3SD2A

Crystal structure of a putative member of duf3244 protein family (bt_3571) from bacteroides thetaiotaomicron vpi-5482 at 1.40 a resolution
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
NPMGIPIQPTYEKCAILSNILNVSFGRAKDYAIITVTNKATGEIVHSKTYHNTSIVMIDMSSCEKGEYTIHIILNDCLLEGTFTVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a Putative member of DUF3244 protein family (BT_3571) from Bacteroides thetaiotaomicron VPI-5482 at 1.40 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Unknown function
molecule keywords Putative member of DUF3244 protein family
total genus 15
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2011-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11589 DUF3244 Domain of unknown function (DUF3244)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.3080 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3sd2A01
3SD2A 4G5AA 3D33A
chains in the Genus database with same CATH superfamily
3RBSA 1QRNA 1ZMYA 2PYFA 1O6SB 1ZK9A 3GBNL 4LLVB 4ZMWA 32C2A 3KXFA 4QAMB 1VGKA 2VLLB 4H8HA 1DJYA 5FA3B 1C9SA 3LNEA 4BFKA 3Q1SH 3QIUB 1N9PA 2YEVB 3BPCB 5I74B 3MGTA 2PW2A 1CXLA 5GRJL 4I9WD 1N67A 2EDMA 1EERB 2Y2WA 4Z7VB 1IL1A 1RFDL 2QADD 2EDQA 4IM8A 1EA9C 1DBAH 2JJTA 3I75B 3VXOA 2W0LA 4IOFC 4LP5A 5F1KC 3RWJB 5JPMC 1R3IL 2YBRB 2B4CH 4ICXA 3BDYL 3BZFA 3DRTB 2PO6A 1LHZA 1XBDA 1ESOA 2FR4A 4HCRH 1N5AA 3PFUA 4YPGB 3ULUL 3SD5A 5E2WL 1JYNA 1Y07A 1AGCB 4JCWA 3NSYA 4UT6A 2X0VA 4XHJD 5JW4N 1HNYA 3N1FC 1YN7B 1YHPA 2AJ3A 2OYLA 4AYSA 4E9WA 4EXKA 4U7KA 4L3ED 5JHLH 4CVUA 3IU4H 3F62A 1IC5L 5CJ8A 5I1JH 1FPTL 3EUDA 2W9DH 5DMGC 3MLTA 3WG7B 4XB3A 1OT4A 4RMSA 2R56H 2DJMA 4XN1A 2YXWA 2OK0H 1XCXA 1IILE 4AJ0A 3B9EA 1OB1B 2H2PD 2VC2L 1MFAH 4RFNB 2NTSP 3WE1A 1J9RA 4JAMA 4RX4A 3MRPA 5IM7A 1N5YL 4JREB 1JI2A 2ADGB 5IMLB 4LHUA 5FFOA 1RUAH 1OHQA 4AMWA 4DFIA 5I1GL 1E27A 4P2QE 3MRJA 3JWNC 5SX5H 1ZIAA 3V7MA 2BVOA 4XOBA 3WELA 1MWAH 4NQCB 4NWTL 3T71A 2GBTA 5T1MB 1UJTA 2W95A 2WIIB 4JB9H 3MFGB 4GSDL 5KSAB 3SBWC 4PRBB 3HUJB 5FWRA 4JG1H 4TVPE 2B14A 3UTQA 4HUKB 5HDWA 1IVTA 2AI0H 2IAMA 1IFRA 1BM3L 2WLNA 2Z92B 1KJ2L 2RD0A 1KXVA 4N24A 4QXGH 3KPLB 3CFCL 3EFDL 2NYKA 1OEZW 4MD5B 3IU3A 4DTGL 2I7SA 4F24A 1GYWA 4PY7A 5IMKA 1QTSA 2R2BA 2B4CL 4GW1A 1ORQB 3RPBA 4UM8B 4U3HA 3PHOB 2WSKA 3UZVB 4DSYA 1CBJA 1G43A 1R3KA 1FI8C 2IQAA 2B1AH 2J25A 5EBLB 2ZUWA 4NAQA 1SJVA 1TEYA 5HYQA 3FTGB 2A9AA 4KX7A 5FOBA 3LIUA 4I0CC 1HINL 3WNMA 3ABMB 4TTDC 2F61A 1AMYA 1FGNH 1TJHL 2ZPKL 2J8UB 2N1TE 3QULB 2PP7A 4WFFD 3CSTA 3T0XA 3EYFA 1QPXA 1QVOB 2F58L 3IGAA 2O5XH 4XCEB 3CDCA 1ZLWK 5DMYA 1R4XA 3QFJB 2NY5H 3TS8A 2ERJB 3R06B 2FO1A 4FZ8L 1I85C 4PB9L 4JL2A 1RZIB 3QCVH 4CJ0A 2DWEA 1F58L 4MS6A 5BRPA 4LLYA 4EZLA 3TU6A 1S5HB 3O4OB 5L2KA 2VDMH 4LSSL 2DV6A 3KVPA 4U1JA 1WTGT 1WFJA 1DQIA 5DYFA 4JDTL 5FKAB 5EPMB 1OP5K 4LOFA 5GS0L 3QDJE 3T65B 3VD4A 3WUWG 1F6AB 5DVPA 1KZQA 3TWCL 3U30B 3VDAA 3VXME 4CMHC 3RVUD 4M8QA 1DUYB 4D2NA 4TRPH 2LVCA 3MXVH 1IEBA 4HFUH 4BFJA 3FAXA 1JS4A 1NPUA 5EU3A 1HEJC 5AOLA 4UYPA 2LFGA 3N50A 3EO0A 5LO7A 3TNMB 1GHFL 5E99L 1A8JH 2J3SA 4GG8A 2VRAA 3L3JA 1EFXD 1MY7A 4X7CC 1DBJL 2OULB 2YRBA 4PI0A 3BKMH 2EP6A 4MCYA 1KIUA 2DQDL 1B3IA 4W9KC 1RY7B 4P3DB 5AQ0A 4JM2F 3VX0A 4Y5YC 3W11D 1BZ9A 2VDKH 1U58A 3L4TA 4F7PA 5E56A 3QIWB 1SOKA 1EZUA 3DV6B 5KVDL 2FO8A 4YDLB 2IALA 1NL0H 4XP9L 1OARL 1I8LA 1G7HB 2KKQA 3KMDA 3HJ0A 3CFMA 3TO4A 4ZX5A 1PIGA 3NOIA 1I3VA 4NQQA 4HDIA 4JFDD 4MAYC 2XTJC 4NJAH 1G0DA 4PJCA 5C07D 4M48H 4UNUA 5CXPA 5DR5H 1G6RA 1SHMA 3FO9A 3CVBA 4PRHD 2VL5A 1TT6A 4HEME 4XXCA 5IW1A 4R96A 5D7IA 4TS6A 2NDFA 3CDFA 3GSUB 1TCRA 5IBUG 5EZPA 5IJCC 1FIGL 4R90L 2JKIS 3U9UB 4J27A 5I71C 5C6TL 1A65A 3C6LC 3K1KC 2RBLA 4LIQH 3ZR6A 1SF5A 5FHBH 4ELME 4QTHA 4EUPH 2IPKA 3HPLB 3IGKA 1ND0A 3AUVA 4UDTA 5GGQL 5K9QI 4OTXH 2CNZA 2BNUA 2Z91A 1RZ8A 1S9YB 4XP5L 4LHUD 4NZDA 1BQLH 1NMBL 4MX7B 4NM8H 3WNPA 3U0WH 4MAYD 4U49A 4YHLL 4M6AA 3KPSE 4F2MB 5JYLA 1NAMH 3GKWL 2HPOA 1I4FB 4U7MA 1UKTA 3T77B 2YZ8A 3K2IA 3IDIA 4AT6B 1I7TB 2YXMA 2EE3A 1UB6B 2R56L 4DN3H 1BPVA 2VLMD 4ATWA 4LBAA 3S6CA 4G8IA 3ZXAC 1TITA 3CMGA 1OAQH 1NAMB 4AEHH 3UO1L 2A77H 4EKJA 2OMUA 1L0QA 4HMEA 1CLOL 4OF5A 3MZTA 3DV4B 3MV8A 1MJ8L 4NRZB 1TTAA 2VSMB 1FV1B 2J71A 2WW8A 3QZLA 1PQZB 2EEDA 4X6BA 3V5HA 2W9EL 5E6YA 3H3KA 4LL4A 4FXKA 2C9RA 1QX1A 1T6BX 3LDBC 4Z8FL 2R69L 1U3HA 1FIGH 2KERA 4BRJA 4HCRL 1GS6X 3HBGA 5EZIH 4JQXA 1QLEL 4PRDA 3IDJA 5DQ9B 2BVQA 4PBDA 3EYQD 5D8JL 5HHMD 1RH8A 5ENWA 1X4ZA 1WFOA 4ZPTB 4DAGL 4U6XA 4N1HB 4RDQG 4LEOB 1ICTA 1RZ7H 3CD4A 4LPXA 4KJYB 3WO4B 5HYIA 2CIKA 4ZAKD 4LSPL 2XNAB 3KNBA 3ETSA 4GI9A 2F7QA 5BVJB 1WA1X 1T6WA 2DOCA 3ABKB 4RRPM 4TQIA 1D5MB 3CFQA 2X28A 2E9GA 3PG2A 1QTPA 4K7PH 5TH2B 1AD9B 3MAWA 4HCGA 3RWDA 5LVEA 1DANU 1NLBH 2AMGA 5L7XH 5KYYA 2WVUA 3GXPA 3ORJA 1MHPH 5CWSA 5JR1H 4WWKA 3RGHA 1IC7H 5JMOC 1CGWA 4YXHH 3F7QA 4KQ3L 2WBJD 2Y07H 4K0OA 2XQ0A 1XF5A 3ATDA 3BZFB 1WPCA 1EEZA 2DI7A 3V4VB 2WLMA 4XB8A 4FERA 1T1WA 5F9JA 3VUAA 2NCMA 4I48A 1YNLL 3LKOA 5KN5B 5HYQB 4M7JH 3S4SG 2W0KA 1VGKB 3Q48A 1JIBA 4NNYA 3VH8B 2IQ9L 1WGOA 3VFSB 2IVFC 4NQEB 1W80A 2GJ6B 5F6HJ 1YG9A 1BAFL 5CJOH 4JVPA 1OD9A 1ADQH 2Y5TB 4W9ZA 1XQ4A 4UCFA 2EIZB 3TVMA 1WFNA 1L7IH 3WNKA 5F7HA 2FWLB 1T5WA 3GMPA 4OF0A 5HHVH 4MWFB 1KDJA 3MRDA 3VXQB 4B7IA 1GC1C 1JYWA 1KBGL 1QSZA 3UBXA 5HPMB 1X4XA 4PJIA 3VXSA 5DVKA 3ZHLA 4HIPA 1JOIA 4XX1G 3CU1A 3GSVA 1RIVH 5FK9B 1AGBA 4X6FB 1WC7A 3ZKMD 4P2AA 1JHLL 4W68A 1YMHB 2AZUA 3IFNH 3DETD 2DQHH 3MRLB 3NQKA 4NJ9H 4HFWB 4PJAA 3TIEB 4KKAC 4B53A 5FYKE 3MRHA 5JYMA 3KGSA 4GRLA 3T4AC 5T1JA 2VR9A 1BFVH 4RWYH 4S1RL 5JO5B 4Y4HA 1ORSB 2QQKL 1RHFA 3VJ6A 3AG3B 1E7UA 4KAQH 2E27H 4WJ5A 1L9SA 1Q4NX 2C3XA 4IK6A 4AC4A 1E0OB 2XZCH 4UQ3A 3SDDB 4WCYL 1DUZA 3VFMA 2GK2A 1SLWA 1MIMH 3KVQA 2WZ5A 4ACTA 4C4KT 2P28B 1J05A 5F9OH 4Z23A 1Z66A 1R6VA 5DXWA 2JKNA 3FDWA 3ZMNA 7FABH 1NCWL 1ZLEA 4R83A 3DJ9A 3W9DB 5JIHA 5E9DA 4CA4A 1OAJA 4G7VH 2PW1A 2ZUSA 4G6ML 5IFJA 1OKEA 4KNUA 4R7NA 5GSRB 2ZX8A 3DX6A 2UX7A 2HRHA 4HJSA 2OJZH 1IGFL 1NCCH 2DRUA 3BWAB 3LEVH 3CWGA 4MJJA 5ESAA 5BZWA 4XPTH 1H3PL 1S7VB 3M17B 2QZQA 2ICEC 5B7EA 1GPOL 3BQUB 1OGSA 1KTLB 1WQVT 4AH2A 4LOUD 3EGXB 1NQBA 3CSYB 3BN3B 1QRNB 2PYFB 4GQ9H 3RY6A 4Q0XH 2X1OA 2ARJQ 3P9LA 4PTUA 5AW9B 3TO2A 3A4EA 1BQRA 1G87A 2WXOA 3CE1A 4N2FA 5DHEA 5G5DA 2BIQA 4EZMA 4PREB 5T3XH 2HLFC 1CE1H 1OAUL 5GRYA 3O3UN 4XC3H 3IBEA 3AG1B 1CLOH 1L7TH 2FWOA 4NQVB 4OLYL 5DT1L 4PJIF 1FUNA 3FT0A 4YL9A 4PJ9D 4MMYB 1Y18B 3RVVD 1RZGB 4L1DA 1EFQA 1Q9LA 5CEXB 5I1EL 3WOVA 3BWUC 3FOLA 4P5KB 5I6LA 4P5RA 2VLKA 3DROA 1J1OH 4GMSH 5KVGE 3NA9H 5I0DA 4NXSA 3BLKA 4MA3B 4JY6B 4KX8A 4PV1C 2QFPA 2Q76A 3QEGL 4BK8A 4PTTB 1A9EA 3LQAH 2BXZA 1YEEH 3TASA 1BBJA 3UAJD 2LLNA 4ZS6D 1KPRB 3QNZA 3UGUA 2EH7H 4PS8A 3FF7A 2YQ3A 3BGFB 3I50L 1S46A 2QL1A 3AUWB 3L54A 3P3TA 4HG4K 2Q8BL 1JPST 3AY4C 5SWZD 3V95A 3N0AA 4X5XB 4OGXH 4AUJA 2EE2A 4HGWA 4OZHA 5ALCL 4P2QD 4RGOH 4G1EA 2WZ6A 4LDOB 1ZV5A 1QSED 4FQCL 1UFUA 3QZMA 4ODUA 3MBEB 4MJ5B 1NGXA 3DO3A 3SDXA 4Z7QB 2CA3A 3HRZB 1TZIB 4WI0B 3L5IA 4LIQL 3E9UA 4YE4L 3MTXA 3ULUH 2VIRA 3QEQA 4KKPA 4HU2A 5AZEH 1MFMA 1MJ8H 2WWMD 1HSAA 2V3EA 3KM2A 1U8IB 4LAQH 2DQCL 3V0FA 3L3KB 4OIFA 4GFXA 3UABA 4XO3A 1LE9B 2DYPD 3HAEG 3BP5A 5FV2A 1A02N 3LHPL 4JG0L 2IG2H 5JHDD 5EZJA 5I16A 4S11A 5IVZB 4B95C 1W0YT 4PJ8C 3BGMA 3MLRH 4AVKA 1I8LC 3FRUB 2NXZD 4BK4A 3AB0C 3HTLX 3B9VA 2FEEI 3MBED 1KIUB 2CRZA 3AG2B 4LP8A 4LGSB 3LV3A 5FM5O 5EBMA 1ZLDA 1XGRA 1QFPA 4HWZB 3NCBB 3ZYJA 4G8IB 3D2UB 3GM8A 4ZOBA 1EQWA 3BOVA 1JWMB 2BVPA 3WEMA 2NSQA 5E24E 1FZJB 4WFGD 2R59A 4WW2F 1N64L 4ZO9A 3ZL4L 3HAEA 4JFPA 3K2KA 4MDJB 3SY6A 3W9EA 5B38G 4AX3A 4BKLA 3PXLA 2CWRA 5K9JH 3VVWA 1UZ6E 4XBPB 3FQUB 5EO9B 1WIUA 4TNVK 2VE6A 3T4AB 4Z78B 3HB3C 1BM7A 3IXTB 4C56B 4Z9KB 3RPIA 1ZGLM 5D72H 2YBGA 3R7QA 1KBWA 5IR1A 3Q2VA 1CFNA 2UVEA 4OLXL 5I26A 4KTDH 5F7YC 4JM2C 3WFBL 2VL4A 2PO6B 4F33A 4DKDC 5C0CA 3LSOB 1ACYL 3VRLF 4NENA 2GAZB 4PG2C 1D7BA 2W92A 5H94A 4NM8L 3HI5H 3GSNA 1V3KA 5DRNA 1SLXA 4X7DC 4B0MM 3GJEA 1QLFA 4KAQL 1IAKB 4JFFD 3TBBA 3M8OH 2DH3A 2X3CA 4LRIC 4LF3B 4IQHA 2TRHA 2QADC 2VLRB 1JNHB 5GISL 1KUMA 1JPGB 2VZUA 2WZPA 4NWUH 1M05B 4YSTA 1CBVL 1XGYH 4LQ1A 5DMIL 7FABL 4KROD 3I9GL 2XVBA 3ARGD 3DIDA 2DMKA 1IKNC 3FHQA 1JWSA 2P4AB 3UJJL 3UEQA 5HGBB 1E50A 2FX7H 5IMKB 1MREL 1KG0A 3GMLB 3LZFL 4I48B 3MV9B 3VI3A 5HHPB 4YAQA 1W6LA 3BSZH 4J6IA 5J4MA 1ED3B 1LM8V 2WSPA 3L3DA 4LVNB 3B1TA 3KPRD 3VA2C 2AJXL 4X8XA 2E7BA 3DX4A 5CU9A 3D39B 4Y7OC 5DA0B 1DJSA 3L1FA 5KAQF 5CJQL 3OG4B 1NCDL 5FYJH 4WF7A 3MCKB 4XI5C 1UD8A 2CK2A 2EE9A 5KYUA 3BH4A 5AOZA 1IGMH 2OMYB 2WXFA 3OKEB 4JL1A 1AVAA 2H2SC 4FLHA 4YSRA 3TO4B 1HHGB 5EZLB 2J5LB 3O3DB 3T0ED 1IQDA 3LD8B 1SFHA 4HMDA 3SCMC 1GGIL 2A9ML 3H2WA 4I13B 2Q6WA 3PAVA 4KY2A 2W88A 1TDQA 2XFXA 4EI5B 4QXUL 5EEVA 1KN4H 3F6LA 1PX8A 4WHDA 1KJ2A 1QSEB 1QO3B 4IGBD 3RDTC 1ZSDB 1UB5B 3RWCA 5E2UH 4AIEA 4CDGC 2IH3A 4HIJA 4ZNEE 4JRXA 3ZIYA 5D7LE 1NCBL 1ULVA 3UBFA 3T2LA 4OLVL 1DVFC 4DP5X 3S9DB 1YEGH 2OK0L 3OKEA 4GAAA 1UA3A 4U1LA 4DP0X 1MLCA 3BSGA 1GOGA 3V4UL 1WBZB 3CZNA 4HETA 2CJSA 2I69A 3IK2A 4ZMAT 4G43B 3VWJD 1AANA 4AV5A 4KVCH 1HQRB 4X6CF 1CYGA 2ZYSA 1E2WA 3OAUH 5ABAA 4LOVA 4P46D 5I8OH 3P77B 5SWQB 3AS1A 4GRWE 4JRXB 1I9RL 3GI8H 1MCKA 2TAAA 4W9LC 5I1AA 4MNQB 1I8UA 1LD9B 5F9OL 2X2IA 4KTYA 1HSAB 2CGZA 1FWXA 4BCZA 4I0KA 4EBQH 1BAWA 3QG6A 1PL3A 2P43B 4PJHB 5D70H 3VD0A 3PPEA 1RFDH 3D50A 1F90H 5FGCE 2BS9A 1JD7A 1XMEB 5FPIA 3KLAA 5F2FA 9CGTA 3FKUS 5FF6A 1FL3B 1DCLA 1F8TL 5LHDA 3BVVA 3LKQB 3Q5TA 5EA0L 2SODB 5LWYH 2GB2A 4IDJH 1D7DA 4JUSA 5J6GA 1M57B 6TAAA 2LHAA 1HINH 2OCCB 4B0MB 3K3QA 3K6OA 1EGJH 1KEMH 4MNHA 2KUTA 1U8OA 4M61B 4ZFZA 4Z5RB 3GMMB 1I8MA 4KK6D 2IPKB 1MVUB 3VD7A 2BWQA 3SZKC 2O6DA 2F08A 1Z7JA 3WKQA 3TFBA 2HUEA 4FNQA 1UADC 4E9YA 3NP4A 4YHKH 3L7EA 1BWWA 3V4PL 2D31B 1NBQA 5EO9A 2BVEA 5HGDB 4AVHA 5DJDA 1IKOP 2IBBA 2NW2A 2W80C 1S5IL 5H4ZA 5JMRA 3PY9A 4FABL 5TPWH 5EEXA 2YAMA 3FULA 3U4EB 3U1SH 2WLIA 4L37B 4GS7B 1E43A 1RZKC 2Z31D 3POCA 5CLYA 4AM0Q 1TG8A 2V2XB 4W9FC 3FYIB 4D7BA 4EN3D 2CJTA 1LEIA 3X1BA 1G7MB 2VDNH 4OZGE 4X80L 2MTAA 1FZJA 5FAAA 2ICEA 3ARFB 2HG5A 4XZUB 2DBLL 2Y2TA 3SPHA 4GMTL 2XWRA 5CD5C 3X1NA 2R0LL 4S0HA 3E1ZA 1E5YA 3AAZB 1QFWH 3EUUA 1QPKA 1XHHA 1I3UA 3H9ZA 3LRGA 3U0WL 1KIRB 4XMKH 1YAZA 3DHUA 4JFDB 1S7TB 3SKMB 3BT2H 1PLGL 3RPIB 3UCRA 1JZ8A 5FW6A 3HR5A 3OGOE 4PRHB 2YBRA 3IMTA 4DGVH 1D5ZB 2OMWA 3ECBA 5BW7C 5HYSG 5I18L 1N64H 3PAYA 2H1LM 5A2LH 3T2QA 2E74C 3W5MA 4X9GA 5DJAA 2BMKA 3TIDA 1IFHH 3NZHL 4M5ZL 4OU3A 5I8KH 5IB2A 12E8H 3UGEA 2A83B 2E86A 1IGCH 4ZUWB 2VERN 4L23A 3GXMA 2ZD0A 3T6QC 1KZYA 3L7FA 2F2HA 4OZIE 3IETB 3MODH 4PJFE 3UJIL 4OCNC 1WV7T 2VT0A 4OF6A 5FLUA 3CLEL 1FYHB 1S3KL 1F1DA 2VDLB 4IHOA 4L1LA 4PI2A 2GEQA 4HKZA 5CAYB 4AQOA 1EHKB 4M4PA 5F8QC 2VXSL 2NT1A 3ARDD 5DJCA 1P7HL 3GSOB 1BD2E 1EZLA 1N6QH 3H42L 3ATBA 5L4IA 1URLA 3KPQA 3AITA 2K7QA 1K3ZA 4OUOA 1D9KC 1ETB1 1MKFA 3K6DA 3KYNB 3VAEA 3RIFF 3PQYE 3QCUL 2BDNH 1INDL 1UKQA 2DWYA 3L9RB 4JKMA 1XR9A 1BQUA 1SMAA 5EC2A 5CEYB 2VLRA 1X5HA 1UT9A 2RCSL 8FABB 4FZEH 1PLGH 3UTQB 4NN5C 3IVKA 1BXAA 2ARWA 2MNJB 2ZXCA 4Y1AE 3HI6H 1C08A 1NCOA 4Y1TA 3U6XA 4Q56A 4YXLL 4L29B 5CFHA 4CMHB 4DKFL 2DQ6A 2H4EA 3BWUF 1TZAA 4CC0A 2VC2H 4APQC 3NCYP 1U92B 3NYKA 3Q2LA 2UYLA 1JGEB 4I0PB 2AXFB 1DVSA 3WXWL 2M83A 5J13B 4JFWA 4KQ4L 5C0BD 3WU1A 1I9IL 1E3FA 4NQEA 3T3MB 2F54D 3KW7A 3ZTCC 4EN3C 1IBDA 1CG9A 1L9QA 2D7QA 3BP5B 3B3IA 1XF4B 4WFHD 5DEFA 5C0GA 5KBDA 2VXUH 3D1MC 1BMWA 3MLTB 1SY6L 3GI8L 4F5CA 3G5YB 4Z7VA 4X6CB 1OALA 3CZKA 4JGUA 4U1LB 3RWGB 1A6AB 3MLVH 3KAAA 1MDTA 5HDQH 2G75B 4XTRD 2XY2A 4LSQH 4QCIB 2BW4A 2AXWA 3FT1A 3LV3B 2VNCA 3S2AA 2FCBA 4KOCA 2RHEA 3SOBL 3GZQA 4YH6A 1F4HA 4NO0D 1JWMA 3OKMB 5K93A 5ALBL 5DEGB 5BS0D 1ETZA 4D8OA 5F3BB 3FB5A 3LKSA 5T3ZE 2OP4L 4NFDA 4UV7H 2Z64C 3FT3B 3ASNB 2DQFA 2DLTA 5JLZB 5JPMB 2EUVA 1DBBL 25C8H 4WUUD 1ZWIB 4HUNB 2FGWL 2AI0L 3HE6C 4FXKC 4NHUA 4JS7A 5DHVH 3Q8CA 1NIFA 2K78A 2OX5A 2YD1A 4DEUA 1IKFL 3OPZL 3MRHB 3IRZA 4AQEB 3ETBJ 4NC0B 1AO7B 3NJFA 3AS2A 1WA0X 2JELL 4JKKA 4CKVX 5A2JH 4KO5A 2L7QA 5IQMA 4ONFL 1CGTA 4NKOA 3MLSL 3DO7A 4E9QA 1XL6A 1F3DJ 4P2YA 1WG3A 2XZCL 3N3EA 5FYKL 3MO1B 3PV6A 4XX1E 1VGEH 3WD5H 4JHAH 2GKIA 4NQSB 3ISYA 4EDWL 2HKFH 3TWCH 3F00A 5JDSA 5G5DB 5I1HL 3ZZLA 4ANKA 2UZYB 4L3CA 2KMWA 1R3JB 3GMOB 3OHXA 5F7DA 1MUJA 4QRSA 5E5RB 4WI7A 3NJXA 4HUMB 1G6RL 4MDRA 2I9LB 1AMXA 3WFDH 3DPDA 3DHJA 4R5TA 4POUB 5B39A 5C92A 2IJ0C 2EDOA 4V1DA 3MV7A 4MMXB 4LIQE 5EIIA 3GEFA 3GK8H 1UM4H 3C6LA 2AQ2A 1N3NB 1JTPA 2ZPKH 1MFBH 2P8MB 3ZUCA 5I18H 3TCXA 1ZY9A 2CLVB 3A67L 5AL8A 5KSVB 5A7EA 4G7SB 4JFPB 1KGUA 2FB4H 4H26A 3AMLA 1GC1L 2R2HB 4XXCC 3W9EB 4MQ7A 2Q9OA 4X83A 3JWOL 4YZFE 2BY3A 2NSXA 4B5EA 2A0LC 5DLMH 4HV8B 3SCMD 2G2RA 3OZKA 1HWWA 3O4LA 4TM9A 3V6FB 5I6OA 2FH6A 3T0EC 3OXSA 2VL5B 1XCQA 2GSMB 2NXYD 3UIYA 5I76A 3RWEB 2WQXA 1CF8L 4LL1A 2GBVA 5KEZA 3JSSA 4PGJA 1GRWA 2Y5EA 4Y5YA 4UINH 5I75C 3L5HA 2YJQA 4UQBA 4PBWD 4XE5B 5ICXA 4N9GB 4UILL 3SPJA 3RIAF 1TLMA 1F97A 1W0VA 3KYOA 1TJXA 3VU1A 1J1PL 4PJ8B 1FL5A 2HJFB 4LSDA 4XZ4A 1GZPB 4N20A 4XMPL 2YPKB 3D4YA 4ZMZA 3OLGA 3QJFA 2J44A 4NO0A 3ENEA 1PNDA 3IMBA 1SVBA 3ABLB 4JJOA 4ORGA 4YE0A 3B83A 1RXLA 2QDVA 1T0MA 4E5XA 5DZLA 1LEIB 3QAZC 3O41A 3F6IA 4NQXB 4Q6IC 5KVMC 1WFUA 1CLVA 1NCNA 3L4UA 3BH9B 5TDOB 1EHAA 1EAPB 1QBLL 3BUYB 4AIZA 3B5GA 4AQAA 2Q87A 4MGXA 3AW5A 1IM9A 5AOJA 3TBCA 2FBJL 4HJUA 5D7IE 4G5ZL 4MJ6B 3S8WA 4OZGB 4QRPB 1FIEA 1I85A 3CHQA 3O6KH 3ZE1E 4OB5L 2ZXAA 4WO0A 5D71L 3T0DA 1BX2A 1IAIM 3MYJA 4TQPA 3IDIB 3U9WA 1N19A 4AT6A 3B1UA 4FCHA 5I1DB 1S78C 4U6VL 3QZOA 4ZX6A 4Q9CA 4FHKA 3OKOB 2X4OB 1COBA 3NN8B 2YEQA 4KFMA 2K0RA 3UTSA 5H37G 1KGXA 1JL8A 3BT2L 4QR7A 4W6WB 4Y4HD 4BWWA 4YFEA 4H40A 3SDAA 3KLHD 2ROXA 3DDFA 1GYAA 5KTEH 2WBWB 2XX0A 2YUZA 2YKKA 3GMMA 4WVRA 2AJZA 5A16A 4TULH 5DYOA 3MGOA 4N4YB 3PLYA 4Z7WA 5T1KB 1H8LA 3FB5B 3LKSB 4IDLA 4HIEB 4BIKA 1R19A 2R7EA 3HNSH 3ALPA 2Y5TA 3MFFA 3DJRA 3NZHH 4YHMH 2X6VA 3ET9F 4KKLC 3VD5A 4BM7A 3K4ZA 4GAFB 1KXVC 5GZOD 1B2WL 2P7TB 3F05A 4YSCA 5L2KD 4ZDHA 4IU3A 2CMRL 3GIZL 5DUMH 1CWVA 1U3NA 1BW8A 3RVWD 3SBWA 1MF2L 3OJDB 1DLHA 3GUTB 5I2IA 1L9OA 2ATPA 5IJKC 4AJWA 4QT5B 1JNNH 1L9MA 1FNHA 4LARH 2QVKA 1J0ZA 5KYXA 3A4DA 3RP1A 3QHFH 5L2JA 4E41E 4A37A 3U0PA 3JTTB 5MENA 2JE8A 4FI6A 5EG6C 1SY6H 2DI8A 5BXFB 2YLHA 2ZKYA 2Y1VA 4HBCH 3CLFL 4QNPF 2XOTA 1D5MA 3IE9A 5D6CB 2JQMA 1EO5A 2ORBH 3L4YA 1CFQB 2VTFA 5T1LB 5JLZA 1DVQA 5CSBA 4C4UA 4MAUL 4IRZH 5CWSB 4IBYA 1A1MB 3T3PF 4YDVB 1JV5B 1G7IA 2FYYB 2PTUA 1FNSH 1L7IL 3NCXA 3RYMA 1MWOA 1GGTA 2NY2B 1BOGB 4P99A 2BVQB 4MXWH 3O9WD 4H0IA 3AABA 4FMKA 4HHAB 4O5LL 3UAJC 4WKZA 2BM3A 2QV2A 2Y0SA 2F8OA 1ASQA 2WWKO 5EIIB 4ODHL 3ZDYB 1JZFA 2AJ3B 4FRWA 3FUIA 4AK2A 4JM4L 2X6BA 4P5TD 3UBGA 1MCFA 2D9QB 1MCWM 1MI5A 5IQLA 1D5IL 5TQ2L 1UM6H 3ES6A 1WZKA 1DQQB 2H26A 1Z3RA 3OHXB 1N0LA 4C57C 3WE6A 1A2YB 4OJDH 1PCSA 1A4CA 2GJZA 1DQLL 1X5ZA 4DUXA 1XH1A 1BQKA 3EKCA 1S7UB 1U8PB 3ECQA 1URIA 2Z65C 2R29L 3LPOA 1NEZA 1HILB 3GSUA 4UOJA 4IRJA 3I6GA 4WFED 1OIOA 3UZVA 2K1MA 4LBEB 4M7KL 4XVTL 5JXEA 4U1MB 1HHHB 4JM0A 2X9YA 1FH5L 4PWFA 4F5CE 3KZ8A 1SM3L 2D9CA 3X14A 3GSRB 2V5RA 2JI1A 3L9RA 4Y16D 1F6AA 2AK4E 1UZ8A 3H54A 4I77L 4D3CL 2MCMA 4XGZA 1Y6KR 3TN0B 5IY5B 1P7BA 3EFFB 1FJ1A 4Z3FA 1XBRA 4XCCL 4QY8A 1U8KB 2WNGA 4BHUA 3PHAA 4DK3A 2OSYA 1WAAA 3O3AB 1AKJB 1QG3A 3VI3E 3TPUA 3NACH 1VCBC 2K3TA 2OX5B 3JT2A 3NMEA 4UQ2A 4YN3A 1DZBA 1A7RL 5C0FB 4N5EC 4M6MH 4NN6C 4HZAA 5DJZA 3A5VA 4DUVA 1PEWA 1XF5B 5LDUA 1KT2B 1S7QB 4N1CA 3B9KB 3M1CA 1IE4A 1V54B 4IRJB 1GCYA 1UWEH 3L4ZA 3MX0A 3TZVD 4PJGF 5KN5A 4FXTA 4NRXB 1II4E 3E7JA 5BVPL 1HYSD 1XGTB 3C60C 4QTHB 4OCRH 5AYUL 3T3PE 1E2ZA 1OP4A 2PMZA 4K8RL 4ZOEA 1MG2C 3X17A 1NBZA 1VIWA 4NOBA 4UWQB 1XGQB 5F72S 1NCBH 3RGVB 3PABA 3UTTE 1J5OH 3WI9A 3QXVA 1KB9K 3QSKB 1P5VA 3T0VA 4HFUL 4ELMA 2B77A 2KZWA 1BMGA 1UASA 1VGEL 4R0LA 2MCPH 4J3OG 1LEGB 1WAEA 5DO2D 4Y5VB 5C9JB 1L0YA 1UM6L 2NTFB 3BQVA 3QXWA 2X40A 4BWTA 2AVFA 3ZL1A 5MHSE 1OWRM 4KJPC 4KJWC 3Q6FB 2CR3A 3MOAH 3CNKA 2I26N 4NQCD 4KKAD 4PIRF 2XIIA 4E41D 4KKZA 1Q9KA 1JTTA 1H3PH 4KQ3H 3VXNA 4TVPL 4DZ8A 3D0VB 3WO4C 4G6JL 3D3VE 4MCYB 1HYSC 4OLYH 1BIIA 4CC4A 4PWHA 2GFBB 2PLTA 5GS1C 2LAAA 5EOQL 4AZ8B 1U91A 3FCBA 2PWGA 2R1WB 1KYOJ 2D3JA 5C0CD 1UUSA 4AV4A 5H8DA 4EI5D 5DS1A 5E4EC 1ET8A 2VGLM 2LV4A 4MAYB 3DSNB 5HHMB 5GZNA 4P3CL 5KSBB 2DQHL 4HIXH 1X6LA 2VW4A 1JJUA 3QXDA 3P3YA 1F4XH 5KS9A 3QQ9D 2BOBB 1CGUA 3O0RL 3D0VA 5EF0A 2BSBA 5AUMB 4IDJL 2APFA 4M62H 4M6OL 2DKMA 5E51A 1TF4A 2PYED 5LBSL 5JOPE 3AWGA 5GRUH 1JHTA 3MRKB 4BDVB 3AREB 4BEIA 3LRLA 2HX9A 4P23B 4Y2OA 2A73A 3QFJE 4K94H 2C1OA 2XVGA 2RTTA 5FW8A 1P4LB 5C0IB 5GIRB 3VXRA 2APWA 4MDIA 4IBWA 3KPRE 3QK0A 3CPLB 1LK2A 4PJCF 4D9LL 4W70A 1DLFL 1IARB 5EU7C 1E8YA 1C5BL 3IAPA 4F57H 1EBPA 4F37F 2B5IB 5DUBB 3ARED 5E1GA 1GAFL 5DJ0A 4BZ1L 1CJYA 2AMUA 5HJ3A 2RGSA 2CDFA 1EVTC 1OGTA 4J8QA 3ZDZB 2V37A 2FJHB 5I5IA 1HU8A 3E38A 2BOCB 3BVNA 3EOYG 1FNSL 3S3SA 2JSFA 5E95B 3FQTA 2E75C 1BYPA 2VLKB 3DROB 3NABH 3BVUA 2VLLA 3ZLQC 4NBYB 3AXHA 3BH9A 5TDOA 2MKLC 3RA7H 5F9WC 2P5PA 3ESMA 2XG5A 4HPOL 4Z7NE 5CLWA 1KFAL 1RUQL 2SEBA 4EIBA 4KUZH 1J8KA 3GHPA 3FSAA 4O2CB 1TQBC 4ZPVA 2R4SH 3TJEL 4JNXA 2P46B 1M05A 5B4MC 3AQDA 4B3VA 2JXMA 2VM9A 3AU0A 4OGYH 2P9RA 4G6MH 4O51B 5FCSH 1IGTB 3G9AB 1NGQH 1H3TA 3SGKA 1AH1A 1ECZA 1AKJD 4NZRH 3TH3T 1KCKA 1YYMH 3QORB 1P7QA 3VQLA 5DGRA 1HE7A 2MPVA 3OJVC 4M48L 5B38B 3ZDYF 5GS1B 5G55A 2ENQA 4F1SA 1IAOA 3SGJC 2UXGA 2D8KA 4X6DA 1HWGB 2WYHA 2EXYC 1DL7L 1VFAA 3BHBA 3FW6A 4E9VA 4ZW3A 2ZSVA 2AQRA 1F4WL 1Y1DA 1UJ3C 3L3KA 2IBGA 5TQ0L 2OM5A 1QMUA 4UV4H 4EOWL 5AKTA 3S34L 1LK3L 2YPLA 3I6LE 3K8LA 3RX8A 3BGAA 4AQ1A 4GRMB 3B2UD 1G6VK 1XSJA 4X0KA 1KLUA 1UA7A 3V2AR 2A1WL 1CICC 2YD8A 1RZKL 4LPYA 1B0GA 3RJOA 4IU3B 1S9XB 3QE5A 1U8MA 4O58H 3K81A 4ODUB 4F93B 1R9FA 4QT5A 3HLAB 4M43L 2Y07L 4MB5A 2QZ5A 5HGHB 1QACA 2NSMA 3C60B 3LRSA 3CN1A 5KVGL 3EDDA 4XB7A 4NM4L 2EIKB 4NRXA 2ZCHL 4BKSC 5LG6A 4IRJC 3WAJA 3ZKXB 4NPYB 5ID1B 1MLBB 2H3KA 5AAWC 4N85A 1JYXA 2R7EB 1KIQB 4NN6B 1S9WA 3M88A 1Y1UA 3UBXG 3ZYOA 2EQDA 2XPZA 2CKBH 1F00I 3D4GA 4H26B 4QRTA 1FZOB 5EZJB 4OFIA 2CLZA 1M42A 3HVNA 4AEHL 3GEWB 1BGXL 1SEQL 2FHCA 1KPVB 4PJAB 5F7MC 5INCA 4E5XG 1JNJA 3BT0A 4KDTC 3FSOA 5D1QE 1GCFA 4DIXA 2ATPB 2ZKMX 1N0XL 3O6FC 4HCRA 2YD2A 3CN4A 2FX9L 4YAQB 1AZRA 5AW2B 4DK5A 1TQTA 1AXSB 1TFPA 4L9LC 2E3VA 4JFYA 4U1MA 2ZZUT 2BINA 2GCYA 5ITFB 5KJRH 4J6RH 4YSDA 2FYVA 3BIKA 4TNEA 2N3JA 3GT6A 3UYPA 2V4LA 4ORZC 5KSAA 2MNWA 5IQ7H 1MDAA 1E3ZA 1CT8B 5FX3A 2R1YA 1I8KB 2XBZA 3W11C 4PGEB 1UQSB 2APSA 2DDQH 4OLEA 4MA1B 1PZCA 3D18A 5AB9A 3WJJC 5BMFH 2CRIA 4G2AA 5E5MA 2AAVA 4MWFA 1FAIL 1CUOA 2GC4C 2GBUA 3OQ3B 4RMQA 2Z1PA 1R5IB 1Q0EA 3CSPA 2XWEA 2J6WA 2XRAH 2EJ1A 2A99A 4JFZH 3O6FD 4NSKA 3APCA 4F33B 2FQEA 4Q14A 4WU5B 1MCLA 3RL2B 1MCCA 1OSYA 2XKNB 3U0PB 2VMJA 4P2OC 4AEEA 3EJJX 1HFUA 1K72A 2K9UA 3U82B 4FF9A 3N1PC 3WFHA 5I17B 1EX0A 1TVBB 2NY2C 4WAFA 35C8H 2ZE0A 3BQUD 1QA9B 4MKTA 1MIML 1A25A 2HT3C 4WRLA 3A6OA 2EIEA 5HDOA 4AXWB 3BUYA 5DTFA 4AIZB 4CU6A 4EZKA 5C0EA 5FKPA 1TVHA 2HZHA 1YEDA 3L2LA 5EU5B 4ZSOB 2F54E 4MA7L 4LT7A 2HP4A 2VDMB 5BNXD 5ID0B 3FL7A 4S0SD 3O3DA 3S37L 4DJMA 2EKSA 3REVA 4HV8A 4BD4A 4LLQB 1CXEA 3RU8L 4ZYKA 4Z7NB 3TTSA 1WISA 3OAUL 1CXIA 4ZUUB 1XCQB 1U93A 4DOHE 3DIFA 3EYVA 2A9NH 3QJHA 3M1BB 1AYRA 4RAUB 4KMLB 2AF2A 3MJ7B 1V3MA 1RZQA 2FNBA 4JFSA 4JY6A 5F7KC 3HZMA 1MAKA 4HZLA 3A67H 1A7PH 3OAZH 2AGJL 3ESUF 4HQQH 2ITFA 4CMMB 3MC0A 4L05A 1BP3B 3GTNA 1HXMA 4N2BA 2XACC 4UOQA 4ZYKB 1HL5A 1G9EA 4NNXB 4ZUSB 2FWOB 2XWXA 3KPTA 2OMBA 2Y3NA 4MNQE 2FECI 2N1KA 2W60B 4JZNA 2WBJB 4KKNA 1HL9A 3LS5H 3V4PA 5CCJA 2ESVE 3BMVA 3L1OL 1T0MB 4Z7UF 3ETTA 1OP9A 5F89A 1GY1A 3MOBH 1EXHA 1WTLA 2WZPD 1TQUA 3SE3A 1LO5B 2WSDA 3O45B 4KKBD 4J4PD 1H9DA 2MQ0A 1TQVA 2OTPA 5IQOA 3BH8B 1GVIA 3TT1L 5HXMA 1H6EA 1O6TA 1U3HD 4N2GA 3WUWA 1P9MC 1QSEE 4QRPA 2QV4A 1EXUA 1XIWD 4R3SB 4ZUSA 1AGEA 4AGLA 5HHOD 4NQVA 4HUCA 3WKML 2BVYA 5AB2A 3QZWB 5I1DA 2NNRA 1RJCA 4TQHA 3VD9A 2Y7OA 1X5XA 3GTTA 2I07A 3CZSA 4Y2LA 5CEZD 3CH8A 1MFBL 5E1IA 2G5UA 4QHKI 1OTUD 1K8IB 1LDSA 1TQCB 2DWDA 1AQMA 3FHEA 2YA1A 3CUPB 3PWJA 4M62L 5HJDA 2GW5A 4PP1D 2CO4A 1MRDL 5K39B 1EAPA 1VEMA 2AQ1A 5FUCE 3GBML 1PU0A 5JW5B 1J18A 3UH8A 5E4AA 5C0CE 5KSUB 3EJUA 3SKUD 1KJMA 3T0EA 4HT1H 3CVCA 2K8QA 5K9KA 1T04A 5DD6A 3MUY1 3PP4H 4EUPB 1KLUB 5E5LA 1TJIH 1L5GA 1NWPA 3BPNB 3IJYA 3OB0K 3SKNB 1Z3GH 1QRND 3FH5A 3RKDC 1FVCA 3MODL 1NGPL 4DVBA 3W37A 2FATH 3QI9A 5C09D 4WV1C 1JGIA 4ADIA 1TTFA 4U6VH 5HVWA 4J3TA 4GKZA 1E6OH 3VDBA 2B39A 2WK2A 3FC8A 2NY1B 1IGIH 3P0YH 2ZTBA 2D7OA 3DX9A 1WWAX 2CHWA 2I5YH 5CP3A 3VXRE 2BP3A 4RMTA 4YS4A 5BS0A 3KPRA 4F7PB 4JPQA 1PTZA 2FHFA 3RVWC 4ZXBB 5GS0H 4WI8A 1MJ7H 3AU1A 1OGPA 2HG5B 1INEH 1OK8A 2JB5H 1QBLH 3K0YA 1KEGL 3QNYA 4WO4A 3T0EB 1Q1JL 2YQ2A 4JN2B 4PJXA 4OJFL 4XNYH 2EDJA 4OLUL 4JQVC 2ICWI 2WVSA 4H8VA 5JHDB 3US0A 2JTYA 1MELA 2NRDA 1EAJA 3S5YA 2G60H 3GSXB 5IHUH 3ULVF 1U4EA 4Y2DB 3CFKA 2YZ1A 4KU1A 2JJVA 2AAAA 4HIQA 1CI3M 1SXCA 3BWZA 3MLZL 4P2RB 4XNUH 2JCCA 4PRNB 3MLUH 4FNPA 4KZEH 3OKDA 1I1FB 1WZMA 3ZE2E 3FB6B 1SN0A 5JQ6L 3L3HA 4N0FB 1TMCB 1I9EA 2E6JA 2GIMA 4NYLA 4HT1L 5L0QC 1C5CL 1MHCA 2VH5L 3FUKA 1IGYB 1KACB 3GPEA 4OCWH 3RGVA 1BV8A 5DWUH 2Z7WA 1OSZA 5I28A 1FZOA 5LNEA 4ZFGH 2UWEB 5I30L 4LAQL 4WUUA 1ZOXA 4LU5L 4MMZB 4JPVH 1FNEA 4U6TA 5INDB 4MD0B 3K2UH 5JXAH 3HE6A 1EMTH 4N86A 1ZT7A 1Q38A 3FYEB 1RURL 1KELL 3UMTA 4AW4A 4ES9A 3BIBX 1FVDA 3TEWA 3V0EA 2XBTA 4FQJL 1AXSA 5CMAB 3N2JA 3IFOA 2ILLA 4O2EB 4XNQA 3OKMA 4NKOB 3DO7B 2E7CA 3WXWH 1UZ6F 2WZAA 2IQAB 2YAOA 1JVOA 2GJ6A 3PJLA 1FBIL 2RALA 1DJZA 1VFBA 1ZT4B 3HZVA 5LG1A 2YPVA 3ARGC 4PJDE 1SJHA 3C8DA 3H3BC 1HOCA 4JFXA 5DTFB 2VQTA 4LO9A 4GRMA 2P5EB 5AW1B 3A6BH 5HI3D 4Z18A 4JRWA 5K9QG 4P04A 4Y16C 5AVVB 1R75A 3CDZA 2X4TB 4DP2X 5INCB 3G5WA 4JO2L 3IMRA 5E7BA 4EF3A 1RZJL 2WZ0A 4M1CC 4EN3A 2IAAC 4JHWL 3FCGA 4NSKB 4ZUUA 4QOKA 1XCTA 5SWZB 3J2PA 1IBYA 1WT5C 1X3DA 4U1HB 2JLPA 1OAZH 3QUZD 3C08L 2EUWA 3DHPA 3R1GH 2V5YA 1S6NA 1DQKA 2FVNA 3HC3H 3LRKA 4OVVA 5D2NA 2B2XL 4FQXC 3WIHH 4N6QA 1A6TA 3OAZK 4AYGA 5GSVA 2IPTH 5FYKH 2VXTH 1BD2B 5JORA 1ZS2A 2CLRA 1PD1A 4HLEA 4ODSH 5LNGA 2QPSA 3UAAA 5ID0A 4R0LB 3UDWC 2VN5A 5A7BA 4ODBD 5I1HH 4BA0A 1T2XA 4FXGB 2A9NL 2QEJA 4FFZL 4IIZA 1JGLH 3RVTC 3NPZB 2D4DA 1F45A 4L8DA 2X89A 4IEFB 2XFXB 3AJ7A 4JJ5A 1CIUA 4LCCA 1IGFH 1NCCL 1U2CA 2BP8A 4LVOB 4AIOA 4Z3GA 2FJHA 1AHMA 5J8OA 3VRIA 3E6FA 4JW3A 2J8OA 4K5NA 4I9WE 5KVEH 3B6SB 1DQDH 4IRSB 3HG1E 5C97A 3WEAA 2J8UA 3SDXE 1KIPB 3QUZC 3OZLA 4YDKH 1DN2A 4X7SH 2FEEL 3KWUA 4NRYB 5DMKB 2UZYA 4LMQI 3QA3B 3VGGA 4O2CA 3MCLH 1GKEA 2A9CA 5D93B 2CRYA 2DLIA 2OI9C 1ACXA 1MCPL 1A21A 2XZAL 3HNTH 5DI8B 3BP6B 3NPSC 2XWDA 3TNNA 3DMMB 4Y4KA 1EZVX 4BFIB 4GW1B 2P5ED 1NC4A 3FO0L 5HDQL 2YD7A 5FO7A 5HHXH 3CTTA 5T5NG 4E9XA 4HULB 5C86A 4BHUI 4NKDA 2VR4A 5BVPH 4I2XE 5I0ZA 2Y7SA 5I1JL 1U8OB 4K9EC 1I8MB 3QIBC 3EO9H 4FQ2L 2X3BA 2OR7A 3AZUA 3BKJH 4GSDH 1IT9H 4QRBA 5BV7H 3DV6A 1EJOH 2R4RL 1JHKL 1VA9A 3HZMB 4MS8D 5D1XC 4ZX3A 3BJ91 4AY0A 2P80A 3D07A 4BFNA 1U8LB 1D5BB 5CFAA 5CR8A 2J43A 3JYBA 2VLJD 1DVFD 5F71A 1M7XA 1MFCL 2WHVA 2PPEA 4WJKB 3VO0A 4DP8X 4F8QA 2GC7C 4YUEH 5KJ4A 2YAHA 1LNUA 1DN0B 1SYSB 2ED8A 4QYOA 3WS3A 4PP2A 3NN8A 3UTSB 3QQ4B 3FU0A 4N1EA 1YO4A 1HK6A 3BYYA 4W4NA 5MEOB 3WFEL 4LSUH 1Z32X 2R2CA 4X4YB 4U31A 2Z8VC 5F6IB 2VN7A 4LEOA 2YXFA 3D2UD 5JPNC 1KCVL 2ROYA 3HR6A 3V5DA 2J1KA 2JIXB 2I85A 2VUOA 1HHKB 1MW0A 2YD4A 5EO0A 4HLJA 4KVNH 5E0QA 5F7BA 5HHNB 2F7OA 1G7HA 4AYFA 1YQVL 4WEEA 1BQHB 2JH2A 5GGTL 3PWVA 4OGAD 3SYCA 3C5ZC 4NIYE 3HE7C 4NUQA 4GIOA 1MHEB 4DO4A 4ZTPL 5E8EA 3BDYH 1S7WB 2OZNA 1JTOA 4KVPA 1OPOA 3EYSL 1ZHLA 3QFDB 1OO2A 4PRPE 1PF3A 1MSPA 3GXTA 3KH4A 3VW3L 4PJHE 4NFBA 1DJXA 4OFVA 4BXVA 3U7AA 5CBAA 2E46A 1L6ZA 4MASA 1X9UA 2F58H 4L8BB 2WYIA 5G2NA 3WSQH 1UM5L 3DMMD 1KCWA 3S8GB 1UH4A 2XN9A 4K3JH 4WFEE 5SX4I 1KCSL 2LABA 4H8WL 5AW5B 3ZRFC 5IHUL 1QQDB 5DURD 3G5XB 1REIA 2Q3XA 3FU5A 5CGTA 1MNNA 3D0LB 1BXXA 4OM0L 1AACA 1ONQB 5KW9H 1AE6H 4LMQE 3GUFA 5CKAA 1XV8A 1D9KD 1AZVA 4M1GL 1QNZL 3NEEA 2NXYC 4JRYA 3SY0A 4JO8A 4LLWA 3GJFK 5GGTA 3RFZA 1YUKB 1JNLH 3EBAA 3VFTA 3H42H 3DPBB 2WTPA 5D6DA 4PLKD 1W2KT 1CDGA 1CXHA 1WZ1L 2V6HA 4OJEH 2W07B 4IRJD 2VABB 4Z3EA 3DUSA 4XMUA 3WKMH 3UTSE 4UIMA 2ADIB 1JK9B 4DO5A 3KBFA 4ZMVA 1E6JL 4ODWB 4M6NL 4MD0A 3T3ME 1JPSL 3K5RA 3V55A 4MXVE 3I50H 3LIZH 2FSEA 2IPTL 1N0LB 3IDXL 3OKOA 3SE8L 3APFA 3F7PC 1IIIA 3ZT6A 3VGFA 5C7XL 2PWHA 5HGBA 1DVFA 1U3JA 1H6TA 4XVJH 4MZIA 2DF3A 2XKSA 2AK1H 3O41B 3HPJA 2HYMA 1I1FA 1NANH 3S36L 2A5UA 3FZUD 4ZZFA 5IMMB 4DP4X 1ZCRA 5IWLA 2EYSA 3R8QA 1YSOA 3BX7C 1Q1JH 1NMBH 2BHZA 3ZK0A 4XAKE 1XCWA 3B7YA 4ONGL 1MI5B 4YIQB 1AR1D 3WTTA 1YMMA 4G6KH 4PRPB 3ZTJG 2CO3A 4D0BA 3QWRD 3K2UL 4R90H 4G5ZH 1RZKH 2AEPL 3VFWA 4XRCA 4E41A 3M45A 4X6DE 2HMIC 4JBSA 4ZFGL 2CD0A 5I30H 4L48A 2X42A 3BKYL 4KRNA 4M1GH 4LZKA 4M6OH 4PJBF 5T3ZD 3MX0B 2XZAH 2PPDA 3HNTL 3M17A 4RISH 4EDXA 1BYOA 1JGVL 5E4OA 4DUWA 4PJFF 3OKDB 3SOBH 5JQ6H 2XWTB 3NZUA 4AYDC 3N91A 1FNFA 1JF1B 2GQHA 2ZJSL 3T65A 3RB7A 4PS4H 1SLVA 3UIZA 1XSOA 3QPQD 2AQPA 1IKNA 2Z31B 2OFQA 2WO2B 4QY8B 5EWIH 4WTZG 4JPVL 2CLRB 3G5ZB 3SPGA 4KMTH 1LO3L 3EW3B 3U1PA 2WUCH 4FQHB 3IKCA 5E6IA 2FEDC 3BKML 5H2BB 4L5FE 4GRLB 4MFHA 1OF2B 5J1AA 4M7ZC 4KDVA 1HILA 4JZJC 1N59B 2ZOUA 5KYXB 5D7LD 1NBVH 3SDCC 3VJ6B 3WFCH 4U1HA 2KZ1B 3AWFA 5H94B 1TMQA 2V7NB 3G6DH 1UD5A 4Z3HA 5HVHB 3ELQA 4J8RA 2XBDA 4K3DH 4JE0A 3L48A 4A38A 1GZHA 2OXHB 5HDBB 1U8KA 4G8GD 3P0VH 1GZQA 2IQ9H 4Z95L 4MMZA 3WHE1 4ZQKA 3ESNA 4UQ2B 5ES4B 5JW3H 5ELIA 5K9KB 1ZXQA 1DQMH 2A9BA 3DMMA 4S1QH 2DPKA 4P2CG 3MYJB 4Y4KB 5IB3B 4QHLB 3RL1B 4F8PA 3HC0B 3LN4B 1Y18A 3KLQA 4G1EB 4KO6A 4RQQA 3TF7C 1JD9A 5ILTL 2P48B 3KBEA 3LOWA 4Z0XA 1J10A 3B2VL 5LXVA 5LGJA 1HDMB 3W56A 3QC6X 4HWZA 5DJYB 1DDTA 4QIRA 2AJZB 3B6SA 3QRGL 4BH7A 3OAYH 4XBMA 1D2PA 4F7MB 3DTXA 5ALBH 2NR6C 3VXSB 1F4YH 4ABWA 1FAIH 3HB3B 3PP4L 3UYOD 4OI7A 2HTLD 4YMPA 5TE6H 5I16B 1H8OA 4KV5F 3TBTA 1LYQA 5GSRA 1IGML 2FT8A 5DJ2B 4FXGA 4S0TD 3DXAB 4YFDB 4XP6H 2QQKH 2X1PA 5EOTB 2QPDB 3HG1A 4PW9A 3TFKC 4FYQA 1CFBA 3M7FB 2E4FA 3IAQA 1ZHNB 2MRYA 3CU7A 3SBRA 4KK5C 4JPWL 1G1CA 2VXUL 3MV01 3MROA 1T5XB 5D2NB 3M07A 4YPGA 4NQXA 2ZIDA 2XIBA 3QWOA 4YDKL 5C07E 1SLUA 3EH3B 1BD2A 3MXWL 4P4RA 1OWWA 2PABA 5IJBC 5KZCD 1O9VA 5IVZA 2WPGA 4FI8A 4RLDA 4Z7VF 4KXCA 2XI9A 2VDPH 2A2QT 3O4LB 2NR6D 1MRFH 5F96H 3BUBA 4M8VA 3NZ8A 3SBQA 1MFAL 2WAHA 1S7VA 1CFMA 2WOBA 2OMWB 3ECBB 4FTVE 4X5QA 1K2DB 2XWBB 4S1SH 3X3FL 1UACL 4PGCA 4HJ0C 3KYMA 4XP1L 1H3VA 3U0TB 2Y22A 2LLLA 1KG0B 2FHBA 3VI3B 4B9KC 4KXZI 5A3ID 4K71C 3HRZC 2VRKA 4FQPA 4GQ9L 5FYLD 32C2B 3KXFB 4AKPA 4PWEA 3MHZA 5A2BA 4A39A 6PAZA 4L4JA 1CE6A 3QBTB 1RPKA 2CDEB 1G1KA 5ECGA 4GQQA 4W9DC 4BQ6A 2R8SH 3OKKB 4QF1B 2UZPA 4OQTH 2OJ1A 4X50A 1SJHB 1IEHA 1TU2A 1JPGA 3BW9A 1OAUH 4F9PC 2WD0A 3L6FA 1GYCA 4F7EB 1HHIA 2P7TA 3O6KL 2GTWA 1RCYA 2ESVA 3W0WD 3QUKA 4L0YA 4OZFA 4FMFA 1XR8A 1D6EB 1J88A 4CGUB 1AQKL 2FATL 4WU7B 5T3XD 3UYRH 2ED6A 1HTYA 1S8DA 1J48A 2F7PA 3NJMA 4FNTA 3WTYA 3IMSA 2IOIA 2CHXA 1OK0A 5JTWA 4GJTB 2VJ0A 3OKLA 1I3RB 4BK5A 1TEFA 2Q76B 4URTB 2AQTA 1V3LA 3QEUA 1SNRA 4RRPA 4ZMTA 3W0WB 4P5TA 3II2A 1AXIB 4PW3A 5C8JA 3DYMA 3OC8A 1XAUA 5GGRA 4UIMB 1MRFL 5F96L 4ZD3L 5EU6A 4HJGB 1W6WA 2I60L 3TBYA 5IEHA 5IV2B 1SXNA 5DUBA 1T5WB 3GMPB 2DQDH 4JVWA 3FJTA 3UG3A 4NO3B 2OMTB 4W9IC 5T1LD 4UDUB 4U0RC 1FE8H 3MOAL 1MI5E 2ZKHL 3LKRB 4OCXH 4QLRA 1ZHBB 1U4FA 1WCBB 1TKWA 2XN9E 4W9EC 3E8VA 3WXVL 2E9JA 2GCYB 2JMRA 1NAKL 5ITFA 4GEIA 2X3AA 3PWUB 4L9LA 3VG9B 4NQDB 2PKDA 5SWSB 1OE3A 5GGSY 1BZEA 5CIPA 1I75A 2WY3B 4NQTA 2XY1A 3U36B 4ANWA 1UVQA 4EOWH 5C09E 2J8UF 4PCTA 4FTVB 4AKOA 2P3YA 2NY6C 1Z3GL 1KTDB 1A66A 2CA4A 4F7KA 4UTBA 4G6FD 1PJWA 1DBMH 5DHMC 2JKRM 4NN7B 1UCBH 1TO4A 5EORH 2FL5A 1RJYA 4FABH 2JK5B 2LU3A 4KFZC 1AQKH 5EZIL 3IS0X 3CSBA 2X09A 3NZSA 4L4TD 4QD2E 3HW7A 3QDGA 4Z76A 1MCQA 5DVNA 3ILQC 3V7AG 1RZFH 3VGAB 3ZE1B 4I1PA 4ZUWA 4QJ3B 4ZS7H 3UCQA 3BLBA 5HI5C 1NM4A 1CT8A 1Y7VA 3HVDA 4CN4A 1QUPA 4G1MA 4YIQA 2CKBB 3RA7L 4RX4D 5CZRA 4MVBD 1TVHB 4X7TA 1PS3A 1UA6H 3RAJL 5JHMA 1XGPB 3VA6A 2F53E 3U7YL 3HRPA 3V6OA 3ZTNL 4L18A 4IGBC 4Y4FD 3RDTD 1A8ZA 1FVEB 3LZQA 4H1LG 1BQHG 4XPTL 4ICWA 3ULUC 4AGNA 1HJCA 1TQBB 1EEYB 4DH2A 1UJ3A 4H88H 3DXAA 3I3EA 4YZWA 1OCRB 2XKNA 5J6HB 4X6DB 1GOFA 3LCYA 3TFKD 5TDPA 4Z7UB 3OMNB 1HC1A 4IIQB 4X5RA 4D8PA 3LHPH 2H2SD 4I87A 1MVUA 5IQ7L 1GMEA 1W8EA 3RTQD 3OSVA 3EYFB 3MMEB 2D7TL 4CBPA 5GJTL 2JQAA 4LASH 4MYPA 1JF5A 4Y4FB 4HWUA 2BSRB 2FRGP 1EEUA 4OJCA 3IKCB 1YDPB 5C0FA 3CFEB 5IB4B 4J4PA 1C8QA 2IH1A 1N0XH 5GHWL 4ES8A 5E08L 3HC0A 4RQQB 3K7UA 4P9HH 3DGCR 4ZZKA 3UPAA 1KOAA 3CXFA 4OI9A 1IVLA 3FH7A 3P9WB 5C6PB 2J6EA 3NFSH 1UXMA 3MNVB 1PCXA 4L8BA 3VD3A 2B2XH 2FUTA 4B9ZA 2F5BL 3FUJA 3VXRD 4MNGB 1J5OL 1ZRUA 2YA0A 4A04A 1KMGA 3L7FB 2AV7A 2YXVA 4MA7H 4FDWA 3NACL 2XN9D 4XRCB 5E6IB 3V5HB 3FQXB 4JHWH 1OE2A 4U4IA 4XNZC 4QRRE 4ABVA 1DZ0A 4YXKH 1OM3L 3R4RA 3T2PA 3NH7L 2ZXGA 4PP1C 3GSQA 1KJ2B 4U1KA 2GFBA 1JHTB 3S36X 1UD4A 4LQFH 5H35B 5D2LF 1MCSA 5AD0B 5CLXA 1LD9A 1KGYE 2V3DA 2B0SL 5IHLB 2F9BT 4AQZA 2R2EA 2RFXA 3X1GA 4NQDD 4BFEA 3U2SB 4HAKA 4D94A 3B7UX 1CLZH 1O5DT 4I77H 1PX4A 1PQZA 1CDJA 3BP7B 3INUH 1MREH 1MFUA 3IJ8A 3LZFH 4UQEA 4Y5VC 3RZCD 2NMSA 3QQDA 1YEGL 5IF0A 4AGOA 4JFDA 5F7FA 2KZKA 1E40A 3DX1A 3MRIA 4LEXH 1QLEH 1ZVYA 2QVFB 4OQ1A 4EZJA 5DJ0B 2DL2A 3GBDA 5DJCB 1J9QA 1QFUH 1RIVL 4PU2A 1N6VA 3IEAA 5GS1A 1DSWA 2IADB 3B37A 4Q4IA 5EF2A 2VLRD 3F01A 2ZG1A 1RHHB 1X5AA 2UYLB 1S7XB 2UZXA 3CVIL 4I0PA 4QMEA 2WM0A 5EOQH 2PPAA 4ESKA 4DPBX 3GJFB 3LKPA 3QARA 1E4KA 5HHME 4ZFOL 5EU3B 1XF3A 3O2DL 5GIRA 1T3FB 5B3JE 2W1NA 3RWHB 2XWCA 5I1CL 4JB9L 3EJRA 3BUDA 3MGTB 4N8VG 4LEBA 2ZUYA 1E4XH 4O2FB 1J11A 3PQYD 4R0LC 3ZTEA 2C34A 3P4OB 1KC5L 2ZYRA 1V7NL 1EK3A 4HEPG 4H13C 8PAZA 1DVZA 1R3HA 3ARDA 4XVJL 4YQXL 2EDBA 4PWJA 3FCTA 4X8GA 4UBDC 2NYZA 4KUCD 5DD5L 5F88B 4FI7A 5C07A 3O8XD 1TXKA 1G9MH 3S5LA 4LLMA 2R0ZH 5A6LA 3WFDL 4PJEE 5EBLA 5EU7E 2IDUA 4EUPG 2QKIC 1KBVA 3LMJH 1YPZA 3SE6A 4IMLA 4Q9RH 1NGWA 3VXPA 1IC5H 4QO1B 1E2VA 5D7JB 1QKZL 2VZOA 1OTSD 5BUPA 1S9WB 4JKNA 1AD9A 1XGYL 1W72L 3GHBL 4FA7B 1YN6B 1CFTA 3KCPA 5AL0A 3G5ZA 4YX2L 3DTDA 3PWPA 4E0RA 3EJCA 5ISZA 4QNPE 1G0YR 3T9WA 4S2SA 5D1ZC 4GAJL 4BZ1H 2GYSA 4RIRB 4R97B 4GIPD 2HT3D 3P2BA 4K8RH 3WTWA 4HHWA 2X12A 3HLAA 1HE8A 4J3OC 4H25B 1GGCH 4XP4L 2DIJA 3P2DA 2BMKB 4WI4A 3ZYZA 3TZVB 5FKAA 2X6AA 4ZQTA 4JDEB 5JOPD 1VFAB 3NFNA 5K1VA 1LO0L 4QOKE 2K4WA 2ZWSA 1M71B 2F18A 1AQDA 2AP2A 1SYVB 1EJ6A 2BSDA 2HLAB 2RIKA 3DOSA 3LZLA 4WWOA 5DD3L 1E8ZA 1LO3H 4Y5XC 1JV5A 1NAML 4UYQA 3QJFB 4WDIA 2VAJA 2X6UA 4HF5L 2EVIA 1HHGA 3EGDB 3ARXA 5EUKA 1C08B 1FE8L 4XWGH 3U30C 5ETUB 1LJMA 1XCTB 1PPIA 4JN1H 3JTTA 4UT7H 2JKWA 4CL7A 4NQDA 3EIFA 5L4FA 1W72A 1R3KB 1U30A 1XB6A 1ZT4A 4MCNA 4J1UB 4O5LH 5IVXE 2ID5A 1ERNA 2LU5A 5IQ9A 2O4EA 5E2VH 3O8XB 2VR7A 4F92B 4KXBA 1LLAA 3WIHA 3ZTNH 4GXUM 4IGBB 1T04B 3CG8A 4EUPA 5DRXA 1G7IB 4OIIH 2BRRH 2EVFA 5IEHB 2OJEB 1JPSH 1L9NA 3UO8B 3O81A 2J8UE 4N90D 4KKQA 2IH1B 3QJVB 3HC2A 3CBKB 1AS7A 2A0LD 3NA4A 5F0JB 1EANA 1ZT1A 4AG4L 3RNKA 2MHAB 1WZLA 3FUHA 3ARRA 5HGAB 1I3RA 3FOLB 3L4WA 4OFYD 4PJGB 5C6TH 5H37H 2HH0H 3O6LL 3DX8A 3QDMB 4QXVA 2BOLA 3L3IB 1BVLA 1N6QL 1H5BC 1A9BA 3D3VA 5B8CA 4KVNL 3UZEC 3V5KA 4ZFOA 1ZS8A 5F7EL 4NN7C 3DVGA 3J07A 1M1XB 1AY1L 4WV1B 4YNYB 3LEXA 3AS0A 4FFWC 1YVLA 3O3AA 2ZYIA 4I8DA 5E99H 1XGPA 3T09A 1N12A 5F0LB 2H32H 3ASWA 5TDNA 1BG1A 4MS8C 5D1XD 2J8HA 1E8XA 4EQ2A 1B2WH 2C7FA 3KWXA 1EEYA 5DD0H 2H0FA 3EBHA 5FO9B 4X5XA 3EGSB 4MNGE 4PJIB 1FCGA 1T83A 1RLBA 1WIOA 2R69A 3QDMD 4I3RL 3DJTA 5CZVH 4YO0A 3RVXC 1MAJA 2F53B 2XICA 1IGCL 4JGMA 4PB0L 2FK9A 3GPSA 5DJ8B 3R1GL 3ZQXA 4LARL 3E6FB 3O4LD 3I2CH 3WIFA 2XN1A 2BWIA 4BZ2L 5CHNA 5CD5D 2R0WH 3KPPB 4HIIA 4HWBA 3VFNB 3PYCA 4JANB 1S3KH 4XMZA 3VTTA 1W0VB 4C83B 2OZ4H 1ZLSH 2NW3B 3NIFF 4TOYL 1X5LA 4WLCA 4KI5F 1GZPA 2X4TA 3KJ4C 1A6VL 4YC2C 3MV7D 4N2CA 5C0AE 1AR1B 5I23A 4L8DB 3RHWF 2J56A 4BBWA 2ENYA 2Y36L 2BY0A 3B9AA 3CFCH 1VADB 3P69A 5FYLH 1JGDB 1Z9SB 2XRAL 4JFZL 3BAEL 2K9FB 2OSXA 2WP3O 3V4LA 4Q6IA 1Q72H 3X3GH 2IDQA 2W65A 4E5XB 5D8JH 4HWEH 3VI4A 5C0JA 2Y25A 1KTRL 5F3BA 4FZEL 2O61A 1EJ8A 3TO2B 2D3LA 2CO6A 2X4PA 5DUPL 3N9GH 4X7EC 4JFOA 3CLFH 1CR9L 4LGPB 4RGNB 5D7JA 3QDAA 5E2WH 4F9LA 5EU5A 3TT3H 2COQA 2AQNA 1YEKL 3LVTA 4LCYA 4MJIB 5LXGH 3SYQA 4BQ8A 4XT1C 1EFXB 1V05A 1V27A 2DLHA 3OC5A 3QIUC 5CUSH 2NQDA 2OLDA 5F44A 3ULUF 3MRRA 4HAFA 1R3IH 2X4OA 3EYQC 3VG0H 4Z7IA 2EYRB 4NXKA 3QRBA 2QKIA 1SQMA 4I18A 3FTZA 3F83A 1QATA 3H2PA 3S36H 4MMXA 2YK1H 3MRBA 3ZDZF 4PD4K 2FNWA 2NY5C 1I1AC 2HMID 2VLKD 1J05B 3HLKA 3P0VL 3NCWA 4Z95H 5EUOA 2MSPA 4WW2B 5FA3A 5BUAA 3UTZB 1KDIA 3NSCA 2E7HA 2OMUB 5F1NA 3D51A 4LF3A 3WIHL 1PG7H 4PBVC 1EWHA 4BFFA 3KPMB 3PHQB 3KPOB 3PAZA 4IK7A 4NNPL 4P46C 3OB8A 2IXQB 4WNSA 2KLSA 1FNEB 5A3IC 2KZBA 4NNXA 5AFAA 1N2RA 3C6SA 5FYJE 1OAXL 3NJHA 3IPBA 1OXYA 4OGZA 5F3FA 4HS6A 3VRIB 4ZMPA 4HF5H 4KO9A 3MRFB 4RGMB 3KLKA 4CSTA 3GK8L 2VN4A 3P9LB 2CJUL 2H2PC 2A3TA 1D3CA 4O4YH 2FGWH 3GLZA 3ZDWA 2BNRD 1CU4H 3AXIA 4L4TA 4DQAA 3QNFA 5I8EA 5L9DL 4OV5A 4QXWA 3E8UL 1MHCB 4A7UA 3KLHC 2V17L 3JVGC 3RUGE 1DQVA 4MJ6A 3S5LG 3Q06A 2E8YA 3TGXA 4LCVA 2HVKB 2ATAA 3IDMB 1NCHA 4KDWA 5H37A 2WWNA 1J9SA 1VPOH 3QUKB 3S2CA 2O5ZL 3H4HA 2RA1A 1FG9C 3Q7JA 1MXGA 3MBEA 4MJ5A 1SJMA 3ARZA 5HVGB 5C08D 5TE4L 1I9RH 2LE9A 3WD5L 1ITCA 2FR4B 4EXPX 2BHUA 3FU7A 4F1ZA 2KT6A 4XBGB 1GIGH 2CGRL 5ENWB 4NC1E 5CD3A 5BXFA 2N4IA 4XR8C 5HD8D 4J1UA 4OQTA 4UILH 4XMTA 5BOPA 2VOTA 1RQ5A 1AGFA 1MEXH 2APBA 3QNZB 1NKRA 3BKJL 3C2AL 3GMQA 2C9UA 1T7WA 2EH8L 3P54A 5FUCC 4XNDA 5BV7L 1U8CA 3HI1A 4R26H 3O6MH 2ICES 4G8GA 3IJYB 3SKNA 1DEDA 4LLUA 3I02A 5IFJB 1K3IA 2C9AA 3C09C 4PHZA 5HY9A 4YSEA 4IMKA 1FO0A 1E9OB 3LIZA 5FM4A 1SGKA 3T0EE 1SDDB 2Z7UA 1DVUA 3ZQ9A 5IB5A 4QKXB 3PWUA 2QGDA 3WIFB 4Z7AA 3MJ9A 1WAAF 4APQB 5KG9A 3EOBB 4K94L 4YDZA 3H7LA 4WUKH 4G8EB 2YMOA 4RMUA 1LVEA 3LEXB 1MCRA 1S5IH 2LAGB 2GITB 1MRDH 3GZKA 2GI7A 4OZHF 5CR1A 2BNRB 4WUUB 5EFIA 1T1YA 3GJFH 2XQYG 3K46A 3TJHD 2Z8SA 1JPFA 1Q9OA 5J6SA 2FBJH 3OGCB 4QHKJ 2DEYX 4FYSA 3T6XA 1MCHA 4A6YH 3JWOC 3EFOA 1P4BL 1NIBA 4DP1X 1WAAE 3E0GA 2WCGA 2BP0B 1UJ3B 3VD2A 1MZZA 1ZT1B 2IBZX 4U1SB 4IKNA 5E8OB 2BHFA 4HK0A 5C0RL 3K4AA 1U8JB 1YY9D 4PV8A 4FQ1H 1F86A 1FLTX 2XYBA 4POZD 4X5LA 3CLWA 4Y19A 1PD6A 4LCIL 4OT1H 1NGWB 4X99B 4ZFZB 2HKFL 4OAWB 1BYNA 2NUTB 1R5VB 4IMKC 1A5FH 3RG1C 5DHYB 4U1NA 3JUYA 3GM0A 4PGEA 4KC3B 4WK4B 5EEUA 3FONB 3QEGH 3PL6A 4IGBA 5E2TL 4WSKA 1EH9A 1H3WM 5JDSB 1U95A 1KWGA 2DD8L 2OSWA 5DGQA 1BQLL 1NJ9A 5BRQA 1OF2A 1VSCA 4YPJA 1DBJH 4OLUH 1X5IA 4BSVA 2W91A 5F97E 4NEHB 1RZJH 1JGDA 1Z9SA 1DJGA 3EH1A 4PJDF 5D1QB 1KEML 1VEPA 2DYSB 2FX8H 3DX8B 4KHTH 4MB3A 5FW7A 3TA3A 2FDBP 1BFTA 5BZZA 2LU7A 5T3XL 1U8IA 3PFQA 4GMTH 4QXTA 5K59E 4I2XA 1BQSA 1XH2A 4TSBH 1A3ZA 2ITCA 3V6ZA 4XC1H 3BRFA 2Z8RA 1FYTE 1QFOA 3DI2B 1W16A 2ZWNA 2EINB 3HE7B 5I1KH 1G84A 4LHUG 2H3XC 3QRLA 5C0DA 4ZUVB 5B3SB 4LSQL 2OTWB 3C5JB 1GW6A 1EMTL 4PBXA 4XCFL 5I76B 3WTXA 3G08B 1OCWL 2B15A 4N22A 2COVD 3C08H 3MLWH 5CN1A 1T4KA 3VFGH 3A47A 2D3VA 3MROB 2NXYB 1NEZG 4R2GD 4L4TB 3DVGB 1UURA 4JANA 1T0NA 2VJ8A 3FCSB 4NPJA 3SKOA 4ZQKB 3DXAE 1Z5LA 2N7BA 2ZOKB 3QFJA 2CR6A 5TDNB 4ODSL 4JG0H 4XTRC 4Y8AA 3U79A 3WDIA 1VKXA 1QZ1A 2FIKA 4I4WA 4MJHA 3RVVC 2GJJA 2V17H 2CPUA 3T77A 3ZKND 2ZX9A 3QDJA 1RVFH 4GG6E 1NDGB 3BDBA 4G9FB 1ZDQA 3K1DA 3QO0A 4ZSOE 3WKYA 5EO1A 5JW4Q 1LEKA 5J6GB 3GBNH 2F19H 3JV6B 3R18A 3V52H 3G6DL 3FB8A 4FX5A 5ERWB 2XQYK 4M61A 4Z5RA 3VYPA 4M1CD 5KVGH 3ARTA 1C7TA 2GSGB 4PJ6A 4M8QB 1BF2A 1QKZH 2R1YB 4LHQB 1EAOA 3MRNB 4FFYA 1INDH 2JIXD 3QIUA 2NY7H 3SQOL 4FNLL 3NK3A 1QRNE 1AKJA 5AW8B 2CO2A 5AB1A 2AV1B 5K1JA 4MB4A 4BUGA 2OI9B 43CAB 1EHXA 5EBWA 3JWNH 2P47B 3QJUB 4JFFB 5E5UB 4LLUB 3MRRB 4OCLC 3CX2A 2G2PA 5JUEH 3KCWA 3RURA 1OGTB 3IDJB 5F8RC 2H1PH 3C5XA 2QVMA 1N8ZA 1PIFA 2VMDA 1JGVH 4FGMA 4J8RB 1DFBL 2QVIA 2WO4A 5CCHE 4XPHH 3ZR5A 4KI1A 1QNIA 4JRYE 5LKNA 3NEXA 2MCAA 1NFIA 4WKXA 4DGYL 1FLRH 1PY0A 1PG7X 2DICA 1XT5A 4MDIB 3EO0B 5CJQH 4JFHD 3UMNA 4Q6YA 3V4VL 3BFWA 4BQCA 1CE1L 5KYYB 3Q13A 3SGEI 2Q3AA 3L3JB 3LN9A 5GGUA 4UQ9A 1KY7A 4MCMA 4ZG1A 1OT2A 3KPLA 4PRHA 3U4EA 2O1AA 1WGVA 3H9HB 1UFGA 3HG1B 1NA8A 1QBMH 3GMRB 4N2LA 3VWJB 3K71B 4ZX4A 3HZKB 4HJTA 1QWHA 4XXWC 4DERA 5FCUL 4DCQA 2WCSA 3JBG7 3U4AA 4U6XB 5IHZB 3D08A 4KKRA 2BVPB 3RGVD 1NFIB 1UT2A 5L9DH 4PJBE 4JFDE 1HQ4A 2B3IA 3MV8B 4UV7L 4OFYA 2YPLD 2F0CA 1RKRA 2CJUH 4GW5B 4TL5A 3NPSB 3B5TA 4FHBD 3ZE2B 1CFQA 1MJJB 1IL1B 3VB8A 2CBPA 1E9QA 4FN0A 4GRWF 1NFKA 5HPMA 1U6AL 3QORA 5A43C 1H5BA 1EDQA 4OBRA 3UJTL 4IBSA 4DZBB 4TPRL 1WIPA 4G6AD 3PHOA 2F53A 4JFYB 5D1QA 2WXIA 3BEVA 2XTSA 3UPCA 1A7PL 4R7LA 3KYNA 4RNRA 2OR8A 3TPKA 1AO7E 2VQ1B 2SEBB 5IQ9B 1HXKA 5AOMA 8FABA 3A24A 1LO0H 2BZCA 2OXHA 3GXUB 4JPKL 2I9TB 4BFBD 1JK8B 4RCAA 2P8LA 3RE0A 2IG2L 4KOBA 4MMZC 2UY6B 2VYRE 2XZQH 5KSAD 3E80A 4NCC1 5HDBE 1FFNA 4APXB 2VZTA 3PP3H 4PJDB 3SOTA 5AW6B 4GUQA 2MWCA 3LEVL 4MHHG 4LCWA 1ZVSB 3U2JA 4Y9GA 1U8HB 3JV4B 4FEIA 5AAMA 2HN7B 5D4IA 5JIQA 4RNRB 3OTTA 4ZUTA 5IREA 5I1EH 3C2AH 4NHCL 5E1HB 4EE2A 4G7YL 4KUZL 1AG0A 3NGBB 3CVDA 4OLWL 1EUTA 1W15A 4AEIL 1BZQK 4WIQA 2D03L 4JFQB 2GSIB 2HT2C 5CJBA 4KUCF 5CP7A 5AAPA 1M7DB 1HYRC 4NKIL 1F2XK 4TYUA 3RY5A 3MV8D 3L4CA 4L8SC 4V2CB 5CINH 5GRUL 2N0KA 1NPJA 5FYLL 5K9OB 4XVSH 2EEXA 1J5CA 4RGND 5K69A 1CVSC 4HPYH 1KCVH 2YJLA 5DK3A 4ZO8A 4F7TA 3FTUA 3VGAC 4GLRI 3JV6A 3ZO0A 4CRPA 3IWUA 2X7LA 3QG7L 4PJFB 3TEXA 2CXGA 2WWKT 4IIQA 3S96B 4TUOA 5IROA 1ACYH 3MBWA 2D2CC 4UU9A 2VW7A 5IGXL 4JM2A 4OD2B 1ADQA 2AZAA 1CS6A 4PLJD 4XNBA 1GC1H 1NUNB 3GBMH 5D1ZA 1X5MA 2WQAA 5I6NA 2AEQH 4NUJA 3I84A 1ZK5A 2XXGA 3ML8A 4OVUA 4YWGL 3RVXD 5ABZA 5J9PA 3SDYL 2DY2A 1K6QL 1PDKB 4NP4L 1T80A 5GZOC 3IM1A 5GS3A 1F1GA 3TNMA 4AGQA 4G7RB 4JLRB 4LNRA 5IW6B 1HHJB 5BQ7A 4L1TA 4BSVB 4N25A 1GTNA 4GKNA 5L0QB 2X2YA 4NO2B 1I7TA 3CXHK 2V9UA 4FFWD 2Y3AA 1HNGA 1TZGL 5T5FL 5JIDA 2YSTA 4DGIH 1DEEA 1YRKA 1F1AA 4HPOH 1MJ7L 2NYYD 3GSRA 3VFMB 4OGQC 1K8IA 2HA1A 3GBLA 4U3CA 5D9SB 1YEWA 2NUTA 2WQRA 3ARDC 1YEEL 3C09B 1YYCA 2DBLH 1BBJB 3GLDA 5D5MA 2VLJA 2YSSA 1KJ3H 5E94A 5LQBH 5CILH 5LJYH 5INDA 4TNGA 2QBWA 3H6AA 2XT1B 5JZ7C 2OZ4L 4R9HA 3SHSA 1IGJA 3J8F7 5JW4R 4JHVA 4ONHB 3EFOB 1SBBA 4GRLD 5FFLA 1JWUA 2AJYL 1RZGA 2YRLA 2G5RA 3O3EB 2ATKB 5DHXB 4AYEC 4TSCL 1OGAD 2DQCH 1A9VA 3ZYIA 3W3BA 5B39B 3P73B 2PYEB 2PWFA 2RJMA 4Z7UA 5IMOA 5G4MA 4ZI8A 4X6CE 2Z1KA 5ITBH 3A22A 4WK0B 3QORD 5HGGS 4YWGH 2VDRL 2ZUUA 4BELD 5M95B 3K6SB 2D7TH 3FSZA 3O45A 3HG4A 4H2AA 4PREA 1BA9A 5FYJU 1R17A 3SKOB 3UBHA 2HPTA 3SE8H 3BAXA 3F85A 5JOEA 1QYGH 1F42A 1X5KA 2B9BA 3KPMA 3PHQA 3QDJB 3EO1A 3TBYB 4V1DE 3UGXA 4DPRA 4DP7X 1Q0XL 3AM8A 4DGIL 2FJGA 4F58L 2E59A 5AYTA 3DARA 1ZLVH 1JZGA 5EO1B 2EC8A 3H9SA 5TFSH 4WWID 1XIWB 3VE0B 4R84A 3VWKA 3TBVA 2Y24A 3QQ3B 4L0PB 5BS0B 1P84J 3NCYS 4LQFL 4RAUA 4NAMA 2B16A 1JRHH 3L17A 4QHNA 2R2EB 2RFXB 1KLGA 2K4AA 3ILPA 4O00A 4XVUD 1VFOA 3PV7A 4IS6B 4J3OD 2J6EL 3D25A 3QYMA 3TXAA 2WXMA 5BZDA 2HT2D 1RERA 5LUMA 2VE6B 3BVDB 3D85B 1X7QB 3P3RA 3PF2A 2EKSB 5HI4C 1GKOA 1A1MA 1U2YA 2C3HA 1HSBB 3STZB 3IDGB 1FL6A 2GG1A 5DVOA 3ATFA 3BCDA 5JUEL 2I24N 1G7JB 3C5JA 2E8ZA 4PJ5A 1GMIA 2O72A 1C5DA 3OVUB 1RJYB 1EO7A 4RETB 1VERA 5F1IB 4DQOL 3GSQB 3UOAB 5ESQA 3WDJA 5EEYA 4AJYV 3CSYA 1CXKA 1U3YA 1FP5A 2YD9A 3BUTA 2YQBA 3EBIA 1XXDC 4TTDD 1G1OA 1TO5A 3SDAD 3KGUA 4J4PC 2ZAIA 3FHAA 2NY0B 3CXDH 2AV7B 1LDPH 4U1NB 2OW7A 5JNYA 1OSZB 2VMFA 4KHXH 1R3LB 4XAWL 2BY1A 1OAKH 5D96C 4ZDHB 2NX5D 5PAZA 3T3PB 2B8OT 2CDGA 4FXKB 1T21A 2HFTA 4WHTB 2BSTB 1DE4A 2O5XL 4MMYA 4P8QA 3VCLB 5D1XA 5I2IB 4UDUA 1T7ZA 4JKWA 5ICZB 3CFJB 3QIBA 5LGYA 4P5KA 1Y6NR 2JCCB 1I1RA 1IC7L 4JRFA 1IC0A 4LHJB 4LLVA 3VSVA 3I6GB 1FH5H 3DBXA 2F7IA 3SPVB 3FO2A 1LO5A 3CFBA 3HHSA 4JO4H 3DVIA 1BXVA 5FO8B 1AGDB 2ZCZA 1D7FA 2YUVA 2X1QA 5DS8A 3VXTA 4D0CB 3O6FB 1GTFA 2AJSL 3AMKA 1G9HA 1JNHA 1Z9NA 4Y4KC 4PWIA 2F74B 3UTPE 3JTSB 4BWUA 1JE6A 5EU6B 1AO7D 2YPKA 1BX2B 1DLFH 2H0PA 4AIXA 3MRIB 1U0QA 4PJEF 3O2WL 3WEXB 3RHWK 3QUZA 3TEZA 4LLDA 3HHMA 4AE1A 4WU7A 1DQJA 2DQTH 4H0GA 3DX9B 4XOCA 1TOXA 4XVTH 2UY7A 4P2OB 4WKZB 5E1AB 2YAEA 1TUPA 5LB1A 3J27A 2YC1A 3QXAA 4XOEA 3BAIA 4L4VD 4ZXBD 3S5ZA 3QEHB 3SDCB 2AXJA 2FSDA 2IEPA 4K7PL 2PCPB 4R4NC 1L4IA 1XGUA 3Q43A 4GH7B 3BD5A 5GSVB 1NCIA 4FQLL 4XBPA 1K4CA 3D34A 2AEIT 2FLRT 2DKUA 4RMWA 4X4MA 1S4IA 4GQPH 5IJVA 4MD4B 4NZUL 4BSWA 4NN5B 3FRUA 2CM5A 3VTMA 2A6KA 2B59B 4J3VA 3FQXA 4YR6B 2WTRB 3QQXA 3WFEH 4LSRL 2HFEA 4YHIA 5IBLD 2OJZL 4UNIA 5JO5A 1L7TL 4FQXA 5EBMB 2B3RA 3KXFD 3WTUA 4ETQB 1JZ6A 4A7TA 3A6CL 3NTCL 3VFGL 5TF0A 2AQ3A 1JF1A 1M6OA 1N8OE 2YKLH 2HVBA 3HBZA 3BPCA 1J5DA 2L04A 2DYPB 3PHSA 1IAII 4XP5H 1TJMA 1BSIA 1ZSHA 3MREB 2BNQE 2A6DA 4JY5L 4KH9A 2N01B 3TH4T 5IJVB 4C83A 3PE9A 4KROC 1BLIA 3DK2A 5FR3A 3MRLA 5LAPA 43C9B 5LN8A 3HMXH 5TTRA 1O75A 1GOHA 5DK0A 4PG9B 1B2YA 2AHIA 1M3JA 1O7SA 1EGJL 1IJ9A 1YDPA 3IPEA 3EGSA 3KWWA 1F18A 3NRQA 4QLWA 3G5VB 5AW0B 2Q3ZA 2OTUA 4JMXA 1WE5A 5C2BL 1KYOK 4WJ5B 3QHFL 4X6DF 5AOKA 1XXFC 1HKLL 3TVMD 1JXKA 1PNCA 5CNHA 1KENH 5HYSA 3WFCL 1TETL 2BSCA 1V7MH 3Q8BA 4G3YH 5CSZB 5DO2C 1JGUL 4UTAA 4ISVB 3SQOH 1KLGB 3ILPB 2NLJB 1RP9A 3TEYA 3C5SA 1H6UA 4WJG3 3R8BB 1V10A 3MNMA 3TBSB 3V9CA 3HB3D 4OZGA 2DWEB 4Q2ZB 1KB9J 4UQIM 4NKMB 1CF8H 3F5WB 3P40A 3ULSB 2AK4A 4O02L 2OTUB 5IKCB 1KB3A 3U7WL 1BCIA