3C08H

Crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYDGRYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Matuzumab Fab Light chain
publication title Matuzumab binding to EGFR prevents the conformational rearrangement required for dimerization.
pubmed doi rcsb
source organism Homo sapiens, mus musculus
total genus 37
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2008-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H01
1CT8B 5CZKA 1DQDH 1OVZA 3AGVA 4MXVE 4DAGH 1AHWA 3OR7B 4G6ML 1P4BH 4GRWB 4OZFH 4V2CB 2FZ3A 1LO0H 2YD7A 1OCWL 3S5LG 3UTTE 5C6WH 5HSFA 3NFNB 3O3AA 1EBPA 1RU9L 4LAQL 5IBTH 3UDWC 5JQ6L 2BVPB 3QAZC 1Z9OA 2Y7QA 4XPBL 5GS1C 3SQOH 5DEFA 4YGVA 2NNAB 1MRCH 3PGFL 3QI9B 4LP4A 4Z5RA 4DQOH 2VXVH 3SDDD 5ENWB 3T3PE 1U58B 3DXAD 35C8H 3V52H 4X6DB 4OD3H 4MA8H 1J8HB 4JDVA 4XC3H 5IROC 5DYOB 5F6IB 3DGCR 5ITFA 3OR6A 1YYML 4K71B 3CXHK 3DTXB 4TNWK 1T5WB 4OJFL 2ICWB 4ZODA 1HKFA 5IBLC 3U1SH 1VFUA 3MRGA 3SN6N 1ITBB 4JFYA 2VLMD 1I9IL 5D7KD 3MRJB 1FC2D 4GQ9L 4WRLA 1JPSL 4Z7UB 4Z7OE 1YEFH 2WUCL 3RZCB 5KS9F 1SY6A 5DMYA 3T77A 5SWSE 3W0WE 2HTKC 2DM2A 3CIQA 3C09C 1OAZH 2AXFB 1QQDA 5HHMB 4ZO9A 4YHNB 3T4YB 5EZOL 2EYSB 3NZHL 3UO1L 4LOUD 3HFML 1S7QA 3D87B 1MHPL 1MLBA 1QFWM 3P30H 3RX5A 3TBSB 5B38G 3UTSA 4AYFA 3SY0B 1KLFA 4CNIB 4FRWA 4WCYL 2AK4B 1ZHNB 3CLFH 4FFWD 1G9NH 4QXUH 3WEXB 4PJGE 5F1NA 5ICXA 3QHTC 2IBBA 1OF2A 5ICZA 5GSVA 3RVTD 3HPJA 4FMKA 3CVHB 1NBZB 4HKJB 3VFMB 5ISZE 2BVQB 5F7FA 4XP5L 1YMMA 5CLTA 2YUXA 3IAQA 4P9ML 1YQVL 1YY9D 4WEMB 5L2KE 1DUYA 2E7BA 3VFUB 2DBJA 2W9DL 5IG7B 1QSFD 3KYMA 5EO9B 4HUVA 5B4MD 1TXKA 1MF2H 5E6YA 5E00B 2FJGA 2YXFA 3AB0C 4X6EA 5J6HA 3ZE1E 3D0VA 1NPUA 5ALCH 1K4DB 2ED8A 1OD7A 1ERNA 1ORSA 3GMPB 2OTUB 3VMPA 2E7CA 1FL6A 4CN6A 1DQJA 1DUZB 1NC4A 4PJBF 4RGMB 3VXRB 4XZUA 4UIKH 1OLZA 1C16A 1QFWL 5TH2B 1IGTA 4QXTA 5HPMA 5JDSB 1CE6A 3VFGH 5KTEH 2CO7B 3SDAD 3VWKB 3T0EA 3L3OB 1EDQA 1NC2B 4IEFB 4UQ3B 1PD6A 3QEUB 4APQC 5JPMB 3WKML 4KQ3H 3L5IA 4BELD 4LVNB 3O3EB 4B7LA 1CFNB 2VISA 3L6FA 1HQRB 3PWPE 5T1KA 1ADQH 8FABA 3K8LA 1T21B 3FB8A 4HWBL 4XH2B 1KJVB 3F7RA 4HGMA 4S1SL 4TUOA 2GJZB 2I60L 2R2EB 1XGYL 4HC1A 2Y07H 5B39A 5IUSA 1G7JB 3QDMB 1I7UA 1DQQB 4JZJB 4OV5B 2PXYB 4CDGC 3HMWL 4IS6B 4YFEA 1OHQA 5IB2B 1FYTA 1RIUH 1MH5B 1QBLH 2V5SA 4M03A 5KSAB 1QHPA 3EYOA 1NGYB 4GKNB 1GGBL 4X7TB 5T3XL 1HKLH 4XBGA 4LEXL 5KVFH 3FHAA 1OSZA 3BN9D 3MRKA 4PGCA 4N8VA 1KNOB 2GAZB 3CAFA 4KRPB 4NKDA 4B0MM 5GRJH 1VPOH 3PP3K 3CC5A 4ZSOB 2DQTH 5MENA 1WK0A 2GI7A 4J3XA 4C54A 2FHBA 4ONGH 4OLYH 5I9QC 4KMQA 1CGUA 2MPAH 2HWZL 5IW1B 4LDLB 1LO3H 4Z95H 4TUJA 1FL3B 3MRFA 5AZEH 4J23A 4PRHE 1JPGA 5F9JB 4MJ5B 1ZE3C 1ND0A 4NQSB 5C7XL 1WITA 1J0KA 1A7BA 4Y16A 4NQEE 4DKFL 4Q7DA 1KXTB 3O4LB 4HS8H 5H37G 5ITBL 2W0KA 5SWQA 2Y6SC 5JMRA 1ZGLA 4AG4L 3QDHA 3LEYL 5C2BH 1GSMA 2B1HH 4HZLA 4AIZA 2CR3A 4XI5C 3ILPB 3NACH 4NO2A 3FOMA 3O8XB 1SBBA 4YXLL 3JBG7 2A6KB 3LB6D 5CUSH 5I66B 3MMEB 2BNRE 1SYSA 5L7XL 4IMLB 4L4VE 3OF6A 3O0RH 3QNXB 3VGEA 3H0TA 2J8UB 1WIPA 2FLRT 4WHTB 1NAMH 2VZ1A 5BZWA 1CZ8L 1PQZB 4ENED 3MR9B 4EIGB 5IFAL 3VRJA 5C0DB 5DO2C 5TDPB 3ZKNC 3LKQB 1YN6A 1MFAL 1ETZA 3L5XH 3KYAA 5CINH 5DJDB 5IMMA 2ITDB 2Y25A 4XPAH 1JPFA 1HIML 4JFFA 3S4SA 3HZKB 1UEMA 3T4AA 2CLRB 3WNPA 3QIWB 1J7VR 3RU8L 3QNZB 4H88L 3DXAE 1KPRA 3EYSH 1WAAA 5CJOL 1S7XB 4ZG1A 4I77H 3QUXC 3ARYA 1ZT4A 3ZKMC 1CLZH 4LHUG 4RQQA 3H9SA 1KB5B 1KELH 5SX4I 1JNJA 4U1SA 1S9XA 1OQOA 1OGAA 2DTSA 3M07A 5DC9B 5D2NB 3GMOA 1KJMA 4M00A 3TBVB 5C9KA 2EH7H 1PAMA 5LGHH 3A6OA 4MMXC 4KI5C 2APBA 1WVZA 2VL4A 4ODBD 1WBYB 5KVMC 2BVEA 2GW5A 4A6YB 1NMAL 3VI4E 1NL0L 1WJ3A 1XGRA 2VLME 5D7KE 1HI6A 1AQKH 5DJCB 1AI1L 4UT7H 1UXWB 4K9EH 3MRRA 5CKGA 2BCKB 5DJAB 1CFSA 3AXLA 4Y0GA 1JWUA 2VWEC 2FYYA 3RWGB 4ONOA 2Z31A 1JWSA 3SKOB 4NZTL 2UUDH 2K7QA 2QQNH 4LSRL 5E5MB 4HUWB 2IAMC 3BPNC 5FM5O 5MP6H 4ZOCA 3GSXB 5ERWB 5ESVB 5JIHA 4NZRL 3ARFB 3KNBA 4HEME 1A6AB 3OG4B 1NBYB 2XPGB 4UDTA 4WIQA 5F44A 1YNKL 3W5NA 4P5TA 3U36B 1MCFA 1NH6A 3FHQA 3TCXA 3OX8B 1N59B 4QRQA 5HGBA 3BO8A 4MCYA 3IJSB 1E4KA 4XWOD 1N2RA 4YR6B 4KHTL 3EOTL 1AE6L 3AREC 3GIVB 4DWHA 4N0UB 4JVUA 4LIQE 4W81A 5J12C 1VEPA 4Y16C 3S5LA 4RISL 5HYJB 3X14B 1JZ5A 3TN0A 2CMRH 2ZCKH 4PJXE 5CJXC 5DQJB 2OBGA 1DP0A 1QSFE 5KSBA 2NY3D 3QJHB 1DQMH 4NT6B 1HYSD 2OQJA 3D69A 4FZEH 1R3KB 1OARH 4GXVL 1OPGH 2LFGA 3M8OH 3CFBB 4ZOBA 2DLIA 1EHLL 4YC2B 3CUPB 2MFNA 1JL8A 2HYMA 4D8PB 3UZEA 4ODUA 4WO4B 3CCHB 4G6JL 1F4YL 4LGRB 5CCKL 4CDHA 3GHBH 1UH2A 4MB5A 3KJ4B 1I7ZB 4PJCE 3VFOB 2BDNH 1MWAB 2NYYC 3HZYB 4R3SB 4PJHE 1FCCA 1I9RH 5GHWH 4IIQB 1BVKA 5DFVC 2GSIB 4OD1H 1G6RL 1UWXK 3KPRA 4XMPL 3UYRL 1T1ZA 1UYWL 2JCCE 4GAGH 3GNML 4KXZH 5D71H 3IDMA 1RULH 4YDVA 3BZDA 3T08A 4PJ5A 4ZDHB 1KN4H 2HVKB 3ZL4H 5IF0A 5F88A 1RUAH 4PY8J 4XCCL 4RDQG 1H3GA 1AY1H 2C3GA 4P23C 3DMMB 4JZOA 4MAYA 2WQRA 3RL2A 3WS3A 4Q74A 4UDUA 3EHBD 4JRYB 4IRSB 1XF4B 3RVWC 2NXYC 2CUMA 1KB9J 4U3XA 2HJFA 3KXFD 4GH7B 2ADFH 4X7DC 4YGAB 4D94A 5B38A 5ABDE 5GS2D 1ZS8B 4PV9A 3LHPL 2ZZUT 3ARVA 4PLKC 5FYKD 1B3JA 3BDBA 3TVMA 3WXVH 2Y36L 4HWZB 5TF1L 4RFNB 5HDOA 4LCUB 3R8BB 1RZJC 2ZUQC 3HPLB 3LSOB 3SO3B 3GI9H 4OAWA 1G9NC 2H2PD 1I8MA 5FCUH 4JFZH 1S7UA 5GRXG 4L4TE 3T0DA 1RUPH 2FECL 2HFTA 1FZJB 3U7YL 1I1CA 1I3VA 3OPZH 1L4IA 3CPLA 5I71C 3RVXC 2Z31C 2F54A 1JBJA 3L3IB 4K8RL 4XP1H 4RBPK 3LRSA 3RWJB 1MAMH 4MX7B 5EU7C 1QA9B 4IJ3B 3FQTB 4R4ND 4OZGB 1ZHLA 1NEUA 1BD2B 1KJ3H 4PRPA 5MEPA 5CEZD 3GMMB 4JY6A 4OZIB 4BK4A 1XF3B 3Q5OA 1CQKA 2HFEB 5C08B 4X7SH 5GS0H 5DI8A 4D3CL 2D4DA 1AKJB 3OR7A 2PO6C 3QIBB 4YWGL 1F90L 3LEXB 1KTDA 4Q6IB 4XPHH 3GUTB 4L3AA 4LCIL 4BZ1H 1E4KC 1FNHA 2BVPA 1MLCA 5E2JA 2FR4B 2Q3ZA 3O3UN 1OAKH 4U1JB 2FGWL 3C2AL 3V6BR 4YFDB 3OAZK 5SX4H 2NNAA 4HJ0C 2UVFA 2HH0H 5ENWA 3TN0C 1RUKL 4Y2DD 3QPQD 4KKBC 4M3JA 1U58A 4N0CC 4JANB 3GGWA 3A6CL 4C57C 2IADB 4DJMA 4KMTL 2YR3A 1NSNH 1J8HA 4J3UA 5DYOA 1B0WA 4KHXH 3IFLL 1SEQH 4QRUA 1KFAL 2HAZA 5DWUH 3BZFB 3CFDA 1C08B 2MHAB 1IAIL 2ICWA 1NFDF 1IBGH 4NDMA 5C0AB 3IDIB 2ZNWA 1VDGA 2EZ0D 2EYTA 4YBHA 2OTWB 1H3PH 1G7LA 1P6FA 4ZO8A 4M7KL 4Y4KC 3MRJA 5DR5L 4Z7UA 4LLDB 2E3VA 4AH2B 2G9HB 4Q97A 3O11B 1HHKA 1REIA 1ZOXA 3QUYC 2OK0L 2CRMA 2XN9B 1T5XA 4YHZH 2AXFA 4KTDL 4MNQD 5KZCB 4GKZB 4A2LA 2WINA 3T4YA 4JM2D 2EYSA 4OLVH 5C0JB 3VFVB 5EBWB 1XGPB 4J3VA 4MD4B 1ZT1A 2ZUTA 4MAYC 4CNIA 4WFED 1ZHNA 2LU7A 2B8OT 3BXNA 4PS4L 4XVSL 3WEXA 2EICA 2YRPA 3JTTA 2VDQL 4ZFFA 5GGTH 1T0NB 2W60A 3QNYA 3HAEB 4X9IA 3CVHA 1NBZA 4I2XB 4OLZL 1CDJA 4HS6B 3S36X 5KVGH 3VFMA 1XF2B 4NNPL 1I85A 4U3CA 2BVQA 1CD1B 4RZCB 5DJ6B 3TYFB 1X4ZA 2I9TA 5D7SH 1LHZA 2GSGB 5TPWH 2E8YA 3QUZC 3F7QA 1RUMH 2DKUA 4B7IA 5EO1B 3VFUA 5IT2H 3THMH 2HKHH 4KAQL 1BEYH 3WN5B 5KVEL 1KJ2L 4LP5A 3QRFM 1M05B 1UWXH 1J9CT 5E00A 2DI9A 3L3KA 1DQDL 1BWWA 4DAGL 4MQTB 3MOAH 3G5VB 3FFDA 4O2CB 1K4DA 2OI9C 1CDIA 1LO0L 1FRGH 2IANB 3OAYH 3GMPA 4H8WC 3MJ7A 4P4KB 5KSBF 2XWJB 5IBTL 1LNUB 3ZKXB 1DUZA 1FG9C 3DX6A 2J12B 2EDXA 2UWEB 3WD5L 1GZPB 5K59E 3SQOL 5CP3H 1MRCL 4UOJA 5JDSA 4DOHE 4DQOL 2Z8WC 5J13B 1NGQH 1RK0B 1MFBH 1UQSB 5DRNA 5EU6A 3V52L 3HE6C 1N6UA 3QEGH 4UQ3A 3EFFB 1BGXH 3QEUA 5JPMA 1OOAA 1IM3B 4OD3L 3QDJD 4MA8L 3O3EA 2VABB 4XC3L 1CFNA 1LVEA 5EORH 2WMPA 1GXEA 1NLDH 1T21A 3ULVD 5EBLB 4BQ9A 2YN5A 2IJ0C 1KJVA 1AXSB 2NY4D 4TSCH 3WIHH 2GJZA 4V1DD 2B5IB 3JV5A 4PJEF 3AY4A 4LHUA 1K3ZA 1RK1B 5AG8A 5CEXB 3QDMA 5F9DC 3GSVB 4XCYB 4XHJC 4XXCA 2EKSA 2IFFH 3GDBA 4JZJA 3NIGF 4RBPH 4OV5A 2PXYA 1YEFL 1MCHA 4LPTA 5LWYH 4GG6F 1S8DB 3BQUD 1I3UA 4M02A 5I73B 4K2UH 4UNTA 4YQXH 4XP6H 1OAZL 1IL1B 2DL9A 1G0YR 1LWRA 4LKCB 4GKNA 4X7TA 3E8UL 3MNVB 5DD0H 3HS0B 4YK4B 3P30L 2Z4QA 4GUPB 2D2OA 3SQBA 1RZJL 2NY1D 2GAZA 3MSPA 3C08L 3CLFL 1G9NL 1NANH 4QXUL 5A43C 1FG2B 4UUJB 5DD3L 4ZSOA 5EA0H 4HH9B 5D93C 4K9EC 5I16B 3K80A 1PY4A 3OAZH 3KXFE 5IW1A 1LO5A 3RTQD 5FYKE 4WWKA 3LCYA 1NMCC 4ZPTA 4NZUL 4MJ5A 4YEFA 1ZA3B 4NQSA 4OFKA 4E9LA 2CRZA 4XNXH 5BXFA 2Q8AH 3CFJB 1DVFA 3O4LA 4K3EH 4YDLB 5IHBA 1R5WB 2Y06H 5INCB 4P5KB 3SDCA 1FFPB 1TCMA 3PQYD 5IMOB 4GRWF 3S36H 3W2DH 3ILPA 3LMJH 5ALCL 1T3FB 2X5PA 2IPKB 3STLA 2A6KA 1NAKH 3CDFA 4QLRA 4M93C 4XCNB 4NC1C 1D9KD 4LVOC 4E42A 4IMLA 4NHCH 2A74B 3ELAT 4UIKL 4GT7A 1TVHB 3QNXA 3SPVB 4WUUA 1FV1B 1YNLH 1G1YA 2DYPB 2J8UA 1IT9L 4WHTA 5IFHH 5E5RB 3KPMB 3VFGL 5KTEL 2FBJH 1MAJA 1PQZA 4ZYKA 2YC1A 4HBQA 4MZ2A 3UJJH 3P0VH 4X6DF 5FO8B 4O5LH 2O5XH 4KQ3L 5CBEB 5TDPA 1XGQA 4HAGA 4FOMA 3KYNB 2XQYK 4LLYA 2DI8A 3GMQB 3KS0J 1ADQL 4Z7WE 2W38A 1FGVL 2ITDA 1WC7B 5AAWA 1HE7A 1UM5L 4I0PA 3HZKA 4IRJC 2AS5M 3QCVH 3QNZA 2ATKA 2MCPH 1H3VA 4GW5A 2DAVA 2Y07L 2GJ6D 3GMNA 1S7XA 5E4EB 1NUFA 1OAXL 3GK8H 5F89B 4XBPB 4JPKL 4Z7UF 5D2NA 2YD8A 3SE8L 3BIKA 4HJGA 4NUJB 3TBVA 5DK3A 4GAYA 4YJZL 1D5IH 3QR2A 1RIUL 1QBLL 3HCVB 2A6IA 2DDQH 3AY4C 3MBEB 5E6IC 4Z78B 3IVKA 2F53D 3GRWH 1HKLL 1WBYA 2EIDA 3ARBC 5IR1B 3FRUA 3NCJH 1DSFH 5KVFL 2WP3T 2V7HB 4JPVL 1IKFH 1OAYH 4MAUH 3Q3GB 5DJCA 1ZVSB 1UXWA 5GRJL 1VPOL 2IF7A 4JFDA 2BCKA 2DQTL 4J1UB 3PJSB 3RVVD 3TC9A 4ONGL 4JFPB 1YNTB 2MPAL 2D31A 4JE4B 5CEYB 1LO3L 4Z95L 5E5MA 3CH1A 3C87A 5AZEL 3GSXA 4ZO7A 5ESVA 1YEJH 3QFJE 4ISVB 2QSCH 3ARFA 3B9AA 2XPGA 4UZGA 4FA8A 4BM7A 3Q1SL 1R3HB 2F5AH 3CX5K 3OGCB 1MPAL 3OX8A 2NXZD 3SGKC 2O26U 2ZCHH 4JHWH 3H2WA 4WWKC 3RKPA 3LVEA 3VDAA 5C2BL 3FQNB 2B1HL 5DVLA 2BNQB 3NACL 4YR6A 2GFBA 3GIVA 4N0UA 3VXPB 3RY6A 2B1AH 5CUSL 5D8JL 1KYOJ 1DVFC 3W9EA 1BFOB 4FXLA 3X14A 5IBLD 4UQ2B 3GIZH 5DQJA 5M94B 3O0RL 5GRUL 1RVFH 3QJHA 2QTEA 4NT6A 2D0FA 2DQDH 3UTTB 3QIUB 2X09A 3CFBA 1EERB 4XB8A 4LK4A 3S34H 2HTKD 4UV4H 1JHKH 2EDTA 1I3RB 3BD4A 4D8PA 3NCYS 2VAAB 2XZAH 4WO4A 3MUGB 4G6AC 3LRHA 5I1LB 3NA9H 1NCUA 5GJSL 1LO4H 2YA0A 3TLRA 5CINL 3VFOA 5DK2B 3QWRD 4XPAL 1V8HA 1HQ4B 1JK8B 1MWAA 1YMHB 3HZYA 1U8LA 4IIQA 3H9ZA 2GSIA 1UA6H 5I1AB 5DT1H 4L9LB 4UU9A 3EYSL 3MRMA 4I77L 1QR1A 3MRCB 3QDJE 1CLZL 5SX5K 1Q94A 2ZPKH 1F02I 4QRRD 1KELL 4X98B 3RWDA 4ZDHA 2P8LB 4KZDL 4BSWB 4OLXL 4I0PC 3ULVE 2XKUA 2HT4C 1TDQA 2EH7L 5LGHL 1H9VA 2EDEA 1BREA 4GRLD 3I02B 4V1DE 4LPXA 1OLLA 3BEWB 3RWHB 4JRYA 4IRSA 1XF4A 3MOBH 1MY7A 4OB5H 3QT2A 5SWSB 2BVUA 3MLTA 5TFSH 3W0WB 1AQKL 4C83B 4UT7L 4I18B 4K9EL 4CVXB 5DRXB 1VERA 3TJHD 2BOCA 4K3GA 4LCUA 4BSVA 3LSOA 2YZ1A 2QLVB 2ARJB 4P9HC 3WDHA 5MP6L 4PJGB 1RZIB 2VLKE 2JK5B 2MKLC 1FZJA 5E08H 1MELA 5DJ8B 4JPIB 4LLMA 5BMFH 4JFEA 5EUOB 5JXEA 4P46C 3L3IA 1GOGA 1JHTB 4YBLC 3VXMD 4APQD 4F15C 1A9BB 5ISZB 3ROLA 3RWJA 4BSJA 4MX7A 4TVPH 2HLAB 1EPFA 3VD7A 3PE9A 2VQ1A 3FQTA 5EU4B 4ZD3H 3N9GH 4IRZH 3U4AA 1BD2A 4XHQA 3DROB 4OZIA 5IQ7L 5L2KB 1XF3A 3NIFF 5C08A 1C5CL 2JTDA 3DECA 2LTQC 3BGAA 1FIGH 3QIBA 2CMRL 5CJ5A 3LN4B 3GUTA 1DQML 2DQJH 2J8UF 3KJ6H 4FZEL 1OARL 3PL6C 2XXMB 4G6FD 3ZYZA 1OPGL 3M8OL 3RDTA 4Z7QF 4QHMA 1F4XH 4HLZH 4WHCA 4KGJA 4OFDA 1R6VA 3R06A 3B43A 1JF5A 4JANA 1I1AB 2ZCLH 3K81A 2YN3A 1EH9A 3G6AB 5DMJB 1QRKA 4P57B 4X5XA 2IADA 3QRGH 1FO0B 4OCSL 3BRFA 5DJXA 4IDLA 3WHXB 4JLRB 2BDNL 4F7MA 1OD9A 1UADC 3C6SB 1I9RL 5HGHB 1KIQB 4OD1L 4EQ2A 1J86A 4OM1H 3PWPB 5I8EB 3NA4A 1C08A 2MHAA 5D71L 4HIHB 1EBAA 1J05B 3C6LC 3FOLB 5T3XE 3IU3B 2OTWA 1KN4L 4RDQF 2P42B 2IALB 1AFVH 3QUMA 5E56A 5D6DC 1RUAL 1HH9B 1AY1L 2ZOKB 4LLDA 5CFHA 4AH2A 1WEJH 3O11A 2GJ6E 3IU4H 2X42A 3IB4A 2XN9A 5AWNH 1IJ9A 2Y6SD 3OTTA 3T2OA 4OBSA 5C0JA 3VFVA 5EBWA 4XI5D 3MCG1 2CXKA 4PG2C 1CK0H 1IILE 3WXVL 3MTRA 2EDBA 3VI3E 3WHE0 1HHJB 1CLOH 2F53E 3IS0X 3GI9L 4N0FA 1N0XH 3FT2A 1T0NA 2ADJA 4ODXB 2B4CH 4RFOH 5FCUL 2K9UA 5JORB 4JFZL 4LCYB 2A73B 1OAQH 1UZ6E 1KPUB 1RUPL 1D7FA 4HS6A 2QADC 3OPZL 1JI2A 5F7YC 2BHZA 1CD1A 5IP4A 4RZCA 2OM5A 2DQGH 4JGMA 2YEZA 1WUNT 4XP1L 2GSGA 5DA0B 1MAML 4PRHB 5DO2D 3PDGA 4FG6C 4ZNEE 5EO1A 4TOYH 1KJ3L 2X4TB 2Q20A 3JTSA 3HI1B 3RI5F 2FSEB 4JKWA 1M05A 4NQEB 3TZVA 3T0ED 4X7SL 4D0BB 3G5VA 5AYUH 1GIGH 4XT1C 2ICWI 4O2CA 2IANA 4OLEA 4XP9H 4P4KA 3ZKMD 4XPHL 2XWJA 1LNUA 1T0PB 3ALPA 2IPUK 1E28B 1OAKL 2UWEA 5JPNB 1HSBA 4QHLB 4NRYB 5E1AB 2EDNA 1J1XH 2VDLH 1I75A 4L4VB 4Z0BH 2NMSA 2HH0L 4KI5D 5F7KC 1G9MH 1RK0A 3VJ6B 1UQSA 4GS7C 4PTUB 1QPXA 1F8TH 1I8KB 4PBWD 1E4WH 1IM3A 1NSNL 3UJIH 3IJYA 1WWAX 1JPTH 2VABA 4BFIB 3GB7B 3GSQA 3EZ8A 5FGBA 1SEQL 4IM8A 5C09D 5F70A 5EBLA 5I1JH 4AMKH 1EO5A 4JRWA 2OMNA 5DWUL 3S35L 3RWCA 4Y5YB 4GKSB 1BOGA 1IBGL 3NCBB 1UM6H 5C0EA 3SDDB 2IAMD 1RK1A 1MOEA 3GSVA 1H3PL 2ZKHH 3DXAB 4OFPA 2JF1A 4JY5H 5I1IH 3OMZA 4P2YA 5E8NB 4KRNA 4NOFA 1S8DA 5J4MA 1WWBX 1HCVA 4POUB 4YHZL 1IL1A 3VH8B 4QRRE 3DVNB 4PR5B 1AQDB 1WICA 1FPTH 3MNVA 4PJIA 5GSRB 1X9QA 1DLFH 3INUH 3ARED 4GUPA 2P8MB 1U9KA 3UTPD 5F3HB 1A4JB 4Y16D 4P9HL 1CXEA 1FG2A 4UUJA 3EYVB 4H20H 3UTQB 5F7NC 4HH9A 1NJ9B 5I16A 3EJZC 2OP4H 1RSFA 3MZGB 2BERA 4U4BA 1LMKA 5KVGL 4LSQH 3HMXH 3O2DH 2BOBB 3NAAH 2VUYA 1AO7A 4WFHD 1FNFA 1ZA3A 3OF6D 4QHKI 5D7SL 5TPWL 1X5YA 5DZNA 4LPUA 3PHOB 1RUML 4R0LA 4OZGF 1UJTA 4HKBA 1QBAA 5IT2L 3TJEL 3CX5J 2HKHL 1A22B 1IGML 1BEYL 5JIPA 1HINH 4N5UA 5INCA 4P5KA 1FFPA 1ZWIB 4M1DH 2H6PB 3X3FH 3U79A 5IMOA 3MOAL 1A4KA 4KK9C 4ESKA 1T3FA 1FRGL 3VXME 1RIVH 2IPKA 4XCNA 3ALXA 3E6HB 4WI5A 4UINL 3VFTB 5ANMA 3O41B 4JFFD 2A74A 1RIHL 4NSKB 3TZVC 1TVHA 3OXSB 5L8JB 1FV1A 3BZEA 4PJXB 4ZUWA 1QSFB 1CR9H 1NGQL 1A5FH 2BJMH 3NPSB 1T1WB 3FT3B 1MFBL 3H9SD 2GUOA 1AXIB 1GHFL 2P24B 2Q8BH 3RVWD 2NXYD 3QEGL 3BDYH 4OTXH 2X41A 5FO8A 2CKBB 3TM6A 1IGYB 2AKRB 3V0VB 2PW1A 4PLKD 2A1WL 3GMQA 5E8EB 5EORL 4HS3B 1B6DA 2F8OA 2Y72A 1U8PB 4F58H 3V79C 1WC7A 4KI1A 1VGEH 4Y5VC 4TSCL 4NRZB 3WIHL 4L4JA 4PJCB 4GRWH 3IKKA 1NMBH 1FLRH 1UB6B 1X4YA 3TPKA 1NCAH 1E27B 4PJHB 4U1HB 2XRAH 3SDAB 3DUUB 1T2QL 4GLRI 4XBPA 2WWKT 1IEAB 2R69H 2PR4L 3ULUF 2JCCB 3HHRB 2OZ4A 1JP5A 4CRPA 4KDWA 4NUJA 5SWZA 4L3CB 3RVXD 2Z31D 2L4OA 1DBAH 3P4OB 1IFHH 3HCVA 4XP6L 4XB7A 4Z78A 2VR9A 3S7GA 3VW3H 3SE9H 1MCNA 4L29A 2MSPA 2YPVH 5IR1A 4MD0A 5DD0L 3VH8G 5J1SC 5IB5B 1QLRB 4QGTA 3EYFB 2VDNH 1FBIH 1BOYA 4H1LG 4P5TD 4PGBB 5HGDB 3ZE2E 1ZVSA 5IJKC 4Z7NF 1T03H 1O0VA 2PO6D 3O4OB 1FZKB 5BS0D 2LAAA 4Y5XB 3SGDH 1K85A 4JFPA 4I5BA 1YNTA 1F3JA 4S0SD 1Y6KR 1AGBB 5JO5A 5CIPA 3T2PA 5CEYA 2WBJB 3FB7A 2G60H 1EXUB 4ISVA 3OKDB 1SBSL 3TN0D 5JW3H 1T89C 4NKOB 4KKBD 5I1CH 3RUGA 1HXYB 4N0CD 3V5KA 4R96B 4DK6A 4NFCA 4GFTB 4XNXL 2I5YH 2Q8AL 3OJDA 5A2KH 4PB9H 3OGCA 4K3EL 4DEPB 1HCFX 3CFIC 3PV6A 1JTPA 5J8OA 4P2QD 4S1DC 3FQNA 1D6EB 1CXKA 2F5BH 1OT1A 1BQHG 1WF5A 2BNQA 3S36L 3W2DL 4KUCF 3LEVH 4R0LC 3EDEA 4G3YH 4UI2A 12E8L 4NQDA 2JIXA 1BFOA 1HWGB 5LG1A 2UWEF 4UQ2A 4NHCL 5EOCJ 5FUZH 3CVHH 1IC4H 5M95B 1YNLL 4IBLT 4QRTB 5E24E 3IAGC 25C8H 3KPRD 5EFIB 5IFHL 2FBJL 2NY2D 4UAOB 1A7QH 1SMAA 4NBXB 2PYED 3UJJL 1IGIH 4NBZB 1Y18B 3TBYB 1I3RA 1UKQA 3ZDYE 4O5LL 4ZQKA 2O5XL 1A1OB 1MHEA 2VAAA 3MUGA 1FAKT 5H37H 4PP1D 5I1LA 5ELIA 2EDQA 3HI5H 5HI4C 4MAYD 2QSQA 5DK2A 1HQ4A 4KI5E 1YMHA 2IMNA 2BP3A 3T1WA 3CZJA 3QCVL 4LCCB 1TQCB 5KG9B 2MCPL 1EHNA 4LLWB 3GK8L 3MRCA 4PREB 3T09A 3D2UA 3UTOA 2P8LA 5IMKA 4BSWA 5T5FL 4Z9KB 5C09E 2VWEE 4M61B 2D9QB 1D5IL 3H7LA 4M5ZH 4RCAA 2DDQL 3ZZ1A 3I02A 3AVEA 3D85A 1S9YB 2VSDA 4X6FA 3BEWA 3GRWL 5AZ2L 3RWHA 3WNMA 1T20B 2NTFB 4MXQC 3NCJL 2C1PB 2XY1A 3MYJB 5D96B 4YDIL 1MFEH 1H3WM 5SWSA 2F9BT 2EEAA 4UB0L 3W0WA 1OAYL 2J88H 1K8DB 3B2UD 3MACL 4JFOB 4C83A 4I18A 1SM3H 3CSPA 4U1GB 1NGZA 5DRXA 2O61B 43C9B 4X0KB 1S7RB 3VGAC 1GC1C 4HV8B 3WE6A 2X9WA 4PJGA 1RZIA 4XNMA 2R1YA 4PJDA 1YN7A 2B4CC 2QSCL 3CU7A 4HDIB 5TE6H 4JPIA 1GH7A 2O5YH 3HE6D 5ISZA 1JHTA 2F5AL 1SVZA 3CFCH 5J0BA 2Z35A 3U0TB 2ZCHL 4JHWL 2QJDA 4Y4HC 5EU4A 5DF0A 5J9PB 2ADGB 3DROA 3MUZ1 1KPVB 3O6LH 3B4NA 3TFKC 2B1AL 3MV8A 2OSLB 3GJFA 3GIZL 2CIIB 4D9QE 1RVFL 4HKXB 4MSWA 5C6TH 2DQDL 5CJQL 2HVJB 2E7LA 2KQMA 3WLBB 5HJ3B 3HNSH 4GLRH 4JN1H 3S34L 1ORQA 3B2VL 3PXHA 2WP3O 4UV4L 2BSSB 4ELME 1LQSR 2RR3A 3H9YA 4DOHB 2XZAL 1I1AA 5JA8B 1G9MC 4JFFE 2NW3A 5F7EH 4P57A 1LO4L 1FO0A 4HUMB 3MO1B 3SBWC 4FP8H 2WBKA 3BHBB 4JLRA 3WHXA 1JZ3A 1A6UL 1WAAE 1G0DA 2NY3B 4J3WA 3C6SA 4OI9A 1H5BB 1C12A 1KIQA 1MJUH 5C0IB 3H9SE 1IZJA 5DT1L 2N7AA 3EOBA 4FQCL 3PWPA 2NPLX 1CGSH 3SCMC 4Y4FA 1J05A 1T4KB 2ZPKL 2H8PB 5JIKA 1RJZB 5J56B 3C5ZB 5C07A 2CSPA 4P3DA 2IALA 4HF5H 5KSUA 5MEQB 1EEUA 1H3UA 4NYLB 4KFZC 4G42B 1Z9MA 1J5OL 1P7QA 4PLJC 1UGNA 3L3GB 1A14L 2AJZB 1D5BA 3G6DH 1ED3B 3MOBL 4O02H 5D5MB 5TFSL 1NCBH 4ERSH 5IQ9B 5J11C 5JOPD 3B6SB 2J8OA 2OJEA 3WNNA 4EBQH 2VR5A 4OIBA 2XY2A 5EU7E 3TH3T 1QBMH 4XPFH 1HHJA 3R0NA 3WFCH 5FM5M 4QRSB 4CMHB 4NNYB 4ODXA 3LDBC 2GITA 2QEJA 3VFWA 3OKKB 4LCYA 2A73A 3PWLB 2J2ZA 2X7LB 1KB5H 1E6OH 1KPUA 3V6ZA 5E08L 5AYQA 4KUZH 5BS0E 3KXFB 3MUY1 1T0MB 4HIEB 4KY1H 5GGUB 5TDOA 2DTMH 2YUZA 4EI6B 3PIQA 4AEEA 4PRHA 4M1GH 4TVPL 2R56L 1CWVA 1D5ZA 4ZD3L 4A6YH 5I1DB 1AJ7H 2DIAA 3N9GL 4IRZL 2FSEA 2MQ0A 4IRJD 1RMFH 5EU6D 4D0BA 3ZE0F 4QTIH 3U6RB 4MNGE 5FOBB 4MXVF 4XCFH 2DQJL 2W92A 1EEZB 2WIIB 3KJ6L 4P2QE 5BJTB 3NBNA 1DL7H 5JPNA 3U0WH 3ARQA 2XKSA 4NRYA 2B20A 2BNRA 2W65B 1BLNA 1DBKL 2VQUA 4L4VA 5E6ID 4HT1H 4LHUD 2BSRB 2P8PB 2VDPL 4G7VH 3ARBD 3E3QC 1LP9E 1NDGB 2ZCLL 3T3PF 4MD5A 1HNGA 3QRGL 3U46B 5KN5B 4OUOA 2J6EA 4YNYB 4XVJH 1B88A 4U0RC 3EAKA 3GB7A 4PD4K 3KR3H 3S98A 3SKMB 4G7YH 2PYEE 2YBRB 4OM1L 2V17H 3RIAK 1N5AB 1UEYA 2DQIH 4Q2ZB 4U6HB 1P2CB 1EX0A 2CJUL 4GKSA 1UC6A 4S0TD 5CLWA 4JREC 4W6YB 3SDDA 4J3OC 5EZLB 1T7WA 4QNPE 5TQ2H 2CLVB 3O6MH 4F7PB 3DXAA 2P44B 5E1HB 1CE1H 4ZS7H 2AXGA 4KK6C 1KTRL 2XWBB 3LKPA 3V6FA 4Y88A 5DUBB 3MRIB 4X6BB 1GGIH 4PFEA 4ZUTB 4Z7OF 5HVHC 3IF1A 5AWNL 1UT9A 4LVHC 3VH8A 3QI9C 3DVNA 4PR5A 4WWKD 1AQDA 5GSRA 4EDXB 3QQ9C 4DGYH 1PG7X 4H1LA 2EDWA 1CK0L 2HT3D 5GRZA 4FQ1H 1MWAH 2XA3A 4KJYB 1A4JA 3QZWG 1T2JA 1DVFD 2OL3A 4FNLH 1CLOL 2W0LA 3UTQA 1N0XL 1EGJH 1NJ9A 2ICCA 1SEBB 4PJGF 2B4CL 2YD1A 4RFOL 2X4QA 4K71C 3SDCD 5HPOA 4R97C 4JPWH 1OAQL 5IB3B 5A3IC 2C1OB 4PJ9C 1CDGA 2ZUYA 4JM2B 1VFAB 2DQGL 5EUOF 2BOBA 3QFJB 4G6AD 1W72A 4WUUD 5ESQA 3IGAB 3BRGC 1G6VK 4TOYL 5LKNA 4M6AA 4ONFL 2AV7A 1BQHA 1ZWIA 4WNQA 2H6PA 4JGJA 2JE8A 4P59H 5AYUL 1GIGL 5E7BA 1A7RH 5IIEB 1WFUA 3ZE1F 4ZUSA 3E6HA 4C56D 1OTSD 4Y2OA 4EKXA 4KDTA 1I8LA 5EBMB 1DQLH 3V5HB 3OXSA 4I0PD 3VXSA 4NN7B 2HT4D 3OGOE 5BOPA 2OYPA 1J1XL 1S9WB 5TJWK 4Z0BL 3RHWF 3K8MA 4W6XB 3FT3A 1G9ML 1SJHB 1T1WA 4LMQI 5HI3C 4G9DB 5I1KH 1F8TL 1XFPA 1GL4B 1K4CB 1QRND 3PF2A 1E4WL 2V5TA 1DJSA 5GGQH 2IH3A 5HHQB 3UJIL 3HUJF 1JPTL 2V5YA 3V0VA 4RMRA 3GSUB 3L7EB 3GSNA 4U6XB 3VXQB 1P5UA 4PGDB 2A6DB 4HAFA 4NRZA 3IT8D 2V2WA 4OGZA 2FEEI 5F3BA 4JQVC 4DVRH 2VERN 4EUPB 1MCRA 1KCSH 4PJHA 5F21B 3DVIA 3SDAA 1XCTB 3BWUC 3DUUA 4JFDD 1BECA 1D3CA 1IEAA 4JY5L 2D03H 4WDIA 4W70A 1LDPH 3K3QA 1X7QB 3QDJB 5HDBE 5I1IL 3BUYB 4JFQA 4P46D 1N5YH 4ODSH 3LAFA 3BPCB 4NQUA 2D9CA 2M2DA 5ETUA 1QVOA 3O2VH 1FPTL 2NY4B 3ARFD 4V1DB 1DLFL 5I1EH 1M71A 3INUL 4DW2H 5DMKB 1XGTB 5D7IE 3KYOB 3DJ9A 5MHSD 2AEQH 4ODTL 1FZKA 4H20L 1UJ3B 4PUBH 2OP4L 3BQUB 1AGBA 3L95B 4JDTH 3PL6D 3VRIA 2WBJA 3PHQB 4K7PH 5JOPE 2BZDA 3GM8A 4GRMB 4YUEH 2R8SH 3QSKB 4LSQL 3HMXL 1RV6X 1EXUA 1OP9A 3EGSB 3O2DL 5A2LH 3SKJH 1RFDH 4AENB 3C60C 3OKDA 3NAAL 3ULUH 1PG7H 4M6OH 4NKOA 5I6XB 4NC1E 1FJ1A 4L4TA 5FYJU 2NY1B 4K23H 3WNLA 4NN6C 4XNZB 4L8BB 5F7MC 4GW4B 1FSKC 1QYGH 3O6KH 3TO4A 3P9LB 4PB0H 1G7PB 1UCBH 3PDDA 4XWGH 1HINL 3GMRA 3CH8A 1VKXB 4P49A 1CCZA 1ACZA 5IHZB 3NIDE 1D6EA 4M1DL 2P7TB 3V4PH 4U7SA 3PWNA 2RAMA 1CIDA 1DEEA 3RTQB 1RIVL 2C7UB 1FDLL 3E2HB 5CSBA 3C6LD 1KEGH 1AC6A 3BGFB 2DWEB 3DV6A 2NR6C 2CD0A 3VG9B 3U7AA 4EIZC 3HAEH 5IB4B 4NZDA 3U30B 1C1EH 5JIIA 2GT9A 4QRTA 3DARA 1CR9L 5EU6E 1A5FL 5EFIA 2BJML 2A83B 5BV7C 1A1NA 4B53A 3QA3B 1WIOA 4JZNB 3HLAB 2Q8BL 3PQYB 2J5LB 4WW1B 1Y18A 3TBYA 3BDYL 4KDTC 1I8LC 4KJPC 4OTXL 3VGBA 3W82A 5CZXD 5F7DB 1K2DB 1WZMA 2ZG1A 1D9KB 2H26B 1EHXA 3FMGL 3RGVC 6FABH 1FLTX 4JRYD 4LCCA 4IRSD 1M1SA 5D9SA 5KG9A 4S1QH 1NMBL 1FLRL 2X6MA 4KV5E 2XRAL 1KOAA 4EUPG 3I50H 4PREA 3GJEA 1IQDA 2QADD 2R69L 3RFZC 1WGOA 4WHYG 4M7JH 5EIIB 2X4UB 5C3LD 4F9PC 4M61A 3QQ4A 3VG0H 2VH5H 4FG6D 1S9YA 3X3GH 1BPVA 2O5ZH 3HC3L 1N64H 1ZSDA 3VW3L 3SE9L 3JWDC 5AD0A 4P48A 1T20A 2EC9T 2VLJE 3HE7A 2C1PA 3RY5A 3MYJA 4UTAH 2VDNL 3RBGA 2GJ6B 1FBIL 5HGAB 3D25B 4JFED 3VI4F 2PYFB 4JFOA 1T03L 3CVIH 4X5WB 2CLZB 3JSSA 5T1LA 2XIDA 5IEKA 4X0KA 1VCAA 1U8KB 4X80H 4P3WA 1FNAA 3C5JA 3A0OA 4Z76B 5LGKA 5GXBB 2A6JB 2G60L 2F53B 2BK8A 3PWJB 4TSBL 4O00A 5CGYC 1KCVH 3QCTH 5JW3L 4WW2B 1OTUC 2I5YL 2QQQA 4PB9L 4QF1B 3RDTD 3VFSB 1LK2A 2ICES 3WYRA 1Y6MR 2OR7A 3PWUB 2LVEA 2ADGA 4P2OC 3QAZB 1WFOA 4LBEB 2ZWLT 5KOMC 5GS1B 3LEVL 2IBZY 2WWKO 3DURB 2FDBP 1JGDB 3MRDA 4G3YL 1QR4A 4WUUE 3P4MB 3TO4C 1D6VH 1S7VB 1JGVH 4OIIL 4LPWA 3LPFA 2CIIA 2ZG2A 5GZOC 3F6LA 1U8NB 3CVHL 2CK0H 1IC4L 1U41A 4PJXF 2HVJA 5I19H 3I3DA 2A2QT 25C8L 4ZFOL 5IFJB 2NXZB 1QKZH 3MRHA 3WLBA 5T3ZH 3MFFB 5DHYA 3RWEB 2BSSA 4KC3B 1IGIL 3U2SA 4MNHB 4C56E 1I9JH 4NIKB 1B4JH 2EYRB 3HKFA 3WDIA 3DPBA 4U1NB 4LARH 3MODH 3HG1E 3HR5A 2XWTA 3WJLA 3CU1A 1KIPB 4H26B 1LE9B 4PJCF 1MJJA 2N7BA 2VZVA 4U6VH 5C0IA 3TA3C 3DX8B 4PJHF 1YEIH 3EJZD 1QRNE 2NLJB 4F80A 3FZUC 3NN8A 3C09B 1SMOA 1FFOB 2H8PA 2JCCF 1RJZA 5IHUH 3C5ZA 3FTGB 5F93C 4X8JB 3CX2A 3GMLB 1B4RA 5JOFB 2FX7H 4NYLA 1OW0A 1KUMA 3U4BH 1DQTA 4G42A 3JV4A 2AJZA 4ELKB 2EE6A 1ED3A 4MA3B 1MFEL 2RHEA 2CQVA 1HHGB 5IQ9A 3MLXH 3O45B 2J88L 1NBQA 1UWEH 4QRRB 1SM3L 4R7DA 5HHOA 3QZWA 4KK9D 3B6SA 3RX8A 3CFEA 2OCFD 3KPNA 1TVBB 1CL7I 1PG7W 3T2QA 3HE7C 3MNWA 3L5WA 5FA3B 4QRSA 4NNYA 3TZVD 3QXAB 2ZUSA 3OKKA 4X4XB 5A40E 3PWLA 2G5BB 1U8OB 2YPKB 4KUCD 2OZ4H 4DUWA 2IAND 1LD9B 2A9NH 5MHSE 5FKPB 5TE6L 3AB0B 3KXFA 1T0MA 1FVEB 3TCLB 2O5YL 3AS3A 3NFSL 5E8DH 3CFCL 1QOKA 5CZVH 2FJFA 5I75C 1DBJH 2DLGA 4DKEH 3TBTB 1OQXA 2JJSA 3S96B 1NUNB 5E7FA 4XRCA 1PYWB 4WY7H 1P9MA 4X8XA 1R5IB 3O6LL 1D5XB 3FQXB 3S88H 2FZ3B 1CICC 1PY9A 1KN2H 5JHLH 5FOBA 4NM4H 2Q86A 4X4ZA 1NFIA 5C6TL 5BV7L 2WIIA 5D1ZC 3VXMB 4APQB 5LQBH 1WLHA 3VFPA 3HNSL 4YGVB 4JN1L 1LDSA 3U7WH 3LKOB 2BSRA 4KK5C 5ACMA 1F58H 3LQAH 4M4PA 4MJIE 2R23B 2BY3A 4YHIA 1BQLH 1LEGA 3MXVH 3MRLB 5F7EL 4IMKA 3RWFB 3U46A 4FP8L 4YNYA 4JDVB 1G6RB 4HJJH 4RMWA 1YEKL 3IXAB 3OR6B 1JZ8A 1MJUL 2ZP0T 4G6FB 3SKMA 4QWWC 4XVTH 3RAJH 4U6HA 1P2CA 5L88H 4CGTA 4Z7WA 1TZGH 1MRFH 5IVZB 3S3JA 3UZVB 1RQ5A 4KZEH 2CLVA 4HF5L 4F7PA 4P3CH 5JLZB 4AEHH 2XWBA 3JWDL 4E41D 4DFIA 3T77B 3MRIA 5JR1H 4ZUTA 4PRAA 3G6DL 4O02L 5I9QB 3RL1B 5LXGH 1CVRA 4S1DD 5DVNA 4MGXA 1NCBL 4ERSL 2J8HA 4L8DB 4TVPD 1ZLSH 5DC0A 4EDXA 2F8VA 1AO7D 1OW0C 3ESVF 2X05A 5TE7H 4EBQL 4KJWD 5K9OB 2A9MH 3DSNA 1QBML 5ICXB 3P9WB 1HILA 3WFCL 5ICZB 1NCNA 5GSVB 4NRXA 1SEBA 3IDJB 1EJOH 1RZKH 1B0RB 1KB5L 1E6OL 2P46B 4JFEE 3KLHC 2C1OA 3F62A 3HRZA 1CFVH 1VFAA 5E8OB 4KY1L 2AJUH 4XAKD 2DTML 2VYRE 1ONQB 3I2CH 4BYHA 3QFJA 5BO1H 4M1GL 3BGMA 1DUYB 2VN7A 1BF2A 3X11B 4A6YL 1UKSA 3IGAA 3EKCA 1AJ7L 5HI4D 4O51A 5I0DA 2HJLB 1U3JA 4X6EB 1BFVH 4NQXB 1RMFL 3D0VB 1DCLA 3FL7A 1X4XA 4MMZC 3UAJC 1B9ZA 4U6TA 5IIEA 4QTIL 2AEPL 4M8QA 3ZTJG 2QQKH 1IKNC 1JV5B 5F8QC 4XCFL 1A3LL 1DQJB 2EDYA 4QXWA 1FGNL 2WSKA 5BW7A 4LASH 4UOW1 1AIFB 1DL7L 5EBMA 3U0WL 1C16B 1VA9A 3UCRA 1H8SA 1IGTB 2E5EA 3FT4A 4QXTB 3AAZB 4YFLF 4Z8FH 1X6NA 1S9WA 5ID0B 4Q9RH 2W0PA 5K59F 4HT1L 1WISA 2NY6C 1SJHA 2J3SA 2E6QA 2MKWA 4G7VL 3T0EB 5D1XC 1XR8A 2YK1H 4MXQD 4G9DA 4WI8A 3QEHB 1EUTA 4WENB 5SWZD 5HHQA 2XT1B 4XVJL 2FHFA 4RGOH 1OB1A 3ARZA 5EIVA 4JHBA 3FB8B 4U6XA 4G7YL 3N1QC 4ZFGH 2V17L 3VXQA 4PGDA 2A6DA 4IMKC 3GZKA 1XEDA 1KEMH 4EUPA 5C1MB 5TQ2L 1CL7H 2WV3A 3O6ML 1MFCH 4RA0C 3QUKA 3GKWL 1CE1L 1WZLA 3JVGC 3BUYA 5E2TH 5FYJH 1GGIL 2XI9A 5CSZA 3BKMH 2GYSA 5EDXA 4JVWA 5D5MF 2Q7YB 4XP4H 5C09B 4MXWH 4MQXC 2HTLC 4NUGH 5FB8A 2AJ3B 1G84A 4DGYL 1A02N 1FO0H 5DMKA 1OSZB 3OKEB 2IAMB 3BPNB 3DRQB 4PJ8A 5BVPH 3TFKD 4FQ1L 3MCLH 4NKDB 4N90D 1AH1A 1X5GA 3CC5B 1AD9A 2V9TA 3QXUA 4FNLL 3IFNH 2VE6A 2X10A 2X4RA 2FWOB 1EGJL 3K8KA 5FA4B 5F7HA 4LLUA 2NY5H 3OB0K 2P49B 4JPWL 2YRLA 2CRYA 4WTZG 3NOIA 3TEUA 4GRMA 4LEOB 3GFUA 4RNRB 3EGSA 3LPGA 4AENA 2VTFA 4H0GA 4NQDD 3WUZA 2JIXD 1ND0B 3L3DB 5E2VH 2RGSA 3AREB 5J12B 2VLKA 4AM0B 3TBWB 2FBOJ 4X7FC 4Y16B 1WBXA 4LQFH 3GHEH 5H2BA 4L8BA 4ZXBA 4GW4A 5HYSG 4LGSB 3P9LA 4WVRA 1G7PA 1EZVX 2EC8A 5DK0A 4XCEA 2OXGA 5J6GA 1VKXA 2FATH 1UH3A 4AIOA 1A7RL 3FOMB 1CXFA 1XIWA 2C7UA 4G8IB 3SCMD 3J7HA 3DHJA 3NTCH 1SYSB 5EWIH 3ZTNH 3CDYA 4KJQC 3OJMB 1ZVYA 1DQLL 1NGXB 1KC5H 2NY0C 1RURH 3H0TB 3UP1A 1MIMH 2C5DC 1S9VB 2A83A 2LVCA 4W68A 4CW1B 3QA3A 1IAOB 3D2UD 5I1GH 5A1AA 5I1KL 4WW1A 3LS4L 4YE4H 5K33A 5FKAA 1NCDH 4G8FB 3C5SB 1YN6B 4LLAA 1OTTC 3CGTA 3HB3C 1MNUH 4ZTOH 4HWBA 1ETZB 1UXSB 4CAGA 1OM3L 2H26A 4KVNH 4BH7A 2F8XC 3D85D 5EO0A 1YEHL 2QV2A 4MHHG 4C4KT 4F9LC 3WFDH 4JFFB 3S4SB 3DUSB 3G08B 4LLVB 1MCPH 1KPRB 2PKDA 4DVRL 3W0WD 1KCSL 1WBZB 3LKRB 1ZT4B 4EI5A 4RQQB 3H9SB 1GVIA 2ADIA 4RRPG 4U1SB 2NXYB 2D03L 3OHXA 2UYLB 4U2YA 1KJMB 1LDPL 1O7VA 2R4SH 1T1YA 5EIIA 3DYOA 3REVA 4PJIE 3UPCA 2HP4A 3EJYC 1FORH 1MQ8A 3O2VL 2ZUQB 3CNKA 4BUGA 4CADB 1XGRB 3FQUB 5DHVA 2GJ6A 1TZIA 1HI6B 4R6UA 1NCCH 3K2UH 4KQ4H 5C92A 3D25A 2PYFA 4NQVB 4E41E 2AEIT 1TJGH 3D1MC 4X5WA 1CFSB 1PVHA 2AEQL 3D39E 1TFHA 4EJ1C 2FYYB 4PUBL 1ZVHA 5I71B 1U8KA 2Z31B 1JWSB 5FGCE 4TVPE 4UNUA 1SQ2N 4Z76A 3BH8B 4PJ8C 4K7PL 1AO7E 4YUEL 2A6JA 2R8SL 4JM2F 1RD6A 1JMZA 3R4DA 3PWJA 4OZHA 3MV8D 1RFDL 3KLSA 3KNBB 3L5HA 1GGYA 1Q9LA 1PG7L 4M6OL 3WXWH 4KMLB 1KIRA 4N1EA 1U91B 2PO6B 3O6KL 4QF1A 5BS0B 5K9KB 1T6VN 1UCBL 3GO1L 3VFSA 1GCFA 3BO8B 3MBEC 2CUHA 3UDWA 1QO3B 3VD4A 5K93A 4OZFG 1N2RB 3V4PL 3OXRB 4V2BA 4LBEA 2HFGH 4K7PY 5ANME 5TDNB 4ZNEA 2VRAA 4XAKE 2X9YA 5GS1A 3DURA 3QDGA 1JGDA 1BAFH 4ZXBC 1KEGL 3P4MA 3TN0B 1S7VA 3NH7H 4D9LH 1ZHKA 5FYLD 1A64A 1C1EL 2OQJB 3ARWA 3K1DA 4MNGB 4KK6D 1KCUH 2ZOLB 5IK3A 5IFJA 3PWPD 1XIWC 5I1HH 4XXDA 3MFFA 4P2QB 4Y4FD 1OP5K 4G5ZH 1WCQA 5FHAH 2ICEB 3G9AB 5C07D 3UBXB 2ID5A 4J6RL 4MNHA 4ODUB 4W6WB 4LSSH 3QQ9D 4TVSa 3P11L 1L9MA 1I1YA 5JNYB 1ODAA 1MHCB 1WQVT 3FRPG 1P7QD 4N1CA 6FABL 4S1RH 4H26A 1KIPA 3OB0H 4L9DA 1LE9A 4HBCH 3ROOB 4NKIH 4EN3C 4OV6F 3DX8A 4AL8H 3KPRB 4MS8C 1JHLH 2NLJA 2NY2B 3QUYB 3EOAA 3I50L 1WWWX 4YH6A 2PYEB 5A3ID 4LIQH 1FFOA 5E03A 1QSZA 4PJ9D 3FTGA 1J10A 4LRIA 2OJZH 4X8JA 5F88B 2HFFA 4M7JL 3GMLA 4EZMA 4DUXA 2XTLA 2L7UA 4JZOB 3VG0L 4MAYB 1T2XA 2C4XA 2VH5L 5AG9A 1ZA6A 3ULVF 3X3GL 2O5ZL 2VKWA 4UDUB 4WEUD 1N64L 4EI5C 4FXKB 3V6OC 3GBNH 2XV6B 2W91A 4UTAL 4MA3A 4OF7A 2CKBH 2HJFB 1P4IH 1NFDE 4WU5B 1HHGA 3FN3A 3O45A 4I9WD 2EXWC 4LGPB 4R7NB 3CVIL 1UM4H 2DI7A 4QRRA 3MXWH 1S3KH 1J12A 1NLBL 4OAWB 1TCRB 1JUFB 4R8WH 3FONB 4NQTA 4HPYH 3RUGE 4L9LC 3MUJA 3TGXA 5J89A 2G5BA 1RZKC 4HFWB 1KCVL 3QCTL 1LD9A 1MI5A 5HI3D 1AGEB 3GM0A 3TCLA 5DA4A 3ZT5A 1M4KA 1TPXC 2OI9B 3DI2B 2BNRD 2I07A 5DJ2A 1ZHLB 3KPLA 1GZQB 3S96A 2R1WB 4PJ7E 5GGVY 5FM4A 1F4AA 4NQDE 3KPSD 1R5IA 5DI8B 4FQXC 2YOCA 1D5XA 3FQXA 2P47B 3PGCB 1DDHB 2C3WA 4BZ2H 4YX2H 5B3NA 3I9GH 4HD9A 1D6VL 1KTDB 1JGVL 1S78C 3B5TA 3SOBL 2FEEL 1VFBA 1MLCB 4WU7A 3HE6B 1JFQH 2CK0L 3VXMA 4APQA 2DICA 5I19L 3MA9L 1QKZL 2H9GB 5GZNC 1P1ZA 4YAQA 5T3ZL 4K07A 4NC0B 5DDHB 2DQCH 3MJ9L 3LKOA 2JELH 2VZSA 2EE9A 1S5HB 4OFYD 3GBLA 4D2NA 4HWEH 4P4RB 2FEDC 2R23A 4XNQB 1I9JL 3GGWB 3MRLA 3UBXG 1B4JL 3RWFA 4LU5H 2P5WE 4FQ2L 4BQ8A 3DIFB 1G6RA 1S5IH 4PJFE 4LSPH 4LARL 1FZOB 3IXAA 2FGZA 4U6VL 4QRUB 2XKNB 1YEIL 3CFDB 1ZT7B 4JFHE 4NDMB 3G04B 7CGTA 5IVZA 2IGFH 2EYTB 3MGTB 3U82B 1JGLH 3JUZA 5IHUL 2BFVL 1G7LB 2PF6A 2P43B 3C60D 1JTTA 2W9EH 1MCIA 1A6PA 1PKOA 5JLZA 4ZUUA 3U4BL 1FE8L 4BKLB 4HG4K 2AABL 1HHKB 4YZFE 4XMKH 1PEZA 2HT2C 1OAUH 1S9KC 1T5XB 3ARTA 1KTKE 3FFCA 1X5KA 2FX8L 2WINB 5D93B 3RL1A 5BRZE 4LRIC 2X4SA 4L8DA 1K8IA 2XICA 2EEDA 1N7MH 1ZT1B 3U9PL 1QSED 1BBDH 4KDVA 1DE4A 1E4JA 3BXNB 5K9OA 1NMCB 3JTTB 4ZFFB 2EXYC 5D7IB 4XC1H 4PJDE 3GBMH 2W60B 1FFRA 3VI3F 4GG6E 3QNYB 3V4UH 3IDJA 4QHUB 3L3HB 1BM3H 1B0RA 3L7FB 4WTZA 3QWOB 4H0HB 5FM8A 2D0HA 4OCLC 4QEGA 1OP5H 2R9HD 4BFBD 1YZZA 4WW2F 2A9NL 4FQPA 1UZ6F 5E8OA 4JAMA 2F19H 2I9TB 2R2CA 1ONQA 4KJPD 5GRWA 5CZVL 1E0OB 3VXSD 2AV1B 1DBJL 2MNUA 3WL9B 5HYSA 4DKEL 2APVA 4NQCD 3BEVB 4Z7VE 5JHDE 4M93B 3X11A 1WCBA 2VUOA 4LVOB 4WEBL 3MV8E 4WY7L 1RZGB 2HJLA 2EKJA 4M62H 3RGVD 1G9EA 3L3KB 4NQXA 3E3QE 3EYUH 3S88L 3FFDB 3MJ7B 1KN2L 5JHLL 5EC2B 4LSUL 4NM4L 1JV5A 2A0LD 3DX6B 2IG2H 1AIFA 5LQBL 2ZNXA 3KPQA 4GBXC 2XA8H 3QEQD 1U42A 1HSAA 3K2MC 3AAZA 3B8SA 1ITCA 2UUDK 3JWOH 4OSUH 3U7WL 5ID0A 5JOEA 4RX4A 3LQAL 2DLEA 2YPLD 4Q0XH 4IRJB 1BQLL 5DRNB 5FYLE 5EU6B 3MXVL 4RWYH 5L9DH 3QEHA 2V7NB 5GRVK 2VZTA 3AM8C 5I8OH 3QUXA 1OT2A 5K9QI 3C8KB 4HJJL 1LGVA 3DO7B 4HIIB 4KPHH 5MI0C 4LNRB 4XVTL 5C07E 3RAJL 5K9JL 5L88L 4OQTL 1TZGL 1MRFL 3KHOA 5E6IB 4NO5B 2GCYB 5I74C 4LHUB 1X5IA 1FNGA 4RRPA 4X6CA 2VLLA 3ARBB 2H1PH 4URTB 2EKSB 1S7SB 1CLCA 1SVCP 5CGYD 1VHPA 4AEHL 3DGGA 3QQNA 5D7JA 4L1HA 1FFNA 3QH3B 1OTUD 5F6HI 5JR1L 1BZ7B 1Z5LB 2YUVA 1CDYA 2WBJD 4LL9A 2Q7YA 5C09A 3RJDA 5GS3A 2AJ3A 5D7LD 2LE9A 4OF5A 4P2OD 1XGUB 1ZLSL 1P53A 2BHYA 3BFOA 2Z4QB 5JA9A 3OKEA 2Z91B 1VEMA 5TE7L 2IAMA 4NC2B 3DRQA 4L4TD 3SE4C 5FFLA 4KXZI 3TO4D 2AK1H 4U1IA 5JDJA 3AMLA 5GGSY 2FWOA 3S9DB 1EJOL 1RZKL 5FA4A 2DMBA 4B5EA 5IEHB 2PN5A 3QPXH 1LO5B 4I9WE 1A7PH 2XZQH 4WWKB 4LEOA 4HCRH 3VDBA 1CFVL 4RNRA 4ZPTB 5IV2A 4M3KB 4JM4L 5FDYA 2FB4H 3WFBL 3SDXE 2AJUL 3L3DA 3PABA 3AREA 4TPRH 3I2CL 1BQSA 4AM0A 3TBWA 3V0WH 5BXFB 1DVFB 1UWGL 4UT6L 1G0XA 4K8RC 5CJXA 2EIBA 3N1PC 4OZFA 3SDCB 5JZ7C 2EC9U 1BFVL 1F11B 5EH1A 4F57H 3VGDA 4XBEH 5C0ND 3STLB 2FNBA 3BE1H 2QQKL 4G8IA 3ARDC 1T83C 2DJ4A 3FZUD 4J12A 4OGAC 3DOSA 4E42B 1A1MB 2ZJSL 5CSGA 1NGXA 1TTUA 4WUUB 4XGZB 5ADOH 1A8JH 4Z8FL 3KPSE 3P3YA 3UJTH 4Q9RL 1PW3A 1S9VA 1JYNA 5IW6B 1L6XA 4CW1A 4ZYKB 3MJ6A 4K3JH 2YC1B 5GS2H 1IAOA 5F96H 2VDOH 2YK1L 5FYKH 4S2SB 2V5MA 5GQBA 1XGQB 4G8FA 1F3DH 1PLGH 3C5SA 4RGOL 4LLYB 3O6FC 3FRPA 1INEH 1UXSA 3BUTA 4ELMA 4OUUA 5FEBA 4C56B 1CXIA 5FDWA 1YDPB 4PGEA 4ZFGL 4I0PB 4R2GC 2AJVH 3DUSA 3G08A 2ATKB 4LLVA 4P23A 3HE7D 4FS0A 4Q6YA 4GW5B 3V8OA 3GMNB 1KEML 2K3TA 4NFBA 4YPGB 1WBZA 3LKRA 43CAB 1CL7L 3CMGA 5HVGB 1IAKB 1QRNB 4MWFB 1Y6NR 2UYLA 5T1LD 3BIKB 4HJGB 3RPKA 3ARRA 4GAYB 5E2TL 5FYJL 2NCMA 2A6IB 3BKML 1TMCB 3OG6B 5CEZH 5GPRA 3IVKB 4XP4L 5EN2B 3AFLA 4M48H 3FRUB 2VIRB 1VADB 2WNGA 3P9MB 4CADA 3FQUA 3T0AA 4M6MH 5D7JC 3MCLL 1Q0XH 4NQVA 1BVLB 2IFGA 4JFDB 2Z8RA 4G43A 1CICD 3ZE2F 3IFNL 2JLLA 2PCPA 3BYYA 1F42A 2D31B 5E2UH 2NY5L 4P46B 4YBLB 4F15B 5D1ZD 1CD0A 3CH1B 3BH8A 4O4YH 1EJ6A 1VGKB 3NCFB 1QSEE 5DQDH 4D9RD 4I3SH 4PP2A 5E2VL 1W2KT 3RIFF 1AGDA 2KQNA 2DS4A 3VMOA 4LQFL 1CFQB 1U91A 5IJVA 2PO6A 5BS0A 5K9KA 4M7LT 1PGRB 3EBAA 2M8XA 4FTVD 3SO5A 3JV0A 3L9RA 1QO3A 1RJCA 5I18H 1NGPL 4OI7A 3PL6B 3OXRA 3P77A 4TYUA 2GFBB 3B5HA 5TDNA 2ZSWB 4QWWD 2HKFH 5KAQG 2O93L 3NPZB 4JG1H 3VXSE 3W9EB 4NQCE 1MCLA 3NTCL 1H3TA 5EWIL 4XPTL 3ZTNL 1XAUA 1N6QL 5EPMA 2VZUA 2L7JA 4Y5XC 1KC5L 2C3XA 1RURL 1JZ6A 3TPUB 1MIML 4MNGA 5JXAH 5DD1L 1INQB 1FYHB 3I6GB 2YMXH 2ZOLA 2AGJH 1V3KA 4NHUB 4P2QA 4F7CB 5B8CC 4F37F 5I1GL 2QR0A 5KANI 2ICEA 3C5ZD 3UBXA 1ADQA 4NO0A 1QHOA 3ZHLA 5F1IA 4KTEL 1HHIA 1MNUL 3QEQE 1J1OH 3BN9C 4ZTOL 3C6LB 5HBBA 3ZDYF 4KVNL 1I7RB 5JNYA 5JW5B 1MHCA 1LP9A 3QFDA 4F3FB 3PNWA 2DKSA 3AC0A 3GSRA 1E4XI 3MLZH 3PG2A 5DGRA 5F71A 3WFDL 4IOFC 3K0WA 3ZDXE 1U8LB 2YPLE 1B2WH 4LAQH 4Y4KA 3ROOA 4KI5F 3CXHJ 4UU9B 3MRMB 3U9UB 1QR1B 4PRBB 3QUYA 5DJZB 1Q94B 5HHOD 3N1GC 3RWDB 2PYEA 3KLHD 3U0PB 3OAYK 5I8KH 3NCYP 2R4SL 1CFTA 1MFNA 1MCBA 3MYZA 4WWID 3VXOB 2WUBH 4OFVA 3OKOA 1FORL 4FXKA 1I3GL 3MV11 1DTUA 3MLTB 3BMWA 2FO1A 1NCCL 3K2UL 4KQ4L 4WU5A 2ARWA 4X4YA 4M4RA 1TJGL 5AUMA 2VC2H 4R7NA 3UAJD 2QADB 3AS2A 1II4E 3LB6C 5MEOA 2BOCB 2FX9H 2JJVA 2X4OB 4BSVB 2VR4A 1TCRA 4Q9CA 1JUFA 2BRQA 1GGCH 5D7LE 4EUPH 5E9DE 3FONA 3QUZA 1YEGH 4GQ9H 1U8HB 1P69B 3ZO0A 4WHYH 1W8OA 4HFWA 1ZLVH 2NY6D 5LBSH 2FO4A 5A2IH 3D0LA 1AGEA 5D1XD 4GAJL 4LLMB 4JFEB 1BZ9A 4PRDA 5I8CB 1CN4A 3ROLB 1MHPH 3ULVH 1IAIM 4HUUB 3S6CA 3DX9A 2VQ1B 3CSYB 1GZQA 1NANI 2R1WA 3C9NB 4PRID 1WV7T 2HFGL 3DWTA 2DQEL 4NFDA 3KWWB 5I17B 1MCSA 1MFDH 2Q6WB 3PGCA 1BAFL 3WO3B 1DDHA 4QOKD 3NH7L 5ESAB 4D9LL 3BH9B 4GS7B 2Q87A 2R0KH 3HE6A 2OX5A 1BJ1H 1KCUL 2X70A 2COQA 3RDTB 4K94H 2H9GA 5I1HL 5DDHA 3BP4B 1P6AB 4QHMB 1R5VA 4G5ZL 1S5HA 2W9DH 4JKMA 5FHAL 1DN2A 1H15A 3R06B 4P4RA 4MQXD 2HTLD 3TESA 4XNQA 5L8KB 4U7KA 4HFUH 4KU1A 4X5XB 3VFRA 5DJXB 3L5JA 2X1PA 4YHLH 3DIFA 3CJJA 4F7MB 5HHVL 2HN7B 1FZOA 3BDXA 3RA7H 1YECH 3P0GB 4HBCL 3A6BL 4NKIL 1WAAF 5HI5D 4AL8L 4JHAH 4MCZA 2XKNA 1JHLL 2AJSH 1ZT7A 4N1HB 3G04A 1D5MB 4LIQL 3MGTA 2EDFA 2OJZL 3QUMB 1DBBH 4PY7A 2PTUA 1IGFL 5EU3B 1Y0LA 3LY6A 4BKLA 4EQ3A 1F00I 2ZSVA 5E2WH 4CKVX 3WKMH 2Z8VC 1T66C 3VXUA 5C0FB 4EXPX 4JR9H 2CKBL 1P4IL 1IM9B 1N8ZB 1F6LL 2X44D 4HULB 5HHXH 3T2NH 1UM4L 3ZYIA 4BK5A 3MXWL 3QFJD 1S3KL 1J8KA 1T7YA 4JHZA 3I85A 5JW4N 3I6KB 4N0FB 3FT2B 5D7IA 4KJQD 4R8WL 2ADJB 5C8JB 1OWRM 4JFXB 3HMWH 4QHUA 1JNNH 2RIKA 1MREL 2NY0D 4HPYL 3L3HA 2C4FT 3L7FA 3QWOA 3B83A 3V7MA 4HIXH 1KCKA 2DLHA 3V8CA 1MCDA 1X5ZA 1T22B 2CDEB 2YEZB 5T3ZD 2W59A 4LCWD 5CP7A 5D72H 4LEXH 1QLFA 2AV1A 3WL9A 3BEVA 1YEEL 1RUQL 3JTSB 5D4QA 4TNVF 1RZGA 2MQ3A 4PYGA 3TZVB 4D9RE 2JJWA 3SKUD 4HHAB 1P4BL 4BZ2L 4YX2L 3I9GL 1E4XH 1DR9A 3ZT6A 2EIZB 1C8PA 5EC2A 3WFEH 1Z9LA 1DN0A 4FTVE 3QDAA 1JFQL 1WWCA 4HWNA 3S37X 1HSBB 3AU1B 3F5WB 3QXWA 1JNHB 4OZGE 2VO5A 3MROA 2JELL 2VXVL 3EHBC 3R8QA 4HWEL 3EJYD 1RJLA 4QXGH 4Y5VB 2DJSA 4IRJA 4RGNC 1I4FB 35C8L 3K7UA 2V7NA 4LLQA 4LU5L 1V3LA 3IJYB 4CUCA 1WZ1H 1J0ZA 4LSPL 3OJVC 4ZFZB 3C8KA 1MIEH 3GSQB 4HIIA 3DO7A 3B9KC 4M7ZB 3GSOA 4IOSD 1YC8A 2W07A 3S8WA 1KULA 3RWCB 4LNRA 2H2PC 1LE5A 1BOGB 3W11C 5E6IA 5H94B 5C0EB 4NO5A 2GCYA 4K55A 1C5BH 2IGFL 4PJ8D 3U1SL 1JGLL 4GOSA 4HKZB 2D3VA 3ARBA 1S7SA 3E0GA 4QNPF 3LV3B 5FCSH 3VWJA 5IFAH 1JIBA 5EOQH 5EBGA 2FIKB 3QH3A 1BJ8A 1BZ7A 1Z5LA 4XMKL 1CIUA 4HGKC 1OAUL 2YS4A 5HHOE 5CD5C 4WFGD 4PJIB 2XQBH 1HIMH 1Q9WA 1XGUA 4ACPA 3VU2A 4WJ5B 2KBGA 2Z91A 2VLKD 1URLA 3P4NB 4X5LA 3MRPA 1G7HB 2VLJA 1MUJA 4ZXBD 3VCLB 4NP4H 4XC1L 3BYTA 4KKAC 4E41B 4ETQA 5B21A 3V4UL 5IEHA 3RBSA 1BM3L 2XYCA 4C55A 4GXUN 5BZDA 3SGKA 1XIWD 4ETYA 5FGCB 1CG9B 3H3BC 2X89D 4Y2DC 4TNWF 2F19L 1JGUH 5GJTH 1AO7B 2IC2A 4Y1AD 4GSDH 2LQRA 1MCOH 1NL0H 4R0LB 2VXUH 2E8ZA 4HKBB 1TQBC 1PFCA 5T5NG 1BMGA 1YPZE 4MHHI 4NKQB 1AXTH 3ES6A 1MF2L 4I2XE 1F11A 1A4KB 2VN4A 4EN3D 5IB1A 3WS6C 5DVKA 3JV6B 4JQXC 1R3JB 1KLGA 4AQ1B 3G6JE 5ANMB 2YSSB 1A1MA 2XA8L 4PRIE 4XGZA 4C58B 1XZ0B 1YNKH 3VA2C 3BZEB 4ZUWB 1PEWA 3JWOL 4OSUL 3RZWA 1UB5B 3FAWA 5IW6A 2R0WH 1JGEA 3MLYH 4EI5D 4QOKE 2GUOB 4Q0XL 4RWYL 5L9DL 4S2SA 5I8OL 5T1MB 3EOTH 1V05A 2EXWD 5T3XD 2PW1B 2RFXB 4F7EB 3ET9F 4C56A 3S37H 4FQLH 2YWZA 1YDPA 4KPHL 4BQBA 1YY8A 1VSCA 5EG6C 1AP2B 3ZTJH 4BZYA 4YPGA 4WV1C 3HG1A 4PGZA 1BFSA 2WM0A 3DI3B 43CAA 2E9BA 2VKXA 1PBYA 1IAKA 1QRNA 4MWFA 4XMLH 5SWZB 1EUUA 3FO0H 3I6LE 4OFIA 4H5SB 2IH1A 2B2XH 5HDBF 3DO3A 5IMLB 4BUHA 4RMQA 5EU5A 4L29B 5EN2A 2P5EA 4MD0B 3BSZH 4U0QB 3VGAB 2VIRA 1VADA 3P9MA 3VWJC 5E0QA 1G6RH 4FQXD 5DHXB 5B3JE 4Y89A 5DD6B 3G5XA 1UYWH 4JJHA 1BVLA 2AK1L 2P48B 5D7IF 3KLAA 1S78D 1NFDB 4OLYL 4I5BB 5HDLA 4L8SA 3DBXB 1F3JB 4JN2B 4P46A 5JO5B 4LMQE 5CIPB 5HHPA 3FB7B 5GZND 1A7PL 2XZQL 1P7KB 4YHYC 4Y4HB 1VGKA 3MPCA 4HCRL 3QDGD 2XQYG 2ZG3A 1N6VA 5KS9A 2FB4L 2FEDD 3RUGB 3V5KB 1SY6H 5LGJA 2Q1EA 2BY1A 1CFQA 4TTGA 3OJDB 4HS8L 1TNMA 2WZPD 1VEOA 3PV6B 4JCMA 2Y36H 5TF1H 4F57L 4R4BB 3PL6A 4WHDA 1FP5A 4HUKB 4XBEL 3WO4C 5T3ZE 3MRNA 4LCWE 2ZSWA 3NIDF 2B0SH 4L8CB 2CO6B 3QO0B 3BE1L 4PJ7B 1R3IH 3GSWB 4NQDB 2EDDA 5GS0C 2V2TA 2JIXB 5CP3A 4JEGB 1SYVB 1UJ3C 3IDNA 5DUMH 3TPUA 3UJTL 4DCQB 1INQA 3VRLE 2A77H 3I6GA 4G8GD 1LEKA 1NAML 1HDMB 5C2UB 4NHUA 4K3JL 1AGCA 3S3PA 2HT2D 4F7CA 1EO7A 2VDOL 2W0FB 4ZQKB 1MHEB 5CHNB 1PLGL 3SCMB 1MVUA 1FNEB 3L5XL 3C6LA 1CDCA 4MJIA 4D3CH 3WIHA 4ZOAA 1I7RA 4YHMH 5JW5A 4XNZC 4F3FA 1T6WA 3LKSB 3SDYH 5D6DA 2AJVL 1IRAY 3LQZA 1GRWA 4PJFB 3CDCA 3U9UA 2ESVA 4PRBA 3C2AH 1L6ZA 1FH5H 5DJZA 3D2UB 3PGDB 3U0PA 2X9XA 2VITB 4Z0XB 5IMKB 1NGWA 1NBVH 5J11B 1TZHA 2WIMA 2Q7NA 3VXOA 4PG2A 5CEZL 5DVOA 3QXDB 3D85B 3TH2T 2P45B 4X6FB 4KMTH 4Q9BA 1KACB 2IBGA 3B3IB 4M48L 4GJTB 3UX9B 3L1OH 1MI5D 4Z6AT 3LDBB 2V2XB 4M6ML 1JZ4A 4Z18A 2IQAA 5D1QA 1DANT 1NGZB 2NZ9C 5BRZB 2I9LA 5CGTA 4WI7A 3H9HA 2X4OA 2YKLH 4HC1H 2IPTH 5E2UL 4WFGE 2QQNL 3WE6B 4XX1G 3IRZA 1MQKH 5CMAA 4O4YL 1U8HA 4XNMB 5FK9B 2R1YB 3QJFB 4PJDB 1YN7B 2AI0H 5DQDL 4I3SL 2DB8A 5GRVL 2YD2A 5L0QC 3DYMA 3NFPB 4L8SC 4FABH 5I8CA 1TTGA 2Z92B 3MZTA 4LSDA 2Z35B 4LQ1A 4HUUA 2CK2A 4DVBB 1AR1C 3CSYA 5I18L 2W1NA 4PS4H 4KKCC 4RAVB 3C9NA 5KAQF 4Z7VB 5JHDB 5C6PB 3D6GA 4MB3A 4Y1AE 3V0AC 2A38A 1TETH 2HKFL 3KWWA 5I17A 2Q6WA 2RQ8A 4JG1L 3MV8B 3PUCA 3GJFB 2ZCKL 5ESAA 4IDJH 3BH9A 1EHAA 4N68A 4YPJA 4MSWB 4NNPH 4CVWA 1FZMB 3QYCA 2BSTA 5JXAL 2C3VA 3MLPA 2YMXL 2AGJL 1HK6A 4U31A 1PKQE 4U0RB 1ORQB 3BP4A 1RHHB 3MRBB 1TJHH 3OBAA 4P2RD 1IGJB 4KAQH 4Y8DC 4N8CH 2YHGA 3ZE0E 2NW3B 2GEEA 1J1OL 4PTTB 5E6ZA 4JREB 3GHBL 4NCC2 1X5HA 1GGUA 3BZ4A 4L5FH 4ALAH 3MLZL 3FB6A 3ARSA 3RVVC 2HN7A 1C5DA 3QO1A 5GHWL 1B2WL 2W9LA 1C12B 4JRXE 4NZJA 2DN7A 3V6OE 1OL0A 3FFCD 3EOBB 5DQ9A 5JW4M 2DQFB 2UY7A 3ARGA 4NO3B 3WD5H 4GAGL 1RULL 4Y4FB 3BAEH 4JKPH 5HVHB 1D5MA 4LVHB 4U1MB 5I8KL 1KCRH 5C07B 4P3DB 2CDFB 5KSUB 3ZL4L 1QG3A 2E27H 3GRWA 5EU3A 2WUBL 1P7QB 2NX5D 3D3VE 2NXZC 4RIRB 1D5BB 3VXNA 1RZ8A 3J8F7 1T80A 4K8RD 5C0FA 2Q3AA 4PY8I 1C7SA 5JZ7D 2ADFL 1IM9A 1N8ZA 1FNLA 4R97B 2VC2L 2OJEB 4PJ9B 4HH8A 2FX9L 3ARDD 4OGAD 3I6KA 1CFBA 5DRWB 4OZHE 3TT1H 2Q76B 1GGCL 1H8NA 4RFEB 2GITB 5C8JA 1YEGL 2BHUA 4JFXA 2NY7H 3H3KA 3VFWB 2IEPA 1JVKA 2YD4A 4UTBH 2J7LA 2XNAB 1B0GB 5D1QC 1KLUB 4DZ8B 3ZYOA 3V6ZB 1JN6B 5LBSL 1KB9K 2MJWA 1F2XK 1T22A 2CDEA 1PZUB 5TDOB 3E8UH 2H2SC 4QRPE 1CGXA 3BWAB 3PIQB 3ZKND 3ULVL 1XF5B 4KROC 3SDXB 3ETBF 3O6FD 3O9WC 1FC1A 1RZJH 1D5ZB 1PSKH 3MJ8B 5ICYB 3C08H 3QDGE 4XTRC 2PTTB 4MA1C 4RX4D 5F9WC 4AK1A 2BX5A 5DD3H 5DS8A 3QXVA 4R2GD 3SGDI 1CYGA 5GS0L 2XACC 4Y19A 2EDKA 4HHAA 1MFDL 1EAPB 1G7QB 3QUXD 4U49A 5DJ0B 2EIZA 4HUXA 2XTJC 3OKMA 5EUOE 4BZ1L 4ZFOB 4QY8B 4LDOB 2R0KL 3TIDB 3N1MC 4NZUH 3SGJA 2WQ8A 3AU1A 3F5WA 1JNHA 4NM8H 4N9OB 4K94L 3UTZA 2BNRB 4GRLC 1BLNB 3FO9A 5IHLB 4FHBD 3KPOA 3CFKB 6CGTA 3KPSB 4Y5VA 1I4FA 4MD5B 4HFUL 2CR6A 5HYIA 3BD5A 4WI3A 5D7JD 5F8RC 4FFVC 4YHLL 5B22A 4G8GE 4KH2A 1ZANH 4KHXL 4ZFZA 3TJHC 1MRDH 5C0GB 3RA7L 1YECL 3SJVA 1S7TA 3ZSTA 4LPYA 5FYJE 4OLUH 4JHAL 4YXKH 4RMSA 2AJSL 3RVUC 2NZIA 1U92B 5ACLA 5H94A 1PX4A 1AHWC 4HX1A 1IT9H 4HKZA 4OKDA 1JYVA 3HA0A 4GXUM 1DBBL 2P1YA 3LV3A 2AXGB 1DFBH 3HUJE 3EO9H 3WNOA 3LKPB 3V6FB 2VLRD 3ARGC 2FIKA 5E2WL 2D0GA 1FNSH 5IJKA 3SHSA 5I15H 3IF1B 3RWIB 4MJ2A 2FH8A 4R26H 4ZS6C 4PRNA 4DTGH 3STZB 4JR9L 1FGVH 4OLVL 2UY6A 1CDHA 1UM5H 1ZTXH 4H1LB 2IPUG 5HHXL 3T2NL 1KGCD 4WJ5A 3P73B 3P4NA 5EB9A 2AQ1A 1G7HA 1OAXH 2OL3B 3C60B 3LKNB 3VCLA 4LKXB 1T89A 5GGTL 4JPKH 3WLWC 4E41A 3FCTA 2CXGA 2X4QB 1NEZB 3SE8H 1JNNL 1MI5E 3D39A 3W39A 4NN6B 2Y5TA 1FSKB 3LD8C 4HIXL 4XVUC 5C86A 1K3IA 1CG9A 5T1DH 4PJAE 1ZEAH 3BIBX 1QSEB 5D72L 1OWWA 1W72B 4R90H 5ESQB 1EO8H 4JPVH 1Q9KA 1LO2H 2EDLA 3THML 4D9QD 4OZIF 5E94A 4K7FA 2NYYD 2AV7B 1BQHB 4IOFD 4WNQB 5DFVD 4WGVB 2BVTA 5ILTH 1E4XL 5BV7B 3JV6A 3MFGB 1U3YA 1R3JA 3WFEL 4ZUSB 1J88A 3OQ3B 5I2IA 1VFOA 4NN5B 4TQEH 2FRGP 2YSSA 3VXSB 4NQCB 4P23D 1XZ0A 3Q1SH 1UB5A 2PW2A 1WFTA 5C71A 3QULA 3MRQA 3TWCH 1CGWA 3RGVB 1MPAH 4QXGL 2AXHA 3MV7D 5DZLA 5FF6B 5H35B 1U2CA 4PIRF 1BGXL 3SGJC 2IH3B 4H8WH 4F8QA 2ORBH 5T1MA 1WZ1L 5SV4A 1ACYH 1VB9A 2RFXA 2Z93B 4L3ED 1TENA 4F7EA 3UPRB 1MIEL 3GSNB 5D8JH 1NLDL 5HGGS 2R1XA 3QEQB 1KTLA 1A9EB 1NCTA 4P2RE 5GRUH 2V2WB 5F3BB 1AP2A 3NCEB 5HTSA 4U33A 1C5BL 4MZ3A 2CRIA 2YPLB 3O3DB 1W8NA 1Z3GH 2IFFL 5HVFB 4WDIB 2VDRH 1JF1B 3TV3H 5EOQL 5DTFB 3FFCE 5LWYL 4JFQB 4H5SA 4GAFB 2BXYA 4K2UL 5DUPH 4DFHA 4EOWH 5IMLA 4YQXL 5GJSH 4FFYH 5ETUB 3BOVA 4LSTH 1QVOB 4UT9H 1UZ8B 2XQBL 4E0RB 1M71B 4JO2H 3T0EC 3WNKA 1AGFB 1J11A 3OKNB 1U8JB 2VXTH 4BJLA 5DD6A 1JWMB 2DOCA 2NX5E 4NP4L 5EA0L 1NFDA 3DBXA 4JN2A 4J7RA 3B5GA 1Z6JT 4TUKH 4KZDH 4OLXH 1G1CA 3VRIB 1NEZG 3CMOH 3WV0A 5CAYB 1A7OH 8CGTA 5I76B 5KJRH 1CXHA 1X5AA 2K1MA 3IXTA 1P7KA 3C2SA 4Y4HA 1EK3A 4HJ0D 1JMXA 1BIHA 5D7LB 4P2OB 5E9DB 1JGUL 5GJTL 2HG5A 4GSDL 1FJ1B 1MCOL 4L4TB 5T5NF 3VGHA 1A0QH 4AT6B 5IWLA 2VXUL 3ZSSA 2XFXB 3MCKA 1ZHBB 3TO4B 2GK2A 1MCQA 1AXTL 2QBWA 3GMRB 2LU3A 5HYEA 2Y06L 4I13B 3ULSB 4BQ6A 2B7DT 4NNXB 4JDZA 4R4BA 2VZ3A 3FAXA 3LMJL 3PWNB 1K6QH 1DEEB 5HYFA 4NO0D 3F65A 4L8CA 3QO0A 1CVSC 1NAKL 1U93A 3GSWA 4PJ7A 3DV6B 3M1BB 1SYVA 2AJXH 3CK0H 2WLYA 2YWYA 4BQCA 3CLEH 4Y4KD 2GT9B 3H7BB 4DCQA 3SBWA 1QD0A 2DM3A 3IDYB 2R0WL 1A1NB 1HDMA 1M6OA 3QUYD 3MLYL 2UZXB 1T66D 1GYAA 3P0VL 3TA3B 2W0FA 3IJHB 5D2LE 5CHNA 5IQ7H 3SCMA 1FNEA 2OR9H 3Q0HA 1C5CH 2ITCB 3S37L 3S3SA 5JUEH 4FQLL 5FO7A 2AAVA 5LAXA 1KXQE 2VL5B 3QG7H 1QPPA 4KTYA 3LKSA 4X6CE 4J3TA 3KVQA 1MJ7H 5D9SB 2P5WA 4PJFA 5LCVH 3VFNB 3TO2A 5L6YH 3GJEB 1M7XA 4UV7H 1IQDB 1A6TB 3PGDA 3S35X 1GOFA 4HXAH 4XMLL 1HH6B 2VITA 4Z0XA 3FO0L 5DLMH 2B2XL 3QQ4B 2ERJB 2R29H 2BNUB 4HMEA 1J0JA 1OY3B 3QXDA 3QUZD 3N85H 3PP3H 4OCSH 1ZSDB 4PJIF 4H25B 4OI8A 4JB9H 5AD0B 3B3IA 3UZQA 3BJLA 3BSZL 3DVGB 5HHNA 3HE7B 4ZTPH 1A3QA 1DSFL 4OIAA