2MPAH

Bactericidal antibody against neisseria meningitidis
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
224
structure length
224
Chain Sequence
EVNLQQSGTVLARPGASVRMSCKASGYSFTSYWLHWIKQRPGQGLEWIGGIYPGNRDTRYTQRFKDKAKLTAVTSANTAYMELSSLTNEDSAVYYCSIIYFDYADFIMDYWGQGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords MN12H2 IGG2A-KAPPA, light chain
publication title Bactericidal antibody recognition of a PorA epitope of Neisseria meningitidis: crystal structure of a Fab fragment in complex with a fluorescein-conjugated peptide.
pubmed doi rcsb
total genus 41
structure length 224
sequence length 224
ec nomenclature
pdb deposition date 1999-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2mpaH02
2IFGA 3MQIA 4Y5VA 5DQJB 4RWHA 1J86A 3MRGA 2VRAA 3V7MA 1IEHA 2GW5A 4K9EH 2AS5M 1HHKA 4HK3N 4LIQE 5AD0B 3GMLA 1T0PB 1QFWM 3QPXH 4TPRL 3MRQA 1AP2B 2OR8A 4X7TA 5GGRY 3S4SA 4UB0H 3EYFB 2NY4B 1FORH 4L4TE 1U36A 5BS0B 3C6LB 2Z4QA 4IRSB 4NQDE 4HT1L 1I1AD 3HAEA 3OXRB 4IHOA 1KN2H 4DK3A 3WIHL 1UFUA 1BJMA 1UXWB 4KAQL 4O2EA 1TTFA 1HZHH 3IKKA 3SDYH 4PBWD 3WXWH 1ZT7A 1CICA 1FVCB 4UOW1 1YJDC 2R1YB 3F65A 5HI3C 3GKWL 1P9MC 4JGMA 1JHTB 1LEGA 4U1GC 3UAJC 3I50L 4NKOA 1NCDL 1PYWA 3P0GB 4NRXB 1FN4A 3SDAB 2OL3B 4HULB 1Z0NA 1XFPA 3ZZ1A 4RA3A 4HKBB 2BCKA 5FHAH 1TQBB 3S36L 1YYML 3N50A 4OV5B 2DWDA 2VSCA 4R97C 1F8TL 1MLBA 4M00A 3G5ZA 4UDTB 3X11B 4PJCA 1H15B 5D1XC 5FUOL 4JFFB 3BESR 2BJML 2X5PA 1OARH 5GS1C 3IRZA 4FA8A 2Y23A 1CG9B 3FFDA 2OR9H 2P44B 4HD9A 3O3BB 3NIDE 4YAQB 4JPVL 4ZUTB 1VFUA 4LLUA 5A43C 4N0RA 1EAPB 3QNYB 1BOGA 4LVOB 3O6ML 1SJVA 3SE8L 1R3JB 2QADB 2VWEE 2JIXD 4TQEL 5HVGB 2P24A 3V4PH 3EBAA 3WKMH 4X4XA 3O8XC 4PRPD 4NT6B 4P5KA 3JWDH 2PO6B 4PJCE 1K4DB 2DLFL 3MA7B 3OR7A 2D7MA 1QYGH 1ZGLM 4G80A 3FCTB 3PNWA 3UTZA 3RWEA 1DL7L 3FOMB 3RZWA 4WTXA 1EXUA 2YN5A 2MQ3A 2IH3B 5KSVA 2V7NA 4QT5B 2FX8H 1K8DA 5IVZB 3MO1A 4XP6H 1GOGA 3RZCC 3G6JA 5FYJE 4HIHA 5I1LA 4XP9H 5IW6B 3U2SA 4NP4H 1JF5A 3V0AC 4Z77A 1MCJA 3GSRA 2GTZA 3KPOB 1XGUA 1QSED 2DM7A 5D2NC 3VFOA 2B20A 5EBLB 5A3ID 1QR1B 3ECBA 4LEOA 4WHYH 4TSAL 5HHOD 5DQDL 5E2WH 3SCMB 1T7WA 2WANA 2D4DA 5EC2A 3ARBA 1BP3B 5C09E 3B6SB 2HYMA 2QEJA 5IW3A 1G0DA 4N90E 2EICA 4CVXA 4LPYA 5EZLB 5F7KC 3OF6D 1LQSR 4RBPH 3MBEB 5I8KH 4D9QE 2H6PA 2X1WL 1B90A 1XIWC 3VFGL 1YNTA 2E9WA 5GS3A 4KH2A 4WU7A 1FFNA 4PRHD 3NABH 1AR2A 4NRZB 5KVDH 5GZND 4JFEE 1CWVA 3DBXA 4ERSH 4G7VL 1FGVH 2VLRA 3CDCA 1KIRB 3GO1L 1A14L 2YBRB 1GGCL 4QRRD 1BFVL 4OZFH 5ITBH 1WISA 3DRTA 4JREB 3FRPG 1C8PA 3F5WA 2VH5L 1U58A 3U6RA 1FAIL 3LD8C 4NO2A 4RMVA 3L95A 3QQ9D 3MOBH 3HR5B 1AXSB 2OM5A 1DVFD 5MEPB 4ODWA 1AIFA 5EU3B 4PTUB 3HB3D 2KBGA 3A6CH 3VMOA 5CIPH 2P4AB 4JEGB 4RRPG 5CBEA 1YNKH 2ARJQ 5CEXA 5MHSE 1ZEAL 2I26N 5EUOE 1VEPA 1Q0YL 1MNUH 2IAND 1M7DB 2Y7QB 3V79C 4WFGE 1MF2H 1PZ5A 5IIEA 5ADPH 2C1OB 3K2MC 4F15C 3J7HA 5HDBE 4OB5L 1S7TA 2XICA 4DGIL 3U7WH 5IB3A 1CLOL 2Y07L 5T3XE 4JM4L 1NGPH 3QHFL 4GMTH 1T2QH 3PDOA 3U9PL 5L6YL 4LDEB 4LAJH 2BK8A 3LS5H 2GEEA 3BN9C 3NZHL 1AR1D 1JPGB 4O58L 4WHDA 4AQOA 4OCMC 4UT9H 3LKSB 1HSBA 2W07A 3VXRB 2QR0B 4BH8A 4G8GE 1NBZB 1KC5H 1CGSL 3U4EA 1W72H 4XH2B 2ZSWB 2J7LA 5KOMC 2F8OA 3MGAA 4TSCL 1P7QB 1XF4B 3IF1B 3QUZB 2IPUG 1RU9H 4RNRA 4PGCA 1TCMA 2FBOJ 3I75A 5MP6L 1R3HA 2MNUA 3OAYH 1UZ6E 1DE4A 1BAFH 5FOBB 4CVWA 3WS3B 2ED8A 5T1DL 4D9RD 3FN0H 3RDTC 2FJGB 1YPZB 3TIDA 4JRWA 3BDBA 4ODHL 4WFED 4UT7H 1MFBL 5EPMB 3FO0L 4O2FB 3C6SB 4NYLB 4N9OB 4OZIF 3ET9F 3VDCA 1IQWL 3OQ3B 5BJTA 5HVHC 2VL4A 3ARXA 3H7LA 4OLVH 2QHLA 4CADA 1BVLA 3O4OB 5I6XB 4QRUA 3RHWK 3GHEL 4L4VD 5DK2B 1G6RL 2ESVE 4PG9A 1ZHBB 3K8KA 1CXIA 2IBZX 3IDUA 5I71B 1T7YA 3QDJB 4ZTOL 4ETQA 3IT8D 5H37H 1CE1L 5INCB 3HZKB 4ZXBA 1A6TB 4MB3A 3RY6A 4HXBL 3C5ZB 3VDBA 4HIJB 1P5UA 1D9KB 2BDNH 5SV4A 1FPTL 3RX7A 4OJFH 1Q9KA 1MCOH 2CLRB 1BWWA 1U41A 2OXHA 4LIQL 1PD6A 1JMXA 2EKSA 4L9LA 4WUUA 3G5VA 3QI9A 1FIEA 5IMMB 4NFDA 4NO0A 1JGLH 4YR6A 1FC1A 2YN3A 2V9RA 5D1QC 1QRNA 1WT5A 5CEYA 1AE6L 2DB8A 4IRJB 2CIIB 5E99L 1N26A 1EH9A 4GKNB 4D0BA 2Z31C 1OAYH 4HS8L 5C7XL 1LD9A 3BMWA 1IGCL 4ZUSB 1MCPH 4HWEL 5GGTA 4ELKA 1TENA 4OLZL 3VXTA 1PLGH 4JFQB 1U8PA 4XP1H 3TYGL 4ZYKA 1AO7D 3V5DB 1P69B 3OX8A 4WU5B 3FFCD 3MNZB 4NZUL 3UC0L 1FG2A 3GNML 3UJTH 1EEYA 4CUCA 4FQHB 5C0AB 4M3KB 2JB6A 1AFVH 1F4YL 2B1HL 3DX9B 1F4XH 1OGAB 1ZANH 5FYKE 3C2SA 5JMOC 1MIEH 1P4LB 5L2KB 3QXAB 5D7IB 4MNQB 4EXKA 4ZAKB 2CJUH 2AJSL 4GBXD 2BRRL 2R1WB 2G75A 5DS8B 4FFYL 1OD7A 4GRLD 5LQBL 2FR4B 4OCRL 1D3CA 3VGBA 4QHUA 3JWOL 4L3EB 5D7KE 5IMOA 4I9WD 1VERA 1E6JH 1XH3B 2O5ZH 3WFDL 2FJHA 2EXYC 5I73C 4XPGL 3P4LA 4M48H 5FYLD 1C5CL 4A2MA 4MJIA 1FE8H 5HHME 1HYRC 4J3XA 4MVBC 1AGCB 1S3KL 2FGWH 3ABZA 4K3JH 1RUMH 5SWSE 5I2IA 2ENSA 4PJ5E 5TQ0L 3PGDA 3INUH 3JBG7 1MWAH 1X5FA 3W0WD 4XRCB 3V5HB 2LQRA 2HFEB 5EU6D 5C9KA 4JO4L 5I76B 3S35X 3CJJA 4XP4H 4HJGB 2OP4H 4G5ZL 2V9QA 4LCWD 5F1IB 3EO1B 2ZUTA 1NMAL 3HMXA 5IK3B 5FYJL 3NMEA 2P43B 1T2XA 1X5GA 3ETBF 3QIBA 3SKMA 4KDWA 5DD0L 3PQYB 5JOFA 4DW2L 3MZGB 3EZJB 2Q3AA 1Q0XH 1G0YR 3KJ6H 1LEKA 2UZIL 2VAJA 3D9AH 3ULVE 5IWLC 1PQZA 4K7FB 5DZLA 2NY0C 4EDXB 5BMFL 3FB7A 1R3LB 3IXTB 1KEMH 4U1JB 5E6YA 4RX4D 3A6BH 2DKSA 1IGMH 1PAMA 4XVUD 3BUTA 2OBGA 4LDLB 1UWGL 4M4RA 2ZUWA 2H1PH 2OTWA 3E8UL 4K7PH 2FIKB 4QWWC 3RWDB 1V5JA 3LRSA 3FB5A 4F7EB 1NGQL 4K3GA 1JNHA 1CFVH 1MH5B 4MSWA 1NPUA 4N8CH 5E8DL 4DVRH 5KVEH 4U7MA 4W68A 2HH0L 3BJ91 2P8MA 4KRPD 4F8TA 3FONB 2YPLB 2ITDB 5J12B 2DQUH 2AP2A 2MKLC 3SGJC 5GRJL 3EYSL 1MI5A 3S37H 3I3DA 4MA1B 1FO0B 4S2SB 2R29L 3P0VH 4JY4A 3LPGA 2R9HD 5D9SA 5DTFB 1HHHB 3ZKMC 1VSCA 1B3JA 4Y19A 4HXAH 3O11B 1TZGL 5I66B 4MZ2A 5JW5A 4P2RB 2XZCL 3STLB 1WF5A 3QHZH 3CSGA 3NCJH 2BSRA 1ULVA 2HFFB 4OLYL 3WHE1 2F19H 1HIML 1KTRL 3M1BA 1QSFE 2CMRH 2BVUA 4OTXL 4YDKL 4Y5VC 3VWJB 2D03L 1XR9B 4Z7OE 4AEHL 2Y72A 4RWYH 4JRYB 2B4CH 1XT5A 4N1EA 1NFDA 3DOSA 4HBQA 4M7KL 2XWBB 4M7JH 4ZUUA 1BQSA 4CJ0A 4ZD3H 1D6VH 5HHNA 1C12A 3VFRA 1H5BA 4Z76A 1DQML 4Z7WF 5T3XL 1PX3A 4XMKL 3PGCA 4Y19E 3QQ3A 2J8OA 1OAUL 4BKLA 1N6QH 4W4OC 4CDHA 4JHWH 1KF9B 1NBVL 5BRZB 1X5KA 1CI5A 4QF1B 1DN0A 3IYLW 3BUYA 1KB9K 2IQAA 5FYLH 4KHTL 4NBZB 3JWOC 2VXQL 1PEWA 1Y6MR 4LSVH 4X6DB 1NFDE 3PHOA 2Y1VA 3H9SD 3SDCD 4Z95L 2G5RA 5EDXA 4HFWA 4NO3A 5HYJE 2VWEC 5KSUB 3RRQA 4XCYA 4XCCH 1WFUA 4DGVH 4OCWH 2UVFA 1G7QB 2X4PA 2X05A 4X8XA 4WW2C 3MRKA 1RUAL 4OQ1A 1ZVSB 4L29B 1YN6B 3KWWB 2H45A 5D96B 2Z8SA 3LQZB 1JWSA 2QQKL 1GYAA 4HLZH 3SDXE 3W9EA 1I7TB 1GZQB 2DQJL 1DQJA 3UZVB 1X5XA 1A4KA 2GJ6E 5KVMC 1NCBL 5IB5B 4LAQL 3B9EA 2VO5A 4KJQC 1DEEA 1XZ0A 1HHGA 1ED3A 3HE6D 2ZJSL 1RK1A 5H94B 4GAGH 2VSDA 2Z35B 1P4IH 4JANB 3SE4C 4S0SD 1IKFH 1C08B 2PYED 2GUOA 3GB7B 3VWKA 4ZFOA 4G6KH 4M6NH 1VCAA 3C8KA 3QXWA 3PIQA 4GG8B 1CXLA 3VD7A 3RGVC 2E6QA 5ESVB 4EBQL 5CZXD 3TPUA 1HXMA 2ZPKH 1SBSH 2XI9A 1QNZL 4DN4L 3RIAF 3Q6GH 5IQ7L 4MS8D 5EU5B 4NKIL 4YDJB 1EGJH 3ROLA 3NA9H 2A74B 4M5ZH 2AJZB 3PG2A 4P4RB 3T3ME 3WFHB 1LK3L 4OZ4B 5L8KB 3PWPD 1FFOA 3EHBD 5F9WC 1TJGH 5FAAA 1OOAA 3EGSA 2BRQA 4LQFL 5B4MC 1FYTA 1KCUL 1CLYH 5GRVL 4KJYA 3NFNB 4EQ3A 3ZDXF 4XPAL 1MQKH 4HF5H 3CFKB 3OG6B 5F7NC 4GT7A 2NQCA 2GK0A 3S9DB 2I9TA 1ORSA 1T21A 1Q72L 3QHTC 1JZ8A 3RU8L 3NCCB 3NCMA 1B0RB 1BFSA 4ODTL 4HS6A 3MMEA 4KPHL 3E0GA 4QOKE 5J13C 3SBWA 2R8SL 5FYKL 5F70A 1HH9A 3L6FA 3QDGE 4LLMA 3L5WB 2VR4A 4YFLI 1T5XB 2FGZA 1RIHH 4PJ7E 3L3JB 2W1NA 1IILE 3S5LB 2H26A 2MCPH 3LPFA 3TIEA 4Y16A 3TBYA 1IM9B 4F7PA 3N06B 1JTOA 3OJDB 3LKOA 1T66D 4PS4L 3RGHA 4MAUH 1NC4D 2Y9RT 3QEHB 4XVSH 5DSCA 5BO1H 3QUYC 4M7LH 3FN9A 1XGTB 3RWHA 3O0RH 2ARWA 4U1IB 5CUSL 5DQJA 5MEND 5DEGB 1KNOB 4G42B 4F7CA 5JR1H 3MJ6A 5IJVA 4L8DA 3OAZK 5E8PB 5F7FA 5C2BL 4DVBA 5CWSA 4KMLB 5AD0A 1FNSL 1A1OB 5DHYA 3JTSB 3IU4L 4UDUB 1IQDB 1KEGH 4XC1L 3CVHB 3KPPB 3WNOA 5IVXF 3O2WL 3EYFA 2D7TL 1CE6A 2Y5TB 4ZDHB 1AC6A 3MODL 5E00A 3SJVB 3C6LA 4IRSA 1BF2A 3KPRE 1EEZB 4FTVE 4OQTL 4OF5A 2WSKA 2XKSA 1F2QA 4LEXL 2XA3A 4LHUD 5HJ3A 5L9DH 4NQTA 4IOIB 4X7FC 5I15H 3MRPB 1AGDA 3E6HB 3IDYB 5GJSH 4D0DA 3TNMB 5D7IF 4GG6B 3MR9B 5LG1A 1NCDH 1QFUH 5GGSY 3V5KB 4C4KO 3M45A 4KDTA 4Z0BH 3U83A 4PUBH 3RPIB 4NRXA 5T5NG 1K9TA 3SDAA 2OL3A 3ARDA 3GSVA 3ULVL 1MOEA 2AAVA 1WUNT 1D5BA 4MQXD 2XV6B 2VDLH 5BS0E 4UDTA 4GMSH 1H15A 4KQ3H 4JFFA 4URTB 4HUUB 4OUUB 4LVHB 2J5LB 3D2UB 1GGBL 4HGMA 4Q0XL 4YGVA 4U6XB 5CFHA 3MV7B 3SN6N 4UV4H 1OP5K 3GI9H 4YAQA 2DTSA 3ISWA 3PWVA 1GOFA 4P46D 4UTAH 1ADQA 2NY2D 3MRBB 2NYYD 1JHLL 1KUMA 5KG9A 1MAJA 1NAML 2W60B 4F7MA 2MWCA 4NGHL 1R3JA 1OSZB 4BQ6A 2PYFB 1U6AH 5IESH 4NC1E 2DL2A 2WBKA 4E5XB 3F12B 2HLFC 2VDOH 3ARPA 1J87A 2HJFA 5DT1L 2PO6A 3G08A 3IKCB 1K4DA 3GMRA 3MA7A 4JFFE 5A2LH 1DZBA 1GC1H 1LE5A 2D31B 2HTLC 1U42A 4XWGH 3ZYZA 1EERB 3GHBL 3FOMA 1M71A 2I5YL 4FN0A 3UJJH 2JIXA 1XR8B 3LN5B 2IH3A 4R7NB 3DX7B 2FJFB 3DV4A 4QT5A 4PRPA 3ZE1E 4KVCL 5IVZA 1PEZA 1EEUA 5TF1H 1KCVL 1HILB 1IKNA 4UT6H 1CL7L 4NQEB 3QUMA 3K1DA 5IW6A 4NN7C 3P3YA 5HYFA 2AJYH 4OGAC 3KPOA 3IETA 3VFPB 5EBLA 3IJSB 3HG1B 4X6CB 4M5YL 4I0PD 4FXLA 4YHZL 4HGWB 4QTHA 3TA3C 3BWAB 3HI6H 1ACYH 4PRBB 3RY5A 4LOUD 2GHWB 3MRLB 4LSPH 5L88L 1JGEA 4KJPC 4Z7WA 3BWUC 2FLBT 3T77B 1IEAA 4M1DL 3NPSC 2HMIC 5GGVY 3MBEA 1LP9B 4PTTB 1KB9J 4K3DL 1WTGT 4Q2ZB 2BY1A 4QRQB 4J3SA 1FLRL 3K1KC 1DUZB 3JV4A 1G9ML 3AM8A 3BPOC 3V0WH 3DX8B 4NRZA 4QRPB 3FO1A 3RBGA 4A6YB 4YC2B 1SEBB 2YXMA 3QFJD 5HVWA 1FBIL 4APQB 1KIRA 3CFDA 3UYRH 3KPSA 2BOCB 4POZC 2EH7L 4G9FA 4UIKH 4JJHA 4PJBB 3QUXD 3PXJA 1UGNA 2ZSVA 4UU9B 1KIQA 1A6AB 2PW1B 4HHAB 3VGAC 2L7UA 4Y2OA 4ZFZB 1NAKL 1TLKA 2J3SA 1JNLH 3HR5A 1AXSA 5EU3A 4PTUA 1J7VR 3SGKA 3MREA 4JPWL 2HRLA 5TDOB 2DI8A 1NKRA 5E0QA 4AEIL 3CC5B 2X1PA 4NZTL 3BQUB 4UI2A 3CFBB 3T0EB 4BYHA 1MJ7L 1KCSL 1QQDB 1UYWH 1XCTB 1M7DA 2Y7QA 5K33A 2HT2D 4OB5H 3UTTD 5IR1B 2LU4A 4M6AA 1B2WH 5MEOB 2XN9D 4HIEB 4YHKL 2UUDK 3ULVC 3X13A 1N59B 4QHKI 4XB8A 2A6KA 3MLVL 5DHVB 1HWGB 1KPVA 4DUWA 2ADIA 1K2DB 1RZIB 2BXZA 4X6DF 3FZUC 2BVTA 3I3EA 2VB5A 1U3HC 1QSZA 1JPGA 4C83B 3LKSA 2HJLA 3QB7C 2RQ8A 2HLAB 1YC7A 2E9JA 3EDFA 3FN3A 1NBZA 2ZNXA 4M8QA 2BVPB 4ONOA 3BAEH 3O6FC 4P2YA 5E95B 4XH2A 5B39G 2ZSWA 4PLKD 5C8JA 3VXSD 2A77L 3OZ9H 3ROOB 4JFZH 3BVNB 1XF4A 3IF1A 1N64L 3VI3F 2XYCA 4G6AC 1TVHA 3MNVB 4ZQKB 5IG7B 3KLHC 3HPJA 2RFXB 4N68A 3TGXA 3UX9B 3X17A 3B2UC 5FOBA 2F74A 3WS3A 2PNDA 2J6EA 3IS1X 5CMAB 4OLXL 3T4AB 1T7ZA 3LIZH 4OSUH 3P77B 2FJGA 4I0CC 3P9MB 4LSUL 1KIPB 4HPYL 4MXWL 4JAMB 5EOTB 1CTNA 3VXRE 5EPMA 1FAKT 5F93C 5C0CB 4O2FA 2HKFL 2Z8RA 4WWKC 2AK4D 4JQVA 4U7KA 4Y4KC 4NO5B 4P3CH 4P99A 2E6PA 1A2YB 3Q1SH 5DK2A 2YK1H 4TVPE 3TH3T 3WFZA 4Y1AB 1QKZH 5EO1B 2DM4A 1EEQA 5TQ2L 4LKXA 4O51B 5CBAA 5INCA 3MYJA 4NBXB 3BDYL 2IH1B 2E7LA 4FP8L 1D9KA 3AREC 4F37F 2R2CA 1YPZE 5E5MA 2H32H 2DTML 4EI6B 1DFBH 5FO8A 5IM7A 2VABB 3ARFC 4JN1H 4JDZB 5CZVL 1J5OL 3TCLB 2CXKA 4KMTL 5IMMA 4MAYC 3UBXG 4MX7A 2O26U 4CKVX 3I6LD 5LJYH 2WWMD 4ALAL 2V2TA 3B83A 2CIIA 4GKNA 2AXHA 3EDEA 1J0ZA 2GAZB 3QDJE 2LFGA 1CLCA 4ZUSA 1G9MC 3FQWA 1CCZA 4XHJC 1BIIB 4XI5C 2HA1A 3FQTA 4NZUH 5IVXA 2AV1A 3T08A 3UTSB 3WFEH 3MNZA 3DI2B 5JXEC 5C0IB 5J06A 3HI5H 3OMZA 1UKSA 5JTWA 4FQHA 3MJ7B 3IDIA 1MRDL 3DGCR 2NXZD 1RI8A 3DX9A 4X4MA 2V6HA 4X5WA 1ZAGA 1OGAA 2Z8WC 5D7IA 3HR6A 3DSFL 3EDDA 4XWOC 4XBGB 4TUOA 4U31A 4KJWD 2EYSB 4ZO9A 1A6VL 2J4WH 2JF1A 1A7QL 1ZA3A 2DJSA 4L3EA 2OK0L 1DTUA 3NCFB 1MFNA 1RIVL 2B2XL 2ADFL 2BFVH 1XH3A 3TT1H 3VGFA 4KK9C 3UP1A 1GAFL 1L0XA 4KZEL 2NY3C 3WE6A 3B2VL 2E9IA 3QFDB 5C0AE 4MJ5A 1I1AB 4OLUH 1HH6B 3N9GL 1YY8B 1MPAH 3AB0C 4XHQA 2PTVA 4OZFB 1NSNH 3RAJL 5DEFB 5BCAA 1KJ2A 1OGAE 1RQ5A 1TIUA 5IVOA 1AGCA 4JVPA 4NJ9L 3OJVC 5L2KE 4MNQE 4U7SA 4UTBH 4G7YH 1PX4A 1A7OL 2WBJB 4IJ3C 4M7LT 4YK4B 25C8H 2UVEA 4OCYL 1S9XB 1OP3K 1YQVL 5DWUL 1U8NB 4ZOBA 3TBWB 3WL9A 4XNQB 1T4KB 5CIPB 2HFEA 5I76A 3PHQA 4L3EE 1DSFL 2C7UB 4O5LH 4ZFGL 1VPOL 3VWKC 4TTDD 1NCNA 2BNQB 2MPAL 1I7RA 1YEJL 4HJ0D 1RUKH 3TVMB 4CBPA 2DBJA 2AXJA 5F1IA 3EO1A 5JW3L 4I1NB 3KGRA 5F96H 5IK3A 3O6LH 3BT2L 4DW2H 1JPSH 4WDIB 3W0WA 4L4JA 4C54A 4F3FA 3BGMB 3THMH 4RMUA 3PQYA 4NQSB 4Z18A 3PWUA 4AQ1B 1T5WB 3SO3B 4EDXA 3EYQC 1R3LA 3QULB 5DVNA 4LNRB 2VDPL 4HK0B 4LKCA 5JOPE 1I9JL 1VFBB 3JVGA 3MLXH 3FRUA 4F57H 3FQUB 4LBEB 1I3RB 3RWDA 1DQLL 1WTLA 3A0OA 3CD4A 4KKBC 4L9DA 5IHZB 1W72B 5C0BE 1BBDL 2EE9A 4WO4D 4R7DA 3UEZA 1D5XB 4POUB 3MRFA 3VU2A 2SEBB 3MLTB 3FONA 2ITDA 1NMCB 3PQYE 1L7IL 1YMHA 4PD4K 5KTEL 4G8IA 5KZCD 1I8LC 2ORBL 5B3JE 3N85H 3ARWA 3TN0B 1TQCC 4L1HA 4PGDB 3QAZC 1WBYA 5C0GA 2Q76A 1JL8A 4NHUB 1KLGB 3RUGF 1OAXL 3CCHB 1UVQB 3D85D 4HPOL 4LL9A 3LHPH 4Y16C 3CSBA 1KBGL 5D6CA 2A9NL 5I66A 5ALBH 5AZEL 4P2RA 2C3HA 1AJ7L 3STLA 4R3SA 5B8CC 1FZJA 2EDHA 1MAMH 2D03H 2HFFA 4MA8H 3RKPA 1T0MA 4ZTPH 2QHRL 4JM2D 3F7PC 4P59L 4XGZB 4EQ2A 1AKJD 3VWJA 1XR9A 2YPLE 3RHWF 1M05A 4GRWF 2B1AH 1GGIL 3ZHDA 3GMQA 1QFWH 2JCCF 2HJKB 1DQMH 1WK0A 4Z6AT 4PRID 3MUJA 2LTQB 4IBLT 3U36B 1C5DB 4Y4HC 1YEGL 2X09A 3P11L 1YNLH 2R0LL 2NY4C 4PJ9D 1I9RL 3MLSL 2ZCLH 1L9MA 4PLNC 3X12B 1SY6L 4NIKB 5DUMH 1RUPL 4JKLA 5BRZA 4QF1A 3S88H 3KLAA 3P0YH 4FQIL 4JRYE 1YUHB 4MXQD 4PJBF 4X6DA 2ZCKL 5IHBA 3H7BB 1LE9B 1OSPH 4XAWH 4NWTL 2XG5A 3BEWA 1A6UL 4WNQA 3ES6B 4OZGF 2IPUK 1FNLA 1UJ3A 1KJVB 1DVFB 4NC1C 1TQBC 4NM8H 3RWJA 3BKJL 1G7QA 4FQLH 5EOQH 3HTLX 4JFHD 5TE7H 4L29A 3BRGC 1RFDH 1YN6A 4IIQB 2VOTA 1DANU 5DJCA 3F62A 3LQZA 4QXGL 3SDCA 1G7MB 2APTA 5AYUH 2BHZA 1GZQA 1YECL 3L5XL 2EZ0D 2NY1C 3TBSB 2ZUQC 1UWEL 4RA0C 4PJXF 5IB5A 3QA3A 4N0CD 1QLFB 2BNRB 4KROD 4RAUB 15C8L 2GSIB 2J8UE 4OF6A 4E0RB 5H94A 1OTUD 4MLIA 1BVKB 4HQQH 3WJJA 5EU4B 1K6QH 3QNZB 2CKBL 6FABH 3C9NB 2XACC 5DLMH 1S5HA 4DGYH 3AGVA 2ED7A 4I8DA 4HKXA 4ZMAT 5F1KC 3B9AA 5D7JA 3MLZL 3BPLB 3FT3B 5AZ2H 3P9LB 1MCIA 3L3DA 3PXHA 4LRNL 5DJ8B 5FF6B 4GG8A 1B0WA 3HNSH 5ICXB 4YHML 5HYIA 5DI8B 2CO6B 1BBJB 3QIUB 1UACL 4NZRH 3EW3B 4GKOA 2H3NA 1NCAH 1BLNB 2VDRL 1AGFB 4NKIH 4OFDA 5C0EB 2P5WB 1MEXL 5JXAH 4JG1L 4V1DB 1ZLVK 3ZTNH 2D7QA 5EU5A 5EU7E 1CZ8H 1KGCE 3HZMA 1D6EA 2A6IB 3FL7A 2V5RA 1P1ZB 3ULUH 4ONGH 2EDOA 3QDHA 4OZ4A 2DS4A 3VRLF 4LFHG 3ARRA 5F9OH 1KCUH 3EUUA 5L2JA 2WV3A 3WJLC 4KK5D 1DBMH 3NFNA 2G9HA 3E6FB 3FQNB 3SDDD 4HKZB 4TSBL 5E9DD 4K2UL 4DWHA 1BJ8A 5FXCH 2I60L 4BFIB 3RU8H 3SCMC 1TMCB 4XVTL 3SKOB 1RHFA 1T89A 3ZHLA 2GITA 5IHLB 3JSSA 1NUNB 4HKJB 1F90H 1QG3A 2BSSB 2NPLX 5I1IL 3EO0B 5CCKL 3QCTL 4XPHH 4HUMB 1ETZA 3CMOH 3MBEC 4KFZC 3TFKC 2WQ8A 1AGEB 1IAIL 3KNBB 4KTDH 9CGTA 4N5ED 2VLJA 1FGNL 5LWYL 3MJ9H 2DLEA 4BFEA 2HT4C 3DSNA 3OAZH 5K59E 3SOBH 2EEDA 4E41B 4I48B 5BW7A 3OJDA 4YHYB 4KKCD 1E28A 1OAZH 5E7BA 4UIMB 4X6FB 2X4SA 4O02H 3MBXH 3WCYA 1OWWA 4MZ3A 4U1IA 4JREC 2CDFB 1Z5LB 3KJ4B 2JKXA 4LCUB 2J88L 3NAAH 4U6VL 5E8PA 3P73B 4BUGA 3LKNB 3SQBA 1BD2A 1BMGA 2BVQA 1A1OA 4UDUA 3L1OL 4IS6B 1F45A 1QEWB 1I1FB 5I1CH 4PBXA 3MODH 1V3MA 3LQMA 3RL2A 5F71A 4NSKB 5FUCE 1EPFA 3H9HB 2DQHH 4YDIH 1EEZA 4RGND 1CR9H 3WXVL 2YUWA 1WEJH 3H9ZA 4QNPF 3KYNB 4NQUA 1WFOA 2R69L 2D9QB 2DLIA 1WIUA 3BFOA 2R4SH 4IOIA 4XNUH 3MRPA 1BX2B 2DQFB 3TNMA 5A2FA 4CU8A 1ES0B 4UINL 3BZFB 4GRLB 3RTQC 1HN1A 3RPIA 4QHLB 5HDLA 2AKRB 3OPZH 3RWFB 1AHWA 3F8UB 1TXKA 4NRYA 3RL1B 3U0WL 3SJVE 3F7RA 7CGTA 2XQBL 1FH5H 3S4SG 3QUZC 4LRIC 5DEZA 5FA3B 1RZFH 3BXNA 1L6XA 5IROA 3DO3A 4OUUA 3ARGB 4HUWB 1F6AB 3D2UA 3ZLQC 5CD5C 4PP1D 5HHQA 3EDKA 3PL6D 3KYOA 1A7PL 3KYKH 3MRCA 1XF3A 4U6XA 3MV7A 4LSRL 1L7TH 4GG6E 4KXZH 1PVHA 4JB9L 4PJ8A 2NX5B 1DBJL 1KB5L 1SYVB 3V4VH 4YDLB 1CIUA 3IGAB 5ADOH 2VDKL 1MRCL 3NOIA 3Q2CA 5DD3H 1OSZA 2PYFA 4Q9CA 5EU6B 5DT1H 4U1GB 4PD4J 2PTTB 4JVUA 1T0NB 4GLRI 2YUXA 2B0SL 3IKCA 3O4OC 4ZUWB 1FVEB 3D39D 5F1NB 2D31A 3C5JB 5B22A 1OW0A 1NEZA 4R97B 3SKUD 1U8KA 5KW9L 3MV7E 2NW3B 3I2CL 3LN5A 4H1LG 3C5ZC 4R7NA 3VI4F 2VN4A 4KVCH 4R8WH 3RUGA 3MPCA 5GS1B 5JHDB 1D9KC 3QJFB 1SM3H 5HDOA 4GSDL 3FMGH 2NY5L 4I18C 1WVZA 3U7YL 1CL7H 1ERNA 1N2RA 3OB8A 1QFWI 2F54E 1HILA 1FO0L 1Y18B 5KSAD 1P7KA 3BSZL 1T6VN 2OTUB 5E4EB 5LAXA 1NFKA 3VFPA 2VYRE 3IJSA 4IRJC 1PG7L 4C56D 3HG1A 4R0LC 4YXLH 2AK1H 4P3DB 2MMXA 4JFDE 2MQ0A 2ZCHL 4GW5B 5HHPA 2ADJB 2PCPB 2JCCA 5JQ6L 5TE6L 1G7JB 3AY4A 3BWAA 4OGYL 2OZ4A 3GM8A 1HQ4B 1JPST 5DJ2A 2Q8AH 1JZ7A 4RISH 5EA0L 1MFAL 3BE1L 4HMDA 2EKJA 1RZKL 2JELH 4NOBA 4GKZB 4NQEE 4Q2ZA 5C0RH 1J05B 1W2KT 5LBSH 1HDMA 2QQNH 4UBDD 4A6YA 3K7UA 1VEMA 3HG1E 5I8OH 4X6CE 4APQA 4EUPH 3MXVL 1H3XA 2C3XA 3FO9A 1SMOA 4Q9QL 1ZS8A 3ZL4H 4PJHB 5DD5H 3BO8A 4PJBA 5D2NB 4ZAKC 2WZPD 4UU9A 1A6AA 2PW1A 4K8RL 2FWOB 4LCIL 1FV1A 1HE7A 3O3AB 4ZFZA 3TBTB 1XGQB 4OZGA 5ISZD 3KXFD 4H0IA 4XPFH 5EZOH 3QQNA 3ZHKA 5D1ZD 4AEIH 3VRIB 5TDOA 3QFJA 4JM2F 5J6GA 1LP9E 1A1MA 3U0PB 3CC5A 3BQUA 3CFBA 3T0EA 1QQDA 3GSOA 4QRPE 3L5IA 3IDJB 1WFNA 1XIWB 1Q9LB 5IFAH 4WCYL 3MYZA 4PJXA 4RAVA 3P40A 5KJRL 4U3XA 4Z7UF 5GSRB 5DR5L 3KPQA 4JKWA 3MUZ1 1VENA 4X80H 4ZSOB 5DHVA 1NUFA 4UUJA 3SE3C 4YXKH 1RZIA 4NNPH 2MOVA 4FXKB 3WDIA 1ZSDB 3PJSB 3DXAD 1SHMA 1G7PB 2EIZB 4WGWB 3WO4B 3N1PC 1XF2B 4HH9A 3WD5L 4FXGB 2VAAB 1KLUA 4KUCD 3DTXB 2BVPA 3ILPA 4OUOA 3GGWB 3ROOA 3BVNA 1DLFH 1T2JA 3QQ4B 1II4E 1N7ML 2WUCL 3WHXB 4DEPB 5JA9A 4KZDH 2BNUB 4HJJL 3C8HA 3BN9D 3W11C 2RFXA 3B3IB 3R4DA 3GIZL 4YFLF 1RZJH 5DRZB 4MCYB 4O2CB 4XAKD 4U6YB 2UZXB 3P9MA 3QIWD 4FZEL 3VXSA 4JAMA 1GHFH 5EOTA 2DKMA 3ARYA 4PJEF 5C0CA 4UV7H 4WIQA 3IFLL 1LDPL 3QG7H 1NCCH 2PYEB 3W39B 4LCCB 4NO5A 5IJKC 4U1MB 1NCWL 1IGFH 3EOBB 1JUFB 4HUKB 5J12C 5KN5A 4HC1L 3U9UA 3T8XB 5T1KB 4FQXC 5HGAA 1A2YA 1MVFA 4HWUA 3ZKQD 2YD1A 4OFYD 3VH8G 3LB6D 2UWEB 4ODUA 1CFNA 1WCBB 4MA1C 3WUZA 4UNTA 5JNYA 3GSNH 5EO1A 1EO7A 1ZVHA 1B0GA 2HVKB 2KZ1B 1CFQB 1FIGH 2VLLA 2ENYA 1MJ8L 4IOFD 4H25B 1JPTL 5I30L 2IH1A 4YWGH 2IPTH 2W9EH 4BJLA 5KVGH 4YHNB 2OX5A 4EI6A 3HPLB 2N7BA 4PFEA 1UM4L 4H20H 3RDTB 4ODSH 4CVUA 5I1GL 4S11A 4JDZA 3O3DA 3TCLA 5GS2D 4JE4B 5FDYA 4PJDE 1T1XB 3EJZC 4J12A 5EOCH 5TH2B 2FEDD 4R4FL 4P2QD 4XB7A 4Y1AE 4PLJD 3FAXA 5I8EB 1G9NL 2GAZA 5A40E 1AH1A 2XZQL 4U1LA 2DQTL 5KS9F 5JORB 4JG0L 1QZ1A 2YKLL 4U1KA 4FQ1L 3IDNA 5DFWH 4P5TC 4I2XB 2P5ED 2EC8A 4OBRA 5FCUL 3WFBL 4MNGB 4K8RC 1OAKL 3KDMB 5F6HI 4AL8H 3KS0J 5E6ID 3RX8A 3MJ7A 2CK0L 1MFEH 4YXHH 3HRPA 3CVHL 2XWTB 1V8HA 3OKOB 5C0DB 1X7QA 3D3VD 4JGJA 5MENB 2PW2B 2YD8A 2YD4A 1JHKH 1A47A 1CF8H 4PG2A 4WV1C 1NGZA 2EYSA 2Z31B 3HNTL 3S5LG 5FM5O 2P8LB 1X5ZA 4KC3B 4Y0GA 4PY8J 2I25N 4FQ2H 2ZG2A 2E27L 3ZMRA 1N8ZA 4X0KB 3GZKA 5DO2D 3UTSE 4ENED 1UB6B 5C0ND 2M26A 1OCWH 4DZ8A 3DETC 1TNNA 5D96C 1OP3H 4Y2DD 1FZMB 5F72S 4OKVA 3BKMH 3QFDA 1U92B 4NKQB 1HH6A 2PUQT 4BZYA 1YY8A 4QHNA 2JB5H 1I1YB 4P2OD 3REWA 3TPKA 5IEKB 5DEFA 5K9JH 4HWBL 2O5XL 4N0YH 1TNMA 4X7DC 1UXSB 3BX7C 3WUWG 4AG4H 2WBJA 5EU7C 5K93A 3TJEH 1G6VK 3CMGA 3HS0A 1S9XA 2VZVA 4JKPL 4QCIA 4ZNCD 4G3YH 3TJHC 2YUZA 2UYLA 5JW4Q 1CS6A 3TBWA 3X3GL 3C60C 2R0KL 4XNQA 1T4KA 3BKCL 5F9JB 3S8WA 4JZJB 1JNNH 1MHEB 1OL0A 1YEJH 1GL4B 2OTPA 5J9PA 1XGPB 3TVMA 5D5MB 4TRPH 5JW3H 4F80A 3GBLA 4PGBA 3CFEA 3UROR 2XKNB 5E2TL 4LSQL 1CL7I 3UXFA 4PJGB 4F2MB 2VC2H 4DUXA 3BGMA 1MCFA 5GS0D 5TDPA 3ZKXB 5DMYA 4Z0XB 5I73B 1T5WA 3OKEA 3VFSB 4F7TB 2KDGA 3EOYG 3ARVA 1P5VA 2NY2B 4LNRA 4UAOB 4FQJH 4JFXB 4LPUA 4HK0A 1ZT1A 3SGDH 4XPBL 4HEME 2FEEI 4B53A 1BZ7A 3JXAA 4Z7QE 4XNXL 1A4JB 2YC1B 5ELIA 3DMMD 3O3EA 4AIOA 2BNQE 2YZ8A 2HT3C 1D5XA 5CP3H 4Y8AA 2F9BT 5GS2H 3R1GH 4IOSD 4L3CB 1FL6A 5GSVB 1MHCB 5B38A 2VQTA 5EORH 1XCQB 3TN0A 4OFIA 2YPVH 4XP5H 4MQ7B 3OXSB 1LK2A 4QGTA 4QWWD 1OTTC 1KLGA 5ALCL 4MXVE 1T1ZB 4EDWH 3CCHA 2C1PB 4GAYB 4NUGH 1J88A 1YMMD 2NY0B 2Y06H 3KVQA 3M17B 2DYPB 1AJ7H 2VDMH 4YO0B 3U4BH 1BVZA 5F7UA 4B50A 5FUCC 2GTWA 1MHPH 1G9NC 2EXWD 4TUJB 1U93B 1G6RB 3QRFM 3EJYD 4GXVL 3MOAL 4WTZA 2ZUSA 2EDEA 4P23C 4R90L 3BH8B 3D85A 4HDIB 2VZSA 4QXTB 4OGXL 2UY7A 4JO1L 3H42L 2VL5A 1MLCB 7FABL 4NQDD 4BQ9A 3X14B 3HE7B 5AWNL 2Z8VC 4I4WB 2R0LH 5D8JL 3U36A 1C16A 3ZTJG 1FG9C 2X4TB 4K07A 3NCEB 3WSQL 2F53B 1URLA 4EI5C 5JDJA 2G5BB 1QO3B 1ZT4A 4NNXB 4OIIL 5C92A 4PRDB 1RMFL 3MRRB 4OM0L 1A6WH 1QSEE 1HWHB 2E8ZA 4FQIH 2DIAA 4Z7UA 2W38A 4PRIA 4R2GC 3NACL 2VN7A 3IDYC 3PP4H 5IBLD 1U8HB 1YUHA 4PJHF 5E7FA 1A6UH 4YUEL 4BFBD 1TETL 1LE9A 5DRXB 1JI2A 1VGKB 2FL5B 1E4WH 3ES6A 2DKUA 4EVNA 3GUTB 1CQYA 3GBMH 4H0GA 4K9EL 4PV8B 4KRNA 1NGXB 2OSLB 3TZVB 4LHJB 4LK4A 4XNMA 4OI8A 3UBXI 1IM3B 3LV3B 5DMGC 3TH2T 2CGRL 4IIQA 1E6OH 3QPXL 2MFNA 4PRHE 1J8HB 1J1XH 2PXYA 4NNYB 2J5LC 1G7MA 3BRDA 1P53A 4UB0L 1FORL 2BP3A 3TBSA 1JYXA 2JJVA 5GS0H 5C0FA 2WWKT 1KN2L 4CL7A 3T4YB 5J11B 4RAUA 1VACB 4JY6B 3LN9A 3NH7H 5IB2B 4GS7C 5DGQA 5FV2A 3VXOB 1HZHL 5LGKA 3SDYL 1BVKA 4OD2A 1D7FA 4ZOEA 3WXWL 3QNZA 2WIIB 3RJQB 4PJEA 1N5AB 4NPYB 2V2XB 4AEFA 5FGBC 5J6HA 3K4ZA 3P30H 1Y0LB 1BQLH 4NQCB 1ZLVH 4H8WH 3SPVA 3ALWA 4K71C 4BH7B 4ELMB 2IANE 3FT3A 1RIUH 3LS4H 1OW0C 3KLSA 5DJ8A 5FHAL 5FF6A 1UG9A 2HRPH 4D0CB 1BBJA 3QIUA 5ANME 1AGFA 2HG5B 5C0EA 5I0ZA 2BNRE 3QZWA 1JJUA 5C07B 1OARL 4MD4B 1BM3H 1OGTB 4KUCF 1S9VB 2H2SC 2BERA 3VXPB 4J4PA 4HCRH 2A6IA 1EJOH 2ZUYA 1P1ZA 4BQCA 4PJFF 5F3BB 4CMHC 4PJAB 4KKAC 4EOWH 5DK0B 5J3HC 3B9VA 5HI4D 1S7RB 3CK0L 3MROB 5D2LE 2AK4B 2CXGA 5C09D 4HKZA 4OD3H 1PG7W 4N90D 3V4PL 1MFCH 3WKML 4BFIA 3SKOA 3JWDL 4RFEB 4D9QD 1BFTA 2P5WE 5KS9A 4XXDB 4V1DE 4GW4B 1QYGL 1KJMB 3V0VB 3VFMB 3RGVB 1A02N 1MSPA 5JZ7D 5GZOC 4D9RE 3CNKA 5B4MD 1AGEA 3KNBA 4BA8A 4Z78B 3BIAX 5GGSA 4WFEE 2FX8L 5FGSA 4E41A 1U2CA 4I48A 3ARBD 2R23B 4XP6L 4APQC 1JTTA 2C3VB 1CTOA 4EN3C 4IMKA 3WN5C 1RVFH 4N0FB 4XP9L 4NP4L 1JF6A 2EDNA 4JFEB 4O4YH 1Z5LA 4HS3B 1R0AH 1UB5B 3GRWA 2YPKA 3V6OC 3IFPB 5MHSD 2VJXA 3P73A 5DJAA 3LKNA 5KSBF 3HC0A 3WFCH 5E2WL 3MRNA 4IS6A 3HAEH 1QEWA 5IP4A 3NIFE 3KS0H 5D71H 1UEMA 3H9HA 4DJMA 4KK8C 2X4UB 3I6GB 1TCRB 2DIBA 3PV6A 5EUOB 5IB4A 5JPNB 4G8EB 3KYNA 3LEXB 4K9EC 1J1OH 1CIDA 1NANH 3VDAA 1X9QA 3NABL 5KVDL 3RVTC 2EDJA 5IF0B 1BX2A 2W0PA 5TE4H 4ERSL 2DQFA 1FGVL 5D4QA 1QACA 3QYCA 8FABB 5HPMB 2N7AA 5HYQB 5ITBL 5CSBA 1U9KA 2DI9A 4MB4A 3SHSA 2Q1EA 4QHLA 4I3RH 2AKRA 3RWFA 3RL1A 3FFCE 3ZE2E 1VFMA 3MOBL 4WHYG 4YPGB 1ZWIA 5ERWB 1BIHA 3SGDI 3WNLA 2VDQH 3A6CL 1KENH 3WV0A 4HZLB 4KI5E 3H2WA 1YNKL 2VXSH 2YA0A 1S78D 5HI5C 1MNUL 3MACH 1SQ2N 2FZ3B 3WNPA 1MF2L 5IOPA 1KOAA 1X6LA 2NX5A 5JIIA 5JW4M 3U7WL 2B39A 1ZTXH 1LWRA 3D5OF 4U1NB 4GMTL 1P9MA 3H6JA 3AFLA 4M9OA 2NR6C 3LS5L 4I9WE 1PJ9A 2PTTA 5I1EH 3C8DA 4YBQD 4OZFG 5C6TH 3UPCA 4M02A 5E24E 5D5MF 4OLEA 4UT9L 4MNHB 1NQBA 5DRNB 3ELAT 5F1NA 4KTYA 1M7XA 4OFPA 1KC5L 4H5SB 5I8CA 1YZZA 4UQ3B 5D1XA 5ACMA 1WLHA 1W72L 2NW3A 4GSDH 3QWRA 2ESVB 4AT6A 2NY5H 4G6FD 5GS1A 5JHDA 2NX5E 1RU9L 2FATH 3QDMB 3QJFA 1DBAH 4I0KA 5IMLB 2WMPA 3BSZH 3T3PE 1BAFL 5EU6E 3JWDC 4I77H 5FECA 1ZGLB 5F7HA 3FN0L 5DRWB 2OTUA 1H3TA 3BGFB 4YHIA 4ZXBD 4D9LH 4ISVB 2A1WH 5AEAA 3FQRB 2QSQA 4UT7L 3T09A 4P3DA 2EIDA 3K2UH 4LLYB 3O8XA 2PCPA 5JHLL 2JJWA 1JVKA 3BP7B 1G7JA 5IKCA 4YIQB 1JE6A 4OLVL 1BJ1H 2Z91B 4NUJB 4WUUD 1KT2B 1Z6JT 5JHDE 3QI9D 3BE1H 4AMKH 1RZKH 4NO0D 5GJTH 3OKMA 4NCC2 5C3LD 2D4FA 4IDJH 3PWLB 3JZ7A 4OT1H 3FAWA 3D6GA 4OBSA 3SKJH 5M94B 1HQRA 1R5IB 1J05A 5I1DB 2BDNL 5A16A 3RZCA 3MXVH 3TA3D 4OJFL 1V7NH 4Q9QH 4J3OC 1MCOL 3RNQB 1AKJB 4NN7B 3NFPB 4PJHA 5D2NA 3ARUA 5EZJB 4AH2B 2XWJB 1JGLL 5K9QI 2FWOA 3S37X 3V6ZB 3TBTA 3MV8B 3K0WA 1XGQA 1MCWM 3BEVB 2EH8H 4PP2B 4NQXB 3T2QA 2VZ3A 2R2EB 2ICEB 1OAYL 3TO2B 2GJZB 3VRIA 1MCPL 2HKHH 2I9LA 4PJ9B 4MA7H 3Q3GB 1YN7B 4JHAH 4POZD 1KYOK 1G7IB 2VQ1B 3NPSB 1I1AC 1PLGL 2V17H 3QDAA 4ZOCA 5SWSD 4XP1L 3IDJA 1GXEA 5E03A 1JTPA 1WV7T 2NCMA 2X42A 1XIWA 3VJ6B 5ISZA 3BPOB 1FLTX 4AIXA 1Z9MA 5D2NE 5E08H 3UJTL 3S35H 4YK4C 3U0TB 3N1GC 5FO7B 3AAZB 4ZSOA 1LVEA 4JZNB 2DD8H 1AFVL 1AC0A 1F4XL 4LLQB 1A0QH 1LILA 3BYTA 3HFMH 4FXKA 1ZSDA 1ZANL 3PJSA 1G7PA 1MIEL 2EIZA 3KR3H 4MJID 2CJUL 4X98B 3H8NA 2FBJL 5JDSB 5IGXL 1T04B 3WIHA 2L4OA 4UILH 3MGOB 3V6FB 5J0BA 3ULVD 3VFTA 5HGGS 1N7MH 4RMQA 1F11B 2ZWLT 5DFVD 3GGWA 1E6JL 3H3PL 3GSXB 3PWNB 3QQ4A 1NC2A 2IGFH 3FZUD 3WHXA 3F7VB 1RJCA 2O5ZL 2BNUA 3DXAA 3UCRA 5KVFH 3RFZC 3SO3C 2F15A 4ZSOE 3SEPA 3MCKA 4FZ8H 3ESVF 4M48L 4OZHB 2XPGA 3WS6C 3H9SE 3RVWC 1FE8L 3IFNL 3F6IA 4U6YA 2RGSA 2CLVA 4X5XA 3NIDF 4P2CG 1TZIA 4K3EH 2FGWL 4JCMA 4K3JL 1RUML 4MDJA 4ORGA 4OCXH 3QIBD 3INUL 2IMMA 1MWAL 3I9GH 5CGTA 4X7SH 3MRMA 5EFIB 1IAII 5GRUH 3KLHD 3W39A 4S1DD 5IW1B 3EOBA 2ICWJ 1JUFA 3B2UD 5F3HB 1NMCC 1IAKB 3BD5A 2OP4L 4WW2F 2NW2A 2CRZA 2UWEA 5JLZA 4PJCF 1WCBA 1UKTA 3O6FB 5TDNA 3LN4B 4X4YB 2HAZA 5D7LA 5D7SH 3TBVB 1HHIB 1U95B 2HVKA 5I30H 1CFQA 4H25A 3T0VA 1Q0XL 3KJ6L 3NZ8A 3EFDH 4YHNA 3D9AL 2XRAH 4X6BB 1JGUH 3MV9A 3RDTA 1S7SA 3A6BL 2W91A 3I6KB 3IXAA 4Q6IC 1IGML 2PYEE 1MI5D 3BW9A 1K8IB 1EZVX 5E8EB 4G6JH 4NCC1 2EO9A 2H1PL 4K7PL 1PZUB 3SDDB 1VKXB 4R4BA 5GGTH 2EYRB 5E9DB 2K9UA 4WWKB 1CFVL 4XT1C 2QQLH 5TH2A 3NFSH 2UWEE 4Y4KB 4N8CL 5FA4B 4DVRL 5KVEL 1QSFB 2DQTH 4Y19D 5DJZB 4WI7A 3CFIC 1CDGA 1J11A 4IDLA 5ECJE 5KSBA 2YKLH 3IU3A 2IJ0C 4NFBA 2DQUL 3ARFD 2VISB 4HSQA 3WLBA 3LH2H 5EUKA 3G5YB 2DQGH 2IMNA 4MD5B 2QSCL 3BRFA 3RQ3A 1V7MH 1HK6A 3O4LB 2I07A 3P0VL 4JGUA 3FRPA 3PWPE 5I1AB 4P2QA 1U8QB 2X4QB 1NMBH 3KDMA 5GZNC 4HX1A 4H26B 4XCEA 2AI0H 4HXAL 2VLKB 3EKCA 4RRPA 4XHJD 4BFGA 2CR6A 3NCJL 1KXQE 4PBVC 4MAYB 1JGVH 4G6MH 4N8VA 2F19L 2F5AH 2CMRL 1FZOB 2DQCH 5D1QA 2Q20A 2ITCA 3GSQA 3GJEB 3D25A 5JXED 4CVZB 2Z31A 1DVFC 1N0LA 3HB3C 4I5BB 2IADA 4RWYL 2NNAA 2B4CL 3P4OB 4LCYB 1NLDH 4Z7NE 4X0KA 4I2XE 1N0XH 4M7JL 3AXLB 4AM0B 5HYJB 3DGGB 2Y36H 2XIDA 4MNGE 4ZD3L 1D6VL 3TV3H 1EFXB 1FZMA 1YEHH 2P7TB 3QCVH 2MHAA 2QSTA 1U92A 1AY1H 5DUPH 4X8JA 1F3DH 4K94H 4RGNB 2EIEA 2C9AA 5EUOF 1N6QL 1CDHA 4WFFD 5MENE 1WZKA 4QTIH 1UXSA 3WIIH 5B39B 4XXCC 5HDBF 1U91A 2P48B 5FYLL 3C2AH 5GHWH 3D1MC 32C2A 3HZYB 5F6IB 3GFUA 5EO0A 1AR1C 2NY3D 4LSVL 5F9JA 1JFQH 2HTKD 3HMXH 4ZNEE 3DURA 4WRLA 1QLRB 2CDGA 1XGPA 3VFWB 5D5MA 3BPLC 5CINH 2P45B 3KYAA 3N1MC 3BZ4B 4XCCL 2VIRA 4DGVL 3OKKB 4OCWL 5J1AB 4CMMB 4JCLA 3NGBC 4XX1E 1H8OA 1BECA 5AAWA 2WINA 3RWGA 12E8H 3PL6B 1HCVA 3VFSA 3AB0B 5F21B 2DOCA 1CDJA 3VWKD 4DAGH 3FKUS 3B9DA 4JFXA 4Q9RH 5J56B 3L5HA 2XY1A 1UZ6F 5L7XH 4G8FA 5IV2A 2GT9A 3S36X 1A4JA 4GAGL 1B9ZA 2YC1A 4YZFE 1AQDA 3T65B 1P4IL 2JE8A 3PWJB 2VDNH 4U49A 3ZTJH 4Z5RB 4PJGE 4AJ0A 4L3CA 1IKFL 5GSVA 1MHCA 1YEKH 1H9VA 1XCQA 4W81A 3MLUH 3PABA 1UCTA 4G6KL 4WEUD 3NA4A 3OXSA 3T1FA 3IDXH 1UADC 4GKSB 3TP4A 3UBXB 2PTUA 3LEYH 4LLWA 1FYTD 1BQHA 2IEPA 1GCFA 4GXUM 4GAYA 5IWLA 1F02I 3W81A 3M17A 1R24B 2DYPA 5GIRB 3Q6GL 4QOKB 4HLZG 5KSAB 3QDGB 1EGJL 3NA9L 5HGDB 1KPUB 5FV1L 1U8IA 4D8PB 3DI3B 4M5ZL 5F8QC 4HZAA 3Q6FB 1G6RA 4RDQG 3QWOB 5CJOH 4C56B 1WZMA 4YBHA 1TJGL 2Q7NA 1N3NB 3KJ4C 3RWCA 3GSNB 1RK0B 2UV3A 1MAKA 5F89A 1CLYL 5SWQB 3MOQA 5SWZA 3F58H 1CU4H 4NQVB 1JZ3A 1T1YB 4Y16D 1MQKL 3IJYA 4UQ2B 1IGTB 3HLAB 1MLCA 4PYGA 1KYOJ 1KG0A 3WSQH 2CQVA 3X14A 3SGJA 3FTGA 1RZ8A 3NN8B 4NM4H 5I1KH 4XC3H 3GI8H 4EKXA 2OJEB 2G5BA 5DURB 2RCSH 4D3CH 1QO3A 1RMFH 3H3KA 1F42A 1Z0MA 5EC1B 3CU7A 1N5YH 4XVJL 3U46B 1WQVT 2R0WH 3MRRA 4KI5C 1WAAE 4L4TA 3EYUH 2EC9T 1Q9WB 4Y5XC 2MCPL 2B4CC 1QLEH 4WJ5B 1N4XL 1HYSD 5DJDB 5BV7H 4MA3B 4MAUL 4XVSL 4GBXC 4GQPH 5C08B 4M7LL 1ZA6B 3ALXA 1LO3H 4GRLC 5DRXA 3O0RL 4PLOB 1SEQH 3C6LD 4IRSD 5EWIH 1VGKA 3GMNB 4PPTA 2V2WA 1EO8H 5DUBA 5JR1L 4X7CC 3NCYP 4QRSB 4RMRA 5D1ZB 2F53E 1NGXA 2CGRH 3CFJB 3V2AR 1LHZA 3L7EA 4Y4HB 3LV3A 5I1HH 3RVXD 2IWGA 2BOBB 3KPTA 2BX5A 3ARGC 4NNYA 1KEGL 3TNNA 1MCNA 4Y5YC 5C0JB 2IF7A 1OF2B 4W4OA 2DI7A 3SDAD 3ARDD 2EO1A 2GSGA 1VACA 4R96B 4YDLC 3VXNB 2ARJB 1QA9B 3HCVB 5GGUB 3BHBB 5L9DL 4JFFD 1ORQB 5I15L 4QHMB 1F2XK 4PB9H 2YMXH 2WIIA 3IAQA 5GJSL 2V2XA 4NN5B 4OCNC 5DD6A 2XNAA 1VFOA 5JQHC 1QFUL 1HI6B 1JIBA 5TFSH 4Z0BL 2H9GB 4PUBL 3VXQB 1J8HE 1YEDB 4ELMA 5CJXC 3MV11 2VE6A 5E8NB 1JZ5A 3UTTE 4WW2A 2H2PD 5HGHA 43C9B 5EN2B 2QADD 2XN9E 2VDLL 3HA0A 4MQSB 3AU1A 3F7QA 5B3NA 4GMSL 3CXDL 2HG5A 2IFFH 4KQ3L 1IC4H 5C07A 1NDGB 5A1AA 2NY1B 2PO6D 2ZUQB 2CR3A 4XVUC 1C5BH 1OGTA 4NHCH 5JUEH 3L3KB 3ULVF 1Z2KA 3GMPB 3G6AB 4PIRF 4UV4L 2FSEA 3GI9L 1T3FB 4UTAL 3CK0H 4F37K 5DK0A 5E4EC 2D3VA 3ILQD 4NQCE 3DHJA 1S7RA 1FSKB 5LGHH 1NCUA 2FHBA 5DHXB 4ELME 4KRPC 1U6AL 3SE4A 5ID1B 5IESL 1YEEH 1QFHA 1CD1A 2VDOL 2WP3T 3MXWH 4RGOH 5IFHH 1OAQH 3VRJA 3SKNA 2EE6A 4M62H 4M8VA 1GC1L 2E7HA 5E2UH 4GW4A 4PB0H 2BSTA 5C07E 2A2QT 3V0VA 3VFMA 4ETYA 4RMWA 3RGVA 1X5LA 4XWGL 3LZFH 3LSOA 5HGBB 5M7QA 2APVA 4CW1B 3UJJL 5C09A 4PJAE 3NPZB 1A7RH 2Z93B 1W8OA 3SCMD 1VGEH 4GW1A 2CRIA 4K55A 2AK4E 4LNVA 2IAMB 3B5HA 2X4NB 2PR4H 3AROA 2QQQA 2R23A 2ZUUA 4J3UA 5TF1L 3EOAB 4L8SC 4UT6L 1P84K 3P4NA 1QHOA 3PGFH 2B5IB 4JFEA 2AJYL 3MBED 1MCQA 1NUGA 1SBBA 2OYPA 2AXGB 5LGJA 5DVMA 1QTYT 4Z7OF 2HT4D 1IFHH 4BSVA 4HG4K 4IM8A 2XA8H 1FVDA 1RPQA 3JUZA 3CLFH 3KPSD 2V7HB 3HI6L 1ACYL 2OQJA 5ESAA 4G9FD 2P5EB 4FMFA 1CFTB 1OP9A 2H8PB 3JV6B 3HMWH 4LSPL 4Z7VB 3QEGH 5L8LB 5HHVH 3I6GA 1I9IH 1PY4A 1SVCP 1TCRA 2X1XR 5E6IB 4CJ1A 1YEFH 3FHAA 5EUOA 4JQXC 3I6LE 3LEXA 1WZLA 3V0WL 4YFDB 1U8MB 4J7RA 3QUYA 2OL3H 1UA6L 1RHHB 1DUYB 8FABA 5FO9B 3UYRL 3LKQB 5HPMA 1E4XH 1AGBB 4LARH 1A6PA 1I85C 2AJXH 2K7QA 4UIKL 3WO4C 1U3YA 1NFDF 2N4IA 3GJFB 3UO1H 1QBAA 5D72H 4IEFB 1BEYH 3IAPA 2X2YA 4S1SL 2NY7H 1MY5A 3CUPA 3MRHB 1X4ZA 5J7CC 1JNLL 3TWCH 1KXVC 5ERWA 5FYJU 4G8GA 2NTFB 4DEPC 4HZLA 4W6XB 3VXMB 3BZEB 1ADQH 1JV5A 4RFNC 4ESKA 2COQA 1P2CB 3V8OA 1UYWL 5HYEA 3CXHK 3QXDB 2DRUA 3HHRB 5E6ZA 3SDXF 3HE6C 2OXGA 3HZVB 5M95B 1B2WL 4ODXB 2XY2A 1VADB 2FH6A 3EFFA 3GMMB 2CK2A 5INDA 4JRXB 1P7QD 2R39A 4P9HH 3QUZD 3TYFB 1F00I 5I9QC 4NC2B 3AMLA 1QFOA 4RMTA 4TVPD 4MCZA 3RJDA 3RTQB 3QH3B 3G6DH 4LCCC 3K81A 4XX1G 4Q7DA 3IDMB 1T6WA 3B9KB 3BOVA 3DUSB 4MNHA 4LHUG 5DRNA 4JO2H 4XBPA 1I7ZB 2X70A 5CZXC 1JGDA 4H5SA 5EO9B 2C3WA 4P4KB 3BAEL 2EC9U 3OZ9L 2CKBB 2ESVA 3BIKB 3OGCA 4JFZL 5IB1A 3QUMH 2ZOLA 4WW1B 1DQDH 3QDMA 1FNGB 5T1LB 4FQPA 1GIGL 3QO1B 3HUJB 3PP3H 3Q5TA 4YX2H 1PKOA 5CILH 5CSZB 3LIZL 4OSUL 5ETUB 3O45A 4WHTA 1GC1C 3T3MF 3MTRA 1YYLH 3C5ZD 1BREA 5CEZD 5JHLH 4LLYA 4CN4A 1I9EA 1D9KD 3DVIA 2H41A 3WIFB 3T04D 4P3CL 2JJSC 1NEZG 1Q94A 3F7YA 2VNCA 2Z91A 4NUJA 1NBYB 1KT2A 1CYGA 3Q1SL 1W0WB 3QDME 2YK1L 1QKZL 1LO0L 5F8RC 2DJUA 4FNLH 4YQXH 1K5NB 3WLWD 1OM3H 4I18B 1T66C 3FO2B 2ZG1A 4PJ7F 1DFBL 3RNQA 1IC7H 5DYOA 4Z9KB 3R8BB 4JN1L 3VFUB 1VFAB 4J3VA 5DDHB 4AH2A 2XWJA 2WWKO 3DYMA 1TPXC 3OTTA 4R0LB 2F5BH 2APBA 3D18A 4MB5A 3UDWC 4PP2A 1UH2A 5C0AD 4NQXA 3HI1A 3TA3A 3ULUE 2GJZA 2VXTH 1IT9H 3HC4H 4MD0A 1OGAD 3QP3A 3Q3GA 1LMKA 1YN7A 3WBDA 1F6LL 4WUKL 5L2KD 3OJ2C 1G7IA 3O2VL 2VQ1A 4ZAKD 5H2BB 1TTUA 1OD9A 1MCKA 1MCLA 5DMIH 1CDYA 4JJ5B 3WFEL 3QXUA 5FB8B 1RJLB 5I19H 5DJXA 1CD9B 3W82A 1JMZA 3HI5L 3N1FC 5CJ5A 4L3ED 3U0TA 3S7GA 3MRQB 5FO7A 4X7TB 4HIXH 4GFTB 1MCDA 3S4SB 1QBLH 3MV8E 4LLQA 4BK5A 2W9DH 2Z4QB 3H0TA 5SWSA 4JZJC 4PJ5A 2FBJH 2AGJH 2R1XA 5IGXH 4X98A 2V5MA 5IHUH 4MQXC 1IAOB 1T04A 1KCLA 3GBNH 2YD7A 4OQTA 4TVPH 2D0HA 3MGOA 4JPKH 3V6FA 1ZT7B 2J4WL 1CICB 1SJHB 3H3PH 5F7EH 1F11A 4L1DA 2J6EH 1LEGB 2BFVL 3TT1L 3GSXA 3ZKXC 3ARTA 1G7HA 1HSAA 3F7VA 1PYWB 2X41A 1KTDB 4J2XA 4ZG1A 2FX7L 4BSWB 1F4WH 4P46C 4OLUL 1MPAL 2NY2C 4UAOC 3IFNH 4BQ8A 3HC3H 2DWDB 1NSNL 1MLBB 4FHBD 4QXUH 1H3VA 3GK8H 4TNWK 4LPCA 5CP7B 4M9PA 4UTBL 4G7YL 1PY9A 4FQCH 25C8L 3PQYD 4H1LB 3LKPA 2D2OA 3OL2A 1U3HA 3FFDB 5EFIA 3EDJA 4JFHE 1BFOB 3W11D 4RGMC 2HN7B 2LVEA 4XNYH 5FDWA 5IW1A 1WWCA 5F3HA 3QWQB 4O5LL 1UEYA 4LLUB 2AQ1A 1N6VA 1DR9A 1IAKA 5C0BB 3U82B 1OVZA 5CEZH 1RUKL 1HKFA 3O6FA 3LN4A 4X4YA 1KB5B 3ZDZE 1NAMA 5F96L 3O6LL 3TBVA 4OZHE 1EFQA 1JPSL 5T5FH 3DVGB 3R06A 4OFVA 4X4XB 3THML 1KJ3H 3CPLA 4P5KB 3V95A 1QBMH 3WNMA 2ILLA 3MX0A 1EA9C 1Z3GH 3MRJA 2YPLD 1P84J 4G80B 2OI9C 1DLHA 3PNWB 3ZE1F 5E8EA 1EXUB 3MLXL 3VG0H 4F57L 5KSVB 1O7VA 2V7NB 5KANI 3RVVD 2BSED 3R8QA 4LLVB 5GGQH 1VKXA 4I0PC 3MFGB 2NZ9D 4WWKA 3L3OA 1K8DB 4HG4J 5FA4A 4Y4KA 3MO1B 1QSFA 4KK6D 4Y8DC 3NBNA 2LVCA 3G6JB 2P49B 2EDKA 4DK6A 4HIHB 5I1LB 3TF7C 4FQXB 4P2RD 4LOUC 3HE7C 3U2SB 4GUPA 1DBBH 3OKLA 5AYQA 2O61A 3GSRB 2GTZB 2QSCH 2VISA 3RIFK 3N85L 4BSJA 3VWJD 5E8OA 4CRPA 1R5VA 5DF0A 2E7CA 2ERJC 4LLAA 3TESA 4NWUH 1U8QA 1FCCA 5HHXH 3SQOL 3AREA 2FHCA 5EC2B 4R26H 3LHPL 1WGOA 3UYOD 1KELH 3GMOB 2VLKA 5E9DE 5ALBL 3UJIH 3MRDA 3ARFA 3QUXC 1X5JA 1MAML 4MAYA 4MA8L 3KAAA 4ZTPL 4JY5H 5FUZH 2X1QA 5EG6C 4RMSA 1INDH 2F8XC 3MFFA 4HW6A 3O41A 3GJEA 4WU7B 3DRQB 5F7MC 2B1AL 4S1QH 5BRZD 5MERA 4OV6F 3TZVC 1Z9SA 1QFWL 3DBXB 3P4OA 4YHLH 2VLRB 4LCYA 3O4LE 5HD8D 5E1AB 2DF3A 5HYJA 5AUMB 3DGGA 3S3SA 1KJ2H 1IGYB 3CXHJ 3NCBB 2R0ZH 2HT2C 1EFXA 2P7TA 4W4NA 3CIQA 4P5TB 1YNLL 1A9BB 4CDGC 3O3UN 4U33A 4IMLB 3U6RB 4NO2B 2ZCLL 1MRFH 1NKOA 2APWA 2VLKE 3L95B 3QR2A 5JXEA 2XZAH 3NTCH 4ODWB 1AIFB 1HHJA 1S8DB 5IT2H 5J11C 3SDXA 5DUML 5SV3A 1N6UA 1NFIB 3OR6B 5B39A 2GJ6A 3S88L 3P0YL 3HZYA 5K9OB 1IE5A 2J8UB 2W0FB 1UCBH 2FHFA 5DQ9B 1PBYA 1H0DB 1OSPL 1QLRA 4XAWL 1S7TB 2PKDA 1AXIB 4WV1B 5IB3B 5JW4R 2X4OA 4AK1A 3L9RA 1WZ1H 4PLKC 2HVJA 3PDOB 2VKWA 4NM8L 1KPRA 5J1AA 2LV4A 1FNEA 4PJIB 1AD9A 4FQLL 4RGNE 5EOQL 3ZSSA 5CLWA 1OPGH 3TJHD 1MJUL 1MIMH 4G43B 5TE7L 1RFDL 2AEIT 5JOEA 3GIVA 4P57B 4BH8B 5AYUL 2CUHA 5D7JD 4FQQA 3QEQB 3VH8B 4UNUA 4KHXH 2FH8A 5DXWA 1C7SA 5E56A 4RNRB 2AEPH 2X7LA 1YEIH 4HQQL 3T65A 1K6QL 3PWJA 3C60B 4KQ4H 6FABL 1B6UA 5DLML 4ACPA 2XG4A 1JRHH 3LOWA 4DGYL 1MCCA 2YSSA 2DWEB 2OMBA 1IGIH 3TIDB 2O5YH 5AZ2L 2Y6SD 1HINH 5DC0A 1P6FA 3HNSL 1ZOXA 3OAYK 4NZRL 4XPTL 1CVRA 1NCAL 3UPRA 5BJTB 3ARSA 5JXAL 1BVLB 4FABH 4O9HH 5GIRA 3ZTNL 4QOKA 1CZ8L 4KV5E 4PG9B 1R5WA 3QDGA 3V8CA 4YHPB 4CN1A 1KPUA 1YPZF 3KPMA 2X9WA 3SGEH 4PJ7A 4ETQB 5CJ8A 3ULUL 4ONGL 3C08H 1OB1B 4MYWB 2WWMC 3D39E 5F9OL 4ZS6D 3S34H 4XTRD 3VXUB 1N3NA 5BZDA 1RK0A 2VLJD 1V3KA 2ZZUT 5SWQA 1DBML 2ICWA 5EB9A 4NQVA 4UQ2A 3HLAA 4PR5A 2EKSB 4WUUB 4L9LB 8CGTA 1CFSB 1I8LA 3G5VB 3QI9B 4QYOA 3FHQA 4YR6B 2FO4B 2FO1A 4Q9BA 3G5XB 5IVNA 1UJTA 1QRNB 1F90L 1REIA 4XVJH 5EULV 4PGJA 4D0BB 4JLRB 4XPHL 3CMOL 4HK3J 5EC1A 1LD9B 4WI2A 1ND0B 4KTDL 3DX6B 1M6OB 1BD2D 1J0JA 3SE9H 3MJ9L 4C56E 1N4XH 1BF8A 5DMKA 3VXTB 3KPRA 1HCFX 4FTVA 3WNKA 3SOBL 5B8CA 2GYSA 1VESA 4WJ5A 5BOPA 1OAZL 4MA3A 4ZYKB 1EHLH 4O02L 5F88B 3MBXL 2Q8BH 5DK3A 4KJWC 1RUQH 4P23B 4M1CD 1FG2B 1M4KA 2JB6B 4YHOH 1S7QB 3NAAL 2X4RB 3WUWB 2WK2A 1KFAH 3LQAH 3CFJA 1UM6H 3WYRA 2CO7B 5LCVH 4Y4HA 1AP2A 2XXMB 4ODVH 4EI5B 5I1CL 1PSKL 5BS0A 1OF2A 2DBLH 3OXRA 1H3UA 3FB8B 2VXVH 2DQHL 3MLWH 1UXWA 4YDIL 4KY1H 5IMOB 5C08E 1CR9L 3RNKB 1WEJL 4R96A 4WEBH 2ARJA 4R2GB 1QA9A 3HCVA 3BHBA 1FVCA 4ONFH 2FJHB 2R4SL 3KXFE 2R1YA 1ORQA 4K7PY 4QHMA 4XNUL 5E2JA 5JW4N 2XTJB 1JHTA 3D2UD 1FRGH 3UYPA 4MJIB 4HJ0C 4DZBB 1INEH 2H9GA 2CIKB 3MV7D 4HKBA 3NIGE 3QJHB 4OLWH 4F8QA 3CH8A 4OV5A 4PJ8D 5E8NA 5JO5B 3E3QE 3OPZL 4HGKC 2KKQA 2BVYA 43C9A 3X11A 3CXDH 5EN2A 4C58B 5DJYB 1FH5L 4U2ZA 1H8SA 1I3GL 1RZFL 4BZ2H 1CG9A 4QRTB 1NDGA 2YWYA 3O3BA 1JF1B 4ZUTA 3KYKL 1S9YB 3GMPA 4HBCH 4M7ZC 2VR5A 1EAPA 3QNYA 1L7TL 1T3FA 4GS7B 5D6DC 2AERT 4X9BA 3QIBB 3SKMB 5JOFB 3BGFC 3V4VL 5ADOL 1LEKB 2F54B 4WO4C 5DD3L 1PQZB 2IBGA 1OWRM 5CKGA 3FB7B 5AAMA 5TF0A 2GK2A 1IVLA 1QBBA 2CUIA 4NT6A 4C4KT 4AYFA 3MCLH 1L0QA 4K71B 1X5YA 4JFDB 5AG8A 2OTWB 3FCTA 4NQED 5J4MA 1A3QA 3LRSB 4KKAD 1CBVH 4MSWB 5B3JF 3ULUC 3RP1A 2YD6A 3HG1D 5K9KB 2P8MB 2NXYD 1HXYB 4XCFH 4CN6A 1H3PH 4R8WL 2Z93A 3JV0A 1SM3L 2KPNA 3FMGL 2EDXA 1I1CA 2IAMA 1MI5B 2X4NA 4JM2C 2NY6D 4CMHB 1WBXB 3EOAA 4JY4B 5D9SB 3WJLA 1J0KA 1V3LA 1F3RB 1QR1A 4F9PC 2AXGA 4OF3A 4YXLL 3H9YA 2AK1L 3QEUB 2RB8A 3SCMA 5HTSA 2CLZB 4F58L 2BSRB 2FEEL 2DJ4A 2EDQA 2OS7A 4APQD 4PJ9C 3B6SA 5EZLA 2RBLA 3ARZA 2Q8AL 4M6MH 2H8PA 3JV6A 4RISL 1OTSD 3CU1A 2JELL 2IQ9H 4YGAB 2BZDA 5EIIB 1C12B 1UA6H 2YD3A 5C0RL 1H5BB 4TUKH 4F9LC 4MXQC 5LBSL 2X89A 1U8MA 2QQNL 3QQ3B 2YBRA 3BQUD 1JI1A 3T0ED 4EN3B 3WN5B 5I8OL 3W2DH 4BKLB 4PREB 3ZL4L 5DD5L 3U48A 1XGYH 1A3RH 4KK8D 4S1SH 3GJFA 1A7BA 1DN0B 5LXGH 3BUYB 3TO4B 3P2TA 1SY6A 1EZVY 2IQAB 1MFDH 3SO5A 5JA8B 2P5EE 5MEPA 4Z7VE 4JR9H 3MGTB 5IBUB 4XPFL 5EZOL 5TPWH 3PHOB 5A2IH 4N1CA 3CFCH 3ZT6A 3BZEA 2EZ0C 3O9WB 4NO3B 5BV7B 4XNZB 4N0CC 2C1OA 4KROC 3DO7B 2X4PB 3MRKB 5IFAL 1OTUC 1JRHI 3BH9B 1VADA 5JMRA 4Y89A 4YH6A 4M1GH 1IAMA 4JRXA 1JWSB 4X80L 2J8UF 2G60H 5GGVL 4YXKL 1J9CT 1GGUA 4NNPL 2R56H 1C1EH 3MSPA 3RTQA 3QH3A 4EUPG 4GO6B 2D0GA 2UZYB 5HI5D 3IDMA 3VXRA 2Y5EA 1DEEB 1V3JA 2CSPA 2QR0A 3DUSA 3ZKSD 1TJHL 3VXME 5ID0B 1I7ZA 1J8KA 5EZIH 3VG9B 5EO9A 3ZSTA 1P7QA 3FQXB 3QUZA 4LRIA 3SGEI 5C0CD 3VGHA 2CKBA 4OZIB 3BIKA 1DLFL 2NR6D 1DDHB 1GIGH 4KZDL 1FNGA 1CT8B 1PKQE 3W9DB 4JRXE 4GAJH 3C8KB 3QO1A 3HUJA 1IBGH 1RZGB 5FKAB 2Z9TA 1RZJL 4N9GB 1OQOA 4GRWH 4Y1AD 5I18H 1YPZA 5DVLA 5ETUA 4IRZH 2AJ3B 3TPUB 4KK5C 3I85A 4Y4FB 1HXMB 2XQYK 3SDDC 3C6SA 1GHFL 4NYLA 2OZ4H 5T3ZD 4AIZB 4UV7L 1P4BH 5LKNA 5SX5K 3QG7L 4PJDB 1NCCL 3WIFA 1IC5H 2ATKB 3TLRA 1FCGA 1IGFL 2DQEH 3DVNB 1ZHBA 1NL0H 1NBYA 4NDMB 1CDCA 3CGTA 1AI1H 1LO0H 1W0WA 1GPOH 1TFHA 2Z92B 3QDJA 1FYTB 1NBQA 3ME0A 1U8LB 4KVNH 1EV2E 3HZKA 3GSNL 1AXTH 1A6TA 1T7VA 4KJYB 4B7LA 4N5EC 3VW3H 3C5ZA 3HUJE 4MWFB 4A6YH 4HIJA 4EIZC 3WEXB 1FIGL 1K5NA 3HNVH 1DANT 2MTPA 1ORSB 1T21B 4I18A 4YWGL 1W8NA 2CLRA 2IPTL 2W9EL 5KVGL 3T0WA 3MMEB 3AVEA 5K59F 4H20L 4ODSL 3VFUA 3UTSD 4IRJA 4R0LA 5I0DA 1FQ9C 5EOCL 5HYSG 2WIMA 1S9KC 3CDGB 4NJAH 2ED9A 4KMQA 2CDEB 1S7VB 1YMME 4WUKH 3O2VH 4JFQA 3ZYJA 3VD5A 2J2ZA 4F7CB 5H2BA 2BVOB 2HWZH 3V5DA 5IJVB 4L8DB 2E9BA 4JDTH 4RGNC 4WU5A 3RI5K 5DHVH 1DQQB 4JJ5A 4XBEH 4DVBB 5CWSB 5E2VH 2QKIB 5FB8A 1RJLA 5DHYB 5C0AA 4DTGL 4AL8L 1OLLA 3RPKA 1D5IH 1MFEL 4YXHL 3OBAA 1CE6B 5F6IC 1P4LA 5E00B 3QXAA 5L2KA 3W5NA 4MNQA 5CJQH 4ZAKA 3TEUA 4ONHB 3WKNA 2R1WA 5DS8A 5I1JH 1JHKL 4EIGB 1CF8L 4YJZL 2FR4A 1IAOA 5HJ3B 2MCG1 3X3FH 2WBJD 1AGDB 1SJHA 4D0DB 4FQ2L 1A9EB 2WUBH 5CZKA 2FX7H 4PP1C 1OCWL 2ADGB 3PL6C 3IDGB 4LU5H 2WP3O 4H88H 4LSSH 1KTDA 1TVBB 1BOYA 1A22B 4BSWA 3ARDB 2BVEA 3GSVB 3BKML 3V7AG 2JB5L 2BNQD 1D5BB 2E5EA 3TVMD 3BKYH 5K9JL 4D94A 4N0YL 3OB0K 4F33B 5CP7A 3SE3A 4AG4L 4GG6F 5T33H 4XRCA 3TJEL 3V5HA 4H1LA 4CU7A 4G3YL 3CZJA 4YGVB 5E1HB 4X4ZA 3VGGA 3O6KH 1BFOA 1CK0H 1WSST 1A7NH 2HN7A 3PWVB 4HJGA 1JNNL 2FX9H 3Q5YA 1KN4H 1KCRH 1JK8B 5C0BA 5KG9B 4FFZH 5T3ZH 4F7MB 3RVWD 4WY7L 4TRPL 4A2LA 4RQQB 3D87B 5DJ0B 1RZJC 1UM5H 1KB5A 1D5ZB 3EZ8A 4U3HA 2VC2L 3DVGA 2A0LD 3UTPD 2HJFB 4NKMB 5BXFB 4K7FA 3G08B 3BPCB 3GMRB 3IXTA 4LDOB 4U1JA 1SJEB 1LE5B 4GXUN 5KSAC 4FQJL 3TN0D 4LGRB 2V5TA 1M71B 2FIKA 2JIXB 4F7EA 3PDGA 4HFUH 1MH5A 1IJ9A 3DV4B 2DDQH 4LLVA 4PRPB 2BY3A 2N56A 5IJKA 2MJWA 4YE4H 2YPLA 1YQ2A 3R1GL 3QUMB 4FQXA 2LAGB 5HY9B 2M1KA 3RVUD 1A1NB 3EYVB 1RV6X 4B41A 5EORL 3IETB 1FO0A 4S2SA 3C5SB 5ICYB 2YPVL 4XP5L 3ARQA 3SQOH 5DTFA 1HHHA 4EDWL 5CGYD 4QTHB 4WI5A 4NUGL 4UBDC 4XZUB 3O11A 4KTEH 1RURH 4Q97A 2APFA 2Y06L 4U2YA 2VDML 3U4BL 3GMOA 4Q6IB 1JGEB 1MHPL 4Z7WB 1QSEB 1IEAB 1X4XA 3EIFA 4R4ND 3G6JE 4X6CF 4JRYA 5HHOB 3JV4B 3DRQA 3ZYIA 2JJTC 2XWBA 3FO1B 5D1ZC 4GQ9H 2A6JB 3T2PA 4WFHE 5IMKB 3C09B 1WWAX 3CFDB 1MREH 5E1AA 4DQOH 3KPSB 1SYSB 5AUMA 3EOTH 4G9FB 1CXHA 4FFVC 4X7EC 3U1SH 1IGYA 2DQDH 2ZSVB 1KIQB 3BYYA 3E3QC 4DOHB 3KPNB 4P5TA 1A9BA 5DD1H 1S7UB 1LP9F 4IMLA 2R2HB 4PRHB 4TNVF 3E2HB 4FFWD 1S8DA 1RZ7H 1A6WL 3MREB 4FG6D 1NFIA 3OR6A 1J0IA 3ZDYE 2WAHA 4QRRB 4NKDB 1YY9C 4DFIA 4N8VG 2OR7A 5K9OA 2PXYD 2J8UA 3PP4L 4NN5C 2W0FA 3VFVB 4U1HB 4S10A 2VLRE 5DQ9A 1JPFB 1H0DA 3TT3H 5KSUA 4WV1A 4ODBD 3TH4T 1E4WL 2BNRD 3X13B 3GBML 2A6KB 4FRWA 1KPVB 2ADIB 4DN3H 1ZVSA 1MJUH 3L5JA 4PJIA 3QPQD 3KWWA 5CS7A 2IANB 4G43A 5C3TA 1E6OL 1I7TA 1J1XL 4K23H 2HJLB 1YC8A 4P57A 5TGBB 2ZUXA 4M8QB 5ANMB 1ONQB 5HPOA 3QIWC 3QEQA 3VH8A 4YBLB 5GS0L 4MDIB 5C8JB 3RKDC 3MLRH 2Z35A 1U2HA 3NH7L 3QIUD 3K4AA 1FSKC 4QHKJ 1TVHB 4JANA 3HPJB 2P5WD 3C60A 4M6OH 2VR9A 4LSDA 4V1DD 4KKLD 4X6EB 1C08A 2F74B 4TN9A 4L5FH 3GB7A 4PJIE 1CGVA 5D2LB 1B6DA 1G9EA 1FFRA 3P30L 1J1PH 1BQLL 3LB6C 4J4PD 4JDVB 4H8WL 2A9MH 1NLBH 1TZHB 2DWEA 3MJ8B 5FHBH 4XMLL 3ZE0E 1XF1A 1RIUL 3LS4L 1KV3A 4DKEH 3NGBB 4XPTH 5ESVA 2HRPL 4IOFC 3QUKB 1KTLB 3QEQE 1MWAB 5GISH 2CH8A 4TNWF 4YDJA 5K9QG 2YOCA 2P42B 4L8CB 2A74A 4LSTL 2RAMA 1BM3L 2IAMC 5T1MB 2AJZA 4P4RA 3WFHA 4YHPA 4HC1A 4HCRL 1EJOL 4LKXB 1OLZA 5CBAB 1OB1A 4EOWL 2B5IC 3MYJB 1EDQA 1AD0B 2FEDC 3VD4A 3VXUA 3ZKNC 1A5FH 4PLJC 3P4MB 4PJDF 5E5MB 35C8H 3CFKA 1RULH 4OD3L 5FO8B 4L4VB 5IM7B 1MFCL 4E41D 4X9IA 3CDFA 1CFSA 2JLLA 1B0RA 2FO4A 4MX7B 4NN6C 1F5WA 3G5XA 1BQHG 2V2TB 1X4YA 2B7DT 5C71A 4JLRA 3L5WA 1T5XA 5E6IC 1E4KC 3L3JA 4DKFH 1PG7X 3S5LA 3VCLB 1ND0A 3DX6A 1M6OA 1QPXA 1IM9A 3FQWB 3VXUE 2W65B 3QEHA 1F6FB 3MRIB 3UPAA 3FQTB 3AS0A 1XGTA 4OM1H 5BVPH 5IVXB 2AV1B 4RZCB 4U0RC 5F88A 5DEGA 1UKQA 1KNOA 1RVFL 4P23A 4G42A 4QXWA 4WUUE 5MEQB 4O4YL 4WI9A 1PW3A 3RIFF 4LF3B 2RR3A 3IDIB 4KI5D 2Q6WB 1R0AL 4FOMA 2VZ1A 5DO2C 1S7QA 4ENEC 1QRNE 2X4RA 2GJJA 4X5WB 3JTSA 3WUWA 5C0NC 1KULA 1IQDA 1CDIA 3JV5A 4Y2DC 3WFCL 3CVHA 1PSKH 3KPPA 4C55A 1AO7B 5ABDE 4ZDHA 4EI5A 2Y5TA 3FFCB 4P2OC 3SJVA 4TUOB 4OF8A 5D71L 3FB8A 3U79A 2GI7A 3O2DA 4YLQT 1ZA3B 1EUUA 4QLRA 1FL3B 3RNKA 4Y5XB 4QO1A 1J1OL 3E6HA 3WE6B 1UENA 4GG6A 3MR9A 4MJ5B 4GBXB 5FGCB 4RIRB 3V5KA 5TE4L 3A67H 3ARGD 2EE2A 4HH8A 1KJ2B 4DZBA 1QP1A 1ITBB 3B9KC 1EHAA 2CIKA 3QJHA 1OP5H 4I3RL 5JO5A 1T83C 2NX5D 2K7PA 4HWBA 5I17B 3LY6A 5GS0C 4P4KC 4KWUA 3WL9B 1I3GH 3MA9H 5DJYA 5HI3D 4HUUA 3T2NH 2DIJA 3PHQB 2VDQL 1KENL 4Y5YB 1FFPB 3HAEG 3UAJD 4N5UA 4QRTA 2VXSL 3OJMB 5F9AC 1I7RB 1JF1A 3MACL 1S9YA 1L6ZA 2XTJE 3MRBA 4H8WC 2W60A 3W0WB 3DMMC 4MJIE 4F3FB 3A6OA 3L3IB 5D1XD 4M61B 1DCLA 3PWUB 3QRGH