3L4CA

Structural basis of membrane-targeting by dock180
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
185
structure length
178
Chain Sequence
RNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPIEDVNRSHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTLRDGEHDLIVYKAEAKKLEDAATYLSLPSTKAELEEKSMQSLGSCTISKDSFQISTLVC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion, cell invasion, apoptosis
molecule keywords Dedicator of cytokinesis protein 1
publication title Structural basis of membrane targeting by the Dock180 family of Rho family guanine exchange factors (Rho-GEFs).
pubmed doi rcsb
source organism Homo sapiens
total genus 31
structure length 178
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3l4cA00
3QR0A 3W57A 1RH8A 3QJZA 1GMIA 1TJXA 2WXHA 4KZ0A 5T8IA 4BGDA 3NSJA 2K4AA 4XE0A 5KJ7E 4XZ4A 2WXOA 3NZUA 4OVVA 4PS8A 5JHAA 2NSQA 2CHZA 1E7VA 2WXQA 4HVBA 2JQZA 4ANXA 4WEEA 1TJMA 2RD0A 3HIZA 4NP9A 4GB9A 2CM6A 1W16A 4Y1TA 3IM1A 4IQHA 3QR1A 4V11A 1HE8A 3PRZA 4LT7A 3OHMB 3APCA 3JZYA 3ZIMA 4J6IA 4AOFA 2V4LA 3L9BA 1DJWA 3APDA 1DJXA 1BCIA 1BYNA 3T8MA 4PS3A 2KI6A 3F04A 3HN8A 2K45A 1K5WA 4QAMB 4KITB 3SD5A 2LHAA 4FLHA 1RSYA 2WXNA 3ZVVA 4FHJA 1UGKA 1QATA 2ZKMX 4L1BA 5G2NA 4WWPA 4F1SA 2WXJA 4EZLA 2DMHA 2NQ3A 2WXRA 2A4ZA 2DMGA 2WXGA 3F01A 1DJGA 3HHMA 1WFJA 2A5UA 2CJSA 1DQVA 2FK9A 2CM5A 2WXFA 2WXPA 1DJYA 3DBSA 2QZQA 3L4CA 4WAFA 4EZJA 2CHWA 2Z0UA 2Q0ZX 4MJJA 4Y1SA 1YRKA 3TJPA 2ENPA 1W15A 3CSFA 2QZ5A 2K8MA 4FJYA 2R83A 2YOAA 4ANVA 4QJ5B 4EZKA 4F93B 3L17A 4GNKB 5CCHE 3PREA 2ENQA 1E8ZA 4L2YA 4DK5A 2YRBA 3L54A 4G11A 4TS6A 3GPEA 4NS0A 2WXMA 4NPKA 4ANUA 4LCVA 2Q3XA 4FHKA 4FJZA 3RDJA 2CHXA 4XX5A 1DJZA 1E7UA 2CHDA 4OVUA 4URKA 4JPSA 1E8WA 3RPBA 4BFRA 3PS6A 1QASA 3KWUA 1E90A 4KZCA 4DNLA 2UZPA 4IHBA 5EDSA 2Y3AA 3W56A 3KWTA 2ISDA 4F91B 3ML9A 3N5AA 4A55A 2WXLA 5H4ZA 1BDYA 4TV3A 4FA6A 4LDCA 3TL5A 3PYCA 3PFQA 3QK0A 2ENJA 4L23A 3FDWA 3M7FB 3P2BA 4WWNA 4PS7A 3DPDA 3APFA 3F00A 4ICWA 4L1LA 4ICXA 2D8KA 1CJYA 1WFMA 2CJTA 2B3RA 4HLEA 1DSYA 3TWYA 5CCJA 4QJ3B 2WXIA 1DJIA 3MJWA 5CCGE 4F92B 1RLWA 3L13A 3B7YA 3ML8A 3OAWA 3NZSA 3ENEA 1E8XA 3IBEA 1E8YA 2N1TE 3LJ3A 2X38A 2WXKA 3L16A 1UOWA 3FBKA 4WWOA 3QARA 2K3HA 3ZW3A 3QAQA 4FULA 3R7QA 3CSTA 2BWQA 2FJUB 1A25A 4QJ4B 1V27A 4TUUA 1UOVA 5G55A 1DJHA 3S2AA 2EP6A 4AJWA 4ANWA 3F05A 2NCEA 4NPJA 3L08A 3R7RA 4FADA 5H4YA 5JHBA
chains in the Genus database with same CATH superfamily
5LCVL 1DVQA 3RVTC 2BVPB 5DK0A 3GJFH 5EN2B 1IAMA 4FMFA 3EJZC 4IIQC 2WNXA 3CV5A 2GUOB 3LN5A 2XWXA 4DN4H 5HDBE 1B2WL 2IAMB 2WAQA 4AVKA 3WS6A 2HFGH 2YD4A 3TPKA 5IB5B 1PMYA 4LVHC 2C9UA 3EIFA 2CCWA 4WI6A 4TPRH 3PNRB 4OQTH 4UCFA 4XCEA 3ZKMD 3NIFE 1OVZA 3L81A 2E9IA 4PJHA 1CFMA 5FYJU 1PQZB 4X6DE 5AD0A 2A9MH 4L4TE 5JO5A 4XNYL 3P4OA 2NY1B 1XL4A 1XDTT 2BNQA 1J5IA 2FHBA 1XH2A 5GSRA 5IVXF 3T65A 4FFVC 5JXEC 3SKNB 4C4BA 5JYLA 2CO4A 4E36A 2CIIA 1T4KA 3L4CA 5C0NC 2FTAA 1H5BB 1PDKA 1HTYA 3E3QE 2FX8L 4TQ8A 3L3KA 2KLSA 3B2XA 1U8OB 3FB8B 3CVHB 2VXUL 1BM3H 1WUNT 2XACC 5I16B 3D25B 2CMRH 1YNTA 4R7DB 4UT6H 4BA8A 5AWNL 5F3FA 5HYSA 4IKNA 1NKOA 3Q05A 1EO7A 3D1MC 4JB9L 1P7KB 2DD8L 5JHDA 1A6VH 4K5PA 4BFRA 1AZUA 5JYMA 1SJHB 1T0MA 1QLRB 1BOYA 4CKVX 3CBRA 4H0IA 2KMWA 2DOCA 3BUYB 3MJ9H 4XE5B 4OAWB 2QGBA 1UXLA 4P57B 5F0PB 1YYMH 4U3SB 4PTUA 2WXLA 2YUVA 4DP0X 1QEWA 1LQSR 3KDMB 1KB5A 4CVXA 4ORZC 3NJMA 4KDTA 4NX0A 3HAEB 2R0KL 3QDMB 3LMJL 1DFBH 2QADD 2MOVA 1AC0A 2WYTA 2HN7A 3BQVA 3DVGB 4TSCL 2KHAA 3VFSB 3PNWB 5LGJB 3FTUA 4O2CA 1JUFB 1MCOH 1QSFD 2H6PA 5IV2A 2ZYSA 1JOIA 3CDCA 4BCYA 4BUHA 4JRLA 1YNLH 2NW2B 2KZWA 4Y88A 1NMCC 3FT1A 5G5DB 1IGFL 4I89A 3K7UA 3N50A 1XSOA 4IJ3B 5IEKA 3GXPA 4KVCL 3C6LB 3FN9A 3QC5X 4UQEA 5IW1A 3WTSA 3A0OA 4HZLB 1N5AA 4HEPG 3Q8EA 1BFVL 3FH5A 3KYOB 4WTZA 4IW4C 5HP5A 4F7PB 4M3KB 4N6RB 2ZCHH 2JTDA 1OGAD 4HX1A 3VGAC 4JLRA 5IW6A 4GINA 2JKXA 4K0OA 4PJFB 4GUPA 4LP5A 4FQHA 2WUCH 2DS4A 3QQXA 2JKRM 2A9NL 2Y4SA 1E28A 2FWSA 1KB5L 3VX0A 2OSLA 5J7CC 4P3CL 2QVFB 2AFNA 4W9IC 1KB9J 3M17B 3GIZL 3IFPB 4IEFB 2J21A 2WSPA 2YD1A 3CHRA 4KJQD 4ZTEA 2AEQH 3S8GB 2NY3C 2A0LC 2O6PA 1IBFA 3ZVVA 5FYKD 3UACA 1XXDC 1F90H 3WUWB 5D2LE 2B8OT 2B9BA 5DWUH 5AKRA 1IJ9A 3TBTA 5LAXA 1WFJA 3MSPA 2WXPA 1S7TB 3HG1A 1P1VA 1VPOL 3KWWB 2ENPA 1AC6A 3KPRA 2X88A 2QQLH 4M43H 1T5XB 4YXLL 2H3XC 4XOCA 5IVNA 1K9TA 2C1PB 4XBPA 3HPLB 5E5MA 5EWIL 2ZSWB 2YAQA 1HXKA 2DWYA 4X5RA 5DUPH 5IQNA 2E56A 4ODSH 4D0DB 1TSRA 4XMTA 1NSNH 4OD3L 3RY6C 1YEKH 1JFHA 1I3GH 2EYTA 4AITA 2IEPA 3SKMA 1NTDA 4HIHB 5TGBB 1RIHH 2IDUA 4DGVL 1YVLA 3DECA 1XSIA 2ZT9C 2VZ3A 2UZXA 3DURB 1IQWL 5AB9A 3Q2LA 4IGBD 1I8IA 3FO0L 4WZ9A 5DCCA 1A6ZA 4KZEL 4UANA 3WEOA 1AO7B 4DIXA 4E9TA 1GS6X 3HNTL 3U2JA 4Y5XA 4PRAA 2J3SA 2R29H 1SOXA 1T20A 2XT1B 5FF6A 1KC5H 3LPWA 1JERA 3BKJL 4QXTA 3VXMA 5C0DB 1YEEL 2VZUA 1JPTL 4ZAKD 4QJ3B 4LEEA 4WRLA 3SN6N 3OWEA 2YAHA 4GAJH 1E8XA 4P07A 5L0QB 5C0BA 2H26B 4BSVB 4XNXL 3VYNA 2F15A 43CAA 5LKNA 2N1KA 5I73C 1I9JH 1XCTB 1LWRA 1EO5A 2ZWSA 3C6SA 2VSDA 1HEZA 5D70H 3ZTJH 1OSPH 2Y06L 5HGHA 3TO2A 1QPXA 1WISA 1AJ7L 1V27A 4NRYA 4HSAC 1UWFA 5E8OA 1TZGH 4HIEA 1DBBH 2D4DA 1QHPA 1PD6A 1XIWB 3MNVA 4GKLA 2I7SA 4XN9A 2NUTA 3Q1EA 1YLBB 1RK0B 4GAYB 4JPKL 1KCUL 4Y4HC 2VJ0A 2IXQB 1HDMA 1LDPL 3AY4C 3I6LD 2YK1H 3NSJA 2XPZA 5HYQA 3CSPA 4XMLH 4JKPL 3OXRA 3PPSA 3KNBB 4AJYV 4AENB 2VN4A 5FYJL 1ERNA 1IC7L 2UVEA 3AMLA 4ODTL 3STZB 4XBEL 4O02A 1HCVA 4NAQA 3AWFA 5IQOA 3QEQD 1JCKA 1NINA 2K6YA 4UIKH 1JBJA 4UF7C 2FB4L 4F2MB 2BOCA 4X6CB 4XAWL 3FQUA 4F9LC 5I30L 1PY4A 2ZX5A 5DI8A 4AXWA 4CW1B 3AADB 5F44A 4RA3A 4WV1B 2NMSA 3MLUH 4YO0B 4H8WH 1QW9A 3ULAB 3UIZA 3GKZA 4DKDC 5DVOA 4L1BA 2GTWB 3ZN6A 1N7MH 3TGXA 4WUKH 2DH3A 4JNXA 3R19A 5IOPA 2WO3B 4GYBA 2P47B 5J57B 3IU4H 3MRJB 1SY6A 2E3VA 2G5BA 1QSFE 4YHKH 4HGWA 5DRXA 1JGUL 4MJID 5B7FA 4R7NB 4AL8L 4KY1L 4MBOA 4UBDD 3KWVA 2ESVB 3VFMA 2GSGB 3U6XA 3WIIH 5A40E 5I5RA 2H0FA 3QIUB 3P0VH 1CUOA 3LQAC 4LSVH 2I24N 2H0PA 2K6WA 5I2IB 1QFWI 4F7TB 1BA9A 1BJ8A 1M7IB 1JWMB 3ARBB 4CVWA 5IFAH 2PW2A 4O02L 1AGFB 4R97B 1OGAE 1Q0XL 4W70A 5E5LA 3WD5L 3WJMB 2HSIA 3BFQG 4GUQA 4PI2A 3VI4E 4KX9A 4X80L 4NEHB 3DHUA 4MCYA 4NN7B 1ITCA 4KOBA 2BHUA 4PJ5A 2QJDA 3HBQA 3FN0H 5D55A 3R1GL 3VFRB 4QRQB 5I8CA 32C2B 2VDMB 3SKOA 3GI9H 1SLWA 1MDAA 3CFKA 4PRID 5A3ID 1ZT4A 5J11B 1ESOA 1TOXA 3WNNA 1F1DA 4K94L 4NZDA 3MNZA 2WIMA 2GSMB 2N1TE 4H8QA 5FYKE 2X38A 1SY6L 3TNMB 2XG5B 1MIEH 3BW9A 3BMVA 3VCLB 4U6VL 3DDGA 4CNIA 5CJQL 3BO8A 1XAUA 1UD6A 3VUAA 4TUOB 4BXVA 2VT0A 4JHWL 3QSKB 3ZTNH 3S8WA 4GIOA 3H42H 4PJCA 2IAMD 4L4VD 1D7DA 4QTFA 4OLWH 2QV4A 5ABAA 3CUPB 2D7NA 1T4WA 3ARGC 2AP2A 5ANME 3VU2A 5I1KH 2VDMH 3HC4H 5DO8A 3MBEB 4KKQA 3VXSA 1AY1H 2IQ9H 4J12A 1FFOA 5J0BA 5EU4A 1TETH 4HPOH 2EH8L 4P23A 3HIZA 5AW7B 2XVKA 2NY1D 4GG6A 3K1DA 5IQ9A 5HGDB 2ZNXA 2KPNA 4DGUA 1X5IA 3OC5A 3D8MA 2FH6A 5H2BA 3S35X 3DV6A 1NWPA 5CN3A 3VXNA 1AQ8A 3PL6C 5DJ6B 4AZ8A 2PPAA 3EF7A 4JN1H 3SDCC 4W68A 3RTQB 4AGPA 3AVEA 3QC6X 5KSBF 1OEZW 2WJ5A 2MCPH 3KDPB 4PJAB 1NMBH 1I85A 5JA9A 1XF2B 4GRLA 3GJFK 3VI3A 1JF1B 4JVPA 4WI5A 2ZPKH 1R17A 1NBYB 4XNZC 5I5IA 1QHOA 1INEH 3QQ3A 4YIQB 4FJYA 2FQFA 1OP5H 1EAQA 1RIVL 2NW3A 3QR2A 1ZRUA 2BY2A 3NABL 1S3KL 4UIMB 4UQIM 4OF7A 3SCMA 3NCWA 3SIKA 2YAFA 4N1EA 2R2EB 3C09C 3LH2H 4R8WL 5I1JL 2XC8A 3W39A 5A2LH 1PD1A 4JFVA 1W72B 4CJ0A 3QVAA 3BWZA 4XP9L 3OGCA 1H8NA 3HEIB 4M5ZH 4KXZH 1AHKA 2OL3A 1KN4H 4DPBX 3QWOB 1QASA 5GHWH 1KXQA 3PAUA 4JQXC 4O51A 3SE4A 2N01B 1T83A 5DK2B 3UO8B 3JWOL 3NRQA 1RZ8A 2FX9H 4JHBA 4ERSL 4KTYA 3GBNL 3TF7C 5DJCA 2GPZA 4LHUD 3S7GA 4X6FA 2O5YH 2WIIA 1QA9B 4G1EB 3G6AA 4L8CA 5IJKA 2I26N 2GAZB 3QEQE 1VEOA 1MPAH 1HFUA 5FGBC 4APQC 2AQPA 4L8BA 4R5TA 4DVRL 1OCWH 5ACMA 4ZW8A 1CJYA 3QG7L 3ROOA 1XCXA 2YC1B 4G9FB 5C86A 2X12A 4NFBA 1LP9E 3SDXE 5FB8B 3HI1B 3AGVA 3TA4D 3JV4B 3LJ3A 1L7TL 2RBLA 3ALWA 2Q76B 3MNMA 3TN0B 2NNXA 2ZUWA 2R1XA 2R39A 4UQBA 5DQJB 1W72H 4WGKA 5DFVC 1G9NL 3UO1H 4GRWF 4IOSA 6CGTA 2CSPA 5JPMB 5D8JH 3RKDD 3VM7A 4PREA 4MJIE 2YMTA 3SQBB 3DSFH 2O61A 1XH3A 2WZ6A 3H1ZA 1QRNA 4NNYA 1KTJA 3NFPA 4XGZB 4HIQA 5MEOA 1H0DB 3NJLA 1E6JL 2D3VA 3CH8A 4BQ9A 4EKXA 5K9OA 3REWB 5L2JA 2HFFB 2OL3L 2E75C 4A2EA 5JIIA 4NNXA 4RH4A 4YS4A 3CTTA 4NLAA 5AW6B 4PD4J 4YGVB 4B9ZA 1Y07A 4OU3A 3KL3A 4YDLB 5HYSG 1Q0YH 2YA2A 2CM6A 3JV6B 3OJMB 5AZEH 5C2BL 2Y7NA 1ZD6A 5B1JA 1DDHA 1LHZA 2Y69B 3KGUA 4QPEA 1UD8A 4ZNEA 1WCQA 2GK0B 1R3JB 2VR3A 2HWZH 4MD4B 1FPTH 1BXVA 1HYSD 4MCZB 4HXAL 2X4RB 4W6XB 4YL4A 2M83A 2OW7A 4ZDHA 4Z7VE 3KHOA 4MKTA 4DK6A 1DQQA 5KSAA 4PRIE 4I77L 2OK0L 4YDNA 1GH7A 2L8AA 4NO0D 1NFDB 4L1LA 1UEMA 4J2XA 5C0CB 2EKSA 3HTLX 4AT6B 3L5IA 2VJXA 3BSGA 4I4WA 1F4WL 2KUTA 3D0VB 3K5RA 5E2TL 3RWJB 2NY5C 1KYAA 1QFUH 5AVZB 2DI7A 2NXYB 5I19L 3R8BB 4K4KA 5TE6L 2IDSA 5KS9A 4WU7A 2EXYD 5DUBB 1AO7D 3IXTA 2J8HA 2VQ1B 3PGFH 4P5MA 2ZWYA 4HJTA 4IM8A 5LCVH 2PR4L 4JO4L 3V6ZB 4C55A 4LVNB 4A7QA 4QUOA 2A4CA 3X13B 2FYVA 1HIML 2AQ1A 5GRWA 3ZK0A 1XGTA 3PGCA 1JD7A 3GS7A 4PSPA 4N0FA 4LPXA 1FJ1A 1DVFC 4NAJA 5H37H 5C9KA 3D48R 2PTUA 1EEZB 4A66A 2YEZB 4FG6D 4ETYA 3KJ6H 3KPLB 1Y0LB 3FQ4A 2BERA 2BVTA 3I74A 4OCYL 1BVNP 2OMTB 2FJFB 3RYMA 1XIWD 3ISRA 4PTTA 5DJDB 4LLQB 3IGFA 4QXUL 4HBQA 1TJIL 5ICUA 3OZ9L 1LO3L 1H3VA 2LGNA 2XN1A 4E0RA 3H9ZA 3WG7B 5C08A 1JFQL 4J3OG 2XCMC 2PPCA 2ED8A 2UUDK 3FB6A 3FULA 4M7ZB 1DZ0A 4WW2A 3M7OA 2FX8H 3TBWA 1KTLA 3ARYA 4MWFB 5DUJA 4ZMTA 3L08A 4YFLF 2ZWNA 3VFUA 3VGDA 1BZ7B 5H4YA 3UAAA 1SYSB 5KEZA 4UM8A 5JHBA 4LHJB 3O41B 4HFWB 5IFJA 4U1JB 5CAYB 4Y4FC 5C92A 1MHHB 1IBGL 1L9MA 4RLDA 4F7MB 4XRCB 4S10A 3P2DA 4MX7A 1R24B 5E6IB 3WL9B 2Z35A 4M3JA 4QT5B 4L8DB 3VH8A 4FOMA 4R96B 2E4FA 2UY7B 2HMID 1HSAB 3UAJD 3QDME 3Q8AA 4LT7A 2IIJA 4MVBD 2FHFA 4PS4L 4UTCA 3S5LA 4N3TA 5BS0A 1YQVH 1DBKL 4AQ8C 1GIGH 1L0XA 2BZDA 4WI0A 5G4NA 4QAMB 1CG9A 1YEJH 4QRSA 1F8TL 2LU7A 3SDXA 1HH6A 1X4YA 2HX9A 1YEIL 2R0KH 4PJGA 2ESVD 3LMJH 3K2KA 1OAYH 3FU5A 3QIUD 5D1QD 1E5CA 4Z7NF 4TSCH 4H13C 1QP1A 4U6XB 4QDGA 1T80A 2OMNA 2BVUA 1YUHB 1GAFL 1T22B 2F61A 4UQCA 4DPRA 2ZKXA 3TBSB 3B9KC 2B08A 3ARBD 1IBDA 3FZUC 4N2AA 3H6JA 5E51A 1GVIA 3MACL 1MY7A 3KBPA 5JORA 4FTVB 1IGFH 3CHSA 4EBQL 1A4JB 1ILSA 2NY7H 1KGCD 4IBTA 4PJFE 2X6AA 5H94B 4S1DD 1BFVH 3IKKA 1WA1X 3KYKL 3QIWC 4WNJA 2B2XH 1ZLWH 1VKXA 2L3BA 1P4UA 4I0PA 3ZKND 3PWJB 5T1MA 5FKPB 5DSCB 4OI8A 2IBZY 4FMVA 4WQOA 2RMNA 4PP1D 5KYWB 4ZSOA 5BQ7B 1CXFA 3OR6B 4YAQA 3CU7A 4WFED 2KDGA 1CGSL 3L2LA 4KC3B 1J05B 3HNSL 4HGMA 5D7JB 1Q1JL 1CC3A 4JREB 3UZEC 3WL9A 9PCYA 1O6TA 2BH0A 4PJ8C 4XB8A 4ICWA 5ESVB 2KZKA 2C7UB 5H8DA 3GIZH 2FGWL 3NPZB 4M7LH 3PQYA 4XXWC 3ZHLA 3SDAA 5C0EA 1C12B 1NFIB 4JRXD 4DFIA 1I82A 1E3ZA 5IQLA 4ONHA 4YR6B 5FUCE 1OQXA 3V0VA 1GJWA 4F7KA 1XZ0B 1I8KB 3NCJL 4H0LC 1SUJA 3ILPA 3Q3GB 5DJAA 5FDYA 2P5EB 2GUOA 3FTXA 3MBED 3RL2B 3CFMA 4DF9A 3O8XB 3HE6B 3P54A 4KUZL 4UINL 4I7ZC 1M7DA 3WNOA 2VIRA 5B1BB 2FT6A 4A6YB 1JZIA 4V2BA 1QFWM 1CYWA 2XI9A 3VGGA 2EYSB 3QUZC 4OD3H 5JHAA 4IJTA 3M6DA 1AO7E 1H6TA 2PN5A 4RGOL 5EU3B 5IMLB 4DGVH 1LO4L 1UT2A 4PJBB 1BX2B 3RTQD 4OIIL 2Z64C 2XV3A 3JVFC 1FI8C 1MWAH 3DDFA 1XWVA 1JYWA 3ZIMA 2B59B 3KLAA 2A99A 1GKEA 2WZ5A 1FL6A 1LQBC 4OM0H 5GXBB 1CE6B 1FIGL 2PO6D 1ZT1A 1Q94B 3HNTH 5ACZB 5SWZA 5HJBA 3EH3B 4EIZC 3IU3B 5L8JB 5K93A 1XD1A 1OAQL 5F3BB 4Q0XH 3TCXA 1YEEH 3I3EA 3PV7A 5KG9A 4Y9CA 1M4KA 1KN2L 1RZJL 5FCUL 5IESL 2OLDA 3L3IB 4UNUA 3QAZB 2ZSVB 3C60A 4IS6B 1XVSA 2XBDA 1CXLA 4XNXH 3TA3C 1U0QA 1XTMA 3EOAA 1P7KA 3PWVA 5J9PA 4OZHB 4ADGA 4KVPA 1CD0A 4GP8B 3KYNA 5I9QB 1SJHA 4PHZA 4J4PD 5AOLA 1QLRA 3UTTB 4N9GA 1AANA 1HZKA 2CRYA 4OAWA 4HJJH 4P57A 4LCWA 1A4AA 3JWDC 3QJTB 4M6NL 4X8CA 5TQ2H 3VWKA 3QPQD 3ARZA 2EC9U 5INDA 3CDZA 4JPKH 1KCUH 4JZOB 3HR5B 5BOZG 3FAWA 5AVUB 4F2ME 1IL1B 2MMXA 1OP9A 1P5VB 3KPMB 3MRNA 4X6CE 1OB1B 4G9FD 2ICWA 5LGJA 4XVSL 4ODTH 4OIAA 4XBEH 1OP5K 1BDYA 1HK6A 1AXSB 2RB8A 1SBBA 1OTUC 4JFXB 5T1KB 1T5WB 4A63A 2IH9A 1KB9K 1ZS8A 2L0DA 4HK0B 3KJ4C 5FFOA 4TQEH 3FK3A 3AXLB 3FT2B 1FSKB 3GMOB 4XAWH 4QYAA 1JHLL 2PPEA 3FB7B 3G5YB 5I30H 2FO4B 3EJQA 2WTPA 5FOJA 3REVA 5CP7B 2CLRB 5EIIG 5CJXC 2ESVE 4DVBB 3BH9B 4WHYG 3CX5J 5KVGE 4N6RA 1G5AA 5JOPD 5E0QA 1BQHG 2DWSA 3EJYC 4Z7WB 4GP4B 2XJLA 3BAXA 1LWHA 5ICZB 1TPXB 2IGFH 4KY1H 3TWCL 5I66B 2IH8A 5ID0A 4LP8A 4EF3A 1AXTL 3L7EB 2WD0A 1KGCE 4CMHB 4L5FL 4PYGA 1W0WB 3TBVB 2D0HA 5ID1B 2V8LA 5IFHL 3FU6A 1WBXA 2BP8B 4FLRA 2EDMA 4O02H 1C1EL 2YD5A 4JPIB 3AJ7A 5E6RB 4J2QA 3T4AB 3ZQWA 4DPCX 2RJMA 3HLAA 4B7IA 1TQTA 1F00I 4G43B 3QDGD 5IHUL 4ACPA 5C0CD 2ZOWA 2DEXX 1AVAA 3R1GH 2P8PA 3DOSB 2RALA 1B0WA 3JWNH 5CR8A 5KVMC 5DD0L 5GSVA 3BP5B 2W9DH 1BMZA 4HZAA 2KC0A 3OMNB 1ECYA 1WD8A 1YEFL 3D69A 4LDOB 1LXMA 2VERN 3Q8FA 4WEBL 2NXYD 1DJYA 3OKNB 4K71C 3D4GA 4D0DA 3AM8C 4HCFA 4AYFA 5I76B 4BYHA 1SY6H 3FQXA 2E7LA 1KIUA 1ANUA 2FVNA 1CD8A 3S36H 5J1AB 3T2NL 4U6VH 1RJLB 2J8UB 4X7DC 3BI9X 5CJQH 3FTSA 2E86A 3B6SB 3L6FA 4PG2A 1DN0A 4L9LB 4JHWH 4YXHL 3QZLA 3ZHFA 1KXVC 2W88A 1FFNB 1MCHA 1G7QB 3QUGA 4PEEA 4WKXA 2FD6L 4BFIB 4R4BB 3D12B 1ACCA 4KRNA 2C3XA 1OM3L 4X5XA 5F7MC 2Q7NA 4ZX5A 2XV2A 2GTQA 4EXPX 4F91B 3NP3A 1F02I 2EH8H 2VLRA 4ZX6A 3MUHL 1XCTA 3DUUB 4PJAE 1O5PA 1TDQA 3RBGA 3U30B 5EEYA 1ZTXL 2PYFB 1ORSA 1TFHA 3VWJC 3IDGA 2FEEL 2GT9A 3PJLA 2XN9B 3ZZSA 2VLLB 3MA9L 2B5IC 4IIZA 2ITCB 1SDDA 3SO3C 4A7GA 4GAYA 4JG9A 4XC1L 2EO9A 4QTHA 3N43F 2E6PA 1T66D 5EEXA 5F9JA 4LSUH 3BPLC 5E6ID 1NGZA 4R26L 4HCGA 3STZA 4DO5A 4JZJC 4M7KL 3RWCA 2HTKD 3IJSA 3RIAF 3KR3L 4OZIA 5AOKA 3BWAB 4F2MA 2VABB 4YHLL 3GLZA 4NRZB 3B7SA 5FGCB 1ETZB 2GY7B 2EICA 1R3KA 1CZ8H 4XP9H 1I7TA 3ULSA 4YO0A 3P02A 1R1CA 4LPVA 1BYOA 3TH2T 4FQJH 3A4DA 3NK4A 4ERSH 4G9FE 1U6AL 4IBYA 3W37A 2COVD 3GBNH 3VX1A 4ACTA 5PAZA 7FABL 4WUUD 4DOHB 1M2VB 3C75A 3VD5A 3QXAB 4BHUI 3KXFD 3O6FD 4N87A 4Y8AA 1PKQA 4DUVA 1HJCA 1JN6B 3KPPB 5JQ6H 3N0AA 2WXRA 3DGDA 3IBEA 3EDKA 3LAFA 3DYOA 4FTVD 3MJ8B 4YJZL 5IROA 1YRKA 2VAAB 2ED9A 3LRLA 3GD1C 4J8RB 2YSSB 3T2OA 2YOAA 5E1HB 3DC0A 2ODIA 2WCSA 2H3NB 1AGFA 4HKXA 4KKLC 3QZWG 1KJ2B 5D1ZB 1UA7A 1G9NH 5J3HC 3FQ2A 1JGVL 3Q01A 5T3ZD 5JMOC 3DIFB 3D09A 4A7UA 1CFQB 1ZA3B 4QLRA 4M8QB 1DVZA 4G6FB 4L29B 1C5CH 3QORC 3L3JB 2EIEA 5CZKA 1C7SA 2JV6A 2D0GA 1E7UA 4NAMA 3VFRA 1LO0L 4OSUH 3VD0A 2B20A 1WAEA 4FFTA 1JPFB 2Q2EB 2LR4A 3O4OB 2E46A 2MOQA 5C0IB 1UM5H 3FCSA 4DCQA 5CJOL 4ZW6A 2EDDA 3NCCB 3LS4L 3VW3L 1IMHC 2EVJA 4XMPL 1G7HA 3TNMA 2XG5A 5C2BH 4L1DA 5IHLB 3K2UL 5CKAA 4OV5B 2XWDA 2ITDB 1NFDE 3T3MB 4HXAH 5C0CE 1BD2B 2ZP8A 5F89B 4F20A 1Z0NA 3S5LG 4TUOA 1ZLWK 4LSTH 2PCYA 2UYLB 1KIPB 5E2JA 3TFKD 1UOWA 3CHXA 3MU3A 4JFTA 5L4FA 4XMUA 2VSCA 3UJJL 2KT6A 3O8XD 4KKZA 2VXQH 3HE6D 2GQHA 2GABA 4LLDB 3V0DA 3ZXAC 5CEXA 1IM9A 5HYEA 3HOGA 1T7WA 3QA3A 3RB5A 3VXQA 4WLCA 2DBJA 2GJJA 3LTVA 3DGGA 4X6EB 5DQDL 1V7MH 3F05A 4NPJA 5JW5B 4Y2DC 4K3EL 3R7RA 5T1DL 3U46B 4HHWA 3AS2A 3FO1B 4WO4B 5E2TH 4F8PA 1FZJB 3E1ZA 2DMBA 4XPFL 2A6JB 1N3NA 2YHGA 3FCGA 4PJDF 5I19H 1OAZH 4QLWA 5TE6H 3TP4A 1HEJC 2R4RL 4MA8H 1FH2A 4F2FA 4IDJH 2Y36L 3G5WA 43C9B 1FCCA 3N06B 4LRIC 2BNRB 4OGAC 4WEEA 4AEIH 4HUWA 3D34A 3VRJB 1ORQA 2VL4A 4NP9A 3GMPB 4QXGL 5EDXA 4G8GB 4LKCA 1FFQA 2QQNL 3F7QA 1GZHA 1E5YA 3SE3C 2PR4H 2ROYA 1U8NB 4TVPH 1XF2A 1IC4L 1DJWA 1CYXA 5LNDA 1HIMH 2XWBB 4U1KB 3RGVC 3UGUA 1YPZA 4ODVH 4PM1A 3I9AA 3FOLB 3SD5A 1W8EA 3A6BH 5I71C 4FHJA 5AOJA 5IT2L 1S7XB 4UIMA 1KDJA 2BCMA 2DMGA 4K55A 4QRPB 5F96L 4DGWC 5ESAA 2EXTA 4C4UA 3UTTD 4LL9A 2BHFA 4IK7A 3RIFF 1M9WA 1J8HA 4S2SA 2ICWJ 1O7SA 4ETQA 4ZXBA 3EDEA 2V0AA 1OW0A 4M6OL 3WKML 1KZQA 4C4KT 3VD9A 4PW3A 3SPVB 1KCRL 4DQAA 3PDOB 4PJIA 4JFPB 2VO5A 1U8LA 5T5NG 2GAZA 4Z7QF 2OFQA 5T1KD 3W9DB 4EVNB 2MFNA 3D18A 4PD4K 1TZOA 3T6ZA 3UEZA 5ITBL 4FP8L 4KGLA 4QGTA 2J7LA 4IRJC 1IBGH 3TYFA 3JTTB 3SGKA 1RP9A 1OSZB 4AE1A 4YSAA 1SXCA 2D9CA 3F64A 2ZOKA 4LBEA 3S88H 1CFNB 1IRAY 2QKIC 3HI1A 3NOIA 1T21A 3S2CA 4H1LA 5D6CA 4G82A 5AUMA 3GZOA 3M7FB 1TJHH 4XBGA 3N04A 3GXNA 2PETA 2ADGB 1MFAH 1KYFA 1SM3H 4PS4H 1KBVA 3NJIA 3VSUA 1DBKH 1AHWA 2R1YB 4WUUE 2B0SL 3D85A 5JPMA 4B3EA 4R5VA 3NIGF 4Q6IB 5E0FA 5AW0B 3BD5A 2FR4A 1OGTB 1N19A 2WKOF 3HLKA 2V2XB 4U1SA 4XGZA 1YEIH 2FO8A 4MXWL 3WI9A 1NC2B 4FTVE 4OJAA 1ZT7B 5MI0C 4MDRA 3SO5A 2ZOLA 5F6HI 2BOBA 1ODAA 4KFZC 4FXGA 1OZUA 1GAFH 5DT1L 1FL3A 4AQ1C 3JV6A 4KITB 3MACH 2M1KA 3ZQ9A 5T3ZE 3ARQA 1UM4H 5ICYA 3BC9A 3NACL 4XWOD 5CEZH 4Q2ZA 1VJSA 2W5PA 4PGBB 2VUOA 1SXSA 1JPGB 1PX4A 4NKDA 2X4RA 4XP5H 5IQMA 5CCKH 5HY9B 1SBSH 2O5NA 1RI8A 2ZUXA 3KYKH 2DLGA 5BZDA 1W16A 2AJYL 3V5DB 5LJYH 2QPDB 4MB3A 4A68A 5SX4I 3D7PA 4NRXB 2HH0L 3HAEG 1HJBC 1M7UA 1YAIA 2NR6C 3GS0A 3MLTA 4P9HC 3VNYA 5J13C 2A6IA 5KSUB 4ZTOL 4FXLA 2XETA 1C08A 4MQSB 1GZQA 3HCVA 2AK4A 4OZGA 2A77H 2IVFC 2Q8BH 4P46A 3ZMEA 4TOYH 4AI7A 4R90L 2DQTL 4F27A 2F5AL 2DTMH 2DIAA 4ZK8A 2EE0A 1BQSA 4W4OC 2NY4B 2P5EE 1H15A 3QYCA 5DUBA 4Q9QH 3GMLA 3QNZA 2GSIB 1UGNA 3B2UC 3X17A 5L88H 2VQ1A 3HZKB 1IBHA 2EYRB 4RFOL 4NHCH 5TF1L 3NCJH 3QDHA 5I8OH 5ISZD 1QLEB 3BQUB 4OM1L 2VUKA 3QCVH 4ZMWA 4R4NC 2FEEI 3TXAA 2H1XA 4JPVL 4U1LB 2LTQC 3NIDB 4PJBE 1A2YA 4FLOA 1I9IL 4J3VA 4KUZH 5CMAB 4UINH 3P4NA 3NCYS 2UXFA 3DKHA 3EYUL 3PS6A 5DURB 1L3WA 1EFQA 2RIKA 3PY9A 3QUXB 2NYYC 2WTRA 2F68X 4LLMA 1G7LB 2BVQB 4PJEF 4XVUC 1XGUB 4KRPD 4UQ3B 3CCHA 2PTTB 3FQTB 4RAUB 4RGOH 4W9FC 3V8OA 5CBAB 1NIFA 2YWYA 1LO4H 4X0KA 1Y0LA 4ZS7L 1NGXB 2XN9D 1UUSA 2FJFA 1I1AC 3ZRSA 3L8QA 1QTYT 3RVWC 1G7PA 5E00B 4YDJB 2FEDD 3C5ZA 3QFGA 1UH3A 4JCLA 4C56B 4MAYB 4OGZA 3P4MB 5FLUA 3WUWG 4LU5H 2QGEA 1KSRA 1IGYB 3P11L 3M8OL 3RWIB 4OZHE 1M57B 2P5WA 2EXWC 3MRIB 2Z4QB 3QZBA 3UTTE 3D39B 3QS2A 4EUPA 3FONA 1MLBA 2AW2A 4QHKJ 5IBTL 4JS7A 5JR1L 4MDJA 3I02A 4RMRA 4AJWA 1FZKB 1AG0A 1UZ8A 5AVSB 3GPSA 4LEOB 5AW8B 4NM4H 2QHRL 4AMKL 4R96A 4UQ2B 5IVXB 3B7RL 3HHSA 3ZT6A 1T3FA 2XQYG 2O5ZH 3BP4A 3FJTA 2K4AA 4S1QL 1U8IB 4A2DA 2NX5B 4NP4L 3AUVA 4BSWA 1EERB 3EADA 4NOFA 1H19A 1ROCA 4UAOC 2DLIA 1EJFA 3G5VA 4WVRA 4N5ED 3MO1A 3T08A 3GSWB 4LRNL 3DO3A 2NT1A 2X10A 4XVSH 2VDNL 3ARFA 3GSQA 5EPMA 4UTAH 2WZ0A 2EDYA 4JL1A 4FI6A 2X42A 4JE4B 3K6SB 3PHOB 4LLWA 3NSXA 3SY0B 4LK4A 4RWYH 3W2DL 1WGOA 2WBJB 3AT0A 1MHEB 1U91A 2FLBT 3DYMA 2DMHA 3PWPD 2P26A 3JWNE 3UAEA 2J2ZB 1P6AB 4LKXB 3QJOA 5CD5D 5EU5B 1G9MC 1U42A 1A4JA 3K8KA 4V1DB 4XOAA 4Z7WE 2FT7A 2VISA 4G6FD 5D1XC 2YGPA 3P9LA 1IEBB 4XHJD 3S37L 2JELL 4JFHD 4OF8A 2Y22A 2LU4A 2V2WB 4IOSD 5FKPA 3LNIA 1WCBA 5AAWC 5ETUA 2R23B 4EIUA 1QSEB 3AREC 1W91A 4H26B 2X4SB 2YFNA 4BUQA 5HYIA 5KYWA 3OR6A 3RRQA 3WGUB 2XQ0A 4ANUA 4LCVA 4LQFL 1J05A 2MWCA 5D7JA 4HBCL 1EZVY 4RFNC 4Z7UF 4EN3C 2W92A 1E8WA 5AAMA 2VWEC 4MMXC 4IOFD 3HRZC 2WCPA 3ULUL 1HVXA 3F7VB 2V2TB 3UAFA 5FUOH 2XZQL 3QHFL 3V4UL 4RISL 4MDIB 1HXYA 1BD2D 2X6CA 4G6AC 1C12A 1BECA 1XXFC 5FHAL 5L7XL 2OM5A 5EFIB 5LO7A 1C1EH 2P8MA 2HKFH 3DX9A 4MS8D 4TVPD 5C3LD 1XF5B 4HCIA 4MXVF 3DPDA 3MX0B 4FYTA 1DE4A 3GSNB 2UX6A 1XZ0A 2OZNA 5E9DB 1MCNA 1RK1A 3KLHD 3RWEB 4UOJA 5KSAD 4F5CA 3U9PH 5I8EB 1RZKC 5TD4A 4BCXA 4KTEH 1JPSH 1N70A 2TAAA 1AQMA 2AV7B 5T3XL 2J8UE 1YEFH 4WO4D 2F8IA 3ISWA 4WEBH 3L3HA 2CUIA 4NC1C 5FFLA 1E43A 2W0LA 2P52A 5GZOC 2DQFB 1BFSA 3UTQA 2AJSL 2QGCA 4ZMPA 2BNRD 4N5UA 4OI9A 2C9PA 1OXYA 1BX2A 2B4CC 2Q86B 2R2HB 4G8GD 1INQA 5AKSA 5C0FB 5CJ5A 3PHAA 2B59A 4PGDB 3L45A 1ROWA 4PR5B 2VR6A 1MJ8L 3NAAL 1CE6A 2Q6WB 4I18B 3LNFA 4OV6F 4CN1A 4HHAB 2IH3A 2YRPA 5IB3B 3FSOA 3QPXH 3LPOA 1HWGB 1TYRA 4MNHB 4XNMB 5DYFA 5G4OA 2PWGA 1UACL 5CFHA 3VFVB 2QVKA 3BEWA 2YJLA 3R06A 4U1MB 1KPUA 2BY3A 4WDIA 1OM3H 2KQNA 1OO2A 4QRPD 2K45A 1KGWA 2V8MA 1XMEB 3FQNB 3L3IA 4H40A 1JWUA 2XN9E 4IS6A 3I6GA 4TTDD 2LHAA 2NYZA 2VW4A 5L4MA 3C8HA 3TCLB 1ZEAL 1EVTC 4GSXA 4GSRA 4JZNB 1NUGA 4QHNA 2WQAA 4YPGB 2PPDA 5IM7A 1QI5A 3BUPA 4RZKA 3K0YA 4JG1L 3MRPB 5HDQH 4DJMA 1ZTXH 4L3FA 4B0MM 1D5BA 5F1NB 2CWRA 3CX5K 4XO3A 3MA9H 1Z0MA 1A7PH 2V5YA 4P3DB 4GS7B 1UEYA 2BHZA 1EHKB 1PIGA 2YEVB 3O2VL 4XC1H 4CUCA 5GS0H 4LSPL 3HR5A 3VXUA 3TEZA 1T0NA 1Z1WA 5FGCE 3F6IA 3BRGC 2MH4A 2VDLB 3FHEA 4KY2A 1C8PA 3CGTA 2QQKL 4M7KH 2X2YA 3SKUD 1EGJA 1ZANL 2LW3A 3GSVB 1RZ7L 3HS9A 4O58L 2QSCH 4RIRA 1T5WA 4JM2C 2GC7C 2H0JA 4XP4H 3WY1A 1MCWM 5E99L 4YHLH 5JXEA 1QTPA 3WFEH 2FATL 5JIQA 1T7XA 3G5YA 4AV5A 4DOHE 1XEUA 3F8UB 2FO4A 4LDCA 4N2FA 3RNKA 3FTGA 1ZPLA 4Z0BL 3EFOA 2VDQB 3IGLA 4LL1A 2JE8A 3MYJB 3K2IA 1U4EA 2Y7QB 1IFRA 1U6AH 2GFBB 1HCFX 3LDBC 2FWOA 4PVNA 4XWGL 4H44C 4M1DL 2B15A 3EYVA 7FABH 3OTTA 4ZZKA 4M1CD 5TK2A 3WXWL 3NTCL 2W65A 2D03H 4GXUN 5I17A 4NQEA 3U6RB 5ERWB 1V54B 3AZUA 2BVOB 4HD5A 3SHSA 2J4WH 1DSFL 4D0BA 1S78D 1WIOA 3L3OB 1NL0L 3RA7L 4QOKA 2NUPB 2UWEF 4CL7A 3WFDH 4PSRA 4JFHE 3SGJA 4TF4A 2DWDB 5FLVA 2BP8A 3L4WA 4X6BB 3QXVA 2DB8A 1EGJL 1I1FA 2G60H 3II3A 3MLZH 2IO5A 3WNLA 1S4IA 1JGVH 1BYPA 3AQXA 5GIRB 4G42B 4X98A 5D7KE 3MUGA 1RY7B 4QI3A 2HJFB 1QFPA 3PWNB 3Q2WA 3D06A 3NJGA 4UI2A 2W1NA 1AFVL 4PY8I 4WSGA 4ZO6A 2KLRA 4WJG3 2VXSH 4HUUA 3T3ME 3UPRA 3PAZA 1A5FL 1BD2E 1OARH 4N25A 1RZIB 1UD2A 4JJOA 1JL8A 1MVFA 2YXVA 5CJOH 1RUPH 2BSSA 4TVPE 1B0GB 3LS4H 3EOTH 4LGSB 5I18L 4XMPH 3NDYE 5JIMA 1F41A 3K2UH 2WBWB 1LO5B 2BCKA 1SHSA 4HXBH 2GBVA 4F9PA 4LHQB 2WGNB 2LQRA 4GFTB 4ZUVA 1G7IB 3B6SA 1DQVA 4YHOL 2ADJA 2G2RB 3BQUD 4L9LA 4CC0A 3T2LA 4N2MA 3MGOB 2AS5M 5JA8B 2PF6A 3HPJA 4Y9BA 4YHZL 2VM9A 2G4GA 2WWOA 1YNKL 3ET9F 5B4MD 5DURD 3KPNB 5CU5A 3QUXD 4QTIL 1M1XB 2XKSA 4HPYL 1EFXA 5DQDH 3WKYA 5KYXA 2BNRE 1SLVA 2W0PA 2C9SA 4CA4A 4K3EH 4ONOA 5I74B 5IF0B 5DD5H 3GMQA 2H2SD 3OV6A 4Y4KC 2C3HA 4G8GE 3EYQD 4KXCA 1PFCA 4XPFH 1GC1L 1P4IL 2NCMA 4EQ2A 1NPJA 2R4RH 2G9HB 3KWTA 4C56D 1JI1A 4MAYD 3CFJB 2VH5H 1FVCB 1IQDB 1UADC 3UMTA 1OF2B 4LXFA 4RA0C 1KEGH 1N2RB 3RZCA 4IU3B 3S3PA 2ARJQ 4YNYA 4C54A 2ITFA 3T77B 2XVBA 4QRPE 1K8DA 2ZCKL 2XZZA 3D39D 3VDBA 2Z8WC 5DUML 3VXTA 3KLDA 3T8VA 5C07B 2I07B 2X0VA 4TSBL 1RHHA 3DX6A 4M62L 4GW5A 4OGXL 5EOQL 4A7SA 1CXEA 3OKMB 4MTMA 3MRGA 1WP6A 4XOEA 1V3KA 1MRDL 4GBXC 4IRSC 4H7VA 3E0GA 1U3NA 1A25A 1I3RA 1P2CB 4ZFGH 1LGVA 2Z31C 3VE0B 1KWGA 3CZFB 2NX5D 1MCCA 3DETD 3WEXB 5KSBB 4DZBB 1DUZB 5EMYA 4KNSA 4PG9A 1F58H 5AW2B 2OX5A 4M6OH 3WKMH 5C0AA 1AKJA 1TZ8A 2C9RA 1E5UI 1HEHC 3CPUA 4LCWD 1VZGA 3UFIA 3E2HC 5F8RC 2VM3A 4H20H 4M93B 5BVPL 1M2VA 5FIEA 4HVBA 5ANHA 4APXA 4ZMNA 3LVEA 5F6IC 4NO5A 2XIDA 5DMYA 3C5XA 4YE0A 4P2OD 1I4FA 4Y5VC 3KCPA 3QJUB 1KGXA 1BMGA 4G8IA 4JFSA 4M00A 3HN8A 1KGUA 1EBAA 3MJ8A 2OMYA 1OTTC 4CDGC 2VAAA 1DBML 1AGCB 4M7JH 4PJ9C 4HIIB 5HHPB 4F33B 3WAKA 4FQXC 4S0HA 1OV8A 4MRBA 4HJIA 1KOAA 3AY4A 4OJFL 5D1ZA 5FYLL 1QYGL 2B0SH 1QSED 2EO1A 3NDZE 1FN4B 2OMBA 2XWTB 4WHTA 2J12B 5DRZA 2JXMA 2LFEA 3LRMA 3V52L 4QRUB 3ULVE 4OCXL 1EK3A 4XI5D 1KTBA 1TQWA 5EO0A 2CLZA 4GNKB 4PHXA 5HDLA 5AL8A 3IWVA 3IWUA 4R7VA 1JPFA 1FFPB 4F9LA 2XY2A 1HYRC 1PG7H 3HFFA 3EFDL 5B1AB 4UTBA 3DX7A 2PPFA 1YY8A 5EOCL 3WS6C 1VEPA 1BWMA 1EQWA 3NACH 4GRWB 4KZCA 3ZZ1A 1SXNA 1GYUA 3BKYL 2EDKA 3QZPA 4Y1AA 3W56A 1MFUA 5E9DD 2F7PA 3FAXA 2WPGA 3AROA 4XNQB 5CN2A 4P4RA 3OL2A 1JHTB 1X9QA 2YAMA 4ICXA 3BWSA 1WFMA 1DYZA 1GGUA 5EUOF 2CO6B 2PNDA 2CLVA 5IMKA 3NRPA 4PWKA 4ZTOH 4D8PB 1Q0EA 1MCQA 1TJGL 5CWSB 2JIXD 4YC2C 1HILB 1MZYA 5F1IA 4E2OA 1GS7A 4AYDC 2O6EA 5BOPA 5SWQA 5BNXD 1CD9B 2BP3A 5DZOA 1XFPA 5FO7A 2AAAA 4B5EA 3NIDE 1MFDH 1XGPA 2WKGA 5GS0D 1E6OL 4HH9A 5IMOB 2IFFH 5IOKA 4UTBL 1MW1A 1OSEA 4EMZA 4HWUA 1M71B 2EDNA 4XX1E 5F7FA 1ET8A 4OM1H 4U4BA 1MHCA 2XWBA 4I48A 1I9IH 4C83B 1U3ZA 4KDTC 5IB2A 4GB9A 4YOKA 3EYUH 1HE8A 4M8RA 5I0DA 3M1OA 4RDBA 4TULL 4C56E 1RPUA 4Y19B 2AXGB 3RQ3A 3LQAL 4K7FB 1S7QA 1TVHB 1S9WB 1VZIA 5I8KH 1BV8A 4ZS7H 1AGDB 4ENEC 2Z0BA 3IETB 3IPBA 4AIZB 1QO3A 3LRGA 5IG7B 3PAVA 1O6SB 3BD3A 4BBWA 3D39E 3BGMB 3TV8A 2ENYA 2CJ3A 2M26A 2XV0A 2JKLA 1KPVB 1S46A 1S5HA 3KG5A 4WNQB 3P11H 1Y18A 2H8PA 3QQDA 5IVXE 4JFDB 4AGMA 3FQWB 5D5MB 5EZOH 3HB3C 4LIQH 4ZUSB 4YLCA 2NX5E 3QHTC 5CLZA 1OSZA 3DHJA 4NS0A 4GG8A 4YQXH 4K07A 5HHQB 1W8NA 2E5EA 4CU8A 3WYRA 4AMKH 1FC2D 2CHXA 3FXIC 4NLHA 5D4JA 2O72A 4LSSL 3TO4D 1MCPL 4G80A 4LVEA 4S1QH 4NP4H 1UWXH 3O6ML 1J86A 5FK9A 2CH8A 1ID2A 4F3FB 1HL8A 4PP2A 4NN6B 2AKRB 4XXDA 1XBRA 1TLKA 3QK0A 1L0YA 2DM4A 2VDPB 1G6RB 3O3UN 2XICA 1IGCL 4N0CD 3EFFA 5HDOA 4J3OC 3N40F 1FYTA 4LRNH 1L0QA 5B8CB 2XRAH 4KJWC 1JCVA 2DI9A 2VDNH 3FUMA 4V1DE 3U83A 2AJVH 2NY0C 5CSBA 3V6FB 3CPLA 3D3VA 2C3WA 5AYUH 3LHPL 5FA4B 5GGTA 2J55A 3FU3A 3NBNA 4AIOA 3U7YL 5FGSA 5JOFA 3HMXA 3RAJL 3W82A 1ZV2A 1QSEE 4BFNA 1KJVB 3VD2A 3GSRA 5HD8C 4EUPH 4JEGB 1HI6B 4FG0A 4MKMA 3MXWL 5C8JA 5DHXB 5HY9A 1PLAA 3S37H 5DFAA 4K3HA 5BRZA 4HF5L 2OXGA 1MAML 4PGCA 4YDMA 4APQA 1N0XL 3ILDA 1GJIA 4Z7NB 1TU2B 2Z8RA 4BWUA 1OHQA 1R5WB 4JHVA 4MCNA 3SYPA 1XO8A 3C2AH 3PWLA 4JANB 1UKTA 3SDDB 2X4QB 3B56A 4PRBB 1UXSB 2BP5M 2GTZA 3SGEI 2L4OA 4MASA 3T0AA 2RD0A 2AXFB 3FO9B 4U6YA 4GKNB 4Y5XC 2DF3A 3VFGL 4KI1A 3ABMB 1J5HA 3ULUH 3JZYA 1EJ6A 2OA9A 1GPOL 3V4UH 4HKZA 3QHFH 5E9DE 4H8UA 3BVNA 5TH2B 1BCIA 1DJXA 2FJHA 3AY2A 1FNGB 4KV5F 3RJDA 3DVNA 3ESVF 3PXLA 5FHAH 2KZBA 3U36B 5L7XH 3ATBA 4R4FL 3E3QC 1XF1A 3IYLW 2OTUB 5GGTL 1RL1A 1L6XA 4HKBB 4NUJA 1J5DA 2EYRA 3HMXL 3ULVL 2MSPA 1TENA 2X1XR 2VMJA 4P5KB 1BEYH 4POUB 4NFCA 3JWNG 4AL8C 2HTLC 1BZQK 2EZ0C 2F8OA 4OT1H 5T3XH 5AOMA 3GS4A 3BAWA 5J56B 6PCYA 4HWEL 4YBLC 4NO2A 1FC1A 3ARXA 3QH3A 1VEMA 1G7LA 3AB0B 4AC4A 2DBLL 3MLRH 4YUEL 1WWWX 4UQ3A 2AJSH 2Y5TB 2WLLA 3THML 1IT9H 2GJZB 1J1OL 2WLHA 5LGYA 1UB6A 2NY2B 3L4YA 3MRQA 2K70A 2HP4A 3UO1L 1MJ8H 3NAAH 5FKAB 4A2GA 3BOVA 2ATKA 3ML9A 4P2YA 1DUYA 2HRLA 1NLDL 1TZAA 2EIJB 2WYIA 3NJKA 4N68A 1IGYA 1FA4A 2HYMA 1E3XA 2FCBA 3BN3B 3PIQB 5IJDC 1CIDA 4YVUA 4FFWD 2X09A 3KLSA 3FFCB 3QIBB 2DJ4A 4K94C 2X6MA 4ZPVB 1NIDA 3C9NA 4GW4B 1NCOA 4IDLA 4K7PH 1RIUL 3HE7B 1FZKA 1KBBA 2O5XL 4XCYB 1ZEAH 4RAVB 3B3IB 5EOCJ 2WLIA 3QJSB 4X5QA 4FABL 3JV0A 1JYXA 3P1VA 4ELDA 3IVKB 4JG1H 6TAAA 2EEBA 3X1FA 4K73A 4EKJA 5ICXA 1JIBA 3N1FC 1GGIL 5G55A 3GMNA 4N2GA 5HHOA 4F57L 1Y1DA 3O9WB 1OZTG 2LU5A 5CHNA 5LGKA 1OLZA 1DVFA 1ZJBA 1LE5B 2PCPB 2G3NA 4F58L 1N9PA 2P45B 1KB3A 5BZWB 3Q6GH 1AP2B 4OCWL 5F7DB 1RK7A 2YQBA 4FS0A 4JY6A 2QQKH 4Y2OB 1GCYA 1CN4A 1UA3A 2R15A 3CHPA 4O58H 1IEAB 3AT8A 4LCUB 3SY0A 1Z5LA 4YDKL 2Y25A 5E99H 4CRPA 1FZOB 3MLSL 1R3LA 4B9JA 4BZ1A 3JVGC 4OD2B 3OLEA 5D7IA 1DO6A 4PV8A 4V1DA 4OZFB 1JAEA 4RSVA 5L2KB 4ZO7A 2ODHA 1CXIA 1IFHH 5TK4A 3MV9B 4L3EB 2EE9A 2GBUA 5HPMA 1IEBA 2H1PL 2OMWB 2XIBA 1T04B 2G4EA 3OJDA 4LCCB 1QX1A 2JWYA 4IBLT 5BOJA 4AYGA 2OV0A 1TMQA 4DERA 2A83B 4XWGH 2R23A 2FK9A 5IMMB 3NJXA 2JKSA 3CZGA 4P5TB 1ZTMA 4TN9A 1AS6A 1DBJL 1E5AA 4Q7DA 3WXWH 4BZ2A 2BSTA 3NTCH 5IREA 2A9DA 1BG9A 1MLCA 2W81C 5GGUA 4MXQD 4B50A 3K2MC 3QHZH 5C3IA 1R0AH 1TT6A 4JFYB 1NL0H 2KERA 2Q10A 5EUKA 5D1ZI 5B1KA 4J28A 3MBXL 1SLUA 4DT2A 3WY4A 4DKAA 1IGIH 4UOW1 4F15C 4ZS6D 1SOSA 2R56L 4Q97A 2F54B 5TPWH 5I1CL 3FT3B 1S9KC 3P69A 1THCA 3TT1L 4P23C 1Q72L 3RB7A 3HVNA 1F4YH 1XF5A 2ZTBA 2NNAA 3JWOC 4OZFH 3MX0A 3RUGF 3BZEA 15C8L 3BP7A 2YO3A 1BQLL 1LWJA 3E8UH 2N0MA 3ZKMC 4BFFA 4OW6A 2BXZA 2JKNA 1M6OB 7TAAA 1UYWL 4BZ1L 3WJJC 1AIFA 5GZNA 1XMWA 4V33A 5DQ9A 1DCLA 5MEQB 5M94B 2C1OA 2R7EA 1HX0A 2ZX6A 1Q90A 1I85C 3N41F 4KI5F 1A5FH 5CIPB 5I1IH 3DO7B 1YG9A 5CUSH 1YY9D 1EDHA 2YJQA 3BISA 1KV7A 3VSQA 1PZBA 3GTTA 5I18H 5C97A 1E4HA 4BZ2L 3QIWA 1BZEA 1NMCB 3TBYB 1DEDA 2AXWA 3EJRA 2KBGA 4ZFOB 1G9NC 3T04D 2Q7YA 2Q86A 3LKNB 1I1YB 1GW6A 3SCMC 4YHOH 5C0FA 3BUIA 3PWUA 4FJ6A 4GMTH 1CR9H 3TESA 1LJMA 4I18A 3CVBA 2EIZB 4OR1A 1MRCL 4MNHA 4W9DC 1RJCA 2EACA 5E6UB 2H5UA 3EAKA 4ZUTA 1MOEA 1OALA 2R59A 3CFDB 5HHVH 3SE4C 4QTIH 5CN1A 3VJ6A 1CICB 4JGMA 2KZ1B 3H55A 4PS8A 4UV4L 4Y19D 4HMDA 1KT2B 4OLVL 3CHOA 1ND0A 1RJYB 2IBZX 5IJKC 3AAZB 4G7YH 4YPJA 3UG4A 4IBQA 2QVTA 1TQBB 3PRZA 5DHVA 2CALA 2WN3A 3KE0A 3WTTA 2GCYB 3OKDA 2OYLA 3MRPA 4K3JL 1ACZA 1NJ9A 5KVFH 4K7PY 5C07E 1LEIA 1JVKA 1CFTB 5C09D 4PRNB 4TM9A 4Y0GA 1E9QA 4JFDD 3OKOA 3T1FB 4P5SA 1AGEA 4Y1TA 3ZZLA 1WBZA 3QRGL 3U7WH 4BKLA 5BXFA 4F37K 2VN7A 2HT2D 5DJ2B 5DUMH 4H25B 5DD3H 2DLHA 2PP8A 3BT2L 3HFML 2OP4L 4NUQA 4UQ9A 2FLRT 5KSBE 5E8EA 4LPUA 5EOQH 1OCZB 4L37A 4WFGD 4F93B 3CQPA 3ZE0B 3AITA 4ZFZB 1MRDH 2EVGA 2H45A 1NEZA 2WUBL 3RWDB 2YRBA 1D7BA 4Z6AT 3TYGH 5EZLB 1H3GA 4KK9D 4JJ5A 3K71A 1PLGL 5H35B 5D2NB 2AVGA 1AE6H 3Q8BA 1XH0A 2PCXA 2W9EL 2HKHL 2UZPA 3IRCA 3N43B 3U4EB 4HT1L 4AEEA 1FE8L 4NI3A 2JLPA 2Y3NA 1XB3A 3V95A 4GOSA 4DGIH 3AQYA 3DO4A 5BVPH 4CSSA 5TF0A 3MRBB 3QCUH 3OX8B 4P2QB 1D5XB 1A6WL 1PLBA 3U6RA 3WGVB 2BVOA 1MG3C 4YSTA 4NQSB 4FXTA 4J3UA 3LY6A 3L3OA 3MA7B 2JSFA 4DETA 1U2HA 1U8JB 4HZ1A 1SRDA 4JMNA 5I73B 4AW7A 2DW5A 4ZTPL 1NDGA 3AG4B 3MJ7A 4JM2F 5EO9A 1MHPL 1XCQB 2VDLL 5DMIL 4HIXL 4E41B 1FNEA 5FECB 1OAXL 4ZD3L 5BMFL 3BHBB 3EJSA 3Q7JA 4UOQA 1I7ZB 5FYLH 5GJTL 3KVDD 5IBLC 1JNNH 1I7UA 2MTPA 2HJKA 4KX8A 4U0RC 1BP3B 3QO1B 4QRAA 2O6FA 2P80A 4Y4HB 1ILUA 1J1PH 1U8KB 3LRSA 5CU9A 3FUHA 3T2PA 1WICA 4GRWE 3W0WB 4BGDA 2N0KA 4HH8A 3GSOA 4MNGA 4KXDA 5JW3H 1FORL 3SBRA 4HJ0C 1RZIA 5DMJB 1R3HA 3EFDH 2Y07L 4LOUD 3JBG7 4NWUH 5ADPH 1VFMA 1TJMA 5EOCH 3CMOH 4KKCC 3X1EA 1CF8H 1HH9A 4P59H 3H2QA 3BEVA 4NBYB 1NCBL 2GW5A 1B0RA 1S7WA 2VLKD 2ARJA 4QRRA 4MMYB 4JGJA 1D5RA 2HG5B 3NPSC 4PJEA 3BCDA 2HT4C 2D2OA 4ES8A 2Q1EA 2Q7AA 1RJZA 1A7NH 3D4YA 3G9AB 3PV6B 4ZYKA 4M6AA 2J44A 4ZBJA 3AG3B 4AQEB 1BYNA 1WFNA 5MP6H 1UZ6F 4OCNC 3G9VA 3K6IA 1IM3A 1K72A 3QFJA 5E4IA 4LPYA 4WW2C 1J5CA 4KK5D 3MBWA 3ECBA 5F97E 2VC2L 4Y5YC 4OZ4A 4EJ1C 3S0PA 3BJLA 3G6DH 4RGNB 3WIFB 2QKSA 2NXZB 2NY2D 1ZPUA 4ZX4A 1UJ3B 1OF0A 5GRUH 1JXDA 2ICEB 3D52A 4LIQE 1X4XA 4NPKA 4JVWA 4W9HC 1FFRA 1AMYA 4CVZA 1E6OH 1IQDA 1NICA 1YN6B 1T89A 2CQVA 2VDOB 2XXGA 3DMMA 4FQQB 3AXHA 4N0YH 4ODBD 3W11C 4EI0A 1SF3A 3DK2A 3HZMA 3IFLL 4AV4A 4MAUH 5DS8B 3RNQB 3BDYL 4Y19E 4AM0B 2F53A 4M4RA 3EO0A 3FFCD 3QIBD 4WWKA 1S9VA 1E67A 3BPNC 3KD4A 1YMMA 4LPWA 5KVDE 3AC0A 3HE7D 1RVFH 3H3PH 5C7XH 1I75A 2A6DB 2KS0A 1R3IL 4PJDB 4RX4D 4U2ZA 2P42B 4NO3B 4TULH 5FA3B 2OAAA 3E1F1 1CE1H 3BH4A 1BBDL 3RX7A 3LQAH 1JNLL 5C09E 4LNRA 4TSAL 4Z3IA 2XOTA 3O9WD 4JFDE 4B97A 5D5ME 5K69A 4JFEB 3GC3A 4LSQL 1BF2A 3RVTD 3UTSA 4G7SB 3WENA 2H41A 2MCMA 1SEQL 1WZAA 2VDOH 1LD9A 3BXNA 4BIKA 2DQ6A 1A7OL 2AQNA 2BIOA 4H0GA 3RDTA 4WFGE 3B2MA 2NDGA 3FRPB 1D6EB 3VXUD 2MCAA 4KXAA 1JZ7A 3FF8A 4I0PC 3ARGB 1J9TA 4RNRB 3ZSTA 3C2SA 5JIKA 1S6NA 4NQDA 2GJ6A 2AV1A 3MAWA 4M8UA 2ZOOA 4OIFA 3MLWL 4RDQG 5MERA 4ZX3A 3O4LB 2IFGA 3RWGA 4XX1G 3D6GA 3QI9B 4NBZB 1CGTA 3NJHA 4FE9A 4W9EC 3MV9D 4LSSH 4L3ED 3P3RA 4FFVD 4TMPA 4BK8A 5GGQH 3HVDA 1JRHL 1MCPH 2I60L 1JI2A 1CYGA 4P2RA 4YLBA 1FGVL 5C6TL 1LTXA 4XTRC 5C0ND 3BVTA 3PL6B 4OQ1A 3SDCB 2VMFA 1VADB 3SDAC 4R7LA 1S9YB 3UYOD 5E6YA 5C0RL 1Q1PA 4Z7QB 2F9BT 3G5ZB 4FNQA 2UY6B 1ONQB 4JQIH 4GLRH 1RZJC 1IILE 5T1LD 1BZ9A 1P7BA 2TSBA 5I82A 2Q0ZX 3D9AH 3SY6A 3LHPH 4DK3A 4KNUA 1JVOA 4IBWA 5LG6A 3VXRA 5FW6A 4PY7A 3P30H 4JFOB 2G2NA 4Z7NE 1PPIA 4YK4C 1SGKA 3NIGB 4DWHA 4KVNL 4FN0A 3WXVL 1NCJA 3KCWA 5KSVB 2C3VB 5DTFA 5DEJA 2DL2A 4EDWH 4TUKL 1D5ZA 1FLRL 2DWEB 4KNTA 1N0XH 2NY1C 4JRYA 4A39A 4PJXA 1D5MB 3QUMB 4N4YB 1U92B 2FIRT 1BVZA 4ENZA 5I24A 1QR1A 4XH2B 3MV8B 1YN7B 1NCWL 3AS3A 3VFGH 2ZICA 1ZLVH 1UH4A 3EOBA 4Q89A 1GPOH 4FTDA 4LAQL 3NCBB 1LEGB 1WO2A 3EYOB 3RI5K 5E1AA 1EDYA 3C60C 2R27A 1AZRA 1CL7I 2P4AB 4QF1B 3DPBB 1E9PA 3M45A 4JCWA 3BZDA 4AYMC 1QUNA 3QRLA 4DZ8B 1RURH 3QAQA 2WB7A 3V9FA 1MUJB 4M9OA 1DQIA 2LE9A 2VDKB 3FRUB 2AGJL 4PJHF 2BRRL 5C7ZA 4U1NB 3RY5A 1H9VA 2P3YA 3E80A 4G8EA 2K78A 3VWKC 5EZJB 4C83A 1I8MB 2YPLA 1YC8A 1GW0A 2BINA 3KPOB 3OKEA 2DBLH 4JE0A 1BVLA 1WQVT 3U1QA 1A6TB 2A0LD 2VR9A 1MDTA 2WZPA 4K7FA 4Q9CA 4D9RE 2A7BA 4GKSB 3IB4A 1AGDA 2UV3A 3T9WA 4JAMA 2AJUL 2CK0L 1YNTF 3APCA 2APVA 1O6SA 3FFCE 2ED6A 2MHAB 5LUMA 5ECJE 5HHXL 1NLDH 2O6CA 4TNEA 1P84J 1CWVA 4BQCA 5KJRL 1EHLL 4FG4A 5L4JA 5A16B 3C6LC 5DF0A 4Y2DA 3CIAA 4YL9A 1UGKA 4FQCH 3DXAB 4R3SA 1PAZA 4MA3B 4LVOC 5D5MA 3BKML 1NGPH 1DLFL 3A6CH 2CM5A 3D0LA 1DQML 5IY5B 4G6JH 3KW8A 4JFQB 1L9TA 1RIUH 3QJFA 4YEEA 3S36X 2XV6B 4TUJB 4LRIA 3OKYA 2O5XH 4UUJB 1UZGA 2DIJA 2G2PA 4OY9A 4FABH 3MOBL 3NH7L 4KQ0A 4KMTL 2QVIA 3DGCR 3QQ4A 3IDNB 1J0HA 1MWOA 3FB5B 2IPKA 4MSWB 1GGIH 4PRDA 3ZJAA 3RGVA 1D6VL 3MZGB 3DSNB 4F3FA 5EBLB 4ADIA 4G6KL 4XZUA 5E2UH 1QAWA 2YMXH 2X4UB 5EBMB 5C0AD 1DJZA 3O11A 1UA6L 2ATPB 1FL5B 4RBPH 2SODB 4WJKB 1G6RA 1P0SE 2DQUL 4EE2A 1EHNA 4HYTB 2BK8A 1L9SA 3L9RB 1QBLL 3GM0A 1KV3A 4OCWH 5C0JB 2E9BA 5L2KE 1NGYB 3LKQA 4AIXA 1X5FA 2EVIA 4AEHL 2YA0A 5AAPA 3MV9E 4L3EE 2BZ7A 3VAEA 5HGAA 3DVIA 3ZKSD 4E41D 4BE5A 2DMKA 1R9FA 2FQGA 4QO1B 2DQDL 3MLSH 3O3BA 3ZYJA 3MV7B 5FUCC 2NY5H 1GKOA 4RAHA 5FOBA 3FU7B 5AG8A 4HMEA 3UL4A 3NZSA 4LE8A 4BK5A 1M1SA 3GLAA 4KHXL 2E7LC 2IANA 4YSDA 2QBWA 2FWUA 1W0VB 2H1PH 3KPSB 4Y4HD 4BJLA 5F9OL 5ENWA 4J1UB 3E6HA 5IIEB 3W0WD 4KUCF 3HZYB 1KJ3L 4WI9A 3POHA 4ZW3A 4PG2C 4YXKL 2I9TA 1DBJH 3SDDA 1BBJB 2F54E 1TTBA 4PRBA 3DRTB 2QKIA 3RWHB 5B39A 4X9BA 3LV3A 5L8KB 3FO9A 3QWRD 3QNYA 2DQJL 1UOKA 3ASWA 3BRFA 2VDPL 2P5PA 3MBXH 1G6RL 2FBOJ 3ETBF 3H85A 5KJ7E 1K4DB 3IKCA 3PAYA 2FX7L 4D9LH 1NEZG 2DIBA 1PZCA 1Z9LA 2CK2A 1HQ4B 5L0QC 2WKLA 3TT1H 1Q72H 1VFAB 3ZHKA 5JXAL 2Z8VC 4LCYB 4KU1A 4OUUB 5GS2H 1ZXKA 4W4NA 4TL5A 15C8H 1T1XB 1HNYA 4FLQA 2A73A 3B37A 3BAYA 4FG6C 3WLBA 4HKJA 1NCUA 4BZ1H 1O9VA 4YDVA 4LSRH 5ESQB 4ZUWA 3STLA 5LGHL 4Z3FA 4QCIA 5JW4Q 4TNWK 5KVFE 3WO4B 3LEYL 3T0WA 3EGDA 4DTGL 1E4XL 5CZVL 3KL0A 2CO7B 4YBHA 5DVMA 2IGTA 3PLYA 1I7RB 2BFGA 2DQCL 3MTRA 3T0EA 1G9EA 2GEQA 5IR1B 3VD7A 1YDPA 2H9GA 5CGMA 5IHZB 5IUSA 2IALB 3B9KB 2X4PB 3L5HA 1JTOA 3JZ7A 2PYEB 3BGFC 1CLVA 2AJZA 5D7LA 5BJTB 4MQTB 4U05A 3U0WH 4PRHB 1BW8A 4CU6A 3CSYA 2FJGB 4DN3L 2CGRH 1P9MC 1WFOA 3ZL4L 4PLKC 1MY5A 3MRDA 5IJVB 3B9AA 2YD0A 4HIJB 5HI3C 2PWFA 1B4TA 2BP0B 4JDVB 4GKZA 4MB4A 1EXUB 1E90A 2IH1B 1PNDA 4G5AA 3BWUC 3LNEA 1FDLL 4UV4H 4YHNB 4OLVH 3V79C 5AKVA 3ZUNC 3UBGA 4W4OA 5CBEB 4PJ8B 3TL5A 4GRMB 5BUPA 4NENA 3IMWA 4XCYA 3CXHJ 3APFA 2EDBA 3MXVL 1J5OH 4JFED 4BDVA 2G3ZA 4K23L 5CCJA 4K3JH 4BK4A 1QACA 1JGEB 1U2CA 3PG2A 1C5DB 2LU3A 3HN5A 4FL4C 2WANA 4ZFFB 1ZSHA 3L3DA 1JRHI 3ZE0E 3GXFA 3KVQA 3EJJX 1IAOA 4F24A 4R97C 3ZHNA 3ARGD 4MD5A 3KBEA 2BWQA 3CZLA 5KBPA 2UX7A 2PCPA 1E27B 2DLFL 3H8NA 1COBA 1A3QA 4OGYL 1W6LA 3BT2H 1SXBA 4LEXH 3CDGB 3BRDA 4IKIA 4NN7C 4FXKA 2RFXA 7PCYA 3EBGA 3IS1X 4U1HA 1IEAA 4OTXH 1UD4A 4LCUA 4GXVH 1WWBX 1Y6NR 3QUZB 3U9UB 2WUBH 2WXHA 3HW7A 3J7HA 5FM5O 1B3IA 3PL6D 1RP8A 2X4OB 2VZTA 2ZCLH 3BN9C 3SDCD 4OD2A 2XFGB 3V4PA 5L2KA 1NH6A 4P2QE 1EUUA 3CXFA 1VACB 4GQPH 4P8QA 3OHMB 3GB7B 4LCCA 2HKHH 4K5NA 5CZXC 1YZZA 4KROB 3OR7A 4OCSL 3DARA 4XP6H 2A83A 1KEMH 1WZ1H 4P5TA 5DRWA 2EEFA 3RY4A 1CLOL 2GHZA 3PP3K 3P73A 2XN2A 4JUSA 1NEUA 4E41E 2NLJA 2QLVB 1A6WH 3H0TB 3CFIC 4JRFA 4M5YH 4Y16A 4YZFF 3RP1A 3NK3A 3QEHA 1PG7W 2V7NA 3I75A 3TA3B 1TVBB 3VM5A 1EMTH 3ZDYF 1BOGA 4BCZA 4NZUL 5HYFA 2BFVL 4ZTPH 1TYEB 3MBEC 5GS3A 5HYJB 5KYYB 4HIXH 2V5TA 1OM9A 3D2UB 3WE6B 1OAXH 3V6OE 4WK4B 4FNUA 4ZD3H 2OJEB 4PBVC 4Q4EA 3W0WE 4EI5A 5BMFH 5EF3A 2YEQA 5CJBA 5JDSB 3OVUB 3CXDH 4P9ML 1T7ZA 3P3TA 2GEEA 3BMWA 2K7QA 2FZ3A 3TC9A 2AZAA 1NCCL 4XPAL 3V4PL 1HZLA 3RTQC 4KQ4L 2D3NA 3Q6FA 2IMMA 4GO6B 1GZHC 4R2GB 5SWSB 3FKUS 1MRFL 3QQ9C 3EF4A 1UOLA 4HJGB 1WBYA 2MNWA 2UWEB 3GXDA 1VB9A 4N86A 4TNGA 4PJCF 3GMMA 3FHAA 4F7EA 2A6KB 2QHLA 2VR4A 3RIFK 5LDUA 3AG1B 1NCBH 5DFVD 1T6BX 5AAWA 4HLEA 3DV4A 5CCGE 2DWXA 3AREA 3RL1B 3UERA 5DFWH 3QJRB 5DS2A 5EZIL 4HK3N 4JPQA 4JY4B 4CGTA 4TNVK 2FECI 1YJDC 2ZE0A 1JV5B 3JWDH 2IWGA 3MPCA 1RZGA 4GG6F 4KJYB 4RGNE 4NWTL 4EN3A 3EO9L 4ZXBC 4B27A 1YYLL 1QBAA 3A5VA 1PSKL 5AVYB 1CICA 3GLDA 3F12A 2Z93A 3MRFB 4GW1B 1S8DB 4OJDH 1CI3M 3QUYA 1N68A 4JO5A 1SJEB 3QPQC 2VC2H 1ZLVK 4FFZA 1JK8B 3W57A 2Y6SC 3VI3F 1IC5L 5D71L 3SGKC 2Y7OA 4NCDA 4XODA 4HIPA 1JD9A 3NZ8A 4HEPA 3G08B 1HC1A 3SPJA 2WC7A 1JXJA 3Q1SH 5JHLA 2ILLA 2X70A 1WIUA 4C8XA 1F18A 4I0KA 1WDAA 4PJDE 5TDOB 4GUCA 3CN1A 3TN0C 3DXAD 3MZTA 3BDYH 1U3HA 1AHWC 5JPMC 2BNUA 1G94A 5GZOA 4N90D 1K2DA 5K9QI 4ODWA 4S1SL 4X5WB 4FLHA 4XCFH 4IU2A 3SQRA 2N7AA 1R3IH 4JFEE 4Q56A 2W38A 2X1OA 2Y1VA 5I15L 2YGNA 3ARDA 4K71B 1F3DJ 3GHBL 1A4KA 4XO4A 3RWDA 1KLGB 2XZCL 1MCLA 1Q9WA 4YZWA 1JNLH 2X0WA 1NBQA 1B6DA 4NQVB 4TSAH 4P3WA 4QHMA 4Z3JA 3NYKA 1SDYA 4X4KA 2BS9A 2IPUG 5CGBA 5H35A 3BZ4B 2G5RA 5D2NA 5BO0D 4KH9A 4NGHL 1K4CB 3BPCB 4FFZL 1TXKA 3U4EA 4NYLB 4J27A 2P46B 3U4KA 3O4LE 3IDMB 2BDNL 1A7OH 1ZLUH 3LKSA 1FO0B 3FMGL 4N2LA 4XN2A 1A1NA 1NCDH 3AU1B 4LLAA 1SYVB 4P2QA 1UFGA 5JHLL 1RZKL 4Q9RL 5GQBA 3PF2A 1FF5A 3HBGA 3H9SD 1EVUA 1KULA 2QADB 1EEYA 4FKKA 3FT0A 3MV7D 3SPIA 2VLJB 2A74A 3X11A 4AWJC 4Z7QE 1AS7A 2R0ZL 5EA0H 1K5NA 1PYWB 3FDWA 3KPSD 3PUUA 2I60H 5FECA 2FSEA 5FR3A 4P46C 5K9QG 5C6TH 4XR8C 3IF1B 4XN7A 3VWJB 3UTZA 2FSDA 1M6UA 3VQ2C 3O2DA 3MJ6A 1CLYH 3G6JA 2APTA 4HEME 5C0RH 4U3CA 3W81A 3OPZL 1KNOA 4DKEL 4RBPK 4OLXH 1IU1A 4PWFA 5CLYA 1U8KA 2PCFA 3FCUB 1A21A 4Y4FD 4XO5A 3BPLB 1AI1L 3NIGE 4E9RA 4DGYL 5BZZA 1DEEB 4LVNC 4JN2B 4ZJ9A 4JPWL 1JG9A 3UBFA 2HA1A 2DEYX 2DM3A 2XA8L 2XWEA 4FZEH 2QT6A 4ODXB 3FFDB 3V0HA 5FO9A 2EUVA 1CF1A 4KRLB 3TZVA 3VRIB 3INUH 3FSWA 3F7PC 3QFDA 4KVNH 3TNNB 5E8PA 2BZCA 5F93C 3WXVH 1G7JA 4DQOL 2HG5A 2EKJA 3UZVA 2IADB 1TNMA 3MV8E 4TUKH 2Z91B 4IBUA 4PJ7A 4GT0A 4ZPTB 1LO2L 2XFXA 3MRMA 4XN4A 4OI7A 1LEKA 4MA1B 3MROA 3VMPA 2AC0A 2X0UA 2WMPB 3IMTA 2HAZA 4Y9GA 5KS9F 5J8OA 2YBRA 3MRKB 1S5IL 1LNUA 3O2DL 4B9KC 3LN4A 3IN0A 2XZAL 1VGKB 3B9KD 1IE4A 1NCWH 1X7TA 3FZUD 3RWFB 3LKPA 2PYED 5DJ0B 2OXHB 2W59A 5K9KA 4LAQH 3X14A 2YAPA 1AYRA 5FFGA 2R0LL 1MW0A 4PRHD 5ABZA 1W0YT 4L3CA 5E6IC 4WJ5B 5I0XA 2WOBA 1MF2L 3GUTB 3TIDB 2HTKC 1URZA 5JQHC 1AD9A 2ED7A 3OZKA 2IMNA 3LVTA 3O3EB 5EUOB 3C5SB 2AGJH 3N85L 4EOWL 3MUY1 1CT8B 5DS8A 2BRRH 3QORB 1JGLL 1HAWA 4OLYL 4XCCL 3IJHB 1YEWA 1L7IL 1A4CA 5I1HL 3R18A 3RDJA 4PJ8D 5HI4C 2QMKA 5DHEA 2Y2WA 3O45B 1MCIA 3ULUC 2CKBB 3NN8B 5HJGA 3K72B 1UENA 3E9TA 4ZAKB 3CQFA 1FYHB 4WW2F 1MI5A 5CILH 4HWBA 4HUXA 1WEJH 3B4NA 3MNDA 3ARFC 5IGXL 4ZQTA 5E8DH 2R0WL 1RZQA 1N18A 4PB0L 3DXAE 2AJUH 2OULB 5GRXG 3BUDA 3O6LL 2VDRL 3EJTA 2ZONA 3WFHA 5E94B 3RHWK 3ZO9A 2PW1A 4NKOB 1Q4NX 2BJMH 1QLFA 4YDIH 5IJBC 3I3BA 3TVMA 2CDFA 2JQMA 4ABQA 1TZIB 1WFUA 3M1BB 2IPTH 3QUZD 3F65A 4HJ1A 1DQMH 1QPPA 5F7NC 3GBEA 4FFYA 1DQKA 3O4LA 4YSUA 1JTTA 2BIHA 2CKBH 1MQKH 5CINL 1JK9B 2C4FT 5AYQA 4QHPA 5D7JC 4PJGF 4JREC 5AAMC 4KMTH 4XP1H 3GRBA 2UZIH 1MELA 3BP6A 4KROD 2F5BL 3Q13A 1NAMH 1D6VH 2Y7SA 5FO8B 4MMZB 1U36A 3BVUA 3DX8A 2V3EA 1TTFA 4HWBL 4KO7A 4ZO8A 3U2IA 4ZMYA 2TSAA 4OFYD 1UA6H 3L7FA 2W0FB 5AZ2L 4Z8FL 4PRPA 4CSTA 5T33H 2RQ8A 1WPCA 4ZRGA 1BZOA 3MV7E 3RGHA 1ES0B 1QBLH 1JS4A 4AY0A 4IRSA 4L8SB 3TA3D 2NZIA 1F3JB 2Z31A 3MMEB 4AEHH 3T3PF 3WIHA 5GJSL 5B38B 3KPSE 3TFKC 5IWLA 5HYJD 1CFSB 3D2UD 3O8XC 2DQDH 5EC1B 2A1WH 4AUJA 4W1TA 4Z76A 3GZKA 4OCRL 1SVZA 4KPHL 4CADB 1WRFA 35C8L 2OR9L 5D9SB 1MVUA 4DW2L 1A3LH 4FFYL 4KHXH 4X7TA 3B2VH 3VGBA 2QEJA 3CBJB 4HS6B 3GJFB 1Z9OA 3VG9C 3FT4B 3IFNH 2IOIA 1E65A 2XNAA 2ZYIA 1KJ3H 1T1ZB 2AI0H 3QYMA 3QUMA 4YXKH 5SWSD 3GNMH 3K91A 3L4UA 4P06A 2X2UA 1OTUD 1HINH 4S11A 2D7QA 3L9EA 2ZX9A 3UZQA 5A1AA 1IAII 4UNIA 4PJ9A 4IRJB 5GGRA 1F3DH 4FQXA 4GSQA 4HDIA 4XMVA 5EC2A 5DZJA 5C0GB 2I9LB 2OKMA 2QV2A 3FU9A 3Q44A 1Y6MR 4YSEA 4OJYA 4QEGA 5J1TC 2X89D 3EYOA 2P24B 5KYUA 5JXAH 5CSZA 3DROB 3HG0A 1GHFL 3WIHL 1Q9LB 3HC3L 4OZFG 2CGYA 4QRRD 4JHZA 4ECNA 2CDGA 1P84K 5I9QC 1NAKL 2AF2A 2G75A 3VGEA 3CLEL 1QNIA 2PABA 2D7TL 2J73A 2PYEE 4MXVE 3B43A 4L4VB 3JTSB 5HHNB 5MI0B 1E4XH 2P49B 3LXUX 4G1MA 5HGBB 4NKMA 3DBXB 3IMBA 3WDIA 2C9XA 2K9UA 4PRHE 1G0YR 1NANI 3KPOA 1R34A 2WO2B 1X5JA 3Q48A 1DJHA 3QUML 2MQCA 5E8NA 4AQ1B 4BH7A 4I3SL 5DMKB 2JTYA 3ASNB 1SUHA 3SB3A 4N0UB 5E2WL 1L9QA 1YECL 5E2VL 1QMUA 1T6VN 3VDCA 3ZTCC 4DUXA 3GKWH 1DO5A 4L0PB 4LLYA 1FSKC 3G5XB 1N4XL 4HFUH 1IC1A 3MLYL 3WFZA 3QUKB 2IJ0C 4UWQB 3T8XB 4YFEA 4WSKA 1CFBA 2ADYA 3WNPA 1QWHA 1BAGA 2AITA 1FV1B 4ZOCA 2F53D 5J13B 4LFHD 4NDMA 1F11A 4H2AA 1A1OB 1ED3B 1FDLH 4PV9B 2HRGA 4MQ7B 3FYIB 3UYPB 4HAFA 4WNSA 1H8SA 4TUJA 1YEGH 5BV7L 1ZSDA 3QDJA 1IX2A 4LF3B 1LK2B 3MXVH 2A38A 3KPQB 4CMHC 3GYRA 5CLWA 2ERJB 3FB5A 4MSWA 3CVIL 2FL5B 3PGDA 2R8SL 1CBVH 2OMXA 1BQRA 4M8VA 3SGJC 1ZHKA 1B6UA 1MEXL 4Z5RB 4QAWA 4PUBH 1QHQA 3WN5B 2X4UA 1D9KA 1H3XA 3ABZA 5LWYL 4MD0B 4N8UA 1U8HA 4JQVA 3V0EA 5MENA 4ZUUB 1INDL 1NCHA 2LTQB 3T4AC 1A3RL 4OGYH 4G9DB 1NEPA 2ADIB 4GAFB 2XIIA 4LHUB 3GRGA 3BKCL 3QB7C 2VLJD 5LBGA 1YEHH 2CRIA 4P9HH 2H32A 2XKNB 5GGSB 3T4YA 5EOTA 1XD0A 4NQXA 2CE6A 2GJ6D 4LLUA 4NQDD 1GC1C 4MNQA 4MJ6B 3WSQL 3MUZ1 1E4WH 4NQCB 5K39A 3HHRB 2YGOA 3MGTB 1CK0H 1OK8A 2F2HA 2HUEA 3VWJD 5LN8A 3FFOA 1KLUA 3MREB 1UURA 3NUKA 3OLIA 5FDWB 5LLIC 2WINB 1AR1B 3QNXB 4KHTL 4ORGB 5LDSA 2BW4A 4P2RD 3QT2A 2I85A 2CPCA 1BGXH 2EADA 1VIWA 3RBSA 1AD0B 4F9PC 5E56A 4A2MA 1FH5H 3HZYA 1WT5C 3ARVA 1ZLUK 1BIIB 4FGMA 3LIZA 3VO0A 4L9LC 1CLOH 1BBJA 1HHIA 1EZSA 1T2QL 4ODUB 5HYJE 4LARH 5DC4B 1ZAGA 3FUNA 2QL1A 2ATAA 3GDCA 4LB8A 5DD6B 1GS8A 1SOKA 5ILTL 5EU6B 3WS3B 3TJHC 1T1WA 1QG3A 4CC4A 3CFBA 5JW4R 3HI5H 1KJMA 4P2CG 4NZUH 4NPYA 2BFVH 2WQRA 3S2AA 1GGCL 5AB0A 4G5ZH 3T0XA 1TEYA 3CWGA 3VFWB 5SWSE 2C9VA 2CU9A 2XTLA 1P4BH 2UWEE 3TBBA 2R1WA 5AENA 1KIQA 1CVSC 2DTSA 1NUDA 1SN0A 1Y6KR 3SJVA 5DYOB 1RUQH 3IDIB 2EVHA 1NCCH 2PWDA 2JK5B 4KQ4H 4NZJA 3AUWB 3RZCC 4X8GA 4D0CA 4GAAA 3CE1A 4BXSV 1L0PA 3WO3B 5IHBA 4NO0B 4YLQT 2E74C 3I9GL 2Y24A 3GT6A 1JVLA 5IR1A 1A9EA 3TV3L 3BH8B 3T09A 1JTPA 2C9QA 2G0LA 1QFOA 2ZJSL 1V7NH 3CXHK 3LIZL 3P77A 4PGEA 3F5WA 1RSYA 4KKLD 3MOQA 5BO1L 5J3HD 3RUGB 5BRQA 1F6AA 2EDEA 3L5JA 2PXYB 4JFFB 4OLUH 4HC1A 3V5KB 3JYBA 2H7WA 4A2FA 4QWWD 5EZIH 2C5DC 3QORD 2YQGA