3SD2A

Crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
b'NPMGIPIQPTYEKCAILSNILNVSFGRAKDYAIITVTNKATGEIVHSKTYHNTSIVMIDMSSCEKGEYTIHIILNDCLLEGTFTVQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative member of DUF3244 protein family
publication title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sd2A01
4G5AA 3SD2A 3D33A
chains in the Genus database with same CATH superfamily
1YQVL 4KZDH 1JXFA 2ZWKA 2CPUA 2WB7A 5EBLB 3HN3A 5HGAB 1HVXA 1UEMA 5TK4A 4HPOH 5F3HA 4HS3B 1K6QH 2RHEA 5DS8A 1FDLL 5I18H 5L2KB 1FO0A 1QRNE 2JIXD 4TULH 4ZAKB 3KG5A 1P53A 2AEWA 4U1GB 3U7AA 3BGFB 4PH8A 4WWID 5K9JH 1DLHA 2BIHA 3GHEL 3VWJB 3W9EB 4PJHE 2E27H 2EE2A 4UYPA 1J0KA 4P4KB 4X5WA 1XGPB 5LWYL 1UZGA 4MCMA 4ZDHB 5A2KH 1DJXA 3QYMA 3V6OA 2CNZA 5CEXB 1E28A 2AMUA 4QXGH 5CILH 5CLZA 5AYUH 1A4KA 4NJAH 4P23C 3DKHA 1HWHB 2FSDA 3B5HA 5B39B 1TJHH 4YLCA 5HI4C 2DDQL 3L17A 4LDEB 3B34A 3IJYB 1OT4A 4U1MB 5IR1B 5IVXB 4ZBJA 3VG0H 1P4IL 2YAPA 1MHPL 4KO7A 2WN3A 3A4DA 1CF8H 5B22A 2MCPL 4QY8A 1JHLL 4BA0A 2DB8A 3CVHB 4HCRA 4G6JH 2DKUA 2X3CA 3NIGE 3BX7C 4AZUA 1UH4A 5CN3A 1JZ8A 4FL4C 4CC4C 2P5EB 3I9GH 3WSQL 3TF7C 2CXGA 4DZ8B 4JFFB 2PR9A 4PI0A 2B7DT 3UTPE 3NJGA 3W38A 1ULVA 4XCNB 1CT8A 1T4KB 1UCBH 4U1LA 3MA7A 4FQQB 3KHQA 2OJZL 3F6LA 4G5ZH 1K4DB 1MFCL 5DFWH 4PTTB 1T2XA 3VX1A 5C0BB 3MRQB 4I9XA 3ARTA 4OUUA 1U0QA 2HKFH 4J7RA 3TVMB 1RZJH 1HI6B 1UGNA 3D8MA 3QS3A 2JI2A 4MMZB 2L04A 1JF1A 1CQKA 2VDRL 2LQRA 1G7MB 2ZE0A 4P5TC 5J8OA 2NTSP 3QXAA 2ZJSL 4MMXC 5TH2A 1QUNB 4U1IB 2ITDA 4KPHH 2FQDA 4GG8A 4M1DH 4E9TA 1KXHA 5DUMH 4S0SD 4Y7MA 2R4SL 4L8SB 5D2NE 4Z0BL 3HI6L 1INDL 3MA9H 4HQQH 4W9ZA 4ZD3L 1U8CB 2OMYB 5BW7A 1THCA 1E7UA 3CVIL 4PSRA 1XXFC 3KPPB 4AIEA 1FH5L 4CW1A 1HXKA 4M61B 3WJMB 3GIZL 3O4LA 4CVZB 3DRTB 4LP8A 4UAOC 2EECA 4WWKA 1R5WA 1R46A 1VEMA 3ZW3A 1DJWA 4MNGE 2WNXA 5ANMB 1T0NB 2XA8H 5IB5B 4G9FD 3ZRFC 1YNTB 2WTRA 3MLXH 4JPIB 3U1PA 5GGTL 3HJ0A 4XHJD 2XZQH 1KG0A 3PGCB 1TJIH 4IRSC 4QOKA 1WZAA 2ZG1A 4QHKI 2ZKWA 3OV6A 3KVDD 3D85D 2XICA 2Y22A 1DN0A 2DQJH 4M1CD 5DJYA 2ZOLB 2JELL 4N2AA 2ZP8A 2EO1A 2W9LA 4Q8BA 3UPRA 3FAWA 3BDYL 4JFEA 5D5ME 1ZVSA 1MZZA 4PB9L 3VWKC 4FP8H 5C3IA 4RA0C 4RFNC 4UNTA 2J6EA 1RY7B 2BIIA 2J12B 5DJDA 3V0AC 4G8EA 3ARFC 1NAMH 3ULVD 4IU3B 2Y5QA 4N2CA 5ID0A 3F5WB 3HCVA 2NXZC 3E2HB 6CGTA 4XMZA 1SFDA 1EZLA 3KWUA 2CE6A 1J5DA 5I66A 4ZUUA 1VAHA 1ZHBA 3JZYA 5AZEH 5C0CB 3X12A 3JV6B 4NQCE 1XR8B 2A6JB 3S2CA 4J3WA 2XG5B 1OD7A 3U4BH 2XVLA 2BS71 4ELMB 1QG3A 4Q0XL 3FFCA 1GPOL 1HZHH 3N1MC 3LKPA 4X9BA 3WXVH 2Y4SA 3MRJA 2ZAGA 2IO5A 2ZNWA 3IGUA 5BZWA 3CMOL 4U1KA 4QWWC 2DLFH 1EH9A 1A2YA 3OHXA 4MQSB 1GL4B 4NKIL 3PDDA 2FWUA 1U21A 1DLFL 2LW3A 3B1UA 5HDLA 3W1ZA 3QG6B 4LSPL 4DN4L 3WS6C 5JYMA 1IT9L 1HKLH 1T89A 3BP7A 4HD9A 1T1ZA 3O45B 4XCYA 1OGAB 4PIRF 4G8AC 1K5WA 3WELA 3MJGX 4X99B 2DMHA 3K1DA 5D55A 5HYSA 2ZXBA 5IFAL 1KENH 3HNTL 5E9DB 4QGTA 1FNSH 4NQQA 2SEBB 3X1BA 1IV8A 4KY1L 4MNQE 3IGAB 4FCHA 2OI9B 4L29B 3LKNB 4JZJB 4MQXD 2LLGA 5DO8A 3WKYA 1QLEH 5B4MC 1N4XL 1AC0A 2NY7H 2EUVA 3BZEA 5IESH 3DJ9A 3LPPA 5F89A 1RIUH 2J8UA 2EZ0C 2NDFA 1DVFD 4HJEA 1JXKA 2DWYA 2V7NA 1HCVA 5DQDL 1HXMA 4KV5F 1H15B 3NA4A 1E5CA 4A37A 1H5BB 1ZA3A 3QC6X 1FJ1B 1N3NB 1J0ZA 4X4YA 3ZKMD 1RZKH 3ZYOA 4LARL 2R29A 3EG9B 4CN1A 1RJZA 1JGDB 1J8SA 3TV3L 2ZWYA 4EIZC 5JQHC 4UQDA 2JV6A 1QEWA 3OF6D 1LP9B 4QLRA 7CGTA 4IKJA 4YQXH 4PCSA 2QQNL 1ICTA 4LSQL 4OLYH 2FT7A 3EBAA 3IJEA 3CSTA 4AQOA 3QQ9D 2YPLB 1DANT 2WLJA 4HP5A 4OFYD 4BD4A 3ZTEA 3HAEA 1HE8A 3LS5L 5I1KH 4YSEA 3IXAB 4HFUH 3QIUC 2P47B 4XNAA 4D9QD 3OZ9L 2HFTA 1THAA 4F27A 1CXLA 3DBXB 1KJ2A 4FQXB 4TLSA 3S35H 5I0DA 2MCAA 4PHXA 1A5FL 1H9DA 1RZJC 3FMGH 3KM1A 3I3EA 5IMKA 4H5SA 1LQBC 5KYNA 1SVCP 3OZLA 4R96A 5DWUL 2W65B 5E8OB 1N5AA 4YHMH 4XAWH 2H6OA 1LEKA 5IROD 4AYID 3MRLA 1FYTA 4AIOA 2RQ8A 2HUEA 4U2ZA 3NCYS 2X4TB 4C56E 3TA4D 5EORL 3UZEC 5E2WH 1GS7A 4A6YH 4ZMOA 3U1SH 5HVHC 5CIPB 1FGVL 1OWRM 4JN2B 1VPOL 3BH4A 3WEMA 2NY5H 1N2RB 2P5PA 5I8KL 2OP4L 3HR5B 5CXPA 5DSCA 3TBVA 1AQMA 2MKLC 2YLHA 3LXBA 3IU3B 3N41F 2XBZA 2VAJA 4WFGE 3IAGC 2CZNA 4NKOA 1T0MA 4OF8A 3BT0A 3ZU8A 3GSRA 3Q2CA 5ISZD 1BIIA 5DJCA 4EIUA 2ATPA 1S78D 4LKCB 3SGJA 1ZTXL 3AM8C 3VD0A 3GSNL 4O58L 2YAFA 4F15B 1K5NA 4MLSA 4JE4B 2DL9A 4MD0B 2HTLD 4TRPH 3DUUA 1CVRA 4BZ1H 3KPSE 2WLIB 3SE3A 2YEQA 1A6PA 4XCFH 3B9KD 1INQB 1EHXA 3UTQA 1TYJA 2DQTH 4K8RH 3T8XB 3HS0A 4PY8I 3QUKA 4XCEA 3QJHB 3RHWF 5FO9B 1A8JH 3KGTA 2W5PA 4C47A 2ZWNA 4P99A 4JRYA 5E4OA 1OANA 5ICZB 4X0KB 1ETZB 4YLQT 4MRCA 1C1EL 5I1AA 2L0DA 4GUOA 3ESPA 3QFDA 4XPGL 3EGDB 4R7NA 2XI9A 2YMXL 2QSCL 1FFPA 1X3DA 3RWHB 2F7QA 2EADA 2HT4C 3ECWA 3CBRA 4U1SA 4JM2D 4PRIE 4NIKB 1U8JB 1TPXB 3MRFA 3IWVA 4G8IB 3UJJL 3VFMB 1SY6A 1AGFA 4RMUA 2NY6B 2FE0A 4Y19D 2YQBA 3CFBB 3T4AC 3RVXD 5HPOA 4ZFOB 1I3GH 2EKSB 3DJRA 1QLFB 1JZGA 2V2TB 3GMPA 1P6AB 4ZW7A 3WNNA 5JW5A 4URKA 1UATA 2J21A 2X4NB 5DK2B 2FLBT 1WD8A 2DY2A 4M29A 3QUHA 1E90A 3WENA 4ANWA 2DM4A 3BUPA 3T71A 2G9KA 1QNZH 4Y8AA 5DEGB 1FORL 1OGPA 3GRGA 3ROOB 5T5NG 4K9EL 5C0GB 2Z35A 5EU6A 2GJ6E 5I0YA 4J8QA 3EBHA 5CJBA 3O41A 4JKKA 4LSSH 1MCOH 4TVSa 1V3JA 4P5MA 2IDSA 5C0AE 4UTAA 4R84A 5E99L 3HJEA 4X4ME 1U8KB 2C7FA 1M57B 4OZIB 1YLBB 3UO1H 3MJ7B 1YYLH 1MCDA 3BAWA 2HJKB 4DP6X 3FH7A 4KVCH 5EBGA 3HZKA 1CE1H 5DD0L 2MNJB 2VDKB 3HR6A 3UADA 4B3EA 3FT0A 3LB6C 3LNFA 3DA0A 2EVJA 1MW1A 1FF5A 1WPCA 1RZKC 4JHAL 3C6LC 5ELIA 5LNEA 1R33A 3IDXH 1AHWB 2A6IB 4HWZB 4RWHA 2V2XA 4QXUL 1SN2A 5E6IB 1K3IA 4U1HA 4EQ3A 2CLRB 4ONFL 1MRDH 1HEZB 5IF0A 4NQED 5BRZA 3P3SA 5E08H 5EEXA 5PCYA 2GY7B 3VAEA 2PW2B 1NIEA 1K9TA 4TLUA 3X13B 1EJ8A 3MLUH 5E2UL 1CLZL 2EDHA 3O3DA 2OJ1A 1Q9KB 3DMMD 1G6VK 4F8NA 5C09D 3HIZA 5SWSB 2XT1B 5IQ9A 3V7AG 4C58B 4NCC1 5CSGA 4LQFH 2G0LA 1WGOA 1GGIH 2L4OA 4HJJH 4MD5A 1EDQA 1Z5LA 3W39B 4WFEE 2FX7L 3T1FB 5ACMA 4YHZH 4Y16D 4X8CA 2FB4L 1HEHC 1BZ7A 1WV7T 3BKJL 3HRPA 5FUCE 5FW7A 3MLPA 4PJFB 2BJMH 2RACA 4A7VA 4LOFA 5A6MA 5FCUH 2W07A 4W81A 1P4LB 2NY5C 2BP0B 1JDCA 5DRZA 3IMTA 3LIZA 3WKMH 4M9PA 1ZLWH 3U2SA 3I6KA 3IKKA 4PGZA 2IAMD 3VVWA 5C0ND 3TNMA 1C16B 3P0VH 5FUZL 4BSVA 2LU5A 1U9KA 3BQVA 2R1XB 4G7VL 3OJMB 4J3OD 4NLAA 4OB5H 3CFIC 3JTBA 2JI1A 4QXTA 5JO5A 3KPTA 5GRJH 4ELDA 5FWQA 5HDBF 2AJXH 2DKSA 3EJYC 4XNMB 5CINH 1KT2A 2HH0H 4OVUA 3O2DA 3O3BB 4AJYV 1ZSDB 4HUXB 4YC2C 1DVUA 2ZCZA 1AO7D 1SDDA 2X6BA 4KX7A 5IHUH 3VXSA 4C56D 3EGXA 3E0GA 4LCYB 4XTRD 2G3XA 1QSEA 3P77B 3RG1C 3TONA 3QIWA 1HU8A 2AAAA 2NOYA 2ZSWB 4K8RC 3PP3K 4CILA 4MJ5B 4R9HA 1BMGA 1IAIM 1ANUA 3SYOA 5IREA 3KZ8A 2H6UA 2OL3H 1H6FA 4B7LA 3O2VL 1JPTH 4WFGD 4HOMA 1IGCH 1JPSH 1FRGL 1MG3C 3HC0B 1T03H 3VYOA 3CPLB 3HMXA 1AD9A 1FAIL 2C26A 2Y07H 3ABMB 5JOPE 1F4WL 5DR5H 1I8AA 2MCG1 4K94H 3RTQB 2JK5B 4DN3H 2FUQA 2O6PA 1OLZA 2K0RA 4XXWA 1CXHA 3TCLA 2F61A 4O51A 3LHPL 3M17A 1UURA 2ODHA 5G5DB 4Z6AT 3FYIB 2XJKA 1FZKA 1VESA 4ZMXA 2Q6WA 5DEFA 1PCXA 2VR6A 1S8DA 1FO0H 5GS1C 2QV2A 3MOBL 1FBIL 3RUGB 1H3VA 2KLTA 1YA5A 4LCIH 5K69A 2JTDA 1MDTA 3KYMB 3BZFB 1D6VH 1NEZB 2E6JA 5IBTH 5MP6L 3O4LE 4XWGH 1C7TA 1KN4H 1E4XI 1WT5C 3AT0A 5HGDB 1V7ML 1QR1A 1TXKA 2A0LD 3L3KA 3FQTB 3N0AA 4YDMA 2CGZA 3GRWA 3QUMA 4LEXL 2VM9A 3FOLB 2ED8A 4PS7A 5TF1L 5E56A 3B5TA 1J9QA 4S1RH 3DGGA 4QOKE 2TSBA 3EKCA 1I7ZA 1IJNA 1RULH 3DV4B 4PJDF 1NGWA 1C9SA 2VXSH 1MFNA 3QUYC 4LHUA 3S2AA 4BKSC 1MY5A 3KWXA 4LF3A 4AEIL 3FT3A 5EIIG 2Y36L 4JFEE 1MCWW 2DD8H 4HCRH 4S2SB 4YHPA 1NDGA 3V6ZB 2XFGB 3VFTA 5I0ZA 1X4XA 1P1ZA 1BSIA 4XOAA 3DTDA 2BCKB 4HXBL 2RR3A 2ERJB 3MBXL 1JL8A 1OCOB 1AC6A 2I69A 3AXIA 5DZJA 2F53E 3LMJL 4GUQA 3U9PL 1RP9A 1YPZB 5J11B 1X5HA 1N7MH 4R0LC 5FV2A 3WMQA 2WSPA 4ODXA 4PJ5B 1TITA 2NW3B 2WP3T 5IT2H 3BWUF 2NY2C 1A25A 1Q94B 2FX8L 5AW0B 3W0WA 4QYOA 3VI4F 2ICES 3RZCC 3FFCE 1YG9A 4R8WL 1ORSB 2E7CA 2UY6A 5HHOD 4NWTH 25C8H 3TJEH 5C0AD 1J88A 2YN5A 3HG1D 1WHPA 4MVBD 5GGRA 1F6AB 3GEWB 3TZVA 4AIXA 4Z7WF 1FV1B 3L3OA 3GDBA 4JRXA 3ZTNH 2HFEB 3PWPB 4PEEA 3QIBC 4LMQI 3AS3A 2JJTC 3WFDH 1SN5A 4WU7B 2CIKB 1QVOA 4ONGL 4BFIB 4K7PH 2FO4B 4QHMA 5ERWA 1U41A 2H8PB 3Q3GB 2RFXA 3QPXL 3WE6B 3DX3A 2EIEA 5AKTA 3P30L 4RRPG 3NCYP 4DO6A 4DVBA 3H7BB 5L9DL 1JWMA 5E5MB 1I1AD 1U4FA 2GSGB 3RWGB 2AQ2A 3QXDA 2ZOTA 5J0BA 4CA4A 4FTVD 4U0QB 2ZKHH 1D7BA 3CFKA 2X3AA 1J5OH 1Y6NR 5GGUA 4MX7A 1IKOP 4FAAB 1ZA6A 1ZS2A 4APQB 2YXWA 2Y3NA 3EOBB 2DF3A 4L9LA 4LIQE 3MRNA 5HDRA 5IMLB 3UZQB 2M26A 3DX8B 1ZT1B 2BNQA 1JHTA 2J8UE 2GBVA 2WBJA 1BX2A 2E9GA 2XZAH 3ARBC 4NOBA 4NO3A 3IT8D 5EU7E 2X38A 2YPKA 3RL1B 5AD0B 3ESVF 5KVEL 3WGVB 2JCCF 2VXVH 2C9SA 3AFLA 1ZS8A 1E5AA 5EPMB 3MR9B 4JJ5A 3BYTA 2Q5BA 4EVNB 2YD2A 3FCSB 4HWNA 1TTGA 3EYUH 5AWNL 3VU2A 2AABL 2QVTA 3R1GH 1TENA 4NC0B 4ZUWB 4NN5C 1AQDA 1U92B 3NYKA 1E6JH 4WWOA 2ITEA 3MV11 1SEQH 4HPHA 4M48L 3PQYD 3TBTB 4DP2X 5C0RL 4LGPB 3V2AR 1OSPL 1OB1B 4B27A 4EIBA 1DFBL 4GP8B 2AC0A 1G7HB 1PF3A 1YCSA 4MD4A 3DOHA 4WEBL 1CTMA 2PTTA 4ZPTA 5C2BH 2ARJA 1OXYA 2MIZA 4OY9A 1UVQB 3REWA 2R83A 3CFNA 4J4PD 1A9BB 1RIVH 3CK0L 4BCYA 5F7YC 4XMPH 5C0IB 1RMFH 1IKNA 3ZYIA 4Y4FB 4K94C 5BUGA 2NUTA 4YR6B 4JHWL 5KBDA 1DJHA 1FYTE 2FZ3A 3GHBH 5L8KB 4LAQH 2D7PA 1XV8A 1ZV2A 4LL1A 3RWEB 3U25A 4RBPH 3POCA 1OP9A 1U30A 5DJ2B 3A3YB 3HG0A 4JGMA 3WV0A 4CMMB 1SQ2N 2Z92A 3IJHA 4FEIA 2YC1A 1MOEA 1LXMA 3MUGA 2X4PA 4JFYB 4WO4B 3WCYA 4DCQB 3MRHB 2CUMA 4PY7B 1NICA 5DJXB 1OTSD 4MXQC 1G7IB 3S35X 3HE7C 3S6CA 1MFAH 3WNIA 1U3HC 3ARGA 2MHAB 5C7ZA 1VKXA 2J8OA 3SPIA 3FUDA 1NBVL 5IEKB 1HHHA 2EKJA 2QQQA 2APVA 2HKHL 4K7PY 4LIQH 1X9RA 3CFJA 4DGYH 3ETBF 4WJ5B 5KEZA 2R0WH 3T3MF 4B9GA 5IHZA 1QRKA 4Z0XB 2FQFA 5CZVH 2NPLX 1ZEAL 5SX4H 4XMKH 4XP9H 2KZWA 1NLDL 5FECA 4JGNA 5KSBA 5ADPL 4XNYL 5JIDA 4C83A 4HS8H 4NBYB 4LPWA 3PHAA 3H3PL 1MFEL 4FQIL 3C60B 2KKQA 2QKIC 1SHMA 4JO2H 1MQ8A 2R29H 3AT9A 3BC9A 4IHBA 1FFTB 1MJJB 2EVGA 3GSQA 3GZKA 3SPJA 3HBGA 4WK0B 4ERSL 1LEGA 1A6TA 4LU5L 3RA7L 3UAEA 3QHFL 2GJZA 3LV3A 1WCBB 4WWKD 5AOKA 1XIWD 3DX2A 4HKBA 2EUXA 2R4RL 1G1CA 3HAEH 2RGSA 2XYBA 5JHDA 2FJHB 3AADB 2IQ9L 2Y3AA 1ND0A 1N6UA 2VLLB 4GY4A 2O61A 1F97A 4JMXA 3SDCB 4QRAA 3QISA 2NX5B 3RX9A 2XHNA 3UDWC 1TMQA 1KJ2H 2BCMA 4AQ1C 4L2LA 4YWGH 5F96H 3NZHL 4M7ZB 5HDQH 1E27A 4B6ZA 4XP4L 3LJ3A 1PNCA 1QACA 2VLKA 4JAMB 4LRIC 4PAZA 1E8WA 1CXFA 2C5DC 1UD6A 1JK9B 2WWMC 2D8KA 4UZGA 5DD6A 5DMGC 3PL6C 1PY9A 3EADA 1MWAL 1KFAH 1SJEB 1OCCB 2HJFA 3VMOA 2QKSA 4NNYB 4UM8A 4X6CF 2BP8B 2VQTA 2XU9A 1RK1B 2KQMA 3K8LA 3P3UA 4H1LG 4W6YB 2VNCA 3KYOB 1L5GA 5IM7B 4Q97A 1L9RA 1O6VA 4LE8A 5EOCJ 5EU6E 5E2JA 4WKZA 2F1BA 3IBOA 5DTFB 3VXMB 1TZHB 4R4NC 3T3PE 1MVUA 2P7TB 3L5WB 5JDSB 2FJFA 3C5ZA 5HDWA 2BVOA 4MZ3A 1S7TB 3TLRA 1E6OH 3QJFB 1KJ3L 4XVOA 4GB9A 4I4WA 1YEIL 5E6SB 3S36X 2OS7A 3MRIB 4X4ZA 4NENA 1DO6A 4NJ9H 3MRCB 1BECA 4NM8L 4WFFE 5EZLB 1ZXQA 5JR1L 4QIRA 3GJFB 4R5TA 4KJWC 1QD0A 5T1DL 3GDCA 4JO1H 2VDNH 2P8MA 1L7TH 3SIKA 2PYFB 4DQAA 5F7KC 1U93A 2VDMB 1DBAL 2FT6A 4LB8A 1H3PL 4N9GA 1F11A 1G5GA 3CXHJ 2QFPA 2XN0A 4JQVC 2CK0L 3T2NL 4K2UL 4J12A 1DQQB 1S7QA 1RUQH 1MCCA 3RIKA 1T04A 3A47A 1L9PA 2BZ7A 5BO0D 2WINA 5KS9B 4UNVA 1JZ2A 4L3ED 4WSKA 3QZMA 4P4RB 4WRLA 4BH8A 3ULAB 3CQPA 5J6HA 3E8UH 3VFSB 1KY7A 3ARSA 3E1F1 1WFUA 1NCDL 4B60A 4ZOAA 1SY6H 5BVPH 2PXYC 1JSYA 1TSHA 4HIIA 2MOQA 2HPTA 4JO3H 2QFRA 3FQWB 4M8QB 1JZ5A 3D2TA 3BN9C 1ACYH 1Q90A 4LBEA 1TIUA 4PG9B 1EEYB 1T89C 1SN0A 4GG6A 1CGTA 1D9KC 3IDJB 3LX9A 4XPAL 5FYKH 3F7KA 3BFQG 5HHVH 1BBDH 2X9WA 5IFHL 1P7QB 2NNAB 4NUMA 3F7PC 2AK4B 2AJYH 4FQLL 4MXVF 2IGFH 3D39A 4MA8L 4X83A 1VRSA 4TOYH 1MCSA 2KHAA 4F5CA 3EHBD 5I1HL 5GGSB 1XGTA 1KIRA 1VLXA 4MDJB 2L7EA 1S4IA 3MRPA 5HHNA 3Q06A 4UTAH 4HIPA 4BQCA 4RAVB 5HYQA 1L0XA 1NEPA 3K1KC 2B15A 4JFDB 4YDJB 5EWIH 5IBUB 3VXSE 4QTIH 2C3WA 4A2DA 1QSEE 1NIFA 5T1LA 2WLHA 1S7VA 1KCSL 2OMVB 2A99A 4QRPD 1HQ4A 2KZ1B 2V7HB 4KUZL 4FEMA 5GJSH 4J3BA 3HG2A 1J0HA 4UT9L 1M9SA 2VGLM 1IGJB 1XEDA 3J8F7 3OGOE 1CR9L 5F8QC 4OTXL 4UF7C 2Z91B 3F8UB 1UB5A 3CDGA 3OAWA 4X7EC 1I85A 3EDKA 5C0FA 3NCBB 4GRLC 5DLMH 1ZWIA 2Q3ZA 2VN7A 3DOSA 4P2QD 1HHKB 3N43B 1Q0YH 3VJ6B 4JDVA 4Y4KA 5GISL 1GYCA 4KGLA 3RWJB 1EAPA 3HC4H 3NIFB 1A4JB 2Z8RA 4HX1A 4TQHA 1H8NA 1XGZA 4OIAA 2WOYA 3Q0HA 4F91B 2YXVA 2P8PA 1FGNH 2WIIB 3N04A 4BUQA 4ONHB 3BFOA 4WTQA 4G7YL 2BC4B 5GRXG 3OXSB 2OMXB 3T6XA 2VC2L 4XPTL 1BJ1H 3NRQA 1PJWA 3QUZA 1A6UL 1CGSH 1JGUH 2WUCL 2BNRD 3T5WA 4JRYD 1F2XK 4P2OC 3LXAA 3TWYA 1MCRA 5KZCD 1AI1H 2Y5TB 5EEVA 2G9HB 5GS0H 1NGPH 1A9VA 4I89A 4XVTL 1X5IA 3TN0B 1KZYA 3BAYA 4HIJA 4V11A 3BEVA 1LGVA 4ODTL 1A1NB 3SQOH 4UZUA 1DJIA 3MGAA 4QF1A 2E76C 3RNQB 5F6HJ 4GRMA 1QNIA 1KEGH 4LP5A 1WICA 4NO5A 4ELKA 1IGTA 3KNBA 4RIRA 1F45A 3HI5L 4F33B 3D4GA 3H1ZA 5BPPA 3CX5J 1A7PL 2X1WL 2ZXEB 4PV8B 3I50L 4P5KA 4YXLH 4TUKH 4OCNC 1I3RA 2ZXCA 4HJ1A 4NB7A 1OSZA 1GY1A 5KYYB 2C1OA 4CNIA 3QXWA 4MASA 2NNXA 3BT2L 2VIRA 1YEFH 4FXGC 1TTCA 3INOA 2FQGA 3O2DH 5DZOA 3S3SA 4CU6A 4JO4L 2OMUA 3GNML 1GZHA 5BMFL 5DHEA 2A9NH 4ZUTA 3I74A 5T1JA 4GI8A 3DX4A 4EBQL 4U7MA 3RX8A 1ZDQA 3FQYA 3N44F 3LPOA 3W0WE 4B53A 3GJEA 5CUSL 5JW3H 5KANG 4ICWA 1FPTL 1M7DB 3SO3C 4X6EB 4L1DA 5F7DB 3LVTA 4U4IA 4PG2A 1I1RA 3EW3B 1SYVB 5D7IA 5CD3B 5ITFA 2BX5A 4V1DA 2CH8A 3O3UN 4EN3A 2GFBA 2J7LA 2PABA 2FHCA 1E9PB 3HMXH 4JRXE 2QHLA 5JZ7C 4HEPG 3BSZL 4GBXC 5KSAB 3N42B 1YNLL 2GJPA 3HS9A 4AGPA 4CRPA 1UQSA 3N1QC 1P9MC 1XGUA 4JDEA 2ZUWA 4JFVA 4QHUB 5GZOA 2FL5B 2VDOL 4OGZA 2GIYA 4HZLB 2JIXB 4HXAH 1J5HA 2VO8A 4QRSA 4W9JC 43C9B 2QMJA 4P9MH 2ZPKH 1CLVA 4F1ZA 5E1AB 1HSBB 4G7SB 4S1QH 2DQFB 4PGJA 5C6TH 1NIDA 3QA3A 2DYPB 3S88H 3NEXA 2YGVA 4ZQKB 5BRZD 1J5IA 3J27A 1JPFB 1WK0A 4JZNA 1CDHA 4ZTPL 4AVHA 3RB7A 4NUQA 2BNQE 3T6ZA 3WIAA 3PV6A 3FU8A 4MJHA 4NPKA 1UOKA 2WD0A 2WHVA 3L3DA 3VQLA 4Y5VA 3S7GA 4D8PB 3I75B 5I30L 1CMOA 3QUMH 4JL1A 4HZ1A 3IDMB 4GP4B 1B2YA 2ZCHL 1G7LB 1J9TA 3QWNA 2V2WB 3DXAB 3ILQD 4GKSB 4GQZA 2D7TL 3HW7A 1FVCB 3GC3A 2LR4A 5E8EA 1Z6JT 4XHQA 2WKGA 1G6RL 3LDBC 4HKXB 4HWEL 4U3SA 1OT1A 1EBPA 4FYSA 3SE8L 1BQRA 2EYRA 5EB9A 4B96A 1WJ3A 1HHGA 5CD5C 2EYSB 2UWEF 4PS4L 3RQ3A 1IBFA 2DWTA 3MI6A 4L18A 3MN8A 1UADC 4DETA 5C08A 2A5UA 3QZNA 1MJUH 4MJ6B 1JZJA 4WGKA 3Q44A 3LEYH 1F4HA 4AQAB 2D0GA 2AEOA 2DIEA 3BGMB 3KLKA 1DQJA 3INUH 4CVXB 1KXQE 1T7XA 4UINH 2BHUA 3J07A 5FFOA 3WFCL 3WUWB 5IJVA 3ATAA 2KH2B 2VLJA 1DE4B 1HCYA 1ZT7A 2HMID 4DP9X 3D0VB 3QNYB 1QOKA 2B16A 5SWZA 4F58H 1X5JA 1U3ZA 1T6VN 2MQ3A 3O6FA 4QHNB 5J12B 4YBHA 1EVUA 1KPVA 2FGWL 4RESB 3WLBA 5K5YA 1WH0A 2EVIA 4M1GL 4PVLA 4P2YA 5L6YH 2WLMA 2B3RA 1PS3A 2XYCA 2WKOA 3QIWD 1UUSA 2JQAA 3R0NA 4QT5A 4HG4J 2CNYA 2EIZA 4IOIA 3VH8B 3NJMA 3FOMA 2H4EA 1R4XA 1ZJBA 2BSEA 3QNXB 4TVUA 3L1EA 1GZPB 1EO8L 5EIIA 2OYMA 1NC4D 3L08A 4NS0A 1MI5A 3T0ED 2R2HA 2XFXA 3PCYA 5B7EA 2DQCL 3BEWB 3LZPA 5KBKA 1KB5B 2NY3C 3UC0L 3CVHL 3DHUA 3ROLB 5GS0C 5LB1A 5IKCA 3U7YL 3HZVA 3W5MA 2LLLA 3TOPA 3S37H 3DURB 2OCCB 1ZHLB 1O5PA 1NL0L 1S7SB 4MAYA 2D7OA 4G9FB 3AG2B 5DHVA 5HDOA 4K3DH 1XZ0B 1URZA 3CFMA 1H8SA 2ZP0T 3ELQA 4N87A 4YPJA 4G3YL 1NBQA 2XX0A 4AGMA 1AQKH 2DTML 5IW6A 5KSBE 1CL7L 5DO2C 2F1AA 2PPFA 4UQEA 5I1EH 3SPVB 3CHXA 1IAKA 3F7VB 1SJHA 4OCSL 1PMYA 4BQ6A 5IZ7A 4AJ0A 4HLJA 1NMCC 3AUWB 3TFKD 2NDGA 3TWCH 5HI3D 1JTOA 1JXGA 4JG0L 4FFVC 1GOGA 2NW2A 2EE0A 3HPJA 5D1XC 3VXPA 3DETD 1EXUB 5D2LB 2FH8A 3IRZA 2XBTA 2XSKA 4LPYA 4Z7VB 3BRGC 4BE5A 2Y1AA 4RRPA 1A6WH 4H8WH 3QQ3B 4MBRA 3ZL4H 4CKVX 3VD9A 2ZAHA 1MY7A 2FD6L 3BUYA 3BZ4B 1X5MA 3QRFM 5B3SB 5KYXB 1UT2A 4IHOA 2D03H 3VGFA 3L3IB 1FFOB 2QR0B 4FNQA 2C4XA 4EZLA 2VLKE 1FWXA 1HDMA 1OB0A 4I2XA 5EZOH 3SKJL 3OMZA 4LCCB 1EZUA 3JZ7A 3WFZA 1XAKA 2E47A 4PRPA 3MKGA 5F3BB 3HMWL 3BDXA 1DUYA 3EJPA 4G6AC 3ZGIA 4P46B 4TVPE 1ZMYA 3C09C 4QCIA 2CK2A 3L1OH 2IV8A 5LQBL 3UBXG 1AKJA 4PJ8A 4I48A 3U36B 1I7UA 3CNKA 1KTKE 2HVBA 4F57H 5CLTA 2AI0H 4U1JA 4X5LA 5F9OH 3CFCH 3Q8AA 3T77A 4N1EA 4YAQA 2NMSA 1KCVH 3CFDA 5GGRY 5GRVK 1VDGA 3K0YA 3L95B 4BQ9A 4E41D 1AD0A 2BOCA 2ILLA 3ECBB 4KDWA 1HAWA 1JWSA 2EDJA 2YQ2A 3G5ZB 2AJZB 3O0LA 4U7KA 4Y4HD 3L1GA 5ALCH 1NANI 4NZTL 4N8PA 3EFDL 4JB9L 4A7QA 1S46A 3FQNA 5G2NA 5CKGA 1SDAB 4GUPA 2A1WH 2YXFA 1C8QA 1NCIA 1QRNB 3O0RH 3NH7H 1ZLWK 1SXAA 3FPYA 4GMSH 4WI0B 3V0GA 5IFJA 1GYUA 3VQ2C 2W92A 5EOQH 3DI2B 4PJHB 4OM1L 3C5JA 2ZUYA 4ZUSB 4YX2H 4ZYKB 2F18A 4CADA 4X6DF 3PFQA 4LPTA 2EICA 4MS8D 2A9AA 5F0LB 4FNPA 5DRXB 4MNHA 2FEEI 4H26B 4IBYA 3TF4A 4M3HA 4TSAL 3QRBA 2ED7A 2V3DA 1U8QB 3QZBA 4WHCA 4DVRH 4L0ZA 1IU1A 3D12B 3S4SB 3JQOB 5EEZA 4WHTA 4P3DB 5JQ6L 2CUIA 2PLTA 3TT3H 5EDSA 1AR1C 4GW1A 1D6EB 3L1FA 2EDEA 2VLRA 3P2TA 1EFQA 2C7UA 3F84A 1XGYL 3ECUA 3LS4H 3K6IA 3CXDH 4JFOA 3VGEA 4Q2ZA 5F2FA 3BESR 1I9IH 5B7FA 1NUGA 1RJLB 4XBMA 3L3OC 1KJMA 1JRHH 2N56A 3SOTA 3WIHL 5IMOB 4F7CB 5C8JB 4Q9CA 3K6DA 1NAMB 1TG8A 2H2SC 2IH1A 3E6HA 2Q7YB 2WYIA 3P9MA 4GG6E 2EYTB 1TQBB 4AC2A 1IC5H 3TH4T 3WEAA 4B5ZA 5I8CB 3SPGA 3GI9L 4TVPH 1OAXH 3D39E 1CFNB 4I0PC 1HJBC 2V6HA 5FB8A 1T5XA 2FVNA 4B9FA 4F5CE 3H56A 3PE9A 1F18A 4KTEH 3CBKB 4DGIL 1OP3H 3QQ4B 5JW4N 2HX7A 5EIVA 5ISZB 4LZKA 5F9JB 1WIPA 1TTRA 5FKPB 1S5IL 1LO3L 2XXCB 4JFQA 4TUJB 3RJDA 3LEXB 1A8ZA 1CIUA 1T66D 4HIXH 3ASWA 4JFPA 4NAMA 1F0LA 1BFSA 2BH0A 4TMPA 3GSOA 3B9KB 5D2NB 2UZPA 2H47C 4XMWA 1HWGB 4NQDA 2AXGB 4OU3A 3DROB 3OC5A 4F93B 1QLEB 4G9DB 4PMFA 4Z5RB 3IAPA 4PRAA 3KPNB 3MV9A 2B14A 2BRRL 4XBEH 2ZSVA 4LOUC 2X4RA 4MCYB 2CO6A 4MNGB 1I8KA 4H8WC 3TM6A 2NQ3A 4LBAA 2O1AA 4H1LA 5I76B 4EKXA 3LEVH 3STBA 4JM2B 3QO0A 3VCLA 2H5UA 4LLUB 2K4WA 3ZR5A 5CBEB 3O6KH 1T4WA 3T0DA 4W9CC 1BD2A 1JWUA 1NUNB 1HIMH 1PW3A 3LSOB 4NQUA 1BGXL 1COBA 1A21A 4NN6B 1BFVL 1IKNC 3QEUB 4WY7H 4POZC 3PWVA 3WFHA 5LNGA 5I71C 1YUHA 3O3AA 1JPEA 1FZOA 2ZX8A 1XD1A 4FI6A 4NCC2 1P5UA 1RLWA 2CKBA 4HPYL 4IEFB 4OCRH 1KGUA 3X11B 2VOTA 1X7QB 3S36L 4QAMB 1KIPA 1OAQL 3TXAA 5AAWC 4OIIH 1JHKH 1EERB 1TLKA 1RURL 3FUHA 4XHJC 4D9RD 5JHDD 3B2DC 1CQYA 5HYFA 2NT0A 1NCTA 4FZEH 4Z1PA 4NQCB 4PTUA 2CGYA 4M1CC 2XN1A 3RILA 3DO7A 2Y7QA 4U1NA 5TDNB 4AYGA 1N64H 2CO3A 3SOBH 4PJ7F 2TRHA 5H37G 4AH2B 5BJTB 3BAIA 5CCKH 3BP5B 5BRQA 5AOZA 3WTXA 2KLRA 2E7DA 3IAQA 1X5ZA 3ISWA 3ULVC 1A7RH 4URTB 4MJJA 1WC7B 2AMGA 3GIVB 1WITA 5T5FA 3D69B 4Y5YA 3T0WA 5MENA 1WUZA 2Y2WA 4EI6B 3V7AE 2KL6A 3T08A 1NJ9B 4RFEB 2YKLL 4OAWB 4FXKA 4RAUA 2JKWA 32C2B 3D9AH 3M8OL 1ZHKA 1I53A 5D7IE 4MNQB 4KI5F 5DK3A 5EBMA 1SXZA 3GINA 3D87B 5CNHA 3DVNA 1JPGA 3RZWA 4ZFOL 3B3BA 2DQIL 3U4KA 1S7UB 5H94B 3RPBA 3MGTA 2FH6A 2GITB 5CWSA 2A77L 2VERA 5CN2A 5C1MB 1AGDA 4MKTA 2Q76B 4Z23A 3EBIA 1ZIBA 2PO6A 3CDFA 5GSRB 5HHPA 3OJDA 5F6IC 3CLEL 4HMEA 3TA3A 3DMMB 5BZZA 3GXDA 3OC8A 2YAOA 4DP7X 5LXGL 3CZUB 3I2CH 3PJSA 1PNDA 3FRPG 2AQSA 4HIHB 1PY0A 2PW1B 5GGQL 3EXJA 2AVGA 4KQ3L 4TNWF 4MQXC 3ZKND 2WZAA 1QATA 4F1SA 2XY2A 1HKFA 2ZOWA 4CKQA 1PIFA 3IF1A 4HLEA 2WMPB 4R5XA 3ZKXB 4M7LT 5C3TA 2ENJA 1C12B 2Z7YA 2ITFA 1DVFC 1ACXA 3GSUB 4LNVA 4BKTC 1TUPA 4X50A 3MYZA 3MX0B 4NGHL 1V55B 4GT0A 3MROA 1PZUB 5D7JD 2R7EB 2VDKL 3QK0A 5AW7B 5T1KA 2KS0A 5I19L 1IFHH 2ZT9C 2FEJA 2N7BA 3IS1X 1A7OL 4QR7A 3ZKMC 1SYSB 1U6AH 5TE4H 4GAJH 4QRQA 3D33A 3K0WA 2QPDB 3ECQA 2DS4A 3HPLB 1NCGA 2XUWA 3HVNA 4YLBA 5JHLL 3LN9A 4GAGH 3KPLA 3UJTH 4I3RL 3S3BB 1RL1A 3QQ9C 5C08E 1KLFA 5I23A 1U8MB 5BO1H 1UJ3B 1XCTA 2P28B 3MJ8A 4C56B 3ZL1A 2KUTA 4AX3A 4Z7QE 2R0LH 1WAAA 1BAGA 5IQNA 1J1XL 5CP7A 3CVCA 1KCRH 4OLVH 5DRNA 4GSUA 4FQPA 3SDAB 4E68A 3E6FA 1SUJA 4D9LL 2B9BA 3I9AA 3MNWA 3EOTH 1B3IA 4OZGB 5TFSL 3WNLA 3RDTA 1QR4A 5BUPA 5LDUA 4GIOA 3MYJA 2ARWA 5F21B 5IROC 5E5LA 2A74A 2BW5A 4WQOA 2NTFB 5I1DB 2XWJB 4BSWB 3D34A 3AREA 2YN3A 3ES6B 3Q8BA 5AB1A 5CAYB 1KIQA 2JJSA 3QYCA 4XP5L 4Z8FL 1Z5HA 1SMDA 2Y5EA 2XG4B 4L3FA 3VFRB 5B3JF 1HE7A 1LP9F 5L7XL 3B8SA 1JZ7A 3WNOA 2FJGA 3ZDZB 2AKRA 5FK9A 1VFAA 5I1GH 4L4VA 3QR1A 4NXSA 2IPKA 4G8GA 4YN3A 1DL7L 1S78C 3BQUD 1J0JA 4RDQG 3OSKA 1LNUB 5ALBL 1E3FA 3NCXA 2G2NA 4OI9A 1GGCL 4OSUL 3U2JA 1E42A 1IARB 1KTDA 1RFDH 2HTLC 1B4LA 2Z4QA 1W0WB 3OPZL 4OKVA 1KEML 1G7PB 3MLVH 1PAZA 4PRIB 4PGEA 2HJLA 1CU4H 1W8NA 4OIFA 5CCGE 3N06B 4BXSV 1I8MB 1T1YB 2FIKB 5DD3H 1NCCH 3QEQD 3JVGA 1WGVA 1O6SB 3BISA 1M2VB 4GKZB 1AGEB 1WBXA 1VACB 1MCWM 4RNRA 4YGVB 1G7JA 4N8CH 2COVD 2WXNA 1OAZL 2F54D 1CG9B 1E8ZA 2Z0UA 3S37X 4U6HA 5MEOB 1DDHB 2PR4H 5EF0A 2W94A 3VXOB 2E8ZA 1I75A 3DV6B 1F00I 3PWLB 4JM2C 5K9QI 2RMNA 1TZIA 5E0FA 5EUOF 1KLGB 2W59A 1UC6A 2J73A 2GJ6B 3W82A 2NXYB 4MA1C 2JE8A 1YEDA 3LN4B 4IKLA 3G6JF 3MV01 1A1OA 4P2CG 4WIQA 3HRZB 4XRCA 5HHOB 3RWFB 4FULA 4I2XE 1HYSC 3PAYA 5C0AB 1CD1A 2XXMB 2EILB 1H3WM 1XWVA 4PRPE 3QORD 4Y4KC 1PZAA 2W0KA 4LKXA 3LKSB 2C9XA 4JKPH 3IFLL 3TYFB 2NZ9D 4M43L 4IMLB 2MCMA 3WIIH 5BOJA 2CJUH 1XBRA 3KH4A 3L3HA 1KMGA 2B20A 2P5WD 4U2YA 1LMKA 2BY2A 4ZMPA 4Y0GA 4BFJA 1SHSA 1ZGLB 1SM3H 3HI1B 3OKLB 1ED3A 2IDFA 1I1AB 2OL3B 3UGEA 4HIEB 3V0VA 1QA9B 5JLZA 1LO2L 3HLAA 4B95C 3C8KB 4IBTA 3BAEL 4S11A 5GGTA 1HCZA 3MFGB 1IE5A 4V1DD 3JWDH 2DEYX 1ZV9A 3FU7A 3VFGH 5F72S 4XGZB 4TNVF 2YK1H 2G5BA 3IE9A 4CMHC 4Q58C 4PLOB 1AFVL 4KRPD 3THML 3D3VD 4H0GA 1TQCB 1YEJL 2O6DA 5DS8B 5H35A 6PCYA 3ZTDC 5GZOD 1FO0B 5HGBB 2MOGA 4AV0A 3ARVA 2RTTA 3ALXA 3AUVA 4KMTL 4X5WB 1HSAA 1KCKA 3QULA 4NHCL 4R83A 3BIKB 3KWWA 4GRWE 5HHMD 3O8XA 1ZLSL 4HH8A 3GTVA 2A3TA 3MJ9A 1S9VA 1YECL 4XNUH 3D2UA 1H3UA 4PLJD 4A66A 2J3SA 2OW7A 1NGQH 1GZHC 3ISYA 4OF0A 1A4KB 2AZUA 4OZ4A 4PW4A 1CI5A 2DQGH 3ZQXA 1OV8A 3PQYB 4I18A 3RPIA 4ICXA 1BXXA 2HRPH 2E59A 5E9AA 2VLRE 3CVBA 4C54A 2DICA 1TZGL 3S8FB 3IBEA 1T20A 1SBSH 2N7AA 4TS6A 4QY8B 5F1KC 1FIEA 1UACH 3V0EA 5JOFA 1ETB1 3QDAA 3WDIA 1CL7I 4H4NA 4EN3C 4Y16C 1ZLEA 3CMGA 3W37A 4WW2C 3GKZA 2A7BA 2WZPA 3VXRA 1ECZA 5ETUA 4AE1A 1R3KA 3TPUB 1UKSA 3KAAA 4UOQA 1CT8B 2IALA 4NBZB 3B7YA 5K9KA 4FABH 4U1LB 4YDIH 3MA7B 2IAMC 4KXCA 5I8OH 2MTPA 4J2QA 2H2PC 3FN0L 4Z3GA 5KJRL 5D4IA 4O02A 4JPSA 5TE7L 4TLKA 1S7XA 8FABA 4UZSA 5I75C 3T0AA 2VLJD 4J3OC 5DT1L 5DFVD 2ZWSA 4OUUB 4ZMZA 1BAFH 1FCGA 4XMUA 1YC8A 5SWZD 3KLSA 3P73A 3TYGH 4ETYA 3FU5A 4HFWA 4XMTA 1JF1B 4Y2DA 4RGNE 4PJ9C 3RY5A 2XETA 4EPSA 1D2PA 1IGML 4Y5VC 1MAMH 4M7KH 4XTRC 4KNSA 5TH2B 2ITDB 4XC3L 1IC1A 2A6KB 4RZCB 5J13B 1O7SA 4FQ1L 4OLUL 4GG8B 4UV4L 4IK6A 3FN3A 3ZX1A 4WUUA 2EABA 1OZUA 4NQDE 5EN2B 2AQNA 3NFNA 5J7CC 3CHPA 1NKRA 5AL0A 2B5IB 4K3HA 1Q8MA 1MI5D 2XWBA 2Z31C 4JQIA 4CW1B 4BFRA 4ZNCD 5HHQA 1M6UA 2G2PA 4RH4A 3L4CA 4GRWH 2G3MA 3MV9E 1DZBA 1U2YA 3A23A 3DSFL 4WWKB 2LTQB 1XIWB 1VFBA 5TQ2H 3II1A 2R9HD 1KGXA 4NN7B 1SVZA 1WZKA 2WKLA 3FHAA 3QJQB 3PPSA 3DHJA 4JVPA 3UBXA 1QFPA 2WTRB 2VN3A 1H3TA 1GZQA 1KG0B 4AUYA 4H25A 4YNYB 4QOKB 1XH1A 3B8YA 4MGXA 3OBAA 1R0AL 2EDNA 2Y7SA 2DAVA 1AGBA 3FHQA 1BD2E 1NMAL 5DJYB 4RA3A 1DN0B 1KJVA 3VRIB 1VGKA 2YQ3A 3UPRB 1KLUA 3WDHA 4ZNEA 4UUJA 4XNXH 1E67A 5I73C 3L7EA 3NCJH 4JFEB 4U05A 1FSKC 2OMWA 1ZVSB 1EHLL 4PVNA 4UIKH 3O6FC 2X4OB 2P44B 3MODL 5LBVA 2A0LC 3BHBA 3NABL 2WCSA 3GI8L 4G8EB 2NZIA 1NCBH 3QEHB 4WU5A 3HCVB 1MWOA 4XNQA 2WNWA 4V2CB 1FC1A 5ESAA 3KJ4B 1AR2A 3ZE0F 3VU1A 1T2QH 1FL5A 2ESVD 1ZHBB 3ARDD 4MAUH 4Y2NA 1KELH 3N6YA 4G72B 5KSUB 1MFVA 1OAUL 3CIAA 3FFCB 3JWDC 3LKPB 1B0RA 4L1BA 5KVGE 2H45A 1T0OA 4I0KA 4JRFA 4ZG1A 2QDVA 1UFGA 2ICWJ 3MRJB 4ENZA 3E8VA 5FYLD 2EEBA 3VXNA 5BZWB 4U1KB 3OHXB 3APFA 1A2YB 5DF0A 2HWZL 3U7WL 1OT2A 4UV7L 5CEZE 3OX8A 1KTJA 1RUAL 3RUGF 4NUJB 5D71H 3U0TA 4GQQA 2YRBA 4TPRH 3BP7B 4CDHA 1T1ZB 3S34L 4XCYB 1NCUA 5I15L 3A6OA 4BCZA 5TGBB 5MENE 5KTEH 4O4YL 4XZUA 1BEYL 4N2IA 4GFXA 1XZWA 1KGIA 1A14H 4XVJL 2YWZA 4DKFH 3LN5A 3NK4A 3CN2A 2IBBA 4KROC 4LSRL 2AF2A 4MVBC 1RJCA 3PIQA 5C0EA 1BREA 3BZEB 4CBPA 1NFIA 3G04B 2X2HA 1U8LA 1XH2A 1NAKH 3US9A 2I26N 2ORBH 2J8UB 5HPMA 4PV9A 4D0BA 2OYPA 5A7EA 2QGBA 2J4WL 4L3EB 5TQ0H 1NIBA 2DYSB 2X3BA 2TRYA 2WVVA 4H1LH 1GTFA 1E2WA 2VW6A 5HJBA 1QBMH 1ZA3B 3GBML 4RZKA 3O6LL 5JMOC 2P46B 4KNQA 3FQXA 4X4YB 4HJGA 3RVWD 1VEOA 3DIFB 4LCUB 3ALPA 1RJZB 2E0PA 2Z1KA 2YSSA 3EYVA 3I02A 4G2AA 2WZ0A 1G9NH 1QEWB 2CO2A 3EH1A 2WJ7A 2V17L 4LASH 4AGQA 5B8CC 1SDYA 3MGOB 5I6OA 3IJEB 1AHKA 3H9YA 1M2OA 2C1PA 1GW0A 4R7LA 1E40A 3HAEB 4KAQL 4WI9A 2R1WB 1KWGA 3MOQA 1OTUC 4PJ8C 1BZDA 5F9WC 3UCRA 1U4EA 3AWEA 4PUBL 4QKXB 4RSVA 3EHBB 5BNXD 5IMKB 4JY4A 1TTAA 4X2UA 4R96B 5AL8A 4KHTL 3OG4B 3OPUA 5KVGH 1N5AB 2XKSA 1LEKB 1V3MA 4ZZKA 2VDML 2EP6A 3MRLB 1FYTB 4P59H 3FCUB 3RGBA 3MUUA 4PVMA 1UKQA 5CEZH 1LWJA 1MNUH 1TETH 5I1IH 1A02N 2VYRE 4YUEL 1WAAE 1YYMH 3VRJA 1G9EA 5DUBB 5SX5H 4B9YA 4XNBA 4FI7A 2R59A 3TBVB 2AXFA 1RK0A 3FXIC 3TU6A 2GJRA 2WXHA 3NTCL 4J4PC 4ZFFA 1EEUA 4FYTA 3NBNA 4O5LH 3PNWA 5TF0A 1CBVH 4NKOB 1T0MB 4HA1A 2PWEA 4OLWH 1EMTH 5DJCB 2ATPB 2YAHA 1NUFA 4U0RB 5F1NA 4ZW5A 1TO4A 1A7NL 4J8RA 2QADD 1WIOA 5IVZA 1H0DA 4YXHH 4HHGA 1K5NB 1R3LB 2LU4A 3KBFA 1KCLA 4M7JH 2Y1ZA 2F58L 5F1SA 4DP0X 2Q87A 3KLHC 3W2DL 4KK8D 1TO5A 1UUNA 3DUUB 4KQ4L 3WFEH 1RZ8A 3D25A 1OTSC 4QRRD 4X5RA 4FG2A 4N8VG 3UTQB 5C71A 3HS0B 2VKXA 3QUKB 4G42A 5H37A 3FU9A 4L4VE 4EI0A 4G8GE 2EIKB 2VM3A 4JRYB 1EWHA 4B41A 2VR5A 1QWUA 2B4CL 4ZXBD 2K6YA 5I1AB 2GW5A 5KZCB 2ADFH 2X42A 4R7NB 3GMQA 3WKPA 5J13C 4ODWA 3NFPA 4IKIA 4LMQE 2R15A 2YR3A 1FAKT 1E5BA 2F8VA 3EYQD 1DBBH 4AM0Q 1FFNA 4F92B 1V3KA 1Y1DA 3MRFB 4IGBD 3FFOA 1BD2D 3NAAL 3SCMA 4MMYA 1AGFB 4ZO6A 1YJDC 5CLWA 3NSXA 5I6LA 5I1CL 3G3LA 4HC1L 3D18A 5CJXA 1RI8A 2B1AH 3ARYA 1PJ9A 4L8BA 2CMRL 4RGNC 2VWEE 4RDBA 1UM4H 4AYBA 3GMPB 3FO0H 4G6ML 3SGKA 4EN2A 3QEGH 3T9WA 1OTTC 3SYCA 3WN5C 4JREB 4DKDC 3RIFK 4IBSA 1IGYB 5D96B 3GMMB 4GEJA 5CN1A 4TTDD 1F3DJ 5DQJA 1UA6L 3D5OF 5IY5B 5TD4A 4FG0A 3FRPA 2FATL 3LH2L 4HBCL 3S97C 4APXA 3AG4B 5EU6B 3O41B 1ODAA 5J57B 5DHYA 4P5MB 4JPKL 5FA3B 1Y6KR 3FQUA 1HL5A 4GKOA 1FDLH 1IBYA 2O6CA 1E3ZA 2YFOA 4XBGB 3NP3A 4A7UA 4AUUA 5L2KD 1I8LA 3WMSA 1P7KB 3KS0J 4M8RA 4IRZL 2IH3A 3GHEH 3FU0A 1TJGH 4ZMTA 1Q0XH 2V33A 1IKFH 5LWYH 4P4KD 2J2ZA 2MTAA 1JPST 3EO9L 4J3SA 3CJJA 4AENA 1FG2A 4NAJA 4GS7C 2GABA 3NJKA 5CF3A 4MKMA 1EXHA 2V2XB 3C5XA 1EHAA 5CLXA 1G9NC 4YDLC 3SKOA 1F02I 3ZE2F 3C2SA 5FIEA 2DDQH 5I5RA 5BRZB 2V9TA 2VMJA 1ZVYA 2CBTA 3H7LA 4PGBA 5B39G 4UMSA 4WV1B 1P4IH 3BPCA 1MHPH 4TNEA 1W6WA 3G6DL 3WD5L 4DQOL 5C92A 3K6SA 1JHLH 3UPAA 5IJKC 1QYGH 3O3DB 3DTXB 2BXZA 4IIZA 4PP2B 5CKAA 3CFTA 4RGOH 1ORQB 3WSQH 2P5ED 3KPMB 4JFFD 2VXTL 1Z5LB 5DJZA 3MBWA 2VDPH 4AGLA 2GUOA 3SQRA 2YGNA 2O26U 3BPLB 1CFVH 2WQWA 4PWGA 2WTOA 4GXUM 2ODIA 5DI8A 1OP3K 5JHBA 2KBGA 1BZ7B 2E8YA 4LEOA 4YDVA 2BHZA 2X2IA 3S3JA 1QBLL 2J1KA 5F7FA 5J6SA 5C0BD 3Q5OA 5JPNA 1F56A 2OZNA 5FO8A 5IB2A 3U2SB 1CFBA 1OIOA 1NFDA 3WU1A 4FQHB 2IDQA 4OGXL 3TNMB 3TBCA 5T1KD 5EEUA 2VDRH 4G80A 1UXWA 1BM3L 3V4VA 4AJWA 1MCBA 3WTYA 2ZJSH 1IZJA 4QXTB 3PWJA 5JO5B 1ZLUH 5E1QA 1TCRA 4UQAA 4L8CA 1BDYA 2OLDA 5GRZA 1KT2B 2NLJA 4NRYA 4B9CA 3CLFH 2R4SH 3VXRE 1BXVA 4Z0BH 1R3HA 1C5BH 3HI6H 1EFXD 4ZD3H 1EGJA 1SDDB 1AXTL 3CVIH 1N5YH 3EGXB 4KHXL 4XB8A 4PP1D 2BWQA 5DVMA 2APSA 1FH5H 3QIWB 1J8RA 1SUHA 3AY4C 3MRDA 4FG6D 3B3IA 4Q7DA 5I9QB 2CIIA 3H9SA 1GA2A 2H32B 2D4FA 2QPEB 1XGQA 1X4YA 2PPCA 3UTTD 3OXRA 4FKEA 3V0WH 1GGUA 2OMZA 3WY3A 2R23A 3T2LA 5FKAA 4P48A 3QJSB 5GGTH 5MI0C 1AD9B 2IOOA 3MBEC 4KI5D 3D0AA 1M7IB 1XGRB 4KX8A 4NC2B 1JZ4A 1QUPA 1QTSA 4XMXA 5EO0A 3ARED 5FYKU 3TCLB 4O51B 3R0MA 3M17B 3AQZA 3MNVA 3BDYH 3HS8A 3L2NA 2DRUA 1FZKB 4FKHA 7FABH 2Q6WB 4PB9H 5DEFB 5M7QA 4ZFGH 4QYAA 1S8DB 4GINA 2CDEB 3MNZA 2F74A 3QQDA 3IXTA 4I3GA 4EI5D 4Y5XC 1OW0A 4ATWA 2IEPA 2OULB 4ZT1A 1R1CA 1X6NA 3AJ7A 4NRXB 1KGCD 4HWUA 3EYOB 4TNFA 5ACZA 1XVSA 4ZRGA 5ENWA 5I6XB 1QR1B 1YC7A 3ZIYA 2ZG2A 3LNIA 4O9HL 3Q8CA 3L3KB 1IILE 3MJ9H 4KDTA 5C0CD 4PI2A 3QUMB 4X5XA 3QQNA 4Q0XH 3BKYL 3CZEA 1GPOH 4E9RA 3ZQWA 1UT1A 1PFCA 4S1SH 3Q5YA 1I7ZB 4QGYA 3SGDH 3PWUA 1NGWB 1TFPA 4NKIH 5CJOH 2A4EA 4JR9L 1G1YA 3FK3A 1DLFH 2CGRL 1MEXH 2EIMB 2FWLB 3QCUH 4NO0A 1ADQL 3K2IA 1JFQH 3RDTC 4DN4H 1LK3L 5C07A 3FT3B 4ZNEE 5L4FA 2B0SH 4MWFB 1B4JH 2HN7A 4M5ZL 4YHPB 1NDGB 3BW9A 3VFTB 3J7HA 1GRWA 1P1ZB 5IB4B 4TSBH 4HH9A 2H3NA 1KB5L 5BXFB 5IFAH 3HNTH 3B7RL 1KIUA 3KDPB 5J89A 1OGTA 8PAZA 2YEZA 3P2DA 4ODXB 1B9KA 4KY1H 4HPOL 5BS0A 3ILPA 3MXWH 1K6QL 3G5XA 4BQBA 4OCWL 4O02H 1NC2A 2COQA 1U8PB 2UY6B 2B39A 2GBTA 1JD7A 2PPDA 1HNFA 4ADGA 5ID1A 5DQDH 2P8LB 4GQRA 3ZL2A 2EXTA 4YEFA 3TZVB 4QD2E 2O6EA 3NEOA 4U49A 4JKWA 4JRXB 1PGRB 4XVUC 3V5KA 35C8H 3AQDA 4PJIA 1G4MA 2AV7A 2MMXA 4AE0A 4N0UB 1ES0A 1HQRA 1KACB 2EDQA 3MCYA 4NJAL 4OFKA 5AYUL 3L5XH 4QHMB 4LOEA 5ERWB 3RGVC 3EYSL 2VRQA 2RFXB 2BVQA 2Z7WA 1CK0L 4I0CC 4BELD 3LD8B 1JWMB 5I8EB 1CDIA 2VZVA 3QC5X 3VG0L 4LSQH 3SJVA 5BOPA 3CQFA 1YN6A 1R47A 5EOTA 1F90H 2P48B 2WQ8A 4U31A 3CFKB 3LS5H 1DBKL 5GGUB 4G6JL 3SDDD 2VWEC 3OZ9H 5FF6A 1J7VR 1ZA6B 5KYUA 4L9LB 1XF4B 2NRDA 3MRNB 4PIBA 3M6DA 2BNQB 2WN2A 5FYJE 3G08B 5K9OA 1JHTB 1HXYA 1UWEL 1A5FH 4FQXD 1PYWA 2WBJB 1BX2B 3AC0A 1Z3GL 3DLQR 3PXLA 4YZFE 4HU8A 4JO8A 5E2TH 4EJ1C 5MEPA 4HJ0C 1B0IA 2QPUA 3ZHLA 4EQ2A 3KYNA 3P3TA 1MWAA 2PCFA 5D1ZA 3L4VA 1MW2A 2OW6A 4N0CD 1RLBA 2FEDD 1IEBA 5E4EC 4G1EA 3UYPA 2OFQA 5AW3B 1TT6A 2HKFL 5DFTA 4AMWA 4DEPC 5EU3A 1FGVH 2YZ8A 1VPOH 2D2CC 3DYMA 4UB0L 4GFTB 5EF2A 3DNKA 1JVLA 3Q2VA 5I8KH 2OP4H 2DPKA 4R26L 3D2UD 5EF1A 2WXFA 2WWKO 3KLQA 4CVUA 3DGDA 4KKLD 4ZMNA 3ILQC 4BFEA 4NKMA 1B4RA 1G9ML 1EZVY 4M1DL 4MD4B 5DUML 2PTTB 4ZPTB 1ZTXH 1QTPA 2ARJB 4A7GF 3MA9L 3GSNH 4O58H 2C9VA 2VZTA 4D7PA 3N42F 4FJ6A 4HHAA 3QRGH 2X1PA 2IMMA 4K3JL 4Y1AD 1TKWA 1BJMA 2X70A 3BPLC 1TNNA 2QELA 1FL3B 3LPGA 3MACL 2NUTB 2YQGA 2FZ3B 3S48A 4PR5A 4EOWL 3E9TA 3UYOD 4Z7WB 2DL2A 2JNZA 1Y6MR 5BQ7A 3RFZC 1KUMA 4PJEA 1O75A 1GY2A 2APWA 1E5UI 2GAZA 3IJHB 2YC1B 3VE0B 2XA8L 3MUGB 1UM5L 3P2BA 5CSBA 2VJ8A 2UV3A 2GEQA 1YSOA 4JE0A 1ET8A 1R5VB 1C1EH 2HMIC 4WWPA 4YSQA 4XPGH 2QSCH 2XWTA 2YZ1A 3IFNL 1VKXB 3M7OA 2IDTA 3NDZE 3DECA 2CRYA 4Y2DD 1G9HA 1HHHB 3NK3A 1R3JB 5EHFA 4PLKD 4W9LC 3UJJH 3CFJB 1QW8A 3IE4A 2VXUH 4LLWA 1NAML 4XWOD 2DWXA 1W72B 2NY6D 3K74B 4I18C 1HILA 2XV2A 4QO1B 1G0YR 5CJ8A 5DCCA 1KYFA 2PTVA 4OGAD 3VGAC 3FSWA 2HG0A 5IHZB 1M1XB 2DV6A 4PBXA 3X1EA 3GS0A 2VERN 1BFOA 3TJPA 4WUUD 2JCCB 3GS4A 5KSBB 3B2XA 2YD7A 5LCVA 4C83B 3SBRA 4BFKA 4H20H 1IIIA 5DWPA 2I60L 3T0EC 4UT6L 2Q20A 4BWWA 3Q1EA 2ZKXA 4P23A 3GSQB 4Y2LA 2B2XH 1LEGB 1A6TB 3PV7A 1K72A 4P57A 2GJZB 3Q8EA 1FORH 2DLFL 2V9QA 3LV3B 4JEGB 3ZMRA 3OKMA 4K9EH 4DKTA 6FABH 2DYRB 2VAAA 1I3UA 3L81A 3EFFA 3DBSA 5B1CA 2AV1A 5JHDB 1GIGH 1DQDH 2IFFL 4RMBA 5E99H 4J39A 2O61B 1OPOA 4FRWA 5D4QA 4CC4A 5I74C 2AEQL 2GTWA 1NGXB 1WS8A 1TVDA 3LKRA 4NQSA 3ZT5A 5DD0H 1U3JA 5EA0L 1P4BH 4JM0A 4UIMA 4UT9A 5H2BB 5F1OB 3REVB 3MOAL 5KWYC 5DD6B 1QLEL 1UZ8A 4JHAH 2NY7L 1OOAA 3C8HA 4UQ3B 5GSVB 5IESL 2IQAA 5GIRA 1JK8A 4KTGA 3X14A 1P4UA 4UM8B 3TEUA 4FNSA 4PREA 3VNZA 2H9GA 3P02A 5E4AA 4BK5A 3L6FA 1EBAA 4ONFH 5E6ID 3RPKA 3CBJB 4FLRA 2OA9A 4ZFQA 1L5GB 4OD2A 3FNKA 4GW5B 2CDFA 3MRMA 3PY9A 4WKZB 1BW8A 4KZEH 3V10A 3MLTA 1CLZH 2BSDA 1MVUB 3QUXD 4B5EA 3C5ZB 4MMXA 5HYJA 1DQTA 2BVOB 3TO4C 1JE6A 2AHIA 1X9LA 5E6UB 5D7LA 4XN8A 5LBGA 1WAEA 5D1QA 4YQXL 5SV3A 2FSEA 2EDXA 5TPWL 4GQ9H 3F7RA 3PWNA 4NENB 1M42A 2B1HL 2SODB 1TFHA 4HAGA 3GO1L 2CDGA 3T3MB 5SWQB 1AVAA 1SMAA 1TQUA 2EDLA 3BKJH 3N3EA 4OZHA 4TLTA 5DUPH 4J5VA 4OFVA 5I5JA 1I7RA 3FCTA 3K5SA 1U93B 1XCXA 4WEMB 5H37H 3NEEA 3BVNA 5KAQG 1F11B 3WOVA 4R4BB 2W0FA 4JFZH 4IJ3B 4UT7L 2EO9A 4XAWL 5AOIA 5FUZH 4Y4HC 2FNWA 1S7QB 4PRBA 4G7VH 4IRSA 2R1YB 4PRDA 1T04B 3PUUA 1UXSA 1HL9A 5KG9A 3RVTC 4Q9RL 3ARPA 2F19L 5CZXD 4DTGH 5D7JB 1W2KT 5AVSB 5J6HB 4OCYL 1BG9A 3VWKA 3EOAA 3WY2A 5DZ9A 4GAYA 4LESA 3MO1A 2ZCKH 5HP5A 4HIIB 3ZYZA 3ARFA 5G4MA 3V5HA 4MS8C 3BYYA 4H0LC 3C2AL 5I24A 3NCMA 5DA0B 2EVHA 2IPUG 2UXFA 2PCPA 1CICD 2DBLL 5C86A 3SQBB 4N2EA 5KN5A 4FQ2L 4GG6B 4DPRA 2ALWA 1O0VA 4CU7A 4FADA 1VGEL 2E75C 4TUOA 3JWOL 1NFDE 4F7KA 3D39B 1EJOL 3SO5A 2KI6A 4BZ1L 4DP8X 2VISA 1F4WH 4N8VA 3H2QA 4ABUA 2G5RA 5KW9L 3OKEB 4IBLT 3NQIA 2DQTL 3FUJA 1J0IA 1XGTB 1KIRB 3LHPH 2OXHB 1EANA 3MRPB 3WS6A 1DJSA 5FFLA 1TF4A 1Z9NA 5HHNB 2C9AA 3MLWL 4WI2A 1FZMA 2JF1A 3GF8A 2ZF8A 5HYQB 3QDMA 1CTNA 3MOBH 3S3CB 3T6WA 1FBIH 4PJHF 1RQ5A 2EC9T 5T1LB 3Q8FA 1QSFD 4Z3HA 1HQ4B 4LEBA 1RZFH 3TBYB 1L9SA 3UAAA 3Q48A 9PCYA 3G6AA 5I1JH 2A73A 3H9SE 5T1MB 5J9PA 4ANVA 1V7MH 5E6YA 4F9PC 1IC0A 5DMKA 1TNMA 4LEXH 3CDGB 5TF1H 3LQZA 4RMRA 4P2RA 2BSRA 2Z7ZA 3NJLA 3S5LA 3BQUB 4K9EC 1M6OA 1ZWIB 2EE9A 1G6RA 1M53A 2E7MA 2YBRB 2X5PA 3PHOA 1I9EA 1UTDA 4CSZA 4HX1B 4ODBD 5A3IC 1Z9OA 3N85L 3UACA 5A7BA 2Y36H 4FLOA 1T66C 3VXUA 2P8PB 4FN0A 2D9QB 3NIGF 3D4CA 3S96A 2PNDA 5BQDA 4X9FA 4XN5A 3HBPA 1CZ8L 4PGCA 3I6GB 3UTZA 3MTRA 3MBXH 3QEQB 5ECJE 3HVDA 4YO0A 3L4TA 3QUZB 1UZ6E 5EBLA 4OJCA 2ZNXA 2OTUB 4LSSL 1MCOL 5K1JA 2VXQL 1G1OA 1NQBA 1DFXA 4G6FD 4B0MB 1EO7A 3QIUA 5JMRA 4AXWA 4MJID 1Z32X 3UO1L 3MCG1 3BZDA 2WNKA 3PHQA 1XSJA 1JFHA 1YYLL 2P26A 4JDZB 4R8WH 3ZHDA 3W9EA 2OZ4L 3BEVB 4BGLA 1LDPH 1CE1L 1RZIA 2DMBA 5HI5C 2NYYC 4QF1B 4GRMB 4ELKB 2G30A 1IGTB 3KNBB 3G5YB 2IFGA 4RIRB 3KLDA 5J5EA 2Z3FA 4PJGE 5CEXA 4R3SB 5C07E 5IQMA 5K33A 3V4VH 4I1NB 2CJ3A 5IB1A 1UD4A 4RAHA 1OSZB 4ZMQA 5B39A 4W9HC 3UZEA 3QPXH 1MRDL 5IR1A 2VIRB 3AABA 2LHAA 5L9DH 1GMIA 4ODHH 1M7XA 5I0WA 1A3LL 1ZKAA 3GMOA 3SY0B 1NEUA 4N0YL 1JYXA 3KW8A 5E2VL 5BS0E 5GJTL 2LE9A 2YD0A 4GO8A 4F7PA 3RX5A 2DWDA 1ZTMA 4PYGA 3HN8A 2A9CA 1UASA 1V27A 2YA2A 4I1PA 4BHUI 3GJEB 4Z7UE 4M62H 4B7IA 3EOYG 2EC8A 3D51A 2F1EA 3MLSL 1OF2A 3SE6A 4LQFL 4WF7A 3AM8A 3CSBA 4NFBA 1GGIL 4HJJL 4NPJA 5AAMC 4AOFA 5KVDE 4XCNA 5D7IB 4B0MM 5ITFB 4V1DB 2GFBB 3FQRA 2V5RA 4YHZL 4XNZC 1P2CA 1Q38A 2F7PA 3NRPA 3DRQA 3QAZC 3R4RA 4PJIE 1MRCL 3P69A 3UTSD 1BQHG 4DPCX 2DMKA 2HXAA 3B4NA 4KRPB 1UQSB 3MRQA 3QT2A 3D3VB 2XTJD 3QW9A 2CLVB 3K6NA 4JDEB 4TQEH 5D5MF 5AWNH 2MFNA 4WTZG 4MMZA 1NFKA 3CTTA 2W88A 1BVNT 5HYEA 4QRSB 1C8PA 3P0VL 1BJ8A 4K55A 4KK9C 4R97B 3SJVE 5I5IA 1JNHA 1PD0A 5BZXA 3WEXB 4QXWA 2Q9OA 3VD3A 2WTPA 1YAIA 4M48H 2OR8A 3QA3B 1URIA 2XXGA 5PAZA 5C0RH 1ZLVH 2ZIDA 1VFOA 3F58L 3JTTA 4XBPB 4JZNB 2EE6A 1DFBH 2HH0L 3S8WA 3FJTA 4UTBA 2ED9A 2NY0D 3L3DB 3WDJA 1K4CB 1L6XA 1U8CA 2QHRH 2NNFA 3RWIB 2YHGA 3CK0H 3E3QE 5A16B 1IGIL 1QQDA 1T21A 3T4AA 4JHWH 3O9WC 3RY4A 4X7DC 2BVEA 4KZ0A 1KB3A 5E8EB 3EXLA 5CZRA 4U3SB 5SX5K 1GXEA 3BVDB 3T2OA 5FC9A 2GG1A 4HOZA 2OL3L 2EYRB 3A67L 4QHKJ 1JPTL 3HBQA 5ANMA 1T0NA 4YK4B 1HHGB 1IGCL 3QPQD 4X9HA 4NQTA 1YNTA 4JPIA 3RFRA 2Y07L 2BY1A 3DOIA 4H8VA 1VZGA 5C08B 4DN3L 5E1GA 5E24E 5EOCH 3QJTB 4O2FA 4X7SL 2EDBA 4BFFA 1L9MA 4Z7QB 2I24N 2K3TA 5AVVB 5D7JC 1NBVH 2FYYA 3B9VA 1KULA 4FNTA 2Y6SD 1HX0A 3P0GB 5IJVB 2P43B 5KBPA 2VLJB 1FO0L 3DUSA 1ZT7B 2ADIB 3GSXB 1KB9J 2E7LC 2A2QT 3U1QA 3T8MA 3HE6C 5A2FA 1EUTA 3KDMB 2Y1YA 5SWZB 2AEIT 4H2CA 1D6VL 5E00B 5KVDH 4W9IC 1MF2H 1BLNA 1C08B 1ZEAH 3FB7A 4PJEE 3VI3A 3U30C 3G5VB 2F08A 3JV6A 3F65A 2A6JA 2WIMA 4XNYH 4XXCC 2WO4A 2OJEA 3C6LA 3H3PH 1MFEH 1LLAA 4XN7A 4ELMA 2ZYHA 4FQIH 5IGXL 4QT5B 5I66B 2DQDH 5B38B 2LU7A 3HNVH 4IOIB 3CH8A 3IDGB 2XDHA 4S1RL 4CVWA 3IMBA 3FOMB 4LU5H 2WANA 3R18A 3QHFH 1RULL 4LHJB 2DH3A 2GBAA 3UAJD 1SJMA 1SVBA 2R4RH 2C3HA 5J3HD 3QG6A 2R2EB 3QI9C 1R3IH 3BJLA 3KPRE 1MI5B 5E70A 2R2HB 2XFXB 4IKNA 4R5VA 2MNWA 4YDKL 5AVRB 4LDCA 2IQ9H 1JGLL 4OFDA 3HZMA 5B1KA 4LLYA 3WLWD 5ABDE 3UP6A 5IKCB 1NKOA 2H41A 1GKOA 2NX5D 3ESOA 5J06A 5F93C 3OL2A 3CU1A 5FHBL 5E9DA 3NZHH 1LQSR 1NGYA 1VB9A 5DHVB 3BPNB 3FW6A 1T7WA 3US1A 1DQKA 4P06A 4I9WE 4L0PB 5IT2L 5EF3A 1GKEA 4O2EA 4X80H 5IW6B 3W5NA 3CLWA 4ZW8A 4EOWH 4IOFD 2YD6A 3LRLA 1MWAH 1MCNA 3OB0H 4HCFA 4N2KA 1IAKB 3AITA 1QZNA 3WAJA 5AVTB 2B3IA 3M7FB 3RYMA 4HAFA 3ATDA 4NWTL 3QWRD 3BRFA 3U6RA 3CSGA 1H15A 2UWEB 1JUFA 4M6AA 5JUEH 3HPJB 5BCAA 1FJ1A 1HH9B 5KSVB 3DO3A 1TYEB 3T8VA 5DA4A 4ETQB 2BSCA 3LZLA 3BLKA 1GYAA 2QQLL 2ESVB 3ARDB 3NMEA 5L0QB 3BUYB 3RAJL 1YEIH 2PWHA 4IHOB 2UX7A 3NIDE 2PUQT 3BE1L 2JB5L 4X7TA 2VL5B 5D7KD 5FR3A 2Y2YA 4KX9A 3I6SA 5CGYD 1HDMB 2IANA 2QTVA 4I2XB 4XX1G 3RI5K 5JR1H 3A4FA 2HG5A 2PP8A 2XWDA 2QSTA 5ICXB 1N6VA 4PRPB 4WUKH 5T1DH 3N2JA 5FGCE 1X5XA 3DBXA 5C6PB 3GUTA 2DLGA 3HOGA 4YFEA 2ICEB 1YEHL 2XZAL 1DBAH 3LXUX 3S0PA 3U0WH 3WNMA 4I48B 1I7UB 1JXDA 1EHNA 3U4AA 3GPEA 1JG9A 2CK0H 1B2WH 4K2UH 4U1JB 2F7IA 2VXVL 2DLEA 3T77B 1CD8A 3IKCA 3L4YA 5F7EL 4CUCA 3TEZA 5HYJE 3GBNL 3EYUL 1AD0B 2BOCB 3VO0A 1JWSB 4ZS6D 3TS8A 3ATFA 3QORC 4KDTC 3R1GL 5D7LE 3B2UD 5D1QE 4AZ8A 1N2RA 3QDJD 1NCDH 2J6EL 4PJCA 3ZKSD 1X9UA 2HTKD 2YD4A 2CKNA 5GS1A 1EDYA 3QHZL 3IU3A 4WAFA 5LAPA 4GUPB 3BXNA 1BBJA 5TJWK 5FPIA 3IDYC 3B43A 4E36A 3ZYJA 3VM5A 4FLSA 4OZHE 5IFJB 1WT5A 4AMXA 3O2WL 2AJSL 4BUGA 4IBZA 5LCVH 4K71C 4BUHA 1IM9D 3QAQA 2X1XR 1A6VL 1MSPA 4RFOL 4ZMWA 3CN1A 4GRWB 4XMPL 5GZND 4GAAA 1P7QD 1HZLA 4YBQC 2DIAA 4MA8H 4TQPA 1ZLUK 1Z9LA 2F8OA 4HJIA 3BMWA 3CU7A 3QR0A 1A64A 4PS3A 1QSVA 1INQA 3LYRA 4XMLH 3FTVA 4YHKL 4WHTB 4XZ4A 3T8XA 2Q8BL 3QUYA 3HHMA 3QJHA 4GW1B 3F62A 4OFQA 5JIHA 1NM4A 2ZCLH 3C8DA 3O6MH 4A7SA 2C7UB 3MLZH 3BD3A 5D1ZD 1ETZA 2IOIA 4YL4A 3FS9A 4JFOB 4JFDD 1M56B 1N0XL 3PABA 4Q2ZB 4XVSL 4AYMC 3RWHA 4N5ED 4DESA 4R0LA 4UTAL 3NFSL 1KBPA 2F68X 2WZ5A 2IH1B 3E6HB 4N2GA 3P9MB 3QDGA 4PLJC 4UT9H 3UAFA 1CR9H 2E5EA 4MBOA 2Q0ZX 3VFVA 3RZCA 3CFBA 5F7NC 1X4ZA 2ADJB 2NR6C 5FB8B 3HTLX 4ZFOA 1IZKA 4LEEA 2WXOA 1PDKB 3JT2A 4OD1L 2CWRA 2ATKA 4N68A 5B3NA 1E4KC 1IEAB 4XP9L 1I1YA 3SKMB 1CVSC 4DZBB 1QPPA 1S9XA 1VHPA 3QIBA 4FC3E 3NCWA 3NCCB 2D0FA 3QDME 2IDCA 3U0PA 3L4UA 2QADB 4G7YH 4EUPB 1DZ0A 1GS6X 4JFQB 4M7LH 2AXWA 1F4XH 3RRQA 3VGHA 1B6DA 2N7SA 4XPTH 3E3QC 1TU2B 3QHTC 3MV7A 3B6SA 3D4ZA 3NJNA 4WZ9A 1A6UH 5EO1A 3BVVA 4XAKD 1Q9LA 4HUVB 3OQRA 4JFPB 2AQTA 1XB3A 4NZUL 5J1SC 1U8KA 4J27A 2ZXWB 4L1HA 1YDPA 3APDA 2FBOJ 2H1PH 3MJ7A 3I3BA 3AB0B 2VT0A 2HJKA 3TN0D 4P2RE 4ODTH 3WJLC 4HF5L 1FH2A 3IFOA 3HB3B 3ARBA 4LVOB 1RHHB 4A38A 4PRAB 2Z0BA 4UOJA 3WNJA 2V37A 1KBGL 1KYOJ 3HI5H 2ZSVB 3FB6A 1A7PH 2X4RB 4WI4A 2CO6B 1I8KB 1EUUA 4H1LB 3I50H 2A6IA 5FM8A 5E8DL 1OK8A 2ZYIA 5JHLA 4QRUB 4IGBB 2XWEA 1SOSA 2YRLA 1BD2B 3BT2H 1I8IA 3FTUA 3T0VA 1X7SA 2EIDA 2ZUQC 3UGXA 4DOHB 3GNMH 4WK2B 5IMMA 3K8MA 4KKRA 4FJYA 2HAZA 1SEBB 5AW9B 1DCEA 3PWVB 1UWXK 1YUHB 3O11A 3O3AB 1FZOB 3VTTA 2I5YL 4AEEA 5IUCA 2YS4A 1N0LB 5FV1L 5CUSH 1P5UB 2CKBB 1FLTX 4LFHD 2R9HC 4AEHL 3H42L 3NGBC 1EAQA 1CYWA 5SWSA 1FPTH 1MKFA 5J4MA 3BPOC 1BVLA 1KIPB 2IJ0C 1E4XL 1AS8A 2QZQA 5IV2A 3FCGA 1USZA 4OT1L 1NCOA 4TNVK 3T1FA 5DMYA 3L3GB 4KXBA 2Y7QB 3NJXA 5T3ZD 4JO1L 3IETA 3KGUA 1L7TL 1F41A 1PLGH 1YNLH 2HRLA 3DX7A 3IN0A 5KSAD 3K6OA 2OXGA 1Y18A 1P4LA 5E51A 1EDHA 4IRJC 5IVXE 2VDOH 1T5KA 4P49A 3UTOA 3ECVA 1C16A 5MHSE 1EK3A 3D4YA 1AXSA 3QPKA 3HE7A 1OY3B 4UM9A 1IC7L 2R27A 2JKLA 4OJFL 1U3HA 4Y5YB 1NPNA 3ARDC 5DGRA 2DYPD 4XNMA 5GS2H 2VQ1A 4ZTPH 3KM2A 2Z4TA 5AUMB 4FXKB 4P5TD 3ZE1E 4HUXA 5I30H 4M93C 4K7FA 1FNLA 5FUOL 4NRZA 2KLSA 5IOPA 4PU2A 2ZCHH 5DVNA 3DVNB 1JPGB 2D7TH 4OF6A 3DXAD 4OIBA 5D7LD 3RDJA 3STZA 3VW3L 3CX2A 5JPMB 1G6RH 3MGTB 4HWEH 3BIBX 4PRHA 4XO9A 4XN4A 4WNQB 5CWSB 1MXDA 1D5RA 1QHQA 3CHSA 4FFZA 5FYKL 1AGDB 3VG9C 1JYWA 3SE8H 4UI2A 2VUKA 1BBDL 2PO6B 2FRGP 2X1QA 1EX0A 3OJDB 1UYWL 3JV4A 3TA3B 2AJYL 2IGFL 2BM3A 3KD4A 2QKIA 3ZY7A 4E9SA 1Q9WA 3UIYA 4TOYL 4MZ2A 1NZRA 3PJSB 1WEJH 2YD9A 4NPYA 2JK5A 1EIBA 4NCDA 3KCWA 1AP2A 3Q2WA 4FMVA 1EO5A 4A63A 1DQLL 1PL3A 1EVTC 4OZFG 3VFOA 1UH2A 3IF1B 2XJLA 3L4XA 3SDXA 3WE1A 4IRSD 1YO4A 4YPGA 3RGHA 4JQXC 3WFCH 4NFDA 3X1FA 3JUYA 5D8JL 4BK5C 4Y88A 3UDWA 3WUWG 3C9NB 3RKPA 2AZAA 3BVXA 4AQ1A 3MROB 2CQVA 5T1KB 4LRIA 1YRKA 2FGWH 2CHDA 1KZQA 3RVWC 2YKKA 3X3FH 4M1GH 3PL6A 2PWFA 3FOLA 5ANME 1T22B 4IMKC 5JA8B 2VN4A 1LDSA 2OTWA 4PJ7B 5F71A 2IADA 5DLML 5D1QC 3KPLB 2XQBH 4F7TA 3VH8G 3DV4A 4Z3FA 1EFXB 4H44C 2P3YA 1XCTB 3SE4C 1EO8H 3GK8L 5FGSA 4XE0A 3SEPA 1NDMA 2WV3A 5C2UB 1NWOA 1FGNL 4S2SA 2O5XL 4H8PA 3V6ZA 3IPEA 3OZKA 5JIIA 4ENED 1ZIAA 2YFNA 4QWWD 4UCFA 4WSGA 4GO9A 3U7YH 3UTTB 4OI7A 2J8UF 3MNWB 4YGAB 1WCQA 1IE4A 4ANKA 2ICCA 5TDOA 5DJ0A 1NL0H 1YPZA 3MYJB 2QDWA 4Q6IB 1AG0A 1DTUA 1M4KA 2A74B 4G3YH 1U95A 2NNRA 3VI3E 3AT8A 1AI1L 3AREB 4ELME 3WHXB 3KJ6L 5DD5H 1NGPL 3ARUA 1KIQB 3FUEA 3WAKA 1WLHA 5ADOL 3SQOL 5F1IB 4I88A 2J5LB 3ZTJG 3LIZL 1ZXKA 1CCZA 3NPSC 1F6AA 4LGRB 4JG0H 4EI5B 2AKRB 3M1OA 1KBBA 1QI4A 5HVWA 4JPWL 4Q74A 4JQVA 2HFEA 4YZWA 2F53A 1SLVA 3HFMH 4YXLL 2IPKB 2EZ0D 4G8GB 4WU7A 5HGHB 2FO4A 1OGAE 4LP4A 1CGYA 1CO1A 3TIDB 1BF5A 3WE6A 1QABA 2FD6H 4JHVA 1P0SE 1AYOA 1F58L 5EU5A 4CC1A 4UTBH 5E5MA 4WGWB 4P3WA 5E9DE 1KTDB 2Z4QB 4GXVH 4OKVB 3EUUA 4KK8C 4QI3A 3S3PA 1YMMA 3VXUD 4LCWD 4OD3L 4PGEB 2PXYA 2F5BL 2HJLB 3SKJH 1O7VA 1P69B 2ZD0A 2ITCA 3MJ6A 6TAAA 1CD9B 3TEXA 2BSSB 5IMLA 5D9SB 3HMWH 4UQBA 4Q56A 1L7IH 2UUDH 2VDPB 1A6ZA 1WA2X 3EH2A 3QJUB 4P46D 4LL4A 3S98A 3LRMA 4WHDA 1D9KA 2V5YA 3DVGA 4JZOA 3WHE1 4RNRB 2XPGA 5LQBH 1G7JB 4ZXBC 1OHZA 5AD0A 1FHGA 2GSMB 1BQHA 1UM6L 4LSTL 3TTSA 3HMXL 5IHLB 4U6HB 3GTTA 1E4JA 1WWBX 3MFFA 3RURA 3KEHA 2ICWA 4WEEA 4XO4A 4WTZA 3MR9A 2C9PA 2G60H 5FYKE 3FCSA 1RUKL 1Y7VA 4XT1C 5AKRA 4IGBC 4JY5H 15C8L 3DC0A 4G1MB 1FN4B 2NCEA 4NZTH 1YEDB 3EFDH 2YPLE 4XRCB 2A4ZA 1A1OB 1IL1A 4S1QL 1W15A 1N70A 4W9EC 2IANE 3EDFA 1UWGH 3K2MC 1CD1B 4ZMVA 3S88L 5A2LH 3ABZA 3LZFH 1QRND 4LKXB 1B9ZA 1QW9A 4OCXH 4I3SL 2AJVL 3GRWL 3QUML 4TTDC 1A9BA 2L8AA 5T8IA 2C34A 3BUIA 3CZNA 5ECGA 4Y4FA 5DDHB 1R5IA 4TSAH 1R17A 4CDGC 1DHKA 3V0VB 4GRLA 5JLZB 1