3SD2A

Crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
NPMGIPIQPTYEKCAILSNILNVSFGRAKDYAIITVTNKATGEIVHSKTYHNTSIVMIDMSSCEKGEYTIHIILNDCLLEGTFTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords Putative member of DUF3244 protein family
publication title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sd2A01
4G5AA 3D33A 3SD2A
chains in the Genus database with same CATH superfamily
3FT1A 3HRPA 4JLRA 4YSCA 4APQC 2R0KL 3WEMA 5B8CC 4Y16C 3AREB 1KN2H 3ZU8A 2ZX8A 1E5BA 1TJGH 2H4EA 4N2HA 3T0WA 5IVXE 3MLXL 3AADB 1AE6L 4XP9L 4FQCL 3G08B 4MNQA 2VN3A 3CK0L 1EFXA 2QQKH 4OZHF 1I85C 1JOIA 4QHUB 2PR4L 1XGTA 2QV4A 4OZGF 5DHEA 4I3RH 3EAKA 4KVNH 1SF3A 2XVBA 2VB5A 5E8NA 5FYKL 3HTLX 1J5OH 2QADD 3ARDB 3MRFB 1RUAL 4JJ5A 2A6IA 5AW1B 2ED6A 4UOQA 3CC5A 4I87A 4ALAH 3OC5A 3MRLB 1NWPA 1WZ1L 2FEJA 1AG0A 4JPWL 5E6YA 5GIRB 4BGDA 5KYUB 1F4YL 4CSZA 3RP1A 1U93A 2CDFA 2AEIT 5FUZL 4K7PX 4MKTA 4TVPD 2JLLA 3GRWL 2HFGL 4RMUA 3LMJH 4I77L 4JBSA 2FO8A 3ARGC 3B2UD 3EDKA 1PCXA 3WIFB 1I7ZB 2FAUA 3CUPB 4GXUM 3C5JB 4GRWB 3MACL 3Q6GL 4DVRL 4NQDE 2HAZA 5C3IA 3CFNA 5IK3B 1F6LL 1DSYA 3FOMB 2ICWJ 2QSTA 3UFIA 5CJOL 3II2A 1QP1A 4I18B 3A24A 3QIBC 1YMMD 1R4XA 3ARDA 1QLFB 5HDQH 1HZKA 3QIBD 1UD4A 4YR6B 4FZ8L 4OQTH 4BE5A 1J88A 5CGTA 3H3PH 1VDGA 5KYUA 1BVKB 3FQUB 3PAVA 1U8OB 1OD9A 4Z95L 4XN2A 4ABUA 1MZYA 5L88H 1NFDE 1KBGL 4P2QD 4F2ME 4ELMF 1EEQA 3G6AB 5D7EA 4LKXB 3WIFA 3CUPA 2HA1A 2A9AA 3C5JA 1R3LB 4NI6A 2A6KB 4J1UB 4WEUD 2EYSB 3OBAA 5IK3A 4K3GA 2WVVB 4ZFZA 3DARA 3IM1A 4OZ4B 1EIBA 3SYCA 5BOPA 5GS0L 1YO4A 3GEFA 3RVVC 5J1TC 1KXVC 2PN5A 3QEQD 4XO9A 5EN2A 2R4RL 2Y36L 2Y1VA 1SVBA 4M6OH 2BW4A 1TIUA 2P28B 3PP4L 3RVVD 2GITB 5LCVL 5I8OH 4DPBX 3UBXA 3QFDB 1EEYB 4YR6A 2PPFA 1GC1H 2ZNWA 4NAJA 4RRPM 4JMNA 5C6TL 1GYUA 2D7TH 3K74B 4U7SA 2YAQA 4YHOH 5BZDA 5LGKA 3NCBB 2WVUA 1BVKA 3FQUA 4HSQA 4JRXB 3FUDA 2X4QB 4JFHE 4PJCE 5E7FA 1U8OA 4FFZL 4FNRA 1OGTB 4XH2B 5GZOA 1Z7JA 1LMIA 5C08E 2LAAA 4PJGB 5TQ2H 4U4BA 3GRWH 3F6JA 4L18A 3G6AA 1LP9B 5HHOD 4Y4FC 4HUXA 5IQOA 3K6NA 1DO6A 3O6ML 2K7QA 3IMUA 5BUAA 1R3LA 3O0RL 3P3RA 4KX8A 2A6KA 4OIIH 3ARUA 4J4PC 1TVBB 4Y4FD 3TLRA 2EYSA 2FT8A 5EEXA 2WVVA 1H6FA 4LVNB 4J4PD 1DVTA 1SEQL 4NNXB 3PRZA 3LNIA 3LXCA 3MNVB 2EH7H 4LOFA 2AQQA 2OLDA 1GR7A 2BP0B 4HMEA 3RTLA 1IMHC 4HJEA 5HTSA 1CXFA 4UQ3A 1IM3D 1RSYA 1U95B 4LLQB 3PHOB 3CMGA 3QFDA 1EEYA 2PTTA 4I8DA 4EO5A 5BJTA 4H26B 1JMZA 1BBDL 4X8JA 4O58L 1D9KB 1K3ZA 2EILB 2VW6A 4JRXA 5F1IB 3N55A 2DM2A 2EVIA 3MV11 1E9PB 3FU7A 1BFVL 3K7UA 3IF1B 1J8RA 3OLIA 5T3ZD 1OHQA 1NL0L 2BOCA 4EPSA 3FK3A 3QJUB 4HLJA 1OAUH 4PJEA 4PWFA 1TVBA 4XR8C 1NCDH 2YD6A 4DGVH 3M8OH 5FUCE 4NNXA 2IAMA 4M8RA 2YA2A 1JK9A 4GP5B 5ESVB 2J73A 1J9CT 5BVJA 1HZHH 5JW4Q 2D2OA 4EI5D 4LLQA 5CEZD 4C4KO 2VZVA 4UQ2A 5CCGE 4PH8A 3BAJA 4H26A 4FLHA 5MENB 5IIEA 5CZKA 4M4RB 1C5CL 5F1IA 3VH8G 4PW9A 5HYQA 3HNSL 5BVPL 2O61B 5ITFB 1FFPB 5CWSA 1E9PA 2H2SC 5JIDA 1RZIB 2APSA 1MFCH 1KJVB 4Y4KB 3ZTNH 1AKJD 3HB3B 3RB5A 3F65A 2H2SD 1CFVL 2XQYA 1OP3K 5ETUA 2H0JA 3AAZB 3UAJA 4KDTC 1DCEA 1CT8B 2ORBH 2LFEA 1MI5D 3DXAA 3IFLH 3MUJA 3N06B 5HYSB 3NCJH 4FJZA 5I0DA 4W9CC 4AQAB 4FQXB 4Y4HC 5F7NC 3ESPA 2TSBA 1EHKB 2WMPA 3HZMB 3WUWG 4LMQI 4KDWA 3T1WA 4H13C 5HI4C 4ZUVB 4KHXH 4OAWA 4P4KA 4NXKA 1JIBA 1BM3H 1AXSB 1J9QA 4GRLA 3SKOB 3MR9B 2EDNA 5HI4D 1PQZB 4MA7H 4Y1SA 1A8ZA 4LASL 5MENA 2AXGA 1KJ2H 1PTZA 2N1KA 2NY0C 2Y25A 3O9WC 4M4RA 4JFED 3ZE2E 4TKWA 1JF1B 2O6PA 2OMUA 4MMZC 1RZIA 1J87A 3O9WD 1ZSHA 5HYFA 2ODHA 4R7LA 1KJVA 4M43H 4Y4KA 3V10A 1ORSA 5KVEH 1LWJA 4HIHB 2NQ3A 3AAZA 3LY6A 4N3TA 2ZAGA 4YSTA 3FUJA 1AKPA 1CT8A 1T0NB 3ROLA 1GS6X 5DJZB 3E2HB 4A7VA 1H6UA 2OULB 2WNKA 4AQAA 5JOPD 3HEIB 1FC2D 4RWHA 4FQXA 1MCWW 4HZ1A 3QHTC 5CCKH 1XD1A 4HGMA 1FE8H 3HZMA 1FIGH 4AL8C 5IJVB 3CH1A 4GBXB 4QMEA 4JFDB 3FAXA 4LKCB 4ZTOH 2FT6A 4ES8A 2X44D 5GGRB 3SKOA 1AXSA 5KYWB 2Z92A 1MFBL 3T1FB 4X5PA 3MR9A 3W57A 5KN5B 1PQZA 1AZVA 1CQYA 4KDVA 3VFSB 3GDBA 4XBPA 2B8OT 5IFJB 4TTDC 1KB5B 4G7VL 4NJ9L 4Z78B 3MV8E 4TRPL 1LO3L 4Q0XH 2EEBA 4QHKI 2CO4A 1CF8L 1S4IA 3MRRA 1UADC 4K5PA 4HIHA 2NQCA 5CZXD 1AQKH 4KZEL 4FHBD 2H9GB 2LLLA 4ODBD 4ZS6C 4K94H 1SJXA 1GTNA 4ZFOB 3DOSB 3TT3L 2VH5H 3HI6H 4OGXH 4YHLH 4AIXA 4B95C 3BN3B 1S5IL 4PJ8C 2Z0UA 4D9LL 3WAJA 2B14A 4N2IA 4HIIB 4KTYA 5KSVB 1KFAL 1NANH 1Q1JL 4PBXA 1BYNA 4N90E 4GBXA 4JFDA 4LKCA 1NIDA 1WRFA 3UOAB 3TBBA 4AJYV 2EEFA 4IGBB 3BHBB 5KYWA 3T1FA 2QHLA 3MO1B 4L4TE 5KN5A 3AMKA 4JE0A 2WLMA 4ZSOE 2YWZA 1IQDB 4YWGH 1UEMA 1KB5A 4KJQD 2PCFB 3CXDH 2BIQA 5DMYA 1DR9A 4Z78A 2CNZA 3TNMA 5KWYC 4CU6A 2G60H 4LRNL 4N87A 4K73A 2WBJB 4OTXL 5E8DH 2J8OA 3ISRA 2XCMC 3NGBB 3UX9B 5KVFH 4NQCB 3GNMH 1OTUC 4BA0A 3QRGL 4XX1G 3EJUA 3L16A 4F15C 4CU8A 1ET8A 3RZWA 3CIAA 3DOSA 4RMRA 5HHPA 1OTUD 2ZWLT 1IGFH 3O3UN 4HIIA 1Q38A 3BKCH 3C6LB 2VXQL 1FNGB 1AGBA 2PWFA 1XMWA 4NKOB 4Z76B 1VSCA 5C0NC 3BHBA 3EH4B 1KT2A 4XPGH 3MO1A 4FTVE 3TO2A 4X4ZA 3LS5L 3VFPA 3CBKB 1MN4A 3CLEL 2R1WB 4AQZA 5J06A 4J8RB 5DQ9A 1TJHH 2PCFA 3K2MC 4MLSA 1NFIB 4N0RA 1I7UB 3L4WA 2DL2A 3G5VA 5CLZA 4PVNA 3ZDYB 4FNQA 4J23A 1X5FA 5GGVY 1TCRB 1IIKA 4JRYB 3VWKB 1OB0A 4LMQE 2KDGA 2Q76B 4LCWB 4NQCA 3T0EB 1H3PH 2VR9A 1FWXA 3QJRB 1YRKA 3CG8A 4H5SA 4HBQA 3OKEB 3ZQXA 2NNRA 1YEGL 1RZKL 3PWPB 3QCUH 3V6FA 5E0FA 3MCKB 5EHFA 1GZHA 2VLLA 1U0QA 3QC6X 2EH8L 5JXAH 2GJZB 4AMKL 4P5TB 1DVFD 4EOWL 1WSST 3QS3A 1H6TA 4NKOA 4UNIA 5FYJD 4XWGH 3DURB 2OSLA 1JGVH 5FO9A 3WIIL 1CURA 4JX0A 5L0QB 3D12B 4Q56A 2R1WA 4J8RA 2VSKB 1NFIA 1WTLA 1ZVYA 4XP4L 4FS0A 1I7UA 5BV7L 1QYGL 1G5AA 2YOAA 5E08L 1SFDA 1JTOA 4AX3A 1TCRA 3QZWB 1DBBL 5LQBH 5FCUH 3RJQB 1JI2A 5IQNA 2Q76A 1OAKH 1TVDA 4HS8H 4ANWA 5F7YC 2FYYB 5C0CE 3OKEA 2F1BA 2QSVA 1K6QH 1CB4A 4YHKL 1EZLA 5CAYB 1GGYA 3O8XB 2I5YL 2CDEB 1KYOK 4PB0L 2KHAA 3N6YA 4P5TA 3LIZL 1FAIH 4Y2DC 3S36H 4O5LH 1FV1B 3LXUX 2OFQA 4MA8L 4ZX6A 3CFEB 1E6OL 4NUJA 1BD2A 1OF2B 2VN4A 1ZV9A 1UYWH 4N68A 4Y7OC 3AWFA 5D5MA 1C5BL 3WKNA 4JR9L 4NENB 1JDAA 4JFSA 1Z5YD 3TN0D 1AD9B 3V4PL 4BFBD 3RL1B 1F58H 5DQJB 3SDYH 3HW7A 4MNGE 1KGWA 4ZOCA 1MWAB 3U1PA 3MOQA 5F0JB 5B39G 1N12A 3L6FB 3I74A 3T4AC 1A02N 1U92B 4HYTB 3NIFE 4R83A 2X9ZA 3TA4D 3I75B 1NCAL 1L7TL 1BZOA 1G7IB 1NCWH 3FU5A 7PCYA 3HS0B 2P43B 4KROC 2FYYA 5CINL 2EJ1A 1SJHB 1T7YA 5LO7A 5A6IA 1ZSDB 5ISZD 1E8WA 2XOTA 3WELA 3O8XA 3NRFA 4BK5A 4HU8A 4CGTA 3SJVB 1OSZB 3H9SA 3NJHA 4UOJA 1XDTT 3SOBL 1VKXB 1FV1A 4UT6A 5EO9B 1ZGLA 4UOW0 1UGNA 3O2VL 4K0OA 2R2BB 1P9MA 4P5RA 4NENA 3V95A 1N6VA 1N0XH 5EO1B 2DWXA 3M1BB 5D71H 2KUTA 5DQJA 2Q1EA 2ESVE 3QR1A 3UABA 5AKSA 1MWAA 5M94B 3NH7L 3L6FA 1R3HA 5JZ7C 1DLFH 3UAAA 2J6EL 4S0HA 3CSYA 5FF6B 1G7IA 3BPLB 5DJXA 2W8CA 1HKLH 3HS0A 5DVPA 3VFUB 4YXLL 2DDQL 2TRHA 1ES0B 1OVZA 4ATTA 1JPFB 3SGEI 1ZSDA 2XLLA 4L8DB 2IG2H 1XV8A 4UDTB 5JUEH 4WU7B 1RMFL 1V3LA 1N5AB 2CLZB 25C8L 3V4VB 3B34A 4Z3GA 4OSUL 4PEEA 3SEPA 3SJVA 3SN6N 4HWEL 1HHJB 1VKXA 1HNFA 4G8EB 1ZDQA 3S37H 4HJUA 2YAOA 2R2BA 2Y0SA 3QYNA 1C5DB 1R0AL 5FYLH 4ZW6A 2CUAA 5DMJB 1F6FB 5CEZL 5EO1A 1OCCB 4LSUL 3RTQC 1AO7B 4Z7OF 1HI6B 2FX8L 5IY5B 1XH3B 4PGBB 3QH3B 4FKEA 5CSGA 2F5AL 1AMXA 4OLUL 4W70A 1KNOB 1PZBA 1KB9J 4UAOC 5E1QA 4FXKB 1ES0A 2FX9H 4CJ0A 2AEWA 2MNUA 2WUCL 5BS0B 3VXSA 1JPFA 1OE3A 2W65B 4XCNA 4FKHA 4L8DA 5LGJB 1CYXA 4YFLF 4YBLB 3C8KA 5DC4B 1U8LA 1QI3A 3OHMB 3ASOB 4XVTH 1I3GL 3T2QA 3IRZA 2N01B 2OJEB 5FCSH 3ZKXB 3DNKA 3GBNH 1LILA 4JANB 3RDTD 4G1EA 1BMGA 1A5FL 4TVSa 1TTCA 4LFHD 5HHXL 3T8XB 2B15A 4E41B 1I4FB 5IJKC 1AO7A 2C8NA 3UMTA 1SXNA 3JV4B 1XAKA 2WNGA 1XH3A 2Y2YA 3QH3A 1T2QL 4ODSH 1IVLA 3B56A 3IK2A 1XF4A 2DQGH 3P4NB 1FN4B 5T1JA 5C07D 3WFHB 3JTSB 1KNOA 3Q5OA 2R4SL 3DX0A 1H8SA 5FYKE 1XGUA 3MOBL 4HULB 1MW3A 5BS0A 8PAZA 3U1SL 2E4TA 2W65A 2VDLH 3R0MA 5LGJA 3SY0B 3HG2A 4OW6A 4AEHL 1KY7A 1PG7H 3GI8L 4GSXA 2XPGB 1FGVL 2WXFA 2YC1B 2DJ4A 3P54A 5TK2A 3ZL2A 4WI6A 1D7FA 1MLCA 2WXOA 2OJEA 4M1GL 2J2ZA 4W9FC 2OW6A 1K4DA 1NSNH 1KPRB 5J6HA 1R5VA 5GGQH 3WIHH 5CZVH 4KITB 4PRHE 2AAAA 4DGIL 4E5XA 3T8XA 2WWKT 1OSEA 1I4FA 1Q94B 1IGMH 2NY5H 3KM2A 4DK5A 2OMTA 1IFGA 2XFXB 3BPCA 3DO3A 4WCYH 1RJLB 4JN1L 4NJAL 3U4BH 2JQMA 3CFDB 3OKDB 4I0PC 4PW4A 1DVUA 4EUPB 3CE1A 3P4NA 1FN4A 2APFA 3L4XA 1NFKA 1NC4D 4FABL 3UEZA 1ADQA 4WEMB 5HVHC 2CK0H 4PJXE 2NTFA 5D7JD 5AW7B 3RPKA 4UTBL 1CD1A 3TIEB 3MV7D 3GHEL 5T3XD 5JIIA 4E9XA 2XPGA 4N5UA 5T1DL 3ATAA 1WZMA 3MTRA 1PLAA 4UT9A 3UPAA 4C83B 5ADPH 2F5BH 5ILTL 1S2EA 5KSBA 5GS1C 4O2CB 1THCA 1KPRA 4GS7C 1BQHG 1JNNH 4OH2A 3DMMB 4WFEE 3KYOB 1W0WA 5K1VA 4BA8A 4MB1A 3FT0A 5HDBE 3CN1A 3VXOA 3H9ZA 3UL4A 4EDWH 2IOIA 1Q94A 1GCYA 5L2KB 1B4RA 4H8WL 2F7QA 3AT0A 4WV1C 2XX0A 3M17B 2XFXA 3BVNB 3ECBA 1RJLA 1M2OA 1FPTH 3CFDA 1KYAA 3OKDA 1SBSL 1A21A 4B9ZA 4EUPA 1KEMH 4JY6B 4A6YH 5J3HD 3MSPA 1NQBA 3ABGA 4P46D 4OQ1A 4OI9A 2X6CA 3TIEA 2XTSA 2ATAA 1QSVA 3G5YA 1OGAB 3BKJH 4H20H 4PM1A 2LOEA 3BWUC 4NN5B 2I9LB 4OCYL 1OPGH 3QUZA 1YNLL 3WO4C 3ASWA 1C1EH 4JPQA 4C83A 4Z7QB 2QKIB 1X5JA 2YXVA 2XN0A 3UP1A 4HIEB 4LEXH 3EDFA 4IEFA 3WTWA 1EK3A 3UZVB 4NPJA 4V1DE 4V2BA 4L0YA 3FCTA 1OSPL 5JORA 3S4SG 2R1YB 1OK8A 2Q8BH 4AIEA 5L2KA 1UM5L 3JWDH 3UTOA 1RZFL 5IB4B 3M17A 1E5AA 2BVQB 4IOSA 3BVNA 4XRCA 1EERB 2VN7A 5TDPA 3KPRD 4XGZB 4W9IC 1FZJB 1NAKH 3L7FB 3QXDB 3O4OC 2DQEH 1BVLB 1YJDH 3CFTA 3KPSD 3I9PA 4U1NB 3UTSA 1FSKB 3GBEA 3RY6C 3FYEB 3STBA 1GGIH 1E7VA 1BZQK 5F9AC 1E67A 4DESA 3HA0A 5F9JB 2B2XL 1WGOA 3UO1H 3FTWA 4KVPA 3LZNA 3O81A 3IYLW 4AC4A 1HXMB 5CEYA 4JRFA 5CM1A 1AHWA 3BUPA 2K6ZA 2QKIA 3HE6D 4IKNA 2ICEB 4HIEA 5B7EA 1IM9D 5T1LD 1H19A 4ZO8A 2O5XH 3ZKSD 3UZVA 1OP5K 5GGTL 4JPSA 4TSCL 1NICA 4P04A 4KKBC 1IQWL 4K2UH 3FH5A 2BVPA 4KUCD 5IHUL 3TIDB 3ETBJ 2JTDA 3SCMD 3OVUB 2BVQA 1E4WH 3CLFH 2BJMH 1LO4L 2PPCA 4PJ5D 4OKDA 4XGZA 3DETC 4IU2B 1UCBL 1FZJA 3WJLA 3L7FA 1EQWA 3UYOD 1IU1A 1BVLA 1MFEL 3AUVA 4XAKE 3DETD 5HGBA 3SGKC 2A9BA 1GGBL 5F88B 4GI8A 1I8LC 3PJSB 5E4EB 4DT2A 3GJFA 3S3DB 1NINA 3QUMB 2HTKC 1HXMA 4K3EH 4PRPA 2FO1A 3K4ZA 4PLOB 5C0EA 1PNDA 3VX0A 1E8YA 1YEJH 3HCVB 3W2DL 5EEZA 4HLEA 2WWNA 4M5YL 2VLMD 5A7BA 2ICEA 5KSAB 4OCSL 1DSFH 1WAAF 1J86A 3VA6A 3S98A 3MRGB 4OF5A 3FQTA 3KDPB 3OGCB 3OB0K 5HDWA 1GH7A 1Z3GH 1DFBH 4PI0A 1N10A 2AXFB 3ISWA 1L5GA 3CFUA 3PV6A 3PAUA 5DURD 2IFFH 2WLIB 4ZOEA 4U1JB 1WFNA 5IVOA 3CFBB 3TX4A 1J05A 3PQYD 1XGYH 3O3EB 2X9YA 2VO8A 2NW2B 5F88A 4ALAC 3OX8B 3PJSA 2DIAA 4WJKB 2VDNH 4N2BA 4QHLB 3QUMA 4J3OD 3G3LA 5CKGA 5FB8B 4AK2A 4EBQH 2LLGA 4OR1A 2G5BA 4LPUA 2EDYA 3HCVA 4U7MA 1TT6A 4G6FB 1E5CA 1FI8C 2OMVA 1TR7A 3BKYL 3VQMA 3HC3H 1URZA 5DGRA 3QARA 3T0AA 1MIMH 2JFCA 3MRGA 3ZIMA 1YEEH 3MOAL 4N8PA 2M83A 4GINA 4O9HL 5D1XE 5I8EA 4YLQT 2I26N 3H3BC 2AQTA 1CGVA 5D6CA 2FHCA 2HRPL 2XZQL 3EBGA 3MRDB 4BFEA 2PO6A 2WLIA 2ADGB 4ONFH 4DCQA 2DJMA 4OCWL 1B4TA 2XXCB 3CFBA 2CKBL 3QCVL 5IEKB 3GGWB 4N0FA 3OKOB 2HB0A 3O3EA 4XI5C 1WT5A 4GKZA 1NC2A 3T3MB 4ZW5A 1GGBH 3OX8A 4NRZA 1C9SA 1UT1A 4J3XA 1A1MA 4QHLA 2EIZB 2ROYA 5FXCH 5F1KC 5E8EB 4JGMA 4FQJL 1A6AA 2JQAA 2WHVA 1F1DA 2IFGA 3E3QC 3QNZB 4BWUA 1YN7A 2WYZA 5EBMB 3UTTD 3SE3A 3N85L 2VDPB 3MDJA 3QQ9C 3ZL4H 1TPXB 2ZKMX 1ONQB 3BVDB 1OARH 2ZYHA 3RQ3A 1F4AA 3QQ9D 3GS4A 4GIOA 4YSSA 2Q2EB 4QRPE 3B3BA 2ICES 4B0MM 1X5KA 3EW3B 2VDML 3VFOB 3JV0A 2ADGA 3HPLB 3G9AB 4M1DH 4GW5B 5FGCB 4XP6L 4W68A 5L6YH 2ZAIA 1UXLA 4DZ8A 3GGWA 1YY9D 3OKOA 1A25A 3D0VB 3Q7JA 5ALBL 1G9EA 1GC1C 1CBJA 2WZPA 1OP5H 1KCVH 2A4EA 4L8BA 4P2OB 2HUHA 3ABMB 4LLWB 4BCXA 4EZMA 2CMRL 2EIZA 2PCPB 5IG7B 3PPSA 3X17A 1JHTA 1HH6A 1LO0H 1KGXA 3NZHL 3IT8D 5EWIH 1RUKL 3IDUA 3PNRB 4GB9A 5F1NB 2KZBA 3QIWB 3P9WB 5ALCL 4FQHA 2GKIA 4S1SH 1J18A 1ONQA 5CD3B 2H32B 5G5DB 3KWVA 5DRWB 2VKXA 3QJHB 3CFKA 1GRWA 5L9DL 4F57H 3P9LB 1YEFH 4RFNB 4A7UA 3TBVA 2NT1A 2RR3A 5DSCB 3VFOA 1HYSC 2NZIA 1TQBB 4HEMA 5EDXA 1UJ3B 5AYUH 4PP2B 1RZ7L 4J3OF 4DVBB 1P7HL 3QEHB 5EBWB 3QUXB 4AM0Q 4OFKA 3WEXB 3RWJB 3MUY1 3F5WB 1WGVA 4TLTA 4P2OA 2MSPA 2ZONA 1PEZA 4ZFGH 1TQVA 2H1LM 2G4GA 2ZCHL 4OGAD 4TS6A 2YD5A 1UM6H 3S3JA 4WI5A 3OKLB 4FXGB 4DKFL 5F1NA 1YNTF 3QIWA 1A6VH 4Z7IA 4KTEH 5EH1A 3DHUA 3MRMA 3BESR 4Q6IC 5CD3A 2ZCLL 1X5HA 3L4YA 5G5DA 3TVMD 1G7HB 5DZOA 1OAZL 1EDHA 2A2QT 4PJ7B 1U8QB 3P9LA 2XA8H 3VU1A 5DD5L 5HI5C 5GS0C 5IVXA 5SWZB 4BH7B 5DVOA 1ZV5A 3GXFA 4UNVA 1TZGL 3FTZA 4JM2B 2P8LA 5AQ0A 3MCLL 1UJ3A 5LNEA 4PP2A 2FNWA 4DVBA 1JUFB 5EBWA 3QUXA 5I16B 3RWJA 1O9ZA 3PWJB 4H8HA 1QSEB 3KDMB 1T80A 2WGXA 5TF1L 4NM4L 2BNRD 1INDH 5KYYB 1YMME 5EU3B 1JPSL 4IMLB 4R96B 1UXMA 1IL1B 1WA0X 1QWNA 2VNCA 1GCFA 3OKLA 4FXGA 1M42A 3VVWA 3AMLA 5KBNC 3KBFA 2X1WL 4HCRH 1C12B 3QPKA 5JW4M 3EYOB 4JRLA 4EZKA 3FHAA 3QISA 1G7HA 2LGNA 4P2QE 1U8QA 5EZJB 1NMAH 2UXGA 5D1ZA 2QMJA 1U21A 5CLXA 1DJZA 4BINA 1QBAA 4IBQA 4YHPB 5SWZA 3SKJL 4BH7A 4OZIE 3D3VB 5TGBA 1HZLA 3A0OA 3DV4B 4NQDA 2Y06L 1FHGA 1M6OB 1JUFA 5KBKA 3P11H 5I16A 1QSEA 2DQ6A 4NRYB 12E8L 3E1F1 3KDMA 3QEQE 1F4XH 5DJCB 5BRQA 2QDVA 4UTAL 1HHHB 3OR6B 2Q10A 3BPOB 3MV9D 3N0PB 5DQDH 5I1LB 2PW2B 2Z93B 4IMLA 1XSKA 1NKGA 4JFQB 4LPYA 4R96A 4QOKD 1IL1A 2Y9RT 5DUPL 1KEGL 4J28A 4M5TA 2WKLA 1C8QA 1NGPH 4QAWA 1C12A 1IC7L 1CXLA 1I75A 1NM4A 3EBIA 3RX8A 1UUNA 1ZJBA 1DLHA 1GPOH 1WAEA 1JG9A 3EYOA 5K59E 3LEVH 1EO8L 4ZXBD 3VO0A 1RUMH 1A4KA 3FQXB 5JXEC 3LPWA 3RI5F 5EZJA 3BSZL 5C08B 3T2OA 5HHOE 4BD4A 1QHPA 1AQDB 1MVUB 4FFYH 4D8OA 2ZIDA 4ENEC 1RCYA 3EDEA 1U58B 4Q6KA 5F7HA 3MBEB 4OU3A 2G3NA 4IQHA 8CGTA 4KQ4H 4FN0A 4ENED 1T5WB 5T5FH 3VXQA 5IR1B 5DHVH 3KL5A 4X6DB 4NRYA 2V9UA 4Q9QL 3N04A 5C71A 1HHHA 2N7SA 2VZOA 3LJ3A 1D5ZA 3BZEB 2FJGB 2K6YA 4ZK8A 3I9GH 2DM7A 1AY1H 1B88A 5C0AE 3T04D 4NBXB 1HINH 3FUHA 4MBRA 4ZZKA 3SDCC 4GQQA 3N5AA 1QUNA 1MH5B 2OAAA 1NGQH 2YMXH 3SPIA 1JK8B 1OW0C 1D6EB 3FQXA 2Y7QA 3FONB 4PJCA 3TO4D 2J4WH 1NKOA 2YARA 5C08A 4ZPTB 1JV2B 1LK2B 2XIDA 1ITCA 3IDIB 4Y9FA 5CCHE 3R4DA 1HXYB 1AQDA 1MVUA 4AQ1B 4ZPVB 3ZO9A 2IANB 3MBEA 2CJUH 4JHVA 5CHNB 5KTEH 4WW2B 2EO9A 3NIGE 4ESKA 1P7QB 2PMZA 3NJKA 1KLUB 5I9QB 4AWJC 3M07A 1U8HB 4W4OA 4LU5L 4WW1B 3ZKMC 2D03H 4UINL 2QDWA 2X88A 2H0PA 3T6VA 3JZYA 5IM7B 4CW1B 1LEKA 2X4RB 1U8IB 2FJGA 2E76C 1FH5H 4OJFL 4JE4B 5CEZE 2W0PA 1M05B 1OZTG 2ICWI 5I1IH 4X5QA 2ZJSH 3UGEA 3DX4A 3O6LL 3V0VB 3K6DA 4XVUD 2V17L 3ZDXB 3RFZA 3BMWA 3ARBD 4G8GB 4H0GA 2O5YH 4ONOA 4BQ6A 4N9GB 1PFCA 4RETB 1GGCL 2H47C 1JK8A 1CO1A 2Y07L 3HI1A 2P5EB 4KQ3H 3FOLB 1WUZA 1LK2A 3HJ0A 2YGQA 3GLZA 4K5NA 1UATA 1Q0XL 3CBJB 3IDIA 4UTCA 1HXYA 1MI5E 4OLVL 4ZPVA 2IANA 4OFDA 5CHNA 4UM8A 1BECA 4FLRA 1LO5B 5FDYA 3Q9QA 1E4KC 1KLUA 2UZYB 4RX4A 1X9UA 1U8HA 2AQ1A 2VTFA 3VRIB 2O26U 3VM7A 4LEEA 3CMOH 4XPAH 4G7YH 4CW1A 5LXVA 2X4RA 1U8IA 3K2UL 5AAWA 5DJ8B 4UQIM 4UMGA 3V0VA 1OE2A 5KSUB 2OR9H 3SE9L 3ZUNC 3DJSA 5KBMA 5DHXB 2ALWA 4G6JL 4N9GA 5I1DA 1JRHH 1IGCL 1QW9A 5EEUA 5I0ZA 2P5EA 3UYRL 1M57B 3LKSB 4XPHH 4H8PA 4JREB 3SD5A 1S9XB 4GMSL 3QEGH 4MCYB 2HFFB 2V2TB 1KCUL 3QNXB 4PP1C 2GBTA 2YFOA 3HFML 3KNBB 2CCWA 3WG7B 3BP5B 2AJUH 4PP1D 4FFWD 1LO5A 3VYNA 1CL7I 2UZYA 5J6GA 3VRIA 4S1QH 3BH4A 4KXCA 3RZCD 4PB9L 5FHBL 3MLUH 3AW5A 5GSVB 3J2PA 3QQ3B 3BKMH 2P8MB 3NYKA 4JVWA 3FQWB 5C0IB 1VRSA 4A39A 4U6XB 4PWJA 1BA9A 1EZVX 2F1EA 2ZXAA 2VLJD 3WHXB 3MGAA 3LKSA 3WNLA 2ARJQ 1TJIL 1S9XA 4JVPA 5C3LD 3BZ4B 1ASQA 3QDJB 4WWOA 4LVHC 4XXCC 1W8OA 2HVKA 3VFRB 3BUYB 2VRQA 1M9WA 1J5DA 1PEWA 3Q2NA 5FFGA 4M7JH 3BP5A 2QFRA 3H56A 1BFTA 3LD8B 4ELKA 3I6LD 5C2BL 2YRBA 4NGHH 2MNWA 2RB8A 3ZR6A 1HNYA 3L2MA 3D51A 5GGUA 4JO2L 4JZJC 3GS0A 2ZAHA 5D1QC 4LHUB 4F9PA 1YCSA 1O0VA 4CILA 5I0VA 1IVTA 5HI3D 5D1QD 4Q9RL 3W3BA 3EHBD 1PZSA 3NACL 3K5RA 3QQ3A 1HWGB 3ARED 2P8MA 2RTTA 5C0IA 3TBSB 3FQWA 4Y5XC 1ZTXE 2WN2A 3RNQB 3KAAA 2P45B 1OKEA 3KYAA 3MNWB 2VDOB 4HK3J 4EDXB 2XNAB 5C0FB 1EPFA 3MV8A 3KXFD 3BZ4A 3D18A 4PCSA 3MMEA 5F72S 3VFRA 3BUYA 4DZBB 1L0PA 1G84A 1RPQA 1JHKL 1XX9C 1KUMA 3NFPB 3SGJC 3CQFA 4G3YH 1TJXA 2CHWA 1FNSH 3T3PF 3W39A 5DS8B 4KPHH 3QG7L 2J8UF 1MOEA 2UWEB 5KEZA 3KGSA 3II3A 1MY7A 1F5WA 5BV7C 4FQIH 2C9VA 4NRXB 4Y9EA 3TBSA 1E3ZA 2CO3A 3RNQA 2ENYA 3ZDZB 3MNWA 1ZRUA 3FS9A 3AXLB 4GG8B 1PW3A 1ANUA 1M2VA 4XC1L 3MLZL 2QHRH 4Z7WE 1AI1L 2R8SH 3PLYA 4AVHA 4KNUA 4EDXA 2WLNA 4UZSA 5C0FA 3O3BB 1I1AD 1P4LB 3GC3A 2J8HA 4OLZH 1BQUA 3H1ZA 3PJNA 5BOJA 4DZBA 2VLRB 1CTMA 4QNPE 1FA4A 1BDYA 3NFPA 3HRZB 3VGAC 3Q1SH 3RLSA 4A7GA 4P2RB 1WEJL 5C09B 3OWEA 1GS7A 3FRPA 2HJKB 2B5IB 3Q3GB 2HVJA 5DS8A 4K7FA 3T77B 1UB6B 4AENB 5IBLC 1DBAH 3NJGA 4H0LC 1UOWA 1ML0A 32C2B 1TTUA 3LNDA 1CFSB 5FX3A 4HKJA 4RIRB 1ZOXA 4LDLB 5F7EH 5HDRA 1KGIA 3BEVA 4FTVA 3O4LB 4RSYA 3GMMB 4FOMA 4FYQA 5EOCH 4UM9D 3AXLA 4YHMH 3BWZA 3JUYA 3VNYA 2IJ0C 3H42H 3HN5A 3L9RB 3O3BA 3V4UH 4NS0A 1P4LA 4KZDL 2JKLA 5SWSB 4Z7OE 5DVKA 3PHQB 3N40P 1OHZA 2VLRA 4YSDA 5IW1A 1I8IB 1EV2E 3NZSA 4RGNE 3FUNA 1OAYL 4MDIB 3CVHA 5JOFB 1COBA 1O6VA 5JHLA 1BQ5A 3ZZ1A 1KZQA 1S7QB 4P2RA 1V7MH 2JMRA 2BP8B 2HJKA 4MHHG 3Q3GA 3DJ9A 3T77A 3MJWA 2FTAA 4AENA 4YDJB 4RWYH 1T03H 1G1OA 1KJ3H 4NN7C 3LB6C 32C2A 2UUDH 1RPKA 3ZGIA 3EF7A 3EUUA 4FMVA 4NO5B 4FJYA 3V7AG 2XXFA 4H4NA 1NCGA 2HKHL 3ARQA 3UZEC 4OFPA 3QCTL 5T1KB 2M1KA 3ZZQA 3S97C 4AVJA 1SYSB 2CM6A 1O7DE 2VDQB 3L9RA 3PGCB 4XCYB 2ERJC 4IBSA 4FQLH 3L7EB 3B9KD 5SWSA 4JCMA 3WY3A 2HMIC 1I8IA 3C75A 1CCZA 4Y0GA 5KVDH 3KPLB 4MDIA 5E2VL 2IV9A 3S3PA 5JPMB 5ISZE 3O6FC 4KI5C 3RUGE 2CCVA 1BVNP 4DEPC 1AQMA 1WEJH 4ZMQA 3DKHA 3QUYB 4HWBA 5I5RA 3KLHD 5BRZB 4GG6E 3B9DA 3O6FD 1D9KD 4KI5D 1MNNA 4TOYL 2NY5C 2O5ZL 2GPZA 1T7ZA 1KC5L 4OIAA 4GRWF 2Y1YA 2P9RA 3QHZH 3D39D 3C60D 1CDYA 1CZ8L 2QQQA 2CBPA 3HHRB 2BVTA 4YZWA 1NIFA 3AQDA 3HBPA 1EEUA 4PY7B 2MTAA 1QZNA 2IF7A 3GSRB 3TFKC 1XGPB 5B38G 3EO9H 5T1KA 4K9EH 1VPOH 4HKZB 1IV8A 1SYSA 4F8OA 1EJOH 1A7RL 3TBWB 5HSFA 3PGCA 4XCYA 1OK0A 3MA9H 3L7EA 2E0PA 2HT2D 3I2CL 4G11A 3KLSA 3G5XB 3I9AA 4M3JA 2UYLB 4R26H 3V0GA 3PABB 3VG0H 1AIFB 1U8NB 2GYSA 2BLFA 4O00A 4K23H 3HHSA 5AG9A 4PCTA 4A7QA 1MHEA 4EJ1C 5EIVA 2LVEA 4XHJC 1U3HC 3QRBA 4AQEA 3LZLA 4G8IA 5BRZA 2A3TA 2GIYA 1H9VA 1P69B 2M8XA 3B9AA 1E5ZA 3MLYH 2A0LD 1CN4A 5CKAA 1CG9B 5DJ0B 3HB3D 2AK1L 4MJ2A 5DVMA 2DLFL 3T8VA 5I0WA 4PY7A 3B4NA 2ZF8A 2WLZA 4S2SA 2JB5H 2AJXH 1F6AB 1QLEB 1KXTB 1ZHLA 3AABA 3GSRA 1KPUB 3E1ZA 4B53A 5D2NC 3MRBB 2YKLH 2AJ3A 3EIFA 3VTTA 4DGUA 5E9DB 1UD5A 1MCEA 3PWNB 2I60L 3TBWA 3VRJA 4A2LA 2WCPA 1FBIL 1S7SB 4JW3A 1H3GA 5EV7A 3G5XA 2UYLA 4HIJB 3D34A 4NERA 3PABA 1AIFA 3U0WL 2WQAA 4NUQA 3EGSB 2AS5M 2AJZA 2FRGP 3AB0C 4LSVL 5HGHB 4PJGF 4L2LA 2EP6A 5LWYL 4M00A 2HN7B 3LRSB 3E6HA 2N0KA 1LP9F 1HCFX 3SDAC 5ACLA 1WFIA 3JWDC 4UV7L 1TQCC 4X9IA 5TQ0L 5EIIB 3V6OE 4PJEF 5DWUL 2AJSL 4ZD3L 4PBDA 2NX5B 1K5NB 3C87A 1YJDC 2R56H 5C0JB 5DZ9A 4F5CA 1F6AA 1KXTA 1ND0B 2VQ1B 2B39A 4FHKA 5MI0C 1XCWA 2F54B 4HJSA 3MRBA 3W5MA 1GKEA 3BFQG 3SQBB 2Z31C 4J3WA 2V3FA 3B5HA 3FMGH 3KCPB 3SKNB 3AY4A 5J89A 1A7OH 1QNZH 4IIQC 1R3JB 5C07E 2FL5B 1J9TA 1U2CA 2WXIA 1MJ7L 4HIJA 4OF6A 4QGTA 2Z8RA 4Z77A 1T6VN 3EGSA 2CHNA 5C0BB 2OR7A 5DUMH 4Z0XA 5HGHA 2RGSA 2IDTA 3IMBA 2HN7A 4MD5B 4N85A 4ONHA 4XXWA 2J20A 4KH9A 2WLHA 1EHAA 3V9EA 2OCCB 2CDGA 4H8WC 3S3SA 1CVSC 1XF2B 4L37A 3RVWC 2YPVH 3BUIA 2KH2B 4LCCC 2H6PB 4YXHH 5LNGA 2NX5A 1K5NA 5I73C 1PDKB 5HGAB 4F93B 4APXB 1A6ZB 5C0JA 3OKNB 1TZAA 5AKRA 1QOKA 5D96B 5HYIA 1ND0A 2VQ1A 2UZXB 4ODHH 4ZUUA 2F54A 1ZLSH 3FHEA 4P5MB 3BMVA 4OLXH 3SQBA 4WI0A 4RMQA 2NY7L 3SKNA 1R3JA 1MPAL 1F02I 2FL5A 3NSYA 4ANKA 3AGVA 1QG3A 2PP9A 1AZZC 1Q9KB 1TZIA 4IGBD 3MV7E 1LDPH 5C0BA 2JJTA 5L2JB 3NSFA 5CGMA 2BIPA 3HOGA 1ZT7B 1RLBA 4UNUA 5ITBL 2VGLM 3K3QA 3EYVA 3B8YA 4PG2C 3FT3A 1BZDA 3F85A 2IALB 3RGVC 1FYHB 3COOA 1JPGB 1XF2A 3BZDA 5EU5B 2XI9A 2H6PA 1DHKA 2WBJD 4L1TA 3VYOA 4ZMXA 3GIZL 3LNFA 4APXA 3DIVA 3OKNA 2MTPA 5E24E 4G7RB 4NQCD 5M7QA 4HDIB 1WAAE 2FK9A 1SOKA 2VE6A 5GS2H 2K8MA 4L8SC 2X6BA 1VF5C 4TL4A 2EINB 4QRSA 3BGFB 2JKTM 3VD4A 3LZRA 2B0SH 3DSFL 4BQ8A 2OR8A 4N3UA 3C6LD 4Q9CA 5F9WB 5ABDE 1BGXL 2A1WH 3M7OA 5C7ZA 1QPPA 3X3GL 4ODTH 3CDFA 1G1CA 3GJEB 2H45A 2P80A 3OQ3B 1NGZB 2VXVL 4JDTH 4EKJA 5JW3H 2BVOB 3P30H 5L2JA 1AFVL 4S0TD 1Y6MR 4W9JC 1F2XK 2AV7B 3SDDC 3WTVA 1M7DB 4OIFA 1U41A 1P4UA 1TLKA 1LQBC 2BWQA 3J8F7 3KG5A 15C8L 5AZUA 5IROA 1RURL 3IVKB 1JZ2A 1JPGA 1IBBA 3AY2A 3QPQD 1J0YA 4BFFA 4MYPA 5EU5A 4A2DA 3BUDA 4JRYD 3VWKD 4FYSA 4XMZA 1TYJA 4LCWD 4F7PA 3PGFH 3T0ED 1RK7A 4HDIA 4YHYC 3US9A 2VN5A 1EO7A 2YAHA 3OJ2C 3A6BL 3PFQA 3KPRE 3PWPD 3IU3A 3U7WL 1PCSA 2NY4C 2BNUB 3DA0A 2R1XB 3MRHB 2FB4L 4ZMWA 2PLTA 1MAMH 3MXWL 4PTUB 2NY4D 3NJLA 3PREA 3WD5H 1GYAA 4LARH 2ZKHL 3GJEA 2NY6C 4HD5A 1O9VA 4N25A 1E7UA 2KC0A 3DV6A 3HC4H 1WLHA 5EOTA 5LCVA 3WYRA 1KJMB 2AV7A 1XIWC 2LTQC 1KWGA 2W1NA 4X8XA 2LLNA 4P23B 3EH1A 4ZZFA 4U1MB 3TPKA 2IPTL 3Q8AA 5EU6B 1Z9LA 4QAMB 5KZCD 2SEBA 3UBXG 1H3XA 3HUJB 2EXTA 5HHQB 4EIBA 4V33A 3T0VA 4KTDL 3NK4A 1OB1B 5C2UB 3IN0A 4YDKH 2EDOA 2DIJA 2O6DA 3WXVH 3C5ZC 4L4VB 2BNUA 2AAVA 2R1XA 3Q1EA 3MRHA 2BRQA 2CIKB 3C5ZD 2PTVA 1L7IL 1T89C 3FO9B 1VESA 1E8ZA 2VC2H 2KLTA 1MREL 2MCG1 3UAFA 1EJFA 2XQYK 1T7WA 4YS4A 2G3XA 4P23A 2GUOB 4U1MA 2XN1A 3Q8BA 3LKNB 5B21A 5AD0B 2WQUA 5EU6A 5I1KH 1MVYA 2OSWA 4TLUA 2CO6B 2ZXWB 5HHQA 1H5BB 1WFJA 4P3CL 4WWNA 3F7PC 5E2WL 4DGYL 1OB1A 1D7CA 2D31A 1IAIM 2HRGA 3GSNH 3MPCA 2YBRA 5I0YA 3WOVA 4N2LA 4R2GC 4DEWA 5K93A 4HC1H 1S3KH 4KU1A 5FKAA 4L4VA 1JNHB 3SBWA 5DJAB 4ODWB 4Y1TA 4R2GD 5AZEL 5DO8A 1RZJL 1D7DA 3PQYE 2OK0L 3FO9A 3NBNA 4JY4B 4FE9A 4R4FH 5F3HB 4DSYA 5TE4H 3ARFC 4Z7AA 4NWUH 4RSVA 3U4AA 2D3LA 3CFQA 2Q2LA 4L29B 3ZDYF 1LO2L 2OKMA 3E8UL 1JFQL 3VM5A 4TNEA 5HXMA 1W0VA 2GUOA 3QWRA 5AD0A 3K71B 1QSFD 3KPNA 4WJG3 2B4CL 2Y5EA 5JPNB 5HPOA 1MW0A 1QEWA 2HH0H 1TTRA 3TA3B 3QE5A 5DGQA 6FABH 2CO6A 2BHUA 3B2VH 5DMIL 1H5BA 3NCYS 2LV4A 4YDVB 2QQLL 2E6QA 3EYFB 2ZSVA 4OLWH 1SN0A 3HMWH 4D2NA 3FH7A 1WC7A 3QUKB 5DJAA 4ODWA 4YC2B 2AK4B 4JB9L 1LWHA 4O4YH 1VADB 1RULL 5FIEA 2F9BT 2XQYG 4GXVL 5E51A 4CC0A 5F3HA 1C8PA 3AS2A 1I1RA 2VDRB 3FT2B 5ANME 2AW2A 2AABH 5I76B 5DD1H 1IFRA 4L29A 4Z8FH 4OB5H 2UZIH 3ERXA 1DBMH 5HJ3A 1EANA 2OQJB 3REVB 3VW3L 5AWNH 1Y0LB 5GSRA 4LGSB 5JPNA 2GTZB 5F6IB 1HSAB 4F24A 5K33A 3OHXB 4LSTH 5AEAA 4NNYB 4YDVA 5DDHB 3LN5A 5D1XA 3C09B 3EYFA 3IKKA 3MQIA 1M53A 3CD4A 3HE7C 3DVGB 2JI1A 2DTSA 1UD8A 4KHTH 4G83A 2AK4A 3HZYB 2BIOA 3IJ9A 4DFIA 1YDPA 1NPUA 3M46A 5IBUB 5CJXA 3EYUL 3VSUA 5FS5A 3DVIA 4JGUA 5EMYA 2IWGA 2A77H 4PJAE 2QMKA 5K9OA 1HL5A 3Q8CA 3FT2A 4N8CL 2YMTA 4HLZG 1KBWA 4PGEB 2ZXCA 4LXFA 3S6CA 4TSBL 3MAWA 4B9YA 4E41D 2OQJA 1Z32X 5DK3A 5EOCJ 3REVA 1CFNB 4BFJA 1Y0LA 1KBPA 4HS3B 2I24N 4HOMA 1VCAA 1AR1D 3O6KH 3OHXA 2ZPKH 4GRMB 4NNYA 2XRAH 3RU8H 2DQUL 4LGPB 2FEDD 3OPUA 1H9DA 1HNGA 3C2AL 3TYGL 4PJ9C 2NY2C 2X1PA 4QRPA 1JDDA 3DVGA 4Y16B 5B8CB 5JO5B 3P0VL 4XAWH 1T6BX 4PJ9D 3HZYA 5CS7A 2O6CA 2XG4B 3CV5A 2APWA 3HG1E 4UF7C 5KOMC 3NVQA 3AM8A 5LAXA 3RYMA 2H26B 2R0LH 3DHPA 3EOAB 4HUWB 3I85A 4ZAKC 4ONGL 1P5VB 1ZY9A 2BNQB 3VXTB 3KGTA 4NUGH 4OD1H 3AQZA 1BXAA 5A40E 3ILQC 4ZAKD 5L4MA 1AGDB 1JS4A 1GSKA 3IJYB 4L9LC 5IUCA 5BO1H 3FT4B 1CFNA 2JE8A 3X12A 1HEZA 4WFHD 3A6CH 2GY7B 4C58B 1KB5L 1KN4L 3HNTH 4HS3A 4WHDA 1NCCL 3H6JA 3NDYE 3RAJL 1HCVA 3BLPX 1EHLH 3EOBB 1NZRA 5ICYB 2OM5A 4CL7A 3MCYA 1YC7A 3HC2A 4OCXH 4YSEA 2ENJA 1OWWA 3H85A 3SZ6A 1QFUL 4YNYB 5B8CA 4Y16A 1MJUH 5JO5A 2OP4L 2IXQB 2IGFL 3ARGB 3X1EA 5E6IC 4ZFOL 2NDFA 1A2YB 2XG4A 4AG4H 2FHBA 1TSRA 4AGOA 1CLVA 3HG4A 1JPTH 1RV6X 1I85A 1P5VA 2WNXA 3VXTA 1SHSA 3OSVA 2W9DH 2BNRE 4N2FA 1UT2A 2ENSA 3DMMD 1EVTC 5I1HL 1BQLL 1AGDA 1F0LA 1MCJA 1Y18B 3IJYA 3PXHA 3GSOB 2G5RA 2DB8A 3FT4A 4CDGC 2WSPA 5L2KD 3RKPA 3QIBB 3NTCH 1UACH 4GP8B 4M6MH 3GK8H 3KZ8A 2EYRB 3P3YA 3EOBA 3L4UA 3CHRA 4G72B 4QXVA 5ICYA 5I1JH 1DJWA 3PV7A 3LZPA 4M7LL 4YNYA 2YK1H 1OGAD 2VXUL 5CCJA 2RFXA 1BQKA 4M02A 4ZTPH 3DRTA 5EUOE 1A2YA 3EYSL 5KVFL 3JUZA 3GD1C 3SQOH 1T22A 3C08H 3JV6B 5CBAA 3VE0A 2I27N 1HJCA 3Q2LA 2E7LA 3MV9E 4DETA 1YMMA 4JFYA 1W91A 1FORL 2FATL 2OV0A 4O02B 3GSOA 1BVNT 1I53A 4PRDB 5BW7C 1JGEA 1TKWB 3DHJA 3GI9H 3QIBA 4K5OA 4OD3L 4UT7H 3VXNA 4MCNA 3TJPA 1FLRL 4WI9A 4F1ZA 1AP2B 4JHWH 4ZMVA 2QSCL 1CVRA 1X44A 1OTSD 2NY1C 4AUYA 2GJ6B 4P2QA 1ASOA 1MRCH 2DYSB 3D9AL 3VXMD 1TENA 2GIXA 2F1AA 3KWWA 3W9DB 4A2GA 2AP2A 5KSBF 1JDCA 4PVBA 4FAAB 4OZIA 1JPST 2DWDB 2OI9B 3LEXB 5A2AA 3KCWA 4XNUH 3APMA 1NMBL 4Y4FB 1RU9H 4FYTA 3TV3H 3QAZC 3EYQC 1RK0B 4TULL 3T09A 4UQAA 4D3CL 1PGRB 1UM4H 4MA1C 3DTXB 2YD8A 3QEQA 4WUKL 4JG0L 5EORL 1J7VR 2IADA 4HQQH 5EF1A 4KY1H 1IM3B 1GW0A 2QPEB 4Q14A 2GJPA 4HSAC 3T6WA 5GRUH 1MCNA 1TKWA 3LN4B 2P47B 3V55A 1YA5A 3VAEA 1MQKL 4AGPA 1HAWA 1MCKA 5AW9B 1OL0A 3QRFM 1PZDA 2JSFA 1AP2A 2XJLA 2JJSC 2GFBA 3ULUH 2BCKB 2IOOA 1U6AL 1URIA 4QLRA 5CILH 1YG9A 2DQMA 3WFDL 4AEIL 5K9JH 4FZEH 4JO4L 4X9YA 2WXQA 3IJSB 5HHOA 3W9DA 2GEQA 3SPGA 5E4OA 4H1LB 2ZT9C 3OQRA 5I26A 1WDAA 2I25N 3LEXA 1CICC 4UUJA 4Y4FA 4ELDA 3TEZA 1OPOA 3C8HA 1SPDA 2NXYC 1BIIA 2WQSA 3MJ9H 4X4YB 4OBRA 1D3CA 4H88L 1MCLA 1RK0A 4J4PA 2OSYA 1ZHKB 2XJKA 3EOTH 4NZUL 1KGJA 4U1HB 4XMLL 5KSAD 5T33H 2NXYD 4KTGA 1GY1A 3DTXA 4UT6L 1MJ8L 3WIAA 1U8JB 4C55A 2JB6A 2QZQA 2Y2WA 1IM3A 3TXAA 3B5GA 1NAMH 1E2VA 2W0FB 3WTTA 3MUUA 3HZVA 3LN4A 3EFFB 1GAFL 2DKMA 3RFRA 4PBVC 5B3JE 2C3VB 3CDGB 4N2GA 1HXKA 4JKMA 4YDMA 4BZYA 4R97C 4WJ5B 1MWAL 2BCKA 2D0FA 2J6EA 2YXMA 3R1GL 4NO2B 1ZS8B 2WAQA 3BWAA 3ZXAC 4BJLA 1ZA3B 2GUYA 5I15L 1MHCB 4WKZB 3B6SB 3FU0A 4YZFF 3WXWL 3BVTA 5GGSB 3WS6C 1MI5B 1U42A 4POZC 3ULVH 1FHNA 5GS3A 1NCBL 4PRID 3OZ9H 4X4YA 1NLDL 5I19H 2Q87A 4G6FD 1U8MA 2A7BA 3REWB 1FL3A 3RIAF 1L9PA 3L9YA 2YBGA 3MRQB 3QQDA 2BX5A 1U8JA 4Y4HB 1S7UB 3T3PE 2QQNL 4Y88A 1C7SA 1JERA 3EGDB 4EI5A 2J8UE 3BWSA 3QIUC 4FI7A 2W0FA 4PG9A 2R0ZH 1XBRA 1G6RB 2QTVA 3EFFA 3GBMH 3DVFA 3IS1X 3UTQA 2Z4QA 4JFEB 4IOFD 4ZW8A 3GF8A 4WJ5A 4GJTB 3WKMH 2IH1A 2K6WA 5E7BA 3O9WB 2NY0B 1YEWA 4NO2A 1ZS8A 3KLAA 1B2WL 2KPWA 1CGSH 1KTLA 1AKJA 4HBCL 1MHCA 4WKZA 2V2XB 1S7VB 2DEXX 3UGXA 2LR4A 1I9RH 5GGSA 1MI5A 3P3SA 3VD1A 1CLZL 3AS3A 3V4VL 1BV8A 3ISYA 3KH4A 4JFZL 3QGVA 4GO9A 1WITA 1WWBX 4YSOA 3CFCH 1PD0A 5IQ7H 3V0WL 1YYML 1LYQA 1RP8A 3REWA 2G9KA 3MRQA 1S7UA 1B2YA 3HI5L 3MBXL 4PYGA 3I6KB 5AOZA 1O9WA 4KKAC 1JZJA 1PYWA 2IBGA 3D2UB 4ZQTA 2MPAL 4MNQE 1PY4A 1X4ZA 2VLJE 3DJRA 1EJ6A 4JFEA 3STZB 4YSAA 3LH2L 3FJTA 2EDXA 5MERA 3O9WA 2DBLH 2IWFA 4J3SA 2EC8A 2JWYA 3L4CA 2E75C 4G42A 4GYBA 2V2XA 1NCJA 2FUTA 1GMEA 1MHHB 1X9LA 3I6LE 4Y1AD 1ETB1 4ODXA 4BWWA 4XPFL 3UTZA 4DTGL 5GPRA 1U8PB 3NFSL 5DZNA 1HE7A 2CBQA 4ZFQA 3K91A 1MW1A 3C9NB 2WTRB 1T21A 5I1GH 4PJ8B 3UJIL 4YHZL 5I0XA 1R3IL 3I6KA 2AMUA 3K72B 4G6KH 4PVMA 2FCBA 2DKSA 3IN2A 5KANG 2MCAA 1P6WA 4FI8A 4G59C 1NBQA 2TAAA 3WSQH 3EF4A 3BP4B 5BNXD 5DJYB 2XWRA 4E5XG 1CBVH 1UFGA 2AGJH 1H3VA 3P0YL 3POHA 1ADQL 3BXNB 3AQYA 2Q86B 1MAJA 1MHHA 1SY6H 3VFNA 4RFEB 2GHZA 5DFAA 5JYLA 2ICWB 3NMEA 4MQSB 3TH3T 3ENEA 2WJ5A 4F15B 4G80B 1QEXA 2EXWC 3QFGA 4UT9L 3C9NA 2BHZA 3H53A 4U6HB 4K9EC 3WDHA 2MPVA 2MQCA 3E9TA 3O2WL 4R84A 7FABL 2P26A 3P2DA 3K72A 1A14L 1VGKB 4XZ4A 2GEEA 1E3XA 4DP6X 4GRWE 4EI6A 3T3MF 1CLOL 1EEZA 2DQDH 4RRPA 4X7CC 5DT1L 4E9RA 4XMKL 4JM2D 4X80H 4KAQL 3A21A 2X0VA 2RALA 4QRTB 2TRYA 4NZTH 1XFPA 2F19L 3H6AA 3MUHL 4W9LC 3BXNA 1XH0A 5LGHH 1G1KA 2J5WA 1Q9WB 3MROA 4OF7A 3S2CA 1B90A 4PS8A 2WB1A 2ICWA 1NJ9B 3FAWA 2CRZA 4NC1C 5AAMC 4BRJA 1HESA 1MFAL 2GTQA 2VUOA 2Y22A 4G80A 1HQRB 4ERSH 3C12A 4NP4H 3MRPB 2WTOA 4P59H 3A5VA 4Z5RB 2P5WD 4QKXB 3LZFL 3BGAA 3ECQA 4IYKA 4ZG1A 4KOCA 3WL9B 1W72B 1R33A 5GRVL 4Q97A 2VR6A 5K39B 3GJFK 4LK4A 1W6WA 3D3VD 2OL3B 3DIFA 4MRBA 2XVKA 4N0YL 3OKYA 4ZBJA 5K1JA 5D8JH 4Z7WA 1ZLDA 5I18H 5IESL 1NUGA 4QRTA 4UANA 3CCHB 2ED7A 3MODL 2P1YA 2K4WA 3DYMA 1J5HA 2WPGA 3C8DA 4JKKA 5GZNC 1Q9WA 1D5IH 2K1MA 4GI6A 1M71B 4XVJL 2XVLA 1IAIL 2FIRT 4QY8B 2XQBL 1BBJB 4LSSH 1LMKA 1NJ9A 2GT9B 1AGCA 4JHUA 1IT9H 1HQRA 1KG0B 3B7RL 3LXAA 4JRXE 3I50H 4GQPH 2QSQA 3PXLA 1DVFA 4X4MA 4B41A 5IVXF 2QEJA 1IZKA 2EXYD 4PJGE 2FQEA 3BDBA 1KCSH 1QBLH 1LJMA 4Y2DB 1OOAA 1LP9E 1W72A 1XD0A 5E2TL 1T5KA 3UG5A 3BH9B 4EXKA 1F97A 2OL3A 1A66A 3MBED 5DU7A 1INEH 1F4WL 1FVEA 4FEIA 3MZTA 5EO0A 2BOBB 2HPOA 3O41B 1JHLL 4AT6B 3O2DH 5I30L 2PXYC 3CCHA 5E8OB 3RY4A 3V2AR 2JK5B 1NGXB 1I9IH 5DD0L 3MYJB 2Q7YB 4YBHA 2X3CA 2V33A 4FA8A 3T4AB 4EIUA 3DDFA 5H35A 4QY8A 2DWTA 3L3OC 1BBJA 2L7JA 2NXZC 1F1AA 3WFEH 4NQXB 4KROB 3T6QC 4YX2H 1KG0A 4QHNB 3P40A 4AUUA 1EHXA 3RVTC 4RZKA 3EH2A 4FLOA 5DLMH 1RD6A 3GSXB 3D39E 2OYPA 3IPFA 4CN1A 5I74B 1XF3B 1J1OL 2WO3B 3EXJA 4X7SL 2VYRE 3RVUD 4KXAA 4ABVA 4E9LA 4P9HL 2JNZA 3TN0A 1MDAA 2VZ1A 1DUZB 1ET7A 1XR8A 1YECH 3QZMA 5EA0L 1S9VB 4XN8A 1FNEB 2FO4B 1P7QD 2BOBA 2COVD 2PWHA 4KJYB 4YN3A 4AT6A 1K72A 4X6EB 2Z7WA 2H2PC 5E8OA 2JK5A 2XZAH 1NGXA 1ZLUK 2D7OA 2V7HB 3IU4H 4ZUSB 2F7IA 4FP8L 1N64H 3T4AA 4E36A 4UB0L 5DJ6B 3D85D 3NA4A 4HWNA 4DH2A 3EDDA 4WHYG 3QUML 2ED9A 4JKPL 3RUGA 4DP0X 3JT0A 5I1AA 2Z7YA 5MENE 3KE0A 4FD0A 1ZA6B 1E65A 4K3JH 4G8GD 3F3HA 4HG4K 4GG6A 4WTZA 2G3MA 4NI3A 4QHNA 4OVVA 4G8AC 4MXWL 1Q9OB 3HAEB 2B3RA 4MWFB 5IGXL 1MNUH 1SJEA 3MXVH 4XCCH 5DJ2B 5GS2D 4DPAX 4R4NC 2EE6A 1UD6A 2HG0A 2WOBA 1S9VA 3JVFC 4H2CA 4QXGH 2ITFA 1FNEA 2FO4A 4KJYA 3WO3B 3G5ZB 3RTQB 4QF1B 4U1IB 4HJJL 5IMKB 1EAPB 5G4MA 2G9HB 2P42B 3VJ6B 3BZFA 1ZLVK 1JYVA 1MCFA 2Z7UA 4A2MA 5DJ6A 5JIPA 3UZQA 3RKDC 4CBPA 4H0HB 1PZAA 3NJXA 5BMFL 3GJFH 4UAOB 4PJCF 3PDDA 2YIHA 4IOIB 3RKDD 2PWDA 4K7PL 4P99A 3QXTA 2ZOTA 4HF5H 4RQQA 3A22A 2XKSA 3B83A 4LCIL 3D4CA 4YAQB 1N8OE 3HAEA 4LP8A 5CZRA 2WB7A 4MWFA 2OMYA 4J6RH 1LNUB 1KTBA 5DJ2A 5EUKB 4KXZH 3KYMB 3QHFH 1ZEAL 1F41A 2K7PA 2W60B 4XNQB 4AVIA 5D70H 3OR7A 3WY4A 1S7RB 3LNEA 1DCLA 1LDSA 3G5ZA 3RTQA 3BN9D 1JFHA 3S8GB 4QF1A 2C9QA 5IMKA 5EU4A 2R51A 1P4IH 2ATPB 2G9HA 3EZJB 2X4SA 4OFVA 4U6VH 2YQ3A 4JFDE 2RCSL 4MD0A 1WS7A 2EDBA 3U7YL 5HJGA 4G71B 5CF3A 4NN6C 4Q58C 2DI8A 3L9BA 2HPTA 1P84J 5DS1A 4Y19B 4R0LA 2DH2A 1AR2A 3VMNA 2VT0A 4NHCH 1P1VA 4EQ2A 4YAQA 5L8KB 3NRQA 1DQVA 4LSPH 3G9VA 3ZRFC 2VDPL 3V6OA 3QDJD 4BSVB 1LNUA 3RDTA 1P4BH 5EUKA 1IBGL 3MLWH 1E4XH 3KYMA 4IDJL 5TDOB 1MCPL 4NKDB 2CRMA 3OF6D 2VZTA 2JCWA 4WK4B 1S7RA 2WM0A 2E5EA 2FX7H 3CN3A 4TV3A 4MDJB 4LHUD 3FN9A 1ZE3H 2W81C 1NPNA 1NCIA 1ZPUA 2ATPA 2E6PA 1JGLL 3HLAB 1IKNA 2E27H 1NC4B 2X6VA 4M1CD 3K8MA 3M45A 4LBAA 4I0PB 4BFRA 2BW5A 2KPNA 3LEYH 1L9RA 2H0EA 5D7JB 1I31A 2DY2A 4ODVH 4JPKL 4OCRL 1WG3A 2VJ0A 2YMOA 5HVHB 3PJLA 2XWBA 4FYRA 2X4OA 4NOFA 4NZFA 5EUOF 1CTNA 4XPTL 2HLFC 1NEZG 4XMUA 2XWTB 3L3KA 2LU7A 5CUSH 3V6ZB 1ZLUH 2X2UA 5B7MA 3QWOA 3DX7A 4BSVA 2MRYA 5DO2D 3JYBA 4BZ2L 5BPPA 4OZFG 1LD9B 2GC4C 2WZ5A 4GS7B 4NQCE 1F4HA 1FDLH 3OSKA 1E4JA 5TDOA 3TPUA 1P6AB 5T8IA 4F92B 5KVFE 5JHBA 4MDJA 1YYLL 4WV1B 1N2RB 4G5ZL 1NC4A 3HS9A 4WHCA 3I02B 3GWJA 1N6UA 1VGEH 2XZCH 5I6NA 5HVWA 5D7JA 1HEJC 3BQUD 3MLRH 3MJ6A 3ZE2F 1FO0B 1X9RA 3I6GB 1G7JA 4CNIA 1HT6A 4J3UA 4ZUTB 1A6UH 2M2DA 2O30A 2WLJA 4IRZL 2QZ5A 2XV6B 3BX7C 3GSUB 2VITA 3QPXH 5GZOC 2NMSA 3LYRA 3BIAX 1WIPA 2XWTA 3IETB 1BF8A 1I3VA 2DQHL 4ZYKB 3VB8A 1QBBA 5DTFB 3V6ZA 3MRKB 5E94B 3ZDYE 4L5FH 4LQFL 1XXFC 3HC0B 3B1TA 3FO2B 1XCQA 3L3HB 4QUOA 1ZLVH 3WO4B 3WNPA 3ZY7A 4JRYE 2DMCA 1RJCA 3P4MB 4LCWE 3T0EE 3P73B 2CJTA 4QEGA 5GRYA 3DROB 4R5XA 4RNRB 3UIYA 3FB6B 3PWPE 3GHBH 5C09D 2V5YA 3ZE1B 3K81A 3RGHA 4I89A 3CJJA 1SXZA 1N2RA 3CX5J 4N0UB 3KPSB 4F7CB 3WNNA 4Z3EA 3KYKL 2X2JA 1PSKL 4JO3L 2FECI 4W81A 3W11C 3G5WA 2JXMB 4WSKA 5HGGS 3RIFK 2ETWA 3KJ4C 3QR2A 2WQXA 3I3DA 2XWEA 1FO0A 3I6GA 35C8L 4JQVC 3CDZB 5J56B 4ZUTA 3DGDA 4NKQB 4BQBA 5GJTH 4Z7UB 4TUKH 1UD3A 4I88A 3O4LD 1OIOA 2NR6C 1EXHA 1T66C 3DUUB 4OZFH 3PF2A 4X42A 1WZLA 3FYIB 3OJVC 4NM8H 3IETA 1ASPA 4NKIL 4KWUA 4ZYKA 4BK4A 4N2CA 5DTFA 3MRKA 1RJYA 4J3BA 5E5MA 1T66D 5E94A 1A3LL 1YEKH 3HC0A 3FO2A 3L3HA 4OKVA 5SWSD 1VAHA 2YUXA 3P4MA 2XTJC 1RZJC 4LVNC 2DD8H 4ZT1A 5D6DC 1F18A 4DP2X 3DROA 4WTXA 2IAMC 4RNRA 3FB6A 4HWUA 3D30A 4LP5A 4PJ5B 5JA9A 2PTUA 3KPRA 5F7UA 5IJBC 1HJBC 4X9HA 5JR1L 4LLVB 4RAUB 1XB6A 3KPSA 3L4ZA 4I9WD 1VFBB 1T7XA 1TZOA 3GXMA 5ACZB 2JJWA 4PV1C 4BELD 1S7WB 4XVSH 3MJ7A 2QT6A 5DK2A 3LPPA 5HVGB 3CVIL 3WENA 1N3NB 3CDZA 3GMNB 3H3KA 4HWZB 2WXMA 4ORZC 3RY6A 3X2QB 3UJTH 4Z7UA 3D48R 4PJDB 1ZT1B 1FG9C 4A2FA 3DUUA 4OFQA 3M1OA 1FJ1B 3HE6A 3UAJC 2H1XA 5T1LA 1IM9A 3OMZA 4DPRA 4GT0A 4A7GF 4OI8A 3GMOB 1KENL 1G9NL 1RJZB 3ULAB 2A9ML 2RJMA 1B4JH 4DKAA 4HJ0C 4N4YB 1RVFH 2HKFL 4Z0BL 3SCMA 3PHSA 5DURB 4PJ5A 4M5ZH 4PLJC 3QUYD 5L7XL 5BRZD 3SJVE 3PUUA 1JGUL 4MFHA 4P4KC 1SXCA 4GRLC 4HD9A 4LLVA 1B0IA 4RAUA 4QT5B 1NDMB 1T1WB 4PLJD 4HOZA 1TQTA 2EYTA 1V54B 5ACZA 4WWID 2DF3A 3ZDZF 1YEIH 2VN6A 5H4YA 3DK2A 3UAEA 2P5PA 4NKMB 3SGKA 3INUH 1EAOA 5CR8A 3RNKB 5I6XC 2GABA 4XXDA 4PJDA 5C7XL 2OZ4L 5IEHB 2AEQL 4Y4KC 2HLAA 3TEYA 1QSFE 1UWGL 1FJ1A 2D7PA 5IB5B 3WNJA 1K3IA 2ZCKH 4BE6A 2BSRA 1G7QB 2XXMB 3IFNL 4OUOA 3UO8B 1CDBA 2BVYA 3U0PB 5EDSA 2CKNA 3MBWB 4JHAL 1RJZA 3LQAH 4KUZH 1CIDA 2MOGA 4HS6A 4RISL 3RPBA 3WU1A 3J07A 2ADFH 1NTDA 2GJJA 3CU7A 3MRCA 2XTLA 5FO2A 2FT7A 3VD3A 1TETH 1C08B 3GKWL 4QT5A 1QATA 1NDMA 2ZKWA 1OAXH 2FLRT 3PQYA 2CE6A 2BRRL 2E3VA 1BPVA 2ZX9A 1WCBA 1K2DB 4L3AA 3C5SB 3ETSA 5LLIC 3BT2H 1K8DA 1RFDH 2OMZB 1IO4C 2CU9A 3G04A 2ZUXA 5F9OL 1J0HA 2CGYA 4CU7A 1GIGL 3IDXL 4HHWA 3NQKA 4G6ML 5IB5A 1PD6A 5E9DD 1G7QA 4FQ1L 4G9FD 1USZA 5TD4A 3UTTB 3MBWA 1Q72L 1DQLL 4P4RB 5I6MA 4UZUA 3W37A 1KIRB 1JRHI 3H2QA 3KPOB 5BS0E 2WYIA 5B1AB 4JNXA 4QRRB 4MQXC 4GBXC 3ULSB 5FHAH 3OWRA 4BKTC 3KW7A 1M3JA 5F7DB 3TESA 1UG9A 5IKCB 1S9KC 1F1GA 2CH8A 5DEFB 5CSZA 3GPSA 2JELL 3IAGC 4PGDB 4M48L 1GJIA 5EBLA 4W6WB 1K2DA 1A1NA 3C5SA 2L7EA 2X4PB 4MJHA 1CXHA 4OD2B 3WLBB 1OM3H 2OMZA 3FCSB 5BXFB 2H0FA 4E41E 1CFQB 3KHQA 3RX5A 2VIRB 4BCYA 1BAFL 3VFGL 1V5JA 4JFOB 2EUZA 3FQNB 3QI9C 4NQQA 5IHZB 5D7SH 1BYPA 4UU9B 1IC5L 4AYBA 2C7UA 1IGIL 3UTTA 1KIUB 5IUSA 3QI9D 3B7UX 1ZVSB 5KBPA 1KIRA 2AF2A 4PS4H 1DTUA 3FN0L 4TNWF 1KACB 4WO4C 4I3SL 5C0BD 5CGYD 3ULSA 1Z5HA 1Z9PA 3QXUA 2KZ1B 5F7DA 4OF8A 3D0LB 3NA9H 1O6SB 2G2RB 4WO4D 5DEFA 1F3DH 4RFOL 3PCYA 3QXAB 4PGDA 1BZ7B 2DKUA 4QTFA 3VI4B 3ZSSA 4PJAA 3PWVB 2X4PA 4OD2A 4TPRH 1BEYL 2EO7A 4GIAA 4D7BA 3WLBA 4GAJL 1TYEB 3FCSA 4W9HC 5BXFA 4EQ3A 3O3DA 2R29H 3GRBA 3KL3A 3OXRB 1CFQA 1SQ2N 2HJFA 2Y3NA 3ULUD 2VIRA 4CDHA 1AXIB 4WFHE 1QFWH 4WY7L 4XO4A 4JFOA 5JTWA 3FQNA 4Q2ZB 3TJEH 5MEPA 2H8PB 3HNVL 5I6LA 1MY5A 4UU9A 4YMPA 1KIUA 2HX9A 3TOPA 2EABA 1H8OA 3APNA 5HYJD 1E3FA 4Q6IB 5E1HB 4F7TB 5DD6A 1E0OB 4ANVA 2PWEA 3FF7A 4JCLA 3L3IB 5HD8C 1N7MH 2J88H 4KMTH 3JQOB 3D0LA 2CD0A 2YA1A 1O6SA 3BE1H 4PJBB 3OTTA 1ZIAA 5MEOA 3L1OL 2X89D 4Y5YA 3QXAA 5HD8D 1BZ7A 3LZQA 3VI4A 4B5ZA 2W5PA 4M61B 1I1FA 1A6WH 3X3FL 3PWVA 5AVQB 2C3XA 2E7DA 5GRJL 4K4KA 43C9A 3UJJL 5JIMA 2E9GA 2F68X 4POUB 4DQOH 1TNNA 4I4WB 3OXRA 1R5WB 5L2KE 4QRUA 2FLMA 3BRDA 3BAEL 2CM5A 4D0CB 3QDMD 4Q2ZA 5CD5D 3VI3B 1AOHA 4XMPL 2VDOL 1A3RL 3OJDB 3ULVC 2DAVA 2JTYA 2NZ9C 2A73A 3TVMA 3BP6B 3HMXH 4X7EC 3THMH 2MCPL 1W9XA 1LE5B 3Q01A 4Q6IA 3OZLA 4F7TA 4EZLA 1OGAE 4MXQC 4P5TC 2Q3ZA 3DJTA 1T6WA 1KWKA 3V0DA 3L3IA 2VDKH 4JZOB 4PGJA 4HFWB 4XOEA 4Y5VC 4HXBH 3PAYA 4MXQD 4BKSC 3CFIC 3MFFB 5IMOA 4Z7QE 4YZFE 2W80C 3WNOA 5L0QC 5CN2A 4M61A 4JY5L 2I32A 4JPVH 1CXKA 1CYWA 4D7PA 2BNRA 3FRPG 3S35H 1KJ2B 2XUWA 4I4WA 1R5WA 1KDJA 4QOKB 1VZGA 1OE1A 1NEPA 4KH2A 3O3AB 1CK0L 2DMHA 3BVVA 3L5IA 5F93C 3LPGA 2R9HC 2WN3A 5BCAA 3ZVVA 1YLBB 2QPSA 3OJDA 4J2XA 2D0HA 2VL5B 1E9OB 4UQEA 4XNYL 3BP6A 2R9HD 2XBZA 1LE5A 3BD3A 5FA4B 5KYNA 1FZKB 4JFPB 4H8UA 2AQPA 2V3EA 4BK5C 4ZX4A 2F58L 4MCZA 5C0RH 3AU0A 3TM6A 5AZ2H 3OZKA 5JHLL 1AVAA 2QLVB 3L1GA 4AE1A 2ZOUA 2J1YA 3NJIA 2X4TB 1XEUA 3MFFA 1UXSA 4KFMA 4H2AA 2EDMA 1ACYL 3VH8B 5EU6D 1AHKA 5C1MB 2NOYA 4IKLA 5J12C 1CFTA 1RUPL 3CC1A 3HR5B 3VA2C 3MV9A 2DMBA 1J1XH 1KJ2A 2Y6SC 3N41B 2EADA 4O2FA 4QOKA 1VJSA 4M7LT 1E6JH 3IDNB 2E7MA 2BSDA 3HS0C 4PUBL 2R69L 2FEEI 2X2IA 4ZXBA 4MGXA 1E9OA 4KK6D 3NSJA 4KI1A 4ZO9A 3SDCB 1R34A 1CXEA 3LOWA 1D6VL 2AI0H 1S7TB 3L95B 4JQIL 4LSQH 4JFPA 3F12B 3WUWB 2CR0A 5KW9H 5IFAH 3SQRA 4IS6B 4WEBH 2H1PL 4B0MB 3FRUB 1UWEL 4F3FB 3KLKA 1XWVA 4XC3H 3TWCL 4LRIA 5HDBF 4TN9A 4TSAH 5D7LD 3G6DL 1SM3L 3TC9A 3UADA 4OZHB 3ZT7A 1DBJH 3TS8A 4OZGB 5CNHA 3SE8H 4DN4L 4UV4L 2NT0A 1R75A 2KZKA 1DP0A 4GH7B 4R90L 2W9EL 2C3WA 2NNAB 4ILDA 4YHIA 3S34H 5ID1B 1DDHB 3BPLC 2X28A 3ARBB 2A9DA 3BSGA 1GXEA 4B3EA 3K2KA 1F90H 1CDIA 2VDQL 4NB7A 4F58L 1WIOA 4K7PY 4XP1H 4D0BB 1AG6A 4RZCA 1MW2A 1HHGB 3FSZA 4YJZL 3FULA 1DQJB 1S7TA 2HT3D 3KR3H 3LHPH 1OW0A 2OMXB 4K71C 3JXAA 4N5ED 5LN8A 1AGFB 2G2NA 5MP6L 2NCMA 4U0RC 1LL1A 4KO7A 4Q7DA 4TLKA 4IS6A 3UDWA 2P3YA 3CVHH 1DBKH 1DL7H 1OCOB 3O11B 4JHZA 5DHYA 1P6FA 4HPOH 4MHHI 1A0QL 3VGDA 4LSRL 4FA6A 3MLTB 3P77A 3QJQB 1J9SA 2A99A 4JG1L 4N2KA 4KQ0A 5B1JA 3TA3D 4P9ML 2UY6A 1WBXA 2QTEA 1LXMA 5EN3A 5IMMA 5IV2B 3EJZC 1KTJA 1KELH 3MLVL 5H94B 4XP5L 4MJ4A 2NNAA 2QVIA 4CVXB 1TMQA 2N59A 1DDHA 5CIPH 3B2DC 2AJYL 3ARBA 3PY9A 3DC0A 2AK4D 2WUBL 1P1ZB 3EJPA 3QBTB 2YAFA 1XZWA 2Y2TA 4D0BA 1HHGA 3T3ME 5GHWH 1DQJA 4YBLC 2OMXA 1KXQA 2Z6FA 5KG9B 3IJHB 1ODUA 4OLEA 3OPZL 1MRFL 1HILA 1MF2H 1J48A 3GSVB 1EDYA 3O11A 3DPDA 5I71B 5H37G 1KB3A 4ELMB 1YQVL 3AG2B 5E6SB 2YS4A 4X2UA 3U4KA 3RVXC 5GJSL 3SYAA 1D5BB 3MLTA 4HWBH 2CALA 2NUPB 1SMDA 1E4KA 4AK1A 4L1LA 3RVXD 1D2OA 3N9GH 5FOBA 2Q8AH 1XCXA 2HTLC 1DE4B 5J13C 1B0RB 1JVOA 5IV2A 1BXUA 3HVNA 3EKCA 2J8UA 5H94A 4OT1L 1ROWA 2HTLD 2YO3A 4K3DL 5LDUA 4CVXA 5ECGA 3GBLA 2BZ7A 3P9MB 4HV8B 1QLEL 3CAFA 5FGCE 2XWZA 3QJTB 4NDMB 2VLJB 3B3IA 4XB3A 3QQ4B 4FMKA 4M6AA 3RHWK 4DKEH 3ALPA 5FO8A 3DX6A 4H44C 1AXTH 3IGLA 2HJLB 4XNAA 4JVUA 4URTB 5KG9A 4LOEA 4HGWB 5ID0B 2CGRL 1JNLL 1WWWX 1W15A 1SMAA 3MU3A 4K8RD 5E6UB 3GSVA 4NIYE 1KLFB 4DW2L 5HY9B 2P46B 3F62A 1QRND 1J0ZA 2KI6A 4FNLL 3VCLB 1D5BA 1FL5B 4NO3A 2NUPA 4Q74A 3RZCA 3P2BA 5FO7A 1RZ8B 4JZJB 4HPYL 1OCWH 3VXUD 2WQVA 4B97A 5D1QB 1DE4A 1ZLEA 3EHBB 1WH0A 4YHNB 3WEOA 4HT1H 3QZLA 4R7XA 2BY3A 3HBZA 4B27A 1IGTB 1SZNA 4APQD 3P9MA 4HV8A 3U9PL 4D9RD 4Y16D 5FW6A 4NDMA 2VLJA 4IMKC 4Y5XB 1YEHL 3SGDH 1YUHA 2FSDA 4CAGA 5E99H 3A4FA 2VJXA 2ZOWA 1S78C 1DANU 3KXFB 2HJLA 4Y89A 5H37H 5TJWK 2BNQD 4GSQA 3QUZC 4HGWA 5ID0A 3WKPA 1L9MA 4QTHB 2L04A 2EDTA 3CPUA 4X50A 1EGJL 5ADOH 4OUUB 1FZOB 3FO1B 4XXCA 3D87B 1KLFA 5DHMC 2Y7LA 3N91A 2ZWZA 3VCLA 1FL5A 3KJ6L 5C86A 4IJ3C 3HS8A 3QQXA 3HKFA 1RZ8A 1IC4H 1IFHL 2DI9A 1PG7W 2DZEA 4M93C 4OM1L 5D1QA 2FIKB 2OTWB 4AV4A 2NNCA 4PJ7E 4H7VA 3ZYIA 1UVQB 4YHNA 1VIWA 2W94A 3AREA 2Z9TA 1ZHNB 1PIGA 4OJDH 5LBSL 5SWZE 3KWUA 3G08A 1B0GB 3ARGD 3GIVB 4Y5XA 4PD4K 4QHUA 5KUMA 3GO1L 4R7DB 4W9KC 1I1AB 3KXFA 1QSEE 5I8CB 4NN5C 5I8KL 3EZ8A 1AHWC 4YXKL 1UZ8B 1K4CB 3B37A 1RXLA 4HFUL 3WEAA 4DK6A 4OUUA 1FZOA 3FO1A 3GLAA 1GHFH 2NDGA 4WSJA 3MRFA 2ITDB 2N7AA 1CDGA 2CXGA 1ID2A 4IDLA 2YSSB 4GMTH 3VGAB 2B1AL 1FRGL 4X6CB 2IVFC 3MRLA 5GIRA 3VGHA 3KPPB 1A7QH 3CXHJ 2MQ3A 4I2XB 4FFVC 1EMTL 2FIKA 2OTWA 4A7SA 5B39B 1RLWA 4J39A 3H2WA 5EB9A 4DUVA 2R0KH 1HK6A 5IHHA 2ZOOA 2XN9B 5FM4A 3WJLC 1X3DA 4MAYC 1I7ZA 3D3VE 3O45B 3OG6B 3MLXH 2YRLA 4QJ3B 5F8RC 1AE6H 1V3KA 4XP9H 4FQCH 1B0GA 3GIVA 4UM9B 1FYTD 3CK0H 4MAYD 1KBKA 4R7DA 2WZ6A 3FOMA 5AFAA 2PR4H 1I1AA 4C54A 4Z7VB 2EDRA 3BT0A 5AVUB 1UZ8A 2IH3B 4I18A 4UIKL 4U1KB 5F0LB 3ZE0E 1T1XB 2R83A 2NY3C 3IJEB 5FYKH 3VXRB 1QLFA 2ITDA 3ARXA 1RUAH 2ZWNA 4U2ZA 1O5PA 1TITA 2YSSA 3LCYA 3V9FA 2DEWX 2F2HA 4KC3B 4X6CA 4QIRA 5CN1A 3KPPA 5AB1A 3PAZA 1WZ1H 4JPWH 4PTTB 3CQPA 3EFDL 5B39A 2YRZA 1F4YH 4P3WA 2IO5A 3WFCL 2GJ6D 4NN7B 5FUZH 2A6JB 2HFGH 1DQDL 2XN9A 3I9IA 4I77H 5CJQL 5FC9A 4LKXA 5EOQL 1QBML 3O45A 1NBVL 3FL7A 3F58L 2Z3FA 4UM9A 3MACH 4J1UA 3Q6GH 4IK7A 2RD0A 3K5SA 4DVRH 3NK3A 1V3JA 3EADA 3V52L 4TYUA 5EU7E 4BZ1L 4OZ4A 1P0SE 4N6QA 4Z7VA 3B9KB 4X6DE 3EDJA 5CJOH 1AZUA 2VDLB 2IH3A 2ERJB 2XBTA 2ZQKA 3CZGA 3QWNA 4M7KL 3VFVB 3FQRB 2GITA 1XF5B 4F2FA 2ZYSA 1IIIA 3CIQA 4HXAL 4PWHA 4FZ8H 4RAVB 3O6FB 3UG4A 2CJ3A 1MUJB 4QRAA 4DEPB 5A2CA 2OCJA 3QDGD 2X4QA 4PTTA 5KS9B 3A67L 1X7SA 4GUPB 5BQ7B 1OGTA 3D39B 4XH2A 5JW5B 3C60B 4RDQG 2PO6C 4PJGA 4Z95H 4U7KA 1KBGH 1CPUA 2A6JA 2AV1B 1ZE3C 1LP9A 1LQSR 4GW4B 3MRIB 2IANE 3MRNB 3G6JB 3DO7B 5A2LH 1WT5C 2Y69B 1UH4A 4DNLA 1SVCP 1TOXA 2XACC 4YVUA 1F3DJ 3GKZA 3W1ZA 2NZ1A 1Z9OA 3MYZA 1GKOA 4BH8B 3B9KA 3IFOB 4KJPC 2WANA 4J3TA 3MNVA 4MA3B 3WNIA 5GS0H 4WUUD 3QULB 5DR5L 2BP0A 3D5OF 1UA6L 3KD4A 2R4RH 2Y36H 4MXVF 3VFVA 1U95A 3FQRA 3QYCA 3PHOA 1S46A 1XF5A 3PP4H 2Y7SA 5LCVH 3SE3C 1AOZA 5IMOB 2VABB 2BERA 3ZDXE 4G8GE 2WJ7A 4RAVA 4LNRB 5C6TH 3O6FA 3VG9B 1D9KA 1I9JL 1MUJA 3WIHA 1U3HB 2P5EE 4M29A 1J5CA 4ECNA 4OZIF 1EHNA 3D39A 4FFZH 5JW5A 3C60A 3IF1A 3K4DA 4AMXA 1G4MA 1KCRL 3P4OB 3TGXA 2KQNA 1Q9LB 4OVUA 2HP4A 4GW4A 1JZFA 1PLGL 3MRIA 4XOBA 3G6JA 4KKQA 2X6AA 4Z3FA 5AENA 3DO7A 3O6MH 5I6KA 5G2NA 2OSXA 3O0RH 4A6YB 2DQIL 3MREB 2WINB 4L1BA 4MJ6B 5D2NB 3UEQA 4PQXA 2C9PA 3ATBA 1SEQH 4XBEL 1H8LA 4Y4HD 5ESVA 4GKNB 4X99B 1ED3B 4F37F 2XV2A 5HGDB 5F6HJ 4I0CC 5K59F 4JFWA 2VABA 4LOVA 4LNRA 2IDCA 2GSGB 1J1PL 1VZIA 1ZTMA 1BBDH 1KGCE 3QAQA 4O58H 4F8LA 5J11C 3TZVC 1L4IA 5ITFA 1FFPA 2VSCA 2BSCA 2PABA 4AZ8B 2NY0D 2I7OA 2YGVA 1BFVH 2DQTL 3SDAB 1M7XA 3OMIB 5CXPA 3TZVD 3OAUL 1W80A 1WV7T 3HHMA 4PGZA 1TQCB 1Q9LA 4J6IA 2AXHA 4P3DB 1NL0H 2QGBA 2WWOA 4ORGB 5HYSA 2A9NL 3BYTA 3WS3B 2E8ZA 2WINA