3C08H

Crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYDGRYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matuzumab Fab Light chain
publication title Matuzumab binding to EGFR prevents the conformational rearrangement required for dimerization.
pubmed doi rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 37
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2008-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H01
4HFWB 3D3VB 4U1SB 3SDCC 5I1EH 4PJ5D 1DVFB 2WBJA 1JWUA 4NWUH 2DQFA 4OIAA 4C56E 4J23A 1T1ZA 3A6BL 4UTBH 3VDCA 2CDFA 3KPRB 4HBQA 3AXLB 4JM2B 1Z0MA 1UWGH 1MCWW 2AK4B 2E7MA 1FVEB 1NEZB 4QNPF 5EBGA 5CFHA 1DTUA 3WO3B 1HWGB 1AXSB 3GMQB 4W4NA 4NSKA 1LDPL 5CSZB 4JRYA 1CFNA 2Q76B 3D48R 4LU5L 4LLVB 3BKJL 1KJ2H 3GHEL 4ELMB 5AAWA 4O5LL 3BZEA 4XNZB 4YJZL 4PYHA 1B88A 2OM5A 1YEGL 1AKJD 4AEIH 5D2NE 4HC1L 3TO4B 2P5WB 2EYRB 3HE6A 3DXAB 3KHQA 5TFSH 1TVHA 5K9KB 2FLRT 4GRMA 5E5MA 3DRQA 5I74C 4GKNB 1D9KA 2VQUA 4FP8L 3DUUA 4NBYB 4CMHB 3RU8L 3H9YA 1P6AB 4ORGB 3BN9C 1IQWH 4HIIB 4NHUA 3L3OA 2JJTC 3HZYB 3V4VL 1AE6H 1BEYL 4A6YA 4E41B 5HYFA 3UJIH 3O6ML 4X99A 3QEUA 4I0KA 4ZD3L 4N0CC 5DJZB 4R90L 3F58L 3R4DA 3RTQC 3HC4L 4PJBA 1P6FA 1A14L 3KJ6L 1WC7B 5EU7E 4NUJB 3C2AH 4Y1AA 4N9OB 4HIXL 3WL9B 4D9LH 2BOBA 2NW2B 2X89D 2XZCL 4MQXD 3GO1L 5ITBH 1QO3A 4EQ3A 4Z0XB 4F58H 4ZTOH 2CR6A 1WIOA 4YHLH 1IT9H 3O4LE 5BVPL 4TYUA 5DJDB 4DCQA 3SO5A 2UZIH 2JIXA 1OTTD 4LMQI 1A8JH 3W2DH 2UY7A 3H3BC 4F37F 1RHHA 1BFOA 5HHOA 3VG0L 1DL7H 1FDLH 1XR8A 3QFJD 5I73B 1QTYT 1NLDL 2NY0B 2V7NB 4I9WD 4ZS6C 5KSUB 3NPSC 2QHRH 4F80A 2H9GB 1MREL 3GKZA 3BE1L 3JV0A 1MCDA 3GB7B 5HI5C 1IGIH 4XPGH 5IOPA 4HH9B 1CK0L 2CK0H 1BVKB 4RAVA 3MLVH 2IPTL 4OAWA 1DQDH 5L6YH 4HXBH 4XP6H 1TZHB 4CL7A 2F15A 2VH5H 1NCAH 1EH9A 1P2CB 1DVFC 2APBA 1UVQB 4C56B 4L3ED 5HYQB 3RJDA 1UZ8B 3S88H 5HHMD 2PF6A 5CJQL 5C0GB 3PNWA 4Z7QE 3PL6B 4JM2C 1ED3A 4HUNB 4I0PB 4UQ2A 1KGCE 5LWYH 4FQ2L 4X80L 1X5LA 3G08B 4RFOH 6CGTA 2VR9A 1VFMA 3AB0B 1QD0A 3QEQD 3RKDD 4M7LH 4NQDA 3VXUA 1S9WB 3U4BH 2Z4QA 2YD5A 4R7NA 2FX8H 5KVFL 1UXWB 4QRRA 4NC1E 1YEFL 2AEIT 1QFOA 4X8JB 2FWOA 4XNZC 3HN3A 4XWGH 3IDJA 2DQDL 4JPKH 2R0ZH 3QRGL 1RK0A 3TO4C 3SHSA 1JK8A 4KI5E 3PJSA 1INEH 2FZ3A 3MACH 4JO4L 5I6XB 5D7JD 4WRLA 3I3BA 2GTZA 2LABA 3LB6C 1QHOA 5BZDA 4I48A 5CLWA 1ES0B 1FGVH 3RWFA 1KB5L 3IJSB 3QJFA 4M1CD 2HKFH 4CMHC 4OB5L 1B9ZA 1QP1A 5F8RC 1JRHL 1A6UH 1HHJA 2W65A 4PJ8A 1JGLH 4MNQE 2AXFA 4CVXA 1J05B 3V95A 1CFTB 5J13B 3TYFB 2GSIA 1FLTX 2AJXL 3LQAH 1AR2A 4MD5B 2W92A 1OGTB 2FIRT 5CJ8A 2X05A 4LASL 2BMKA 2C4XA 4AH2B 1AO7A 4J4PC 1OPGL 1PG7W 5GGUB 1FL3B 2Y36H 2AJVH 3CPLA 5K9JL 1RFDL 2FCBA 5KVGL 3C5ZB 4GUPA 1PKQE 3VXMA 2D4FA 4JG0H 2O61A 3IKCA 2MHAB 1GPOH 4NYLA 5C0BE 1S9XB 1L6XA 4H8WH 3IXAB 2LU7A 4WEMB 2IQAB 1N3NA 1WCBB 3O4LB 4JFQA 2ZJSL 3UCRA 3JVGC 3U2SA 2CR3A 4MLIA 4PP2A 5IBLD 4OQTA 4PJ7A 5MEPB 3NN8A 1J1XL 4NKMB 4WW2F 3VFPB 2BSTA 3ILPB 4NO0D 4D0BA 4F8TA 1BQUA 4AENA 5DRXA 3SQBA 1LO0H 3OX8B 5I73C 5MENA 2MKWA 2NY0C 1JHKH 3SDDB 1BGXL 1QSVA 1IVLA 4JG1H 2OZ4L 4LKCB 4UBDD 4WO4D 5FYKL 1FO0H 4YR6B 4KI1A 1LE9A 5C9JB 3VFNA 1PZ5A 2VUYA 2CH8A 4XBPA 5LJYH 4PV9B 3FQTA 3RWJA 2D7MA 2GJZA 4POZC 1MHEB 1EJOL 3NCYP 4Z7QF 1P5UA 5HPMB 2EC9U 4HDIB 4LDOB 4Z0BH 5D1QD 3BQUB 4WV1B 3SKMA 5JW5A 1XGYL 3PL6C 4FQXB 4I0PC 1W0YT 3HR6A 4X6EB 4XMPH 2GK0A 3VE0B 1IMHC 1RJLA 5LQBH 4XP1H 1U6AH 1A7RL 3AB0C 1VESA 4U6YB 1ZGLM 3MRBA 5F96L 4DK3A 1QFUL 1IAIL 3K3QA 5IW1A 4WVRA 1RUQH 5A2IH 1H8NA 2P48B 2A77L 1YY9C 4QHLA 5EBLA 4AIZB 1OT2A 3PWJB 4JFHE 2BXZA 3FQRA 3B2UD 2F8XC 3C5SA 5I6XC 4UDTA 4YDKL 1DUYA 3L5XH 4L8SA 1NGXA 2YD8A 4U7MA 4L4VE 3BVNA 4ZUWB 3HR5B 5IGXL 4MNQB 4JB9H 3TBWB 4Z7NE 2VWEC 4M6OL 4UAOB 3MC0A 5J13C 2PTTA 4L8BA 1LD9B 2AK1L 4RAHA 3IYLW 4G6AD 4ZYKA 3TEUA 3CLFL 3IDGB 3OJDA 5B4MD 3ARBB 4ZUUB 4B41A 2H3NA 3ZMRA 3AS1A 4LHQB 4YNYB 1UB6A 3MRMA 3VU2A 2IH1A 1PKQB 2ARJB 3C5ZC 1H0DA 4W6YB 2ZCKL 4LKXB 2C3XA 3OXRB 3SGDI 3MBXL 4M62L 5J1AB 3DVIA 4QHUA 1M71A 2OR9L 5C0BB 5DMGC 4RMUA 1FORL 5DJCB 2XI9A 3V6ZA 3RY4A 1G9MH 2E7HA 1A7OH 5CIPB 1BFVH 1QFHA 4EN3B 4Y4KD 1XGRA 3MRCA 3TBSA 3GBLA 3S5LB 5JQ6H 4WUKL 2VDQH 4PRHD 3EYOA 2AEQL 5DJ6A 4PBXA 5FB8B 1CVRA 3RWHA 1OTUC 4OZHF 4M03A 2Q3ZA 4MXVF 3LV3A 4GW5B 5GS2H 3SDDC 3VRJB 2DYPD 3VGEA 5BV7B 4V1DA 3EOTL 3LKNA 3Q6GH 4KROB 3RAJL 2BVOA 3PDGA 1G7MB 3WHE0 1CFVH 3ISWA 1JPST 5ETUB 2B1HL 3NA9H 4HBCL 3L3IB 5C0DB 4MDJA 4PLJD 4NQCE 4HAGA 3TYGH 5I1EL 1BD2E 1HXMB 1VENA 3UDWA 4NWUL 1G7JB 5AD0A 3FONA 4WI2A 2QTEA 3KPPB 3VFWB 2EDKA 3T04D 4X7TB 3CIQA 4JJ5B 4UTBL 3V4PH 5J6HB 1GSMA 2PYED 3BQUC 4WV1C 2VC2L 3WCYA 4FQXC 3TBYA 1VPOH 4QY8A 1BIHA 3L1OH 1AGEA 1KEML 1J18A 2WK2A 5DURD 4F7EA 4QT5B 1E0OB 2BXYA 4EDXA 1C5DA 5T1KA 2APWA 1KJ2L 4NC1C 2C3VA 4CNIB 2L0DA 5ICXB 4WHYH 4PJFF 4M00A 4AEIL 3ELAT 4XPFL 1RAMA 4KI5C 3RX5A 3BGAA 4YGVA 5JW3L 4KZDH 5TFSL 3T09A 2DLGA 1NGYA 5IBUG 5C6TL 4I2XA 3GSRA 4J2XA 3LHPH 4NJAH 4L4VB 1T04A 2P24B 3DGCR 2VLKD 1IQWL 3QT2A 1ZANH 5CD3A 1T20B 1FNLA 4GOSA 1LK3H 5IVXE 4R4BA 5J6GA 4EEEA 5TGBB 4UAOC 5EC2B 1EIBA 1AE6L 4UZGA 2VLRB 4E0RB 4N0UA 4MAYA 3I02B 4HS6B 2VE6A 3MXWH 4RGND 2IFFH 3ARBC 1KSRA 1MAMH 1AIFA 1GHFH 4F7CA 3MNWB 5EWIL 5D8JL 5ECJE 4MD4B 5I17A 4NO2A 1SM3L 1NCNA 4ETQB 3T3PE 3C2AL 4NQSB 4QXGH 1T0MB 1A1NB 4LIQL 4PFEA 1INQA 1X4YA 4HMCA 2EDRA 1P9MA 1R3LA 1MFAH 5ITBL 3UTTD 4P2OD 2ARWA 5DD6A 4F58L 3ARED 4ZTOL 1U2HA 3QDME 5CMAB 1IT9L 2YMXH 3T1WA 1FFPB 3I84A 5IMLA 4UQ3B 5BQ7B 4Q0XH 2DLEA 4EN3C 4GBXB 1ZA6B 1PEWA 1T21A 2OQJA 3HG1E 4RNRB 3WKMH 5HBBA 2UZIL 4Z7WE 1ZT4B 2EE9A 2YWYA 4XC3L 4PJCE 4PLOB 3WDHA 3QUXD 4RGMB 1DQML 1W0WA 1W72B 3QPQC 4MQSB 5BOZG 3JWOH 4HKXB 5FA3A 2M1KA 2QHRL 4MA7L 2VXQH 5BV7C 1MI5A 1I1FB 4ZPVB 4KROC 2EDNA 4O51A 4FQIH 2GTWA 1Q0XH 4YDIL 2W0KA 1IGIL 2A1WH 3T1FA 1FFOB 2CK0L 5FHBL 1NH6A 3MRFB 3MLVL 3U7YH 1DQDL 2YKLH 4NQCB 5L6YL 3RPIB 3OBAA 1IEBA 1BD2B 4YHPB 1BBJA 1NCAL 3BWAA 2DI7A 3SJVE 4L8CB 1V3LA 2N56A 4LLUB 1ZA3A 3S88L 1N6VA 4N5ED 2EDWA 1BOGB 1D5IH 2JCCA 4JFDA 1KLUA 5C9KA 4Y2DA 5DS8A 1QG3A 2FECI 4Q2ZB 3IU3A 1B6UA 3DX6B 1X6NA 2X4PA 5DK0A 1UYWH 2DQGH 1G6RB 4YDVB 3KG5A 4M7LL 4D2NA 3DVGA 1KLGB 1P7KB 4HUMB 3FB5A 2G5RA 1NJ9A 1OTSC 3U4BL 1VEOA 4OSUL 3UBXI 2VDNH 3ZSTA 2FX8L 3W5MA 5I71B 4X6DF 3VCLB 4XWGL 4JPKL 4POUB 2R0ZL 2H1PL 5H35B 5F3BA 1UM4H 4DWHA 5IVNA 1JYNA 2G9HB 1R0AL 5TDNA 5FKPA 2UV3A 1IC7H 2QADD 3X14A 2JK5A 5EU6E 4Y1AD 1MHHB 1FGVL 5IVXF 1G7PB 5GGQH 2HKFL 4H26A 1QACA 1A6UL 3V9FA 1JGLL 5C0CB 1DEEA 4GAJL 3DYPA 1G7IA 3LQAL 2VZVA 3F7QA 1U8NB 5KSBF 3ZHLA 2XPGA 1A7QL 1I1RA 3GEWB 4HWZA 2AJVL 1DDHA 1ZSDA 1WEJH 5JOFB 5GZOD 5DJ8B 2FIKB 1CD0A 3L3KA 3PHQA 3VGDA 3I50H 2F54D 1UXSB 2YPLE 4L5FH 4AIOA 4KJPC 3I6LD 2C4FT 4P2QE 2BX5A 4ZUTB 2IBZX 3IF1A 4JDZA 5CEYB 4I18A 3ZDYE 1RQ5A 5IK3A 3QIBD 4H8WL 5CLTA 2XN9E 3C08L 5FA4B 3QDMB 3VFTA 1BZ7A 1FNEB 3HRZB 1D5XA 2D3VA 5JPMB 5IG7B 5L2KD 2BHZA 1BWMA 4GBXC 3HG1B 4QXTB 1X5XA 3H9HA 4Z7WB 5M94B 2E5EA 3ZHDA 2IAMD 1EEZA 4D9QE 2VLLA 4YFEA 3OKEB 3GI9H 2IALB 3BP7A 4RGMC 2OL3B 4KRLB 1K4DA 1LO0L 3JTSB 5AZ2H 3OTTA 5AG9A 1JHKL 4P46D 3PGDB 4TVPD 2LAAA 2BNUA 3B5HA 1U8IB 1GC1C 3P4MB 4KRPD 5C0RH 3DETD 4ONGH 4LP5A 5GSRA 4KJWD 3UTSE 2Z93A 2ORBH 4HWBH 3TIDB 3KLHD 3SJVB 2AXHA 4JR9L 3BPNB 2I5YL 3HZKA 4HZLA 2JJSA 1QRND 4H0IA 4LSTH 1YJDC 3QISA 5I1LB 2DQJH 5LQBL 2MKLC 1U6AL 2GT9B 3MJGX 3SPVB 1ZTXH 1AC0A 4I4WA 3X11A 1RUQL 3QXDA 3FAXA 3GIZH 1FNGA 4R4NC 1HH6B 4QRPB 2Z0BA 1LEKA 5ISZD 5I71C 4P5TD 3MUJA 2H2SC 3T0ED 4Q97A 3T0WA 1DQQB 3QNXA 1YPZB 3CUPA 4NKOA 1H8SA 4HKJB 3KPSE 4U1IB 4QGTA 4KMQA 3W9DB 5DF0A 5IFAH 4DGIH 1JYVA 5KAQG 1FZMB 2IC2A 1ZHNA 5EU6B 4IMKC 5ACZA 4RISH 4N8VA 2YD9A 3MGOB 1ODAA 4P4KD 4OGYL 1J1OL 3G5ZB 1T4KA 4JB9L 4ODXB 3KDMB 3VXOB 4TULH 2B39A 2WLYA 5IR1A 1E4WL 4P0DA 2OP4H 2Q7YB 3RP1A 5DLMH 2GIYA 1AH1A 2BY1A 3MV9A 3JWDC 5FHAL 2PUQT 2QR0B 1UENA 4B7IA 1PSKH 1KFAH 3D39B 3PUCA 1UQSB 2AJUH 4NM4L 3ET9F 4DKAA 1JF1A 2XA3A 4MZ2A 2X1OA 1E28B 4UT9H 4U1HB 4QEGA 1CDHA 2YPLB 4P2QB 3R06B 2WINA 2WAHA 1HHHA 3WD5L 3OMZA 2BNQB 4WFHD 3ZL4H 1MIEH 5I8EA 3LMJH 4LSVL 3EHBC 1SMOA 4LCWA 3TLRA 2XN9B 2Z92B 2L4OA 2B4CL 2WUBH 5FO9A 3SY0B 1BFVL 1OHQA 5KVDH 3MRGA 1KTKE 2XQBH 5DMKB 5E8PB 5KBNC 1QR1B 3NAAL 4LQ1A 4KXZH 3Q0HA 3QQ4B 2AJ3A 2VMFA 3REVB 5J3HC 3Q2CA 1A3LH 5HGBB 2E8YA 5ICYA 2OBGA 3EO9H 2P8PB 3O45B 5BJTB 4J3UA 4Y19D 2FB4H 2CDEB 2X4UA 3S4SB 3TA3B 4JEGB 2WIIB 1KCRH 3Q6GL 3VD7A 3J8F7 4R6UA 1A3QA 3FO9A 4Y16D 1CFVL 1MSPA 1JI2A 3REWB 2C3HA 5ID0A 3TVMB 4O2CA 3NA9L 3UTSB 4KKAC 5E95B 4PBVC 4M6MH 4XVUD 4G9DA 1Z6JT 3ARRA 4ZO8A 4ONHA 3FHAA 4PP1D 1C5BL 5EA0H 3BPNC 2MCPH 3RWGB 3V4PL 1ZT1A 1KXTB 2NPLX 4U49A 2VN7A 4XVTH 1Q9KA 1EEUA 4S1DC 4JHBA 1ZVSB 4LCYA 1CD9B 1VPOL 2OSLA 1HZHH 4G9FE 2FBJH 3L1OL 3ARYA 3SE3A 1F13A 2JB5H 4ZSOA 4JZJA 2HLFD 3P11H 1DQJB 1NLBH 4KK9C 1T7YA 3HUJE 3P9WB 3QDGD 3VFOA 3IAGC 4ODBD 4BUGA 3P0GB 5FYKE 4RBPK 1ZHLA 2P1YA 1UB5B 3QUZC 2EYSB 5SWSA 2VDOH 4OZGA 3RWEA 4WU5B 5SX5H 1JYWA 4N0YH 2R39A 4G80A 1XCTB 1JVKA 5D71H 1C08A 4KZDL 4KVNL 3SOBH 3WJJA 5F7WC 2XT1B 3PP3H 1K9TA 4U2ZA 1HQ4B 4NJAL 2Z8VC 3BPCA 5DFVD 2EO1A 1LK3L 2UYLA 4JRXD 3B9KA 1R3KA 2ZCHH 4F57L 1MLBB 4NT6A 4NHCH 4GRLA 3CDGA 3HAEH 3OKDB 2IFFL 3GRWH 1MAML 1UM6H 1MWAH 3RHWF 1FNFA 3BRGC 4ISVB 1MCEA 1AQKH 2N7AA 5CP3A 5FOBA 4EOWH 5IMKA 1YEKH 2CO7B 5CEZD 3MV11 4QKXB 1L9MA 3ZSSA 1UH3A 1ZLVK 5AG8A 3CXDH 4DN3H 5C07E 3QG6B 4PJ9D 1BVLB 1HNGA 4PJEA 4QXUH 3PIQB 1A9BA 3QXVA 2YMXL 5CGMA 2DDQH 1KB9K 5F3HA 1FCCA 1WVZA 5C09B 2ADIB 1P7HL 4UT7L 2M2DA 3DJ9A 3U0WH 5HYJD 4Z76A 4X5WB 1HHIB 3UTZB 3BKCL 4GFTB 4R26L 3ME0A 2VLJD 4X9IA 4HUXA 5HHPA 3GK8H 2OMNA 1I8MA 1KEGH 1KPRB 3BN9D 3KXFD 2DLTA 3TA3C 1JGDA 4WU7B 1Q0XL 2C1OB 5LXGH 4QCIA 3TVMC 2A1WL 3CJJA 1VADA 2BSRB 1L9NA 3R1GL 4RMTA 3K2UH 4Y0GA 3RTQD 3TT1H 2UWEE 3PV6B 3H9SE 1CT8A 4EXPX 1W8OA 1NSNL 1XIWD 3DI3B 3PWNB 3GSXB 2F5BH 1L0YA 4WFED 4LVEA 2FGWL 1UC6A 1UKSA 3MROA 3MRQB 3NZHH 3HUJB 2HFEA 1XCQB 3R8QA 1EV2E 3SKNB 1KJMB 4RX4D 3QR2A 5GXBB 4PJDE 1NFDF 4P3WA 4ZNEE 1CF8L 2VAJA 2A6DA 4MVBC 3EO0A 15C8H 4MA8H 3DO7A 3RNQB 5IFHH 1PKOA 3ARGB 4NZRH 3BP4B 1U8QB 3RDTB 2Z91B 3O6FB 3VRIB 3KPLB 1AGCB 4V2BA 2VL5A 1IC7L 1RY7B 8FABB 4I3SH 1R3HB 3P77A 2BRQA 3X3FH 1RJYB 2D03L 3MRHA 1MCOL 2QEJA 5HI5D 2Q87A 1WZMA 1S9VB 3TPKA 4LGRB 2J12B 2FHBA 1NC2D 1O7VA 1WBYB 5CZKA 3HPJB 1A6TB 5IEHA 3RBSA 5A16B 4DKDC 2QQKH 3D3VD 4YGAB 5KANI 2V2TB 5K59E 3TBTA 4CVZA 4WDIB 3RL1B 3LEYH 2HRPH 2OTPA 1F4XH 4NFDA 4JM2D 2HVJB 1WEJL 1CS6A 1Q94A 2H32B 2HT3D 3KAAA 3ZTJG 4L5FL 2WZPD 4YHMH 5BS0B 5IB5B 5IB2B 4RRPG 2R1YA 4TTDC 5JXEC 4G8GE 1IBGH 1ND0B 4NGHL 5C07B 4IRZL 3OL2A 3BXNB 4XPHL 4IRJA 3HS0B 1T2QL 1MLCB 3F7RA 1RD6A 4XCEB 1YDPA 2GCYA 5F7EH 3TO4D 3JTTA 1WFUA 2HT4C 3QI9A 2QKIB 1KN2L 3GI9L 3LH2H 1QHPA 3LB6D 4NZDA 2VLMD 5EU4A 5F71A 2D0HA 1F58L 4IJ3B 3DTXA 4OFKA 3KPOA 2OI9B 5AZ2L 1JPTH 4U6XA 4LLDB 4LIQE 1KBGH 5ALCL 3B5GA 1QLFA 1AGBB 5E99H 1R24A 1IEAA 4KK6D 4OM0L 4X7CC 2B20A 4E41D 4KUZL 2V5SA 2CIIB 4RA3A 3BZ4A 4GAFB 2V7HB 2ORBL 4HWBL 4J4PD 4KU1A 4Y4HA 1NUFA 1T1WB 2A2QT 2B0SL 3MPCA 3H9SB 4NNXB 3DYOA 4GG8B 4K3GA 2F8VA 1CDBA 3VXTB 4LSTL 1Z5LB 2A0LC 3G6JE 3T0DA 1FH5H 5ACLA 2AXJA 2DQJL 4WY7H 4HJGB 5BVJA 1IC4H 4NC2B 1VFOA 1ZTXL 4OZ4B 4K23H 2I9LA 1HINH 1NAMA 3GIZL 3CFIC 1LO2H 1OAXH 4Q6YA 1IM9B 1RUML 3L5WB 1INDH 4CAGA 5E6ZA 4PREA 4R8WH 5DRZA 1N7ML 3RA7L 2ZWLT 2MPAH 2EXYC 3ARGC 1FQ9C 1P84J 2FEEL 5DD3H 1T89C 3RDTC 2EYTA 3O6FC 4L29A 3MR9A 3A6CH 1RZGB 1D5BA 1PEZA 2H6PB 3CH1A 2NY0D 1CL7H 5IFAL 1OF2B 2X1PA 3RI5F 1H5BB 4DGIL 3RIFK 3QWOB 5D1XB 2XACC 3W9EB 2DIAA 4RISL 2ED9A 1ETZA 2ESVB 1KT2B 2OCFD 4OJFH 5FKAB 3WIIH 4NCC2 4TULL 4TVPH 1FIGH 1JIBA 5DLML 4U1NB 5T3XD 1GZQA 1KJ2B 1QFWM 4PJBF 4R97B 1YECH 3ARXA 1PSKL 1KFAL 2LVEA 2AJUL 1KNOA 4IM8A 2P47B 1UA6H 3TPUB 5E2WL 4UT9L 4WJ5B 4LSPH 4JQIH 2AI0L 2DWDA 4LGPB 5E8NB 32C2A 4NRYA 4JVUA 2W9LA 4HG4K 1IARB 1MIEL 4LLAA 2I60H 5FGBC 1KIPB 1UKTA 5KJRH 3EOAB 1FBIH 4PJHB 2DWEA 4K7FA 2IG2H 1MCLA 2R2CA 1HI6B 1S9YB 3LS4H 4RWHA 2C4FU 5KVDL 2XQBL 5J89A 3TNNB 3OR6A 5E6IC 2GQHA 2EIDA 1A3LL 5JW4N 4HKBA 1S7VA 3CFEB 5JZ7C 5DEFB 3EO9L 4IJ3C 5GGSA 2OI9C 2ITCB 2FB4L 2C1PB 1QOKA 3W0WA 4MXWH 3L95A 1KCRL 3P9LA 3ARFB 2V5MA 2HKHH 1XR9B 4DGVH 1WAAA 2V2WA 1MQKL 4JANB 1M6OB 2XWTB 3P4NA 4FFVD 4R96B 1UWXH 4YXLH 3S34H 4M6ML 4TSBH 4ZQKB 4YAQA 5CWSA 1KLFA 4ZNCD 5B38G 1OY3B 4ZDHA 2X4RB 4F7MB 5FYJD 1S5HA 4YDJB 5DJYB 5DA0B 4RFEA 2IPUK 3N06B 1FN4A 3CVHA 4DGYL 4U05A 2V17H 4XVTL 3G6JB 3CCHB 4OQTH 1HZHL 5DMGD 4G8EA 1IAII 2FBJL 3OF6A 1RIVH 2JB5L 5GRJH 2YEZB 3HPLA 1N2RA 2DM3A 2GJ6D 3BX7C 4ODHH 4UTAH 2DAVA 1N59B 1CCZA 5H37H 4RDQF 3QYCA 1JYXA 1H9VA 5HXMA 1U8OA 4PRDA 1JPGA 3UXFA 4OCSL 4K8RH 1AP2A 3MV8B 3B5TA 3ROLA 2BCKB 3EGSB 4OLUH 3W82A 4KK5C 1FVCA 2BOCA 2ZG3A 5B38B 1FAKT 1U8KB 4ELKA 5D71L 1OAYH 2A83B 3CSYB 4X98B 3UJTH 1ORSB 5DRWB 4PRAA 1F6LL 3SDDD 3VFSA 4ZODA 1H5BC 3Q5OA 4PRIE 5D1XC 3UYRL 1BQSA 4GKZB 5CKGA 3LEXB 3RVWD 5ADPL 2HTKC 3QEHB 4F2MB 3V8CA 3BT2H 2V5TA 5FYJU 1IGYA 4P23A 3S35X 3I3DA 1CU4H 2VXUH 4FS0A 2I07B 4FFWC 4X0KA 3WIHA 4O2FA 2HWZH 3GRWL 4R97C 3WBDA 1I1AB 4RMVA 4WTZA 1MELA 4RZCB 1MWAL 5KOMC 4CADA 4OF0A 2XKUA 3VXRD 4F9LC 1EFXB 1P7QB 3ZYOA 1AQKL 4FQXD 1WWWX 1YEKL 1MRDH 2C9AA 3V5HB 5DWUL 4HHAA 5B39A 3KS0H 4YE4H 2BNRE 3IXTA 3CXDL 3TV3H 2ZPKH 3IJYB 3RGHA 3B43A 3AAZA 4QXUL 4LVNB 5DVNA 3S3SA 2KPNA 1H3PL 1RURH 3MJ9L 4G42A 4L9LA 4V2CB 2DDQL 1ITBB 6FABL 3O81A 4OLVH 4QYOA 3BJ91 3FN3A 3OKNB 5EOCJ 3C5JA 4YEFA 4Z8FH 5DEGB 1NDGA 5A2FA 1XF2B 2E7CA 2K7PA 3AUVA 5DYOB 3KNBB 3GK8L 4F7TB 1CLZH 2DM2A 5GSVB 3QIWB 4WCYL 3PWLB 2DQCL 3ARFC 2E27L 2ATPA 2E7LC 2YXFA 3MA9H 1JCKA 4QHNB 2NYYC 1YEDB 1U3YA 3PABA 3K2UL 2X2YA 2Y6SD 1HWHB 5CCKH 5IFJB 4L3CB 4PB0L 2ATKA 1VERA 3MGTA 5I76A 3GBNH 3QUMH 1I3UA 4HCRA 1J8HE 5FECB 4LEXH 4CDHA 3MOQA 1YUHB 1I7ZA 4R7DB 2CLRA 1A6VH 2F5BL 3MODH 2PXYA 1CVSC 4HF5H 1C16A 2G2RB 4QOKD 1QBBA 3L6FB 3P4OB 5TE6H 1YMHA 4PG2C 2Q8BH 1PW3A 4L4TA 2F53D 3HMXL 3FN0H 2YPKB 1ONQA 1QLRB 5CEZH 5BRZE 4A2LA 4PBWD 1FO0B 2XFXA 3QXAA 5SX4H 1DUZA 1HH9B 4P2RE 3F7VA 3EFFA 4FOMA 1HHKB 2Z35B 3HI1A 4ZAKA 5IFHL 4NZRL 3MREA 1IC5L 1U8PA 3O2DH 4XCYB 3VXQB 2G5BB 3SDCA 1J0KA 5I1GH 1S7QB 3QPQD 1H15B 4NQVA 3T2PA 3SE9H 4C54A 3UZVB 4OZIE 4BH7A 4HEME 2D31A 1JZ6A 5E7BA 4Y5YA 3X3FL 4KROD 3MV7E 3BZFA 2VKXA 1A4KB 1FL5A 1DBML 2QBWA 3AVEA 2DBJA 1RZIA 4P5MB 1F8TH 2QQKL 3MZGB 3U36B 3BO8A 3DBXB 4OZHB 1T5XB 2ITDB 2DQIH 4K9EH 3BKYL 1F4XL 2AEPH 2P4AB 2R9HD 1LEIB 5GIRA 3N9GH 4HUVA 1Q9LB 3U0PB 1D6VH 4GAYA 4OCYH 3MLRL 5DQJB 5SWZE 1IQDA 3GGWA 4YHML 4JM4H 4XMKL 5FGRA 3STBA 1IBGL 1OTSD 2R1XB 4HD9A 1QRKA 5IESH 5LAXA 1ZWIB 3HC0B 4NRXB 1XF3B 4LVNC 2FEDC 1QR4A 3JSSA 4I5BB 5FM8A 7CGTA 2R15A 1QSEA 1B90A 5GGVH 5F7EL 2JJTA 1CLYH 3LQAC 3CX2A 4MCYB 4LHUA 1WBZB 3MNZB 3D0VA 3VRLE 1U58B 4LLQA 4KKBC 4LF3A 1OAUH 3ALPA 1SY6A 1M05A 5ADOL 2P5ED 3Q5TA 2OR7A 4Z7VE 4NKQB 1CFQB 4IS6B 5F1NA 3EDFA 1KBGL 4PJ5E 4U1KB 1EBPA 1FFNB 3QIWC 4X9HA 1K3ZA 1P1ZA 5E99L 4MS8C 1T5WB 1SEBA 3TJHC 1U92A 2VLRD 3FB8A 4DUWA 5JHDD 5D5MA 4H8WC 5F7HA 1IL1B 1GOHA 5DHYA 3UZQA 3QO0B 4HK0B 1EEYB 1KTRL 3LZFH 1XZ0B 1J8HB 1T0PB 2CLZB 3QSKB 4X6CE 1GGTA 4U6HA 1RUKH 4PJIB 5GRYA 1EUTA 4M4RA 5C0IB 5LG1A 4IIQB 2PW2A 4KJPD 1VACB 1QKZH 5IW6A 5C0AD 4PB9H 2CLVA 4WY7L 3G5YB 5JNYA 2B1AL 2VSCA 4LRNL 4Y4FB 1IC4L 1OARH 2E6PA 4M8QB 2F9BT 2EH7L 5IMOA 3VA2C 2X1QA 3INUH 1LO2L 1OAXL 4MJ5A 3GI8H 2J6EL 2GEEA 1V3MA 3X12B 5CD5C 1DBJL 1KPUA 3VI4E 4P2RB 4R8WL 3KLSA 2Y4SA 4HJJH 3KYMB 4G8IA 3QHFL 5DD3L 1CIDA 4L8DB 3HA0A 2Z31B 3PGCB 5F1KC 3OKKA 5JLZB 3DV4B 4HFWA 4U1SA 1CL7L 1DVFA 1A6ZA 2DKUA 4OZIB 1A0QH 5DD5L 3P0YH 3MV7B 4WNQB 3KPRA 3AXLA 1A6PA 4N5UA 4KDWA 2AK4A 1FVEA 4OFYA 1NEZA 3LSOA 3EIFA 4OJFL 3WIIL 1VSCA 1AXSA 4TVPL 1UZ6F 2J8UE 4JHAL 4BKLB 2MMXA 4XI5C 3VGHA 2UVEA 4PS4L 4LFHD 1T0NB 2WIMA 3CK0H 4LLVA 1R6VA 2JTDA 2FHCA 3VH8G 2DOCA 3T8XB 1UA6L 5IJVB 1F4WH 4LSPL 2P5WA 4JQIL 2EYRA 3FQXB 4MD0A 3MFFB 3BIAX 3DXAA 3ULUD 4OGXH 2R2BB 5ESAA 4Y8AA 1CGXA 5K9KA 4UV4H 1EJ6A 5KJRL 4R4ND 2V2XB 5GRVK 1DBKH 1OP9A 3QFJE 5TE4H 5I15L 4X4MA 3IFLH 1Z3GH 2HVKB 3UC0H 4HIIA 4I9WE 3VI3E 1CIUA 2NNAB 2QSVA 5E1AB 5DO2C 4D8PB 4NNPH 3HZYA 4ZFFB 3QG7H 2R4SH 2DBLL 3DO3A 5DUMH 3C60B 5ACMA 4JGMA 3VH8B 1BX2B 3LKQB 3QZWB 5DJZA 4H1LH 4Z7VB 3P30H 3QDJD 4XNYH 3VD4A 3MRLA 1M7IB 3FO2B 2CMRL 4R2GB 2LTQC 4MXWL 3OAUL 4PJ5B 2UUDH 4NUJA 1RZJL 3HCVB 3V0VB 5C0CD 2NTSP 4L3EE 1GGIH 1WGOA 2NW2A 5HHME 4JDTH 1BREA 1KCSL 2Y5TB 4O00A 1DLFL 3S34L 2EDBA 3HI5H 3I6GA 4LLYB 4Z0XA 3GNMH 1G9MC 3IDIB 2B4CC 3QEQE 2EKJA 3GMPA 4X6CB 4X83A 1KACB 2NY4B 3FMGH 1S7RB 4JY5H 1K85A 4Z9KB 1N6UA 4IIQC 2FJHB 4MWFB 4QTIL 2VB5A 4J7RA 1WICA 4GXUM 4AM0B 1AKJB 3KYOA 2CKBL 3OGOE 2HH0H 1RIVL 4Y4FC 5GRJL 3E6FB 5JO5B 2V7NA 4UTAL 5KSBB 1YNLH 4XPAH 1B0RB 2OTUB 2H9GA 1TZGL 2X4SA 1Z2KA 3FZUC 4JHZA 2J7LA 3CDFA 1I4FB 5CP7B 3DOSA 4PJAE 4OLUL 1TCRA 1S8DB 4HH9A 4DJMA 4EBQL 2FR4B 4JFPB 3QH3B 3QWRD 4KV5F 1OAYL 2Z31C 3UJTL 1TZHA 4YQXH 4D3CH 1WFTA 4TSAL 4C56A 2ADFL 5HYQA 5MI0B 1UZ8A 5F9JB 3WN5B 4TTGA 2Y7QB 3PL6A 1XGUB 4FXGB 4I0PA 2QL1A 4FQJH 4M43H 5I30H 4MQTB 3BDYL 4FQ1H 4MNGB 3O3AB 4FG6D 5T5NG 1JMXA 3TFKD 1T2XA 4JZOB 4M48H 3S6CA 2EH8L 2J8UB 5C3TA 4HG4J 3ESUF 2VXUL 5HYSG 1S9WA 1NKOA 3SJVD 4XH2B 2XRAH 1EPFA 2HWZL 3OAZH 5D7SH 5IVZB 4WW1B 1VCAA 3B9VA 1F4HA 4H20H 3NABL 1GGCH 5LBSH 3K74B 5D2NA 5BZWA 2NR6C 5D9SA 2NY5H 3RVXC 3S35H 1WBXB 4YE4L 4KK9D 4HV8B 5FYJH 3KLAB 1FZOB 2EE3A 1CGSH 1M7DB 2ZPKL 4HPOH 3FFCB 1QSFB 3FRPG 3QUZD 4KHTH 4QRPD 3QFJB 2AQ1A 1FGNH 3G6DH 2IBZY 4YUEL 3MRPA 1J05A 1Y6NR 1U3HA 5HDBE 3TYFA 4C58B 4ALAH 1OGTA 3C60C 4HULB 5TDOA 4MB4A 1MFCL 2NXYD 4AH2A 3IAQA 3MRNA 3N1QC 4KTEL 5GGUA 1FL3A 3MYZA 5IROC 1JN6B 1CLZL 2LV4A 4R2GC 4NNYB 1KF9B 5SX5K 3GHBH 1JPFA 4XHJD 2YUXA 4K7PX 5DEZA 3F62A 4U33A 1MNUH 1S9XA 3PP3K 5CCKL 1QA9B 5DGRA 2FRGP 3IXAA 4CUCA 3D39D 2IQAA 4AY0A 3O4LA 3QUML 3QEQB 3ZZ1A 1NQBA 4LEXL 2NY4C 3JXAA 5MEPA 3VFPA 4HF5L 4E5XB 3MYJA 2OK0H 2X4OB 1FVDB 4NCDA 1BJ1J 3F65A 2BNQD 2PKDA 5C6WH 3E3QE 5E00B 5TE6L 2Q8BL 4TRPL 3OX8A 4GRWE 2R8SH 5D7JB 3FN0L 3IFPB 2D2OA 4WIQA 5CEZL 3X17A 4MCZB 4LKCA 3FT2B 4M7LT 4YR6A 3V6OE 5C9JA 1NUDA 4PV9A 3O2DL 3SO3B 1NCBL 3IFOA 3UROR 1R3JA 3C87A 1MHEA 5D2LB 3SE9L 5HPMA 4PRPA 4HDIA 1RZKH 2V9TA 2HP4A 5MI0C 5I1KH 3RL2B 3WN5C 3WE6B 4KQ3H 3BQUA 4WV1A 1XGQB 4KMTH 3RIAK 4GG6E 1BQHB 4QHKI 1CICD 5E9DE 4LBEB 5DD0L 4Z78A 2KBGA 4X6EA 2CRYA 3O0RH 3X13B 1RULL 1TTUA 1F8TL 4U6YA 2YD6A 1DBAH 2PTVA 3GKWH 4M1DH 4TQEH 1NCTA 1UWEH 5F44A 2HFFB 1AGFB 4OIIH 1NBVH 3FTGB 4CVWA 2PO6D 1I7RB 4MQXC 4K9EL 2AEPL 5DVKA 1JWMB 2VDPH 4JY6B 3E6HB 3PWJA 1EMTH 2IMMA 1CBVH 1FNHA 4OCYL 1EEQA 3HNVH 1QLEL 4JM4L 1WT5C 4S11A 5H94B 1OTTC 4PRHE 2H8PA 4NO0B 3B2VH 5IESL 5CBAB 4LAQH 1OOAA 4MVBD 4ZUWA 3HR5A 3LN5A 1ZT7B 4MNQA 2OR8A 5EBWB 43C9B 4R0LB 5GGVL 3WS6C 3I2CH 1QBMH 1QQDA 1CGWA 3CD4A 1FLRL 4Y7MA 1C12A 3RGVD 4WO4B 3MJ7B 1CN4A 1FJ1A 3NCYS 2FH6A 3DRTA 3EYUH 5DT1L 5E6YA 3IDGA 4CN1A 3ARBA 1A21A 4JPVH 5DMYA 1DFBH 1YNTA 5E08H 3MRKB 4AMKH 5DQDH 4OF7A 1PKQA 1T66D 2ARJA 5ICZB 4QLRA 1EGJA 5D1QB 5IV2B 1FP5A 1IFHL 5EOTB 4GMSH 5CP3H 2PYEE 4OCLC 5C0BA 3NTCL 3M45A 3TWCH 4KTYA 3RNKA 1DANT 5DJCA 3LZFL 3LOWA 1RJZB 1S7UB 4LK4A 3NFPA 4UU9A 3RKDC 5CIPA 2A9MH 4QRUB 1RUKL 4EN3A 5MERB 3CXHK 4NPYB 4IRSD 4FQQB 4MJID 1QKZL 3ZTNL 5FV1L 1OB1A 1QSZA 4LLWA 4TTDD 5FB8A 5JXED 5GRUH 5FCUH 1AD0A 2EDQA 3WFBH 5IM7B 1OARL 2ED7A 3E8UH 4WTWA 4I3RH 2DKSA 5D7JC 4M7ZB 2IGFH 3GI8L 5D6CB 2WNGA 4OZGF 5GPRA 5DMJB 5C09D 4FZEH 2HT4D 3O9WB 3SCMD 1QFWH 4BK4A 2EDOA 3L3IA 4HJJL 4JGUA 3DVNB 4QRTB 2VLKE 3CSPA 2XKNB 3QUKB 3SO3C 4JFED 3DHJA 1SJEB 3H7BB 3DECA 1WITA 4GG6F 4AZ8A 2J3SA 3DX8A 3NBNA 5ESVA 2EDJA 3P0YL 4X7TA 3RI5K 4RGNE 1IAMA 2FHFA 4X8XA 2X40A 4QHMB 5E9DB 5IEKB 4CDGC 4OI9A 3ULVH 4IDJH 5TF1L 1E27B 1E6JH 5IHLB 2XG4A 5TF0A 2NTFB 2YN5A 3I9GH 1YMMB 2FO1A 2J5LB 4QT5A 3T2NL 2X44D 4Z5RB 3BHBB 4HWEL 3HAEG 5DI8B 3UTTE 1J0IA 5C86A 4W81A 3TT3H 1MY5A 5ICXA 2ICEB 4L1HA 2A0LD 1F4WL 5KS9E 4M5ZH 1S7TB 4RMWA 5IBLC 5INCA 4Y4KB 5EZJB 4PJFA 3U6RB 1EAJA 1MRCH 2WANA 4OGXL 5AWNL 3UTQA 5I66A 1KC5H 3NVQA 4PRHB 1IGJB 4PJEF 4ZOBA 4W4OC 1ZK9A 3FHQA 1VGKB 1NPUA 4L4VA 5TE4L 1O5DT 3IFLL 1Z3GL 1T20A 4R0LC 2DYPB 5EO0B 4X5XB 3RDTD 4NNPL 3O8XB 2ENYA 3DIFA 4E0RA 2R4SL 4WO4C 3HAEB 3I02A 3QNZB 5DUML 2RBLA 25C8L 4HS6A 3MCKB 1MWAB 2Y06L 3P30L 4XNYL 3MNWA 1FV1B 3O11A 2FATL 4MD4A 4AQ1B 4B50A 4WUUD 3C6LD 5JIIA 3VJ6A 1NFDB 1KTLB 3P0VH 2M8XA 3HB3D 4NQSA 1A1NA 3WUZA 4JPIB 5D1QC 1MH5B 4JDTL 5GGTA 4PY7B 2PYEB 1OT1A 4JZNB 3CMOH 5DJAA 3HI5L 5CZXD 4LCIH 1VGEH 3QULB 5CMAA 3SDAB 3IDXH 4NJ9H 3FMGL 4JY5L 3LQMA 4WWKD 4GBXA 1ZA6A 4RNRA 5HY9B 4U3HA 4PGBA 5T3XL 2BFVH 1ZT4A 3F7YB 5BS0D 2F58H 1FG2B 3BYYA 3D2UD 3E3QC 2HH0L 4YXHH 1I1CA 1D7FA 3B2UC 4ZTPL 1MRFL 2O5XH 3ZE2F 1YNLL 4HKXA 4XPAL 4XAWL 2HLAA 3WSQL 4YHZL 5BMFL 2PW1B 4M7ZC 1YY8B 2R2EB 5IBTH 4HLZG 1SBSH 3ULUH 1I1FA 4RMQA 1VKXB 4ZPVA 2FEEI 4FNLH 4XVSL 4Y1AE 3MRRB 5E6ID 3O9WC 3V6OC 1Q1JH 4NN7B 1FFOA 1GAFL 3OG6B 2VLKB 4OCMC 3MRFA 2WWMD 3FB7B 5JZ7D 3ARVA 4NQCA 4LPYA 1BD2A 2VOTA 4YHPA 2GITA 3B8SA 5T1DH 4D3CL 4YQXL 4GT7A 4KC3B 3WEXB 5DC9B 1FCGA 1BOGA 4P9ML 4RGNB 3EYFA 1G7HA 4PRNB 2BVQB 2DF3A 1AJ7H 4MNHB 4FQJL 4M43L 2Z9TA 4Q2ZA 5T1LA 1TXKA 3DX6A 5I30L 3FRUA 5I2IA 4HWNA 3UEZA 1G6RA 4M48L 4YDVA 2X4QA 2F54E 3I6LE 3OGCB 3P9MB 2J5LC 1P4IL 2R1WB 3SQOH 4OV6F 5M95B 1MUJB 5D7SL 5KVEH 3UTTB 3BW9A 3D85A 3BOVA 1NFIA 3AREB 3VCLA 1GGCL 1NAMH 5LBSL 5H35A 4U1LB 3GMLB 5I19H 5KS9B 4DVBA 4M7KL 2NY5L 3KWWB 1UWXK 2DTML 2RGSA 4GQ9L 2G9HA 2Q7NA 1C5CL 4Y4KC 1Z9MA 3S35L 5L2KE 3QQ9D 1J0ZA 5FYJL 2ZP0T 2WV3A 1S7XB 2F5AH 3T3ME 1CGSL 4HPOL 3MUZ1 1JWUB 1MHHA 2ZSVB 1I8IB 2BVUA 4ZO9A 5GGVY 4OCNC 3VWKD 2OJEB 3G6DL 5FUCC 4TVPE 5IVXA 1XT5A 2EZ0D 3L7EB 4NM8H 2HFGH 3O8XC 5GJTH 1U8NA 1U93B 4ALAL 4C83B 2ZNWA 1J5OH 5D1ZA 4J3WA 3DSFH 5D1XD 4JRYB 1KXVC 1CFNB 4PLJC 4TVSa 2K9UA 2ESVD 1U8JA 5JOFA 2HTKD 5FK9B 1T6WA 3GHBL 4Z7UE 3CX5K 1F00I 1TFHA 2JELL 1KJVA 2DQTH 1QRNE 5CEYA 3HE6B 1MNUL 3HE7D 3F7PC 3LEVL 2QHLA 2R4RH 5E2UH 5FA4A 3QDMA 4RCAA 3ES6B 3SDAC 5ID1B 1FE8L 3HRZA 4Z95H 1XGPB 2P8LB 1D9KB 3DUUB 5IG7A 4OV5A 3HG1A 4QXTA 5KSAA 4Z7WA 3DUSB 2OK0L 3L3OB 3RUGE 3PXHA 5ISZE 4PJCA 2IALA 3F5WA 4UILH 5DC4B 4BZYA 4WFFD 2OL3A 3T0EE 5T3ZD 4X99B 4BQCA 3PDOB 3PGDA 3T0XA 1FZKA 1LK2A 2W9EH 4DQOH 1KCKA 4Y1AB 4OLYH 3V6FB 4NN7C 4PGCA 1B0GB 5E8DH 5D70H 3ZT7A 4LGSB 3TIDA 1R3IH 1N5YH 1QO3B 1HIML 3O3DB 3ZDZF 3BH9B 2BVTA 3UJJH 3WXVH 1RZKL 3EDJA 5AYUL 2UZXB 1SYSB 1J1PL 5A40E 3BRFA 3GJFH 4KQ3L 4RGNC 1YA5A 4KMTL 1CLCA 4DCQB 5I1LA 2JIXB 3O0RL 2GT9A 2XICA 3SPVA 2IADB 1BFOB 4L4JA 5HHOB 2F54B 1DBAL 3GKWL 2DQHL 4TQEL 3IJHA 3VGAB 3K4AA 4WFHE 3ZE0F 3WHXB 3QIBB 4K71B 3AREC 2ICWB 1EMTL 1CBVL 1ACZA 2PN5A 5BXFA 2R0KL 4HKJA 4U1IA 5L2KB 3HLAB 1CDIA 4OGZA 2IAMB 2IAND 3L3JB 1KN4L 3B2VL 1FZMA 1JBJA 5EU6A 1EO8L 4LSQL 4Z7OF 5J1TC 1S3KL 4LAQL 5JR1H 4FQHB 2MQ3A 3FQWA 3MGOA 4LPTA 5EC1A 4Y19E 2KL6A 3MV8D 3G5ZA 4P46B 4DOHE 4UQ2B 3I2CL 1QBML 3KDMA 4ODXA 3VXOA 1UACH 4GMTL 1DN0A 1AQDB 4NDMB 4ERSL 5E4EB 2Q7YA 3IGAB 4YFLF 5MHSD 4JAMA 5C0JB 2BRRH 1IGCH 5HHNA 3VXSD 5J1SC 2BC4A 4KY1L 3K1KC 4JPVL 4WGVB 4P4RB 3AMKA 2Z8WC 1DFBL 4R7NB 4HC1A 1GGUA 4QRRB 5E08L 4AMKL 4XWOD 3S37X 4JREB 4TUOB 2FWOB 1E28A 2XWJB 4U1HA 1WAAF 2YPLA 4Z7UB 4QF1B 4P2QA 4U0RB 1RK0B 4XPBH 2YK1H 3CFJA 1I7TB 4GMSL 5BV7L 1EUUA 3HE6C 4XBEL 5FV2A 4PJXE 3TWCL 4KJYB 2VXVL 4FQCH 4IOSD 2XN9A 5FEBA 3T4YB 4I48B 2GUOB 1EFXD 3QDGE 2A9ML 3K1DA 3SY0A 1D9KC 1P53A 3V52H 3MBEA 1HHJB 4S1RH 1TVBB 2AXFB 1QR1A 4CVXB 3FQNB 3QQ4A 3RUGB 3REVA 2OXHA 5D6DC 2MJWA 1NKRA 1J11A 3MLXH 5FM4A 5GRUL 5HGBA 4P5TB 1CZ8H 4PRPD 4XMLH 3T0EB 3TBVB 4JN2A 5HTSA 4JCLA 1IGTB 2P8PA 2R56H 3O45A 3HC3L 5BJTA 1TNMA 3QFDA 2CDEA 4I3RL 1AO7B 2IWGA 4X9FA 3TA3A 2IGFL 2WIIA 5DZNA 4D0DB 5I1AB 5J4MA 1IAKA 1JV5A 4FZEL 4HGMA 2Q86B 1G9EA 1A4JB 2YRPA 3BUTA 2ID5A 3TVMA 2EC9T 3UTSA 1S7SB 5I1DB 4P4KB 4JRXE 5DK3A 3DMMD 3JV4A 2APTA 3LRSA 1OAZL 1HOCA 2XXCB 2FGZA 3QIUA 3IRPX 3M8OH 3QIWD 3RWGA 3SGEI 3U2SB 4QO1A 4DKEH 3VWJA 4MS8D 4PJ7B 3U7WH 1ZVSA 4JKPH 3ULVL 2BSTB 4D0BB 4IDJL 5GZOC 5EZLB 4X6BB 1RMFH 3I9GL 1DQJA 4PD4J 5CEZE 3WJLC 1GCFA 3VGAC 5MENB 5TQ2H 1J7VR 4XXCA 4URTB 3V6BR 1UB5A 2EYSA 3TT3L 3QIBC 4K71C 2VO5A 4WU5A 3QCUL 3MLYH 1LE9B 1XCTA 3VFNB 1PZ5B 4M5ZL 3KPSA 5DA4A 4XBPB 3K8MA 4XCNA 5FYLD 1MRCL 3FQTB 3TN0A 3ZKNC 2E8ZA 1KC5L 3EYQC 3E2HB 5IQ7L 2IAMC 4EI5D 3RZCD 4S1SH 1X5GA 1HN1A 3NMEA 4EIGB 5HYJE 5KG9B 3P4LA 1KCVH 3DLQR 2FSEB 3UTOA 1O0VA 2VLJE 4Y19B 4YBLB 4P46C 1NBYA 1WQVT 2SEBB 1HDMA 3KXFE 5ALBH 3MOAH 1ZHKB 2GK0B 3J7HA 4GKSB 1JNLH 1RJLB 1MLBA 5E4EC 4ZXBA 4Y16B 3DETC 4B5EA 4Y88A 1N64L 1X9QA 4KQ4L 2IH3A 5E2VH 3AU1B 1ADQH 4KJWC 5IW1B 2G60H 4ZFOL 3KLHC 3O2VH 1JNNH 4JREC 5ABDE 1W72L 4I0CC 3FQRB 3IETB 4U0RC 1OWRM 3C5SB 4WFEE 4XI5D 3MRJB 3CMOL 4PJXB 4YZFE 1KB5A 4UDTB 1BVLA 1DUYB 1VGEL 3PIQA 3OPZH 3IDXL 1NCDH 2IQ9H 3QDGB 4M7JL 3QEGH 3BVNB 5I16B 3N1GC 4G6FD 3WFHA 2BFVL 4G8FB 2F58L 1SVCP 5DD1H 43CAB 4RQQB 1DANU 5ERWB 3DX9A 4BH8B 1MFEH 4PUBL 2APFA 4P5TC 1HHIA 2MWCA 4L8BB 1I9JH 3T0EC 3UTZA 5ILTH 4ZYKB 5L7XH 5DDHB 2O5XL 4U31A 1MQ8A 1KPRA 3OV6A 2B7DT 8CGTA 1J9CT 1XF5B 5IBTL 3ULUL 4WU7A 5DO2D 5HDLA 3MLWH 4NQXB 2C1OA 2A74B 1H0DB 1Q1JL 2X9YA 1A47A 4KDTC 2G75B 5DHXB 1Z9OA 3P3YA 2IEPA 4P4KC 2BSRA 4HIHA 1A7PH 3X3GH 1M71B 1FNSH 2JE8A 3QUMB 5K33A 1FYTD 3PV6A 4OZFH 4NO3B 1V7NL 1UFUA 3D3VE 4S0TD 1Q72L 3IFNL 3PWNA 1N8ZB 4FQLH 1AY1H 1XGRB 2O26U 3LQZB 3MRCB 3CFBB 2HN7A 1AJ7L 3DPBA 4G9FA 1C7SA 5CGYD 1MFBH 3RX7A 3MRQA 3L3HB 3HUJA 4XP4H 3WMSA 3SKNA 2OZ4A 3SQOL 2VDLL 1TVDA 1KJMA 2E3VA 5C0NC 5L0QB 3CU7A 3GSNH 5KVEL 2UUDK 4K8RC 5D7LD 4KDVA 1CXHA 4PJ9B 5GGRA 4O2EB 3LKNB 5HGDB 2BVOB 4ELME 1NL0H 3RNQA 4CJ0A 3BP4A 1U8QA 4XP5L 5I19L 3O6FA 5IB4B 1X4XA 5GS2D 4HMEA 4MDJB 4CBPA 2F5AL 1T2JA 3QCVH 4PRBA 3NACH 1UJ3A 3QDAA 5F9OH 8FABA 3E2HC 5EOCH 1R3HA 5HYJB 5F9AC 1JGUL 5IT2L 2VLME 1RJYA 3N1MC 4OCWL 2HTLC 1KXQE 3BPLB 1S9VA 2VLJB 3SKUD 2JCCE 4YBLC 4M3JA 3HPJA 3KXFB 1A6TA 2JJUA 2HFGL 5D7KD 3CFDA 5A16A 1AGEB 4Y16C 2V2TA 4NKIH 2CUMA 1J5OL 3VMNA 1ZHBB 4WDIA 3DSFL 4E41E 3MOBL 5L88H 4JJHA 2VDRL 3NIGF 5DJ0A 3N0PB 3PHOB 1X7QA 3PWUA 2HVJA 2BHUA 5CAYB 4M5YL 1YEIH 2J88L 1ZLUK 4BQBA 4NQUA 2EKSB 4PP1C 2XZAL 5IWLA 5SV4A 1XIWB 5IB2A 5D5MF 4HFUH 4PTUB 4YGVB 4PPTA 1HEZB 7FABL 5FGBA 5J11B 3LKOB 5C07A 2WSKA 3ZT5A 3BXNA 2R23B 3M1BA 3EFDL 1NGYB 2XA8H 5E2UL 3AGVA 3HS0A 3LKPB 2K3TA 2HLFC 1MLCA 4XCEA 5I8CA 1E4XI 3W11C 5CD3B 2DQEH 2QKIA 3RVXD 4K7PL 4R4BB 1BPVA 2EICA 4N0UB 4MAYB 3L3GA 3OAZK 3O3EA 5MEOB 4WFGD 1XH3B 1MCNA 2GSGA 5I17B 4RRPA 4NO2B 2W9EL 4DQOL 1DE4B 4X6FA 4XNUL 4OLYL 3HZVA 5DFVC 4ONOA 4JDVB 2CIIA 1NC2B 2V7HA 2UWEA 4JFFD 1R3IL 1N5YL 4G7YH 1T1WA 3WXWL 2YA2A 5DD6B 4F15B 1CYGA 4GW1A 3UJJL 3DVFA 4R2GD 3H9SA 4NNXA 5T3XE 1XGTA 4GG8A 2YD1A 4JFYA 3OWEA 5E4IA 1PVHA 1TQCB 2P42B 4HJGA 1W8NA 4L9DA 5AZEH 1T3FA 1WZLA 3BZDA 4OZ4A 3PWPD 4UB0L 4YPGA 5L0QC 1BLNB 4ELMF 2NY4D 2Q8AH 4PJDA 3LRHA 1IM9A 4UINH 5EOQL 4B7LA 3L5WA 1IAOB 5TE7L 4ZNEA 1MI5B 4PJ9C 3L7FB 1JMZA 1BOYA 3H7LA 3M17A 2JB6A 4O51B 3OZ9H 3GBML 1G0DA 5IMMB 3T1FB 4EKXA 1JZ7A 1LVEA 1RZGA 5IHZB 2MQCA 3SGDH 4YHOH 2H6PA 3D9AH 3MUGB 5HI3D 2NLJB 2F19L 2DL9A 1IEBB 2ED8A 1WFNA 4CW1B 5JR1L 4N90D 4UUJB 1CGTA 1KT2A 2LFGA 4LRIC 3BPLC 2LVCA 3C6SB 2JCCB 1KLUB 5T3ZH 1RJCA 2X7LB 1K2DB 1I8KA 3CX5J 1UJTA 1TJGH 2EDFA 3IU3B 1UACL 5DK0B 2X4PB 3KJ4B 5ENWB 2VWEE 4PTTB 4G6KH 1GYAA 2V9QA 1DBBH 1G7LA 3B9AA 1F4YH 4K9EC 3WFZA 3DVGB 4BZ1H 3S36X 1YEHL 1NJ9B 3ARPA 4F9LA 4H1LG 1BJ8A 4BSVA 1E4JA 3TPUA 3STZB 4WJ5A 1L7IH 3IT8D 1JUFA 5C0FA 5FYJE 5E8NA 5EFIB 1KIRA 5F3BB 1XIWC 2YK1L 4GJTB 4ODTH 4CU8A 4G8GA 5SWQA 5JXAH 1DSFH 5J11C 1KIPA 5TDNB 3KPNA 3EOAA 3AS3A 1J86A 1VA9A 2XV6B 5IF0A 1U3ZA 5SV3A 2JK5B 5KN5A 3IS1X 3S37H 1S9YA 5LCVL 2GJ6E 3V52L 2MNUA 2P46B 3TNNA 4M1GH 4S1RL 4ODUB 1F02I 3KS0J 4K3EH 2BY3A 1I85C 3SDXE 3MLXL 2HG5B 4H1LB 4MJ2A 2VABA 5DQ9B 4OI8A 3CFEA 3MO1B 4MAYC 2R56L 3FFCD 1QSFD 5MP6H 5JPNA 2R29H 3HFMH 2ITCA 5HDQH 2C1PA 5TH2B 4F33A 3GMNB 3FT4A 5FXCH 4LEOB 3ARFA 1XR9A 1ZSDB 3W39B 2K7QA 2E7LA 5CJ5A 4OT1L 1S7WA 4YHIA 1M6OA 2XWTA 3EO1B 3B9DA 3FB6B 4MQ7B 4ZQKA 4JDZB 4Q74A 5IK3B 4OLWL 4F15C 1C1EH 1HNFA 3H3KA 3E1F1 2X4RA 4YDJA 5IVOA 3VFTB 5DJYA 2Z8RA 3M8OL 3C8DA 3GSOB 4G5ZH 2HJFA 4WI6A 4XCFH 3I85A 3ALWA 3U7WL 3G6JA 3H9HB 3VXRE 4JKPL 3CCHA 1CR9H 1TQCC 1IM3A 2VLLB 3PHSA 4PG2A 1WZ1H 5I9QB 5AAMA 1UM5H 4IBLT 1RMFL 3BP7B 2HT3C 2YEZA 3OKYA 2QSCH 1JHLH 1XF4B 3GSWA 2BNUB 3VW3H 3UPRA 2BVPA 1BZ9A 2BCKA 1GRWA 1Z9SA 5B38A 4GH7B 4NP4L 4AG4L 4XZUA 1U8KA 3CSYA 2A83A 4EJ1C 4X98A 3PQYD 1JI1A 5DRWA 4D9RD 3QUYA 3QO1B 1GOGA 2X1XR 5J57B 5IW3A 4G43A 2WBKA 1X5YA 2W0LA 3PF2A 1RZ7H 4F2MA 1Q0YH 4Y2DC 4LSUH 3MOAL 1NC4A 1HQRA 2XNAB 4EQ2A 2Y07H 3KJ4C 2W38A 4FN0A 2I07A 4KK6C 3KYKH 1ADQL 1XAUA 1I1AA 3QHZH 4HJ0D 2G60L 1JGVL 1FNGB 1P7QA 2C26A 3TCXA 5IKCA 1JTPA 1JNNL 1RUAH 4TNVF 1D5MB 2AJSH 1A7NH 2ZOLB 3T65B 4AIXA 1MCIA 2V5RA 3NZ8A 5B22A 3V5HA 1MJJB 2BSSA 1GVIA 2ILLA 1NMAL 4FXKB 5E56A 1SQ2N 2EXWD 5C71A 4PGEB 4QOKE 3NCMA 5FDWB 3OPZL 2YN3A 4WHTB 1NCDL 2IQ9L 4GSDH 2GJ6B 3QEGL 2F53E 4K7PY 4N8VB 5DJXA 3U0TB 2J8HA 3OHXA 5CEXA 5F89A 1A3RH 4LQFH 3SDXB 5DEGA 3KR3H 1I9JL 1MCKA 1XF2A 3MV9B 4FTVD 4YHKH 2HT2C 3ARDA 5DYOA 5GGSY 3D18B 5CZVH 4BFIA 5GSVA 5FYLH 4RGOH 3PWLA 4HEPG 4X7DC 2ENSA 4KRNA 4U7SA 2EDLA 4AEHL 4QHNA 3X3GL 3U4EB 1FNSL 5IFJA 4L3CA 2VTFA 2Y23A 4LCWB 5EORH 4APQA 5FECA 5DUPH 5DMIL 4GXVH 1AY1L 4TSCH 3KPMB 4HUWB 3VXRB 3TN0D 3L6FA 1I3RA 2AJ3B 5FUOH 3P4OA 5I9QC 1MFBL 4YH6A 1IC1A 1QVOA 4XP4L 5I1HL 1QEWB 4NOBA 5F97E 2YPKA 2QV2A 3RWCB 1U8LB 1NDMA 5CJXA 3GSNL 4QHKJ 5ANME 1FIEA 3RVVD 1HH9A 4KKCC 4RWYH 3MRIB 3B3IA 4TUJA 1NL0L 5CHNB 2Z35A 5JORA 4KI5F 2VJXA 5GS3A 3MQIA 4XCYA 2G5BA 4NFBA 3S97C 4KJQD 1PLGH 3QCVL 3NACL 1L7TH 1YYLH 5F9OL 3CDYA 5EOCL 1RVFH 4O9HL 5INDB 3QPXL 4PRIA 4P3CL 2P5EE 4HH8A 3SE4A 4LVOB 3U1SH 3O9WD 1ZT1B 3ZKXB 1AXTH 1A4KA 2QSQA 4NQED 1RI8A 1Q9KB 1NANI 1J88A 3OXSB 5LVEA 1FL6B 2N4IA 1A02N 2ADJB 2XG5A 3H0TB 1OM3H 4ZSOB 3U36A 3G5XB 4JZJB 4NKIL 5F6HJ 3H3PH 1LE5A 3OAYK 1HYSC 4FABH 2VLRE 3VFOB 1T5XA 4FFVC 5JHDE 5L88L 3S5LG 1NMBL 5CUSH 4ZFGH 1LEIA 3EDDA 4AT6B 1Q9LA 2VN4A 3LS5L 5E9DD 1YEIL 2W60B 3GIVA 1ZEAH 2NY5C 3ARQA 2H2PD 3RWEB 3WS3B 5DQJA 4EUPG 1HK6A 1MJUH 4HAFA 2PCPB 4O58H 1NEUA 3SEPA 1T03H 1CGVA 1ZXQA 2H26B 4LARH 4H0GA 3K7UA 2BNRA 1YMMD 1C08B 5E24E 4QOKB 5C0AE 2GYSA 4U6TA 1BJ1H 4NRXA 2XA8L 1MAKA 4W68A 5JA9A 4I5BA 2MTPA 2F53B 2AABL 2IPKB 4MCYA 1WBZA 3MNZA 1I7UB 1U58A 2DQUH 2UYLB 5EPMB 2Y5EA 5DTFB 1R3KB 2CUIA 4JPWL 1JNJA 1OSZA 3CDGB 1CD1B 4P49A 4EUPB 1IEHA 2VITA 1FFNA 5LGKA 1AI1L 5FOBB 5EU3A 2O5YH 1CFSB 3O8XD 5IMKB 4ZMAT 4XAKD 3RVWC 1T7VA 3KPTA 3QO0A 4HK0A 4UT6H 1GJIA 3ZDXE 5GGTH 1XZ0A 3S3PA 1J8HA 1VFAB 3TH3T 3B6SB 1A9BB 3I3EA 3ULSB 5C0IA 2DM7A 5F3HB 2JF1A 3BGFB 3PDDA 1VACA 4R4FH 5I18H 5E5RB 3G5YA 3V0WH 1UWGL 4Y4FA 5AZEL 2LU3A 5GISH 4Z76B 5JHLH 4OTXH 5CBEA 4OCRH 4M8QA 3CMGA 3TZVD 3SDAD 4HXAH 3ULUE 5BRZA 2WP3O 2VQ1B 5HHPB 2Q8AL 1I8MB 5FF6B 5ANMB 1EHLH 4HGWB 3X12A 1JGDB 4U2YA 5I75B 4P2RA 1HKLH 5IHUH 3OJVC 4QCIB 4MMZC 5FGSA 2Z31A 3PGCA 5JLZA 1ORQB 5KZCD 3DV4A 5D7IE 4YHOL 4TUKH 3S3JA 1RZKC 1BQLH 4OZIA 2YD3A 2HMID 3MV7A 4WNQA 2P5EB 3P73A 3QDJE 4LVOC 4Z7NF 1SJHB 5I1IH 1F3JB 5T3ZL 3ZKXC 4JN1H 1TJGL 4YX2H 4LDLB 2PYFA 5C0CE 2Z8SA 1KCUH 1DBBL 3SE3C 1F4YL 4JZJC 1T0NA 5HD8D 1G6RH 5JHDB 3UJIL 3RX8A 3T2OA 4TPRH 2Y6SC 5EDXA 4XNMB 3GSVB 3UP1A 5H2BA 1OGAD 5KW9H 1LEGB 5SWZA 1L7IL 5C08D 3DO7B 4IHOB 2R2BA 2GFBB 4LVHB 4D9LL 5C3LD 5JXAL 1DSFL 3SGKC 3WJJC 5C0AB 2RHEA 3S36H 4BZ2H 2V2XA 5E94B 3NIFE 3GJFK 3S37L 2VAAB 2HVKA 1Z0NA 4J3TA 2X42A 4YHLL 2BDNH 5E1AA 3CFKB 2AXGB 2X4NB 2V5YA 2Q6WA 4M1GL 3IDNA 4ZFFA 1M7XA 1BAFH 4K3EL 5EN2B 2NX5D 4LFHG 3HNSH 3C60A 2CGRH 3LKQA 5IEHB 3W2DL 1JFQH 2YRZA 4NBZB 4HZAA 1EVUA 4Z7VA 2WBJD 2W07A 2DD8H 2APVA 5IROA 4ZFOB 4CVZB 3O41A 5HDQL 1DL7L 1FDLL 4DZ8A 1JHTB 4P57A 3QBTB 3FO2A 4H5SB 1LNUA 3MNVB 4NZTH 4PJ5A 3NIDE 2R2HB 3DROB 1XFPA 3MGAA 2WWKO 4ZUVB 4OLZH 1RHFA 2Y5TA 3ZHKA 1YN7B 4OF6A 1FPTH 1MCSA 5BW7C 4XPGL 1MFDH 5F88B 3IDIA 4JRYD 4X4ZA 3C2SA 1C1EL 4HXBL 4X6CA 1PY4A 4XP6L 1S7RA 4IRJB 2VH5L 1SJVA 4KK8D 4IOFD 1YDPB 4XCFL 2FJHA 4MWFA 3BGFC 2R9HC 2YPVH 3HRPA 3QI9B 3BEWB 4HQQH 3HE6D 1AKJA 1WZ1L 5TQ0H 1UM5L 5BCAA 5LWYL 3E6FA 5JO5A 4RFOL 2QSCL 3VDAA 1WSST 4WENB 3DTXB 1B0RA 3KPOB 2OL3H 3NA4A 3B4NA 1KIUA 4N1CA 1D9KD 1RZ8B 1IZJA 2VDKH 3CC5B 1I4FA 2HRLA 5HPOA 1QLFB 3TO2B 5I75C 4P59H 4QRPE 1S8DA 3TNMB 2FR4A 1OW0C 2MCG1 3QH3A 5DXWA 4ZG1A 4YLQT 4N68A 1KPVA 1YPZE 3WNMA 5D7IB 4DW2H 1EHXA 1JNHA 4GXUN 1INEL 3MACL 4Y4HB 1U95A 4YFDB 2FLBT 3LRGA 2AS5M 1HSAA 3WN5A 3U46B 5BO1H 4F7PB 1XGUA 3QDJB 4FXGA 3ULVC 1PY9A 3O3AA 3QAZB 2ZCLH 5DFTA 3N1FC 2X09A 2Y07L 2J8UA 4HKZA 5I1CH 5BVJB 1P84K 4Q7DA 4CMMB 3D0LB 4XH2A 1U41A 2X89A 2X9WA 3KYKL 2I9LB 4WW1A 3T3PF 2EEDA 3D39E 2Y36L 2AGJH 3NGBB 2JIXD 1X3DA 1RK1B 1A7NL 2AJSL 5DRZB 5C7XH 1WT5A 1WBXA 4MLSA 4HV8A 2KDGA 5HHOD 4LVHC 1FZOA 4JG0L 3V79C 2BNQE 1GPOL 4YHNA 3JV6B 1XMWA 3QFJA 2D7OA 2HJLB 3C9NA 3VDBA 3AY4C 4F8QA 1ETZB 1OLZA 3WS6A 4Z7WF 2P7TB 1K5NB 5HYSA 1NMCB 2XY2A 2EDYA 4PJCF 3ILQD 1DEDA 1A3RL 4LQFL 3ZKND 4TNWF 3EYQD 3KR3L 3L3DB 1LDPH 2ZOKB 4JQXA 4YHKL 4Y8DC 3NFNB 5CZVL 3GHEH 1KNOB 4O5LH 4NNYA 5FYLL 2ZG1A 3NFSH 4RGOL 1B0WA 1YEGH 4L3EA 1JZ4A 4JG1L 5JW4M 1L0XA 3HHRB 3TH4T 3FRPA 1FO0L 5J0BA 2AV7B 4NQDD 1QA9A 1OP5H 3VXUD 1MJ7H 2ZZUT 4O02H 1ACYH 3QEQA 4QRRD 2DWEB 4F9PA 4K7FB 4FP8H 4IRJC 5DUPL 9CGTA 1UKQA 4GXVL 4Z0BL 1NCUA 4J3VA 1N26A 3OQ3B 2X4OA 3OR6B 3QI9C 5MEQB 3QUYD 3QQ3B 1MCPH 5EIQA 5E00A 1WF5A 3VFMA 2WM0A 4JRWA 1S7VB 4XMPL 1NGWA 4XP1L 4AEFA 5D7JA 3IFPA 5GGSB 1ZVHA 3ULUC 1A14H 3KJ6H 2EDTA 3FT2A 1NBZB 2BERA 3L95B 4PJ8D 3P9LB 4PJAA 3QUZB 4RWYL 2X70B 2V2WB 4JVWA 5K9OB 4HWBA 2W0FB 2XXMB 4WHCA 4EI6A 4OFDA 3GO1H 2YS4A 1PLGL 1L7TL 1YYLL 1AO7D 3GJFB 2ZG2A 4Y4HC 2NXYB 3RL2A 3L5XL 4NQTA 3WE6A 5BVPH 1XGQA 4QXWA 3U1SL 4LBEA 4U1MB 5IB1A 3VXMD 4P5KB 1FN4B 3V2AR 3QAZC 3X13A 2Y72A 4KWUA 1AR1C 3PGFH 3VG0H 3WO4B 1J10A 1OM3L 5B3JE 3MUHL 3H3PL 1AGFA 1BIIA 4FABL 2ZNXA 3FTGA 5EUOE 1I7RA 4N9GA 1JWMA 5CUSL 4ZFGL 4JY6A 3BE1H 4LSSH 2YUVA 1U8OB 4PRDB 4WI5A 3NGBC 3DNKA 4HIJA 5KAQF 1FVCB 1CK0H 1IILE 3UPCA 2DTSA 4LCUB 3ZDYF 4LARL 1NGZB 5ITFA 4HUKB 2RFXB 5H94A 2IPTH 4ELKB 5I0ZA 3S4SG 4MJIE 3V7MA 4NO0A 5C0ND 4W4OA 5MEND 4NN5B 5JA8B 3O4OB 1N0LA 4K8RD 3VXPA 4XRCA 4P9HH 3BMWA 2EEBA 4PYGA 1KIQB 1ZT7A 4R0LA 5DHVA 1MCHA 4AYFA 1G9ML 2P8MA 4LMQE 1NMCC 1A7OL 4FQ2H 5C09E 4WO4A 2VZUA 3MJ7A 5JQ6L 1A2YA 1IGYB 2VDQL 5F6IB 1F45A 1B4JH 4N1HB 5JMRA 1KG0B 1KENH 4FA8A 5KVFH 2AV1A 3MRKA 4JFEE 2HTLD 1YEFH 1MCBA 3BFOA 3T77B 4BELD 2ZUTA 5ICZA 3DARA 1MAJA 1E6OH 4OGAC 4Z77B 2YOCA 3QRGH 5D1QA 2O5YL 3SBWC 5IV2A 4JFXA 3VFRB 1T83A 4JO4H 5B39B 1CICB 2WQ8A 4M6NH 3ZKQD 2YSSA 4UT6L 5GGTL 3IXTB 4FG6C 3TFKC 1S7UA 1OQXA 5ELIA 1BM3H 3AAZB 1KB5H 3TYGL 3AFLA 4QRUA 3FOMA 2F74A 5MERA 3O3BB 4L9LB 1EZVX 2PO6B 3F12A 4NPYA 1S78D 1WIUA 4FQQA 2A6JA 3Q6FB 4DUXA 1CXKA 4J3XA 4TN9A 2E9IA 3V0WL 5HHQA 4OD2B 2JKXA 3BP5A 5IM7A 5JHLL 4OTXL 3WHE1 3LKSB 1OPGH 1TDQA 5D6CA 5K9JH 1D6EB 2PR4H 3DSNA 3W11D 1EHLL 5KVGH 1WK0A 3V6OA 3GUTB 1HKLL 3ZE1E 2ATPB 4XCCH 4PJGE 3DVNA 1Z9LA 4QRTA 2XKNA 3QUKA 4LL9A 1SJEA 4TUKL 1L4IA 3H7BA 3RGVB 1BQLL 3U83A 4R3SB 4OKDA 2NXYC 4GG6A 3LHPL 4QHMA 5JW4Q 1J1XH 2PXYB 1C16B 3H8NA 4JN1L 4WUUE 5DJ2A 1E27A 1ZANL 5JIHA 4UMGA 1KCUL 1LO4H 1PQZB 3BP6A 3WO4C 1ZKAA 1UT9A 4XTRC 4XHJC 5FO7B 1I1YB 3EJZD 5EUOB 4JCMA 4L4TB 4Z5RA 1LP9E 5DI8A 4OKVB 3L9RB 3MXWL 1H3UA 4TPRL 1QPPA 3VMPA 2ICEA 1GHFL 5FYKH 1DUZB 2RIKA 2XKSA 2PETA 1I3VA 1S7TA 3BKMH 1T7WA 2L7JA 3EFFB 3H9ZA 3HI1B 4Y4KA 4ZAKB 2VXTH 3U6RA 4QXGL 3EBAA 1U8MB 1U8PB 4IRSB 4PG9B 5BS0E 5DSCB 4PRHA 4MJIB 2YBRB 1IGJA 4NQVB 3S36L 1MFAL 1EJOH 4NN5C 3O4OC 4BH7B 2YWZA 1VGKA 1HHGA 4V1DD 5HYIA 2NY6B 3BZFB 1F42A 4BA8A 5EO0A 1XGYH 2DYPA 3TP4A 1FL5B 5T1MB 2I9TA 1U91A 4Q0XL 2YZ1A 3WKML 4BSWB 3HAEA 4EIZC 1A7RH 3GRWA 3MCKA 3SCMB 3ARTA 5F7DA 1JFQL 5F6IC 1MWAA 1IAIH 3BO8B 4GLRI 1FV1A 2NZ9C 4F37K 4JFEB 3UPAA 4NZTL 1KTLA 3G5VB 3JWOL 4HUVB 4FZ8H 4JPIA 2VXQL 1MH5A 1IQDB 2PYEA 4FQIL 1CICC 1SJXA 1FPTL 1TJIH 3WFDH 4YDKH 3MJ9A 1MFDL 4NC0B 1OD7A 1ZVYA 3QULA 5T1KD 4OZFG 3U7YL 2YKLL 5FM5O 4JQVA 4PV8B 4L9LC 5HY9A 1AC6A 5FO8A 5IGXH 1QSEB 3CFCH 2PO6C 2YD2A 1D5IL 3RFZC 3EOBB 5EUKA 4MJ6B 4HQQL 1F3DH 4U6VH 2AJZA 2NY2D 4LF3B 4LLMA 4FHBD 2AK1H 3HUJF 2PTUA 3UTPD 12E8H 1UYWL 4X7SH 3CLFH 1IGFH 1RIUH 4J12A 2DQGL 4ODVH 1CE1H 2YC1B 4PR5A 2EDHA 5CJOH 4OI7A 2XZQH 1BP3B 2VDKL 2VDNL 1P1ZB 4P59L 3BGMB 4BK5A 1OL0A 2EDDA 1SMAA 4PJGB 3S9DB 2VLKA 4M62H 4OZFB 2A73B 3FB8B 2FJGB 5JTWA 4MAYD 4CU6A 4DW2L 1LDSA 4K55A 4Q6IA 5ESQB 4BM7A 2R0LH 1UM4L 5TDPB 3WEXA 5IB3B 3RGVC 3IDMA 1JF5A 3K4ZA 1R5IB 4RMRA 2BVQA 2XTJB 3U9UB 4MNHA 5GGQL 2PXYC 4KUCF 4N8CH 4WUUB 2ESVE 3C6LB 2AEQH 5IW6B 3EZJB 5A2JH 2CLVB 2AVGA 3HMXA 1T66C 5JNYB 4OFPA 5I1CL 1KYOJ 3CLEH 3GSNB 2R1WA 3O6LH 2NZIA 4NRZB 1MUJA 5EZIH 1GOFA 3NOIA 1LP9B 3UTTA 5IMOB 4P2OA 3EOTH 3AREA 4RAUB 3RAJH 4OIBA 2AGJL 4HX1B 3VG9B 5KS9A 3KWWA 2B1HH 3VFUB 4OUUA 4WWKB 4ZAKC 3OKMB 4F3FA 3I50L 4IRSC 2DLFH 2X4TA 1MCWM 5F1SA 1ZLVH 5JUEH 3QUXA 2ZSVA 3D2UB 1A6ZB 1I8IA 4WFFE 1EAPB 5T3ZE 1MI5D 3FQUB 2OJEA 4PJHE 2NY6C 4Y5YC 3SGJC 3DHMA 2VC2H 1LILA 3KPQB 1K8DA 4P3DB 3BPOB 3L7EA 1EHNA 5F7LB 1QBLH 2I24N 4LSDA 3LSOB 2XOTA 1KEMH 1U93A 4C83A 5E6IB 1X44A 3SCMC 3IKKA 5L2JB 1T22B 3BMVA 5D93B 3D69B 1WFOA 5T33H 4A6YH 5TPWH 3NFSL 4JFDD 5FK9A 4Y2DD 5F8QC 5F7YC 1JZ5A 1HYRC 5HHVH 5IP4A 1XEDA 4MD0B 4XPFH 5C0RL 3DI2B 4ONGL 5JW3H 5ESAB 4WI9A 2UWEF 1EERB 1MJ7L 4O02L 4HIEB 4QRSB 1ACYL 1UADC 3ES6A 5C6TH 5ID1A 1XGPA 2P8LA 1HCVA 5GRVL 3DUSA 5D6DA 2W0PA 4XNQB 1PFCA 1MCPL 5HI4D 3WIFB 3PDOA 1R5WA 3TCLA 2FYYB 3MRLB 4PJDF 5EWIH 1DJSA 5D8JH 1KOAA 1ZGLA 4DKFH 2E9JA 2IANE 2B8OT 1SM3H 2CRZA 4LSRH 4JKLA 4LIQH 3V6FA 3D87B 1B0GA 2H45A 3VWKB 1ZAGA 3MV8E 1Q9OB 3N50A 3WFEH 3PP4H 2HT2D 3I6GB 4X4YA 4OBSA 3O3DA 3BH9A 1DLHA 3JWNC 3BJLA 4WEBH 5MHSE 4X4XB 4WI3A 3RZWA 3BH8A 1SYSA 1N5AB 1G9NH 3GMPB 1AHWA 3VXSE 1I9RH 3D25A 1JRHI 2XTJC 5E8OA 4XC3H 3C6LC 3WKNA 3B83A 2IADA 2OMBA 3HB3C 3KYOB 2F54A 3PGFL 5K59F 3WJLA 3IDYB 2VR5A 4FQPA 4YBQD 1DQMH 2J6EA 2OP4L 1PYWA 3HE7B 4MA7H 3T08A 3O6KH 3WHXA 1I8LA 3QIBA 1UG9A 2X4SB 4LSSL 1CDJA 5CZXC 2ICWA 2AEWA 5A3ID 1YEJH 4YDIH 3VG9C 5E2TH 1TCRB 1F11A 4XB8A 1A6AB 3BEVA 5L2KA 4WWKC 4MX7A 5FHBH 3HLAA 4HS3B 2IAMA 2CIKB 5F1OB 3L3JA 2APXA 1K6QH 4PJHF 4PRPE 4FQHA 4P9HL 3ZL4L 3LMJL 1WWCA 3DGGB 4WI7A 1TTFA 3S8WA 1RUPH 5DUBB 4KKCD 4P46A 3ZT6A 4B0MM 4G7VH 2JJWA 4XGZB 5HDOA 3BPOC 2WUBL 1AQDA 3B9EA 4NDMA 3IGAA 4MZ3A 5C0JA 5A2LH 1U42A 1B4JL 4P4RA 4OSUH 5D93C 1KENL 4EZMA 2W59A 2WWMC 2J1KA 4QRQB 2IBBA 3NCJH 4TUOA 5TJWK 2XWJA 1E6OL 5BZWB 4Z7UA 5D2NB 4QF1A 2H1PH 1Y6MR 3QWQB 5D9SB 2CXGA 3JZ7A 1I7TA 3VFVA 1QRNA 1F90H 2GY7B 4M6NL 1HYSD 4KJYA 5GS0D 3A6OA 3DV6B 3QNYB 3T4YA 1BM3L 2GUOA 1ULVA 5GS1A 1F2QA 1U9KA 1IJ9A 3GJEA 3ROOB 2CRMA 1TVBA 4GAJH 3G6JF 3MRPB 3FQNA 5EA0L 3RUGA 1U3HB 2MCPL 5ISZA 1R5VA 4P5TA 3T0EA 3BYTA 3TBVA 2ZSWB 1IZKA 1IGTA 5TDOB 1V3JA 3KYNB 5FYLE 1A7QH 3MRNB 3P11L 1NLBL 3QQ9C 4JLRA 1OQOA 2IANB 4D0DA 2PR4L 5I1AA 3WNOA 2Q86A 3DYMA 1A4JA 4KDTA 1JPFB 2XZZA 3CSGA 2VDOL 3BIBX 4XCCL 1S7SA 5I1DA 4P4KA 3VWKC 1FHGA 3QJHA 4ZUSB 2FO4A 4N0YL 3MV9D 2EZ0C 1RZFH 2VSDA 3SOBL 3C08H 1MOEA 2EO9A 2DMBA 1MF2H 3UAJD 2QJDA 3VXSB 4C4KT 3FOLA 4RIRB 4K94H 2CKBA 3MYJB 3K80A 5E03A 2FDBP 3EYVB 4X6BA 5EZLA 2D7NA 4C55A 4WW2B 4HK3J 1LO4L 1HCFX 2ZCHL 3IDYC 4LCWD 1MJ8H 4KKLC 1OSPH 3G9VA 4EVNB 3HE7C 4NHCL 4OZHE 3MJ6A 4MXVE 2EIZA 1UM6L 1JWSB 5DZLA 4J8RB 3BKML 4KH2A 4EOWL 2VXTL 3VD3A 3N85H 1T1YB 3IFOB 3T4AA 3V5DB 1R3JB 1NBQA 5KG9A 2YRLA 4PRPB 1A7BA 3GMOB 4JR9H 4DN3L 4M61A 2FSEA 2I5YH 3CNKA 4Y19A 4JY4B 4D0CA 2GAZA 2SEBA 4NBXB 4Z78B 2OYPA 3NH7H 1ZHKA 1MVUA 4GKSA 3EDKA 4Y16A 3G6AB 5DK2A 5DVMA 5EU5B 3U0WL 3AU1A 3QP3A 1FYTE 3MRDB 3DMMB 4DFHA 3WLWD 1KEGL 4FZ8L 3UBXG 5D2NC 3IETA 3GZKA 5HGAB 2D7PA 4PJFE 3MRJA 1TJIL 3ECBA 4PJXA 5LXGL 5E7FA 3RIFF 3WFDL 3K4DA 2X10A 2XQYK 2H8PB 5B3NA 1W2KT 1A1MA 1VFBB 2NW3B 3TT1L 3QDGA 3AM8A 4LPUA 5SWSD 5I16A 1X5IA 4OGYH 1TITA 1J1OH 3LN5B 3FCTB 3CFCL 4G8FA 5D7LE 2BVEA 4PJIE 43CAA 1QQDB 4RQQA 1U3HC 5ERWA 4BH8A 3BIKB 4ETYA 4U6VL 1C12B 1E4WH 1G7QB 1X4ZA 1FJ1B 3DRTB 12E8L 5FHAH 3K8KA 4X7SL 5DDHA 1JZ8A 1IGFL 1RIUL 1G6VK 1URLA 2IJ0C 3UBXB 4ODVL 1CE1L 3NZHL 5L8LB 4NM4H 1YNTB 3EKCA 1XF5A 3S7GA 1X5ZA 2R69H 3TIEA 3RZCB 5CJOL 2C3GA 2XZQL 2UY6A 4EI5B 1P4BH 5EU7C 4NQXA 2A74A 4X7EC 1ERNA 3DX7B 2G75A 3B9KD 3STLB 4YEEA 5CILH 4I8DA 3WD5H 15C8L 4MA8L 3TESA 3QUMA 4JRXA 5B8CA 1ZS8A 2LQRA 4GRLD 4NO3A 1A6WH 4LSVH 5D7KE 2R0LL 3RNKB 1AFVH 1BFTA 3OB0H 3NFPB 4IEFB 4UU9B 1N8ZA 2B4CH 4I3SL 3RY6C 1K8IA 3LQZA 3CFBA 1WCQA 4N8CL 3NAAH 3WNPA 4XWOC 1OB1B 3BN3B 3BSZH 4LLWB 3TH2T 4KZEH 3L3HA 2L7UA 1AD0B 2IPUG 4WW2C 3OKOB 3CLEL 2VZOA 3O6LL 4NO5A 4UNTA 5EZIL 5J12B 3WLBA 2RCSH 3MV01 1SEQH 3HNTH 4PJ9A 2OJZH 3LEYL 4O2EA 2HRPL 5HGDA 4J6RH 3O2DA