3SD2A

Crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
NPMGIPIQPTYEKCAILSNILNVSFGRAKDYAIITVTNKATGEIVHSKTYHNTSIVMIDMSSCEKGEYTIHIILNDCLLEGTFTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
molecule keywords Putative member of DUF3244 protein family
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sd2A01
4G5AA 3SD2A 3D33A
chains in the Genus database with same CATH superfamily
2DM3A 3LAFA 2UY6A 4YVUA 2YOCA 4HMCA 2RMNA 5A16A 4JO4H 3RILA 4DPBX 1PQZB 3HPLB 2OLDA 2N56A 2J8UF 4Z7NE 3GSOB 2NXYB 5CBAB 4ZMVA 4HS3B 1KT2A 3MGTA 3CK0L 3O3EB 4M43L 4Q56A 3SGKC 3D39B 1HHJB 4HIEA 4L3CB 1VGKB 3TASA 4JUSA 5DFTA 2P43B 1JK9B 1N68A 2XWJA 3JTTA 3Q1SH 5IQOA 3K2IA 1K4CB 5DJ0B 3EYUH 3CN0A 3FB7A 3KCWA 3DO7B 5FIEA 1X9UA 2XKSA 4AWJC 5JOPE 3ARDC 3AWEA 2YHGA 4HS6A 1IE4A 4K7PY 4OJAA 5DEGB 4FADA 3UTOA 3MJ7B 4G82A 3NBNA 4GRWF 1D7FA 3DRTA 4FFTA 4OFYD 2F53E 4JFQB 5C9JA 2FB4H 4AQ1C 2DTML 1YPZE 3X3FL 1IAIL 1R6VA 2X2UA 3ZMNA 4X80L 2X9XA 5MP6L 4DGYH 4YHIB 3LQAH 5TJWK 4P48A 2YSTA 4ZZFA 2DTSA 1D7CA 4RFOH 5A2AA 4NQSB 2Y7NA 3UO8B 3ELQA 3DPDA 4U6TA 1JMXA 4KROB 3N42B 2MQGA 1FL3B 1ACCA 3CSPA 4P3DB 1RERA 4F7PA 1D6EA 3WEAA 2WBWB 4YDIH 4F33A 1LEGB 4E5XA 4G6MH 2YEQA 4GUCA 4NQTA 5DRWB 2FVNA 3OKLA 4OZFG 2BS8A 2PTVA 3ARBA 1GIGL 3LKNB 4FQ2H 4KDVA 2H0PA 1R17A 2G3ZA 2UY6B 1WA0X 5HGHA 4LP8A 2DM7A 5EA0H 1B0GB 5DSCB 3VM7A 4JL1A 1I3VA 3T0ED 1RZQA 4AQEB 1NFAA 5T1JA 1D5XA 2WBJC 3TBTA 1BW8A 3CU1A 2CMRL 4K4KA 2AMGA 3FQXA 2DQDH 4LCWB 9CGTA 3RFZA 2BOCA 1L3WA 1RFDH 5KOMC 5IQ7L 4HHWA 4UAOB 3JVFC 3K1DA 3FN9A 2MCG1 2UZPA 3E6FB 1BMGA 1FP5A 3TBCA 5IJDC 3BN3B 2VW7A 3COOA 3ZZQA 4V1DB 3MC0A 2CJSA 3RTLA 1MH5B 4ZOEA 4HFUH 3OR7A 4CSTA 1FVEA 2BVPB 3MNMA 3M46A 1CFTB 1G6RL 1UCBL 3AM8C 4GBXD 5F3HA 4GXUN 5IBTH 4P2OA 1YMMD 4YN3A 3ARSA 5DC0A 1XD0A 3PQYA 3IRPX 1FLRH 1OQXA 5MEOA 3VI4B 4A2FA 3QFJD 1XGYH 3TT3H 1E6OL 5DS1A 5AVTB 3CMOL 4BEIA 1URLA 4MJHA 2NSXA 4ZAKA 3KWWA 2WUCL 4Q8BA 3AB0C 1CCZA 1O7DE 4LAQL 3QDJE 2CM5A 2R0ZL 3H3BC 3MXVL 3EO1B 2WSKA 1HHGA 3LEXA 5HGDA 4BFOA 1LILA 3QQ9C 2NQCA 2VL5A 4GMSH 5IVXF 2AJ3B 2BP0B 2AEQH 3MV9E 5FYKH 2NNAB 4OZHA 1MCIA 4LLQB 2J21A 4X9YA 4NI6A 2IH1A 3UG3A 2ICES 5CJQL 1L9RA 3FTWA 5DRWA 5BZZA 2A9BA 4PV1C 5EC2B 5JOEA 4JJ5A 4TSAL 1KLGB 2NYYD 3GBDA 3LHAA 3O3AA 5LWYL 3KGRA 5D1ZB 5ID1A 1K4CA 4YJZL 5SV3A 4LPYA 4PR5A 1MNNA 1WCQA 4DGVH 3O6FC 1NDMA 4EOWH 5TF1L 4NZTL 3KYMB 3DGCR 4NRYB 1M7DA 5DHXB 4M6NH 5KVFH 5IFAL 3MO1A 3IB4A 2E6JA 1HQ4B 1ADQL 4WUUD 3UAAA 3FCBA 4XPBL 3RHWK 1HWGB 4NI3A 4W6XB 1KPVB 5HBBA 1RAMA 3FO1A 1F4XL 5EU6E 2MNJB 1CB4A 5CMAA 1A6AB 3T77A 4WEBL 1JZHA 1OTSC 2IIJA 3ISRA 5A2JH 4CKQA 3FB5B 4HLZH 4P3CL 4ODWB 2CIIB 4TF4A 5DHVB 4WFFD 4HSAC 2IADA 4MMZA 1NFDA 3P4NA 4GO9A 1JNHA 2BY3A 4X6BB 5C07E 8PAZA 1YJDL 4HHAA 3T0VA 3U0PB 1JF1B 4CN4A 1KDJA 3ESVF 5DJXB 1Y0LB 2PNDA 2YEZB 5AL0A 5DZVA 2EUZA 4TSBH 4QGYA 1A6TA 2AK4A 3DUHA 2EDFA 1LLAA 2DQIL 4FYQA 4LCUA 4WHCA 5D2NA 3VXMA 4AIZA 5H35A 4JPKH 1ZS8B 3L3JB 3HRZC 4KFMA 2VLRA 5IHZA 1U4EA 4L4VB 2H6UA 4NUPA 3VRIB 2W65B 1AO7B 1T1XA 4CMHC 1NGQL 2OTWB 1S7VB 4HJTA 1JHTB 3NCBB 2H2PD 3CH1A 4PJEE 2BRRL 5FYLL 4CSZA 3G9VA 4DQOL 4ZW3A 3W9DA 2ZQKA 2AAVA 2W1NA 4FFYH 3DX7A 5CBEB 2ADIA 1MRDH 3T6QC 2Q86A 3IJSA 1AXSB 3RZCD 3AMKA 2VR3A 4P4KB 3RG1C 1AGBA 2B4CH 2VKXA 1H3WM 4YHYC 4GQ9L 4BQ8A 4UT9L 3TONA 4IU2A 2W0LA 4D8PA 2ADJB 3O0RL 5TD4A 5HYJE 4OV6F 1R0AH 1L9QA 3MODL 3TLRA 2A5UA 5IKCB 4FXKC 4HWBL 2P48B 1OGSA 2XN9B 4KPHL 4LF3B 2W9DH 2Y6SD 4MXQC 2CU9A 2H32A 3BAEH 2CBTA 4XB7A 4GEIA 4N2AA 1OT4A 2BIMA 5FX3A 3OL2A 4FMKA 3ARBC 2DJSA 2VE6B 3KGUA 1ODAA 2Y1AA 4V1DE 2NY1B 2LTQB 3V79C 3T0EA 5D5MF 2IPKB 4K7PL 2A77L 1ID2A 4OW6A 3ETSA 4GAAA 4XODA 4W9EC 4N0FB 4K3DH 4NQXA 1A6UH 1BV8A 1C08B 2Z7UA 2A3TA 2YAMA 3PRZA 4GXVL 4N5ED 3BPOC 2YAPA 3QP3A 3VFSB 1EO7A 3K6DA 4MJID 4NZUH 2X10A 3GPEA 1FZJB 2QQQA 3MI6A 3VGEA 2VISA 1I8LC 3GM0A 2YKKA 3L7FA 3CZFA 3FUMA 2VIRA 1G94A 4U3HA 4LCWE 4OZHF 2VDNB 3OWRA 1Q9KB 1MFDL 4ZFFA 2CCLA 3DV4A 3MOBH 5E2WL 4Y4HA 1JZFA 1PTZA 3CXDL 4S2SA 5C08D 2WGXA 2HYMA 2HB0A 2PPEA 4G9FB 5BO0D 4ONFH 4QOKE 4AX3A 1MLBB 1CGSL 3B5GA 5CNHA 1I9IH 4CC0A 1JK8B 1V3MA 2EO7A 3KPLB 1EHXA 1E4WH 2R51A 2XG4B 3V6FA 1I3GH 3IETA 1FFRA 1QLFA 4IDJL 5KSBA 1IQDB 2W0FB 5D7JA 2MCPL 1MHHA 4JG1L 3K0WA 1XAUA 2ZYHA 3P3TA 3UZVB 1IBGL 4Y1SA 5D7SL 1KCRH 1TVDA 2WVVA 2Z91B 5CJXC 3CE1A 3SY0A 4Q9BA 4I4WB 4MDJB 5D93C 5CUSL 2D0GA 4PJGF 2MMXA 4NUMA 3PGCB 5KJ7E 2FT8A 2H3NB 1DL7L 2DM4A 3ISYA 5FHAH 4FNLH 3RIFK 2FK9A 32C2B 4P46C 1KZYA 4Q6IC 3UEQA 3IVKB 4M1GL 3M1CA 3SJVB 5B38G 4P2QA 1KXTB 3QIBC 1ZLWK 2FEDD 2AKRA 43C9A 3LNDA 2R7EA 1R24B 5JMRA 4NGHH 5CJOH 1XF2B 4P5RA 4ZS6D 2J72A 3QFDA 4RDQG 1J18A 1JWMA 2VDQL 4Y16D 2KDGA 3CSYB 2MTAA 3QHZH 4BFKA 4GW4A 1CICD 1MCRA 4Q9QH 3HCVB 4TQPA 3CZUB 2XRAL 5MI0C 3MROB 5KS9B 3WD5H 5HHNA 2GEEA 4ZTPH 3HNVL 4JCMA 4XBEL 3SE8H 3KWXA 2BSEA 3RKDC 3EBGA 4GKZB 2DIAA 1TTAA 4UV4H 1UFUA 5C3IA 4FCAA 3SCMD 1L6ZA 4KO5A 4LSQH 2GIXA 3TA3C 3MOAH 4H8UA 4BFNA 1E5UI 1QKZH 5IROC 3WN5C 1MCDA 4BFRA 1GSMA 4JGJA 4WO4C 4PJAE 2Z92A 4LFHD 4QI3A 3OV6A 3IWUA 4JGUA 2VMDA 4LHUG 2NT0A 4M02A 4P4RB 1A7NH 3UZVA 3VCLA 2AJSL 7FABL 2VJ8A 2DYPB 1WF5A 1FV1A 2QQKH 3UBXA 4XCYB 3D12B 4BK4A 3LOWA 5L2KE 2IAMC 3D4GA 4WF7A 3HRZB 1U8CA 3RGVB 1L6PA 2MWCA 2VDQB 1RMFL 1FZKA 1WFNA 4ODSL 1BG1A 5E8NB 3O8XB 4ZFQA 2YD5A 1SUJA 3NJJA 3ZDYF 1TPXC 2X40A 4PH8A 3LZFH 4N25A 2I60L 2H4EA 3SY0B 4MASA 5A2KH 5F9OH 3Q0HA 1CL7I 3GHEL 3K81A 1BD2A 1P6WA 2AJUL 2QELA 4YSAA 5IESH 2B16A 3HE6C 5JOFA 1AD9B 4NQEA 3QCVH 5JHDB 1GYUA 4ZPVB 3BQUC 4YAQB 1N2RA 1MEXH 2W9DL 5AW8B 1FVDB 1GYCA 2WZAA 5JIMA 4HU8A 1I1AD 4XNUH 1NFDE 1QLRA 4POUB 3SD2A 4MNHB 1WGVA 5I76B 5K59F 2P26A 2X4NA 1VKXA 2CO3A 1S7SB 1PZAA 3D51A 3SODB 3IGUA 4XO9A 3KPSA 1J5HA 4JFZL 3RI5F 4XPBH 2LVEA 4JFEE 1N67A 3E6HA 3WG7B 1NGYB 2CDEB 2FYYB 4RMSA 2L4OA 1A6UL 2EZ0D 4AL8H 3NIGB 2XJKA 2LABA 3BP7A 5GZNA 1QRND 2JIXD 4X6FA 4G9DA 4RMVA 3ZT5A 4PJDF 4WFED 1MWAL 4APXA 1IEHA 2DDQL 3RVTD 4RQQB 3LVTA 1C16A 4JY6A 4FAAB 4ZXBD 4DKEH 4HCRL 1U8OA 2R7EB 3RIAK 5I73C 2OMXA 2X2IA 4HDIB 4OM1L 3L2NA 4HYTB 2QBWA 4TM9A 4F27A 5KTEL 3ZTNL 2J56A 2J88H 1HJBC 4P9ML 5HYJB 5LGYA 3QIWB 5DQ9A 1P6FA 1YECL 3HRZA 5F96H 2O61A 3F5WB 4DZ8A 5D7LD 1KC5H 5BUPA 4TTDC 3ZJAA 2EIEA 2WNKA 1QLEB 4AYSA 3EGSA 4U1IA 4UT6L 1G1KA 3HC0A 2FWSA 2VM4A 5AYUL 4DWHA 1Z9OA 3RAJH 5I19H 5D1QB 1NUGA 3LRKA 1TTGA 4LCCA 3ZDZE 1NCOA 2CMRH 3H9SB 4ZUSA 5EFIA 1H15B 3KPRA 5EG6C 3IETB 2PW2B 5IW6B 2OS7A 2G2RA 4O2EA 4YDZA 1KLFB 4BXVA 1WE5A 1J86A 3U6XA 1C5BH 5E6SB 2E75C 1KULA 4X4YA 1FNSL 3VFGH 4XMKH 1LWJA 3C5SB 1JDDA 2PCPB 2ZX6A 3EOTL 4U1JA 2VAAB 2JKTM 4TLKA 2Z65C 1HH6B 4O02A 4OGXH 4QRAA 3NPSC 4JFFA 4DN3H 7PCYA 4RLDA 4PRPA 4W6WB 2B59B 1XGYL 3TT3L 4GAYB 3OD3A 2GUYA 1UWGL 5HDLA 1S78D 3FQYA 2DBJA 3QO0B 5E8DH 5HYSG 4KH2A 5HY9A 1KPVA 5GGTL 4HIIB 2L7UA 3Q8BA 4RGNB 5AZ2L 4Y4FA 5IR1B 4NCC2 1W9XA 1WP6A 2H1XA 2X2YA 1P7HL 2CHDA 1N59A 4O9HH 2F8XC 2HH0L 2ADGB 3DYMA 3RUGA 2BPBA 5EO0A 4PRHE 1FCGA 2BNQE 2JTDA 4H2AA 5E99L 3U82B 1A1OB 2GTQA 1OF2B 3GXPA 1QKZL 4H26B 3DIDA 4WLCA 3QGVA 1PIFA 5BW7C 5L6YL 3UP6A 5TE4H 3O3AB 3WE1A 2UZXA 5DQDH 1AFVH 4OCLC 2NPLX 4LLMB 4ZFOA 1DFBL 1UM6H 4HXAL 4YSCA 1XTMA 4B6ZA 4IJ3C 1FHNA 2R1XA 3W57A 3WKQA 2VXUH 5SWSE 4XP6L 5IMKA 1HNYA 3IYLW 3BKJH 2OMYB 5MHSD 1TEGA 1TXKA 1P4BH 1NUDA 1CFVH 3EJYC 4YFDB 3MJ9A 1XF5A 3B4NA 5DTFA 3V0WL 1A65A 3BP7B 3CIAA 5EF1A 2OL3B 3H7BA 1ED3B 4YXLL 2XBTA 2DH2A 3T0AA 5IMLA 4R3SB 4UQ9A 4G1MA 4PBXA 3MQIA 5C0IB 4P5TB 4JJOA 4KY1H 2RCSL 3MUGA 3UTZB 1ONQA 2HN7A 1NA8A 3OPZL 2R2EA 5CINL 5IBUB 1X5JA 2WIIB 3DJZA 1V7NH 2NX5A 5E9DB 1TYEB 4RCAA 3L3IA 1ASQA 1IC7L 2UX7A 1EK3A 2VXQH 1AP2B 2DWDA 2AJZB 4QMEA 4WFHD 3TPUB 2CHNA 3KPSE 1FO0L 4LLUA 1MFAL 4POZC 4Y2OA 3C09C 5E8PA 2Z3FA 2YQGA 4OD3L 1OCRB 3DSNA 2YPVL 2YPLD 5L2JA 3RWHB 4KRLB 3CN4A 4XCCH 1PKOA 1JVKA 5BUAA 4TNEA 2Z34A 1T21A 5A2LH 1MJ7L 2XWJB 2QZQA 1FCCA 1JOIA 1BGXL 2VSKB 3EUDA 1TZAA 1E2WA 1WA2X 2WZPD 3RUGB 2BNRB 4U1SB 3TGXA 2ISDA 3ARXA 4FG6C 4L29B 4PJFB 1U3HC 5TTRA 2EDHA 5DQJB 4P3WA 2FO4B 1U8MA 2GCYB 4Q6YA 3AITA 5A2CA 3AMLA 4KZEH 3H85A 4NEHB 4G9FE 3D8MA 1WT5A 4X7SH 4ZO7A 1VGEL 3A6BH 4KRPD 4ZUUB 2XKUA 3CDYA 4NM8H 4DGWC 3EGDA 3QW9A 2GFBB 4X9BA 2MHAB 3EJZD 5T1LD 3N1FC 5DJ2B 3C8KB 2DKUA 5I1HH 3NH7L 3O4LD 3F83A 3L9RB 5I75C 2VUYA 3C60A 2N01B 3F7LA 4MQXC 1OLZA 4NBXB 1A6PA 1XXDC 2CAKA 3L1EA 4XB3A 2DMGA 1HZKA 3LKNA 1ODUA 3MRCB 3U36B 2XZAH 2VN6A 4PJ9D 1WCBA 2LU3A 3C5ZC 2X12A 1TJIH 4WW1B 4FFWD 4KDTC 4N5UA 1DN0B 1PSKL 3QIWC 2FH8A 3HPJA 1H8OA 2ARJQ 4KKBC 4HZ1A 1CFBA 1TTFA 2NY5C 2J8UB 3TO4C 2X4TB 4EJ1C 1SOKA 5C3LD 3TBWA 1JCVA 1GW6A 3EDFA 4Y16A 2CO6A 3J27A 5J6GA 4OAWB 4DKTA 1AE6H 3RI5K 3MLSL 1IKFH 2L7JA 1Z1WA 2V9QA 2YSSB 1JJUA 3KDPB 4WNQB 5GJSL 2ZWZA 1S7WB 2Q7NA 3ECQA 4MA8L 2Z64C 4NZUL 4YLBA 5I9QC 2YPLA 2FEJA 3QJHB 2I7SA 2P46B 3J2PA 2K8MA 3K2UL 1EXUB 5ESVA 5C6TH 2WYTA 2PYFA 3CZEA 2CRMA 1FORH 5DJ0A 3SPIA 5T33L 3AJ7A 3QUXA 4X7DC 4YHKL 1RUAH 4M1CC 2EXSA 3U48A 2BOBA 3PP3H 4N8VB 5I5MA 1YNTA 8CGTA 4MGXA 1IGYB 4R7NA 3MACL 4MCYA 4ODBD 3GI9L 2RQEA 2ZXQA 1MPAH 1QLFB 1ZVSA 1WC7B 5ANHA 4XCFL 5D2LE 3B5HA 5AAWC 2NY4C 1EJOL 1KTBA 2BSSB 2WWKO 4HIIA 5EC2A 4R8WH 3D50A 4URTB 5EPMA 4HWZB 12E8H 4BH8A 4MQ7B 4A2GA 2PXYB 2BCKA 3OLEA 3GXFA 4RGNE 3ZKSD 4RWYH 5IF0A 4XNQA 5KSAC 4M4RA 3VMNA 2F18A 4GAJL 3P2DA 4PJIA 2PWGA 1HHGB 1V7MH 1D6EB 2R0WL 4HJ0D 3QO1A 4Q52A 5HGDB 5IB4A 2OMWB 4MMYA 1BMZA 4L4JA 2C7UB 4AIOA 5IB1A 1FPTH 3K4AA 5IW1A 5AUMA 4WEMB 3RZWA 3SYPA 2QADC 4CSSA 2MEJB 1JHLH 1FN4B 4DERA 4GUQA 2AEPH 3T8XB 1MJ8H 4HFUL 3JUZA 4JFVA 4YL9A 5L2KB 3A6CH 5GHWL 5KG9B 2RIKA 5F1NB 1DQQA 1ACYH 1PCSA 3O8XD 3PP4H 1A1NB 5DDHA 5L0QC 5DRZB 4BGDA 4M7ZC 1GL4B 4E2OA 5E8EB 1Z5LA 2EXWC 3TC9A 3JWDL 3ROOA 4V1DA 1DLFL 1QD0A 1WBZA 3WAKA 4E9SA 3EGSB 1TSRA 3ASOB 1BLNA 3GSQB 3VXUD 3IWVA 2GSIB 2HX7A 1EPFA 2HRPL 5M7QA 1E27A 1QI4A 3MRLB 1KFAL 2ED8A 5SV4A 2YQBA 1EZVX 3CLFL 5DWUL 2IQ9L 4N2OA 1X5ZA 5E08L 1PZ2A 5K39A 2WLNA 3EDJA 4FS0A 5AYUH 4B3VA 4DH2A 2YJQA 2ZONA 3BAXA 2GB2A 3WTWA 1AG6A 1UD4A 3AXIA 4MXVE 5DURD 2OMTB 4P46A 2A9ML 2PPAA 4DPCX 1CVRA 3ETBJ 4G43B 2HWZH 3ZTEA 4KTYA 4AQ1B 4PJIE 2X5PA 2MQ3A 4B9CA 4Q4IA 5F3BA 3UO1L 4LDEB 2WAHA 3KYOB 4YHPA 5FO7A 3GXNA 4DP0X 4L9LB 3QDGB 3HFMH 4GS7C 4PS3A 2VLRD 4XZUA 4AZ8B 3K2MC 2FBJH 5FUOL 1M7XA 1YN7A 3ZE2F 1EO8H 1Z9LA 2Z0UA 4PJAA 3V4VH 4J4PD 4BFBD 2P7TB 2HUHA 8FABB 3BQVA 3P3SA 3UIZA 2DMHA 4GEJA 1NC2A 1Y6NR 4R7NB 2W60A 3F12A 4NWUH 1DVFD 5KAQF 2JMRA 3VQLA 4GRLD 4IOFD 4NQVA 3C2AH 4TNWK 2VQ1A 3ZXAC 1XR8A 4H26A 2EKSA 3ENEA 3V0JA 5HHQB 1GZQA 2R39A 4Z23A 4F9PC 4NSKA 4QXUH 5PCYA 3JUYA 1CO1A 2L7EA 3RDTD 4HKXA 4JKKA 1OAQL 3MRMA 2DD8L 1VCBC 1A3RH 3WKYA 1FI8C 1N5AA 1YJDC 1SY6A 3VXRB 4OI8A 1IAOA 2C9PA 4EIBA 3KYKL 4WJ5B 1BOYA 2WQWA 2GC4C 1AZNA 4W9KC 3FKUS 2CQVA 5CWSA 4R90H 1C16B 4JY6B 2C7UA 2CO6B 2E9BA 3SO3C 5L88H 3PF2A 5BRQA 2XIIA 3A24A 1TZGH 4C83A 2PN5A 4XP1H 2BS71 2CUAA 1YG9A 2QMKA 4HC1H 3GIVB 5DEFA 1CGYA 3PJSA 1ZS8A 1H6TA 3HC3L 1N3NA 4ONGH 1RK0B 3KPOB 2X4RA 4AGOA 1OCZB 4X6CB 4WI5A 2QVKA 3GBMH 2J20A 3JWNC 3RY6A 3U0WH 5BZDB 1DVSA 3DYPA 2WSDA 1JZ2A 1KLFA 3UJTH 2ZJSL 4R84A 2Z7ZA 3NCYS 2J8HA 3QYCA 4NO2B 2CD0A 3ARGC 2EEXA 5C0AD 5GGRB 4AKOA 4P2OC 3QWOB 3GJFB 3QIBD 4P23D 2IG2L 4YSTA 4WK2B 4AYMC 1FZMA 5FECA 4AQ1A 1K4DA 1BYPA 3MRLA 5IM7B 4DKFL 3GLEA 2FT6A 2LV4A 4ZTEA 3E9TA 1XT5A 2XQBH 3OPUA 4WHDA 3IFPA 3OQRA 1IGJA 1E6OH 2FATH 4KKCC 5F6HI 3OZKA 3TEXA 2B39A 3V4PA 3FT1A 1ZV5A 2FYVA 2C3WA 4LASH 5SX5K 2C3VA 3AC0A 5D70L 2XN9D 4YFLF 3T3PB 4MNQE 1I82A 3KGTA 3N04A 3VXUB 4CMHB 3IU3A 2NY3D 2UV3A 3RU8L 3DXAB 4I1PA 4AYEC 1VADB 4TV3A 3LD8C 3L1GA 3U9PH 4KH9A 3SDCC 3CG8A 4V11A 4XXDA 4ELKA 3MROA 3V0EA 1U42A 3FT9A 4BWTA 5AW9B 4DP2X 4F80A 3T4AC 4A6YL 2B1AL 2OI9B 4HIJA 5C6WH 2KZ1B 4P4KD 4QRBA 5I0VA 1QFWM 3QNYA 4RFOL 1SBSH 4NQCB 5CIPH 4LFHG 4NNXB 2D3NA 3ZQWA 2P7TA 2Q7AA 5AAMC 4WGKA 2HRPH 1NCJA 4I1NB 3OLGA 1OKEA 2WLLB 2IAMD 4LIQE 4XAKD 4EUPH 3FQ4A 3SKMA 4OT1L 1U8NB 3GF8A 4X4XA 2LLLA 2XWXA 4N87A 2WQVA 2APFA 4HWBA 4ODTL 1AFVL 4PRPE 4GIPD 4RX4A 4UOW1 2Y9RT 2H9GB 3U4KA 3TX4A 2NUPA 3L9YA 5I1LB 2N0MA 1BDYA 3VWKD 1HCYA 4QRUB 3N1PC 2Y3NA 3ZYJA 2HP4A 3FTGA 4WKZA 1BCIA 5BV7B 4Y4FD 3HG1D 1IEBA 3VU2A 4AE0A 1INQA 2DB8A 1CDYA 1NC4B 4EDWH 4FA8A 2AMUA 1NOLA 4CADA 3PPSA 2BSBA 5FXCH 4ANKA 1YUHB 5GISL 2KPWA 1S46A 4A6YB 4Z7VE 2FO4A 3ZDWA 4BQCA 5D1ZC 3ILPB 4JFFD 3MRGA 5D1XD 4O5LH 3C6SA 4PRIE 4PW4A 4XVSH 3P4MA 1TVBB 5BRZE 3IXAA 3Q8FA 3QXWA 1SOXA 4F57H 2A4CA 3Q5TA 4XP9H 3BWAB 3P77A 3NZSA 2R1YA 4OQTH 4LEXH 3L5XH 3CVBA 1KN2L 4M62H 1DQVA 2IC2A 3DOIA 1M6OA 1LGVA 4N9GA 1NCNA 5EO9B 1A1MA 2JKIS 2FJHA 4EOWL 2GG1A 3D25A 3ESMA 3N1MC 4BK8A 5EIIB 3VGAC 3BH8B 3RZCA 2VLKB 4Z7WF 2TRHA 4EUPA 5GSVA 2WPGA 3LRGA 4U7MA 1BF5A 4ESKA 2BINA 5DRNB 5CEXB 3N40P 1DVUA 1KIRA 4CJ0A 1OAUL 2ZWYA 3N6YA 3QWNA 2A0LD 4I85A 5ALCH 4LL4A 4F1SA 3C8KA 1UJ3C 1MJJA 3IN0A 2J8UE 2NY6C 3QHTC 1BX2A 2VLLB 4X8CA 4H13C 4TTDD 5K1VA 4S1SH 2DJUA 4J28A 1DQML 5F7WC 4BFIA 4Z78A 3CHQA 4UAOC 3R0NA 1Q0XH 1IAMA 2VXTH 1WCBB 2Q7YB 2NYZA 1YJDH 4M7KH 2WNGA 2DEWX 4ZUSB 3VXRE 4YSSA 5T1LB 3FTZA 4NN6C 1YYML 1EBAA 1U8HB 3WLWC 4A7SA 1R5IA 1QRNA 2JIXA 3BUQA 5KS9F 3V4PH 1MQ8A 3T6WA 3VI4F 2ZUQC 1E3XA 4PHZA 1EJFA 5D7IF 1J12A 3O45B 1AC6A 1HXMB 1RZKC 4N85A 4GB9A 3SGDI 1IQWL 2ZWKA 4XN2A 2IH3B 1SN2A 1SDDB 3OG4B 1IBGH 1BPLB 5D7SH 3C5XA 3I9AA 1FO0B 1T1WB 1MCLA 1CDCA 4HK0B 2WD0A 2RFXB 3DBSA 1CFTA 3ILPA 3NRPA 3Q6GL 1M3JA 1I1FA 4Q6KA 1IEAA 1N70A 4HBCL 1AKJA 1CL7H 5T3ZE 4ZQKB 2VJXA 1UXSA 2FQFA 5EWIH 1HOCB 4I0PA 3BSGA 2VDLB 2YR3A 5I8CA 1DJGA 3LPOA 3JXAA 5LG1A 1INDH 1AYOA 1M2VB 3DURB 2XKNA 3U2SA 1YEJL 4IRZH 4QHKJ 4YX2H 3TO2A 4KX7A 4LVNC 1LE5B 1T2XA 4W6YB 3GBNH 1X5XA 4DVRL 1KB5B 1ZPLA 3IJHA 3O9WA 3BAJA 3QI9B 2WLIA 5CZKA 5EORH 2OJ1A 1NLBL 3GSNA 4EBQL 1I3RB 4AT6A 5EEUA 1IGMH 3O81A 4HP5A 3TBVB 5ACMA 4PV9A 3UCQA 3U30C 4U1HA 4XMTA 4JKMA 4KTEH 3X17A 4IBYA 1AOZA 4XBMA 4QXGH 2XCMC 3QR2A 1OIOA 2W0PA 3FFDA 2Y23A 1KG0B 3B2UC 3DXAE 3AGVA 3O4OB 4IOIA 4J1UA 1A7PL 1AQ8A 5DJYB 4S10A 2AXGA 3BZ4B 1F4AA 1MAJA 2CDGA 4F8LA 3JT2A 3UGXA 3B56A 3WXWL 3SDXE 2NX5D 4HLEA 1BF2A 2D7QA 3L4XA 5E2JA 2FZ3B 4F9LA 4B7LA 2Q9OA 2DI7A 4YMPA 1KXHA 3TJHC 4B0MB 4KITB 3MREA 3NCYP 3IU4L 2YD2A 3O6KH 2A9AA 3KM1A 5F7HA 1RHHA 3UBGA 5IQLA 4H8WC 3ZPDA 4MNQB 1KYOJ 1OAXL 1RMFH 1IZJA 4DSYA 2A6IB 3O6ML 2L8AA 1BBJA 1GZHC 1KBPA 2ZCKH 3BPNB 4YDVB 5F88A 5J1TC 4GW1A 3ZZLA 3SQBB 4O5LL 3IMRA 1I8KA 5HJDA 5TQ2L 3WO3B 4O4YL 4PJHB 2ROYA 4JY4A 4ZX4A 1XB8A 5C0IA 2NW2B 3MJ6A 1ZIBA 5JMOC 4QY8A 1BZDA 2QKIA 4RSYA 3Q3GB 2CM6A 4CKVX 3P30H 3V0DA 3QZWB 3BZEA 4AH2B 5DVKA 1AGEB 5K93A 4Y2OB 1ORQB 3CSTA 4NFBA 1WFJA 4LHQB 2GKIA 4G3YL 5D8JL 1YY8A 4G70B 5D72H 2ESVE 1QPPA 4ZQKA 3QUZD 5CIPB 4FG6D 4C56E 4CW1A 2YN3A 4Z3EA 5SWZD 4XOBA 1MI5A 4LPWA 5JW5B 2BVPA 1W80A 5EUKA 1CDIA 5TFSH 4EMZA 3E2HB 3CDZB 1J1XH 1QSFE 4EIGB 2EEDA 4JMNA 2HT3D 4KJWC 4PGDA 3T0DA 4WZ9A 3GJEA 3LEYL 4KRPC 4TNGA 2VM3A 2OZNA 4WNSA 1F45A 4X98B 5EDSA 1FFQA 3MUUA 1KCRL 2VC2B 4UQ3B 4L4VD 3H9SD 3EJZC 3CMGA 2OTUB 3OF6A 4PCYA 3KLHC 4MYWB 3V9CA 5IVNA 3D6GA 5C08A 3VG9C 1AIFB 2W9LA 3WS6A 3PREA 2HTKC 2GJRA 1BFSA 5D9SB 2APSA 3KPPB 4I88A 3TFKC 2YXVA 5LVEA 2A1WH 2BZ7A 1L0QA 2EDNA 3W5MA 5AEAA 4K23L 3WAJA 3LZQA 3LKQA 4Q0XL 4NQVB 2XNAB 3VXOA 4FL4B 3CSBA 2QPFA 3HUJE 4WY7H 3DPBB 3GIZH 3D5OF 5B3JF 4XNZB 1KBVA 2DMKA 4OKVA 4F93B 1NM4A 1IL1A 1QFWH 1QX1A 2QTEA 4Z0XA 4LIQL 5G2NA 4PLJC 5INDB 4P59L 4UQCA 6CGTA 2QSTA 15C8L 1OT2A 2P5WE 3WNPA 2MOQA 2BSDA 3WTTA 5I19L 2WLJA 4JQXC 5I0WA 2CLRB 2KH2B 1ZLUK 1AMYA 4YDNA 5DR5H 1W0YT 4ERSL 4F7EA 5IEKA 3F7PC 4NHUA 4YSRA 2R27A 1B2WH 3UP1A 1IE5A 3WTVA 5T1DL 4Y4KD 4AGNA 4LKXB 4OF7A 1AD9A 4UYPA 3L45A 3RWCA 3DROB 2J73A 2YFNA 3CUPA 4EN3C 3Q3GA 3R8QA 1KJVB 1SEQL 3LY6A 3LDBB 5KSUB 1F90L 1HWWA 3HR5A 2X4OB 3PJNA 1TVHB 5E2UL 4AMXA 2V3EA 1IAIM 2IMMA 1KJ3H 2X4NB 2ZX7A 1NOFA 5JZ7D 4AIEA 4ZFOL 4DN3L 1Y18B 4E9TA 3GSNL 2K4WA 3BESR 4HK3J 2NY4D 2H0FA 1W91A 1XB3A 1TVBA 4M00A 5DT1H 4XGZA 3H6AA 4N8UA 1RLBA 3BKMH 4NRXB 1RZGA 4JJHA 4MMXA 3M6DA 1LD9A 4RVBA 5JOFB 4BA8A 4LF3A 5GS0H 2NUTB 5KSAD 4O51A 3DSFL 4FKHA 2CUHA 4DHLA 3QI9A 4I3RH 5E94B 1O0VA 4DOHE 4ENZA 5KVMC 1GS6X 4GRLA 3WLBB 4MAUL 4BFGA 3EKCA 5E6IB 1HHJA 2YS4A 3MUY1 1JHKH 2A38A 2DQTH 2F5AL 3FUIA 3KPSB 3QEHB 2PP8A 4K3EL 1UGKA 4M6AA 4XMPH 1HI6B 4GMTH 5CEYB 1PX8A 2WLLA 5A40E 2HFFB 3MRQA 4IDLA 4QF1B 1IZKA 3AU1B 3QQ4A 2R83A 3RPBA 5IB1B 3DVGB 3SE4A 1PL3A 2W91A 3NCCB 1LEGA 4E5XB 4IRSA 2Q10A 5F96L 1B88A 2DQHL 2UZIH 4XBPB 4QRUA 3B7RL 2WWMC 3FU0A 1TU2A 3QNYB 4LVNB 4YXLH 3SDXB 2EXWD 5F9WB 3L3HA 1Q1PA 2NZ9D 5HYSB 2R0KH 4OUUA 3S96A 4YSUA 2ZE0A 4UV7L 4HJSA 4X7CC 3VE0B 1EZUA 1FGVH 3MCKB 1TKWB 2H0EA 1KPRA 3NQIA 4YDKH 3SE9L 4IKKA 1JZIA 3HUJF 3QJVB 1I3UA 4QHKI 3I3EA 3GRBA 2F53B 5DMJB 4OF8A 3VXSB 5KUMA 1JI2A 1LEIB 4W9FC 3UBHA 4BSVA 2OJZH 4QXVA 2AABL 5EU6D 4MRCA 3O41B 1ET8A 2BSED 3UDWC 3NJIA 4AGMA 4IIQA 1GTFA 3MRBA 5FKAA 3O3BA 4KKAD 4XCCL 1OGPA 1UXLA 3CSFA 4WUUE 4MAYD 4LRIC 3WMQA 4KUZL 4ETYA 1FSKC 1MPAL 5BV7H 2NXYC 5JLZB 2P42B 5HI5D 1BEXA 2YMXL 2M8XA 3RVWC 1I7RA 2P45B 5CJ5A 1GGCH 2A74C 4A1RA 5AYTA 1LQSR 4QRPE 5I1JL 5EBWA 5HVWA 1MREH 3EZ8A 1JYWA 4JKWA 3IAQA 4JO1H 5ISZE 1ZHLB 3IDIA 2A9NL 1F11B 2OPCA 4G7YL 5FWQA 3N0AA 5KVFE 5AB1A 1JZDC 2A9DA 4I2XE 1A1MB 4M8UA 4PJHE 5DO2C 5JW4M 2ESVD 2VLLA 1SXCA 3P73A 1DCEA 3GMQB 4JFOB 4I3GA 2R29H 5HPOA 1HI6A 5CEYA 1X6LA 3EFDH 4AGQA 4HUWB 4Y19B 5H4YA 4XP5H 1TQUA 3RDTC 2VMFA 4R97C 4J3WA 2CO1A 3P40A 4ES9A 1HKLH 4F2MA 4UU9A 1F1GA 3M7OA 3BUBA 3CQQA 1JDCA 2IDQA 2XI9A 1EVTC 3ZGHA 1HYRC 4MA3B 3S34L 2DPKA 4PD4K 3UZQB 3TIEB 2K3HA 3DVIA 1E4JA 1MW2A 4QHUB 3ULUF 4A2HA 1OAUH 2JELL 4PJ8C 3THML 2X0UA 4JR9H 2HLAA 3H4HA 4R26L 4WJ5A 2Z8RA 1RZ7L 2NY2D 2W60B 5E8EA 4O4YH 2CO2A 3T65A 3II3A 3WCYA 4EE2A 3G08A 1MKFA 1K85A 2FNBA 2CBQA 5SWSB 3KXFB 2H1PL 4LLVB 1DBMH 4FQHB 5T1KB 4NP4L 1N9PA 3AQZA 3Q7JA 2XA8L 4UIMB 4WVRA 2PWDA 2CO7B 4N68A 3VW3H 2FSEB 4XWOC 3QQXA 4XCEB 4PG9A 1J9QA 1F97A 1WJ3A 3QJQB 4I5BB 4PJBF 4V2BA 3D39E 3IJEA 3TT1H 4DOHB 4JREC 5CO1A 4HKBB 1KLUB 3VH8B 1F11A 4PG2C 2Z9TA 1TMCB 2OTWA 3NJFA 1NBZB 1NIBA 2RALA 4QHNB 4N1EA 1Z0MA 2V7HA 3QIUC 4TLUA 1QSZA 3RBGA 4D8PB 2JH2A 4KOBA 2P8PA 1BAFL 5DFVC 5E5MB 2AQNA 2PO6D 5AZEH 4F7MB 3C5JB 3TXAA 2JB5H 2YO3A 4M8VA 4MD5B 4OGYL 2V4LA 1MSPA 2LOEA 4B41A 4PJ8A 1YEFH 2P8LB 4Z7OE 1NMAL 4NIKB 1C5DA 2VGLM 2NY3C 4HIXH 2YBRB 1XGZA 5H94B 3V4PB 4E41E 4N2LA 3J7HA 3I6KB 4S0SD 1AO7A 1T1XB 1DYZA 2WLKA 1Y7VA 4Q6IA 5F1IB 4IGBC 5INCB 3EJRA 3KPSD 1YNKH 2W8CA 1ZDSA 1FZMB 3CGTA 2X70B 3AXHA 4L4TB 3UZEC 1JGEA 1RHHB 5J1AA 5JHLH 2R0KL 3ARQA 1FGNL 1KCVL 3MBWA 3KPPA 4PRIA 5BRZA 5IG7A 5IJKC 5KYYB 5I82A 1R47A 4EI5C 5LNGA 1S8DB 3QJZA 5T3ZH 2YAQA 2NXZC 2EQDA 4OCMC 3QNXB 4IKJA 1DJSA 2EDBA 3RL2A 2CPCA 1HHIA 1F58L 4QRTB 5FYKD 2DQEL 3N40F 4L37B 2WQRA 5CGYD 5I6XB 2G0LA 3O2WL 5E5RB 1ACZA 4IOIB 1J5DA 4J1UB 4NZTH 3VWKC 1KN4H 2IDUA 3EG9A 3H9YA 5IFAH 4KK9D 3ML9A 4WW1A 5E99H 1E30A 5ACLA 3SPHA 3SBRA 3CXFA 1EEQA 4KJYA 1KIPB 1JV5B 1F6AB 1UD6A 1CFNB 2XJLA 4FXTA 3TJPA 1CFSA 3J8F7 2FD6L 5IROA 1JWSA 3D0VB 1X5YA 3VA2C 2OV0A 5D1XC 1JGLL 2YGPA 1A22B 1NEZG 1QZ1A 2IF7A 1PSKH 2EH8H 3ZIYA 2YD6A 4LKCA 1S6NA 5I28A 1M9SA 4CC1A 4R4FH 3HHMA 3T4AB 1QSFB 2PTTB 4F37F 1T6WA 1TZHA 5AVXB 3SO5A 4GIOA 4PJBB 5GIRB 4AEFA 2R0ZH 4HALA 3SQBA 2G2RB 4W4NA 2VZSA 1UKQA 1OSYA 3DJSA 2OL3L 3SCMA 2TRYA 2Y7QA 5JA8B 4K07A 1CDBA 4K7FA 4PBWD 2E59A 5A3IC 4MAUH 3QDJB 2CWRA 1SM3H 4FTVB 2DLHA 2X53A 3EHBB 2CHXA 2VUOA 5HJ3B 3PHOB 3IVKA 2PLTA 3TF7C 2E7DA 1M7IB 4L9LA 3VQMA 2EDMA 2HVBA 2X88A 1CF8H 2DQMA 5ELIA 25C8H 2LU5A 3QNXA 4TOYH 2XFXA 3NPZB 3DWTA 3T2OA 1IC4L 4ZUWA 3WV0A 4EI6A 1QABA 4GQ9H 3MXWH 2P44B 4FQCH 4IMKC 1TTRA 1UUNA 4P2QD 2Q7YA 2XICA 3NESA 4F3FB 5B1JC 4GH7B 3S35H 2XYBA 4TMPA 4NKDB 4M5SA 1AR1B 1IT9L 1CXHA 3KYMA 4NRYA 5DJ6A 4PRPD 3WKML 2AI0L 5DUPH 3KL5A 4ZOAA 4HULB 2IBZX 3IJYB 4RFEB 3ZE0B 3ARFA 4GRWE 4YGVB 2J4WH 4QAMB 2F8IA 1SDDA 4KMQA 4B9KC 2XYCA 3BC9A 3FT4B 4P23B 1G6RB 4R2GC 5ESQA 1U8NA 4X4XB 5AB0A 1IIKA 1KXVA 5DVLA 4AQAA 3L3OB 4ORZC 2AJZA 5AOLA 1M1XB 3B9KC 3KEDA 5FC9A 3ROLA 2AXJA 1XGTB 3LMJL 3N85H 4NKMB 2IQ9H 5ACZB 3H9HA 3U46B 2DD8H 2R23B 5E56A 1MFMA 2ZIDA 1CE6A 2DH3A 3DDGA 3G5VA 3L5WA 4QLRA 5CLTA 2OQJB 4Y19D 3ZZ1A 1BF8A 1AHWB 4HJJH 4QPEA 4QWWD 1BJ1H 4M56A 5H37G 4HKJA 3U9UB 3OHXA 1DO6A 1R5VA 4MNQD 4N2MA 2QGCA 4G6JH 2J5WA 2XN9E 3T1FB 1OE3A 3PUUA 3CPUA 1R3KB 1RPUA 3HB3B 3KPRE 1Q0YH 3HS9A 3JWNE 4P2CG 4LKXA 3M1BA 4NQQA 4YHYB 1OSPH 3AREC 2EYTA 1L5GA 4U1KA 2CBOA 5GJSH 4UDTB 3V5HA 1K8DA 1X5MA 3ABKB 3JYCA 3MRFB 4PGBB 4K71B 2G3NA 5E6ID 2FX7L 5BZWB 3F64A 3DMMD 1IM3A 2XA3A 4FKEA 3O9WC 1FNGA 5EBLB 2NCMA 1FRGH 1OGAE 1W0WA 1TQCC 4IKLA 4LHUB 1UXMA 3EFDL 3LEXB 4HF5L 4NKOA 4WSGA 2UXVA 3QBTB 3U7YH 4LSTH 4H0IA 4L4VE 2HJKA 3QHZL 1MWAH 3MRNB 1ULVA 4I89A 4W4OC 2KLTA 1ZLWH 2M83A 1KIRB 3OLIA 3TJEH 5CKAA 3N43B 4UT9H 4EI5A 1A8JH 5DZPA 1QEXA 4O2FA 3K6SA 1EJOH 1HDMA 1SHMA 2GJZB 1QVOA 2OJEB 1D7BA 5SWZE 4AQOA 4JRLA 5JHDA 2VR6A 1O5PA 3V5KB 4LOUC 1E9PA 1TUPA 2P80D 2HG5B 3NJKA 4KZDH 3C75A 2AC0A 4F37K 3CFBA 2WO3B 5TK4A 4F9LC 4A55A 4A7GF 4GINA 1QNIA 1VA9A 4JFEB 1ZGLA 2D31A 1X5LA 4KKLD 4S1RL 4G8GA 2Z0BA 4IOSA 3MYZA 3PHAA 2GUOB 3DXAA 1IAOB 1WAAE 4KJPD 4HOMA 1D3CA 1PG7X 4G8FA 2X1XR 5G55A 3FFCA 4JPWL 1F4WL 3VFMB 4F3FA 3DHPA 1KY6A 3FQRB 4HS3A 2EIZB 5D71H 2HFTA 2W9EL 1OW0C 1ILUA 1PKQE 1AS7A 3VACA 3W82A 1ZGLM 4KWUA 1QP1A 3KEHA 1MW0A 3PWLA 3W37A 1HL5A 1BZ9A 1HSAA 4Z7UA 4WKZB 4IIQB 1NUFA 4ELMF 4EZLA 4Z1PA 4P3CH 1S7WA 2DBLL 3MBEB 1I85C 2VABA 3MBED 3O3EA 4OLEA 5AYQA 2HT3C 2J5LC 4KJWD 5F7LB 3T1WA 1OCWH 2R2HA 4J3BA 4JG5A 4L2YA 3ATBA 4NT6B 3UX9B 4OJFH 2COVD 2WIMA 4X4YB 2PYEB 5I8CB 2AP2A 4LCVA 3QDJA 4ZX3A 4HU2A 4F7MA 1E8WA 2IAAC 3TA4D 1FH5H 1UH4A 5CZRA 4HGWA 3SYQA 3D05A 4FTVE 5I30L 4N0CC 3I2CL 3MJ7A 5EN3A 5I2IA 2NY4B 5EFIB 2C9UA 3FTUA 3DGGA 2YD3A 3TFBA 5T1KD 1BECA 1ZAGA 2G3MA 3RWJA 3K46A 1EFQA 2OCJA 3SSGA 4YHOL 4WGWB 1CN4A 2AXHA 4WI0A 1P7QD 3W5NA 4GRWB 2ZSWA 1OTUD 1OF2A 1ZE3C 1FC1A 5DUJA 1OZTG 4BWUA 4QNPE 4N0FA 2HAZA 3TP4A 1P7KB 1UM6L 4QTIH 1FNHA 3H2PA 1E5BA 4GRMA 3TM6A 4ZUVA 3BT0A 1FFTB 4FYRA 1I4FB 1W6WA 2AITA 3IU4H 3O6KL 4F58H 5I6MA 3L4UA 3S5LA 5C08E 1SBBA 5KYYA 4TUKH 1SF5A 4K8RD 1YO4A 4RAUB 3IS1X 5DJZA 5JPMC 3ZLQC 4OCWL 4L8CA 3QUYB 1KC5L 4GG6F 1XR8B 1UH3A 1U21A 1E2ZA 3A47A 3TIEA 1H3PH 1M6UA 5GGUA 2Q20A 3T2PA 1HEZA 3L1OH 4JHVA 2EIBA 1H3VA 1Y1UA 1JERA 4OJYA 1VHPA 9PCYA 4UINH 3CFUA 3RKPA 1F86A 4X6DE 2XG4A 5F7NC 1T04B 3MKKA 1OP5H 1SHXA 4XPAL 4JQIL 5MERB 1L9TA 4GBXA 2PF6A 4YBQD 1R3IL 1QPKA 3DMMB 3GK8L 3ZRCC 1K6QH 2AAAA 3WIHA 1HIMH 3TN0C 3NRQA 1PAMA 3EF4A 4HV8B 4UT6A 4MB5A 4G6FB 1BQHA 1MCQA 3STZA 3TWCH 1JPTL 1X7QA 4MQTB 4Y2LA 2NX5B 1TDQA 5E9DA 3VRLF 3VSUA 3D09A 1J7VR 3B7SA 3HKZA 3LZOA 4XP9L 3JV4A 5EU7C 1WBXA 1DBML 2OMVA 4FHJA 3WGUB 1OD7A 5IUCA 3LHPH 1MCKA 1Z7JA 3L6FA 3T71A 2EC9T 4NZRH 5JNYA 5JPMA 2AKRB 4FFVD 3CFCH 5E1GA 5KYUA 1UWGH 1J88A 4QYAA 1AI1L 3JQOB 3AS3A 4KTEL 3L4VA 2H3NA 4U6XB 4GAFB 4HUUA 4IDJH 3LRLA 3O4LB 4WI3A 2IPTH 4ZFGH 1FNSH 4PJFF 4PJ7F 4YHPB 4ODHL 4Z78B 2H6PA 3BWUC 2PETA 4LHJB 4WJKB 3C9NA 4HOZA 1TU2B 3SDXA 1MQKH 3UOAB 2D0FA 1XR9A 4Z7UF 1NFIB 2W07B 4MMXB 1GY1A 3MBXH 5TE6H 4NPYA 2WXIA 4FNLL 3SE4C 2V6HA 2NZ9C 3K6SB 2AW2A 3FO9A 4NP9A 4GIAA 3DOSA 2AK1L 2YAEA 4LPCA 4LU5L 4HLJA 3CVDA 1CG9B 4JKPH 3BLBA 5KSVA 1NCUA 4FZ8H 2F74B 1U8IB 3FJTA 5K1NA 1N8OE 3EIFA 1QBLH 4P4RA 4IOSD 4A7GA 4AYID 2ZWNA 5FF6A 3CZSA 2PCYA 3WIHH 5KVEH 2DQ6A 3IFLL 3MLSH 1JF6A 4BFJA 3IMBA 5FHBL 1NAKH 5T3ZL 1OGAA 4Y89A 1UTDA 5FYKU 5DUPL 5D2NB 3ZL2A 3UFIA 4PB0H 5CILL 3HFFA 3X1BA 3DIVA 1VCAA 1Q0XL 2MNWA 1XCQA 4HCFA 2IOMA 3F7QA 1NCBH 1E3FA 1MI5E 1WZMA 1RZJL 2UXTA 3OR6B 5G5DB 3MTXA 2JE8A 1PD0A 3GIVA 4XX5A 3CSGA 3ZN6A 5JLZA 3VFGL 3E1ZA 4M5ZH 1U6AH 1NH6A 1U36A 3MXVH 3QJFA 4ODTH 2QQNH 4ZMXA 2ID5A 2HT4D 4LARH 1JL8A 2YLKA 4PS4H 3LRSB 4PMFA 1SFHA 3C8DA 1EGJH 3W9EB 2BW5A 5D2LF 2KS0A 2XQ0A 5IKCA 1SLUA 5FOBB 4JN2B 1PY4A 3Q06A 4U1KB 4G7VH 2HKHL 4Y7OC 1HE7A 1MIMH 3NCWA 2N0KA 2WB7A 4D8OA 3C5ZA 4KO9A 2IJ0C 4QRPA 1NJ9B 2BSSA 4X98A 3VI3F 3EOBA 4JG0H 4JFTA 1PG7L 1XF1A 1BGXH 5H4ZA 5L8JB 1N4XL 3ZE0E 4I3SH 4F8TA 4QHMA 1YEGL 1JHLL 4RESB 4FG0A 2EDKA 2EDJA 4P59H 3W2DH 1AD0A 1A0QL 3QDGD 1SYSB 5JW4R 2DTMH 3MNZA 3FMGH 5I8KL 5E8DL 3FUDA 1JSYA 4JQVA 5KSVB 1D5MA 3B1UA 4GO6B 5AZ2H 3WS6C 5B3SB 1NSNL 3GZPA 3EO0B 3JWOL 4L4TD 4MCMA 5HSFA 3RWEA 2VLMD 2CALA 4FQCL 5PAZA 1NCGA 5FO8B 3SKOB 3IMWA 4JDVA 3T65B 3EJCA 1MAMH 3TVMC 1BVOA 1SEBA 1I1YB 1KGXA 2HRGA 4KXBA 3W0WD 5IJVA 3QAZC 4XTRC 1G0YR 3QFJA 4UM8B 2ITCA 1E4KA 4YLCA 5DVNA 1ZLDA 1T5WB 5CD3A 5A6LA 2WXHA 4FXGB 1JE6A 2DQGL 4YSDA 2OM5A 2EAEA 2Z35B 4B95C 4HJUA 3D4CA 4XO4A 5I1GL 2EIMB 5DJAB 4AC2A 1CFVL 5EOTB 1N5YH 4NPJA 1UKTA 5CN1A 5IB3B 4PTUA 4J3TA 3FQTA 3OHXB 3NJNA 4PVBA 2ZNWA 5F70A 3GXIA 5FLUA 3JV6A 3MGTB 3RVUD 3FO0H 1CICA 1G9ML 4J3UA 2BVYA 1SUHA 1T0PB 3O0RH 4KK6C 1DQDH 3SBWA 4HSCX 4J27A 3RY6C 2O93L 1MJUL 4LCYA 1MCSA 4LLAA 2BSCA 1KJ2H 3F3HA 1CE1H 3OX8B 4LZKA 2V33A 3CVHH 1PS3A 3TVMA 4D2NA 1V05A 2R56H 2P5EE 7CGTA 2BJML 1EEYA 4JFYB 1A4KB 2H8PA 5HVFB 1ZD6A 4FNRA 1UZ6F 4ICXA 4JFWA 5IOPA 1V7ML 1FYTE 2O5ZL 3GSWB 1SMOA 1UZ8B 4IMKA 3GO1H 2NXZD 1ZJAA 3W0WA 3B83A 3QEQE 4FQIL 2HMID 5MEOB 1ZJBA 2XY2A 3QUXC 4YHIA 3RA7L 4WTZG 2Y7SA 2DLEA 4I4WA 4MDJA 3VFWB 4PJIB 1U30A 1YVLA 4AMKH 1JWMB 4HCIA 1C7TA 3GBNL 3PDOB 1EQWA 4HEPG 4XCNA 5IEKB 4HAFA 1WUZA 5J1AB 1I9JH 1KG0A 1MZYA 4PCSA 4YSPA 5E00A 5T5NG 1IAIH 4FQQA 5FUCC 3NK3A 4CSPA 1TCRB 4Y5YC 1G0XA 3SDAC 4A39A 2NR6C 4Q6IB 3II1A 5FA4B 4U1NA 1VGEH 3BOVA 1I7TB 2X6UA 4OQTA 5KUKA 2AJYH 4UBDC 1CQKA 1T80A 4QTHA 5CCHE 4NUGH 5GZOC 1A14H 4HC1L 1W8OA 1MFUA 2ESVB 4NQCD 5FM4A 1INEL 3QHFL 1D5XB 3K6OA 4YBHA 4YDIL 5C3TA 2XBZA 1OPGL 4PR5B 1B0WA 1Q9KA 3S36H 3UTQA 5CZVL 1XGUA 5F9JB 1P2CA 4Y9BA 4DUXA 4XNBA 3PAYA 1BJMA 4AQZA 1SVZA 1ZT7A 4HJ1A 4PV8B 3LZPA 2CA3A 2E74C 4BKSC 3KLKA 1LO4L 3ULSB 3CFCL 2IO5A 4L0PB 2YRBA 1WIPA 4U1LA 1TZHB 1IKNC 1RUAL 1J8HE 4UNVA 5E1AB 3QPXH 2I7OA 4QY8B 1QZNA 2G5UA 3W11D 4R3SA 3BZEB 1B2WL 1CLOH 3MV8A 4N1HB 3UBXI 1FNAA 2OJZL 2EUXA 1XSOA 3HZKB 3Q8EA 5FCUH 4BZ2L 1T0MB 2C9VA 4V33A 4JJ5B 3LIZH 4LL9A 4ODWA 4Y7MA 2J3SA 1YY9D 2VL4A 3BP5B 1IB5A 5HPMA 1BQRA 3E7JA 1CIUA 4NWTH 3N55A 1IM9B 4HEMA 4JFFE 3P30L 1V55B 4OCYL 4XP4L 4YO0A 2HLFD 3PIQB 5I1EH 1LWHA 1USZA 4JO2H 5JO5A 1AZBA 2JWYA 4KK5D 5FYLH 4KVNH 3L9RA 3FMGL 1TEYA 1CICB 4UMSA 4G6KH 2WTOA 4YE4H 2ZOOA 5AOMA 1AYRA 2ZF9A 5FM5O 4H5SA 5E4EC 3WIAA 1Z3RA 5EZLB 2BSRA 3M17B 3BAYA 2P28B 3IDXL 4FG2A 5ADPL 2DQHH 5DURB 3MAWA 2VH5H 3PWVA 1T7ZA 3PGDA 4J2QA 3FFDB 3PL6A 2XV0A 1N0XH 3VTMA 1JTOA 2OYLA 2F0CA 4DCQB 3K8LA 3ROLB 5FYJD 2OMBA 4FFZL 4XPFL 5J1SC 2XWZA 2AXFA 2H1PH 1C5CH 2SEBA 3P73B 4MZIA 1LMIA 2Z31C 4Z95L 5A16B 2FD6H 3A4FA 2OFQA 3WL9B 1SEBB 1EIBA 2AERT 1PX3A 3U25A 4Y9GA 4O02L 4AG4L 1NGYA 2YQ3A 4IRSC 3HE7D 3NRFA 1BZ7B 4GKLA 4IMLA 4RDQF 2AQ3A 2R2CA 4J8RA 4WWKD 5FAAA 3QDAA 5DJ6B 3TT1L 3UGUA 1MWAB 1T7YA 2XWBA 2OR9L 3QT2A 2HTLD 2FEEL 4U3SA 4XVOA 1BHGA 5E1HB 4NUJB 3QK0A 3B2XA 1NCWH 5FOJA 3A4AA 1BBJB 4YDVA 4G5AA 4L5FL 2X09A 3LZFL 1EMTH 2KT6A 4HDIA 2NY1C 1N3NB 3MRFA 2D4DA 4OD2B 4ZX5A 1JGDA 3OC8A 3VGHA 4JQIH 4WUUA 3NA4A 4EVNA 3BE1L 2HKHH 5E6IC 4BJLA 3ETBF 5GXBB 3ZOAA 2KKQA 1HHKA 3O4LE 1N6QH 3G6DH 2XTJB 3JTTB 3T1FA 4NX0A 1NC4D 4QEGA 4L3CA 1PU0A 3P9MB 5C0EB 2XN1A 3F7KA 3UTTE 3GWJA 3HMXL 1UVQB 2A6DA 5JW4N 2Y6TE 4TUUA 5HJ3A 4EF3A 1JVLA 1PZ5B 1U6AL 2DQJH 1KB9J 2O1AA 4X4MA 5MEPB 4BCXA 2XWCA 2VLKE 5EU3B 4NGHL 1D6VH 1XF3B 4ZNEA 4PGEA 1A7QL 1A3LL 5JPMB 3AG2B 4K73A 1L0XA 1WA1X 2O30A 3MGOB 4UM9B 4X8XA 3G6JE 3QH3A 1A7OL 1BVNP 1KNOA 4U0RB 5I1DA 3LDBC 1ZTXH 2FL5A 4R4BA 4TNVF 4HCRH 2XLLA 4WI7A 1NAML 1Z5YD 3QJOA 3WY1A 2A6KB 1YEKL 4OUOA 2WMPB 3H3PH 2ERJB 2F9BT 1MAKA 3BMVA 3EBIA 4AUUA 4WKXA 5EBGA 1UG9A 4C4UA 4G7RB 1SYVB 2NDGA 3B1TA 4NNXA 2D7TH 2R1XB 4K3EH 4XMPL 3RZCB 4ZO9A 2NSQA 4P5MA 1FH2A 3UYPA 5J5EA 3BYYA 3IPFA 3BISA 5C0BA 3RJQB 4JHUA 4QOKB 5SWQA 2DQUL 1UYWH 2PCXA 3RX5A 3WN5A 1NGXA 4EO5A 1BMWA 5HHPA 4U1IB 3FSVA 2VQTA 2EDRA 4I2XA 2B9BA 2HCZX 4ONGL 3FQXB 1LK3L 1QFOA 2P49B 1D9KA 3SDDC 3O45A 1YEEL 4Y2DC 5D1QD 3RB5A 5KVEL 1U2HA 5H37A 5F93C 1SHWA 3QXAA 4G6FD 5DD5L 2JCCE 3GB7A 5JIHA 1MDAA 3V0AC 4FZEL 3QDMD 2VO8A 3RFZC 2G9KA 3O6LL 4N0CD 1EJ6A 3GDBA 1YQVH 4OU3A 3ZL1A 5EZJA 1EBPA 2BJMH 5HYJD 4B60A 2GT9B 4KRPB 4GXFA 4RGOH 4L3EA 1EAQA 4XE0A 2BVTA 5M94B 1AS6A 3F01A 5JIKA 2NY5H 1CYXA 1I1CA 3VFNB 3SGJC 1S7UB 3S37H 1A5FH 1J9SA 3MJGX 5EBWB 4OCXL 3QUYD 3GMMB 4MBRA 1VZHA 2N4IA 4OFYA 4LDCA 4B0MM 1N0XL 4CVWA 5ERWB 2WTRB 5I1HL 4JN2A 4K8RC 4OFVA 2IBZY 4J8QA 4NSKB 1DJYA 4PJ6A 1LM8V 4R4BB 3VXUE 3FQUA 3M45A 3GMPA 3ZKXB 1XQ4A 4G43A 2ZUSA 3EG9B 4H44C 3MRJB 2UWEA 4XNZC 3RDTB 4RSVA 4BBWA 4TUJB 5F6IB 2XTJD 1A4JB 5I6KA 1YEIH 1IAKA 5JDSA 1RU9L 1H5BA 1F6LL 5ECGA 1JZ7A 3ASNB 3UC0L 3S3PA 2JJTC 3E3QE 4QF1A 2C8NA 4EN2A 3FULA 3OKDB 4LRNL 1TYJA 1JCKA 1E9QA 5EZIL 2ZT9C 2VXSL 1YNKL 5IMMA 3QA3B 5D7IA 3LMJH 1FNEA 3R06B 2X1OA 3AQXA 1PVHA 3DLQR 5FKPB 4N8PA 4MCNA 5K33A 3NT0A 1K5NB 2EO9A 3OB0K 3RTQC 2NW3A 5KS9E 3K8KA 5DZJA 2EO1A 1BIHA 3PNWB 4OH2A 3FFOA 1JGLH 4WWKB 1QNZL 2UZYA 2VLJD 1WBYA 3FN0H 3GS4A 1NSNH 4FLOA 4BCZA 1HXYA 1W72B 4ELMB 2CIKA 5IGXH 3LH8A 3JWOH 2QPDB 5L8KB 1HZHH 4K9EH 5FW7A 3NFNB 3GTNA 3FTSA 1EANA 4H20H 1KXVC 2V8MA 1L0YA 4N0UE 4N8CH 3DETD 4XNAA 2ZWSA 4YK4B 1WS8A 4C56B 2CHZA 1TKWA 4C8XA 5C09E 1L6XA 3QZWA 1KTLA 2SODB 3EYUL 3OKNA 5HVGB 1RK0A 2N3JA 3B2PA 3KPOA 5FYLD 4UT6H 5I30H 5IW6A 5LJYH 5JNYB 1CGTA 2J71A 4HS8H 4M93C 4OQTL 2DWTA 4A2MA 2JI2A 3F85A 3L3OC 2LW3A 4Z76B 1U95B 1GOGA 1NCDH 3GEWB 4H8PA 2C9XA 4C58B 5EUKB 4AW4A 1UJ3A 1QFPA 5GGRA 3AUVA 3C8HA 3QPXL 4JFED 4Y5VB 1A6TB 2C1PA 3HR6A 3U4EB 3WU1A 1MN4A 2JI3A 4HBCH 3Q9QA 4UZSA 4FMFA 4FXKA 3QFJE 1IC5L 2ZXWB 3LV3A 4UNIA 1U8OB 2WV3A 3FCSA 3HZYB 4NWTL 2W07A 1BOGA 4HW6A 4TPRL 5KYUB 4KROD 4JY5L 5B1JA 5JUEH 1PGRB 3S0PA 1PNCA 2OYMA 5H37H 2R15A 5C07A 3E8VA 3IFPB 5KAQG 1E67A 1BXUA 5DXWA 2YQ2A 1PZ3A 2VRQA 3ZR6A 3S5LG 4MS6A 2HT2D 3IDJA 4OF5A 5ID0B 1SDYA 1N0LB 3H9HB 3HKFA 1T4KB 4QO1B 1P4BL 2E47A 4Y5XA 3U46A 3MLZH 4K94H 5E6ZA 4AEHL 2FLMA 3E8UL 3LEVH 3I50H 5C0BD 3FT3B 2GSGB 3WHE1 5I23A 1UM4H 1F3JA 1WFIA 1AZRA 4G9FA 4QXTB 1QPXA 4XO8A 2F7RA 4LNVA 3BVNA 3AZUA 3FB6B 3NCFB 5ILTL 2YJLA 2VB5A 4A6YH 4MMYB 2Q5BA 2R8SL 1KLUA 1T1YA 1CI5A 2DQEH 1MHHB 4NN5C 4E9RA 5HHXL 1OCWL 4G9FD 3STZB 1GGBL 1HK6A 3FO2A 1JGVH 3SYOA 2R1WA 1NPUA 4DP9X 2IANE 1CTMA 4DP7X 4UIKL 4XC3L 3OKNB 4KOCA 4G80A 4HAKA 4XPHH 3FH7A 4KU1A 1EFXA 5JR1H 1I8AA 1L7IL 4OD1L 1L9MA 2EIKB 4L8SC 5SWSA 5GS1B 5CKGA 3AVEA 3P9WB 4JFDE 4U6VL 4G8FB 1JGIA 1D6VL 1DBJH 3L3GB 3WUWG 3HG1B 1J0YA 3MR9A 3QDMB 4H5SB 4S0TD 1KACB 1UURA 1E6JH 3D85D 2YD4A 3TIDB 3B7TA 2KERA 3GNMH 1B9ZA 1KZQA 1CD1A 3G7TA 4DGYL 4GUPA 1I1AB 1SXAA 1P4UA 3MTRA 1T3FA 2Z93B 2A74A 3DTDA 4QTIL 5JHAA 4OZIF 3MUJA 1ET7A 3CDCA 4QRPD 5FCSH 2RJMA 2WCPA 1COBA 3NDYE 4ISVA 1NBYA 4TQIA 4WAFA 2B5IB 3WHE0 1CFQA 3VG0L 4J3SA 5EZLA 5CP7A 5LAXB 3BEVB 3K4ZA 4PJ9B 3FZUC 4UTBA 4UMGA 1X9RA 3NSJA 1RIUL 2OMWA 3DBXA 4ZS7L 1BZ7A 5JQ6H 1FVCB 3R1GH 1OGTB 2GJ6A 4KAQH 3EJSA 3ME0A 3IFNH 3VG9B 2JQAA 2W38A 1CF8L 2HG5A 3U2IA 2QKIC 4LSRH 2ZOLA 3VDBA 3OXRA 4XTRD 5D2LA 1TJMA 2FH6A 3CHSA 2V5TA 2XSKA 3EH3B 3BWZA 4OZHB 3US0A 1F56A 2LGNA 2J1YA 1CBVH 4JLRA 3T8XA 4WV1A 2DYPD 1BQ5A 1XO8A 4BFIB 5C09B 1C1EH 4H25A 5F9DC 2Z4QB 1NMCC 2Z6FA 3ARVA 5DJXA 4FQXC 1TTUA 4U1GC 5FYJU 2Q76B 1F3DH 4D94A 1GA2A 1RJYA 3QWRA 3ZMRA 5AVVB 1ED3A 3KWUA 2AEIT 4P9HL 5HHPB 3RL2B 3QJXA 3VGBA 4HS8L 4S1SL 4N2FA 4Y4HC 2ICWJ 2FIKB 5DS8A 1QTYT 3PWLB 3II2A 4M5YH 1URZA 4UI2A 3OKEA 4KK6D 1QBBA 2X6AA 1K3IA 4X8JA 5HDOA 3FTYA 4UM8A 1KB5L 4UZUA 2ZCKL 3HN3A 1QA9B 3GS0A 5GS0D 5T1DH 2RB8A 1KYUA 4MXQD 2IFGA 3WFHA 3QUGA 3RWHA 3HC4H 4N2DA 4F8PA 4UTAL 4ZG1A 4WUUB 1HYSC 1GGYA 1EEYB 3KBHE 4UYQA 4FTVA 5I74C 2O4EA 3TZVB 1WG3A 2H26B 5LUMA 3DGGB 5EOQH 4GMTL 5TF0A 5HYFA 4NUQA 2Y36H 2NNAA 2F61A 1VACA 2JKSA 4JZNB 4PIRF 1SYVA 4LU5H 4I13B 1XH2A 2K78A 5TDPB 2W95A 5AW1B 3MLZL 2IXQB 4FMVA 4Q0XH 3SDAD 1XGRB 2WINA 3N91A 3GIZL 2BH0A 2YD1A 3UMNA 4E9VA 4I3RL 4MA1B 4XXCC 3TO2B 4XXDB 4A2DA 4FNUA 4XMXA 2NQDA 5A7EA 1Y6MR 1CTNA 2H32B 3IFLH 2J8UA 1M7IA 5F1KC 1DVFB 3UZEA 2EDXA 2EC8A 3CLEH 5CZXD 4CVZA 3GC3A 5D6DC 1ACYL 5B1CA 3TYGH 3SPVA 1ZE3H 1TFHA 3L5WB 4JK0D 5K9JH 3ZSSA 3KXFE 1DEEB 5ANMB 3DC0A 3OKOB 5D1QA 3VFOA 2Z8SA 1I8UA 3QFJB 3CXDH 1KCUH 3STLB 3PDOA 3HI5L 4N3UA 3MSPA 4D0BA 3A23A 1N64H 1IVTA 4X5PA 2ESVA 1N6VA 4TVPL 4MJIB 1U9KA 4NDMB 4I2XB 4FQ2L 1OOAA 2O61B 2VXVH 5F8RC 3HZKA 4Y16B 1JZJA 2E6QA 5LN4A 1LMKA 3IXAB 4AUJA 3ULVD 3HAEG 2H5UA 4I9XA 1CE6B 4G80B 1J0KA 3L48A 3UG4A 4BSWB 3A21A 4H25B 4QNPF 1FVEB 4YO0B 4JPWH 5H35B 1UH2A 2DJMA 1PJWA 2Y07L 4XN9A 1PZUB 1NZRA 1RXLA 3H2QA 1MRDL 4LPXA 3SJVD 4N8CL 1VB9A 2J1WA 1WYJA 2KLRA 5CLZA 5D6DA 1DJIA 1EHAA 1RUQH 4PJ5A 5HHVH 2CRZA 3C5SA 4JW3A 4HX1A 4PRDA 4LASL 4U6HB 3WDHA 4B27A 1YAZA 4IRJA 5HDBE 3AU0A 2WBJD 4FCHA 3TWYA 1XGRA 4D7BA 2P8LA 4DKAA 3TPKA 3FK3A 4U1LB 1LTXA 5D4IA 2OXGA 4AQ8C 1NQBA 1SPDA 4PJ5D 1RIUH 3F7YB 4ZS7H 1RURL 1W72H 3SPJA 1NBYB 3H9ZA 4B53A 2PTUA 4OLUL 5DT1L 1ZSHA 5D7LB 1TYRA 3RB7A 3MRGB 2BNUA 4LSPL 5LCVL 4XNMB 3VD7A 2JJSC 1IGCH 1MCFA 4N22A 4UDTA 5C7ZA 2B4CL 4WTZA 1DQJA 4JM4L 3SKNA 4AEHH 2EKJA 3HN8A 3P0YH 1NGZA 3QDJD 4MWFA 3I50L 3PNWA 3IE4A 4QXUL 4DEUA 1S5IL 3PAVA 4DN4H 1XEDA 3MLUH 2ADGA 4PS8A 2E27L 4B9JA 2BOCB 4YHOH 1DDHA 1AY1L 1DP0A 3DX9A 4IRSD 4B5ZA 1Y6KR 4RZCA 3S98A 4BV1A 1EDHA 4PRAB 1BYNA 3DIFB 3V8CA 2QFPA 4P2RA 4I77H 4H0HB 2DLFH 3IMVA 2AVGA 4BDVB 5ALBH 1K8IA 3Q5OA 5DEJA 5GJTH 3SYAA 4ZMLA 2PXYD 1JNLH 3A3YB 3L9BA 1IGFH 3U9WA 5EU7E 5TF1H 2X89A 5DFWH 1HHHB 4MXWH 2QGDA 2FE0A 5JXEA 3V0HA 2WAQA 1B3JA 3ARPA 4LSUL 3GZKA 4PVLA 1M9WA 2GSMB 2IALB 5BMFH 2E86A 4KUZH 2EUWA 3ESUF 5DD3L 1OSEA 3S9DB 3ILQC 5DD1L 4MCZA 3O3UN 5FHBH 4PGJA 3AT9A 4PS4L 5D55A 3FU9A 3REVB 5I5RA 2X4UB 5ES4B 3T0EE 5LHDA 4PTUB 4L8BA 3GHEH 2EDLA 1Q1JH 1AZZC 2HA1A 2P47B 5CFHA 5I1JH 3C6LD 3I9IA 4PIBA 3GK8H 2QMJA 5EHFA 4F15B 4KKNA 3OAYH 5HYQB 4JFXA 1SQMA 3IE9A 3QB7C 3TA3A 4G8IB 3QXDB 1TQSA 1PY0A 4M1DL 4XPHL 3BP4B 1SEQH 1NM9A 2JQZA 4RRPA 2FHCA 2ZX9A 5AVRB 3ZDXB 1NGQH 1AQKH 1MIEH 1QBML 1TQBC 2IG2H 3IFNL 4IU3A 3KH4A 1WS7A 3I74A 1KYOK 3CLEL 2ROXA 4NXKA 4V2CB 5IEHA 1HE8A 2WQUA 2I5YH 2OA9A 3BD4A 1VFBA 4AY0A 5IFJB 2C1PB 3S88L 3CNKA 3C08L 4CMMB 1TJGL 1KIQA 1KJ2A 5F89B 3V6OA 2H47C 2UUDH 4H8HA 3LN4A 3CSYA 3ZTNH 1K4DB 5IM7A 4AG4H 3HFML 5ESQB 5IBLC 3BSZH 3GPSA 1T66C 4E68A 1F1DA 4QRQA 4XWGH 1Z6JT 4NB7A 2H2PC 5AB2A 1SLWA 4CN1A 2NY7L 4PFEA 3RTQA 5CR1A 3KHOA 3BN9C 5JIIA 3EFOB 3L3KA 1UGNA 4Y1TA 4MNHA 2ATPA 2CR3A 4IGBA 4XHJD 43CAA 4IRZA 3BUYB 4N28A 1HT6A 4MJ2A 3VXNA 3NGBC 4PCTA 2BVOB 1WFUA 4OB5L 4PM1A 4Z3JA 1P84J 2QDVA 1KIPA 1NAMA 4EKJA 1JMZA 3W1ZA 4G6AC 5BUGA 2LVCA 4GJTB 4DP6X 5SWSD 2AJYL 3IKCA 3VI3E 2ERJC 4HPHA 2BCMA 2ZNXA 3G6DL 4IHBA 3RX9A 4GP4B 1AGFA 3UJIH 5SX5H 5EIVA 3X3GH 2A4ZA 2V5SA 1UWXH 1YEWA 3KW8A 3M8OL 4YDJB 4XVSL 1LO0L 2Y6SC 3V5DB 1Z9MA 5BQDA 3LSOA 1UM5L 1OM3L 4F7CA 3NDZE 4KV5F 1DVQA 4Z8FH 2CCWA 3MRKA 1EFXB 3BPNC 3KCPB 4OCYH 3CFJB 2EDDA 4XRCA 5CLXA 1PFCA 2XPZA 3DJTA 4UQAA 1ND0B 2EILB 1NFDB 1L7TL 3DA0A 5AKVA 1F42A 3QZBA 5IB5B 3WMPA 1JTTA 5EORL 4Z7VF 1FYTA 1Q90A 2WC7A 4DP5X 1FZOA 4PVNA 4OD1H 3IRZA 3QPKA 1R19A 4X6DA 5FGBC 1EEZA 1J1OH 5MENA 1KJMA 3OMIB 4U1MB 3QNZB 1QTSA 3C09B 2WTRA 3IDYC 2WKGA 4K8RL 4LHUD 2G5RA 3GSWA 3CFKB 1F02I 2B3IA 4JVUA 1B9KA 2CCVA 4RMRA 4TUOA 1CE1L 5KJRH 1AIZA 1U3YA 2IPKA 3FF8A 2YKLL 4ADIA 3GNML 4R0LB 2JK5A 3BRGC 1JRHH 2Y22A 3KR3H 1KN2H 4M62L 43CAB 4EUPB 2X9YA 2YD7A 3PWNA 2FWUA 2ICEB 3UPAA 1ZLUH 5I75B 1XH3B 2QQLH 2Y7OA 2IGLA 5C0CD 3GTVA 2K0RA 3WFBH 2GJJA 4C57C 2FHFA 4DETA 1DO5A 4HQQL 4NUGL 3GO1L 3NJVA 1P5UC 2YZ1A 4RNRB 3VJ6B 4ICWA 2P24A 4GP5B 4IHOA 5E5UB 1YMHB 4JHWL 5CU9A 5DUBA 3ROOB 1HCVA 1M71A 4NHUB 4BIKA 3BEVA 4N8VG 4DW2H 4POZD 2YUXA 1XIWC 3RGHA 5D2NC 3T0EB 1W6LA 2G9HA 1SXSA 1FNEB 1T83A 4Y8DC 5C0GA 3L4CA 4LSSH 4YEEA 1UJTA 2EVHA 5DU7A 6PAZA 1IBDA 3B3IB 2D73A 5E2VL 2KHAA 1OP4A 4LO9A 4UT9A 3VYPA 1KB9K 1G9NL 1WBYB 2RACA 3FOLA 4R4FL 4MBOA 3U0TB 1M42A 3X14A 2AV1A 4S1QL 1A14L 2N1KA 3DROA 5E8PB 5A2IH 4A67A 4MB3A 5C0JB 5GQBA 1S2EA 1QFWI 3NIGE 5CFAA 4FABH 3LPFA 4ZK8A 4ZI8A 2YEVB 2FWOB 2Y5TA 4GG8A 4WFEE 4J39A 3KCPA 1AR1D 3FW6A 1MLBA 4XPGH 4FQ1L 4HEME 5LGHH 3FFCB 5A6MA 2X0WA 3IPEA 4ALAL 1SY6H 2KLSA 3QDGA 3WEBA 2JB6A 4J8RB 3RX7A 1Z9PA 5IMOA 3L16A 5B7EA 4ETQA 2FJFB 2WLMA 1UEYA 4Y4HB 1RIHL 3Q2WA 1GSKA 2ZSWB 4PRDB 1NGPL 5HDQL 1E27B 1NANI 3RWCB 1RH8A 4QHMB 1KLGA 4AJ0A 3LKPB 5IROD 1ZT4B 1W0WB 4U4BA 5E8OA 1HU8A 4N2EA 3KDMB 3P54A 3C5ZD 4X7EC 4OSUH 1YEKH 3ELAT 3ESOA 4ACTA 1BQHG 3QIWD 4PY7A 4XXWA 4DN4L 4LLMA 4ZFOB 2IH9A 2HT2C 4QTFA 3DRQB 4KKBD 2BC4B 4LP4A 4FTVD 3BGMA 1KXTA 5F0MB 2KC0A 2QVIA 2ZUTA 3UBFA 3X1EA 1WZ1H 3FT3A 3IGAB 4ZXBB 1HSBB 1OANA 2E9IA 5EUOA 2BXYA 2R59A 4A7VA 4JHBA 4OTXH 3OGCA 3VGAB 1N0LA 1HEZB 1H8NA 2GFBA 4L5FE 1NLBH 4BKLB 25C8L 4IHOB 2R9HC 1WIOA 2P9RA 4GI6A 2FO1A 1AAJA 4AJYV 3QUYA 2OW6A 4XI5C 2MOGA 4G8GD 3HE6D 1DSYA 2HX8A 4HIHA 2AQSA 4J4PA 1A7PH 5DD3H 3MLUL 2J7LA 1MWOA 4M1CD 4W1TA 3FH5A 1NCTA 4GRMB 3VYNA 1OSZB 4NENB 2JCCA 1I1AC 1BAWA 2GBAA 1C12A 2Q2EB 3NCJH 1ZVYA 5J0BA 4N2BA 1GY2A 2ZWLT 1AQDB 1OE2A 5HHNB 1DFBH 2NZIA 5DD6B 5DRXB 4YXHH 5C1MB 1NPNA 4HX1B 1M71B 4KMTH 1SJHA 1L7TH 3L3HB 4Z7NB 2XXMB 5FS5A 2FX8H 3T2NL 5BV7C 1ZPUA 5GGUB 2EZ0C 3PYCA 3S3CB 2PO6A 2A4EA 4EDXB 2KZBA 4AIZB 3LKSA 3E1F1 1CFNA 3MNVB 2ZUWA 3H9SA 4TVPH 5FO2A 3IF1A 1Z3GH 3RVTC 5KANI 1S9YB 3QC6X 4GAGL 4HJ0C 1ML0A 1J1OL 3F65A 1J5IA 1X4YA 1HINL 1OWWA 3MOQA 2LU7A 1OAKL 1RZ8A 1UB6A 2GJ6D 3IJ9A 3TCTA 3DMMA 3AFLA 3P4NB 4ALAC 1H8SA 2PW1B 4HHAB 1X5KA 5CSGA 4PYGA 3DX6B 4FZEH 2WCGA 4AJWA 5CP7B 2VERN 5LAXA 5E24E 1NFIA 2I5YL 3DTXA 2CNZA 5JXEC 3FZUD 3WFZA 1U3ZA 1SMAA 2WKLA 4NZJA 5HI4C 2CDGB 3BI9X 3ZY7A 2CNYA 3DDFA 1GAFH 1DJHA 3GSXB 5E2TH 3U1PA 5HGBB 1TCRA 3O8XC 4F58L 3WBDA 5ESVB 4F7TB 3G6JA 5I73B 4LAJH 4EI6B 3SOBH 3VVWA 1TENA 4D0DB 4MSWB 1B0RA 5FYJL 3ZQXA 1K2DB 3HI6H 3KPTA 4TN9A 4FX5A 1FSKB 5TDNA 3UADA 1CLZL 3Q2LA 4CBZA 2YGVA 1AGBB 1P5UA 1SDAB 4QIRA 1NLDH 2IOIA 2DYRB 1ZVNA 3N0PB 3UBXG 3TBWB 4FQXD 4IJTA 5DJ2A 3GJEB 4D9LL 1HFUA 1K5WA 1CLYL 1WAAA 3FOMA 5F0JB 5E2VH 3HS0A 1XDTT 2BVQA 1I8KB 3CFBB 2OQJA 3APDA 1N26A 4BZ1A 1URIA 5CMAB 5D71L 1UFGA 1PQZA 4D7PA 3LPGA 3D06A 2EIDA 1NCHA 2SEBB 3SDDA 1Q9WB 1NDGA 1XGPB 1P1VA 1QACA 5FA3B 2BVOA 1S9VB 2FDBP 3KXFD 4XC3H 4YR6A 4MJ5A 2NCEA 4ABWA 4UUJA 3IJEB 2Z1PA 3WKMH 4HIJB 1BJ1J 2E4TA 3RWGB 2V17L 5F9JA 3LS4H 5JDJA 4JFUA 5LXVA 5F9WC 2C3GA 3H7LA 3ZE2B 3O6LH 4OJEH 1J05B 4FNTA 1CLVA 3NK4A 1XSIA 4MCYB 5EUOF 2OW7A 4IKNA 2A9MH 3UMTA 4CC4A 5F44A 2FR4A 4JM2C 4HUVB 1QI5A 4ERSH 3BKML 4WI8A 1MREL 1V3JA 2HPTA 5K9OA 2P8MA 1JGDB 2OR9H 1MIML 2BSTA 3HB3D 5DRZA 4OLVL 2DWDB 4TQHA 3QO0A 5C86A 1TZOA 2XVGA 3G5ZA 3DARA 4CA4A 2IAMB 3VVVA 4HMEA 1U0QA 1PKQB 5C08B 4DEPB 1ORSB 1WFMA 2VN5A 5ECJE 4KBPA 2I07B 4W93A 4MDRA 1JPSH 1CU4L 1MQKL 3A6OA 3BE1H 4PEEA 4U1JB 1AKJD 3GQFA 3OR6A 2ZG3A 3MDJA 3QRLA 2XDHA 5C0FA 3MV8B 4GAJH 6FABH 3QI9D 3B2DC 4KQ4L 3TV3H 1MHPL 1JD7A 4TNVK 1DUZA 3CH8A 4CU6A 1FYHB 1PEWA 5CZXC 2V8LA 5DHEA 4R97B 4R9HA 5DRNA 3VD5A 3WMSA 4NS0A 1ADWA 2ALWA 3IKKA 3JVGA 1RQ5A 3GXDA 4FP8L 4ZXBC 1HH6A 2LAAA 2WXNA 1XB6A 2F1BA 2QZ5A 1UACH 4KZ0A 3US9A 5DJDB 2ENQA 5FDYA 3PGDB 1FL3A 4R26H 2F5BL 4JHAL 2O5XL 4PTTB 5CJQH 2PUQT 1A1OA 4BQBA 4ZYKB 3RNKB 4IKIA 1DE4A 4PWEA 4LCCC 4D3CL 2C4XA 4PG2A 4TVUA 1MDTA 2L04A 1E4XH 2GSGA 5T3XH 1F4HA 5HYEA 4LGSB 3NPSB 5FA3A 3VXSD 3PFUA 4D0DA 4EIUA 1HIML 2MPAL 1OCCB 2WZ0A 2F7QA 5IMKB 3OB0H 4G1EB 5JQHC 1HILA 4HK0A 4GW4B 4F2FA 2P8MB 1FBIH 3S48A 1JI1A 1L7IH 4LXFA 3VNZA 4ODVH 2EIZA 2Y06L 2UZXB 3ZVVA 4WU5B 3MJ9L 4KKCD 5LGHL 4WTWA 1X4ZA 3E6FA 4R7DA 5I1AB 1QR1B 2ADFH 4L37A 3EHBD 3P9MA 3T3PF 3F05A 5IFHL 4NC1C 4JFHD 1MRCL 1O9WA 4GSRA 2CKNA 2GEQA 4ADGA 1F5WA 3IT8D 4A68A 3D0LB 3WFEH 1JYXA 1AO7D 4H88H 5EH1A 4FXKB 5FB8A 1GS8A 2WXKA 1BVLB 1AJ7H 4JFYA 5FV2A 2P5EB 3ATFA 1IBFA 3WDIA 1FVDA 1ZLSL 1NPJA 3NFSH 1QSFD 1RZJH 3MV7D 1CXLA 5EULV 3FC8A 4PV9B 4P4KC 1SVBA 2WIIA 3DTXB 3HHSA 4KTDL 3G04A 5E1QA 3U4BL 2V5MA 3LCYA 3OF6D 1JUFA 4YPGA 1LE9B 2COQA 2IOOA 5C0FB 5AWNH 1E65A 1FLRL 3HBPA 1Q72L 3BDXA 4GSQA 1YQVL 4ODXB 2DY2A 5KBMA 5D6CA 2X9WA 5T33H 3BPOB 1E4KC 5ABDE 2WW8A 1CFQB 3TYGL 3W38A 1A25A 1PKQA 3UPRB 4MD4A 1B6UA 1XWVA 2J6EL 3MLTB 4N2GA 1WWCA 3MBWB 3MNWB 4PRIB 5BRZB 1CD8A 5CP3A 1QBLL 1WSST 4MMZC 2DWXA 3WGVB 2X6CA 5I0XA 2DOCA 2EYRA 3OXSA 4CDHA 4GUPB 3QJUB 2XWRA 4NCDA 1KOAA 3O11B 1RJZB 3WNKA 3BJ91 3FOLB 4C83B 1IGJB 3IDIB 1UXWA 3K3QA 4I18A 1ZDQA 3L3DA 3I6LE 3AG1B 4Z3HA 2ZXBA 1FFOA 1TQVA 3BZFB 3AREA 3D4YA 5D1ZD 5TE6L 1A0QH 4EQ2A 2N1TE 1F3JB 2DQGH 2H7WA 3AT0A 3ERXA 5D7IB 4MA7H 5HHXH 3ILQD 2XHNA 4DGUA 2M2DA 5D7KE 5LNEA 2XIBA 5BS0D 2BVEA 4Q9RL 4I48A 4AVHA 3ATDA 3TH4T 3VMOA 4X99B 3GMLB 2WBKA 3L6FB 2RD0A