3SD2A

Crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
NPMGIPIQPTYEKCAILSNILNVSFGRAKDYAIITVTNKATGEIVHSKTYHNTSIVMIDMSSCEKGEYTIHIILNDCLLEGTFTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative member of DUF3244 protein family
publication title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sd2A01
3SD2A 4G5AA 3D33A
chains in the Genus database with same CATH superfamily
1IEAA 3VXRE 2DLFH 4J3OG 2MHAB 2O26U 3T2LA 3E6HA 5D4JA 1I1YB 2K78A 3I6LE 4KJWD 3D2UD 5EOTB 3ECBB 1MHHA 3QFGA 3RI5K 1LK3L 2VQTA 5D7JC 1OM3H 4L3CA 2CO7A 3ZKND 5D2NC 5LLIC 1KIQA 4G6ML 3GHBL 5FWRA 2GG1A 5BQDA 5HYQA 5DK2B 3UG5A 3FPXA 1W6WA 4NKMA 3M86A 3LV3A 4DGVL 5IGXH 3SYQA 5D71H 5DMGD 4X4KA 5HDLA 5I24A 2PYEA 1M9WA 3BKMH 2EIDA 4NQTA 1JGEA 1K8IA 3GJFH 3GZOA 4GAYA 4ES9A 4U3SB 3CQFA 1DBAL 4M5ZL 1WDAA 2QVMA 5DK0B 5J9PB 1U9KA 4JZOB 5K59F 1NUNB 2WANA 4H20L 5I71C 5CSGA 1SY6H 3NIGF 3ULSB 2F54A 2OMWA 1XF2B 5IB3B 2F5AH 4KKLD 5C0FA 5E5MB 4HIPA 5E8OB 1I1AD 3QQXA 5HY9A 4NZUH 3VFTA 3LRMA 3RWJB 1FJ1A 4NSKA 3QEGH 3T6XA 2J55A 3MQIA 5HHNA 4FNRA 5EUOB 1WBXB 4AIOA 3KEDA 4Q56A 2Q8BH 2IDTA 2VDQL 5LB1A 2IG2H 3BVNB 1P4BL 5DR5H 4U6TA 5CIPB 1K5WA 1WTGT 1R5WB 3JVGA 3WFEH 4BFKA 3ZTNH 2KH2B 1GZPB 2WLYA 3V79C 4YHYC 2PR9A 1KIUB 1Q8MA 3LNHA 5DQDL 4OGYH 2XZQH 4EIUA 5DD6B 1UT2A 3ARRA 2JTYA 3ZX1A 4ODVL 5IMLA 1CI5A 1UEYA 4UQIM 4BZ1A 3MLPA 3U83A 4PBXA 1F00I 3PV6B 2GBUA 1W0YT 3NQKA 3QUXD 3OGOE 4ZXBC 3L3JB 3R7RA 3RWGB 1L7IH 2UWEE 5IQLA 4WSKA 3GINA 3ARGC 2ARWA 2VIRA 1R0AH 2VXUH 1BBDL 2ITCB 2K3HA 1KLGA 4P4KB 1MCRA 3AUWB 2CR3A 2CO3A 4WEBL 3TONA 4XPGH 5GGVY 1G7MA 1YEDB 3AY4A 3QUYD 1OCOB 2Y1VA 4ODWA 1UZ6E 5DD5H 3O2DA 2C26A 3WIHL 2P5WB 5I8EB 1W6LA 1II4E 1UD5A 3I2CL 4HSAC 3B2DC 1ND0A 3TFKD 1K85A 2EIZB 2APWA 4AZ8B 1A7OH 1YNLH 2J73A 2H1XA 2RACA 3GKZA 1GGBH 2Y5EA 4ICWA 3WNOA 4HXBL 4GKZB 3BRDA 2H2SC 1CICB 3WIAA 4TSBH 1NLDH 4QRSB 5F9DC 3S2AA 3LB6C 4DPBX 2UZIL 1T03L 1ZTXE 4JM4L 2QADB 3BSHA 3AZUA 1YMMD 3F7QA 4HCRL 4XN2A 1HHGA 4JCWA 1QYGL 1P4LB 2R2EB 1EHAA 4F9LA 2AMUA 4NKDA 4O02H 1NGYA 1SJHB 3AG1B 5F6IB 4ODSH 5FHAL 3H7LA 1FVEB 2DQDH 3ZW3A 3Q2LA 1EK3A 1F2QA 2YR3A 5C0DB 2XTJD 2FTAA 4XPFL 5EIQA 3QNYA 1LO3H 2W94A 3RY4A 4N25A 1KULA 3HI5H 1AHWA 1X5AA 1XIWD 3DJTA 4G8EB 1MFBH 1YEKH 1DJSA 3MV8A 3ROLA 3EYOA 1U4EA 4UNVA 1LE9A 2WK2A 2DQGL 3C6SA 3HUJE 4DCQB 3L81A 4C59B 4NKOA 3QZPA 1JRHI 3GBDA 3QORC 3WLWD 2ZSWB 4U1NA 4DGUA 3KJ4B 1M7XA 1DQKA 1MPAH 2Z64C 3HB3C 3LHAA 1GYVA 4AVIA 2NTSP 3V8OA 4OM1L 1JRHL 1J9TA 3TPUA 4D94A 1U93A 1NZRA 2Y2TA 4TTDD 1I9EA 3MODH 4NRXB 3B1UA 4E42A 2XQ0A 4UOZA 5L4JA 1RIUL 3AQDA 3FFOA 5DRWA 4P2QB 5IFAH 2EIMB 4OIBA 2OM5A 4DAGL 3CMGA 4M93C 2ALWA 4YXKH 4KX8A 4MJ5B 3RGVA 4I4WB 3NA9L 2DD8H 4AYFB 1YYLH 4FHBD 4PSPA 3FO2A 3RL2B 3C9NA 4I3SL 2C3WA 4QHMA 3VFOA 1OSPH 1XSOA 3LEYH 4LVEA 5KSBA 1ZEAH 3CHXA 2PXYB 4J12A 2BS9A 2PO6C 2AKRA 4NQSA 2GSIB 4OU3A 3E6HB 2W9EL 2QHRH 3J27A 4OR1A 4WUUB 2Z7WA 3VFVA 3J8F7 3NACH 4PJXE 4TSAL 4OKVB 1MRCH 3SDCC 1YJDL 1YNKL 3MXWH 1MCNA 2VSCA 2GJRA 4NKMB 1I1RA 4UDUB 5I66B 4N24A 1HE7A 1RJLB 2BY1A 3L16A 2PYEB 2EO9A 4KY1L 4U1HB 4KNQA 1JGEB 4K0OA 4PGBA 1C5DA 4LK4A 5I0XA 2OL3H 5GS1A 1MN4A 1ECYA 4Q89A 4LF3B 2Y1AA 2RD0A 4X99A 3P4NA 4QCIA 3MXVL 4PP1C 2ZX8A 4PVBA 1HIML 2K6WA 2ZNXA 4KRPB 1L6XA 5E6IA 3EJPA 3GO1L 2HVKA 3D3VA 2MQ0A 3QAZB 2LV4A 2V17H 2VR8A 5JO5B 5I6MA 5IB4B 1ZLWH 3MGTB 4BCZA 1F4AA 2Q2LA 3F7VA 1NDTA 3ZRSA 1NUFA 2DQEH 2EXYC 4MVBC 1YSOA 4AK2A 1DO5A 4XN5A 5F7MC 4F2ME 1FAIL 2H32B 4PJ8B 3U4AA 1UWXK 3IMUA 3AACA 4IRZA 2ZWYA 3WMPA 5AAWC 4U1LB 5L8JB 3PHOA 4GG6B 1SUHA 5E6SB 3IE9A 1L9SA 3FTWA 1UG9A 3MLTA 3PGDA 1K4DA 3MBEA 5EOCH 1FBIL 5H35A 3D50A 3VYPA 5F1IA 3UYRL 1HCVA 3MLWH 4M6NL 3X14B 1XH1A 3DUHA 2X9ZA 4B9CA 2QTVA 2Z4QA 2LU7A 5D1ZB 4BQ6A 1GYAA 1WQVT 1UH4A 4CADB 4DNLA 3B37A 1FIGH 2X28A 3LYRA 3VI4B 1COBA 4WI5A 5DS2A 3ZL4L 2NY2D 1KSRA 1CFMA 4MNGE 5AVSB 3MLXH 5J6HA 1AVAA 3EBAA 3PABA 4PJ5D 4XAKE 4FOMA 2FX7L 4AIZB 1RUAL 1UT9A 4XCNB 4ELDA 5K9JH 1SXCA 3KEHA 2DAVA 4OUUB 1ZTXL 3KPTA 3EH3B 1HQ4A 4WWKA 5EU4A 2ADIA 4Y1SA 2HUEA 2CQVA 3FU7A 1KZYA 2F5BH 2ZX6A 4MJJA 1MCWW 1N5YL 4ODWB 1HI6B 3FCGA 1U3HD 4KJPD 5T33H 4ACPA 2LQRA 1R24B 3KPPB 3C6LC 4HT1H 1XMEB 2AEWA 2N0KA 1AE6L 3AADB 4UAOC 1A66A 3QUGA 4ZW7A 2OBGA 4BELD 5CJQH 1ZHKA 4RNRB 1NCUA 4MAYD 5IQOA 4IRSA 4N2DA 4K3HA 3LS4L 5SWSD 3PDOA 5BOJA 5EF1A 4AQAA 3V0WH 4XNYL 1JN6A 2VMCA 4A6YL 1FHGA 2XRAL 3UTTE 5KSVA 4W9CC 4CMMB 4M03A 2E6QA 3DSFH 5DJZB 3K8KA 2A6KA 4KKCC 2VXTL 3PRZA 4AEIL 2WYTA 4P9ML 2GVYA 4JDEA 5IFHH 5AUMB 3FN9A 4P4RB 3SDAB 3I9GH 3MRLA 3DI2B 4H1LA 3LKSA 4PRHA 1B88A 1KBKA 3ZVVA 1F3RB 2FYYA 1JZHA 3JSSA 3QPKA 2HA1A 1MOEA 3EJCA 3GNML 3NCFB 2OS7A 1WZAA 1TQUA 1WS8A 4HBCL 4Y2DC 4R96B 5HI3D 1EERB 4PBVC 1JTPA 5H37A 1AHWB 1IGYB 5LO7A 1QRNB 4QT5A 1UXLA 2A1WL 1LE9B 4CU8A 1QWHA 2IXQB 2IADB 1Q4NX 1N67A 1D7FA 4Q6IA 4DZ8A 1T83C 5DUML 3BEVB 4RQQB 2QV4A 2A6JA 3GMLA 3TIEB 5ILTL 1AO7B 4WCYH 3ULAB 4NT6A 4Q8BA 2JCWA 2BNRA 4PJAA 5F7DB 1YHPA 5K9OA 1Q9KB 5EN3A 4KTDH 3EGSA 4B5EA 4G82A 2YD6A 1UCBL 2IAMC 4LHUA 2VJ0A 3BUBA 1I9JH 5DRWB 2A6IB 1S9WB 5BJTB 1XBDA 2IDFA 1HKFA 4PWFA 4QAMB 3RPBA 4AXWB 5J11C 3K81A 2XKSA 3QRGH 4KZEL 3BVVA 1WHPA 1BD2B 3HPLB 4XRCA 4E41D 4UYQA 4NWUL 5J6GB 2OMZA 3ULVL 4QHMB 2JSFA 1X5ZA 2YLHA 4BUGA 3U4BH 3ATFA 4HJSA 1MIMH 1UACH 1JYVA 1W2KT 5TQ0L 3D0LB 5K39B 3ZKMD 2E56A 2F1BA 3QIBC 3FAWA 4IBLT 3VFVB 4GB9A 4EF3A 1ADQA 3Q8BA 2F19H 4FG2A 3HZYA 4K3JL 4UTBL 5BS0D 2DM4A 2F6AA 1JWSA 4K9JA 1ULVA 2OMYA 1IT9L 2BK8A 4YL9A 2B39A 4AI7A 3I6KB 3ZU8A 4OD2B 1MJUH 4APQB 3CFKB 3EOAA 4QRFA 5KS9E 3R18A 1T5WB 1QMUA 4HWBH 1JXGA 2AJUL 2UZPA 5CS7A 3S37X 3N91A 4HS3A 5GS1B 4MDIB 4NEHB 1NC4B 3DVGA 1RSFA 1QLRB 2XWEA 3P4NB 3GTNA 2MMXA 3GKWH 4U6XA 3OVUB 2P3YA 4U33A 5E03A 5J56B 4O51B 3BUYB 2J5WA 1FZJB 2FBRA 3DGGA 1QUNB 2VERA 1DBKL 1E9QB 4HJ1A 5E9DA 4RGNB 4NN7B 3K46A 1U8MA 2Y07H 2OP4L 3QO1A 3EJZC 4KVCH 3VXMA 3EO9H 1MDAA 3OAUL 5B4MC 4OF5A 2FLRT 3X3GH 1E3XA 4Y1TA 2L7EA 3GLEA 1MCLA 1CK0H 4ONHA 4QJ3B 3WUWG 3ULUD 3QPXL 2HJKA 3KYMA 5DC9B 1FV1B 1IGFL 1KC5L 1V54B 4KK6D 2IANE 2F9BT 4X7TA 4EQ3A 3K2KA 4M3JA 4HLZH 4LCWA 1I3RA 4LLAA 4KPHH 2RBLA 3ESUF 3D4CA 3O6KH 1ZPUA 4PCKA 1K6QH 1AXSB 1A25A 1KUMA 3CZEA 1SEBB 1N7ML 3HFMH 2YPVA 5D72L 2WINB 3FU6A 3ZTJG 4L9DA 4IGBC 4WFGD 3HOGA 1WUZA 1ZJAA 2V3DA 2IWFA 1UKQA 3CZFB 3O81A 5IB1A 3CPLA 4HH9A 1I4FA 1E4HA 1GY2A 5CD3B 1CDBA 4G8AC 1FCGA 1YN6A 2DQ6A 3V5DA 4JFEB 5DMIL 1AS6A 5HYJD 1BF5A 4JDZB 3BDYH 2YBRA 3TN0D 2CHXA 4HK3N 2Y7MA 5FUOL 1CF8L 1NKRA 1TITA 2QMJA 4JZJB 2VO8A 4OQTA 1QRKA 4N2KA 4RSYA 5HTSA 1NOAA 1H3UA 1S3RA 3HG4A 3KJ6L 4XTRD 1HNFA 4M56A 4EUPB 4KDTC 4F3FA 5KVFH 2YKKA 1YEFH 3BKJL 4ONGL 3VWKB 4CJ0A 3JWOH 4E68A 3WFCH 4FAAB 4PY7A 2O72A 2FT7A 3QUZA 3DV6A 3QS3A 5DWPA 1MIEH 3ASWA 2AP2A 4ZODA 3NZHH 2CAKA 3LZFL 1XF5A 3MA7B 4ZDHB 4AQEB 1QEWA 5KANI 2A9MH 3PDOB 1V10A 2OMXA 4R4BA 4GO8A 4ILDA 3LSOB 1JZIA 2PWFA 2WAHA 4ZQTA 4A2MA 2VRAA 3DTXB 4PGCB 2P28B 4H5SA 5DQJB 2A6KB 3QDJB 3H9YA 2F53D 3D85D 3RY6A 3VJ6B 3WNPA 4S1QH 3QCTH 5GSVA 2APBA 4YBQC 3EUDA 1PD6A 1RUKH 2ICWI 4HVBA 4NERA 3U7WH 3B9DA 3VXSD 4AEFA 1PSKH 4WY7H 2FYYB 4PJDA 4YHOH 4KRMB 4MDRA 4B9PA 1LEIA 5LDUA 5IHWA 1X4ZA 4JRYB 2LLLA 2QJDA 4TQEL 4NUQA 5E6ZA 4Y4KC 1G7PB 5KYWA 5LG6A 3RTQA 5B38A 2BNQA 4K7FB 3BPNB 3G6JE 4UQAA 3MNZA 4LCCA 3ZKNC 1Q9OA 1KIRA 4F2FA 1YY8B 4ZFGL 1T2JA 1JS4A 3T0WA 4FADA 1H3WM 2UX6A 3I3DA 5JORB 2AV1B 2RH0A 2DS4A 4ODHH 3I84A 1VHPA 1TZIA 1X4YA 4PHZA 2FR4A 5TE7H 1BGXL 1I8IA 2P45B 4GSUA 3BP4B 3EYUL 3RP1A 3B5GA 2EDOA 5TD4A 3SPJA 3FB6B 3EF7A 3DX0A 3ZHFA 4PYGA 2E4FA 2ADJA 4OZFB 2MRYA 3BUTA 3QZNA 3QQ4B 2NYKA 3GBNH 3ZIMA 3N42B 4PJEF 3CDCA 3G5VB 5I73C 2GB2A 4R3SA 3K6SB 2W65A 4XP1L 5B39B 4AIXA 2QL1A 3K2UL 4L8BA 2F8XC 1NBYB 4HC1H 5AL0A 1Y18A 2EEAA 1I1AC 3ARVA 4CKVX 3BZEA 4D0BB 5FCSH 1TIUA 1NMBL 2CLRA 2VERN 5EU6D 3WKPA 3WNNA 1V3JA 4ZUVB 3CMOL 3R4DA 2ITDA 4X8CA 4YHIB 1WA1X 4J3OD 3S4SG 5EOQH 5B1CA 3ZE0F 1IAOA 2IC2A 3MRGA 3VYNA 1E9PA 1BVKB 1PL3A 2A9BA 3AGWA 3B9KD 4HX1A 3T0EE 1MCJA 3VRIB 4EKJA 2PWGA 3L4VA 1EJFA 5EV7A 1JWSB 2DMGA 3NSDA 3QJQB 4GO6B 4JFQB 4U4IA 3E7JA 2VLKB 4JQXA 1T6WA 3BD4A 5F3BB 1A6UH 3E2HC 4OCLC 4JFOA 5D70H 4CSSA 4KITB 5IF0A 4UQ2B 1E3ZA 1DQDH 3FH7A 4OZHF 1SQMA 3V52L 3W9EA 5KYYA 4M29A 4HS3B 4JFDE 5E99L 3NCEB 4ZFZA 4R2GD 3O8XA 3G6AA 3QUXC 4FP8L 4Y4FD 5TTRA 1HHHA 2QQNH 4O2FA 5E9DB 4NRYB 3L9EA 1E6OL 5B1JC 5FA3A 1HZHL 3L3OC 5J0BA 1INQA 1AYOA 5CFHA 3LEXA 3UADA 1DLFL 4FNLL 4E9TA 2NOYA 3UTSA 1TVDA 3GXTA 4G6KL 2QKIB 3KCPB 1JWUB 1KB5L 2QR0B 2B2XH 3NJLA 4N22A 4QOKA 3E3QE 5HYIA 4ONHB 3L5XL 1BFOA 3QUYC 1GL4B 4HMEA 1UWEH 2XTSA 4QHKJ 1MAJA 4WTWA 4MJIB 4KVNL 1QO3A 2BJMH 4DEPC 3GXUB 4X7TB 4RZKA 1F6AB 3TFKC 4WO0A 5T3XH 3B7YA 3TLRA 3EKCA 2HMIC 3EOTL 3LIZA 4G11A 2W07B 2QBWA 3BW9A 4NQUA 3ULUE 2H8PB 3B6SA 3A6CH 2E59A 3TBSB 5HYFA 5K9QI 1J0ZA 3OPZH 2LTQB 3LRSB 2WAQA 2AAVA 4AKQA 4E9YA 3FFCA 2ZXQA 2CBQA 3PP4L 4WO4D 4YHZH 2X6BA 2O5YL 5E2UH 1EAPA 4N6RA 4FFVC 3OMZA 5LAXA 1M3IA 1EEYA 2WXNA 2TRYA 2ZYHA 5CCKL 4U4BA 3WIFB 2XKUA 4U6VH 1XF1A 2PABA 4NUGH 3B8SA 1L0QA 2XTJC 4JFFE 5I6XB 2ZKWA 2AJVH 3VFGL 3NJHA 3LMJH 2ICEB 4QGYA 4NC2B 2YN3A 3LZOA 3SE4C 4XVTH 4JPWL 5ADOL 4FJYA 2H6PB 2BS8A 2XN9A 3VE0B 1RZJL 3WLWC 2UVEA 3ARFD 3O4OC 2OXGA 4JMNA 4YQXH 4AIEA 5IM7A 5KBPA 3IRPX 3T77B 4XPBL 3DIVA 5IQ7L 3QUZB 3ARBA 2DQUH 1F4YH 2NY4B 4JHZA 3IMRA 3SGJC 2OJEB 3W2DH 4NNPH 1UT1A 2R23A 2XNAB 1TTGA 3FC8A 4UQ9A 4XBMA 4F8QA 3L1FA 4NI3A 3QWRA 3QBTB 1XF4A 4XXDA 3H1ZA 3TXAA 3N41F 3H9SB 1KELH 4R4BB 4F7PB 4Y19D 2OMTA 1ZA6A 3SJVE 4NKIH 3RUGF 4Q9QL 4Z7UE 2R7EB 4ODUB 3A0OA 4UANA 1UOVA 2CDFA 1BZ7A 2HRHA 2J6WA 3PHAA 4JN2B 4LNRA 5IVNA 1SJVA 2X2YA 4XN4A 1D7BA 1BJ1J 1U3YA 1JFQL 1MCOL 2BW5A 3FULA 1HQRB 4YSAA 2AJYL 4OBSA 5I1GL 1V3MA 5FA4B 4M7LL 1FPTL 5DHVA 3P9MA 4G5ZL 5CLZA 3U46A 1KIRB 5IMOB 2JK5A 2XQYG 4KO9A 1LP9F 5KANG 4QXGL 1KGXA 5I6NA 3HHSB 1X9RA 3CX5K 4HK3J 4MA3A 4TVPD 3D18B 5C0AA 3WLBA 1DZ0A 1N3NA 4ZSOA 3GS4A 5JDSA 1KBWA 4XXWC 3ABZA 4GIAA 4F8PA 5CEYB 2HFFB 3HR6A 4Z7IA 1BBJB 2WXOA 5DFTA 5AZ2L 5I6KA 4XPHL 3WDHA 5KSAB 1XCQA 3PAVA 3MOBH 5DCCA 3ZUCA 3TF7C 3IKCA 3PS6A 1CQKA 5T5FH 2CHDA 5DT1H 1MKFA 2CRYA 4FCAA 3D39D 3LPGA 4L4VE 4R3SB 3VGFA 4QRRD 3VW3L 3HC0A 4OZIB 4GS7B 1JIBA 4UIKH 3BIKB 3WE1A 3B8YA 3GPSA 1R3JA 3VGDA 5E0QA 1IKFH 3FO0L 2X42A 3ETBF 5EH1A 3NPZB 2H26A 3NIFE 1KPRA 1C8QA 3CZKA 5LGYA 5FEBA 1LEKA 1LO2H 3UAJA 3ZE2F 1UOWA 4Y1AD 2XWJA 2J88H 1TXKA 4RWHA 2GTQA 2PMZA 4Z78B 5GS2D 3QXAA 5JLZA 3PWVB 4A2LA 1WLHA 4OJFL 3N40F 4AEHH 4OQ1A 5DFVD 5ETUB 1G0YR 2VR6A 1FL6A 1P1ZA 4LLDB 4JO3H 4DKEL 3ZSSA 4RISL 2X1OA 3CVHL 2NY1B 2Y5TA 2YEQA 2A9CA 3F2LA 3L45A 3UBFA 3DI3B 1UM5H 3B2VL 4KXCA 2O5ZL 3MRRB 3RWCB 3PJSA 1D5ZB 5GGQL 5CEXA 4CSPA 4WEMB 3B9EA 2X9XA 3MV7E 4FFZH 1ZANH 4XO3A 5CCJA 3TASA 3WEBA 1E4JA 1HK6A 3O6ML 4GG8A 3Q2WA 1BLNA 2WVTA 5ITFA 4EXKA 2Q10A 2C7UA 1A3LH 1DVFD 3NSFA 1ZKAA 2WQSA 5CWSA 4FDWA 3BHBA 3PWPD 4H8WH 1KCRL 2XUWA 3VSTA 4DZBA 4PVNA 3QRFM 4YHLL 1U3HC 4KJPC 2X70A 1FO0B 4JY5L 3DOIA 4ZPVB 5I1KL 4ZOCA 2IFFH 2P8LA 3T3PE 4OIIH 5JNYB 2R69L 1RZJC 2CUHA 4P2RE 5I1CL 4MAYC 4E2OA 1G7JA 1BF8A 4Z0XA 1UD4A 4PJ7F 5HVFB 4TLKA 4ENED 2HJFA 5ESVA 1NEZB 3MI6A 3PUCA 1T3FA 3LKNB 1JMXA 3OZLA 4B41A 2NDFA 4YPJA 3LDBB 1WVZA 5L9DH 2DMHA 2VC2H 3VXUB 3HS9A 1P7HL 1IGMH 2J8HA 2F54E 3SKMA 4QEGA 3RZCB 5BRZA 5CUSL 3BWAA 1W15A 1EGJH 3D30A 1NBVH 2XBDA 3DX2A 4HOXA 2KZWA 2HLEB 1V3KA 3KL0A 4G1MB 5HI3C 2OA9A 1ED3B 4HS8L 4NHCL 2IPKB 3WNMA 3MLSH 5FYKU 5BVJA 5EIIB 3GSRA 3IDUA 4Z77B 3VXQB 5IVXF 2W80C 3WFHA 2LU3A 2ZKHL 1J0IA 2PTTB 3H42H 1KBPA 4HKZB 1QBBA 2ADGB 4YBHA 1KFAH 1U8OB 3GRWA 3HZMB 3QUMB 4FABL 2XACC 2O5NA 4D9QD 4HG4K 2EVJA 4JX0A 4R83A 4PW4A 3U0PB 5JHDD 3V4PA 2PUQT 2VDRL 3QZWG 2HG5B 1GR7A 1HSAA 5AKTA 3VXOB 1VF5C 2ZXCA 4PREB 3UFIA 1UJ3C 2XQYK 4U2ZA 5D5MF 3JBG7 3VI3A 4B96A 4NQCB 4R0LA 2UVFA 2JKNA 2DWEB 1MFEH 4AM0A 4LSPL 3IMVA 4NXKA 4QHNA 3RYMA 3S6CA 2RALA 4PWGA 3X1NA 2FGWL 2YPLA 3T6VA 2J8UE 2Q9OA 1VFBA 3EBHA 1GIGH 5FIEA 5EEUA 2C3GA 1QW9A 1TZAA 4FMKA 4O9HL 3ZYOA 3GJFB 4HDIA 1BEXA 4YSSA 3BIBX 4JKWA 4MKTA 3T2PA 2VO5A 4DF9A 3ZKMC 4IQHA 3GT6A 3OB8A 4OV5A 3NIDF 4MA1B 4WNQA 1TJMA 1T89C 5FFLA 5AW2B 1FLRL 3U46B 1KYOK 1OQXA 3ESVF 3TBTA 2WC7A 4XCFH 1S9YB 2JVUA 2QGDA 2QHLA 1AS7A 1IU1A 2ZKYA 2PW1B 3RKPA 3NCBB 3OAZH 3NCCB 5MEQA 4ZTOL 3DRTA 3G9AB 3TVMD 1DN2A 5CNHA 5EFIA 2UXVA 1BQSA 4WQOA 3QIUB 1XCQB 3FT1A 4GLRI 2EIEA 2Y7QB 2L8AA 1XSJA 2OR9H 1CT8A 1S7RB 3MBXL 3ETSA 5I1HL 1AGBB 1Q0YH 3E3QC 4GP8B 1FHNA 4YLBA 2B1AH 3LRGA 1T2XA 4L3FA 2RMNA 3GMQA 1YMHA 3D34A 3QZOA 1I9IL 4X6BA 4M3HA 3Q8EA 3WJLC 1JNHA 1UVQA 2J4WH 3ESNA 3SSGA 4KXZI 1XXDC 3JTTA 1QEXA 1KY7A 1OAKL 3PE9A 1BZDA 1G7LA 4FG6D 4L0PB 4LIQH 4U3HA 3KXFD 3RNQB 5CM1A 1KTRL 3D39E 4XAWH 3ULUC 3SE3A 2D8KA 3HIZA 2XWJB 4UB0H 1JV2B 4NQVA 3BQUC 4KK6C 5ACLA 5F1SA 3B2UD 2AK1L 1T1ZB 1BVNT 2ZWNA 3O6LL 5ICXB 5JXEA 2YD2A 1HDMB 4BFJA 1DJIA 1GZQB 1LK2A 3PXLA 1Z3GH 5T3ZL 2OSLA 4Y5XB 1G7QB 1NGWB 1S7XA 1U92A 4D2NA 2DL2A 3LZPA 4R97B 3T4AB 5C97A 2Y5TB 4WI0B 5TF1H 5SV4A 2JI3A 4JG0L 4L8SB 4P3CL 5E94B 1BQHB 1UD2A 4LP4A 1MXGA 3MRJB 4PJIA 3QEQA 2CJUL 5DVLA 4FQXA 2G9HB 4R4FH 2WIMA 5FWQA 4ELMB 3RVVC 1QPPA 1LWHA 4Z7QE 3VQ2C 4YXLH 1W72A 3EF4A 3NCMA 4X6DF 4UTAA 5I30H 1CMOA 3VU2A 5GRVK 1JTOA 5C08B 3ESPA 3OD3A 4AMXA 3IU4H 3E6FA 1ID2A 1ZHNB 4AOFA 5F7YC 4F93B 4GXVL 5T1DH 4O02B 2VDML 4IKJA 1ZV5A 2O61A 3EOYG 1CFTA 5AVYB 5TE4L 3UJJL 1DBBH 4B9FA 4BA8A 5LCVA 5GZOD 5KBMA 5SX4I 3SE9L 2P8LB 3AT0A 4X0KB 4DQOH 1M56B 3VSQA 4AUJA 1BIIA 4P05A 3GHPA 2WQXA 2JNZA 3PWPE 4JG9A 4BFOA 3QFJD 4DIXA 1A47A 5KVGL 4HJGA 3ES6A 2AXHA 2WTRB 3VDCA 5DA4A 1ZHBA 2HB0A 1YO4A 3V9EA 1VA9A 5L88H 4GH7B 3CDZB 1GGUA 2HX9A 1CD1B 3ATDA 3PAUA 3VD9A 1NCAL 3CC5A 3BPCB 4NQDE 4PP2A 2EADA 3N06B 2B5IB 5CR1A 2J1XA 3BVXA 3UGEA 4YR6A 3BWAB 2BM3A 3CH1B 3PQYA 4JHVA 4MD5A 4UIMB 2NT1A 4I0PC 4RX4D 1G4MA 3BXNB 3CZUB 1SYSB 2ITFA 4BZ1L 4BSWB 2XCMC 3INOA 4X7FC 2OTUA 2AFNA 2W1NA 2I9TA 1LEGB 1VPOL 3CWGA 1KT2A 5BVJB 2AXFA 3R4RA 5I82A 2YK1L 3GLAA 4DETA 5H94A 3MCKB 1PYWA 3FUHA 3QIWA 3OKDA 1N0LB 3GSQA 4JE4B 4ZO8A 5JPMB 1ET5A 2YAEA 5FW8A 1D2OA 3QXDB 4J3TA 5FV1L 2VZOA 5LBSL 5J3HC 4K2UH 4AQZA 2JCCB 5GGVL 4ODTH 5C07B 1NEUA 3VXNB 4HFUL 2G3NA 1I3VA 2AQ2A 2VYRE 3MLUH 1KDIA 4YHPB 1A2YB 4EE2A 3O2DL 5F9JA 5KVDH 1N6QH 1UA7A 5EBLB 3LNFA 4UM9D 3HZKA 4P57B 3T1FB 5SWZB 4RAVB 5DTFB 4JKNA 3VXTB 1I1FA 2ZXDA 1LD9B 4D9QE 4NPYB 1AKJD 3DGCR 4GAGL 1JZDC 3GLDA 5JHDE 5DEGA 1U8HB 4PJFA 2PWDA 4MSWB 4IBUA 3P3RA 3FK3A 2OL3B 2XV2A 3IVKB 5HDOA 1IC7H 3OHXB 2HVJA 5F7FA 1FDLL 3OC8A 5FO7A 5B3SB 5EPMA 2J71A 1JXDA 4R90L 4XBGB 4J3OC 1PZ2A 2ROXA 5BOPA 1UZ6F 3L54A 2DZEA 3CVBA 1E27B 4NUJA 2W95A 3MRCA 5IW6B 5TPWH 3NSXA 3GJEB 1C1EL 3T04D 1P4IL 1RZ7H 2ZXEB 2VQ4A 1IBBA 2VR9A 3DHJA 3MREA 4P46B 3UPCA 3SDYL 3FZUD 3KHOA 4H40A 5ALCH 5I74C 1NFIA 3M17A 5EFIB 2E9BA 4NO5A 1BXAA 3KPRB 5EO9B 5F7KC 2V8MA 5EB9A 5HJBA 4F57L 1GZHC 2Q7AA 1BAFH 3QDGB 1HTYA 4R2GC 1KENH 3VGGA 1LQSR 1BZ9A 1I31A 3QCVH 3GK8L 1TPXB 1OARL 2YMTA 4OLYL 2C9UA 1YQ2A 4NWTH 4RETB 1ASPA 3UO1L 1CG9B 2E9WA 5L2KD 4QKTA 4J4PC 1BZOA 2VJ8A 3OKMB 1WWWX 2KPNA 4AMKL 5KYXB 4DKDC 3C5SA 1CJYA 4J8RA 3UXFA 1QSFA 4YGAB 4DK3A 4HIHA 2IDUA 4D3CH 2NUTA 3BJLA 4ORGB 2DQCL 4W4OC 4WI9A 4ZUWA 4W93A 5D1QE 1I3UA 1NFDB 2OMVB 4PJAE 2AI0L 5AYTA 1LE5B 4FEMA 3DSNB 4NHUA 5CP3A 4JZNA 2PP8A 2JKIS 3ZKSD 1DL7L 1C7TA 2H41A 2GJJA 2VB5A 2VLLB 4U1KB 3DMMB 5KJ7E 3BAYA 4WO4C 3OXRA 2C1PA 5LAPA 1TCRB 4FS0A 4YDKL 1UENA 4LDLB 4P49A 5DZJA 4QHKI 4C56B 5AW5B 1C5BH 1UWXH 4G3YH 2ZUQC 1XGZA 3K72A 3NTCL 4Y7MA 2YRBA 1CXIA 3HI6L 1M3JA 1Q9WB 5FYKD 3ATAA 3D9AL 3PJNA 3QW9A 1M6OA 4L3AA 2JKXA 3HE7A 1FNEA 3L17A 4ZTPH 4Z0BH 4QLRA 1UD8A 1SZNA 4PJXF 3FU9A 1P7QD 3WY3A 2BIHA 2HH0H 2VGLM 4FQQB 2VZSA 4L3EB 2WBJD 3ZOAA 2XX0A 4GW1B 3FO9A 4AYEC 4XPTH 4DHLA 3P1VA 4XH2B 4BDVA 3BISA 2YD0A 2JQZA 4OCYH 4V1DE 3WTUA 1ITCA 4MAUL 3T65A 4UMGA 5C09B 1BVLB 4XP5L 1KTBA 1SFDA 3Q7JA 1B9ZA 1CL7H 2JB6A 4IRZL 3VGAB 4AG4L 1AC0A 4YSOA 4N0UE 4CC4A 4LEEA 5BV7H 3IN2A 4W6WB 2ID5A 4JQVC 2DQJL 1ORSA 2Y3AA 4GW4A 1J48A 4PSRA 3TO4C 3PL6A 4XMLH 4LAQL 4DN3H 1B4TA 2KBGA 2J5LC 2N59A 4X5RA 2ODIA 4B27A 1NTDA 5F1KC 1IM3B 2DJSA 2BY2A 3QEHB 3C60B 4I3RL 3D87B 5IT2L 3VXME 1MH5B 2FBJH 3DVNA 3TPKA 1H5BC 1V3LA 1DVYA 3LD8C 1WWAX 5D7LB 4TVPH 3K6NA 4HFWA 3KYNA 3TZVC 5FGBC 5KW9H 1N19A 1SN0A 3BVDB 4NQXB 5D7HA 3SN6N 5ADPH 1YPZB 2P1YA 5AYUL 4HGWB 4TULL 1DQIA 25C8H 3VXPA 1OAYH 5HHOE 5T5NF 5CF3A 2NCEA 1F90L 1X6LA 1AMYA 3GXMA 3KPQB 4I18C 4NM4H 5DLML 1TVBA 3L5JA 3W0WB 4YSTA 4S0TD 1A4BA 4LB8A 5I8KH 2PLTA 3EAKA 4NGHL 2E7LA 4BZ2A 3BDXA 3VFMA 5MENB 3T3MB 2WVVB 4NZTH 4L4JA 4D9LH 2VSKB 5F7EL 1RJZA 3OLGA 2J12B 3I50H 4L48A 5C0BD 2G30A 2CUMA 2V5TA 1K3ZA 3FUMA 3IJEA 2Q3ZA 3GXDA 3WS3B 5C2BL 5D1XA 3MACH 2IWKA 4HA1A 4U1GC 3TV3H 1BA9A 4JFYA 2VDNB 1WFTA 5HVWA 4YDJA 4B9ZA 1WFUA 4MJ6A 1NBZA 3RL1B 5ITBH 3GSVA 2R4RH 3WBDA 2NY3B 3LQAL 3PF2A 4EN3A 1S7TB 2G5UA 5C2UB 1BFVL 2TAAA 5BCAA 4PTTB 5FO7B 2P24A 5INCA 4P8QA 3V9FA 1A14H 4BCYA 4YWGH 1MRDH 3I75B 2R29A 4Z3GA 1UH3A 5DYOA 4XZUA 3MLZH 1PIGA 3TA3C 4LSQH 3RIAK 5D93B 1TLMA 2NX5B 5KG9A 1YEHH 1I7ZB 4MASA 3CHOA 4TQPA 2K70A 1V7NL 3CSYB 3K3QA 4KY1H 2Z7UA 2P8MB 4OFYA 1B2YA 3G6DL 4UILL 5LNEA 1A64A 3M17B 4JO4H 3RLSA 3N2JA 1EJOH 1G9MC 1D9KB 1QUPA 4DP4X 4PY8J 5FB8B 5HGHA 3IJSA 3RNKA 5I18L 4GIPD 4EIZC 4IRJB 3DBXA 3VFUB 3U6XA 1J9CT 2EKSB 3CFBA 3QDMA 4P23D 5FOBA 3EXJA 1SMOA 5JQIB 1I7UA 5A40E 1VZIA 3BEWA 1KJ2A 2HJLB 3LKRB 2EEFA 3HC3L 4DGVH 1DE4B 1DVFC 2FHCA 2JI2A 2Q7YA 2BSCA 4YDLB 1AOZA 1KXVC 3D09A 5K5YA 2BSED 4AYDC 3HMXL 2WW8A 4M7LT 5D96C 5A16B 3PDDA 4XE5B 3RHWK 3ROOB 2BZDA 1RQ5A 2ZCKL 3CFEA 3MBWB 4M5ZH 5E5RB 3CNKA 4PU2A 3FN0L 1Z5LB 1E8WA 4H20H 5E8DL 5AOMA 2FZ3A 1J8HD 1MJJB 4V2BA 3TBWB 1Q1PA 1Y6KR 2F58L 3GWJA 2VLMD 4JPSA 4H8VA 3ARQA 4ETQB 1NPUA 1EXHA 3VD2A 1MREH 1PAZA 1KCVH 2CNZA 4OJEH 1OVZA 2V37A 2VL4A 2C1PB 3CSTA 3DUUA 4AW4A 1HSBA 5IEKB 2VDQH 2QQQA 4CDGC 3OWEA 3ARPA 2AK4A 4ZAKA 3QFDA 4L8DB 5MP6L 3B43A 2GEQA 3KPMA 1G7IA 3D06A 1E28A 1R5VB 3O4LD 4FI6A 4Y0GA 2E27H 4N2OA 1IIKA 3AQXA 5DQDH 4DVRH 5GZNC 4UNUA 2ATKA 3B1TA 4LARH 4PW3A 3BH9A 3T6WA 3ZMEA 2ZYSA 5HDRA 4ODVH 4F27A 3QI9A 3RFZB 3U1PA 4IBTA 2ZXGA 4DEWA 1XGUB 4DP2X 4RAUB 5IQNA 4TRPH 3D2UB 1OGAD 5FYKE 5HHQA 4YOKA 4C57C 1XH3A 3AROA 2NCMA 2BPBA 3ESMA 4IMKC 2DY2A 3T8XB 3LPWA 4K23H 2DBLH 4XHJC 3D12B 5KS9F 4P5RA 4DTGL 5IJDC 5JUEH 2GCYA 2DKMA 2WXJA 4RRPA 1EWHA 3IJYB 3E1F1 4EVNB 2W0FA 1F42A 3O3EB 2RAMA 5E6YA 1PCSA 2DIJA 1XGRB 4WEBH 3TNMB 1U8CA 4UT6L 3D0VB 2WSPA 3QP3A 1TF4A 1SOQA 3GXIA 3WIHH 3D07A 1U8PA 1F58L 2PTVA 3FCUB 2YPVL 3I2CH 4WU7A 4JM2B 1QBLH 1KCLA 4YUEH 1GSKA 3GM0A 3HE6A 5H4YA 3KDMB 4WI4A 4HXBH 1QACA 1TJIL 2VLRA 1BOGB 3DUSB 3OM3B 3VRLF 4I1PA 1QTYT 1J0JA 2IH8A 2BDNL 2YQ3A 2FH8A 4M61B 3DLQR 4NM8L 5DEZA 1T03H 2AVFA 3QJHA 2E46A 2WNKA 1HFUA 1D5IL 1OALA 1VKXB 1OCCB 1XMWA 4BE5A 2NSXA 2F2HA 3IYLW 5E8EA 1NAMA 2CRMA 4XCYB 5EZIL 4ZMQA 5DHYA 3BN9C 1R4XA 1NIFA 2JKWA 1L7TH 1XEDA 2OJZL 3CUPA 4LLYB 4PRBB 4OQTL 3WKYA 2W0PA 3TVMC 5LUMA 5M95B 4F7MB 4HOZA 3G9VA 2VLJE 5IROD 4ZUSB 2VAAB 2XV0A 5B8CA 1E67A 1SF5A 4HS6A 4NN6B 3SDXF 5LN8A 4JG1H 3KGSA 4EBQL 1RJZB 1DVZA 5FFGA 2VE6A 5DJ0B 1B0GA 4JHBA 5IBLD 4JRXD 2LVEA 2XFXB 5D1XB 2N7AA 1JGDB 3V2AR 5FUCC 1KV7A 4UBDD 1NOLA 1JRHH 4OM1H 2GJ6A 3BGFC 2XA8L 1MUJA 5C3TA 5D1QC 2IMNA 4FG6C 1KWKA 3NK3A 1GS8A 3IBEA 1HN1A 5DD3L 2ATPA 2FWOB 4I48A 4XT1C 4EUPG 1NM4A 3QR2A 5DFAA 3HG1D 5B7FA 3FQ2A 5JXAL 2XV6B 3GIZL 4FNSA 4G6FD 4Q0XL 1T4WA 4DAGH 1VFMA 3B2UC 2G4GA 1JSYA 5EDXA 1XGYL 1NOFA 3VVWA 4Y2LA 3F7YB 2IF7A 4EI5B 4N85A 1CE6B 3UZVA 1RMFL 4W9FC 4ZFFA 5I26A 5I1JL 1VENA 1FNGB 3L4ZA 4KNSA 3T0BA 1MHCA 4POZD 1BVOA 4QO1A 1IFRA 1CDUA 3FQ4A 3EHBD 1IAKA 1A1OA 1X5HA 2YD7A 1QSEB 1RJCA 3FONB 4I2XB 2DIEA 3FOLB 1MWAH 1MFMA 5BZWA 3H6AA 3V7AG 4LQFL 2YS4A 4MMYB 4XVUD 3QUKA 3B9VA 5GHWH 2DEYX 3NEXA 5F3HA 3UTQB 4IMLA 1YJDH 1YMMB 4LESA 4H1LG 1OPGL 3RIFK 2YC1B 1FNFA 4HCFA 3RVUD 2YFNA 4Y16A 3GS7A 1SHWA 4JY4A 4QWWD 2IWEA 3MV9D 1XZWA 3KLHD 1QFWI 3OC5A 4HAKA 4UM8B 5FW7A 2GAZA 3GMOB 3C08L 1ZOXA 3G6JF 1UZ8B 2O4EA 4S10A 2DDQH 1BWMA 2OCCB 3DIFB 3GSUA 4FF9A 1HH9B 1HHIA 4W68A 1J7VR 4BFRA 2I07A 1XIWB 1SLVA 2ZOWA 4M8RA 4P06A 3U1SH 1RAMA 2XZAL 4PRID 1F2XK 1UUSA 1HIMH 4BK5A 1PZSA 4LVOB 1RK7A 3O11B 4ZSOE 5FV2A 1JPSL 1H3GA 2IAAC 3GO1H 1H3TA 4KKBD 5DJCB 2DEXX 4OLWL 4OZFG 1PG7W 3GBML 1L4IA 3SCMA 1HOEA 4F15C 1JZ8A 2VR4A 4Z76A 1N64L 1Q0EA 1IQDA 4U6YA 1J8HE 2AK4B 2GK0A 1GC1H 3K4DA 3ASOB 2H4EA 3MOAL 3DROB 1J5DA 4XP4L 3ZZ1A 4PJ9D 2WLHA 3FF7A 4WW2C 4ATTA 2P7TB 1J5CA 3CSGA 3NYKA 5F1NB 2KI6A 3UYRH 3KAAA 1CXEA 1CVSC 2CH8A 4PWJA 2KL6A 1ZTMA 1MVUA 4K73A 1MG3C 3MV11 2V2XB 4OFIA 4TNVF 1C08A 1MCPH 1AQKH 4KX9A 5IKCB 3F04A 2QPEB 3QISA 4HETA 2AF2A 3BPOC 2XV3A 1CFSA 5C0CD 3ZL4H 2PCXA 3K80A 3OG6B 4LRIC 2GT9A 2Y6TE 5JXEC 4U7MA 3IBOA 5KYUA 3Q06A 1AZNA 2CK0H 3HRZA 3WE6B 5BMFL 4NLHA 2E3VA 4ZOEA 3U0TB 2VDOL 2DLHA 2R4SH 1JAEA 2YARA 2VZUA 3NPSC 3KR3H 1CDJA 1WEJH 4WFEE 1VGEH 1YQVH 2Q3AA 5GXBB 4I9XA 1B3JA 2YPKB 1KXQE 5I17A 3LXCA 3PXHA 4FRWA 3BP7B 1NINA 3DV4B 1G5GA 2OMUA 4MB5A 3ZMRA 2WMPB 3LS4H 2Z31A 4BH7A 4QRPB 2FD6L 1BF2A 2G2RB 1WIUA 4XNYH 3LNGA 2X6MA 4MXVE 4A6YH 1SHMA 2XRAH 5EORL 3LCYA 2GIXA 2A73A 1ZRUA 2QQLL 4GQPH 4LASL 4I87A 2KDYA 4PB9L 1RUPL 4N90D 2ESVE 1S3KH 1NAMB 5JHMA 2P43B 3SPHA 5BPPA 2K8QA 4ONFH 1RPQA 2OSXA 3RI5F 2BP0A 3FZUC 4EIGB 1RFDL 4PRNB 4MWFA 3ULUF 1PPIA 2FE0A 4B7LA 1F97A 2GITA 4L4TA 4U1MB 1FG2A 4UV4L 5A7BA 3GNMH 4RMWA 1NUGA 4JLRA 2Z8RA 4HBCH 5EEWA 1PJ9A 1WZKA 4QI3A 3W38A 1ROWA 3IU3A 3OKNB 3PPSA 2WN3A 1YVLA 4MMXB 1JHTB 1BLIA 4BQ8A 5GRJH 4PS7A 1FYTB 5DUMH 5H4ZA 5ISZA 1JD9A 5I1IL 5JQ6L 1C5CL 3BT2H 3S5LB 4AGMA 1IC4L 2NY2B 3EYVA 1IC5H 3JV6B 5IV2B 5JA9A 3DTUB 3JV0A 1MI5E 2X4RA 2ZE0A 3NZ8A 4KJQD 4PJ5B 2FJFB 4W9IC 1FL5A 4G8IA 5KBKA 5E2WH 1YYML 3QEUA 3F58L 4I48B 5FHBL 4K8RD 1UD3A 1QHOA 2VDKL 5EUKA 4N2BA 3BGAA 4R7NA 4FA6A 4G43B 4HXAH 4LGRB 4NI6A 4P4KD 4Z7NB 4NFDA 5C7XH 1AZCA 2FJSA 3B5HA 3DIDA 4PI2A 2CLZB 5ERWA 2BVEA 3L95A 2BZCA 1MAKA 4W9HC 3X1BA 1HESA 1KPVA 4NWUH 4RLDA 3RFRA 3MPCA 2P5WD 3ULVH 3HC4H 2YJQA 2WKLA 3ZDZB 4IS6B 4JQIA 1U3NA 4Y4HA 4F58L 3UTPE 4PLKC 2AAAA 4TOYL 5GIRA 1E90A 3VMOA 1XTMA 3WOVA 4Z7OB 5KJ4A 5TQ0H 1X7SA 2WCSA 4U1SA 5SWSB 3FCTA 2VSDA 2A74B 3EADA 5ESQA 3TH4T 1M1SA 4Z7UF 1XL4A 4UTBH 4FQLL 2GY5A 3W57A 4AH2B 4IKNA 1B2WL 2WQAA 2OQJA 1BZQK 4WV1C 2FEDD 1KBBA 3HN5A 4FNPA 3MGAA 2MKLC 1KPUA 5J13B 1TJHL 1UC6A 3S8GB 1PZ5B 1KDJA 4PJEA 32C2A 1ML0A 2AJUH 2UY6B 2XQBL 2VC2B 2V9UA 5CGTA 1RJYA 5T3ZH 3VG0L 2WBJC 3M7FB 1DQML 2HPTA 1FFPA 1U8KA 3VD5A 4NQEA 4WK2B 3ZHDA 1I3GL 2P5PA 4PD4K 1KGJA 2RGSA 1F5WA 3AU0A 4B6ZA 2BC4A 2OFQA 4FMFA 3SO3C 1UOLA 4BH8B 35C8H 3AREB 3B5TA 2FJUB 1XGQB 1Q9LA 1GS6X 3FQXB 4DKFL 3OAUH 3L6FB 4D0DB 3U6XS 3L48A 3T8VA 3NRPA 2D03L 4X6CB 4UINL 2DLIA 4LSSH 5KEZA 3LZNA 4MAZA 5I1EL 3QPXH 2VWEC 3GLZA 2QFRA 1CXHA 4QLWA 2R1YB 4XWGL 1L0PA 4P2QD 2HLFD 1IQDB 4U6YB 4C4UA 2WB1A 3I6GB 3OKOA 3TL5A 3STZB 3S36X 1OOAA 2ERJB 2HT3C 2GSGB 1NCNA 1KFGA 4FL4C 4OZHA 1N7MH 1EXUA 4RMBA 1P2CB 4XBPA 3QJFA 3EH4B 3NCYS 4KQ3L 2PXYD 1IGJA 1WAEA 5GISH 2ZJSL 4X4YA 3S5YA 3BWSA 4J3WA 4JN1L 2CKBA 2C4FU 1AJ7H 4OJDH 1OW0C 1UEMA 5C86A 2YQ2A 3FUIA 4BFBD 4WUUD 5ACMA 2GT9B 4FTDA 4P2OA 3NEEA 5DMIH 3O3DA 1IRAY 3EYFB 3ILPA 1MFAL 2R2HB 1FZKB 4J3OF 5F9WB 4KZDH 1DSFL 2V33A 5FUOH 5A7EA 1CF8H 3AQZA 3CN2A 4K4KA 4OJYA 4YLQT 1N59A 1OSZA 3PNRB 4I0KA 3B7UX 2PYED 3KJ6H 3PFUA 2YUXA 4B0MB 2C9XA 5L7XL 1BAWA 1RURL 3BKJH 5A6LA 4KOBA 5JW4N 3R8QA 5AL8A 3O6FB 1NA8A 3EYSL 1E5ZA 4ATWA 1I85C 1EHXA 3W81A 4OZ4B 2AZAA 4GXUN 4RZCB 2Q3XA 2DM2A 5HHMB 4EOWL 2MOGA 4KRPD 4HOWA 4GKSB 1MJ7L 3QS2A 2R1XA 2Z31B 4UDTA 3FCSA 4KO7A 4JDVA 1X7QB 1CBJA 5MHSD 3WGVB 4ZX4A 4WTXA 3KPSB 2L4OA 4QYAA 1EPFA 3MRMB 1JHLL 4DK5A 3TCTA 3T3PF 4CILA 2EXSA 4ZNCD 4QXTB 2CXKA 1JZEA 3LQMA 4GRLB 3KPLA 4Q14A 3WTXA 1ZT1A 3LRHA 4BSVB 3IGUA 5C9JB 1HINL 1A1MA 4G8GB 3U4EA 1NEZG 4OD3L 1GHFH 3PV7A 1ZXKA 3P77A 5E23A 1R47A 5INDB 1OGTB 2D31A 1Q94B 2Y0SA 4N90E 4OF7A 5IR1A 5EUOE 2CGRH 3FUDA 5HI4C 4BWWA 5ID0A 2X4UA 4FYRA 1IKNC 1N2RA 1TQVA 5D1ZD 4L5FH 5C6TH 3N3EA 4C54A 3FJTA 5D6DC 1J18A 3QG6A 3WJJC 2C1OB 4KMTL 4RDQG 1ZPLA 4PR5A 3W82A 4MZIA 3V4PL 3O3AB 1DZBA 1JK9B 5D7JA 4FQJL 4FQ1H 4ZOAA 1BGXH 5D2NA 2AJXH 2LVCA 3RPIA 4N0CD 1S4IA 2XWXA 2A0LD 2YWYA 4LOEA 5IQMA 4RESB 3TCLB 5EIIG 3QEUB 3Q5TA 3QULB 2L3BA 1F86A 3N9GL 1ZWIA 3RUGA 3KLDA 3HLAB 4NO0A 4N1EA 4EJ1C 3WNLA 4XP1H 1DLHA 3CZJA 1E30A 1QLEH 5JW3L 5DEJA 1PVHA 5FM5M 1RVFH 5FM5O 3L1OL 5DWUH 4OLVL 4F1ZA 4XMTA 4KKAC 3TEWA 3KWXA 2OR8A 4C83B 5IY5B 4CW1A 2EDYA 2BMKB 1A4AA 1LP9A 3P0VL 3DXAA 4HV8B 2DYPA 3QC6X 3G5WA 3RX8A 5FCUH 1U8NA 4X80L 1IIIA 2J8UF 1HKLL 4QTHB 3WO4B 4ALAH 2OW6A 4JREB 1UATA 1ZVHA 4Z1PA 4ZO6A 2F53B 3CN0A 3IM1A 3RE0A 2C9VA 1U8LA 4XNDA 2JJWA 3IDNA 1EDYA 1JP5A 1MCHA 3GMMA 3SDAD 4EDXA 4K5PA 4QIRA 5T1MA 3LKOB 4YSPA 4PRAA 3VACA 3VXSB 3V52H 2XY2A 3PU7A 1ZLDA 4C4KO 4AC2A 3ZZSA 5AENA 5E99H 5IJVA 3GZPA 1QFPA 5GS0L 1B0RA 1U91B 2NSQA 3LKQA 1IARB 2XXCB 4FP8H 5H2BA 1WTLA 1A3QA 1CIUA 3F84A 4JGUA 2LLNA 3RWFB 5I1LA 4MLSA 2P5EB 1F4HA 1L9NA 1RHFA 3GSNA 1HZHH 2X4OB 1AO7D 3RWIA 1F4XH 2BIIA 4FNLH 3NP3A 4ZXBA 5BJTA 1O5DT 1PZ3A 1KB5H 4DP9X 3GHEH 3RX7A 4WU5B 3ARGA 3L5XH 5D6CB 4D9RD 3UBGA 4KVNH 4RFOH 2H1PL 1UKSA 4URTB 2ENJA 5TH2B 1JNLH 3OKOB 2C3HA 3QDAA 3VA6A 3CLFL 1UB5B 2Z1KA 4PJGB 1EXUB 4LEXH 3AXHA 1HC1A 3A23A 3IDXL 1QSFE 4P2QE 4OI9A 1JWMA 2AXGB 2CBPA 4NBXB 1MCFA 3X11A 3WXWL 1O9WA 4G8FA 2AQNA 1O0VA 2GABA 3T6ZA 4IIQB 2P42B 3OKLA 4P2OB 3P11H 2EC8A 3O0RH 5CCKH 1ROCA 2KQMA 3B9KB 2KHAA 5IROC 2NUPA 3QA3A 3IJHA 1GPOH 3RY5A 3VFGH 3GUFA 3SQBB 3M1BB 2X2IA 4TPRL 5F44A 4LLMA 4JRWA 4APQD 3M7OA 1UXSB 4HHAA 2Y24A 5LCVL 4WUUE 3VA2C 2A77L 1VACA 1RK0A 4LLVB 5IBLC 3RDTB 3MA9H 1T2QL 2PKDA 1NC4D 3CSFA 4KDWA 4Z7QF 4X7CC 1TG8A 5IQ7H 1N0XL 3GDCA 4X2UA 1PBYA 4XCCL 1JV5A 1A6AB 3IGAB 4PJ7A 3QZBA 4Y4FB 3QORA 4YGVB 1UM4L 2O5XL 2KC0A 4ACTA 4RGND 3FSVA 2YSSB 2X2JA 1OB1B 1TMQA 3EO0A 5E6ID 3D3VD 3S34L 4JFVA 3DJ9A 1RL1A 4DP5X 4JDVB 3HLKA 1CBVL 2Y36H 1ZT4B 3NIGE 3VX0A 1G6RA 4WJ5A 2DJUA 1JF5A 2JF1A 3TTSA 4ISVB 1T7ZA 3F12B 1IQWL 1HHKB 4PHXA 4K5NA 4O00A 3MFFA 5IVZB 1OAXL 4LPCA 4Q9QH 1SYVA 3ZKQD 5DUPH 1PJWA 1T20A 4KBPA 1AQMA 4POZC 3VWJB 4KDVA 4R4NC 5HXMA 1U8QA 2XWBB 3EHBC 4KMQA 4Y8AA 5MHSE 3MBED 4BEIA 4A7QA 1DUYB 4GEIA 3ZSTA 1D5RA 4PRPA 2YUWA 5GGTA 1RULH 4XVUC 5IVXA 5DMJB 4MDJB 4PJBB 4M7LH 1FPTH 2CM5A 2PO6A 1VCBC 4FQHB 5FKAA 2XWTB 4CNIB 4OCSH 1SPDA 4IW4C 4G7VL 5HJDA 4GG6E 1UXMA 1VESA 3RVUC 4GQ9H 2V3FA 3UPAA 4QWWC 4EAEA 2BOCB 3KLHC 2CE6A 2P9RA 3MCLL 4FXKC 4NCDA 1CLVA 1NGZB 3QNFA 5D5MA 3SDCA 4G6JH 4NYLB 2Z65C 2NYZA 3REWB 3K71B 4WHTA 4M5TA 4WHCA 3JTSA 2DICA 2G3MA 4PFEA 1D6EB 1BFTA 1N10A 3NMEA 4G9DB 5KN5A 4FYTA 1BECA 4WWID 1ZA3A 3MR9B 3VW3H 2HKFH 5I15L 1M2OA 4ERSH 4F7EB 4RH4A 3ARFB 4KKBC 4XCEA 3K4AA 1FSKC 1NLBH 3FO0H 3V6BR 1D5MA 4X9BA 3DYPA 1VADA 5E2VL 3BZ4B 4NO3A 2OXHB 2XX1A 1SN2A 4L8CB 4LPVA 1ZVSA 5ALBL 5BW7C 1FVDA 4YSDA 4ZQKA 1BXXA 2ARJB 2HZHA 4IRSD 4IOFD 4JPIA 3SPGA 3NH7H 3WAJA 1NWPA 4JJ5B 1HHJB 1OXYA 4IDJH 4OJFH 3FQ1A 1G7HB 1Q1JH 4FTVA 4RDBA 2I27N 3T1WA 4Y19B 4PJ9C 1C12B 2A6DA 4GNKB 5AAWA 2YD8A 4WLCA 1AP2A 4DKEH 2QLYA 4RISH 1AG0A 3F6LA 3BSZA 5BV7B 4PIRF 3BESR 4BRVA 4HPOH 4PRHD 3TU6A 1UWGH 4L37A 2IH3A 3AW5A 2CWRA 1FORH 1DQQB 2CMRL 2O5ZH 4HZAA 4TLTA 4UT7L 3UIZA 4YHYB 3HS0B 4QRTB 2I9LB 5GGQH 4J1UB 2E7CA 3WHE0 4C8XA 4G9FA 4KHTH 5DDHB 3IPBA 3OPUA 1T80A 2UY7A 4FG0A 4ZUUA 4WI8A 4CUCA 3O6MH 5JPNA 1B6DA 4XC3L 2Y06L 2IQ9H 1WGVA 3JWNG 4A2FA 5IOPA 4HJJH 2F7QA 4UU9A 4IBVA 2BNUB 5AOKA 3A21A 2BNRD 3EJYC 1HYSC 3GBLA 4W9GC 4ZOBA 2VSMB 5I6PA 4DW2H 5IZ7A 4HCRA 1NANI 1QRNE 2XIIA 1MCSA 2DWYA 4OAWB 1FNAA 4DVBB 5CD5D 2WOBA 2VISA 2HTKD 2MTAA 3QDME 4MKMA 4YHLH 1TETL 4ZPTB 5I1KH 4QHLA 3N1QC 5JW4R 3CFTA 4R9HA 5DZNA 5AB2A 4QRRB 4LVHB 3SGDI 1U95B 3UBXA 5CCHE 5I1CH 2MQ3A 2V2WA 4PJCB 1NC2A 2VR5A 1VSCA 1EUTA 5D4QA 2GTWB 1FZMB 5CMAB 3L7FA 1JWMB 4LCIL 2EO1A 3FU0A 1ODUA 3BWZA 4Y1AB 1BD2E 4X6DA 2F1AA 2Q8AL 5JMRA 3V0JA 1JPST 1S7SA 2OYKA 1FH5L 4I77L 4N8VA 2G3ZA 3OKLB 4PGDA 2VDPB 5DD0L 4EZJA 3QWNA 2PP9A 3WKML 5TDOA 5KVEE 4W9ZA 2MWCA 4N2LA 1RHHB 1FVCB 4NCC1 4F33A 2DI9A 1RUMH 2VLKD 2ZAHA 5K1JA 5ID1A 1JGLL 1MWOA 2FX8L 4ADIA 1RK0B 43CAB 5GRXG 2Q76A 1RZQA 4Y2DA 4O5LL 3FSZA 2WIIB 2X7LB 5DI8A 1S78D 4K8RH 2AEPL 2E47A 3KGRA 3K7UA 4KJQC 2XPYA 4M62H 4HUWA 5IIEB 2R9HD 5JOEA 3KWTA 1KJMB 5E9DD 4U1JB 2VDRH 3DX6A 4KOCA 7CGTA 4K8RC 1DN0A 1PF3A 3SDDB 3HAEA 1TOXA 1H15B 4P4KC 1WWBX 1ZHLA 5AVVB 2CDGB 2GTZB 2IAMA 4YPGB 2DQHH 2IQAA 2KLTA 4HPYH 4A68A 4Y5VB 1OF2A 1RZKL 4YFLF 4MJID 4M93B 4OGZA 4PGJA 4O9HH 3BH8A 3FBQA 2A2QT 4EQ2A 2GYSA 5C0IB 2X0UA 1PKOA 1O9ZA 4HIEA 2XG5A 2YEZB 4G80A 1CICC 2WO3B 3L3KA 4Y9GA 4K94H 3RZWA 4WI6A 5EZLA 3SKJH 3TX4A 3AGVA 1I9RL 2J6EL 5FKAB 1SDYA 4OLUL 3H56A 1OHZA 2QADC 1FLRH 3T5WA 1QA9A 2W9LA 3B3IA 4BK8A 4ZMTA 5C0JB 3WL9A 2MQGA 3QIBA 3NCYP 3T0VA 3A5VA 5F6IC 2FEDC 3FTGA 2BWDA 1CFQA 2VLRE 2Z91A 1WHOA 3FHEA 3CDYA 1FNSL 4NENA 4ZTOH 1EA9C 1WZ1L 2FLBT 3CK0L 5HJGA 2DYRB 3WHXB 4DPRA 4NDMB 3CFDA 5FDWB 4HHWA 1UM6L 3NFPB 2VDQB 1VEPA 3REVB 2ZPKH 5E8NB 2HT4D 2JELH 5I1HH 5IW1A 2RB8A 1VFAB 2E74C 1A4KA 4HH8A 4WW2F 1JUFB 1R3HB 5GGSA 5EF2A 2FQEA 1JPFA 4JFEE 3I9AA 2QFPA 2IJ0C 3IDMA 4GW5B 5GGSY 2FEJA 3C5ZB 3KJ4C 4Z3JA 2R8SL 4I3GA 3QUZD 1W8EA 4EZLA 2NY4D 4FZEL 1CO1A 1O7SA 2R29L 2V6HA 3VFWA 5FECA 2JE8A 3PDGA 1USZA 1ZVSB 2NZ9D 4HEME 4XNUL 1TCMA 3MHZA 4E5XB 3QJVB 4KXZH 2ATAA 5FF6B 4HMCA 4H8UA 2Z7ZA 2HLFC 3H9SD 5GGRB 1MQKH 1NDGB 3Q6FA 3UABA 1ACZA 2AK1H 3N44B 2EP6A 3O6LH 4QPEA 4WI2A 2X4PA 1NGXB 2IBZY 1NCBL 2LU4A 3ZR5A 1HXMB 4TS6A 3KBFA 2GJ6E 1HH6B 2WLMA 2XVBA 2ALAA 3D05A 4FD0A 2PCFA 1NMAH 4FHJA 4JFXB 4X5WB 4ETYA 3W39A 3PWJB 1Q0XL 3BP6B 3CVIL 5AKSA 3WTWA 5EU7C 4LCUA 1BQ5A 1DANT 1PLAA 2OX5A 2PXYC 3F01A 3AC0A 1DQVA 2VXVL 3E8UL 4JG0H 2CJUH 2GJZA 3QDJE 4OZGB 3L1GA 1R3KB 2E6PA 4IGBA 2NLJA 3V55A 3RTQD 3S37H 3LVEA 2EKJA 5HGBB 4GO9A 2DWDB 3EYQC 4ZUUB 1ESOA 5JPNB 2WBKA 4QYOB 3FO1A 3U6RA 4XO5A 3COOA 4K3EL 4HIXL 3L5WA 4JRYE 1A9EA 4FNTA 5JZ7D 2KLSA 4ABVA 1J5OL 3SOBL 1ET8A 2LFEA 1I53A 1MW3A 4CU6A 5KSAD 2VDMH 3IXAB 1Y07A 1HAWA 2CSPA 4R84A 3TBVB 2OR7A 1IBGL 4JMXA 5B7MA 3DX9A 1PX4A 4KDTA 5HHVH 3SE9H 1TSHA 1OZUA 3EFFB 3TT1L 4AQ8C 5KVEL 5CBEB 4KRPC 4CRPA 5JR1H 5KVGH 2NY7H 3QAZC 2V2WB 3S36L 1IEBA 5SX4H 3U1QA 1PDKB 5DC4B 5ESAB 1HXKA 1LO5A 5I16A 4TVUA 1BG9A 1KCUL 1H9DA 3C8DA 3L7EA 1NCAH 2GHZA 5J1AB 4PJ8C 1INDL 1JG9A 1LWJA 5LGHL 1A1NA 2Y69B 4NP4H 1WBYB 2ZF8A 3VXRB 4F5CA 4JE0A 4QRUB 2EYSA 2EUVA 5EN2A 4D8PA 3OWRA 3P2BA 3RWEB 2WP3O 4HJEA 2WZ6A 4O2CA 3CXDL 4PJXA 5C0ND 3TBYA 4ZMZA 1UA3A 1EVTC 5DJ6A 4BZ1H 3MNVA 2VR3A 1RZKC 2Z0BA 3TFBA 3UMNA 4R7DA 4JO1H 4GAJH 3OMIB 4YSEA 3HVNA 5D1ZC 3MRPB 3ARDB 1PQZB 4TLUA 5FDYA 3NGBB 1XQ4A 3GIVB 4Y4KA 1TQBC 4XX1G 1NIEA 3O8XD 4M1GL 3HMWH 1AI1L 5GGVH 5I19L 1RZ8B 5TF0A 2A0LC 4M6ML 1NBQA 2OTPA 2X40A 1NCWL 2BFVH 1V5JA 1J88A 3F8UB 3IETA 1RU9H 1XR8B 4HKJA 2B0SL 5D8JH 4CVZA 1N12A 3IEAA 4NNXB 2N0MA 3AT8A 1ZLVK 1ZHLB 2YGNA 3UTSD 1OAJA 2OTWB 2F08A 4QOKD 1E4XI 3FNKA 1J1PH 1P53A 4AK1A 1URLA 1EHNA 4NUPA 3RX9A 1AD0B 4F2MA 1DQJA 5PCYA 1NBCA 2AJ3A 2VXQA 5FC9A 3H2PA 2ITEA 5E70A 1EHLL 3HKZA 3VFSA 3FQRB 3QFJB 1FDLH 4QHPA 1I1AA 5FO8A 1K4CB 3IF1A 2NY5H 4OCRH 4S0SD 4MJIE 3FT4A 3RVWD 1G9NC 1O7DE 2V2TA 2F8VA 1U58A 1QA9B 2XIBA 5DSCB 3WL9B 4PBWD 2L7UA 4Y5YA 3FTGB 4NJAH 3DURA 3SDAC 4TNFA 2IALA 4NENB 4A7TA 2CUIA 3RZCD 3KYOA 2YIHA 3RBGA 3WS6C 1A4JB 4YDVA 2CIKA 1XCWA 3MJ7B 2CDEA 3NDZE 4MNGA 2IMMA 3QUMH 4F57H 2A83A 1FA4A 5IOKA 3OKKB 2OCFD 2VZTA 2IGFH 2IVFC 4FXGB 4KAQL 1U4FA 2RCSH 2UWEB 5IW1B 1G87A 2NYYC 2XN9D 4YHKL 4I5BB 3EOBA 1CLYL 1AGDA 3KM2A 4AKPA 1ZGLA 4ZMYA 1YEIL 2DI7A 1GGCH 5CHNB 3UO1H 1A6WL 1A6ZA 4UUJA 3QJSB 3QUXA 3P4OB 1J8KA 3DX1A 3QH3A 2GEEA 1EEQA 4X83A 4XNQB 1JK8B 2D0HA 5G5DB 1T7XA 5B1JA 4UQ3A 3Q9QA 3H9HB 1NKGA 2EE0A 3L3OA 4KVPA 3S3DB 3FB5B 4RWYL 2CM6A 2PCPA 5TE6L 4UM9B 2X4PB 5ABAA 5IVOA 1KTKE 3O45B 4NO2B 2EDLA 3IFPA 2NY6B 4RMQA 2AI0H 3HG2A 4QKXB 2ZXBA 3W39B 5TDPA 5C3IA 1B3IA 1GH7A 3LQZB 2YGVA 2RIKA 2ZX5A 4LCUB 4GXFA 4K3GA 1L5GB 1QVOA 2OX5B 2ZP0T 5IWLC 4U6HB 1MFNA 3N43B 1KG0B 1KTLB 1S7UA 2WO4A 4MNQE 4YO0B 3QQDB 2Q1EA 2X89D 1SLWA 3H0TA 3NJJA 4KNTA 2F0CA 3ZTCC 3ZDYB 1CD9B 1BEYH 2LGNA 5L4IA 3NTCH 3NVQA 3MJ9L 3TJEH 4WKZA 2JJVA 2QPUA 5HHPB 3W56A 3D9AH 4X6FA 3CCHA 3U6RB 1M7IA 2KUTA 5C0AD 4GRMB 3HUJB 3N1FC 3W1ZA 2ENQA 2HN7B 1YUKB 2HFEB 4KZCA 4APQC 4A6YB 5IG7A 4M5SA 4RIRA 3BAEL 1TUPA 3CBJB 3FBKA 4X8GA 3P3UA 3MGOA 2E7DA 3MUGB 3QIUD 5GS1C 3UDWC 1TZHA 3MYJA 4P5KA 4GMTL 3SE4A 4JDTL 1IGIH 2Z35B 5T1LA 3MJ8A 3TS8A 3ML8A 5A2FA 2R2CA 2WZ5A 1T21B 5FYLE 3NZUA 4RGNC 4JFHE 4AW7A 2J1ZA 5EOCJ 2R1WB 1KLUB 3F7RA 4KTEL 4XP5H 1KGIA 4DGYL 4AG4H 4IRZH 1KBVA 2YAOA 1A22B 1Z32X 2BS71 1P84K 4FQIL 2E9GA 3SGJA 4DUWA 5L0QB 2M26A 5IMMA 1MHEA 1XT5A 3OJDB 3R0MA 3UAJD 2WWOA 3QJRB 2AQ3A 3E9UA 2BP5M 1A1NB 4HK0A 5GGUB 3IFOA 4KUZH 4TUOB 1RK1B 5EZOL 4JAMA 1VJSA 1UB6B 2B16A 4FZ8L 1NAKL 3ZYJA 2WCGA 3TT3L 5DQ9A 1I8MA 4I3RH 1GOGA 2VABB 4KQ4L 1AQDA 3N1MC 2G5BB 2PW2B 4FFYL 3ABKB 3QO0A 2WWMC 1X5JA 3BKCL 2CIIA 3C2AL 3JVFC 3SYPA 4TUJB 2WLIB 2APXA 3H4FA 4X8JB 1MF2H 5DJYA 4Y4KB 5KS9A 2C3VA 4WK4B 3T4YB 3MRIA 4JO5A 5E2TH 4LL4A 2CLVA 1A6TA 5D7KD 4B3VA 5EO1B 4YDIL 5DLMH 4IBWA 4OZHE 3CHPA 4HKBB 1MFCL 4OB5L 4IKLA 4LLWB 5F0JB 2X2HA 5DZ9A 5I0ZA 2BO0A 2MEJB 5TQ2H 4AJVA 4P5MB 1XCTA 4LMQE 3Q9PA 2IH1A 4JZJC 5C08D 2EYRA 3PWLA 4XXWA 1QSZA 5F7EH 5D7IB 3SB3A 2BVPA 1VB9A 3U9PH 1KYFA 5K9KA 3NCWA 5CZKA 3NCJH 4KK5C 4LP5A 1P7QB 1KCSH 4PAZA 5C2BH 1BDYA 4A7UA 2D7TL 2Q2EB 3G04B 3VWKC 2JXMA 3VSVA 2NW2B 4Z5RA 4PMEA 5EU5B 5EC1A 5BO1L 3VYOA 3ZO0A 2X38A 2FT6A 4RRPG 1JZ7A 1NJ9B 3X13A 2BIMA 4N9GB 3FB8A 4IOIA 3BT0A 1A3RL 2QGBA 3LQAH 5HHXL 2DBJA 1CU4H 2FATL 1BFVH 1DDHA 1X5FA 5G2NA 2YOAA 2Z92A 4ZUTA 3SKOA 1T0MB 5BVPL 4H1LH 5I1AA 3GSWA 4JB9L 2DQFA 3D6GA 3CPUA 5AVQB 3ME0A 3QJTB 1EQWA 2AQQA 4O4YH 4Y5YB 3SDXA 5H37H 1MCDA 3G6DH 5BZZA 2Z9TA 4CVXB 1L6PA 2VAJA 1LMIA 1P5UB 2VM3A 3H85A 3OQ3B 1X5XA 3U9UA 2RQEA 3VXUE 5J5EA 5IFJB 3EGXB 3BPNC 4C4KT 4TF4A 4DPCX 2HAZA 3F7KA 2WPGA 5DJ8A 1KBGL 5KJRH 3HC3H 2LLGA 4LCYB 4BUHA 1LO4H 3RVTD 4M8QB 1J9QA 4F80A 1T5XB 4HUXB 3ARSA 2DLGA 3QWQB 4A2EA 4HUVA 5C07D 5CD5C 4N0FB 5AYQA 1FZOA 3LPPA 3MRBB 4KGJA 3DX3A 2YSTA 2BVYA 4MQ7A 5F7HA 1H0DB 2WNXA 3RIKA 4GP5B 5MEOB 4XI5D 1N5AA 3MO1B 4HSCX 3S5LG 4CU7A 2EH7L 4JKKA 1MFVA 3QG7H 5C0BB 4JQIL 4DUXA 2FB4L 1Z9OA 1J05A 1U3HA 4J28A 3VAEA 5I9QC 1N6VA 2YPLD 2IBZX 3UTTB 4AL8L 1YEGL 5HVHB 3UACA 5CGMA 2WYHA 4YBLB 3AB0B 5D2LB 3HKFA 5B1BB 1ADQH 1SXAA 4WDIB 1OAQL 2ZSVB 4MAYA 4NQCE 4ZS7L 2DWTA 3RUGE 2BCKA 1MG2C 2BWIA 4BFIA 1S7WB 1MHPL 3T2NH 1P6WA 1T1WA 5FYLL 2FSDA 4KKPA 2ZKXA 3ET9F 3S97C 2XICA 1A5FL 2BVTA 2WD0A 2F7RA 1EMTH 3G6JA 1ZSDB 2CKNA 3TYFB 3VGEA 4MCNA 4RFNC 5HYEA 2NDGA 1F3DH 2HX7A 1ZVNA 2GI0A 2UUDK 3WV0A 3F6IA 1ZXQA 2SODB 1A6PA 2X6CA 4HEPA 3QDGD 3WIIH 1URZA 2PN5A 4KKQA 4R7XA 1S5HB 1EGJA 4KROB 3W11C 1CFNA 3MRHA 4P23B 3HNTL 4M43H 5CILL 2R9HC 2ICWB 1CGSL 2C7FA 1F3JB 1WIPA 2FJHA 5ENWA 5FK9B 2EABA 2K6YA 4DTGH 3FN3A 1ZS8B 1FCCA 5GS0D 4OFQA 4PJHF 2HUHA 1OE3A 5EBWA 2O6EA 2BSTB 4GBXB 3KLKA 1AY1L 1TU2B 3L9RB 4HF5H 4N28A 2QKIC 1XR9A 2Y1ZA 3DO7A 3SE8L 2NTFA 3VD7A 1UJ3A 3ABLB 1F58H 4JAMB 2LABA 3GXNA 1A7PH 5C0EB 3MSPA 4F7TB 1EO5A 5JXED 3GEFA 2BCMA 3Q01A 3X17A 4E41A 1E9OB 4LL9A 4ODXA 4U1IA 1RZFL 3RBSA 3TWCL 1PD0A 2CKBL 2BDNH 1RLBA 3P2DA 3UGUA 2EC9T 4PV9A 2A4CA 1PX3A 2VW6A 4S2SB 2LTQC 2XT1B 1D5IH 5F7LB 3UC0L 3GUTB 3DMMD 5K33A 2EDWA 4LBEB 5CO1A 1NWOA 1T1XA 1JF1B 3QEQD 5EZIH 1YC8A 4ZYKA 3KS0H 2YMXH 2A38A 1T89A 4C56D 2OJZH 3WXVL 1MEXL 1MCIA 4OQTH 4L2YA 4JFDA 1M1XA 4M02A 5BS0A 1BJ8A 2R0LH 3HTLX 1XL6A 4LLQB 3W9DA 1WPCA 4WW1A 5D9SA 1HILB 4QJ4B 5I6XC 3EBIA 3O4LB 3EDDA 2ICEC 1HXYA 1WCBA 2DPKA 4EBQH 3MRDB 4JFWA 4ZNEE 3G5YA 4MHHI 1WD9A 2ADFH 2EYTB 5D7KE 1OP5K 4MX7A 5EDSA 1YDPA 3FUNA 3V8CA 4D7PA 5DS8A 4ELME 7FABL 5JOFB 5AOJA 2AZUA 4L3ED 4XWOD 4Z5RB 3QUZC 3WN6A 1OGAB 5E08H 5HPMB 2NY4C 3HG3A 1TTBA 5C08E 4M5YL 5LN4A 1VGKB 5DD3H 2NZ9C 5C09D 2EE2A 1IB5A 2IANB 4APXB 3ARYA 4MQSB 3WJLA 4C58B 4M1CD 5JXAH 3GIZH 4LEOA 4P9HL 3FT3A 1Z0NA 1IGTA 5FKPA 4P07A 3VTMA 4JO8A 2BSRB 4BCXA 3GSWB 1XGYH 1A7RL 3V5HA 3R0NA 1I8KA 4AT6A 1FAKT 3FT2A 2KLRA 3BQUA 4FQ2L 1RMFH 2FRGP 2W9DL 4LPUA 3CH8A 1IM3D 5ACZA 3RJQB 1KB5B 1KNOA 3PQYD 1PLGH 1NFAA 1UFUA 2FO4B 2F74A 3UZQB 4HUUA 3SY0B 3LRLA 2FJGA 3OGCB 4LQFH 2CA3A 4ELKA 3SKNA 4AL8C 3QUML 4ZW6A 4H26B 3N40P 4JFFA 4YHMH 1BWWA 1OPGH 2DH2A 4F20A 5E8PA 2J2ZB 3OKYA 4HWZA 4PUBL 4BV1A 5A2KH 4DEUA 1A9BA 2QQKH 3CVCA 5I76B 5HYJA 1FL3B 2P4AB 2FIKB 4PCYA 3W0WD 5JZ7C 1OP3K 1UH2A 5EUOF 3MKGA 5IVXE 3UYPB 4ZMWA 1IM9B 1FZOB 1QFWH 5KSAC 5J8OA 4N4YB 5IGXL 2PR4H 3IRZA 5MEND 4KJYA 1MAMH 5HYSA 1XV8A 4MCZB 4B3EA 3BWUC 3BKML 1SOSA 4XP9L 2YRZA 2JCCE 1DCLA 4GS7C 4JRXB 3APDA 4B9GA 5CSZA 5D5ME 1RZIA 1ZCRA 3G5ZA 5IB2B 2HRPH 2EDMA 1OCWH 1SY6L 3F5WA 3SJVA 2BP3A 2HTLD 3ECUA 2E75C 4JHWL 2NY3D 4A2DA 3PCYA 5SWZE 1INEH 3FS9A 4NZJA 4OLXH 4Z7UA 5DEFA 4P3DA 5DJDB 3V4UH 3R7QA 3MRFA 3MROA 3NOIA 5E9AA 3L5IA 2OCJA 4G6FB 1M7DA 5HP5A 1DFBH 2ZICA 3QXTA 3RU8L 1IGCL 3CFNA 3CBRA 3WO3B 5C6PB 3D85A 5E24E 1MY7A 3ZXAC 5DD1H 4C55A 5ICZB 3NIDE 5C0NC 3BVWA 2NX5D 3G6JB 4PMFA 2BRRL 3UEZA 1W8NA 1KEGH 2XN1A 5MERB 2NY1C 5DR5L 3V6OE 4I0PA 3WFEL 3ZTNL 4N5ED 1XDTT 2V7NA 2X3BA 5DMYA 4OGYL 3GSNL 1MLCA 2N1TE 3IS0X 4HWNA 2NW3A 4IRJD 3FFDA 3CDGA 3OXSA 4W9JC 3EGDB 5BMFH 3B7RL 1PZBA 5ENWB 4EI6A 2VDOH 2A4ZA 5HI5D 4DP8X 2IOIA 3KPRE 4AQ1B 3TIDA 5J7CC 1WA2X 3JV4B 1ZVYA 1L7IL 3I85A 1XR9B 4ANVA 3MRQA 4XGZA 1N9PA 2GIMA 3LIZH 4LOVA 1UJ3B 2VXUL 1R0AL 1X5IA 1IC0A 1OT1A 3SGEI 4NXSA 1A6VH 1KB9K 3MV01 4ZFOA 5JYLA 1Y0LB 1QLFA 4PRIB 4XPGL 4AYID 4OCMC 2XPGB 4PWIA 4LKCB 4U1IB 2HRGA 2V5SA 2ZWSA 4HJ0C 3L3GB 4L9LB 3T0EB 1N4XH 5A2IH 3EW3B 4AV0A 4L0ZA 3MDJA 2RJMA 2WYIA 1A7OL 1T0NA 1YNLL 3ELAT 1GGBL 2QZ5A 3QVAA 2QQLH 5EU6A 3PHQB 1SVCP 1T04B 4RFEB 1RUPH 3O3BA 4ZJ9A 1NLDL 2UZYA 3LDBC 4K71B 5I5IA 2GUOB 4LLUB 4WWNA 3MNDA 1NFDE 4M7JL 4M48L 1PX8A 4HGKC 3RZCC 1GAFH 1M1XB 5FXCH 1GCYA 3PAYA 1T5KA 3NAAL 3GI8L 4O02L 2EUXA 4WW1B 3DX8B 3RRQA 4ODSL 4ZW8A 5JW5B 7PAZA 1MLBB 3QQNA 1YG9A 4JVWA 1H3PH 1ZT7B 3RVXD 4C56E 1UQSA 4G7QB 1YNTB 3JQOB 3CFUA 1TEFA 3CJJA 1XWVA 5IB5A 1NIAA 3X3FH 2CRIA 1GZHA 1LO3L 5I1IH 1X6NA 3O41A 1IC4H 5KAQG 5C0CB 1YEKL 3CVHB 1B4JH 4YVUA 3S8WA 4HKXA 4RGOL 4XOEA 1A8JH 4N2AA 1G6RL 2BOLA 3SBWC 4HD5A 4Z7VB 1CLCA 3VD4A 4UWQB 1YYMH 3BFWA 1MPAL 4GI6A 1W0VA 2EXWC 4J4PA 2G2NA 4L3EE 4P2RA 3MODL 4HIIA 3EH5B 3ZQWA 1SDDB 1FP5A 3P9LB 3PL6D 4G42B 3WN5B 5IFAL 4KTYA 3LKPA 5GGTL 3FB7A 4JM2D 4W4OA 3ATBA 3SE6A 1FFOB 3MNWA 4L29B 4CVWA 3D8MA 4FGMA 1ZMYA 1YYLL 3VX1A 2B59A 1S9VB 2VDLL 5EMYA 4BM7A 1OSPL 3LEYL 1HX0A 4X5QA 4MA1C 4UOJA 3T2OA 4ZMOA 5I23A 2Z6FA 4OTXH 3MUHL 1T22B 4WO4A 2AS5M 2AGJH 1B2WH 5CLYA 1RSYA 1NL0H 2QHRL 1RV6X 4XMKH 4Y2OA 1E65A 1MRCL 3I3EA 1PNCA 4Q74A 3ZDXB 3DRQB 5D7LE 5F7BA 4LO9A 1T7WA 4JEGB 4YFEA 2BFGA 3P54A 3QNXA 2XQBH 2OAAA 5A2AA 1YPZE 2Y23A 1EEZB 3QIUC 4NAJA 5DRXA 3VH8A 3CHQA 1OM9A 3PWNB 3X1FA 5IJCC 4GG6F 4EIBA 2ZXWB 3I3BA 1J9RA 3QHTC 4B5ZA 3AMKA 2EH8L 2RR3A 1I3GH 1IBHA 3GMPB 3N04A 3LX9A 3P4MA 4XMWA 2QVIA 3W0WE 1XZ0B 3LN5A 4ZO7A 5CEZD 5D1XD 3IXTA 2R83A 3ZHLA 4P5TA 3G5ZB 5AW7B 3P3SA 2KDGA 2XA3A 3LNEA 3V10A 2D03H 2K7PA 2YN5A 3VI4F 2AEOA 1AANA 3MRNB 2DQMA 2J8UA 1OAZH 4MXQC 5DHEA 3F65A 1H6EA 2V17L 1W91A 1KIPB 3OR7A 5LBSA 3MROB 3HS8A 4XWGH 2WTPA 1KTDA 3ECWA 1M71A 2DQEL 2J57A 4GMSL 4JQVA 3BSZL 5AZUA 1D5BA 1AXTL 1OD9A 2PYFA 3QK0A 3M46A 3BO8A 3MX0A 3TO4A 2VDRB 5ICYB 3Q3GB 1AGCB 4Y5XC 1EDQA 5HD8D 4EI5D 2P8PA 2AEIT 1YEJH 1TTCA 2WP3T 3KNBA 3JWDH 4R97C 3T4AC 1JF6A 4OFYD 1EFQA 2EEDA 1H5BA 1SFHA 4L8SC 1QSED 2H5UA 3GSXB 4LPTA 1KGUA 3JZ7A 4GJTB 3AABA 1ETZA 1HEZB 3TZVA 5FGBA 4QY8B 2NX5E 2HP4A 2JJSC 3FRUA 5T3XD 1ZLEA 2HCZX 2WXRA 5F0LB 4JY6A 3V0VB 1FIGL 1MFAH 5EEYA 1DSFH 3V6ZA 1NCDL 4UQBA 2AQRA 4L4VB 3CDFA 2ZWLT 1S9XB 4I18A 2D73A 2PPDA 3UBXI 1O9VA 2B77A 1GA2A 3WEXB 4G72B 2XJLA 1TZGL 2Y7LA 1NGQH 3UCRA 1RURH 5FFOA 4HISA 1YUHA 2J25A 1E4KC 3WG7B 3CFCH 3NIFB 2CHZA 3FUEA 3FSAA 3D39A 4FQPA 5HDBB 3LS5H 5FM4A 2OMBA 2E0PA 4FULA 4YAQA 2JIXA 1TVHB 2ZOLB 4QMEA 3TH2T 3IDIA 4HWEL 1MJ7H 4Z7WB 5I6OA 5LKNA 3S96A 5T33L 4HT1L 2ENSA 3TM6A 5I2IB 3WD5L 1XO8A 4PGEA 3KLLA 3O0LA 3QNZA 5CJQL 2ZWKA 3DK2A 2WXIA 3NJKA 1J0YA 2FL5A 4OF3A 3AAZB 4JS7A 4YDMA 3V0WL 2J7LA 4CGTA 2V5MA 2B5IC 5EZPA 2AK4D 4ZAKD 5CN3A 1HCZA 1O6SB 3DSFL 1GY1A 5JOPE 3TA3A 1HINH 3RIFF 2DM7A 5EBMA 2E7BA 3ILQC 3MV7B 4XNMA 3HBQA 2G75A 2HRLA 1AIFB 3I9GL 5BUGA 3KLAA 1OZTG 2X1PA 3UX9B 3GRWH 3IFNH 3CGTA 1IEAB 5FO9A 3JZYA 4F5CE 1F11A 3APMA 2W88A 3ATEA 1YC7A 3EJQA 3NJFA 1S7QA 5JPMC 3RG1C 1R9FA 4Q6YA 3V4PH 4UTCA 3N85H 2D9QB 3GB7A 1OSYA 3RVTC 1MHHB 3SBQA 4L3CB 2CO7B 3WMQA 1KIQB 3L3DA 4N86A 4YIQA 3PXJA 4TLSA