3C08H

Crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYDGRYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matuzumab Fab Light chain
publication title Matuzumab binding to EGFR prevents the conformational rearrangement required for dimerization.
pubmed doi rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
total genus 37
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2008-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H01
3ARFD 1NJ9B 1AGFB 4HWBH 5FA3B 4WTZA 3GBLA 3OKMB 3VW3H 1MCSA 4PRNB 1ITCA 2YD8A 2W9LA 4O2EB 3S88H 3FCTA 3FO0H 4K8RD 3SEPA 1IGCL 1MRFL 1FVDB 1BOGB 4JFQB 4R90L 4G42B 2NY6C 4TQEH 1AE6H 5F21B 4DKAA 2VRAA 3HKFA 4LCUA 1IC7L 4Z78B 1OWRM 1YNKH 1KPUB 4UINL 1M05B 1T7YA 3D9AL 2OZ4H 3OKEA 4YAQB 3WCYA 4NRZA 3D3VA 5EG6C 2C26A 3R1GH 3VJ6B 2H8PA 2VDPL 3VG9B 2C3WA 5DQ9A 3QA3B 3QUYA 4HKBB 4D9RD 2EXYC 4EIGB 2V17H 3B3IB 4NO0B 4CN1A 1MCPH 1CDCA 3MUGA 4UTBL 4J3VA 4YX2H 3NCJH 5AYUL 2Y07L 1B6UA 4LRNL 4H20H 3ETBF 2M1KA 5F1KC 1SVCP 2FEDD 4FN0A 2EXWD 4LNRA 2NXYC 4X6BB 5C9JA 4UBDC 3S37H 4JO3L 2GJJA 1KELH 3SDCA 5DYOB 3PWVA 5HYQA 5J13B 1NDMA 1U8PA 5E94A 4NPYB 4UDTB 2DQFA 5B8CC 5IB3A 1F3JA 1QYGH 1V05A 3UPRA 3SDDC 2O5ZH 3ULUD 4IMLB 3TWCL 1HIML 1I8KB 4K9EC 1B2WL 4ORGB 3EYFB 5JORB 5DVKA 4M7KL 4JY4A 3UTSD 2NY2D 4PLJD 1F4XH 1R3LA 3TJHD 2WWKO 4XPAL 4HGMA 4U0RB 4NC1E 1QTYT 5HGAB 1I9JL 5I8KL 2X05A 4MX7A 4UV7H 1E4XI 4G8FA 3BE1L 1YEKH 3CZFA 4S2SB 3VFOB 4CVZB 1FV1A 2A6DB 2V6HA 1MY5A 4KZDH 5H2BA 3O0RH 3HR6A 2Y36L 4NZDA 1HHJA 1MLCB 3SCMB 4OZIB 4BH8A 5A16A 1XH3B 1QSEA 2A6KB 4LSPH 4U7KA 4XWGH 5F93C 3GM8A 4HKZA 4X7SH 4JQIH 2PW2A 4PRAA 1MF2L 1AHWA 2P5EE 2AXHA 1LK3L 4JPKH 3FOLB 4KVNL 2AV1B 4JRXD 3OF6A 3PP4L 4S1DC 1MCIA 3TT1H 3GI9H 4F15B 1RUPL 3MTRA 3GGWA 3UBXA 1OAQL 2OR8A 2YEZB 2ICWB 3RX7A 3DRQB 2B4CC 2HTKD 2OR9H 1WCQA 2MNUA 5J11C 5E0QA 4OCRH 5D7IF 4PJDF 4JKWA 1A8JH 3KJ6H 5HYFA 3U79A 3OZ9L 4WJ5B 3MV8A 1M7DA 3EO0B 4YH6A 3MRQB 5E2UL 3LKPB 1HWGB 1JIBA 4YHPB 3HZYA 1IGCH 1MRFH 4R90H 1SJHA 2DQIL 2YBRB 1XGUB 4UAOC 5FUOL 2DQHL 2GT9A 1U3HA 4ZO8A 2DQGL 4MQXD 1LP9E 1CL7I 1K8DA 1IC7H 1LD9A 4KK6C 3U46A 4UINH 4YPJA 1YA5A 1FC2D 3D9AH 1DR9A 1MUJA 1PX3A 3E2HB 4F7CA 5GGRB 3WHXA 3AGVA 3SDAA 3DO7B 2VDPH 4KI5D 3GMRB 5CLTA 3QWRA 4X98B 3RPKA 3ZL4L 1I7RA 1IGFL 1IM9D 1ZT7A 1KIQB 2OP4L 4UTBH 5AYUH 2Y07H 3U83A 4LRNH 3SKOA 3ROLB 3VFUB 3MV01 3SKMA 1YJDL 5E7FA 5EO1B 1ZT1A 1JNJA 4TTDC 1IAOB 4JO3H 5DRXB 4P2OC 4LKXB 5FV1L 1LMKA 1MFAL 5D7IA 4PJDA 2FJFA 4ZUVB 3NOIA 3PUCA 5JA8B 2B2XL 3DGCR 5IJVB 3TWCH 1HIMH 3GSUB 3HMXA 1B2WH 1J1XL 5DK2B 5BS0E 2P5EB 2D9CA 4M7KH 5F1SA 5I8CB 4XAWL 1GGIL 4WHCA 2VO5A 3F6LA 2FL5B 4XPAH 4MSWB 3TO4C 1SM3L 1HSAA 3RNKA 3RIAK 1I9JH 4HDIB 4PJ7F 5HHQA 5I8KH 4XB8A 5EN2B 4U6HB 1YEFL 5DDHB 1CS6A 4KHTL 4RMTA 3BE1H 2HTLC 3AM8A 3K1KC 4PJFF 1CGXA 3QSKB 1GGCL 2Y36H 3QDHA 2NY4B 5IB1B 1U8NB 3U4BL 4LMQE 2WBKA 3BP4B 4Z0BL 3B8SA 5I16B 3WN5B 3FN3A 4KRNA 4HMCA 5DJ6A 3L3DB 5A40E 1U8JB 1FL3B 5C9KA 4U1KB 3VWJD 2Q86B 4RMSA 4OZFB 1MF2H 1YECL 5DRWB 1A5FL 2VISA 3D2UB 4R96A 1L6ZA 1EAJA 3HE7B 1LK3H 4KVNH 1UM4L 4I9WD 3N9GL 1RZKL 3MODL 1FZJA 3WEXB 3PP4H 1S7XB 1HINL 3B2VL 4HXAL 3ULVE 1RUPH 1B88A 3BPNC 2H1PL 1LP9B 4R7NB 5EC1B 4GW5A 4ESKA 1OAQH 4ZUUB 1NEZA 2FO4A 5EH1A 3KHOA 5HGDB 3UTPD 4YXHL 1OP5K 2HJKB 1BBJB 4HD9A 5CGYC 2XG4A 4AH2A 1YN7A 3OPZL 1AIFA 5I66A 4OFPA 3IRZA 3DUHA 1OTSD 3KPNB 3ZKMC 1FGVL 4MA1B 1MRCL 3VGFA 4R26L 4PGJA 2C9AA 3FB6A 1JV5B 3OZ9H 4QRPE 4CMMB 2ATKA 4ZXBA 3QDJA 2YPLD 4PJ7A 1TQBC 1C08A 1GH7A 5E2UH 5L8LB 1G7PB 1YYML 4CVUA 3TC9A 4KJPC 4XXCC 2VE6A 4PJFA 3V6ZB 4GRWF 4BM7A 3HLAA 3ARTA 2AKRB 2DQIH 3G6AB 1AGBA 3FHAA 5FUOH 2DQHH 2I9TB 1KCSL 3CFKA 2DQGH 4HFUL 1CLOL 3FQRB 3MV7A 3MA9L 4LARL 2JB5L 2BXYA 1UXWA 3MRBA 3QXTA 3MBXL 2YPVL 4JG0L 4KRPC 1EBPA 4WRLA 5BS0B 1SVZA 1IGJA 2VOTA 4I2XB 3ZL4H 3ZDYF 1BQHA 1IGFH 2F8VA 2OP4H 3IDIB 4GXUM 4NQCE 3WKNA 3QZWA 5FAAA 4R2GC 4ERSL 4APQD 1PAMA 2M2DA 2BCKB 4JM2B 4PLOB 3FO2B 3VFRA 1YJDH 1HQ4A 1JJUA 5HJ3A 1X5YA 4XHJD 5CP3H 3U4EB 4BKLB 3T4YB 2EYRB 2W0FB 4Z7NF 5D7LA 2UWEA 5ID0B 2VIRA 1MFAH 5CBAA 1GJIA 5F9OL 4PJXF 5MEOA 4CU8A 2QR0B 1G0DA 3ARFC 3P0GB 2B2XH 1BZ9B 3GJEA 1T22A 3OHXB 2DQJL 4PLNC 4HJ0D 5HVHC 1H3WM 2BC4A 1J1XH 1P9MC 2OTWA 3JUZA 3MNVA 3H3BC 5C0AE 3ALXA 3KLDA 1SYVB 1ACYL 3KLSA 4K8RC 4XAWH 1GGIH 3VRIA 3FMGL 5FB8B 3WHE0 4U1GC 1QBML 1SM3H 3S3SA 1WIPA 4GAJL 4Q58C 3MRKB 3MRMB 4XP1L 4WFGD 3NCBB 2AV7A 1MPAL 1Y18B 1YEFH 2BVQB 4KHTH 1UXSB 3NCYP 3PGFL 1XIWB 1U2HA 3RDTA 2ZP0T 1XGTB 1GGCH 4NRXB 3PJSB 3U4BH 4TUOA 4Z0BH 3E3QE 4DWHA 1FLRL 3KPSD 3T1FA 3SY0B 3VXRE 4QRPB 1IQDA 5KSBE 3QIWD 3VDAA 3L6FA 1YECH 1FP5A 2XA8L 5CJ8A 1A5FH 3CIQA 5I6XB 4WV1B 1KB5L 2FEDC 1UM4H 2EXWC 4K71B 1N8ZA 1RZKH 3MODH 1JNLL 3P4OA 3EYQD 2EDFA 3S3JA 5EIIA 1HINH 3B2VH 2ZUQC 3CU7A 3H2WA 4HXAH 1J0JA 1EK3A 3PWLA 1DQQA 2H1PH 5LAXB 3G04B 3QRGL 4OLWL 1A21A 4M4PA 3ULUC 3O3DA 5D1ZA 4YXHH 4LVEA 3KYKL 4C83A 3QAZB 3TT3L 2D7PA 5ITFA 2IEPA 4ODXB 2KBGA 2ADIB 3OPZH 2LVEA 5HI4D 4P2RE 3WL9A 1FGVH 1MRCH 2NXZB 4PLJC 4R26H 3TJHC 4PJAE 1UKTA 3LZFL 4U3CA 2AEWA 2NY0D 1MCEA 1WTLA 2IBGA 4FMKA 3T1WA 3D39A 4UQ2A 1PLGL 4NQCB 1FYTA 1BFSA 4P48A 4Y0GA 3L3GB 1DANT 3BISA 1OP5H 1YYMH 1G6RB 2ID5A 3K0WA 2HG5A 5AZEL 5C0BA 2BOBB 4HK0B 4FP8L 4OI9A 4PJ5A 5DO2D 1ZE3C 1YMMA 1KIRB 4XMKL 3IFPA 4KMTL 1IEHA 1U8IB 1KCSH 4BFBD 4HFUH 1CLOH 1MFEL 3FQNA 2PTVA 1EDQA 3MA9H 4LARH 5BOPA 2JB5H 3B83A 5SX5K 4DKDC 3MBXH 2YPVH 4JG0H 4E9LA 1KUMA 5C0AB 4N8VA 4M61A 4PTUA 1KTDA 1CE6B 4HULB 1C7SA 4QCIA 2Q8AL 2Y6SC 1JZ8A 3QXWA 1H0DB 3QFJE 3U48A 5ERWA 4ERSH 5FYKE 2FZ3A 1TQCC 4B7LA 3DRTB 3LRSB 2IMMA 1Q9KA 1I3RA 1EO5A 2DWEA 4EKXA 2HTKC 2Q76B 5D7SL 3CVHL 3BFOA 2YN3A 4X80L 4AL8L 5KZCD 4NKOB 2F8XC 5DC0A 5F9OH 2CIKA 2DJ4A 1QLRB 1NGWB 1DUYB 3VXRB 2DQJH 5KSBB 3HZKB 4KKBD 3RP1A 1MLBB 3TN0A 2BVUA 4OF3A 1ACYH 1H3VA 3BI9X 2AK4A 4QEGA 2OQJA 2Y5EA 3FMGH 4ZO9A 3T4AB 3WE6B 4MQ7A 1QBMH 4GAJH 1C7TA 4XP1H 3PQYD 1XR8B 4MQXC 5FO9B 3M45A 1BFVL 1MPAH 4H26A 4HF5L 3PGFH 3VU2A 43CAB 1UACL 4KFZC 4KI5C 4PGZA 2R23A 1NLDL 4P2RB 1V5JA 4F7TB 3Q6GL 5GGRY 3EIFA 4PJAB 3QXVA 1FLRH 4MNQD 4EVNB 4O58L 3RWDA 2VDQL 2UZXB 1NUDA 2R2BB 5EBLB 3KPRA 3OXRB 4C56E 2XA8H 4NHUA 3RTQD 1CIUA 2C1PA 5D2NC 1KB5H 1KJVA 1JNLH 4IJ3C 1BVKA 3TBSB 1HILA 2KPNA 4XBPB 1CICD 3ZE0F 2EDEA 3CC5A 3BPOB 4WW2F 3QRGH 4OLWH 4HH9B 5IFHL 5L2KD 4RMUA 3BWUC 5EU6D 5FA4A 3S4SA 3AUVA 3KYKH 4P23A 4IRJD 3TT3H 5DK0B 1NGYA 2BRRL 3FQWA 5F88A 3UAJD 2FX8L 3LZFH 5GGVL 5MERB 2ZNWA 3BQUD 3RHWF 5F6IB 4E41E 2CGRL 4F9PC 5C0FA 3ARSA 3D18A 1PLGH 4LEOB 5ESQA 3QFJB 2XY2A 2BSSA 4PG2C 1L0XA 4JPWL 4LLQB 2DMCA 5AZEH 3SHSA 4HMDA 4UOW0 3MLYL 4GG6E 4FP8H 4J3TA 1R6VA 1ND0B 5GSRB 3WXVL 4XMKH 4KMTH 1CQKA 3B5HA 5A3IC 4LSTL 3V0WL 5DEGA 4J6RL 2KZWA 3KYNA 1HI6B 1MFEH 3NMEA 1DCLA 1MEXL 4XP5L 2XKNA 3BP6B 3L7FB 5C86A 1ZHBA 5KSAD 5D1XB 1SJEA 5GS0D 5IMKA 2ZSWB 4PGCB 1T20B 1OWWA 2Q8AH 4J3WA 2UYLA 2XOTA 1HHIA 4P4KA 2NY2B 5I1AB 5JOFB 4E42A 3GMMB 1TVHB 5SX5H 4C54A 1DEEA 3M1BB 1VFUA 4NC2B 4QOKD 3JTSB 2ZG3A 3X12B 5D7SH 3CVHH 4X80H 2CKNA 3GSWA 1WISA 3EKCA 3X3GL 1OTSC 4AL8H 2J8UE 1NPUA 2YC1B 2AEQL 3QI9D 3I85A 5FCUL 3L5HA 3QHFL 1H3TA 5EUOE 2D31B 2LU3A 1IEAA 5JIHA 3E8UL 4C56B 1UKQA 3D0LA 1DLHA 4P46D 3VWKA 5C0DA 2CUHA 4PR5B 2FX9L 3TBVA 5HGBB 4EBQL 1I1FB 2OBGA 1G7QB 3P0YL 3L5WA 4JREC 4PRPD 4I48B 1BFVH 3OKDB 4PP1D 5C07A 3QJHA 4HF5H 1JHTA 2HKHL 3LKNB 5DMKB 4GLRH 5DJXA 3QG6B 5E00A 2W9EL 5CSZB 1UACH 2W92A 4QNPE 4IRSB 3A6BL 1ZT4B 4XNXL 1NLDH 5E2VL 2DKSA 3Q6GH 1FZOA 4G80A 3DIFB 1DUZA 5AG8A 4O58H 4N0FA 4E41B 5HPMA 2VDQH 4JFDE 2ZOKB 5ESAB 5KS9F 1HSBB 1NFIA 1S9VA 3ZO0A 1K8IB 4APQC 1I1YA 2UVFA 2UY7A 1B0GB 1PW3A 4MJIE 2M8XA 2BNRE 3O45A 5I71B 4GG6B 4XHJC 3X14A 5GS2H 3O2DA 3I6GB 4BSVA 1OD9A 5JXED 1A7QL 1XGPA 4GKNA 4QHKI 2KKQA 3MMEA 5HXMA 4WGWB 2WP3T 5IFHH 4WI3A 4HJ0C 4P4RA 1P7HL 2CLVB 2NZ9C 3LCYA 3FTGA 5F1IB 2HA1A 3EHBD 3PL6B 5AUMB 5H94A 3I50L 2BRRH 4B53A 2P7TB 2FX8H 4P5TD 5GGVH 3EDJA 2SEBA 4Q2ZA 2CGRH 2FEEL 5A2IH 5SWZA 5FO7B 1JZ2A 5E8EA 4PJ9D 1N64L 4JPWH 4RFOL 2EYSA 4GQ9L 1V3MA 1T6WA 3MLYH 4XPBL 4NCC1 1M7IB 4YIQB 3WXVH 3BGMA 4L3EE 3BP5B 3TA3D 2GK0A 4HPOL 4LSTH 5FKAB 3V0WH 2J8UB 3HC4L 4J6RH 2CO7B 3O41A 1KLUA 3HRPA 1RVFL 1JK8B 5EUOB 1JRHI 5F7WC 1CLYL 1MEXH 4GKZA 4XP5H 3QIWC 1NANI 3TLRA 4HIIB 3V4UL 4O5LL 3VWJA 2AERT 2ARJA 4L8CA 4ZD3L 5I8EB 1OHQA 3PGDA 5T1LB 5JDJA 4LLYB 4N1HB 3EYQC 1TPXC 1E4KC 4QTHA 5JPMA 1A1NB 2WZPD 2VJXA 5DTFB 3NIFE 4H88L 3IGAA 3DI3B 2H32A 5LJYH 4WFFE 2VN7A 4NQSB 4YBLB 2HT4D 3NCCB 3MRDB 4JFED 4Y4KD 5HI4C 1M71A 3X3GH 1CXEA 2R29L 5E8PA 4D0BA 2AEQH 3QJFB 5FCUH 5DS8B 3QHFH 2NY0C 1C5CL 2BNQA 3NCFB 4XCYB 1CR9L 4JFDB 4NBXB 1TZHB 3DVNB 3VA6A 3E8UH 3B2UD 5HHME 3QT2A 1O5DT 5IB4A 3QUMA 1P1ZA 3MNZA 3Q48A 4MJIB 2PKDA 3EO9L 8FABA 2BNRB 5DO2C 2DS4A 1F00I 1TJIL 2FX9H 4AEEA 5BVPL 4EBQH 4C4KT 4ZQKB 3SO3B 5J6GA 1DQLL 3P0YH 1TETL 2OI9B 3NCMA 2A9NL 5E5MB 2HKHH 5K9OA 4YHML 4NO2B 3SJVD 2ILLA 3U36A 5DJAA 1MQKL 2W9EH 2QHLA 4IOIB 4YEFA 3A6BH 4PREB 4ZFFB 4AM0B 2QBWA 3G5YB 4XNXH 5E2VH 3WFHB 5GRWA 5D1QB 4GBXC 3HMWL 3UYPA 4Y5XB 1FE8L 1R3HB 1K2DB 3UCRA 2ORBL 3WUWB 2H6PB 3S5LA 4OKVA 5KSUB 2VC2L 3E1F1 3DV4B 1U8OA 5I1IL 3VFVB 4XZUB 1IAKA 1KJMB 3NPSC 4L3EB 4QF1A 1A7QH 5EPMB 3S36X 1AD9B 2EZ0D 3BH8B 4AT6B 2B20A 4RA0C 3TVMA 1NCBL 3WLWD 3TZVA 4KKBC 4U6VL 5I74B 5C0JA 3O3BB 3TPUA 5DEFA 3I50H 4UT7L 2BVEA 1W0WB 4LLMB 3FB7B 2IPUK 3ARED 3ULVL 1N64H 4KTYA 3ARGD 4RFOH 1INEL 1X4YA 2YN5A 5KJRL 3FT4B 4GQ9H 4Q6IA 2PTTA 4XPBH 5EIQA 3L5IA 1T4KA 4TSAL 1I75A 4WTXA 3S7GA 4HPOH 4RNRA 4F7EB 5HYJA 3HC4H 4JFFE 5I1HL 1RVFH 5C0EB 5I0ZA 4O51B 1EHAA 1CLYH 4GUPB 4Z5RB 5T3ZE 4OZFH 2X44D 4X0KA 3B9AA 1AD0A 4LGRB 3LPGA 3GMPB 2MTPA 3KYOB 1K4DA 3MX0A 2QLVB 4O5LH 3UEZA 3V4UH 1TIUA 3H42L 5HHMB 3LKQB 3CXDL 1L9MA 2R56L 3BZ4B 3C6LD 3RTQC 3HC0A 2YOCA 3FONA 4ZD3H 4Y2DA 1R3KA 1JNHA 4L9LA 4K3HA 3T3ME 3GZKA 4LCCA 5HI5D 4H88H 1QR4A 1CICC 4Y4FA 3MLVL 3X13A 4PTTB 3N06B 1BD2D 4NQDD 1X3DA 4G6KL 3DSFL 1DSFL 1FZKB 1MCFA 4AJ0A 3LDBB 4EUPB 3FT2A 5IF0A 4MWFB 1VHPA 5F89A 1S7WB 3NTCL 2R29H 5IMOB 4E5XA 3NIDE 3UAJC 1BJ8A 1N6UA 4JM4L 1KPVA 3BQUC 2VDRL 1C5CH 3ZKSD 3QEUA 2RB8A 4PD4K 1CR9H 5JDSA 2KQMA 5D2LF 3ROOA 5DEZA 3T0VA 1YY8A 2CH8A 1QSFA 1RFDL 1OT1A 2BNUB 3EO9H 3PNWB 1LDPL 3ZE2F 1TJIH 2VLJA 1IM3A 2ZUWA 5BVPH 2MMXA 2Q3AA 4F3FB 2C4FU 1DQLH 2WIIA 1OF2A 1TETH 3HR5A 3ORJA 4UNTA 2A9NH 4MCYA 4XX1G 4YHMH 3QCUL 5TDPB 1SQ2N 3PDOA 5CINL 1MQKH 4PG9A 3QH3A 1ORSB 3U0WL 5KSAC 5GS0C 2IAMB 1CD1A 5E6ID 4YPGA 3U0TA 4OIAA 4ETYA 3AU1B 2HJFA 2CRZA 3HMWH 3MYJB 1FE8H 3WIFA 2ORBH 4PJGF 3Q0HA 5EORL 1DQML 2XI9A 4G3YL 5DR5L 3HZVB 4YHKL 3V6OE 2B5IC 2VDNL 4JVUA 2VC2H 5EO0B 2QEJA 2Z91A 4X6DE 4KGJA 5I1IH 1CGSH 5E9DE 5FM4A 4TUKL 1WCBA 5JW4N 2ZJSL 4JFHE 2ITCB 3QI9C 4YHYC 4MA3A 1LO2L 1LE9A 4JFFB 3ULSB 1NCBH 1NAMB 3VDCA 2WLYA 4U6VH 5J57B 5D2LA 3BESR 3ZHDA 4ENED 1ZGLA 2PR4L 3NN8A 1Q9WB 1S7VB 3MLTA 2AQ1A 5L2KE 4UT7H 2ZNXA 4P46C 3U9PL 4ZUSB 1JGEB 2HYMA 5E4EB 5CWSB 4XPTL 1OAYL 3DECA 3MRLB 2IQAA 3K46A 3ULVH 2CLZA 4HIEB 3CXHK 1INEH 4NP4L 4PP1C 2V9RA 5KJRH 1WFUA 2IAND 2YD1A 2EDBA 1FORL 5IG7A 4X6CF 4TSAH 4CNIA 1KJ2L 1RQ5A 1KJ3L 1M6OB 3PG2A 1JI2A 4Y5YC 3CFJB 2D7MA 2MPAL 5I1HH 1NBZB 2VLLA 3CX2A 4G43B 2P5WD 5KZCB 4M8QA 1HDMB 3H42H 1U93B 2R56H 3CXDH 1PVHA 5SV3A 2NY3D 2J7LA 3S36L 4F7MB 5F44A 2J3SA 1W72A 5TH2A 2WANA 4YR6B 2JK5A 2FX7L 3WNNA 3QUXA 5JXEC 4U7MA 5KAQG 4TPRL 1VFOA 2IALB 3MLVH 4G6ML 4K8RL 1A64A 3RWFA 2VR9A 1MJ8L 3BPLB 4M02A 4G6KH 1FC1A 1DSFH 3DSFH 2J5LC 4KHXL 4KV5E 4QRQB 4F33B 3HG1D 3EYOB 1A9BB 2M26A 3DWTA 4HKXB 2WW8A 4TRPL 3DYMA 4FTVD 4YUEL 3RWEA 1FFPB 4ZNCD 5B8CA 3NTCH 3EGSA 3EHBC 4M93C 15C8H 2CDEA 2ZCLL 4Z95L 4KWUA 3C5ZC 4JM4H 4P5TC 1AKJD 1G7IB 2VDRH 1ZS8B 4HV8A 4JRYA 4P5MA 1MI5E 4XMLL 3GEWB 3WS3A 5FYKL 4PJ9C 3WIIL 5EOTB 4X8JB 2GAZA 4YFEA 5K9JL 1KV3A 1RFDH 1LDPH 5IKCA 4X6DB 2AJZB 2HMIC 4X6CA 5E9DB 1NBVL 4PP2B 4ZOAA 4OLYL 3TA3C 5LGJB 5T1MA 3QCUH 5ISZE 5CINH 2XWTB 2JCCE 4U1NA 1RZ7L 4QRUA 1NBYA 3FN0L 4ZUWA 4DGYL 3U0WH 2RJMA 2OLDA 1EJOL 3BDXA 4XP6L 3SN6N 4Z7UA 2XN9A 5L2KB 2GHWB 1L7IL 1NMBL 4EN3D 3BD4A 4LLDB 4O2CA 3EDFA 5FGSA 4K55A 4IRJB 2HFTA 1EVUA 3QDMD 3IB4A 5EORH 1DQMH 2AJSL 4G3YH 4NO3A 5DR5H 2BSRB 4YHKH 1S9XB 4MA7L 2DI9A 2HT4C 2VDNH 5MENE 1P4LA 4OD1L 1IC4L 4Y4KC 3W11D 4PUBL 4P2YA 3LKSA 4TUKH 5CD3A 5T3XE 4LCYB 4CU6A 4FXLA 1T3FA 1XGQA 2ZJSH 3CFEA 1LO2H 5C08D 3RIFK 3BYTA 1KCVL 3CSPA 5F7LB 3GHEL 4WEMB 3LN4A 5ACZA 3IJSA 3WO3B 3B2UC 4EI6B 4LLVA 2BSTA 3PHOB 4X6EB 2PR4H 5FEBA 1KGCD 4W4NA 3U9PH 2IBZX 5B38G 4NKDA 2DIAA 4XPTH 1OAYH 5FGCE 4ZS7L 3MRHB 1RK0B 1JPFA 4BH7B 4P49A 2MHAB 3PHQB 4Y5VC 4NP4H 5DRNA 4M7ZC 1NFKA 3TIDA 4QXGL 3RNQB 1FORH 1BZ7B 1KIUA 4CVXA 2Q6WA 5IR1A 3MPCA 1KJ2H 1YNTA 4LQ1A 5HHNB 3VXSE 5C09A 2IH1A 4HWBA 3T8XB 1KJ3H 5KN5A 4Y16C 1AP2A 4BQ8A 2MPAH 4AQ1B 3MRNA 2CSPA 4AQOA 3DMMD 3HNSL 4JZJC 1MI5B 3CMGA 3PWJB 1ZGLM 3CK0L 1TTGA 3RGVB 4HZLA 1H15B 2PF6A 3IDJB 3S36H 1Z0MA 2VZ3A 2R2EA 3O81A 4X4YB 2I07B 4LCWE 2JJWA 4NNXA 2FX7H 3QUZB 4Z7WE 5LGHL 1YEGL 4NQEA 3T04D 4TPRH 5TE4L 5HHOE 4K8RH 4G6MH 2OZ4A 2QQQA 1MJ8H 1NQBA 1S7UB 3BWAA 4G9FE 2EZ0C 3PWNA 4KHXH 4RFNC 2JJVA 2P24A 3WLWC 1HXMA 5ISZB 1EV2E 2JCCB 4TRPH 4YUEH 1TZIB 5DMYA 5E2WL 4O2FA 2ZCLH 4Z95H 3CFDA 2IBZY 3W5NA 3IETB 3KGRA 4JFEE 1V3KA 3FQTA 3D3VD 5SWSE 2PYFB 3AREC 4L4TE 4LDOB 1RHHA 5F7MC 1LEIA 4XMLH 5FYKH 1BJ1J 1G9EA 3ARGC 3JV4B 3WIIH 1J9CT 2WBJA 3C6SA 5K9JH 1HHKA 3P77A 5CIPA 4NUGH 3WFZA 5MENB 1ES0A 3GMQA 5IK3A 3MUJA 1NBVH 4OLYH 5IEKA 2E27L 3OAYK 4R8WL 4NRYA 1DDHA 1RHFA 4XWOC 4GAFB 1W8OA 5KG9B 4DTGL 3MRPB 3TGXA 4RX4A 1URLA 1WIUA 2XFXB 3LKOA 3SDCD 1OY3B 1KTLB 1RZ7H 3CJJA 3JBG7 4DGYH 3FN0H 1L7TL 4HEME 3PGCB 2NX5E 1G7MB 1ZVSB 3C6LC 3EO1A 1EJOH 3B9KA 4XP6H 1BLNB 1K3ZA 3ZYZA 4PRHA 1H9VA 1X5FA 3V2AR 1L7IH 1NMBH 1GCFA 2P4AB 2A83A 3BN3B 5HI5C 4AZ8A 5DHVB 5I73B 4JN2A 3O8XB 2AJSH 3RZWA 2VLRA 5D5MF 4MA7H 3V52L 3O6FB 1VPOL 2FIRT 4OD1H 1HCVA 2A73A 3MBEA 3WFEH 4PUBH 4X7TB 1SEQL 1YUHB 3L3OA 5J12C 3VXSB 5IEHA 1EAPA 2BHYA 3BEWA 2X89A 4IOSD 4OZGA 3UTTE 1TJGL 5JOPD 1KCVH 5EU4B 3GHEH 3LN9A 4BZ2L 1V3LA 2P48B 2XYCA 2VB5A 2V2XB 1QSED 1MCHA 2V5MA 1J0YA 2I26N 4L4VA 3DUUB 4LCWB 4G7VL 3QNYB 2ICCA 2EE2A 4ZS7H 4Z7WB 2FD6L 2YHGA 2G9HB 3SGEH 5HHOB 5EU5A 5EULV 4XXCA 3C08L 2FYYB 4GW1B 3ARYA 4BUGA 1BGXL 1AGCB 3CAFA 4G9FB 2V7HB 4QXGH 2RCSL 3EOBB 3OF6D 4HK3J 3MYZA 3R4DA 4R4ND 4GG8B 4XAKD 4DFHA 1RK1B 4NO5A 3P30L 3H9SE 2YR3A 3KLAA 4JKLA 1T2QL 1BIIB 1TZGL 2Y72A 4JFEB 2MQ3A 5GGSY 5SWSB 2ENSA 3GI8L 3HNSH 4L4TB 3ARBD 4PJ8A 3CK0H 3ZKXC 5D5MA 1IFHL 5HY9A 3FO9A 5AD0A 1KXVC 2V9QA 3V5DA 2YPKA 4JFXA 4WHTA 5LGHH 1YEGH 1T21B 1UQSA 1NBQA 5TE4H 3V0VA 1IEBB 3DSNA 3ZTNL 3WLBB 12E8L 4GAYB 2PXYA 2C7UB 3KS0H 2NW3A 32C2B 5JHDA 3OAZK 1VFBA 4Y5VB 5E2WH 3ARFA 1MFDL 2NX5B 4PJEF 3ZT5A 2F53D 5FK9A 4TNVF 2PO6A 1FNGA 4OAWA 5BQ7B 1NMCB 1FSKC 4LHUB 4OTXL 5DUBB 3QHZL 3BZEA 3SDAD 4OUOA 1FVEA 3QWRD 1J1OL 2AXGA 2W07A 1WBXB 3I6KB 5LQBL 1ZA3B 1U6AL 2JELL 2E27H 4L8DA 4R8WH 4ODHL 3FRUA 4X4MA 3ZMRA 3TBTB 4PJBE 3UTTB 4FQLL 1SYSA 4DTGH 5F7HA 4ZTPL 3WBDA 5F3BA 4ZFZB 4N0YL 1RV6X 3H9YA 1U8HA 4G8GD 2QSTA 1L7TH 3VCLB 4XT1C 2NY3C 5CP7B 4L8BB 3LKRB 1G7HA 2K7QA 3OAYH 4WVRA 3CPLA 3DVFA 1YEDB 1CG9A 4PGEB 2X4QA 5HYIA 4LCIL 3OKLB 3V52H 1ZGLP 2ADFL 4BUHA 2CXGA 1DN0A 1VPOH 1E28A 1NUFA 5FUZL 3MXVL 1KNOB 3Q5YA 3JSSA 1SEQH 4PJEA 1YQ2A 4EI5D 3H9SB 1CE1L 1TJGH 3CD4A 2C1OA 2CR3A 2AXFB 2EDNA 3UTSA 4BZ2H 2DF3A 1J8KA 1OARL 4PV8B 1XR9B 1HXYB 1LK2B 5DXWA 4PRBA 1S5HB 5DJ8B 4G7VH 4YNYA 1WBYB 2RHEA 4HPYL 2FD6H 2P47B 1B0RA 5DSCB 3ECBB 4M43L 2YXMA 3EYVB 3C08H 5C70A 1D6EB 2H9GA 1BGXH 3D48R 1FIEA 2OCFD 2RCSH 4OZHF 5IJKA 4GSDL 1S7TB 5ECJE 1C5BL 4RMQA 3SKNA 4JHZA 1FJ1A 5A2KH 2EO9A 2YD9A 4LOUD 1QRNA 3P30H 4EN3C 5EU3B 1T2QH 1TZGH 4R0LB 4KI5F 4WHYH 3V7AE 1N0XL 2ZUYA 3GI8H 3QQ4B 4AG4L 2HN7A 4QWWD 4TULL 1PX4A 3VG0L 4QRRE 4LEXL 4MB4A 1IFHH 4TSCL 3MLXL 4Z0XB 2A77L 4ZXBD 4WFEE 1U3YA 3W11C 5FF6B 3K81A 4DZBB 4OIIL 3IVKB 4MJ5A 3ZTNH 5MEPB 1FFOB 1BP3B 3H9ZA 3TNMB 12E8H 4OF6A 4PJBB 3IAGC 5T3ZL 1NAML 4WU5A 4KMLB 5DA4A 4OD2A 3L1OL 1FAIL 2Y5TB 4JO1L 3VGEA 4YHIA 1MFDH 5CJXC 3T2NL 6FABL 2BVOA 3MV7D 4KU1A 3L95B 5IIEA 3D25B 4JPIA 5I2IA 4OTXH 3QHZH 4A2LA 4UQ3A 3QR2A 5E6IB 2DQTL 4J8RA 5CP3A 4HUUA 3VRJA 4NGHL 1BWMA 2A38A 2PW1A 1J1OH 1FCGA 5CLWA 1C16B 3TO2A 3OAZH 4OZHA 3EOYG 1JL8A 5LQBH 4J23A 1MQ8A 1U6AH 2JELH 1NEUA 3GSOB 4RRPG 3MGAA 4LRIC 5H37H 3MJ8B 4ODHH 2WQ8A 1GC1C 1KG0B 3IS0X 3RWIB 4FQLH 3D69B 3VXNB 4ZTPH 1PG7L 4N0YH 3JV5A 4LKCB 1K85A 5D7LD 4JFPB 3CSGA 1ZWIB 2V5YA 4IIQC 5GRYA 1F2QA 2G75B 1YEIL 4JE4B 4XPGL 3MFFB 1OL0A 1T80A 1T1YA 1WEJL 3RL1A 1R3JB 5F7NC 1J5OL 1N2RB 3UYOD 2Q7YB 5CEZE 4LCIH 2L7JA 4EUPH 5T1KD 2ADFH 4MAYD 3DV6B 1WAAE 1D9KC 5FUZH 1EMTL 3MXVH 3NVQA 4IHOA 4UV4L 2NR6D 2VLME 4KC3B 3GMOB 1JF1B 1DE4B 3WMSA 3SGJA 1RJLA 3EOAB 1QO3B 4L3AA 1CE1H 4GW4A 4HS6B 4FABL 1QA9A 2MOVA 1A6UL 2IADB 1OARH 3QQNA 4A6YB 4QRRB 4LLWA 5SX4I 1F6AA 3T0EE 4BK5A 3BP7B 3GDBA 3FT3A 4HPYH 4DUWA 3X3FL 4M43H 2VWEC 1EO7A 4AEHL 1I4FA 5FHAL 1DEDA 3HZMA 4GSDH 3SDCC 4JVPA 3MA7A 3TBWB 1C5BH 4HZAA 3OKKA 4HBQA 1RZGA 3HFML 1I1RA 2EE3A 2ZSVB 3F6IA 1DQDL 4NBYB 1IAIM 5D1ZD 3WDJA 3BGFC 2EC9U 3O2VL 3RVWC 3MRFA 3MJ9L 3N50A 1N0XH 4QHKJ 4AG4H 4TULH 3VG0H 1JMXA 2RBLA 4LEXH 1U58B 2PCPB 4TSCH 1A9EB 3MLXH 1AKJB 5EBMA 4DVBA 4FA8A 3VI3E 1JPGB 2A77H 3ARVA 3D39D 3GRWL 1TVBB 2GSIA 3RPIA 4OIIH 1FYTD 4LLAA 4JKMA 1U41A 4BFIB 4YK4C 5T3ZH 1NAMH 4PJ5D 1T1WB 5A2FA 5F3HA 5D96B 1RU9L 3L1OH 1FAIH 4JO1H 4AIZA 3IDXL 4OLZL 4N1EA 4NWUL 4FRWA 1Z5LA 4XNZC 1JNNL 2VQ1B 2ESVD 3T2NH 6FABH 4MCZB 3DROB 4BSWB 3SGDI 2YPLA 3W9EA 1WV7T 4G6FD 3QEQE 2XWJA 3BX7C 1J0KA 4RGMC 1S7RA 4TOYL 1RZ8B 1ZTXL 2DQTH 1I8LA 4NGHH 2V2TB 3G5VA 3QCTL 2VAAA 2BMKB 3MRGB 2B1AL 5FM8A 3R0NA 4WDIA 4LLUA 4R4NC 3O9WA 3E6HB 1X6NA 5BRZE 4Z7QE 1PG7H 1UZ6E 1QEWB 2BVPB 4NOFA 3VFSA 3ZT6A 3VFPA 1Q9OB 3ARBC 2A74A 1OM3L 3I3BA 3LRGA 4NWTL 4DEPC 5GGUA 4XPGH 2FBJL 3T0EB 3G08B 4NCC2 5JHLL 1MNUL 1MWAB 1N26A 1QFOA 4QHMA 1CQYA 3WUWG 2EH8L 3I84A 3HE6D 1WEJH 5DMIL 2CDFB 3TN0D 4MXVE 1F3DJ 1J5OH 5KANG 2NPLX 2FHBA 5KSVB 3U7YL 4D0CA 2IFFL 1LVEA 3AB0B 1EMTH 3AXLA 2VLKA 4I1NB 5FOBB 4UV4H 1BPVA 5AAMA 1U95B 4FQJL 4CVWA 2ADGB 3U9UB 5JNYA 3BDYL 3ES6A 3MO1B 5DVOA 3RKDD 1F58L 4FABH 3T2PA 1XCTB 4H8WL 4HS3A 1IQWL 1QQDA 2OXHA 1A6UH 4NYLA 2AI0L 3IDGA 4JKPL 6CGTA 4LVHB 3CFBA 3PWPA 2OSLB 3DMMB 3DXAA 5T3XL 4OJFL 3KPRD 3X3FH 3B4NA 4HGWA 5H8DA 2HT3C 2B8OT 4OGAD 4P57B 1MHEB 5GZND 4AEHH 2DLHA 4NOBA 5FHAH 1K6QL 4U1SB 4LPVA 1PZ5A 2D2OA 3CX5J 4XPFL 5FUCE 3HFMH 5H37G 4Z18A 3BHBB 2J8HA 3FCTB 1DQDH 5FO8B 1BF2A 3QIWA 3BRDA 3K2UL 3O3EA 3V8OA 2UY6A 3QEQB 5I1LB 3O2VH 3MJ9H 1VENA 4P23D 4XI5D 1OW0A 1MIEL 4LL9A 1H3GA 4Z6AT 8CGTA 5ICZA 3CUPA 2WAHA 1A1OB 3QO0B 4ONGL 1G0XA 1IJ9A 1U8QA 3OR6B 3GRWH 3NIGF 4U1LB 5GGSA 2X70A 3BN9D 4J3SA 3QUYB 1Q38A 4EI5C 2QADB 3HI1A 4P5KA 1MCLA 5BRZB 1BAFL 3AM8C 3MV8E 5HYSA 1RU9H 4U1IB 4NHCL 3IDXH 4XCNB 1CVSC 4OLZH 4NWUH 5D93B 3WUZA 1JNNH 4NN7B 3QIBB 1VSCA 4LNRB 4I3SL 1FNHA 1A6TB 3CH8A 3QWOA 1RZJC 3PWVB 3P11L 1NDMB 1DVFA 3MNWB 5F7DA 3VE0B 3UYRL 4TOYH 1U8PB 2NCMA 1ZTXH 2DQFB 3BEVA 3R06A 4XNUL 3TYGL 1FGNL 5JW4R 3CVHA 3UPRB 2FEEI 3QCTH 3V6BR 3CNKA 3GSVB 4QHUB 2CPCA 2D4DA 2IJ0C 3GO1L 2B1AH 2OXGA 3GUTB 2V7NA 5FA3A 4JY4B 5ID1A 1YQVL 3OKMA 5IWLA 3QNZA 2A6JB 1MCCA 1Z3GL 1FVDA 1BOGA 4QWWC 5CSBA 1MHCA 4MX7B 3MREB 1OM3H 2GQHA 3MLRL 4D8PA 2PTUA 4GBXA 4NWTH 2FBJH 3I6LE 5IMMA 5JHLH 4ZXBC 4Z78A 1MNUH 2LTQB 1JF6A 1KPUA 1M05A 2EH8H 2WV3A 4PJDE 4PJIE 5DMIH 1GOFA 3GM0A 3GJFB 1QSEB 3VJ6A 3FAXA 3AAZA 2VXSL 1UM6L 4QYOA 4LFHD 2P8LB 1HNGA 3VWKD 4HKBA 4HKZB 5HDBF 3WFCL 3U7YH 5FYLE 1KXQE 3B3IA 4NO0A 1AHWB 2VKXA 2IFFH 3DI2B 3FQUA 3L3JA 2BVTA 1T5XB 2H2SD 4XVJL 1JYXA 2W0KA 4FQJH 5C07D 3BDYH 1NGPL 4J3UA 1F58H 4H8WH 4DZ8A 4X6BA 1IQWH 2DMBA 4HH8A 4GT7A 3UBXB 1DZBA 2AI0H 4JKPH 3IDNA 3FHQA 2DM2A 4N90E 1ROWA 5IHZB 4LASL 5T3XH 4IMLA 1MH5A 4OJFH 1NGQL 1I8KA 3OB8A 2HVKA 4HWNA 2YKLL 4DQOL 4MJ4A 5D9SB 1LEKB 1K6QH 1FNFA 3MV8B 2DICA 2DTML 4XPFH 3FRPA 5HGAA 3H7BB 3H9HB 3HZYB 5A2LH 4R97B 4NKQB 5FGRA 3DX6B 1HH9B 5DI8B 1QFWM 1SJHB 1NDGB 5DHVH 4S2SA 2GT9B 1U3HB 1Q1JL 1MIEH 2A6DA 1K8DB 1MLCA 1LD9B 3SCMA 1CDJA 3U46B 3GSRB 2XKUA 4MAYC 1MUJB 4ONGH 3JVGA 5MI0B 3SDAB 3W81A 2NR6C 1NCAL 4RIRB 3CDYA 1BAFH 3MRIB 4PY7B 3QDJE 1FYHB 2AV1A 4LMQI 1AC0A 2AXJA 4PJ7E 5E2JA 5BV7C 4NHCH 4U31A 1QOKA 5AAWA 3BQUA 3QDAA 3SGKC 2EDKA 3SKMB 4Z76B 5IBUB 4OF5A 4PJFE 4I3SH 4JCMA 4N1CA 3P11H 1HN1A 4PJHF 2C3VB 1CFVL 4PJDB 5D7IB 5GHWL 4YFLI 4QO1A 3TJEL 3UYRH 2E3VA 1OSZB 1UG9A 3TM6A 3TYGH 4XNUH 2EDHA 1FGNH 1QRKA 5BOZG 3MOBL 3GO1H 1G0YR 1JP5A 4F8TA 1NMAL 3BRGC 2FDBP 1T83A 3GSNB 5I76A 1GGUA 3EO0A 3MRQA 1YQVH 3ZE1F 1OP9A 3QWQB 3G6DL 3LKPA 4Q7DA 3RI5F 5D1ZC 1GYAA 4YHPA 1VACA 3RNKB 4GMTL 5KSAA 2ZUVA 5HHQB 4JZOB 4OUUB 1WC7A 5IROA 4ELMF 5J8OA 3SKJL 3MLRH 2YA2A 4KKNA 4CN4A 5F7YC 3AMLA 3U30C 5DQJB 2BNQD 4XB7A 1A7BA 4BA8A 5CEXB 1P84K 2EH7L 4Z77A 4QOKA 3MROA 3DO7A 2VXSH 4ZSOE 2VKWA 1UM6H 3AS1A 5ESVB 4XCEB 1T2XA 3WFCH 1JZ6A 5IHUL 3LMJL 3GKWL 4EOWL 3QI9A 2VR4A 3CFCL 1KIQA 4LP4A 5IV2A 1ITBB 2OM5A 1HHGB 5CZVL 4ZNEA 3ROLA 1FZJB 2X40A 2YS4A 1I9RH 3ZSSA 3VFUA 1NGPH 4GRWE 4ODUB 5EO1A 4PJHA 5CZKA 3KLHD 1IAOA 1OQXA 3DUSB 1XF5B 5DRXA 4LKXA 3E0GA 4ZUVA 1NEZB 2FO4B 3OR7B 2GY5A 2DQDL 3KYMA 3LVEA 1RULL 4LASH 1YN7B 1TNMA 5IJVA 5I66B 5C0CE 3VXTA 4U4BA 1NGQH 3GSUA 5INCB 3GHBL 3QPXL 4NFDA 2YKLH 4POUB 4DQOH 4JY6B 1NC2B 3ZDYE 1EFXB 3FB6B 4ZXBB 3QDJB 5I8CA 4PJ7B 4WY7L 2FL5A 2DTMH 3F8UB 3UZEA 4Y5YA 4ELMA 4GXVL 4RMVA 3VFMB 5EB9A 4XH2B 5D71L 4HDIA 5EN2A 3INUL 4U6HA 4PJFB 3TCLB 5JMOC 4Y19E 5DDHA 1YPZE 3TVMD 4Z7NE 1ODAA 3HE6C 3TN0C 1AO7E 1Q1JH 3CFKB 3WNLA 4PJXE 5IB1A 1LO5B 1U8NA 1HQRA 3F7VB 3BP4A 3LIZL 3TCXA 4NZRL 4QHLB 4B50A 4KJYB 4JGMA 3WN5A 1Q72L 3MRJA 4JY5L 1U8JA 1UXWB 4NJAL 4F37F 1A6ZA 5EFIB 4OZFA 1QUNA 4X6FB 1NCAH 5LCVL 1F45A 3D2UA 3O4OC 1BQHB 3HE7A 3RKDC 5F9WB 3DNKA 3F7YB 3D39E 2VQTA 3HC3L 3ZKND 3RL2A 3QZWB 4OQTL 3WEXA 1S7XA 3C5ZA 4A6YL 1HKLL 4F8QA 4OBRA 3VFRB 4WNQB 5HYJD 3V6FB 2FLRT 5C0BE 2R39A 3A67L 4NZUL 1LP9A 4R7NA 5EC1A 5GS1B 2NY1B 5T5NG 3RUGE 1EJ6A 1YMME 1B90A 3OL2A 4U0QB 5C0RL 2VIRB 5JZ7D 4O9HL 5HGDA 5GHWH 1CFVH 2HJKA 1BBJA 2QTEA 3N0PB 3TJEH 3VH8G 1PBYA 1B6DA 4OGAC 4PRDA 4URTB 5DJ2A 5GZNC 4P2QE 3KPNA 4Y2DD 4ZSOB 1TVDA 3GJEB 1T22B 2EDDA 5JPNB 2VZUA 3MOBH 5ACLA 2BC4B 3NZ8B 1NMAH 1JV5A 4NBZB 4CMMA 2DKUA 3AS0A 4Y4FD 3WNOA 5DRZB 3NACL 1G7PA 3G6DH 1X7QB 4GRWB 4GMTH 4P23C 4PFEA 3V6ZA 1XT5A 5HDOA 3UXFA 3G6AA 2WWKT 3SKJH 1Z9OA 1UH2A 1NGZB 1ZLSL 1PY9A 3RDTB 3SKUD 3FQRA 3OXSA 2ICEB 3BN9C 4P3WA 1UB6A 5C0CB 1C8PA 3DX8B 2VERN 3P9WB 3AY4A 2EH7H 5JUEL 5L0QB 1CDUA 1QSFD 4Y4KA 2X4UA 4NCDA 5BS0A 3DX7A 4U1HB 1R5WB 4K94L 1I7ZA 1S9YB 2VLJD 5IHUH 3LMJH 5E1HB 4EOWH 3WD5L 3CFCH 4W6XB 1B3JA 3IDIA 3VXUE 5CZVH 4QGYA 1WTGT 2AJYL 2AK4E 3RVXD 1BFTA 4Y19B 5AZ2L 3RA7L 1YPZB 4AEIL 2XY1A 4OCWL 2J88L 1AO7B 3U4EA 3T4YA 1DQQB 2W0FA 4PJXB 5CEZL 4G9DB 5ID0A 4X5XB 2VUOA 3ARZA 5DK3A 2XQYK 2DQDH 2FWOB 1RULH 5ITFB 5A1AA 4Q9RL 4BK4A 1R24B 1EEQA 3OHXA 3DX9B 3WL9B 1KFAL 4M1GL 3GHBH 3QPXH 4MZ2A 5JIPA 4MA8L 1SYVA 3IDYC 3D39B 2EDJA 3D85B 5E6YA 4BQ9A 4WY7H 4KDTC 4Y16A 3F58L 4GXVH 5BMFL 5D71H 3FN9A 5FXCH 1JUFA 2HG5B 3B9EA 2FECI 3INUH 3OGCB 4OGZA 5C0BB 3L5XL 3AFLA 1MWAL 2EICA 3RUGB 1YMMB 1UXSA 2Y4SA 1E0OB 3NPZB 1XIWA 3G5ZA 1XGTA 1IC5L 4NRXA 3PJSA 2R0WL 3LIZH 2FATL 4P2QB 3G5XB 1H5BB 3VWKC 1BVZA 1Q72H 4JY5H 4YDLB 4NJAH 2F19L 1ZHNB 2D7OA 4RA3A 4ZMAT 4QRPA 1ZOXA 5EO9B 2O93L 2H2SC 1RJZA 4MHHG 4N8VB 4BYHA 2P8MB 5LCVH 4OD3L 2NY6D 4ZYKB 2FJGA 3RZCB 3CLEL 5JQ6L 3HC3H 4HCRL 4LVOC 3NABL 3WKML 5I1CL 4OQTH 3RFZC 5ERWB 4A6YH 4MQTB 2Z31B 3KR3L 1HKLH 1QKZL 2Z93A 3L9RB 3NCEB 1ZSDA 3GMLA 5J1AA 3ALPA 2DWEB 3A67H 3ARPA 4NZUH 4BZYA 5LAXA 5DJDB 4D9QD 3ARGA 3TH2T 5C0RH 2Z4QB 4O9HH 1E4WL 3MUZ1 4LK4A 4ODXA 5B39G 5IQ7L 4Y89A 2X4RB 2ATPB 3BKCL 3SGEI 1CFNB 3QUXD 1KENL 2VXVL 4P9HL 1QLEL 4N9GB 4WO4B 2AK4B 1YC8A 3NACH 2NY5C 1P4BL 3PWUA 1G6RA 2CKBA 3P40A 5H35B 3LPWA 3ZE0E 3V79C 3NGBC 3WO4C 1KIRA 3QUKB 4KGLA 5DD5L 1ZLSH 4JRYD 3H7LA 1VKXB 5CJQL 2R23B 4MNGE 5JUEH 5KW9L 3EDKA 1BVLB 4KQ3L 3FFCD 5C0AA 1FVCB 4KK9D 3DTXA 3RWDB 5I9QC 1CE6A 3DYOA 4K94H 3WD5H 5GGQL 3TH4T 2F54E 3S34L 2AJYH 5ANME 5GIRB 1KJVB 3WS6A 2XZZA 3DRTA 5TGBB 1BVKB 3FAWA 3BMVA 3LRSA 2VITA 5AZ2H 2BY3A 3RA7H 1QVOA 4AEIH 3VWJC 1MCBA 4OCWH 3SDXE 2Q76A 4H25A 5CEZH 2XZQL 5TQ2L 4YXLL 2XN9D 1QLRA 2BY2A 4Q9RH 1NGWA 5E6ZA 1DUYA 5KSBA 1KFAH 3LQAC 1CU4L 4M1GH 1DQJA 5F88B 4RCAA 4MA8H 1R5VB 3GJFK 3DVIA 4CMHB 3ZYOA 3FB5B 5AYQA 3VD9A 2BSSB 2X4OA 3F58H 5BMFH 1VADB 3C5JA 5DD3L 4U6YB 1W0VB 2HWZL 3L5XH 1MWAH 4ISVA 4F7PB 2CDGB 2A6IB 4BQBA 5I17B 3KPMB 43CAA 5DEGB 1IC5H 2HP4A 4LHJB 4RFEB 4GRLD 1FFNA 1JTOA 2R0WH 4YFDB 1ZA6A 3Q3GB 2FATH 4P2RA 1CT8B 4F7TA 2XKNB 4M7LT 4PB9L 5IVZB 5DURD 4PJAA 5EOQL 2F19H 1ORQB 1ZHBB 4NJ9L 4CU7A 2R2BA 1SJEB 5EBLA 1T5WB 2HFFB 2HLFD 2JB6B 3OXRA 5DWUL 4HUVA 4OD3H 3CLEH 5JQ6H 4HCRH 1MHHB 5SWZE 3NABH 3WKMH 5I1CH 1C1EL 3KLHC 3MCG1 4P4KB 4WW2B 4RGND 3KR3H 5FDWA 1QKZH 4E42B 4XBPA 4C55A 4PRIE 3VFGL 1U92B 1KULA 4HH9A 2I60L 4PBXA 1JHKL 1KYOJ 3NFPA 1E4WH 4X83A 4MNGB 5IQ7H 5JO5B 1KN4L 4G5ZL 4YO0A 3GFUA 1J05B 3O4LD 5DK0A 3UO1L 5KS9E 3QIUB 3FFDB 3BKCH 4FQ2L 5MERA 4L8SB 1IEAB 5KOMC 4NQED 1KENH 4WW1B 4YHNA 3JWNC 2VXVH 1QLEH 2F54B 4LEOA 1G6VK 2FGZA 3QFJA 5ANMB 3V9FA 5C0DB 1P4BH 3TVMC 5MHSE 3NFNB 3TBVB 4OCMC 2AEPL 2RR3A 3L5WB 1ND0A 5GSRA 2PYEE 3SDXB 3UC0L 4KI1A 1N5AA 1JHTB 3KAAA 2YSSA 4N68A 5D7JB 4M9OA 3FOMB 5DD5H 1HI6A 1BFOB 3L7FA 5CJQH 3HAEA 2WBJD 5KW9H 4KQ3H 3ZDZF 3KXFE 4Q6IC 4XNYL 4FTVA 5D1XA 3NH7L 1VERA 5HPMB 4WEBL 3ZKNC 4PGCA 1T20A 3OGOE 2UZIL 4ZS6D 2DYPD 5EU7C 4YDJB 5E56A 1I1YB 5GGQH 2GTZB 4L4JA 3S34H 1NGXB 4JVWA 4K3EL 2GSGA 3RWGB 5I1AA 3K1DA 5JOFA 4U1JB 1S5IL 4G6AD 5CJ5A 5JZ7C 3MMEB 1JZ4A 5KTEL 3B9KD 1F11B 3CH1B 2XZQH 5TQ2H 1BQUA 4PRHD 4X7EC 3DLQR 4Y2DC 4YXLH 4WUUE 3HMXL 2OL3A 4L9LC 5FYLL 2EE6A 4LCCC 3GSNL 2D31A 2JJSC 1T89A 1PKOA 4Y4FC 3QULB 4OLXL 1CU4H 4CDGC 2VLRD 4OIBA 4Q2ZB 2XICA 5D4QA 3MBED 1JWSB 5SWZB 1PY4A 2V2WA 4OFKA 4PR5A 2O5ZL 5DD3H 1OD7A 3C60B 2X89D 1G7QA 4HFWA 1JF5A 4ZFOB 1BX2B 2HWZH 4KAQL 5F9DC 4I48A 3OKDA 4PRIB 2MCPL 4D9LL 3LKNA 3SE3A 3GJFH 5HGHB 4IRSA 2ZUSA 5FIEA 1ZT4A 4E0RA 3RU8L 2GW5A 5C0IB 4OSUL 4PLKD 1RY7B 4L4VD 5KS9B 1WLHA 4PB9H 1N6VA 3OBAA 5EOQH 3WNMA 4E41A 1QSZA 4Q74A 3HPJB 4NJ9H 5K33A 2ZOKA 5ESAA 1HSBA 4L8CB 3RVXC 2UVEA 2WQRA 1XEDA 5DWUH 3W0WE 3U6RB 3W9DB 4XRCB 1SMAA 1TNNA 5JLZB 1C1EH 4UDUB 4GG6A 4U05A 4N8CL 3IGAB 2AJ3B 5TJWK 2PYEB 1OGTA 1LEGA 3STBA 4OBSA 4XBEL 3VFGH 3ARDB 5EBWB 3MCKA 1INDL 2I60H 1JHKH 4PJ8D 4QNPF 1KN4H 3PL6A 2K1MA 4G5ZH 3KXFB 5AUMA 3UO1H 1BREA 2P7TA 4FQ2H 5IB4B 4O4YL 1AXIB 3MNZB 4HAGA 1OGAD 2VZOA 5HPOA 2JIXB 2PXYD 3P9LB 5JW4Q 4OZIE 4ZFGL 1X6LA 4HBCL 4IIQA 2AEPH 5JHDD 1M7IA 3UC0H 2CLRB 3ARUA 2GK2A 4NN6B 5DMGD 1F6FB 5K9OB 5FKAA 4GAGL 2XT1B 4WUUB 3U36B 2Y7QA 2PO6D 4WI7A 5AEAA 1E4XL 1JK8A 5IUSA 5F6HI 1HKFA 2VL5B 4Z7OE 4XNYH 1D9KA 2AW2A 2NLJA 2X4NA 5ALBL 3NH7H 1J8HE 4WEBH 4Y4HB 1WWCA 4I0PB 2UZIH 5T1LA 5GRVK 2R2HB 4LLYA 1A1NA 3S5LB 5BZDA 4OFIA 1CFTA 2LQRA 4K3EH 1PDKA 2A1WL 4OGXL 4OKVB 4HT1L 2X4TB 3T08A 1DANU 3MV9E 1IAKB 1S5IH 3ARWA 3MRDA 1MIML 5KTEH 4YXKL 5GRVL 4IS6B 4Y88A 3HMXH 1LHZA 3CCHA 3HB3D 3QJFA 5FYLH 3TZVB 4YC2C 3QUXC 1NC4B 3GSNH 5DHXB 4XCYA 4H0HB 5EZLB 5IQ9B 4LSSL 1TZHA 4NQTA 3DVNA 3MLZL 4OLXH 3TPUB 4RAUB 5AG9A 3W0WB 2E6QA 1AGDB 1JN6A 4WTZG 3C8KB 2BNRA 4UT9L 1RIVL 3EUUA 2XTJE 3GBML 4ZQKA 4U6XA 2JKXA 4KAQH 1D5XA 2MCPH 1T4KB 4D9LH 2YWYA 1BZQK 2ICWJ 4RNRB 1M4KA 4IOIA 5L8KB 1II4E 4PREA 3I3EA 4R3SB 4AM0A 4ZFFA 3RU8H 4KK9C 4OSUH 1CGUA 4F57L 3WFHA 3JWOC 5D2LE 5FKPB 5ICYB 4GMSL 3L7EB 4Y5XA 3Q2CA 5E1AA 1R3HA 1HHHB 3FONB 1JNHB 4XBGA 1JI1A 1P7KB 1ZHKB 3X13B 1YZZA 3DV4A 3E6FB 2E9IA 4N8CH 3VFVA 4DKEL 3BKJL 4XZUA 3WNKA 4YZFF 1KJMA 4L3EA 1QRND 2D03L 5EPMA 2GITB 2ZG2A 4XBEH 1AD9A 2W60B 4AT6A 2CUMA 1INDH 1N0LA 2HLAA 3Q6FB 2Y6SD 3LD8B 3O3BA 3VDBA 1J8HB 1W0WA 1MRDL 4LLMA 3FB7A 4PJGE 3ROOB 3VA2C 1YY8B 3QP3A 4O4YH 2WINB 2DRUA 4OV6F 3JWDL 4FQXC 4ZFGH 3ARBA 4X5LA 3FT4A 2EDWA 3MV9B 4HBCH 1AY1L 5EIVA 5CZXD 3KHQA 1OF2B 2QKIA 3TESA 4GRLC 4MCYB 3JUYA 4BZ1L 4GAGH 4KDVA 4F7EA 2YWZA 1E4XH 4JAMA 5C0EA 1EGJA 5FYJD 4O51A 4MJ6B 2IBBA 4GUPA 4Z5RA 3GMNB 5CBEA 5DJ0B 4YPGB 2HLFC 2APVA 2HJFB 3LKQA 3BZ4A 5ALBH 2HFEB 4BQ6A 3UMTA 4OV5B 4OKDA 1AC6A 5FECB 5D7KD 3NFSL 2RFXA 4NNYB 2XTJB 1REIA 4RGNC 2F53A 5F7UA 3DHMA 35C8L 4V1DE 2FB4L 2A1WH 4OGXH 4HT1H 2W38A 2Z91B 5BJTB 3FB8A 3HRZB 1UZ8B 1A4KB 1JWUB 1P7QA 3PP3K 3UBXG 1U8KB 4EUPA 4RQQA 1MIMH 4WGVB 4MWFA 1N3NB 2I9LB 1S7WA 2PNDA 1LE9B 4YXKH 4P3CL 4ZAKD 2FIKA 3V5KB 4I0CC 5EZOL 4HJGB 2D3VA 4TN9A 5D2LB 3NN8B 4LSSH 4FQIL 4JDTL 3MLZH 1TLKA 1KIPB 4G8GA 1NCTA 4GRWH 3PV6B 1UC6A 5CEYA 4LHQB 1YN6B 3NA9L 4UT9H 2CLZB 1RIVH 5CMAA 3GBMH 4PJCF 2ZOLB 2NY6B 4U33A 1MCWM 3C09C 4NSKB 5EBGA 5IG7B 3K74B 4CNIB 5TDPA 4Y1AE 2IPKA 4PV9A 5F1NA 4I2XE 4HLZH 4MNHB 2WBJC 5IVNA 1ORSA 4LPCA 1IKNC 2OJEA 1WZ1L 2IAMA 1MJ7L 1QNZL 2YK1H 4AMKL 2XNAA 3NIDF 4F57H 1HZHL 3AU1A 4ZS6C 3JTTA 4EI5A 4JQXA 4GMSH 4PJGB 3T0XA 3VXPB 4DVRL 3F12A 2AGJL 2EYTA 3X11B 5GJSL 2DI8A 4LVNC 1IAMA 4I18C 3HZVA 5A3ID 4G6AC 4G6JL 4J1UB 5EO0A 4YGAB 3TYFB 4HKJA 4DKEH 3ILPA 2NXYB 1A7PL 3BKJH 5IBUG 3VXME 3B9KC 4MVBD 3LHPL 3HUJE 2D03H 1KACB 2ITCA 2F74B 4JFFA 4X4XB 2MCG1 4GRMB 3DBXB 5B8CB 3ULSA 2NZIA 3EGSB 5C09E 3SDDB 3BIBX 1NAMA 1S7VA 2HJLB 4HV8B 2C3GA 1DBML 3MBEC 1MRDH 4HW6A 2GFBA 4ZUSA 1JGEA 3CDCA 5E95B 3WS3B 4D2NA 4I3RL 4PJCA 2GAZB 5F96L 4C59B 1CD0A 4V1DB 1FFQA 3JWDH 3PABA 4HIEA 4U49A 5IKCB 3W2DL 2UWEF 3CSBA 1VEMA 1BOYA 4X6CB 1AY1H 2Q87A 1T03L 3QFDA 2EIDA 1S8DB 4L9DA 1A6AA 4X8XA 1S9KC 1MVUA 5B38B 2EO1A 4PLKC 4BZ1H 3OV6A 1M6OA 2FLBT 2YUXA 3BPCB 2CRIA 5CHNB 3SE8L 4U1NB 3CFJA 3MJ7B 3KWWA 1NBYB 1NBZA 5M95B 3HS0B 4G43A 2W0LA 1R5IA 3RKPA 1FHGA 5B3JF 3QG7L 1U93A 4FFZL 3HCVA 4O2CB 4MD0B 4F7MA 3RHWK 4PPTA 1UYWL 3NFSH 3O9WD 4M6OL 1CK0L 4NO3B 2JJUA 4KROD 2RGSA 35C8H 2IALA 4L3CB 2FB4H 4NN5C 5TQ0L 1I1AD 5E70A 4M6ML 4QRQA 3VFWA 5DF0A 2DJUA 3LKSB 1A9BA 4Y1AB 4PJ8C 1XGQB 3CFEB 1N4XL 2EECA 1FFPA 1NEZG 4P3CH 1N59B 5EZOH 4JJ5B 3TP4A 5J11B 3CMOL 3BUTA 3DVGA 2ZUTA 3IJSB 4JLRB 4OI7A 1G7IA 5JXAL 4Y8DC 1NSNL 4FQIH 4JDTH 3PP3H 2PXYC 5EOTA 2E7MA 4KK8D 4X8JA 4NKDB 3OMZA 2IH3B 5IFAL 3KVQA 2GJ6D 2VLKD 3NA9H 3D6GA 5E9DA 4PP2A 3VXMB 5DRNB 5DMGC 3TIDB 5LGJA 3HUJB 3QXDB 2NZ9D 1YDPA 4UAOB 2PO6C 1P4IL 4H1LA 1QHPA 2Q6WB 4HWUA 2LV4A 4F2MB 4CADA 4RGNB 5C09B 4ODSL 2FR4A 1VESA 3ZLQC 5T1KA 4MAYA 1MCDA 3O3AB 1WZ1H 1C5DA 5I75C 3PWPD 1MJ7H 1QNZH 4AMKH 1I7TA 4K7FA 1HZHH 4WFHD 1BJ1H 4NKMB 3DXAD 4LLDA 4DVRH 3VRLF 4RMRA 1CDHA 2AGJH 3LRHA 5J56B 4HZLB 1BQHG 2DAVA 5GJSH 2R2EB 4N0CD 1ACZA 5IM7A 4NIKB 3WNPA 2ERJC 2OYPA 3QZWG 3O2DL 4HWEL 1KCKA 1RPQA 1S9XA 3O6KL 4G6JH 3QDGE 3SGKA 1MJJB 4LGPB 4MXQD 1A7PH 3GRWA 3LHPH 3PWNB 4P2OB 2NY5L 1FO0A 2P24B 2X7LB 1U0QA 3HB3C 4RMWA 5BO1L 4PD4J 4R7DB 1F4WL 2JCCF 2GTWA 4EI6A 4PYGA 3PHOA 1DFBL 1DBMH 4GS7C 4WI4A 1EXUA 1RHHB 1OAUL 2XRAL 2G60L 4I3RH 3MRHA 5D5ME 1RK0A 3TO4B 1U91B 5F96H 4ZFOL 1Q94A 5CIPB 5F71A 3PHQA 4KKLD 1DBBL 2GCYB 1BBDL 3W2DH 2NNAB 2F5BL 1T03H 3BZDA 2H3NA 3RNQA 2GUOA 4YGVB 2Y25A 1DDHB 5E08L 3GIVB 4ZODA 1T0PB 2HRLA 2R1WB 4EJ1C 5J89A 5K9QI 1CFQB 3SE8H 5J1TC 4MD5A 1DVFD 1EEZB 4LAQL 4HLZG 3K80A 4K7PX 1MI5A 3MJGX 3QG7H 1ZAGA 4FFZH 3RGVA 4JHWL 5IJKC 1H15A 2A83B 1VGKA 4X4YA 2ESVA 3HNTL 2O5XL 2Q8BL 4JN2B 1UYWH 4M6OH 4MMXC 1CK0H 5C8JA 2E5EA 5TQ0H 2R0LL 1S7UA 4P9ML 4M6MH 3BPNB 4FQPA 2VN4A 5ISZA 2DWDA 2JCCA 1S7QB 1N4XH 1WBZB 3BEWB 4I13B 5IVXF 1TZIA 4GBXD 3OKOB 4AEFA 3CMOH 5EC2B 1UT9A 4D0DB 2R4SL 4D9RE 3KJ4C 4RBPK 5JXAH 3LQMA 3RVVD 2PYFA 1NSNH 3CXHJ 5HHPB 5TFSL 1A22B 1XGYL 1TQBB 4ZDHA 5EUKA 4UU9A 1ZMYA 4NO0D 1UVQB 1FL5B 5IFAH 3QDGB 5MENA 5CZXC 2X4SB 4FQHA 3HPLB 1MAKA 3GBNL 4OGYL 3HE6A 43C9A 2DN7A 1P4IH 1YJDC 4K7PY 4PJEE 3ULUE 2XFXA 4PGBA 4ODSH 1U42A 1KTLA 2N7BA 1A6WL 4NO5B 5GS2D 5C7XL 3I2CL 3PGCA 1ZVSA 3RJDA 3KLAB 5SV4A 1MCKA 4KRPB 3UTSE 3REWB 4QHNB 4S1QL 1PD6A 1XF3A 5FM5M 4N8VG 3R8BB 1A6PA 5D5MB 2XQBL 1J11A 3O8XA 3BW9B 4LPXA 4NM4L 4R2GB 3V5DB 1KB9K 3O2DH 4HWEH 3O6KH 4WHTB 1KJ2B 1A7OL 1OOAA 1D5ZB 1QD0A 3O6FA 4BJLA 4XVUD 3PDGA 1JZ7A 1SEBA 3V0VB 1CD9B 4X7TA 4M7LL 5IVXA 4ZAKC 1GAFL 2Z92A 1YUHA 2O61B 2NY5H 3VXSA 1KBGL 5BO1H 2NW3B 1ZXQA 4LSRL 3SO5A 1VFBB 1YEHL 5EU4A 2XACC 3ARFB 4X9FA 1F4WH 1R3IL 1NH6A 3SCMD 2X1XR 1WZLA 5HVHB 4NQXB 1DFBH 3QEGL 5IOPB 1AXSB 2UV3A 3EYSL 1CFSA 1OAUH 4JRXE 4WWKA 2XRAH 2G60H 3QNYA 5TDOB 1YMHA 4NUJB 1UJ3C 4Z7WA 4BQCA 2AXGB 4U1GB 3SGJC 1N5YL 4Z7VF 1DBBH 2FYYA 4GW1A 1BBDH 3H8NA 4UOJA 1AGCA 2F5BH 3EOBA 1RZKC 4GKOA 5DA0B 1I8MB 5E08H 5F3BB 1QPPA 1VFAA 2DD8L 3EZJB 3DJ9A 1N7ML 4GJTB 4LAQH 4L4TA 1A3RL 2X4PA 2CD0A 4DOHE 1G7HB 1UB5B 5GRUL 4JHWH 4IOFD 2VSDA 3HNTH 1D5BA 2O5XH 5JOEA 2Q8BH 1CG9B 4MVBC 2X4QB 2ZUQB 4OZHE 1V7NL 2R0LH 5E5UB 1DN0B 4J12A 1E28B 4CW1B 4P9MH 4GAYA 3PHSA 1NCWL 1Q9LA 2C7UA 1QLFA 4PJEB 2GEEA 32C2A 4KMQA 1C12B 5F9AC 1JGVL 5J3HD 5ETUB 2R1XA 3S4SG 5CSGA 4KI5E 5L2JB 3OJMB 3LH2L 1FRGL 3UTSB 2K7PA 2R4SH 3BMWA 5K93A 3UJJL 2V5SA 4PY8I 5DUBA 5TFSH 5ENWA 4Z7VA 3BVNB 1XGYH 5GISL 1EH9A 4KDTA 4BFGA 1PFCA 5D2NE 3I6KA 1CI5A 1B0RB 4K07A 4K7PL 2H9GB 2LU4A 1G84A 3GBNH 3IAQA 4RBPH 1T7ZA 4OGYH 2BOCB 1G9ML 3ZHKA 3SPVA 1JYNA 4ZFZA 3DPBA 3IJYA 5IB5A 2VDOL 3M8OL 1I8LC 4YQXL 1QRNB 1A6WH 5C7XH 3I2CH 3VCLA 4G8IA 3LV3B 5CP7A 3WJJA 3T3PF 1Z9LA 2CIIA 4M7JL 3LKRA 1MFCL 4S1QH 4D3CL 4ODBD 4JRXB 3O9WC 4KROC 2XQBH 1I1AC 4M00A 2P5ED 2VL4A 4NM4H 1TCRA 3U0PB 1TQCB 3RJQB 1A7OH 1WGOA 4V2BA 2Z9TA 2AQ2A 4M7LH 1KNOA 5CGMA 1GAFH 4XC1L 3WFBL 4WU5B 4OD2B 1KBGH 3H9SA 1EPFA 4PJBF 2AS5M 4LSRH 4YHIB 1CVRA 1YEHH 3C9NA 1K5NA 1EIBA 1R3IH 2NY4D 2QSQA 1TFHA 4NZTL 2BVOB 3C8DA 4KK8C 4PV8A 3QEGH 4DOHB 5IIEB 5C71A 2QQKL 1XR9A 2EDOA 3EYSH 1HXYA 1LK2A 4I9WE 4JPIB 5DJ8A 4UQ3B 3ME0A 2FBOJ 3VGAC 4MDIB 5BW7C 5DSCA 1N5YH 3ECBA 2VUYA 3D2UD 4OZHB 2P45B 3HE7D 2LU7A 4ZPVA 4M48L 3L3KA 2EIBA 1S7TA 3C5ZD 3BIKB 3UTPE 4OCSL 3LQZB 4OCLC 3QO1B 1CBVL 4MD4B 1CXKA 1BHGA 5DJCB 3STLB 3I3DA 1T1XA 2DD8H 1AR2A 4TNWF 2P8PB 1N7MH 3T2QA 3F7RA 5HI3D 2AK1H 2G5BB 1VCAA 1IM9B 3QQ4A 1A3RH 4N0CC 2YPLE 1KF9B 4IEFB 2HMID 1HH6A 5GRUH 3W39B 5DFTA 1A2YA 4PIRF 3N1QC 5D2NB 3RL1B 1JYWA 4MXQC 5FF6A 4DZBA 4IJ3B 1KT2A 3IVKA 1AGEB 1V7NH 4XGZA 1FFOA 3TNMA 2DLTA 1A4JA 5D6CB 4PJBA 2OTUA 1NCWH 1OW0C 4IHOB 5ELIA 4PGDB 3BXNA 4K9EL 1VEOA 1J0ZA 2Y5TA 1JGVH 1T0MA 1T1ZA 1T7WA 3LH2H 4QT5A 1FRGH 3C2SA 2R0ZL 3L95A 3UJJH 1BQLL 3KPQB 1ZANL 3D25A 4EEEA 1F6AB 2BDNL 4KKLC 3TH3T 5GISH 5BS0D 2GY7B 1C16A 5IP4A 5GJTL 2DOCA 3KDMB 1NL0L 4ONFL 4K7PH 1MFNA 1X5KA 1I4FB 3MJ8A 4ZO7A 1G9MH 4KTEL 5HVFB 1EBAA 3RWIA 1DVFC 1F4HA 3IFOA 3VXNA 3BH9A 4JCLA 1QP1A 4LKCA 4X9HA 2VDOH 3M8OH 4YQXH 4MLSA 4JFPA 1KLGB 3LB6D 5DD6A 5IESL 3OJDB 3ZKQD 3MUHL 1HOCA 2G75A 3MRFB 1FQ9C 2YD4A 4M7JH 1FIGL 2W65B 1MFCH 3MFFA 4D3CH 3QNXB 1JTPA 2ADJA 1NANH 1J1PL 5EBMB 5IWLC 4MXWL 1R3JA 4WFGE 1N2RA 3QXUA 1IGTB 3PIQB 2GSIB 4RGOL 4Y16D 1A7NL 2B4CL 1FZMA 1XMWA 3UROR 4XC1H 3ULVD 4TYUA 3GMOA 5C1MB 3WFBH 1HYRC 1FPTL 2R9HD 2VXQL 3EOAA 2VDLL 4EDXA 4AIZB 4HS6A 5J1SC 3KPSE 1XIWD 3EJZD 4KK5D 4U3HA 3RVVC 4XNQA 4NZTH 5KBNC 3MGTB 2IADA 4OQTA 3VG9C 1CGSL 2YPLB 3W9EB 5IBLD 4TTGA 4A6YA 2A2QT 1IE5A 1KTKE 2QQKH 2ZKHL 2FRGP 4QXTB 4J3XA 4QRPD 1PZUB 4JJHA 3VFTB 3BP7A 1J87A 1P6FA 1U3ZA 4CN6A 3IF1A 3G5VB 1CD8A 25C8L 2VAAB 3RBGA 4FZEL 1FL6B 2D0FA 4JREB 4M48H 2EEAA 3T0WA 4WDIB 2X41A 1T66D 5J4MA 3TBWA 5J13C 4OCSH 5BZWB 1CBVH 3GK8L 2APWA 2ZSVA 1S9WB 2NW2A 4NNPL 4JDVA 1G7LB 2QQNL 2X2YA 1EUTA 3SE9L 4HIHB 1T7XA 5DHYB 1U58A 2DLGA 2NXZD 2PCPA 1TJHL 4APQB 3S5LG 4GO6B 4U0RC 3NZHL 4XVUC 1JPGA 4XWOD 3RAJL 3JXAA 2BERA 1J88A 1TVBA 4NQCD 4ZO6A 4KPHL 1FNEA 1ZLVK 2N4IA 4KRLB 5J06A 3VD7A 4J4PA 1T1WA 4K9EH 3SCMC 3W5MA 5J6HB 5JNYB 3UTQA 3MZTA 4EDWL 2JJSA 2VQ1A 5DGRA 5F72S 3DROA 3JVGC 5F1OB 4YWGL 4HS3B 2QSVA 1QQDB 1EVTC 2R0ZH 1BQLH 3IDGB 1U36A 1TMCB 1ZANH 4HUWB 4GXUN 5T33L 2DKMA 1RZ8A 2BDNH 3CFBB 3WXWL 4QXUL 5C0AD 5A2JH 2V2TA 15C8L 1I3GL 3T09A 5F6HJ 3KPLA 5GJTH 4XXDB 3VI3F 3MRGA 1A47A 1NL0H 1MREL 4ONFH 4F15C 2FSEB 2D0HA 5INDB 5DC4B 2I5YL 3E6HA 1XGRA 1IL1B 4KTEH 2W1NA 3OG4B 3KPSB 1QEWA 1U8LB 2BVPA 4P59L 4M8VA 4N0UE 5IB2A 3QIWB 1Q9OA 5IMLB 1PSKL 4K23L 3O3EB 5IESH 1VA9A 1ZHLB 4IOFC 5LXGL 4XNMB 4UNUA 3T0EA 1FIGH 3G08A 1JGDB 1T83C 3VXRD 1MWAA 2ENYA 4FOMA 4W70A 1TPXB 2HRPL 4I8DA 4MDJB 5ICZB 2CDFA 1J1PH 4MXWH 3L5JA 3PQYE 3IJHB 3S8WA 5GGSB 4RGOH 5KSVA 2X10A 4QRSB 5IROC 2ICES 1A7NH 2B4CH 4JQVA 5HSFA 3DO3A 5FOBA 1DBKL 4HC1A 5J3HC 2E7HA 1U95A 4A2MA 4YLQT 4S0SD 1FPTH 2VXQH 2ADGA 3C5SB 3MQIA 2VDLH 3MO1A 2KDGA 1ADQA 4CJ0A 1LDSA 4MNQE 3E2HC 3UDWC 2NY0B 1XCTA 4HCRA 1XFPA 4XP9L 1SBSL 4P2RD 5TE7L 3QWOB 4LGSB 5F70A 1F13A 1Y6NR 2G5RA 3N1GC 2ZKHH 4IBLT 4NC1C 3BEVB 3BT2L 3R06B 1RIUL 3TIEB 2CK0L 25C8H 5HDBE 4FZEH 4P57A 1MHEA 4JG1L 2R1YA 3K4DA 4N0RA 5K59F 2V7NB 4NZJA 4U1SA 5EU6E 3MR9B 5ID1B 1S7SB 1CGYA 3GK8H 3BHBA 5CAYB 1P6AB 3QNZB 1PQZA 4H5SB 5FO8A 1AR1D 4JANA 4NNPH 4W6YB 1MHCB 2QV2A 3QEQA 5I1LA 2QQNH 3SE9H 3OG6B 4D8PB 4P2CG 4GBXB 2W0PA 1XF2A 5IMMB 4LIQE 1TJHH 1A1MA 1ZLWK 1A1OA 3QO0A 3NZHH 2YRZA 3RAJH 5GS3A 2HH0L 3EAKA 3OR6A 3AAZB 3F5WB 4U1LA 4V2CB 3U2SB 3QFJD 4QYOB 1OCWL 5FYKD 3NPSB 4HUXB 1ED3B 4KPHH 4JDZB 5BRZA 3P73B 3FQUB 3L3JB 2FJHB 4Z7UF 3ZHLA 2NY4C 4U1IA 4X7DC 4N0UB 4XCNA 1MAML 4EDWH 3WN5C 3QIBA 1EHLL 4YWGH 4DZ8B 1A6TA 1H8NA 2K3TA 3RWJA 3RWCA 4YHOL 4MB3A 1ZLVH 3IDNB 5CIPH 3MNWA 4HIJB 5T33H 5DLML 1ZLUK 3VE0A 1Z2KA 2P1YA 3HE7C 3WXWH 2W9DL 4QXUH 5D1XD 2K9UA 3PQYB 1FBIL 3JZ7A 1I3GH 3ZYJA 5JQHC 2DLIA 1MH5B 3GSVA 4QHUA 2HVKB 1MREH 3V7MA 4QOKE 1J0HA 3GUTA 1RUKL 4HX1A 2I5YH 1RUML 3QQ3A 4H0GA 1GZQA 3FL7A 5ADPL 4Q97A 2A6JA 3FFCA 5HI3C 4MNQB 4NUGL 3EDEA 4P59H 4ZNEE 3VXQA 1PSKH 3PF2A 4K23H 3MREA 4MA1C 3RTQB 5LXGH 4PJHE 4TNVK 1DN2A 1V3JA 2HRPH 1QHOA 2YUZA 4C56D 1T6VN 2HVJB 3GJFA 5LWYL 1KEML 1U8MB 4HWZB 4PRPE 1CICB 2V5RA 5TDNB 2P8LA 2X1QA 2YXFA 3ULUL 1T0NB 3ZE1E 2MWCA 5EU6B 1IAIL 1DBKH 1T5XA 4HUNB 2AJUL 2CK2A 4X9IA 4ELME 1WVZA 1WFTA 1GVIA 3BQUB 3AY4C 4NDMA 1KN2L 4IRSD 4JFYA 4XP9H 3LSOB 3WFEL 1SBSH 5TE7H 3O11B 3M17B 3K3QA 2EIEA 2ZUXA 1X5HA 4JO4L 4KUCF 4E41D 4JN1L 5IHZA 3SQOL 5I1GL 3BT2H 4FQXA 1RIUH 4B41A 4FXGB 2CK0H 4PJIF 4GOSA 4JM2C 1GSMA 4NT6B 5D9SA 1IGYA 4JG1H 1LEKA 3THML 4GRLA 3UJIL 1G7JA 1X5XA 5I76B 2IG2L 4KJWD 2HT2D 2XZAL 1ONQB 3ZDXE 1JCKA 3LB6C 1EEYA 3H7BA 3H9HA 1VACB 5KSAB 3DX6A 1HH9A 4WI2A 3MRCB 2FCBA 5DI8A 1WC7B 1NDGA 1GIGL 1XF4B 3GB7B 5DGQA 2H26B 3T65A 4B0MM 3PL6D 3N85L 1UEMA 4MS8D 2GKIA 1D3CA 3DOSA 3GSRA 4K3JL 4DKFL 2B5IB 2HH0H 3HTLX 4Z77B 4QOKB 3MROB 3ULVC 5HVWA 1OCWH 2W91A 3EFFA 2R9HC 4RIRA 1QFUL 3QI9B 4YHYB 3MRIA 4PY7A 4ZPTB 1XIWC 3EJZC 3P9MB 4KK5C 5IV2B 3RWHB 3LEXB 4N8PA 3O4LA 1ZLWH 3IXAB 3STZB 4K2UL 9CGTA 5I18L 5IBLC 3REVB 1MAMH 5FYJL 4Q0XL 4Z76A 1EHLH 5J0BA 4PJHB 4U1MB 4P46B 4YHOH 3NAAL 5F9JA 2C3VA 4PJIA 5DLMH 5I6XC 1NCDL 4YDIL 1D9KD 1OSZA 4WV1C 2W9DH 3KYMB 4PRPB 2HAZA 1FBIH 4K71C 5T1LD 5K9KA 3VXTB 5C0ND 1T66C 4OZGF 3CVIL 1CXHA 3KPOA 2X42A 3GSNA 3T77A 5GSVB 2DM7A 1RUKH 1RUMH 3BYYA 1ZLUH 5ADPH 3VH8B 4Y5YB 4ELMB 4CKVX 1IKNA 1FNAA 4LF3B 3QAZC 1PYWB 4JZOA 4OUUA 4ODWB 5C0GB 1WIOA 4GFTB 1A14L 2DYPA 2NXZC 1SY6L 4JFOB 5LVEA 5DQJA 5GPRA 1IARB 2WIMA 4G8EB 3FO1B 4JFDD 5CEXA 4I18A 1HQRB 2X9WA 2JJTA 5LWYH 1KEMH 3MRJB 4MJID 5DJYB 5ESVA 4XCEA 4CGTA 2BNRD 3ULUH 2J5LB 1A6ZB 1UADC 4G7YL 3SJVE 2NQCA 2GJZB 2B1HL 1IAIH 3RVWD 5BVJB 1HHGA 4OQ1A 2J1KA 4M93B 3RL2B 2AJUH 2DDQL 3TEUA 1ULVA 1XCQA 3P4NA 3C5ZB 4ODUA 4P5TB 2Y23A 4KXZH 4U6TA 4Q6YA 1KN2H 3C2AL 3BO8B 3DUSA 1D5MA 1XF5A 5E8NB 4HEPG 2EDLA 3IKKA 4JZNB 5HGGS 3FQXB 4PJ9B 3QEHA 5DUML 4JO4H 3OR7A 1RI8A 5D1QD 5E8OB 4JN1H 1ERNA 3SQOH 5I1GH 4PRDB 5F97E 2YRPA 5DJ2B 5DT1L 5INCA 3WS6C 3V0AC 3J7HA 4JY6A 3TA3B 2C5DC 1NC2A 1EFXA 5B3NA 3THMH 3UJIH 2IG2H 2XZAH 5FCSH 3IDMB 4UMGA 4L3ED 3QXAA 3VFMA 4XH2A 3E3QC 3G9VA 4GQPH 3B5TA 2NTSP 2A0LD 3TCLA 1E27B 1GIGH 2COQA 1IILE 1WICA 2ITDB 3N85H 1LO5A 4JGUA 3F7VA 5IW6B 3VXOB 3OXSB 5C92A 4QHLA 4KJYA 4FQCL 3DURA 1IC1A 1UB6B 4K3JH 5F7EL 4DKFH 5MEQA 3BZFA 4Y4KB 2X4UB 5EFIA 4GKSA 3DX7B 3KNBB 4X6FA 5I30L 2CJUL 4WFFD 1I7ZB 1FDLL 4LSDA 1IRAY 4M9PA 3SQBA 4OLUL 1QFUH 3F7YA 1F42A 3IAPA 2CRMA 4L5FL 2MQ0A 4K2UH 4ONOA 5I18H 2JTDA 4WNQA 2DI7A 5MP6L 5FYJH 4Q0XH 3HN3A 3V6FA 1NFDF 1UJTA 5GS1A 2KZ1B 1OGAA 4LBEA 1YPZF 4MMZC 3NAAH 4I0KA 1NCDH 1E6JL 2FHCA 2X1OA 4YDIH 5HHMD 3D0VA 3L3IA 4F80A 1BD2E 1MCQA 3O2WL 4NQDE 4ZSOA 3BIAX 2P44B 3A6CL 3ALWA 4M7ZB 5LKNA 5JPNA 3CVIH 1I7UB 3SJVB 2IGFL 1KYOK 3NZ8A 3BPOC 2WNGA 5DRZA 1AR1C 3UJTL 3N1PC 5EDXA 4Y16B 1P7QD 1X7QA 5KVDL 3EBAA 5B39B 2VABA 1FH5L 2Y9RT 3L3HA 4OFYD 5ILTL 5C6PB 4WU7B 1JUFB 1A14H 1ZVYA 4JZJB 1SY6H 4HMEA 5F6IC 1H8OA 1MFBL 4HHAB 1NGZA 2HT3D 1FN4B 3G5ZB 4OLVL 3RUGF 2ZWLT 2ICEA 3TBYB 2NTFA 5C0CA 3DX8A 3V5HA 2EDRA 1F5WA 1WWAX 1NLBL 4HK3N 2P43B 4U1HA 1RJZB 1R5WA