 4HWZB 3L9BA 4F7MB 4MMYB 3T2LA 5I19H 3NN8A 4J3SA 3GMOA 4HPYH 5AAWA 1SUHA 1U3YA 4DUWA 3FO1B 1TVBA 4WHDA 4UV7L 3CFQA 4XVTH 3V4VH 3KS0H 2IGFH 1J1OH 1S7UB 2EIMB 4NPKA 5HDWA 2CPCA 5I1HL 3VFSA 5E1AA 3DUSB 3ZTEA 2VZUA 4S2SA 2HFFA 3NOIA 3OGCA 1KYAA 3WFDH 4D0CA 3E9UA 3O6FD 1F0LA 2IWGA 4FAAB 2O5YH 4U6XA 4OZHF 1H19A 1UD6A 3SOBL 5I1KL 5C07A 3LZOA 4IRZA 1GPOH 4CVZB 1F41A 4J3OH 2WNWA 3MX0B 5GQBA 1CF8L 4TQEH 1U3HB 5EF2A 3IAPA 5D4JA 2PP7A 4TLSA 2R2CA 2YAQA 3I6KB 3K2KA 4PGZA 4GW1B 1XZ0B 4UNTA 9CGTA 1QFUL 1DVFB 5L9DH 1L6ZA 4AKOA 1EJFA 1A7QH 3NIGE 1IAOB 2JV6A 1RXLA 4IDJH 3MRFB 4K07A 4LNVA 1UENA 3VD3A 3MRBA 3D07A 5DFVD 1GC1L 1KGXA 3EBIA 3BQUA 3GXDA 4H0GA 3Q0HA 2CIIB 3ESUF 2WZ5A 2M26A 4F7PA 1FZJA 4R3SA 2VLKE 5FGCE 5T3ZE 1X5ZA 1EVUA 2DMBA 4F7KA 3HI5L 3PFUA 3F6JA 1J5HA 2DTML 3DYOA 4JJHA 2J1ZA 2C3WA 1JN6B 4OCRH 4WO4C 3KXFA 2I07B 3CVHB 1YDPB 1Y18B 4YK4C 3FCGA 3RNQA 4P3WA 4WCYL 4PJAE 3SPJA 3WXVH 4Y0GA 5DJCB 3QUXB 3L4YA 3EH1A 3P30L 3CN3A 4PJBE 3AG2B 4ABWA 4X6DB 5LGHL 2WKOF 5DYFA 1ZA6B 2XV3A 1RK0B 4GQPH 3WFBL 4YEEA 1KIPB 1Z9OA 2WWNA 1RVFH 2IC2A 2BP8A 3D85D 5K9QI 4RZCA 2PYFA 2OZ4H 3RGHA 5IK3A 4IHOB 2JCCE 4K3DL 1MCEA 4WSGA 3PV7A 1MCJA 1B9KA 3RIAF 1WAAA 2ICWA 4L1BA 3VTAA 3OJDA 4Z78B 1G84A 4Y4KC 1WA2X 2X3BA 4AK1A 4FQHB 4DQOL 1T89C 2FX7L 1XGQA 4G7QB 1JZHA 2E59A 2M1KA 5PCYA 3WD5H 2VR3A 2Z0UA 1CE6A 3W9DA 4Z7QB 1NC4B 2XPZA 3K8KA 3MN8A 4PJ5D 5EBMB 3TBSA 1JHLH 5CN1A 2L7UA 4H2CA 1JGLH 2HKFL 2GCYA 2R56L 1FV1A 1G0DA 1UJ3C 1VEPA 5CGMA 5D7LD 1KLFB 3KEDA 4U6TA 1JI1A 3G6DL 1FVDA 4ZUSB 4P3DB 2CLZB 4AV5A 5AENA 4P59H 4ZZFA 5AAMC 4M9OA 3IKKA 4K7FB 4ANUA 2IGTA 1A9EB 2IFFL 3EGDB 5JO5A 5IB3A 3EJYC 3HAEB 3MV9E 2E6QA 3ZR5A 4DF9A 4YHPA 5L2JA 4I4WA 3JWOC 2FD6H 4WWPA 2BSBA 3FB8A 3ILQD 3WLWC 5G4NA 4ATTA 4X8GA 3O8XB 4BSWB 3F00A 1E9QB 2VDQL 3CHRA 4LPVA 5GS0D 5KVFH 1A7BA 1C5CH 1SGKA 3K1DA 3MYJB 3DDGA 5JORA 3OZ9H 4N2CA 2BSEA 2IBZX 2EH8H 2QFPA 2VQ1A 3SDDA 4O02A 1IO4C 3IGAA 3MJ9H 5LBSL 4LQFL 4KO7A 3BVNA 4LOEA 4R4BA 4O00A 2BRQA 1GYUA 3JZ7A 4S1SL 1AR2A 1RQ5A 1T4WA 2DF3A 1Z2KA 3L4VA 3RWEB 1PZCA 2N1TE 1E5CA 4OUUB 4CBPA 4NFBA 2A6JB 4JPQA 1LWRA 4QOKE 4XVJL 4Y4HA 5D7JD 2QV2A 3SDCD 5ETUB 2VMCA 5F1SA 2Y7OA 5DS8B 4ZMXA 1QA9A 3ABMB 3QQXA 3PLYA 4MA7L 5EU7C 1NMCC 1PX8A 3U1QA 4GLRH 2Y1VA 4TKWA 1EHXA 4FE9A 2Z31A 3QYMA 1AD9A 5L4IA 1F3DH 1WUNT 1QFWI 4XOBA 3DDFA 3E0GA 4QHMB 3G6JF 2ZJSH 4N3TA 4DK6A 4A7QA 1T83C 3VD7A 3S96A 2ARJA 2XX1A 2XWZA 2N4IA 4PWEA 1NGXB 1K8DB 3LTVA 2YK1L 4XN8A 3KDMA 2JFCA 3I9IA 3VE0B 4RFOL 3U46B 3UJIL 5DHVH 3Q3GB 3ZMNA 5C0BA 5ESVB 4ODTH 1THAA 2X4TB 5KSAD 5T3XL 6FABH 2H2PD 2QTEA 2QVKA 2APFA 4HEMA 4WWKC 3UBHA 4EUPG 5IF0A 4J3OC 4LLDB 1RZ8B 4DEWA 2A74B 3C12A 3HC4H 3RP1A 1I9RH 4HSCX 4U1KA 3EFDL 3VXTA 4NS0A 5AW9B 4GRLD 3UX9B 1O7DC 3QIBD 1AG0A 4A6YH 4BSJA 3X3FL 4PTUA 3RPIA 1ONQB 1PW3A 4YHYC 5ESQA 4C58B 4MDRA 4KK9D 1BG9A 2FJGB 3A23A 4GMSH 4NIKB 4YSDA 1XGTB 1N7MH 1S3KL 1NLDH 4L3EE 1OD9A 3C6LB 1IGMH 2BOBA 2DQFB 4YHML 5F9OH 4M5TA 4HXAH 1GA2A 2QSQA 5B39B 1DP0A 5I26A 3VSVA 3MJGX 4XWGL 5CUSL 2ICES 3VYPA 1LTXA 1OB1A 3TWCL 3NIDB 5AKRA 4D8PA 2X2UA 5IJKA 1CDJA 3QQ4A 2WYTA 5GGTL 2PCPA 3D18B 3OKEB 2YBRA 4V1DD 1LQSR 3GLEA 4JG0L 5DQDL 1VEMA 2VLJB 4MJID 5D7IB 5DK2A 2PETA 3OKLB 2FJHB 1WPCA 4OZIA 2I26N 1BZ9B 4NWTL 4WGKA 1RUPH 2A83B 4YEFA 2D3NA 3WU1A 4OQ1A 4JZJA 4CMHB 1HH9A 1I3GL 4PJXB 4G8GA 3KW7A 1OHZA 1Q0YL 4Y1AD 1WBYA 2XNAA 5BJTB 4XNQA 5F3FA 3D3VB 3VFOB 4J3OG 4JQXA 2YWYA 1CXIA 1NSNH 4UMGA 1B0RB 1D5IH 2NY0B 2XTJB 4JB9H 5CEYA 2X6CA 4KO6A 3FU0A 3K0YA 1ILUA 3RURA 1AGDB 2G4EA 4NIYE 3SKMB 5EIQA 5CR8A 4HUWA 4Y5VA 3SE8H 3LKPA 3C5ZA 1QEWA 2WXLA 1A14L 1EHNA 2BMKA 2ZX9A 2WLLA 1XCTA 2ZUYA 4XP9L 4KKLD 4D9QD 4TL5A 3JV5A 3E6FB 3H4HA 5SX5H 3HRPA 1A9VA 1TQBB 3MJWA 1JFHA 3V0WL 3PABA 5EC1B 4PV9B 5IHZA 4BDVA 1IKNC 4NO5B 1CDYA 1EJ8A 1NLBH 1SQ2N 5TDNB 1URLA 1DSFL 4JG5A 5H37G 5I17B 5IR1A 5AVQB 3U2IA 2E7CA 5FGBC 5C2BH 2EECA 3GKWL 1FE8H 3ECBA 4O58L 4JKWA 4YWGH 4HOWA 1CO1A 3GMPA 4OUOA 5AB9A 4E41A 4XPTH 4MZ3A 1JZ7A 1NCBH 4RESB 1O6TA 3UEZA 1F8TL 3RWCB 3AM8A 4GRWE 1QAWA 5I66B 3QORB 1HOEA 3AY4C 5LGYA 3VD4A 1IBGL 3B9VA 3RKPA 2I85A 3VQ1C 2DIBA 2R0WH 5CJ8A 2CG9X 4ELMA 3KGRA 4EN3C 4PS4L 3MROB 1FYTA 1NUFA 3C5SB 1BEXA 3AREA 4FEIA 5DWUL 5I6MA 1PQZA 1P5UC 1DQQA 3QI9C 4QDGA 5EZLB 2OMYA 1UXSA 2IFGA 3IDUA 1AO7D 1W6LA 5F70A 3CFTA 4N0FA 2EYTA 3DBSA 3RDTB 3CK0L 4JE0A 4HJ1A 5AB1A 3UAJC 5CGYD 1A6TA 2OXHB 4OCNC 2UY6A 2PXYA 3FFCE 3LEYH 5HHVH 4KNUA 3QXVA 2QLVB 4I9WE 3K91A 4U7KA 4V2BA 1E42A 4OIIL 4CVWA 1F6FB 2W9EH 4YHNA 5DYOB 5AYUH 1BD2A 3RJDA 1BZDA 4MMZB 1TJHL 1QNZL 2GJRA 2BVYA 3WXWH 1ADQL 3MRJB 4H25B 4O2EA 3P3TA 3NCCB 5I76A 1WGVA 1L6XA 5C3TA 3RWFB 1SXCA 4N28A 1AC6A 3MJ7A 4PH8A 1JPEA 1UADC 2RD0A 4NPJA 3V52L 4TYUA 1BIIA 1A7PL 5DEFB 3WE1A 1FNSL 1KXQE 3BEWB 1ZTXE 3LKOA 1ADWA 1YSOA 1IT9H 1GJUA 5G4MA 2Q10A 2IADA 4YGVB 2FB4L 2WBJA 1PG7X 2YUVA 2B5IB 4MB1A 3ZL4H 5JNYB 5L4JA 2G5UA 1NCDL 4PGCA 5LKNA 4HWBA 3BPNB 5IW6B 2FYYA 2NZIA 1KJMA 4V33A 1CTNA 4DKEL 3GEFA 1YEGH 1JYVA 5D5ME 1V7NL 4PBWD 3AMLA 3EBHA 4N9GA 3LZLA 5EUOF 4URTB 1A4BA 5D7EA 4BFBD 1IKFL 1F45A 3K71B 4KKPA 1D6EB 1RJYA 4H8WC 3LKRB 5SX4I 3QBTB 1A1MA 5ALBH 1HK6A 1S78C 3TZVA 2GY7B 5DHDA 4X6FB 2EEDA 3QDGE 5EIIB 1DQDH 3HE7C 3U4BL 4X98B 4ZX3A 4ZSOB 1L9PA 1QNIA 3RGVD 2V7NA 3OR7B 5E99L 2EUVA 2DWYA 2VLKB 1CYWA 3IJ7A 1HZHH 4JCMA 3VM7A 4QRQB 1KEGL 4X4XB 5K1NA 1HL9A 1BZQK 1FNGB 4MCYB 4E9TA 1I1FB 1T0PB 2JQMA 4KC3B 5B8CB 5C0GB 3SBWA 35C8H 3PWVB 1DJZA 1IQWL 2ZNWA 5AKVA 1QQDA 4KHTL 3L3IB 3TEYA 4LDLB 3DJ9A 3DV4B 5I1CH 3E80A 1KIQA 1WVZA 6TAAA 5ERWB 2AXWA 2ZONA 4JFEB 2ZUTA 1DJHA 3BH8A 4NKQB 4Z76A 2BS9A 2ZYIA 4F93B 3QXAA 5DJXB 1OSZA 2YR3A 2YPLB 3HI6H 1I7ZA 4GAJH 4I9XA 4BHUA 3KPSD 3OMZA 5KBPA 2VSKB 3GBNL 1R0AH 2UWEA 3LZNA 5IG7B 5C0EB 1QZNA 1LO5B 4PN6A 5DQJA 4PGBB 1JCKA 1D5MB 4PJ7E 3TBYB 3L1OL 4JM2B 4EVNB 4EIGB 3T0WA 4ORZC 3P4MB 3P40A 4KJQC 4U0RC 4WU7A 2FBOJ 3HCVB 3VXNB 4G59C 4FKKA 3SJVB 3VXUA 2EE6A 2AQ1A 3I9PA 5EZIH 4LCUA 4NC0B 2JKIS 4O2CA 2V8LA 4XO9A 3MLUL 4C55A 1NEUA 4DVBB 4PRIA 2PN5A 2DLFL 1MHPL 4Y2DD 3ARTA 5JMOC 2EXYD 4XPAL 4Y9GA 3CZSA 1I53A 3GXPA 2DQTH 2UVEA 4D2NA 2IV8A 2ZOUA 1U92B 4POZD 4ZAKB 1BLNA 5F7FA 3NCYP 1KB5H 4QTHB 2WXPA 4MJ5A 2C4XA 3JYCA 4YSOA 5EIVA 3BJLA 5AUMA 1B0WA 1F11A 1YNTF 5T1KA 2FECI 4L29B 1WHPA 3K2UH 2PW2A 4NZUL 3THML 4HS8L 2W9LA 4RCAA 2C34A 2P8MA 1T20B 4XHQA 4WVRA 4S0SD 3UEQA 2DM7A 1NICA 1IFHH 4FLOA 4WY7L 1F1GA 3BGFC 3CSPA 3IJYA 3T0AA 2CO6B 3HLAA 4PJ9D 2QKSA 3B5GA 3UBXA 4K8RC 1F42A 4XCNA 4NPYB 2ZT9C 5JXEC 2F58H 1R5VA 3GSWA 1Y1UA 1M3IA 4JRYA 4Z3GA 1QYGL 1U3ZA 1TJMA 2GY5A 4A7VA 1E5ZA 4ZFZA 4FZEH 4GXVH 1RK7A 1RURH 3KCPB 1M2OA 2V4LA 1M7UA 1PLBA 3QXWA 4V2CB 2YXMA 1G7JA 4NO0D 4W9IC 4BH7A 3M88A 2J88H 1U42A 5DJYB 5DLLA 3NZ8B 3ZDXB 2JIXD 2F0CA 2JJSA 3ZXAC 1A7OH 4DVRL 3KHQA 4AVJA 1XF5A 3WSQH 3DGDA 2DQJL 5ITBH 3NJVA 4OLUL 2PTVA 4EO5A 2Y6SD 4XVUD 2YXWA 3DNKA 1MCOH 2B08A 4APQA 3T08A 1TU2A 1F4HA 2H32H 1QSVA 1VADB 3A6BH 4P2OC 5GRYA 2Y7SA 4ANVA 4N8VA 2VDML 5B38B 2PO6B 5J5EA 1U8LA 3CTTA 4Y16D 3IS0X 4IKKA 1PZ2A 3D2UD 4JR9L 1XL4A 2RB8A 5EHFA 1J5DA 4NYLB 3FB6B 5LCVA 4TUJA 1JZGA 4GG6A 1MAML 3U9UB 3CDYA 1QW8A 3MNMA 1NC2D 4ERSH 2AV7B 4G7VL 5TDOA 5F44A 2HN7B 3V8OA 3H6JA 2EE9A 1RZFL 3D4CA 1TZGH 4GW5B 2QPEB 1YPZF 1U41A 2Z35A 4YDVA 5GRJL 1B2YA 5EU5B 3QUMH 5DMYA 2ATAA 2VXUL 3GLDA 1MJ8L 5I1GL 4WHYH 2X38A 4XMXA 4HVBA 3MREA 5E4AA 5CIPA 4DWHA 3TO2A 4F8LA 4F57H 2BS8A 3QWOA 3ZO9A 4YAQA 5DRWA 1DJSA 5I0DA 1EUTA 1AKJA 3DTDA 1MFNA 4L4TE 1W72B 5CLXA 4Z7NF 1ZT1A 2EO1A 3GS4A 4Y5YA 1LO4H 4OLWL 5ABAA 4G9FD 4JO3H 4LSPH 3AZUA 4L4VA 3MGAA 2XPYA 4QXWA 3II1A 5LXGH 1ND0A 3X1EA 4XMUA 4JQIH 2YKKA 5L2KD 2WBKA 2EIJB 3V6OC 3D34A 1TZHB 3FC8A 1HXKA 3BKML 4X7TB 4PD4J 3UO1L 2VDNB 2MNJB 3D69A 1A5FL 3V5HA 1JD7A 2AITA 4PRNB 5CO1A 2COQA 2EDLA 3A4FA 4FOMA 4FG6C 3N41B 4MBOA 3EKCA 3SDAC 4GSDL 4MX7A 3RFZC 3FCUB 4LFHD 5MEOB 3DPBB 4NDMB 5J6HB 4LCVA 3NPSC 5HI3C 2X05A 3TA3A 1BVNP 4I0PA 3ARWA 1RKRA 1TTFA 2HVJB 3GD1C 1LP9A 1ZDSA 1IM9A 3KWXA 3RPBA 1HHHA 5DHXB 3LXCA 4MD4A 4J1UA 2CDGB 2C7UB 4KRLB 5DRZB 1ZHBA 2V2WA 3IGKA 4LGPB 1PSKH 3HRZA 1JYWA 2B8OT 2KZKA 4HUUB 3WEOA 1D7FA 4HSAC 1IEHA 2F54D 5E2UL 4ZQKA 3ZZQA 1U8JA 4ZFFB 5JHAA 3DVIA 1UWGH 1OAYH 1BJMA 1UA7A 2W0PA 4ZDHB 4DZBA 5A2JH 1N9PA 1K8IB 3CCHB 5BVJA 3SOTA 4RFEB 5F9WC 5D9SA 2Z7YA 2MNUA 4HT1H 5L4MA 2ZUVA 3G6AA 3KPRB 4NM8L 3FAWA 4QHNB 4TUKL 4L1SA 2DMKA 3OX8A 1MI5A 4GI9A 3QVAA 3T0EA 1E8XA 3O9WA 3WJMB 1VF5C 1KWGA 1CQYA 1HE7A 1J8HE 3V4LA 1OT2A 5FO8B 5T3ZD 4OZHB 4JAMA 2FQFA 4RRPM 5GSRA 5A16B 4TSAL 1I9IL 2IAMA 3SKJH 5F2FA 3VXRE 1VZHA 4M62H 3NSYA 3NP3A 5T1LB 2P5WB 2IPTL 3BRDA 3LS4H 1YVLA 5I9QB 2H9GB 4JN2A 4KY1L 3QIUA 2LU5A 1JGVL 2O5NA 4M56A 3WY3A 4P4RB 5MP6H 4UTAH 3ARBD 1H6UA 4QUOA 1E6JL 2C1PA 3GZKA 4DP5X 2B14A 1XH3B 1E50A 3DUUA 2WO3B 2ZUSA 3F7YB 4W9KC 3RZCB 3S36X 4XB7A 2WAQA 3L3GA 4ZMTA 3QXTA 1NJ9B 1C12B 1BVZA 4LSVH 4JPVH 5D70L 1LE5A 1KGWA 1K3IA 5A40E 1YYLL 4P4KC 2GSIB 3MRGA 3ML8A 1I9JL 4LLUB 3T4AB 4XOEA 5KANG 3UROR 5BS0D 5ISZA 2AK4E 1RI8A 2BP0A 3ZYOA 4OD3H 3NCWA 2VMEA 2D4FA 3FFCB 3B5TA 1Y6MR 3ZR6A 3F84A 4MB4A 4RGNC 2X12A 2L7EA 1ACCA 3WGUB 1XSOA 2WLNA 5SWQA 4OZGE 3GMQA 5I24A 2LAGB 2FEDD 3LVEA 3L9EA 2H8PA 3QJUB 1DJYA 3PDOB 4M1DH 1HCYA 1AR1B 4XZUB 1DYZA 4JM4L 4FA8A 4F7MA 2V2XB 3P4NB 4MMYA 2WV3A 3EJQA 3V6BR 4N0CC 1FHNA 2R15A 5DFAA 4F58H 3SGJA 4WV1A 5L88L 4LK4A 4QHKI 1CBVL 3KBFA 3ELQA 4RMUA 4NC2B 3FO1A 5CEZL 1CQKA 1GAFH 5FR3A 1ASQA 1OCZB 3MV9D 4K2UL 3BZ5A 3ARGD 4KXAA 3H2PA 4OF8A 3LB6D 3TBTA 1RSFA 1FVCA 4KHXL 3HG5A 4MAYA 1E8ZA 2ZKHH 4G72B 2YMTA 3GRWL 3RHWF 1SYSA 2OULB 4HS6B 3KW8A 4QRPB 4JANA 2ED8A 1KBVA 2HX9A 4GEJA 1ZANH 2QTVA 1LO2L 1Q1JL 3SPVA 5E0QA 2GBAA 3TYGL 3MX0A 4AQOA 4WF7A 1J1XH 5FGRA 1U3HA 4CADA 4YSSA 3DLQR 1WGOA 3I6KA 4WSKA 3ZY7A 2ZUQC 3UGUA 4GW1A 1OP3H 3VXSE 1C5DB 3PWPD 1ZHLA 4J4PC 3BZ4A 4WDIA 4QRSB 5LGJA 4N85A 4UANA 1UOVA 2ZOWA 4NQSB 1IAOA 3RWGB 3MRFA 4G3YL 1LO0H 1BYPA 1SJEB 3VWJB 5C92A 4OGQC 1NMAH 2H3XC 2IMMA 3OZLA 2GIYA 1ZGLB 2CIIA 1HEZA 4WUKL 4QOKD 3T3PE 5CCKH 1NAKL 3RVTD 3MCG1 3Q06A 3Q8CA 3QZNA 5IHHA 2WM0A 5TFSH 1PLGL 3AQDA 3KGSA 1LL1A 2D03H 3LMJH 1W8NA 1K4DB 1OCOB 4TTDC 3VNZA 1JN6A 4MQXD 2YGOA 4S1RL 4AVKA 4GP4B 3VI3F 3SODB 3ABZA 3S34L 2BC4B 5IBTL