3C08H

Crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYDGRYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Matuzumab binding to EGFR prevents the conformational rearrangement required for dimerization.
pubmed doi rcsb
source organism Homo sapiens, mus musculus
molecule tags Immune system
molecule keywords Matuzumab Fab Light chain
total genus 37
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2008-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H01
2Z0BA 1ACYH 5DD1H 4KJQC 1BREA 4AIXA 4ZUUA 1T5WB 3X3GH 5I8OL 4WTZA 4TUOA 1SEQH 3CXDL 1NGWA 3TEUA 4G6AC 4EEEA 2QR0B 4TYUA 5HDQL 1SBSL 1VADB 1NDMA 5ITFA 3QQ4B 1MY5A 4RFNB 3JXAA 5DK0B 4ODSH 5ISZA 1F6LL 3W2DL 4EOWH 1OAYH 1CFQA 5I74B 1IC1A 5DJ0B 5MHSE 1IGML 3GSVA 2P8MA 1RPQA 3QAZC 3VCLA 4KRMB 5IVZB 2O5ZH 3O3AB 5E5RB 4OFKA 4HUUA 4HK0A 3QDJD 4KK8C 3C5ZD 4NDMA 2NXYB 2IFGA 1CD9B 3NZ8B 5I8EB 3OGOE 4FQXC 4LSTL 5EOQL 1BFTA 1WEJH 3UTTA 4WTXA 3N1GC 3BAEL 2D3VA 3ARBB 4JVWA 5I74C 4Z8FH 4N8VB 3VRIB 1GZQB 3L3KA 3OKEB 1ZHBB 5BJTA 5J1SC 4KU1A 3S36X 1P4BL 2P24A 3SPVA 4LLYA 3W11D 3JWOH 2FJHA 4YNYB 4D0BB 5HGAB 2J8HA 5F1KC 4KMLB 1VDGA 4WENB 3FN0H 4F3FA 4HUKB 4XPHH 3QIWD 5KOVC 1CN4A 4YHIA 1IJ9A 5FYKD 1S9YA 1S9VA 2X09A 5JQ6H 4MXWL 2F54B 3SO3C 2WWKO 1J8KA 2HAZA 3MCLL 3OQ3B 2NY0B 5IG7B 4G6KH 2J88L 4NN6C 4PG9B 3N1MC 4HMEA 3UDWA 3PDOB 5F9OL 1AO7E 1CLZL 4LVHB 4OCSH 1BEYL 4K9EL 5IB5B 1FG2B 4QTHA 3WJLC 3SJVA 4OAWA 4XPFL 3K4DA 1J8HA 1YJDH 3SDAD 1DVFC 3QDGA 3BJLA 2O93L 4M1DH 1U3JA 3P4OB 4M7KL 5I1EH 1CLCA 1YY8B 4KAQL 3GMQB 2IPKB 3RTQA 2RFXB 3QUZC 4PJAE 3ULVL 2EE6A 4M03A 2FEEL 2VTFA 5DK0A 4PIRF 2YPLB 3CUPA 1IM9B 4I48A 4Y4HA 5GHWL 1YEDA 4U33A 5DMKA 4AG4H 5M94B 2HG5A 2EECA 1DVFB 4P48A 1IC5L 1VCAA 3EYOA 3BIKA 1G9EA 1HDMA 2X10A 3OJMB 1JNNH 1G7JB 3QIBB 3D39D 4J23A 2BSRA 1KEGH 4GRLD 2Z31A 1JTOA 2BRRL 1QKZH 2VLKE 4R7DB 3CPLB 3O3EA 1QR1B 2HLAB 4LVEA 4E5XA 4HWBA 3QDMB 4LP5A 4QOKA 2DI7A 4XCFH 3JVGA 4CKVX 4LARL 3EJJX 1ORQB 4HWUA 1HXMB 1QSEA 1ZLUK 5LBSL 4CADA 1JI2A 1HWHB 1MJJB 1Z5LB 1MLBA 2VXSL 3SY0B 3VFVA 4HGKC 3FN9A 3MXWH 4I3GA 4OF5A 1MRCL 2NZ9D 3LHPL 4HBCH 5I18L 3QA3A 2D4FA 1AQDB 2Z4QA 2A9MH 4PJCE 3AM8A 4PJGA 3RP1A 4U1HA 1F58H 4KDTC 2DJSA 4FTVD 2J6EA 2ITDA 5I15H 3C2SA 3HB3C 3LSOB 1T20B 4IOSD 4PBVC 3QIUD 2QQNL 2X9XA 3ULVD 4RMUA 5BVPH 5D2LB 3D0LA 4G7YL 1WV7T 2FGWL 5C0AB 3F12B 1A7RL 1PYWA 5BMFL 2W0LA 2DM7A 1BD2B 4WFGD 2X4TB 3VXUB 2G5BA 3O6KH 2PO6D 1M7IB 1D5XA 3EIFA 3HHRB 4HMDA 1X7QA 1NKOA 3ESUF 5EA0L 3G5VA 5BV7L 4NZJA 4P59L 1MCHA 1VA9A 3BD3A 3ULVE 1AKJA 1ITCA 2GSGB 3O3AA 1FYTA 4RAVB 4I4WA 1BJ1J 4ZFGL 5I17B 3WS6A 2KPNA 3AB0C 4ODHH 1B0WA 4OGAC 4JQVC 1RZGA 1JZ6A 1P4BH 1I1AC 3BIKB 3UZEA 4UTBH 1EAPB 3V5DA 1BF2A 1HN1A 1G7JA 1Q0XL 2CLRA 4UT9H 4Y5VA 2Y23A 1GGBL 1EBAA 3LKOB 1UJ3B 1U95B 1JJUA 4JZJA 4HEME 2EIZA 2X70B 2ICWA 2ITCA 1C5BH 1MI5A 5ADOL 5LGHL 5SWQB 2WLZA 4XVUD 1LEKA 4Q9RH 2CLRB 2WBWB 3UZVB 2EICA 1JL8A 4Y4HC 4HF5H 1R5WB 3GJFB 4LGPB 1A6VH 2GY7B 4HBQA 3QXWA 3TBSB 2GTZA 4PBXA 3HZMB 1D9KD 4H1LB 1LO4L 1AGBB 4KQ4H 5ANMA 5JO5B 1PKQA 3LIZL 3P9LB 3GRWA 1IGMH 3WNNA 4PTUB 3GJEA 5D4QA 3MZTA 4BSVA 4O4YH 4LSSL 2R0ZH 4ZS7H 2O26U 3OKMA 4IHOA 2BXZA 1K8DA 3D85A 3NBNA 3FB6A 1KTLA 4UV7H 4LSVH 1AQKH 4LLVB 4C55A 5CEZL 2OK0L 3GMNA 2LTQB 3K4ZA 3V6ZA 2ZOLA 3B8YA 4XNYH 4HIHA 1P1ZB 1MIMH 4LBEB 5C09E 1JZ8A 2HT3D 4NNYA 3CVHA 3QFDB 1X3DA 4Y88A 2AJUL 3GBMH 2EDYA 5F9OH 1FGVL 4RISL 3BT2H 3IAPA 3X12A 3V6ZB 4OZHF 3G5XA 3GB7B 1KB5B 1JGUH 2RB8A 5JW3H 3EFFB 5DXWA 4XGZB 1KC5L 3T0VA 5F1SA 2UZIL 2ZG2A 3GGWB 1A7OL 1J1OL 4JKKA 3TPUA 1RZ8A 1EJOL 5KVGL 1A3RL 1QFHA 2EEDA 4LAJH 3Q48A 1V3LA 4RFOL 1IM3B 1AO7A 2VLJD 1NC4A 1FNSH 4UDTB 5IW1A 2XN9A 2MWCA 3L5JA 3EFFA 4MB4A 2XWJB 2Z92A 2BNRB 5HHNB 1N5YL 3D39B 3EYVA 3TBTB 3GO1H 3LN4B 4FS0A 4HIEB 4J4PD 1EX0A 1T2JA 2D03H 2QV2A 5TDPA 3RL2A 2VJXA 4JFYB 2A6DA 3B9KD 1SJXA 4Z7NE 1UEMA 2R0LH 5IJKA 3DUSA 4Z7VE 4H0GA 5GZOC 1F97A 3QI9B 1FVDB 4FXGA 1MJ7H 3EJYD 3SDXA 2OTUA 4XNUH 2JJSC 4UU9A 3D5OF 3ARBA 4MDIA 5ANME 4LL9A 1NCUA 3BP7B 4AENB 3GJFK 2FX8L 2FH6A 4GSDH 3RJQB 2VR4A 1A7RH 5BRZA 1SY6H 1UKQA 1ZHKB 3OKNA 5D7LA 4UINH 1OP5H 4NO0A 1U42A 1H5BB 2AJZB 4C54A 4KRPD 1U3HD 5ACZA 4RAUA 3JTTA 3MNVA 4XXDB 1KFAH 3FONA 3K81A 1ZT4A 5DURD 1UCBL 3SDDC 4M1GL 3O6MH 1A0QH 1X4YA 4OCMC 4U1JA 1PG7X 3RPIB 4Z0XB 4KY1L 4KY1H 3UXFA 2AQ2A 2CUHA 3MLTA 4NIKB 4LMQE 1QA9B 4BZ1H 3W9EA 2DMCA 2I25N 2BHZA 2DIJA 3DRTB 1F2QA 1E6OH 4PRBB 5HVFB 5J1TC 1T5XA 5IMKA 5JTWA 1II4E 2JB6B 1R3LB 4H8WC 1KGCD 3SQOH 3NIDE 1J8HB 1CL7L 2HH0L 3WFBH 1H3UA 1FLRL 3VW3H 4GS7B 1UA6L 1MEXL 5I8OH 3FT4A 4O51B 2DTSA 4OLUL 2UUDH 4F58L 4LCYA 5DEZA 5FGRA 4FQ2H 2G75A 4MQXC 5DO2D 4GW5B 3I2CH 1NGYA 2XNAB 2ZNWA 2DD8H 3VWKA 3BWAA 4F8QA 4D9LL 2HWZL 5DEGB 2GK0A 1GAFL 5H2BA 5BV7B 4NUGH 1DUZB 4JO4L 1YYMH 2NPLX 4X6DE 1I8KA 1C5DA 4LHUD 1GYAA 1QBLH 2QQLH 3O3DA 3PQYA 5C0GA 3VH8B 3DURA 4I5BA 3JUYA 5E08L 3QDJA 5IV2B 2GJJA 1DLFL 3DXAE 5DHYA 3KS0J 2Q8AL 5I1GL 2D7PA 3Q3GA 1RUAL 3T65B 3D2UD 1XIWD 3FO1B 4X83A 5F44A 3N1FC 2WP3O 1DUZA 4KAQH 4R7DA 1UM6H 1JNHB 5E2UH 2H2PC 2PUQT 2DQCL 4UT6H 3E8UH 1OF2B 1YC7A 5I1HH 2OXGA 3BE1H 3WIIH 1F13A 1OAXH 4XCYB 3IETA 3DYMA 2W9LA 3IGAB 2E9IA 1HHIB 3FFCE 1C8PA 3U0PB 2MSPA 4HCRA 3VXSA 2Y7QB 4ZNEE 1ETZA 1BBJB 3JV0A 4OFVA 4HSQA 3CH8A 4XXDA 5GGUA 3I6LD 3L3DA 4NQSB 3JUZA 3SCMA 5AAWA 5DJAB 4WFED 4KVCH 1N5AB 1KCUL 2GAZB 4ZSOB 1GCFA 4P5KB 3OKDA 3FMGL 5DHVA 4EN3D 2EYTA 3C6LC 5FM4A 1A6PA 25C8L 3BPOC 4ZG1A 2OQJB 2ZWLT 3M17B 1DFBL 4HULB 5FHAL 5F21B 1UM4H 4L8BB 3KPSD 2P49B 1U2HA 3ARDC 4JDVA 5IHLB 5C0BA 2JIXA 4MAYD 1E28A 3GSNA 1SJEB 3ZKQD 3R8QA 1WGOA 3KHOA 5CLWA 4K9EC 3TNNB 5AZEL 1IC7L 3VE0A 3MLXL 3UBXI 2I07B 5JHDE 1KELH 5HYFA 2ESVD 3MRQB 2R56H 4RWHA 1X7QB 5TF1L 5HGDB 4E42A 2CMRH 3VJ6A 4I9WE 2HJLA 3WE6A 1AD0A 5C9JB 1VFAA 3OXSB 1YNLH 5GRVK 2FX9H 3U7YL 4LIQL 2GW5A 3KPNB 4DFHA 4LKXB 3B9KC 5DK2B 2XZCH 3RDTA 2AS5M 4KTDL 2F53D 2VZ1A 3QI9C 1D5ZB 2FB4H 1W0WB 1G6VK 2B4CL 2OR7A 1KGCE 2FCBA 4OD2B 2J8UB 1L7IH 2P1YA 4N9GA 1MFDH 5EUOB 4DEPB 2HVJB 1MVUA 1U3HA 1S7WA 3GHBH 4NM4H 5HHVL 3RDTB 5DRZA 5F9WB 3FOLA 2BHYA 4GBXB 4WW2C 2CDFA 2DQUL 1PEWA 4MS8D 5E00B 5C07D 4CDHA 1WWWX 3FRPG 1L0QA 2ZOKA 2GUOA 1FNLA 3RWIB 3ZKXB 5KVMC 3OTTA 3S35L 4XXCC 1XGUA 4W68A 1MQKH 4JFDB 1E4JA 4M1CC 4HHAA 3A67L 3RVXC 3V4VH 3IFOA 5GXBB 4CVWA 2R4SH 1IC4H 2AXHA 3ARVA 2EDRA 4IS6B 1A8JH 5F7EH 1KJMA 4QRQB 4HX1B 1GXEA 4OB5H 4RRPG 5GGRB 5DRWB 1XF2A 4J4PA 5B38A 3VXPB 5BQ7B 4X5WA 4ODXA 4BELD 3DUUA 2H6PA 3FO9B 4XAWL 4DK6A 5L8KB 4LOUD 4ZSOE 4P0DA 1N3NB 1DE4B 1WJ3A 3M17A 4ERSL 2P5EA 3A6CH 4YXKL 5KG9B 1B90A 2P46B 2WW8A 3CVIH 5GGSB 1LNUA 3CH1B 4P2RA 4G8EA 4YFLF 1N3NA 1FORL 1XZ0B 4HGWA 2P8MB 1MHPH 5EDXA 3TNMA 4YDLB 3V4VL 3BH8A 1QFWL 3TVMC 3RWDA 4X7FC 5C7XL 5FUCE 1JZ3A 1PSKL 2YN3A 1I7ZB 5ITFB 2FEEI 3MODL 3WFZA 5F7UA 1IM3A 3HMXL 2R0WL 4KHTH 4LQFH 4RNRA 1X5ZA 1BFVH 1I9JL 2BOBA 3S88L 4I2XE 5DFTA 1WFOA 2XZZA 1FPTH 1JMZA 4JHBA 3A67H 4D94A 2YPKB 1HI6A 5E1AB 4GH7B 3BKCL 4A6YH 3G6JF 3UC0L 1JK8B 4KK5D 2RJMA 3K1KC 1PX4A 2DQGL 2XTLA 2AXFB 3MUZ1 1DEEB 1OHQA 4HXAH 4NOFA 2OP4H 4X4ME 3S35X 2OP4L 5IBTL 4G6AD 4HS6A 1KLGB 2BZDA 4AEHH 1A2YA 1T4KA 4ZO6A 3O6KL 4MXWH 3FQTB 4D9QE 1U6AL 1OP9A 4RGNB 4PRHB 2VDNL 3CFCH 4WWKD 1AXIB 3KYOB 8CGTA 5J11B 4ZFFA 1NCCL 1HK6A 1AXTH 3MBEC 3REWB 1WBZA 1FNEB 2HN7B 3OG6B 5B8CC 4UBDC 3WJLA 4OCSL 1IGJA 2FSEA 1UB6A 2FJHB 4YNYA 5K33A 3SDCB 3CAFA 2HTKD 4MDIB 1M7DB 3EOYG 1RZIB 2W60A 4KPHH 4LVOB 4Q6IB 4JFZH 4P5TD 1QLFB 4Z0XA 5D1ZD 3RTQC 3FO9A 1SJHA 4GBXD 4YFEA 4OZFA 5JMRA 1YMME 2F5BH 2OI9C 3S3SA 1FL5A 1DDHA 1RUPH 5JXED 3PQYD 1FG9C 4NKDA 5TF0A 4LHUA 1Y18A 4R2GC 3W9DB 4JPIB 3WFEH 3E6HB 5I73B 5K9JH 5TGBB 1IGTA 1G7LA 5C0FA 4PGBB 4JZOA 3ZDXF 4HGWB 3TNMB 4FQXD 5ICYB 3S6CA 4OLVH 2Y5TB 5F7YC 2MCPH 1DBKL 5C09D 3QIBA 4J3SA 1CL7I 2NY4B 3ABZA 4M5ZH 3VXNB 3RZCA 5EZIH 3IJSB 4Y2DA 4PJCF 1S7XA 1IFHH 2HLAA 2X4PB 1ZVHA 5A1AA 3S3JA 4PPTA 2DWEA 1NC2D 4C83B 3M07A 1LVEA 4WI9A 1X5YA 3DO7B 3DX7A 1N64L 1DEDA 2ADFL 1CLZH 5JR1L 5MEOB 3S4SB 3BFOA 3LKNA 5H37H 1F3DJ 1XF1A 2FNBA 1Q0YH 1AGFA 3DRQB 4W4NA 4J1UB 3MGTA 3C5JB 1G6RH 4JQIH 1VPOL 2NQCA 4IJ3B 4M6OL 2E7HA 2VLRD 5KN5B 3MX0A 1KJVA 4OIIH 3MLRH 3HUJE 3DXAA 4I3RL 4P2OA 2H26A 4PRHA 4M5ZL 2JCCB 1WZ1H 1BX2B 1RK1A 5ITBL 35C8H 2M1KA 4KI5F 3NCMA 4ZFOA 1TTFA 4GG6A 3MV8D 5ESAA 1UB6B 3VG0L 5T1KA 4U1LB 5A16B 4GRLA 2DS4A 1XFPA 2A2QT 3O4OC 4YK4B 3VXMD 5SX5H 5L2KB 3VXRE 1I9RH 3O6FD 1G84A 3P4NB 2X05A 3BP4B 3T1FB 1YPZB 3U4EB 4OZFB 3U36B 2HLFC 1KLUB 1UH2A 4YGVB 4U7MA 3FFDB 3L9RB 3MV8A 3RWJA 2P45B 2OMNA 1R3IH 4MB3A 5D9SB 1F3JA 2E3VA 2GJ6D 2VDKH 5C0BB 1IEBB 2JLLA 4G6ML 3O4LD 2GCYA 2ICWJ 3AXLB 5ISZB 3VG9B 2W9DH 3PP4H 3FZUD 3QDMD 5BS0E 1A64A 1S7QA 2FD6L 3GHEH 1EERB 3VWJC 2EDFA 5AYUL 2JTDA 4PD4J 2DBJA 5I1LB 1NGWB 3MZGB 1NSNH 3MBXH 1CFNA 5JQHC 1CU4L 3CXDH 3M1BA 2F19H 2WWKT 3S8WA 2E27H 4PRAA 1LHZA 5CZXD 5EOCJ 5I1LA 2AV1A 3W2DH 1U91B 1QQDA 3MRGB 5E9DE 2A73A 4KJWD 3DVFA 4Y2DD 1CICC 4CGTA 1JYWA 4ODTH 2IF7A 1J8HE 2R23A 5EZJB 1Q94B 4F7PB 2XY1A 4YHNB 1MFBL 1ES0A 3RY6C 3K3QA 3CFKA 3MBED 1HCVA 3QUKA 3OAYK 1MJUH 1OGAE 4FQXA 4N1EA 5I66A 4JDZB 4DQOL 4Z0BL 5DD1L 4JRYD 2N4IA 1KCLA 4OKVA 1K4CB 4KKCC 2ICEB 3W11C 3GRWL 1Q72H 3SE4C 5CCKL 5D7KE 2JJUA 3ARGB 3ORJA 2GI7A 5FUZL 3H3BC 5D72H 2WWMC 2EEBA 3ECBB 3PGCA 1MREL 4IS6A 2OZ4H 1Q8MA 1IQWL 2Z8VC 2X4OB 4DCQA 2KL6A 1WTGT 3W0WB 3SJVE 1FHGA 1MEXH 1UQSA 3DHMA 4PJEA 2JK5A 4YHOH 1TTUA 3GGWA 3RGHA 4UI2A 2YC1A 4W4OA 2X4UB 3ARWA 3QDJE 5FKPB 2PW2A 1YEIL 3B5GA 1FYTD 4G9DB 5F7WC 2IPUK 3BZ4A 5CUSH 5C08B 2VXTL 1D9KC 1Y6NR 3IDGB 4OZIA 3NZ8A 1YN7A 5IBLC 2FZ3A 1ZAGA 1WK0A 1HHGB 4U1SA 3HNVH 1HOCB 3DLQR 3MRLB 1DVFA 3T04D 3CSYA 1R0AL 4QT5B 4PJHE 4JFPA 3O4LB 3BKMH 3KHQA 3RU8H 1S7VB 2Q3ZA 4L8CA 2X4QA 1JHKH 1VKXB 2EXWC 5EWIL 3C8KA 1GSMA 1UACH 3SEPA 5BW7A 1HSAB 4FXGB 3AS1A 3GSOA 3IDIB 4GS7C 4Y4HB 2Y9RT 3PWVA 4OI7A 2CKNA 3IVKA 1S7VA 1TJIH 4G6JL 3VXTA 4X6FB 4JKPH 1N26A 4ODUA 1BWWA 3K2MC 2EIDA 3VMPA 5FYKL 2V7NB 3A0OA 4JG0H 3RKDC 5DJZB 5J89A 4K55A 5JNYA 5SWSB 4DGYH 4Q9RL 3KYMB 4NZRL 2V7HA 5J12B 2J6EL 1YNLL 4HUWB 2VC2H 4RA0C 4CJ0A 3DI2B 5CCKH 1CTOA 2OI9B 4Y16B 2W91A 3ARDB 3WFDL 1YEKL 3K8LA 2PKDA 2X4SA 2W07A 5JW4N 1F4HA 3VG0H 4JM2F 5TE6H 2WNGA 5HHXL 2B5IC 3L7EA 4MNGA 3VMOA 2XI9A 1FIGH 1I85A 4JY6B 1NLBH 3D69B 5AZ2L 1NGQH 1CFSB 4LSQH 3D2UB 4TSCL 1RULH 2V2XA 3QJFA 5FIEA 1MCKA 5E2WL 4JRYB 3VFSA 3GMPB 4K7PH 3LKRA 4M6OH 5LQBL 4YDIL 1DDHB 3SE4A 4XMKL 3BP5A 1QTYT 2GJ6E 4PTTA 3G04B 5F3HB 1K2DA 4YDJB 5BXFB 2NZIA 2B1AH 4F7EB 1FGVH 4RISH 3VWKC 3KWWB 2DQJL 5LCVL 4IIQC 1UVQA 4GT7A 1JWSA 4Q0XH 1D7FA 3TJHD 2O5XL 4M6AA 1CFTB 3RI5K 1A4KA 1FO0H 3ARFA 1FORH 4FXKB 3LV3A 2J7LA 3KLDA 1U36A 1SEBA 5TDOA 3FO1A 4Y4KA 4QHNA 4XNQA 3G5VB 3LKOA 1S9XA 2DQCH 1DCLA 5DFVC 3KPMA 4NNXB 1ZT7A 3DVNB 4MJ5A 4Z7OE 4JAMB 5K9KB 3V4UL 2FYYB 1Q9OA 2AABL 3TWCH 2C3HA 1RZGB 4PP1D 3H9SD 1DLFH 3DOSA 2OZ4L 1DBAL 1F45A 3MV01 3IJHB 2UYLB 3TN0B 1SVCP 1LO2L 3EDEA 1CE1L 4JPVH 1IC4L 4JO1H 3RWGA 1MCCA 4CJ1A 3OJDA 5EU6A 5ECJE 1U95A 1RUPL 3PGDB 4L8DB 4NN7B 3SGKA 3OF6D 1B6DA 2CIIB 5BV7H 2I9LB 4TVPD 4PY7A 4Y2DC 1LEKB 5D1QC 4D8PB 5I8CB 5SWSE 3L5IA 4OLZH 3TT3H 3FZUC 7FABL 1BD2A 1MCFA 3QNXB 1JZ4A 1A4JA 2PXYB 3HCVB 5DJ2A 1HILA 1AIFB 5T1DL 1JPFB 4I2XB 1T5WA 4GBXC 5EC1A 3UJTH 4PJ5A 3F7RA 3QXVA 2PW1B 1G6RA 2O61B 4H1LG 1JBJA 4RRPA 4HEPG 5FO7B 5LAXB 1Q0YL 5C0CA 2JJTC 1AR2A 1RVFH 5ALCL 4URTB 4ONGL 4HWZA 1S3KH 2NY7H 2VXVL 2CK0H 4TVPL 2DICA 5EBLB 4LEOA 4NC0B 1AP2A 3UTOA 1J0ZA 1EO8H 1MJUL 3VXSE 1WBYA 2QR0A 4FQLH 3MV8B 1SYSA 5HTSA 1J1PL 3HLAA 4YDJA 4OM0L 3QIUB 3WIHH 4AMKH 5BXFA 4C56B 1IFHL 4TUOB 5KTEH 1X44A 4JFPB 2B2XH 5FM5O 1S7TB 4UDTA 4YC2B 4HLZH 7CGTA 3RY5A 4H88L 3RWJB 4POZC 1A6TB 2BNRE 4ZFZA 1A6AA 4X8JA 4UAOC 1F3JB 2JJWA 1XGYL 3CX2A 1XIWA 3QO1A 2W0FB 4I18B 3QIUC 1X5FA 4OV6F 2XXCB 1JRHI 1TNNA 4ISVB 2CMRL 1HHJB 5DT1H 4ZPVA 2BNRA 3I50L 1KCSL 4D0BA 1LMKA 4HIEA 3IDXL 3G6DL 5J0BA 1YMMB 1CGXA 2C1OB 4ZXBB 2PTVA 4NZTH 4PJ8A 1LEIA 3DBXA 3LKSA 5IMOA 2X4RA 4PRHE 3VRIA 4KI5E 5MP6L 2DM2A 3DJ9A 1JPGA 1BIHA 2XT1B 1BLNB 2AJVL 4MA8L 5TE4L 4J4PC 5KS9B 1J87A 1VFUA 3I3EA 1F4WL 1O5DT 5TE7H 3D69A 2YOCA 3HMXA 1JHKL 4XCCL 1INDL 2IQAA 1X5KA 4S1DD 4N0FB 3MNZA 4OM0H 4XWGL 3CFKB 1FSKB 4YDKL 4WW2B 5EULV 1MCQA 3T2PA 1RFDH 2W38A 1MHHA 2XWTA 3ZT7A 1WT5C 4TUKH 2APFA 2O61A 1K4CA 1F6AA 2DQGH 1XGRB 3S35H 1QSEE 3R06B 2PR4H 5IG7A 5I1CH 1BFOA 4AL8L 3FQNA 2OTWA 1HINH 4GAGL 1R5VB 3P4OA 2YPLA 1G1YA 2LE9A 3AB0B 3AM8C 2YD4A 1AE6L 1BVZA 1NBVL 5CSGA 1DE4A 4UT6L 3ULUE 1INDH 4X6EA 4JQIL 3BKYL 1J5OL 1F4WH 1AGDA 3GMLB 4KKNA 4AYFA 2IG2L 1F4YL 2CO6B 2NY2D 1LGVA 5DJ8A 4ELMA 2GITA 5F88A 1EEYB 1NH6A 3GDBA 3MROA 3MLYH 5FA3B 3KPLA 4KQ4L 1QBLL 2IBZX 2QQLL 5EO9B 2VL5A 5I30L 3CSYB 2ZP0T 4M7JH 2FHFA 5C08A 2QJDA 5C0NC 4MDJA 4XPGH 2NX5A 4WY7H 3BYYA 3UROR 2B8OT 3FHQA 1DUYA 5CJOH 5HVHC 5D7SL 1GHFH 4Y8DC 5T1KD 1TZHA 4Y4FD 1JNHA 4M7ZB 2F5BL 5EORH 3HS0A 3BYTA 4Z7UF 1BQLL 4OUUA 2MKLC 5DUML 2G2RA 3MR9A 4X7DC 1YEFL 4X5LA 1S78C 4KI5D 4MD0B 3LD8C 3EOAA 1MRFL 1TJHL 2XOTA 4PRHD 3X11B 3QDJB 2YPKA 4Z7UA 1FNEA 2HN7A 5E1AA 1OD9A 2R39A 4JDTH 3BEWA 3MRCA 3L3HA 2BOCA 3MLTB 3QA3B 5JPNA 5IW6A 3VFRA 4MJIE 3ZYOA 2IMMA 2FEDC 3KPOB 2VISA 4B0MM 4Y5VC 5HGBA 4XAKE 4U2ZA 4TUJB 1J1PH 2R1YB 4NQXA 5EO0B 3MYZA 4ZS6D 1KPUA 3GSQB 4LCWB 4AEHL 3FQUB 1ZOXA 1ADQL 4TOYH 1MI5E 5DD6A 5C09B 3T3PF 4YDIH 3S37X 3C6LD 3RGVA 3F12A 5ALCH 4LLWB 3R06A 2CUIA 4KI5C 3STLB 2RGSA 5GS1C 2ESVE 3H9SE 1OARH 3RZCD 5ICXA 5C0RH 3DECA 1TMCB 4X98A 3MOAL 4XCEB 1UM5L 3DSNA 3U1SL 1S8DB 3IJSA 3HZYB 1HQ4A 1PGRB 2NW2B 3ROLA 5ICXB 1IQDA 2HFEB 4NC2B 5K9OB 2DWEB 4HPYL 1KCRL 2MHAA 3IFLH 2WINA 3DMMD 5JW4M 4IJ3C 1CBVL 4JZOB 1P7KB 1EEYA 3BI9X 4O9HL 2IPKA 5C0IA 3VXRA 2IH1B 3QRGL 2IJ0C 4DZBA 1OB1A 3LB6C 3BGMB 4BQ8A 3SBWA 5AZEH 1IL1A 3L3IA 3I6LE 3OGCB 4XC3H 1A6WL 1RHHA 2ZJSH 3G5ZB 2K3TA 3GKZA 4OQTA 4JHAH 3SDAB 3GI9L 5FM5M 1ZGLB 4UTAH 1EH9A 4KVNH 1J11A 2ICWI 3HRPA 1K85A 3DO3A 3HPLB 1Q9WB 1LP9B 2ZUQB 1FL3A 5SWSD 3QUYA 1TLKA 1J10A 3DXAB 4P2OB 2VUYA 3MR9B 5BV7C 3FTGA 3SE3C 5GGUB 3BGFB 5EU4A 5EU5A 1YQVH 4K2UH 4WWKA 4UNUA 4ZUVB 4XHJC 4RFEB 4FFWC 4Z7UB 5E6IB 2J8UA 3RIAF 1J0KA 4ZMAT 2IANA 3U30C 1R0AH 1FZMA 3IS0X 3MNZB 3QO0B 3LZFL 4LK4A 4NQTA 3TJEL 5FYLL 5HHPB 3HN3A 3MRMA 1K8DB 4G8FB 4H20L 1NLDH 1JCKA 5IVXB 3IXAA 3ARYA 3GSQA 5A3IC 4JFOB 1RK1B 3MRIA 3NCBB 4IIQA 4QRRB 4QHMA 1KB5A 1G9NC 3OPZL 5CIPH 5IB1A 3QUZD 4EI5C 4X4YB 1TIUA 4LCCC 3IS1X 2NY3D 3BRGC 3VWJA 3RIAK 5C9JA 1QFWM 5H37G 1PZ5A 3JV6A 5IK3B 1WF5A 4PJBF 1AGDB 4QRRD 3C6LB 1EEQA 5EU6D 1AP2B 4R96A 1MWAH 5JQ6L 3QDHA 5ADOH 4S1SL 3GSVB 5LQBH 1P5VA 4NHCH 1I7ZA 5CD3A 5I1JL 2O5YH 3OR6A 3M1BB 3GHBL 3QSKB 3CC5A 3T77B 3BWUC 4W6XB 3TVMD 3ES6A 5DMIL 3EHBD 4Z7WA 4QRPB 4A6YA 4U6YA 5JOFB 4UTBL 5M7QA 1KYOJ 2HFGL 2FECL 3CSGA 2ILLA 2E6QA 3MOAH 4EBQL 1J88A 2IPTL 1AC0A 4JKPL 43C9A 4HIIB 2C26A 4F7MA 1XF4A 4FQJH 1A3RH 2D31A 4WEBL 3HFMH 3W82A 2O5YL 3T2QA 4CMHB 3H42L 4Z95L 3BQUC 1UACL 4KTEL 4LSTH 2VWEE 2Q76B 3IAQA 5DEFA 1WAAF 1K8IA 4DVRL 2Z8WC 4P9HH 1BJ8A 4ZODA 1RMFH 3MV7E 5JDSA 1H3VA 5GGTA 3MLWL 5GGRA 2XQYK 3TYGH 5D7LB 1E4XH 1YMMA 4YIQA 3HI1A 5EIVA 3LQMA 2ZSWB 3OKKA 4YHNA 1XF3B 5DMGD 5KSUB 3QH3B 3NTCL 4P23B 1A5FL 4FFYH 4LLDB 1DTUA 4S10A 1YN6B 4UT7L 4LMQI 4I77H 4HW6A 1WIUA 4HKBB 3FQRB 3KPPB 1A1OB 4ZXBA 4PJ9D 3MC0A 4WJ5A 4XCFL 5T3XH 1UQSB 3UTTE 1EVUA 3INUL 5DQJA 2F19L 2CDEB 2AXGA 3MRIB 5I1KH 1L9NA 1G9MC 1ZEAH 2ADGA 1MRCH 3WL9B 4CNIA 3GIZL 4ZUTB 1QNZL 3JV6B 4JDTL 4R8WL 5J6HA 1XIWC 2E7LC 1L7TH 2JB6A 4X9BA 4XI5C 3MLYL 3QCVL 2YD3A 4YAQA 1QSVA 1YECL 4POYA 2OJZH 5CHNA 4Z77A 4WO4D 3DMMB 2EDEA 4JJHA 1S9WB 5IM7B 4PJ8D 2IH3B 3QFJB 3ZE0F 3G5XB 3GB7A 4Y89A 4AIZA 1OAZH 4KJYA 5JPMB 3C8DA 3B9DA 4FMKA 5FV1L 4KRLB 4XCNA 4KROD 5GZNC 3MJ9L 4Y1AA 4AG4L 4JPWH 5CWSB 2YEZA 4XBEH 2AJXL 2CLZA 3O3BA 5I71B 4PJBE 1OGTB 3EGSB 4EN3A 1W2KT 1UYWH 5C71A 3OX8B 1ORQA 2MPAH 4AY0A 3ARRA 3O41B 1NEUA 3BN9C 4MAUH 1S7XB 4KDVA 2DQUH 4Y1AB 4C4KO 4G8IB 4YDKH 3CFEA 3L6FB 1UWEH 2YSSB 3VFPB 2NXZD 1IZKA 3WN5C 4PLJC 3ESVF 3SCMB 1QEWB 3VGHA 4LCWD 4Q6IA 3U82B 3GM8A 3SGJC 1YC8A 2BCKB 3TZVB 3CLFH 4BKLB 5T3XE 5K59F 1H3XA 4AL8H 2PYEA 3VXSB 4ZUWB 3QI9A 2Y7QA 2WBJB 3MV9D 1ZLSH 2RHEA 1FVCB 5FO8B 2Z8SA 4MHHG 2VLME 3WD5H 2VDOH 3LD8B 4HIXL 3NFNA 4C59B 1G9NL 3GBNL 2EDDA 3LEVL 4G42A 1BBJA 5DDHB 2KZ1B 5IBUB 4K8RL 2FLBT 3MYJB 2RQ8A 3BPCA 5GIRA 1ZA3B 1C5CL 2Z9TA 5DD6B 1VHPA 3SE9H 3RIFK 4LLAA 5CP7A 4XXCA 5IF0A 5T1KB 5KW9L 4LF3B 2W0KA 5HD8C 4KPHL 5J6HB 5A3ID 5TPWH 2EDJA 2D7MA 4PJCB 3RA7L 4MCYB 1H3GA 2XZAL 2OSLA 4Z7WE 1WVZA 4DGVL 3MJ8B 4NN5B 1M6OB 1HH9A 3EO0B 5FDYA 3WEXB 2I60H 1N6QH 1HWGB 2DMBA 2R1WB 2NY1B 5DZNA 1TVHA 5C0EB 2GEEA 5EZOH 4LKCB 1U8MA 1F8TL 2HKFL 4OQ1A 5HSFA 3DRQA 4NDMB 1BWMA 3MA9H 1B4RA 4KK5C 1VFAB 4GLRI 3X14A 2GSIA 2R2HA 4MA3A 4U31A 3VXUE 3U4BL 3OAYH 5JR1H 3BWAB 4YR6A 3H3PH 1MF2H 2R9HD 4KZEH 2WP3T 3PWNB 5D6DA 3U4AA 3S37H 3RUGE 5E7FA 1T1XB 5EZLB 3O3DB 3PQYB 3SGKC 1OTTC 1QO3B 3SKMB 5L8JB 3PQYE 4FQCH 5J12C 2DKSA 4KHTL 4LQFL 1RHHB 4TQEL 4FQLL 1GGIH 5DTFB 1F6FB 3BXNA 2OS7A 4XVSL 3BT2L 3V0WL 2DTML 3VDBA 4NBXB 1W72L 5JHLH 1CICA 1Y6MR 4A6YL 2OYPA 4LCCB 4NQCE 1XMWA 1G9ML 4DUWA 5I9QB 3G08B 3S34L 2H2SD 1PFCA 2PYEE 4ODBD 4F8TA 3ZDXE 4L4TB 1GPOL 4TSAH 1K3IA 5L88H 5DRWA 4UILH 3FKUS 5HHPA 3S36H 4YUEH 4XWOC 2Q86A 4DW2L 3MRDB 5CS7A 4WCYH 2UZXB 1P7HL 1X6LA 4YLQT 3CU1A 1UT9A 4NKQB 2ADIA 2NR6C 3SBWC 4QRSB 5MENB 4Q9CA 5MI0C 2HRPL 3EZJB 5I8KH 3GNMH 3VA6A 4ZUUB 1UXSB 3GMMA 1D5XB 3O45A 3CX5K 3AU1A 4M7LH 1FP5A 3GKWL 4PRPE 1JTTA 4RDQF 2ZUVA 3KJ4C 2XPGA 5LCVH 3MA7A 5HDBF 2H9GB 2N56A 3TN0D 4LKCA 3CFBA 4G80A 5E5UB 5TDPB 1JPTH 1EO8L 3C8KB 1UXWB 5GS3A 1JGVL 1KF9B 2F58L 1KIPA 2DLGA 3WO4C 1J0HA 1JGEA 1ZLSL 3ZYJA 1YY9C 4FG6D 1A7PH 2X6MA 2BMKA 2OJEB 5CFHA 2EH7H 4NRXA 4FTVB 3QFJD 2BOBB 3KPNA 4NQED 3QPQD 1E4XL 3QIBD 1INQA 2LTQC 2BC4A 1QSEB 1PQZA 4JG1L 3QUZB 4X7SH 1RAMA 2FJGB 1X5GA 1DQTA 5DA0B 1T0MB 2XACC 3B43A 1FN4B 3KPRB 4OCRH 5MENE 4L5FL 2AK4E 4JN2A 4PJXB 1AJ7L 5D1QB 1CGUA 3H0TA 3QQ9D 4P4KB 3EYQC 4Z78A 5I76A 1SVZA 2FX9L 5EN2A 3ZSTA 4EI5A 3KYNA 4UQ2B 1CICB 3KLHD 2R0KL 2DKUA 3TF7C 3MREB 4ELKA 3ARTA 4LRIA 4OF0A 1XF3A 4JFEE 2BY3A 4LCWE 5SWSA 2CUMA 4JG0L 5IMLA 3HI6L 3PHQB 4P5TA 2I5YH 2VXQL 2D7TL 4O2EB 3BD5A 3IU4H 3KR3H 4OSUH 1F58L 2G9HA 3STBA 5JA8B 2ESVB 1E4KC 1I3UA 1QLFA 4CUCA 4WI6A 1VENA 3BOVA 1KNOA 3RRQA 1O0VA 1MFCH 5IROC 3U2SA 1BD2E 1F6AB 3QJHB 4TTGA 2XA8L 1IGTB 4Z7VA 2XG4A 3LCYA 1T7WA 3VXNA 3S34H 1QRKA 4OBSA 4E41D 5IB5A 2WM0A 1V3JA 2R4SL 2AK4B 4PJXE 1U92B 4S0SD 5AD0B 1RZJH 4M48L 4QY8A 4X7TA 4YWGL 3RWEB 3BN3B 1TVDA 1TJIL 4XVUC 5H2BB 5TH2A 4BH7B 1PKQE 1Z9OA 3QIWC 4PGBA 3BDXA 2J1KA 1AD9A 3QG6B 4YUEL 2M2DA 4PTTB 4KK6D 4XAWH 3QUMH 1BOGA 4PJIF 4RA3A 3OB0H 1NC4B 4NJAL 4GUPB 1HHKB 1B88A 1OT2A 1ZT7B 4QXUH 3LRGA 1IBGL 3HNTH 3PGFL 3NTCH 1RK0B 1BAFL 4DK3A 2V6HA 4PJIA 5CLTA 4HFUL 1GC1H 1KJ2L 1BM3L 2DWDB 3GFUA 4FTVA 2FBJH 2EDLA 4ZOEA 3TN0A 2NX5B 5DK3A 1BVLA 3L3OB 1IQWH 3LKPA 3TJHC 5FYJH 1S7SA 4MXVF 4LPTA 2DLFL 2HT2D 4XPTL 4YXLH 3BIAX 5D7KD 4J12A 1TCRA 2B39A 2HVKA 4HPYH 1H3TA 1QRNB 2G5RA 3C5JA 4LPCA 2C4FU 5T3ZL 4OTXL 1N4XH 5GJSL 5C2BL 1I3VA 4BSJA 4MA1B 5BOPA 3EFDL 4FFZH 2JCCE 2B4CH 2RCSH 5GS1A 4JZNB 3T1FA 2GJ6A 5SWZA 4JHAL 4FOMA 3GMPA 5IVXE 5I1GH 1QOKA 4ONOA 4V1DB 2X4NA 1KTDA 2OBGA 3B2VH 3QCVH 3ZKMC 5C0RL 1ZGLP 5EC2A 3MV7D 2VKWA 4I0PD 4OFYD 1NEZA 4BKLA 1U8IA 2BSSA 1LO0H 2FX7L 4U7KA 1FZOB 1FYTE 3MRKA 5C08D 4G8GD 3OZ9H 1VADA 1MWAL 5IBLD 1A7NL 1SYSB 1S5HA 4Z7OF 2IADA 1EUTA 3HC4L 4P2QD 5B39G 2BERA 1G6RB 3BPNB 3VJ6B 2JB5L 3JWOC 3WUZA 5DJ0A 3FO0H 3JTSB 5I16A 3O8XB 4YBHA 3P73B 1CWVA 3QBTB 1SM3H 3E6FB 3O4LE 2XN9B 5HPOA 5F9WC 3BQUB 4RFNC 3CGTA 3SDAA 5JW5B 5HYIA 4BQ6A 3HLAB 3HPLA 1YMHA 1U93B 3B4NA 5ICYA 5F89A 3I84A 2F53A 1RIHH 3RWCA 4OCWH 1MVUB 2E8ZA 3LN9A 4M6ML 4F57H 1RMFL 4L3EA 5E6ZA 1A14H 3HNVL 4U6VL 1HIML 4JHZA 1IGCL 4GXUM 4PJXF 5HI4D 3L3JA 1BMGA 1EDQA 2HRPH 4WEBH 3Q5YA 3QIWA 3DBXB 1AXSB 4PGDA 5I1AB 3QNXA 2YR3A 3B83A 1A1MA 5BRZB 3E8UL 4O00A 4MVBC 1HYRC 3UYOD 5F7LB 4NKIH 4UQ3A 3ARXA 3QZWG 2D0FA 3ZE0E 2X4OA 1A7NH 4DCQB 3O2VH 2XN9E 2WIIB 2VZSA 1NANI 2NY4D 4S1QL 1J7VR 1NBZA 3F58L 4NT6B 4QRTA 3VFMA 2V9TA 4UNTA 5B38G 4N90E 4XPTH 3HE6D 3FT2A 3D0VA 2DMKA 3ECBA 1TVBB 4CU7A 1ED3B 4QHUB 3QXTA 3BZ4B 1U58B 2LV4A 2OL3H 1BBDH 4WUUD 3TWCL 1DP0A 2YA2A 4JANB 2Y36H 4XNMA 4DZ8A 4Z7VF 4RSVA 3P9MB 3V5KB 3Q6GH 4ODVH 5KSBA 5TH2B 3ZDZE 1HKLL 4NNPL 1X5LA 4XPBH 4A6YB 1ERNA 4HJ0D 3BJ91 3B9KB 4LEXL 4JKMA 4LSSH 2ZUTA 5FA3A 5MP6H 4OI8A 2I07A 5F6IB 2D7OA 3TIDB 1FNAA 1XR9B 1HHKA 2ADFH 2BSRB 2VLJB 1LO3H 2K1MA 2VLJE 3EW3B 1FH5L 5HYJD 3DGCR 4F33A 4OGXL 2AK1H 3QWOB 3VCLB 2LAGB 4CVUA 4PJIB 5B21A 2OK0H 3EYFB 4PP1C 4P9HL 2Q76A 2ARJQ 3SE8H 4K3EH 5F1NB 4HDIA 5DJ8B 1VGKA 3QHTC 2X40A 4GO6B 4IOFC 4DKAA 2Q8BL 2XKNA 5HI5D 3VXTB 4AM0B 2Y07H 1HSAA 1QBBA 1MWAA 4NZTL 1TCMA 4RQQB 3K2UL 3PWJA 2BHUA 5BS0A 3OXRB 3IXTB 2APBA 3LSOA 2OR9H 1GHFL 5C2BH 2CRZA 2AJSH 5I76B 3SDXB 2FWOA 4KDWA 3RNKB 2GUOB 3DVGB 3QEGH 3QCUL 1UEYA 2BSTB 4BSWB 3TV3H 4XP5H 3ZT6A 1ND0A 1GH7A 5DUPH 3L5HA 2G60L 3DARA 5GS0H 1EA9C 1U3HC 4GW1B 4M8QB 5HGAA 3V4PL 2AJ3B 1S3KL 4RMTA 5HHOE 4GG8B 3P3YA 4N9OB 4BSWA 3RX5A 4XNZC 3V7AG 3H9ZA 2X1QA 4TNWF 1CFSA 3MLRL 1NCBL 5DHVH 5BZWB 2JJSA 2XFXA 3P4MB 4R4BA 12E8H 1CE6B 3WIHL 2GSGA 1K2DB 5I0DA 5E70A 4FQIH 2CRIA 1OWWA 4X99A 1YMMD 4NYLB 1T1ZA 1R3LA 2VOTA 2W9EL 4DKFH 5EUKA 2MHAB 1AD0B 2AJUH 3B6SA 1GGTA 1ZA6B 3VFTA 4HQQH 4LRIC 1Q9KA 4LRNH 2CKBA 5D70H 2PTUA 4WU7A 3BGMA 4CMMA 3T0XA 4G9DA 1OGTA 4G8GA 1YEEH 4O02H 1WFUA 1P9MC 2FIRT 3O41A 5F9DC 2R0WH 5I1DB 4ZO7A 1QR1A 5DJCA 3B9AA 2X2YA 4U0RB 4KWUA 3UTSB 2VYRE 5D7IE 1GGCL 1NAMH 3CZJA 2NZ9C 2NY5C 2DQIL 4RGOH 1RJLB 3WN5A 3QEHA 1FZKA 4DJMA 3HI5L 4LVOC 4Q6IC 5B3NA 2R8SH 3RY4A 1QZ1A 1I3GL 4JM2A 1IL1B 5I18H 4I8DA 1NFDB 3NPSB 3TVMA 1MCRA 4PYGA 3UTSA 4WY7L 4LCIL 4LCIH 4OT1H 3TLRA 5E4IA 3IDMA 2C4FT 5D7JA 3QNYA 3S98A 1QVOA 5DD3H 1HILB 1N0XH 1DBML 5IFJB 3ET9F 3RGVB 3FQTA 1PX3A 4CDGC 1JYNA 3DWTA 3PIQB 2IC2A 3RWHA 5C07E 1BZ9B 4IRSB 1NCDH 5HDLA 1JZ7A 4D0CA 4HK3N 4XCYA 4WWKC 5LWYH 5TDNA 4JKWA 5IESL 2YUXA 4YHLL 3KNBB 1OAUH 2DM3A 2BP3A 4TRPL 3NPSC 3DUUB 4PR5A 2DB8A 5JLZB 4MNHB 1FZJA 4JVUA 2GT9A 1T7XA 2MFNA 1KTDB 4OLYL 4H88H 4JVPA 1IAKB 4O2FB 1IC5H 3PHOA 3L3DB 1M7DA 5F71A 2YMXH 4PJ8C 4K7FB 4O58H 5D70L 5I1IL 3LQZA 3FRUA 2NX5E 4ALAL 1BQSA 1UZ6F 4MLIA 4M62L 3SCMD 4L3AA 1KEML 2COQA 2NXZC 2Y4SA 3NACH 3L95B 1YEKH 5HYSA 1QSFD 4WUUE 4E41A 2BNUA 2DL2A 4ONGH 1S7RB 3V6BR 1I1AA 1OAQH 1OARL 3WLWD 3X14B 1ZANL 4JFEB 4P9HC 3MLPA 5KZCB 1RJYB 1A7PL 4LVNB 2LAAA 1OCWH 5C6TH 2ICCA 2CXGA 1HH9B 3EO0A 1ITBB 1GC1C 5E2VH 4HC1L 4UB0L 3GJFH 1G7HA 1I1FA 2CDGA 3JSSA 4ZYKB 4P3CL 1ZLWK 4IDJL 4WU5B 5F97E 1VESA 2X70A 1U93A 5D2LE 3LV3B 4RGOL 1HNGA 5DUMH 1MWAB 1BQLH 4S11A 4F7PA 3QEGL 1NFDF 1T04B 4UU9B 1JUFA 2WQ8A 5EOQH 4RQQA 3UPCA 4C4KT 5BZDA 3P0YL 4UV4L 3VRJB 5L6YH 4CN6A 1EAPA 3EDJA 5EB9A 5D1XB 4O02L 1IC7H 4HMCA 2HJKB 2F15A 2N1KA 1XF4B 3HI1B 4K23H 4BFEA 4J8RA 3T2NL 4R4FH 1AXSA 3GJEB 2EYRA 5J6GB 4PJBA 1NFDE 5JIHA 1CIUA 4PJDB 3ZHDA 3CDYA 1UC6A 5DEFB 3ULVH 4BUHA 1PLGL 3S5LA 3C5ZB 1CS6A 2IQAB 1GOGA 2I26N 1K6QL 2F74A 5EO1B 3RDTC 3U7WL 2OTWB 1PD6A 3V0AC 2CIIA 1PKQB 3D39E 1OP5K 2RIKA 3I75B 5MEPB 1M05B 1LQSR 3DV4A 2ICES 2WBJD 3MV9B 4L3ED 2MNUA 2ED9A 3BZEA 5ILTH 4XH2B 1PDKA 1UZ6E 2FO4B 3P4NA 1HEZB 1YDPB 1NBZB 4NT6A 1I8IB 1ED3A 3ZTNL 4F80A 4CU6A 3P4LA 4MQTB 1YN7B 2J8UF 3OR7B 3MUJA 4WFFD 4JJ5A 4E9LA 4XBPA 3D0VB 2VDPH 2DD8L 4OBRA 4YHZH 3WS3A 2BNUB 4AEFA 4YEEA 4WTWA 3HR5B 2Q7YA 1BEYH 2C9AA 1Q38A 5EPMA 3TC9A 4UUJA 1OVZA 1IKFL 4GFTB 1RUMH 3LQAC 4Y4FA 2NY1C 3O2DL 3LEYH 1LE5B 1T66D 2PXYD 4R4FL 2NXYD 2APWA 5INCB 3HAEH 2Y07L 5ICZA 3EYVB 2P48B 3U6RA 4ZD3H 5E8EB 1JZ2A 1YEHL 3NCJH 1DUYB 3MNWB 4HT1L 5FHAH 4G80B 3HTLX 1AO7B 4XCCH 4NO5A 2LVCA 1QG3A 3FN0L 4DUVA 4MDJB 3F6IA 4Y4HD 4KJYB 3C9NA 2ZUXA 3BHBB 5SX4H 2J2ZA 3VFPA 1GRWA 4LSRH 4TULH 4YX2L 5FECA 1KB5H 5F93C 4U1IA 4HUWA 4MD5A 3REVA 1WAAA 5DI8A 4XMLL 5JA9A 4P3CH 4ETYA 2VZOA 3V6FB 3GSUA 3O6LH 3DXAD 4P2OD 2FL5A 3B8SA 3BP7A 1ZT4B 3PWJB 1QFUH 4E5XB 4TSBL 1EZVX 4V1DD 4M5YH 4GMSL 4O2EA 5CD5D 3GUTA 25C8H 1DN0B 2AK4D 4V1DE 1MHEA 3QULB 1FFOA 4N5UA 5E8OB 3W9EB 4Y5YA 3DVGA 4W6YB 4YX2H 5BO1L 2Y36L 4OGYH 4QHKJ 3KXFD 4PJ7B 3WO3B 2FD6H 3GHEL 2VLKB 3FO2A 2AQ3A 1UYWL 5CZXC 4QHLA 5T33H 3Q1SL 4LEXH 3QISA 5CAYB 1RULL 5J11C 1X5IA 3CK0L 4HXBH 2XWTB 3O4OB 1KJ2A 4XCEA 1IM9A 4HJ0C 4I48B 3Q5OA 1F11B 2P5WA 4NQVB 5EBMA 2MQCA 3O2VL 1TVHB 1WZ1L 3L7FB 3H3KA 3ZDYE 1N4XL 5I2IB 3NA9H 3STZA 4KUCD 3IKKA 3BEVA 1EHXA 4J3UA 5DMJB 5DEGA 2CJUH 2YUZA 2ARJA 3BZFB 3X13B 2QBWA 3LRSB 5FYJL 3AUVA 5I73C 3WFHA 5C0GB 1MUJA 5HI5C 3MNWA 4HG4K 4PRPA 2QQKL 2J8UE 3N85L 1FCCA 2UYLA 1CK0L 6FABH 4ELMF 3F5WA 3UTPD 4M6MH 1CXHA 5IQ9A 4NKIL 2OMBA 3H6JA 5T3ZH 3PGFH 3SOBL 1BPVA 5DTFA 4P2QB 3KDMB 4DGIL 2M26A 2PYED 4U1MA 1DQDH 3MRMB 1DZBA 4M02A 2YXMA 3QHZL 1FFPB 4L8SA 3ARQA 1IGIH 1FNGB 3PWNA 2A6JB 1BJMA 3RZCC 1S7SB 3CVHL 2HFTA 4IRZH 3QIBC 5C0JB 4LCUA 4G3YL 1XCTB 4FZ8H 5D2LA 3UAJC 4CVZB 3AC0A 2AJYL 4P2YA 1A6ZA 1AQDA 2YD8A 1L9MA 2H26B 3INUH 3ARDA 4M3JA 3HZKA 4HWZB 4L9DA 1SY6A 5TDNB 4LDEB 2VITA 1KFAL 5D7IB 5E8NA 1EEZA 2A9NH 4MXQD 2JIXB 4IRSC 1KPRA 1TETL 4PJ7A 3SOBH 4FFYL 1SJEA 5K59E 1NBQA 1J12A 3VXUD 1DLHB 1MELA 4MZ3A 5IKCB 4Q9QH 3J7HA 2X9WA 3HRZA 2IFFL 3MACL 3GSNB 3LEXB 2GT9B 3OF6A 4J2XA 4WFFE 4HH8A 2B1AL 1FFNA 5L9DL 5JW5A 3BPLB 2YWZA 4LIQH 1J1OH 5D9SA 5EU3B 1BHGA 1Z3GL 5IW3A 4R96B 4X98B 5CJQL 4DVBB 1D5IH 3NCFB 4Z7WB 2D03L 4JRWA 2BDNL 4LSQL 1UJ3A 1MCLA 3MOBL 3QQ3B 3OKLB 4FFWD 3HPJA 3PWPD 4OCXL 4S2SB 1RUML 3T77A 1JF1B 1CIDA 1D9KB 1MCDA 4N5ED 2XIDA 5E24E 4NQCD 3IDNA 3UTQA 4PJFA 2OJEA 4XT1C 4LKXA 3BKCH 5FYJE 1OW0A 3U9UB 2NR6D 4WV1A 4PLJD 4U1KA 4ODTL 3FOLB 1A7OH 2IH1A 4IRJD 3REVB 1X4ZA 2R29H 4XRCA 4N0UA 1Z3GH 5IMOB 5HHQA 3MQIA 4RGNC 1JHTA 4ZYKA 1JGVH 3R8BB 5EN2B 1JGEB 1W0WA 4ORGB 1LDPL 3D87B 2C3XA 5LWYL 2VUOA 2BMKB 5EIIB 1CR9L 5CBEA 4YHIB 4PLNC 4CVXA 3WBDA 5EUOA 5FYLH 4JM4L 3OJVC 3CMGA 2HVJA 4PYHA 1ZLWH 1IAIH 3LIZH 2EE9A 2F54A 5E8OA 1PQZB 4XNZB 4BQCA 4ZTPL 4U6HB 4EN3C 4ZUVA 1CLYH 3PDOA 4FQXB 4U1GB 3ME0A 4BH8B 2HTLC 1OAKH 3HA0A 4R4ND 4WJ5B 3TH2T 4CW1B 4CNIB 3DVIA 5MENA 3RWFA 3C8HA 2HT4D 4R0LA 1KG0B 1JWMA 1A1OA 3HI5H 1ZGLM 5CSZA 4YXHH 5GRJH 3UBXB 4MSWA 1MHCA 1N8ZB 3RHWK 1GIGH 4P4KD 4HUVB 3QEQA 3DV4B 2CDEA 2UWEB 5CEZE 1UZ8B 5K93A 2DI8A 4JO2L 2P5WB 1DQLL 3M8OH 4L4VA 3PWPE 4Z7QE 1LO2H 3EYQD 2XXMB 5IB2A 3MXWL 1RHFA 2ADGB 1MCWM 3RVVC 5I8KL 2IBZY 3QRGH 3EOBB 4NQEB 1T2XA 4U05A 4G8EB 2NNAA 5CJXA 1A3QA 1JE6A 3QG6A 4YXKH 5I75B 3QWOA 3OSKA 1HQRA 4I18C 2NYYD 4IBLT 4GQPH 3RVUD 2VRAA 2RBLA 1I8IA 4P2CG 1IMHC 1GGCH 5CGYC 5KAQG 2H8PB 1C16B 4RIRA 3WFCH 3VD3A 1QUNA 1RURH 8FABB 3D25B 1JNNL 4M7KH 1FO0B 3KPQA 1FBIH 2VLMD 3PABA 4MNQE 1YA5A 2NY2C 3MV9E 3S37L 1NGXB 3GSRB 1IAOB 1DQML 3EO9H 1U6AH 2BXYA 2BCKA 2ZUWA 3LS5H 3TZVA 3TH4T 2D9CA 4UBDD 1M7XA 2J88H 4MX7B 1CD8A 2HVKB 3RWGB 4BA8A 4OCRL 3TBYA 5HHOD 3TV3L 5EU7C 5C0JA 1U8LA 2KQMA 1MJ8H 5HGBB 4CMHC 2J3SA 2IGFL 4GG6B 3H9HB 3FJTA 3UBXG 1T7ZA 3ILPA 4X6BB 5FOJA 4PJ8B 3Q3GB 4XPFH 4R2GB 2E9JA 3QNZB 5HDOA 1YYLL 1CGYA 4F9PA 3VGAC 1FIGL 4OLVL 3KGRA 4KROB 5CP7B 5CZVL 4LLUB 4KMQA 2FH8A 3P4MA 4R4BB 3CMOH 4R0LB 3G9AB 2FHBA 1CU4H 4Q2ZA 2X4SB 4NKMA 1RIUL 3L5XL 2D2OA 4QGYA 1MRDH 1IEBA 4Z7QF 5D96B 5DVMA 3EOTL 3EOTH 3TCLB 4B53A 5IUSA 1QA9A 1WBXA 1MCPH 5CSBA 4NCC2 1KELL 3NCEB 3VG9C 4R97B 1B2WH 2DJUA 2VKXA 5LG1A 3JBG7 1ZHNB 2D4DA 3RZWA 2QHRL 5INDB 1S7TA 5CZVH 3A6CL 2WINB 1R3HB 4XTRD 5E2VL 2P5WD 1KACB 3OAZH 35C8L 3HPJB 1G7PA 2R1WA 4LU5L 2VLLB 1A6AB 3LY6A 4RFOH 5IBUG 2YD2A 4X6CA 1WLHA 5J1AA 5EWIH 3MJ8A 1GPOH 1GGIL 4LFHD 5GRVL 4KMTH 4OD1L 4OKDA 3RWCB 1TJGH 5AG8A 3HNSH 3WIFB 3A6OA 2JCCF 3O9WB 2VLLA 3KXFA 5EZJA 4N0RA 5HHQB 2VL4A 3BQUA 1ODAA 3VI4E 1CG9A 1RY7B 4WWKB 2J4WH 3GJFA 3ILQC 1FIEA 1MH5A 1HYSD 3U0PA 3N9GL 4ZXBD 3BSZL 2B4CC 4Y5VB 3IU3B 2YN5A 1DQQA 5CEZH 2W65A 1I1CA 5A2LH 4FQHB 1T89A 2IGFH 3MLSL 4Y19B 1UWEL 3EAKA 4NZUL 4Y19E 4K3HA 3PNWB 3FT3A 3TT3L 5CD5C 1FFPA 1GJIA 5H35B 4G8IA 4GJTB 1P4IH 1BQHA 3O8XD 1U3HB 4M6NH 2OTPA 4JRXD 4P2QA 2KDGA 1CL7H 2HH0H 2H2PD 4YO0A 4YGAB 2E7BA 2FJFA 4R8WH 2LU3A 1U58A 1YNKL 5EZOL 1JWUB 2BVOA 3HZKB 5HYJB 4QWWC 5DHVB 1TQCC 3FQXB 3GMRB 4Y16D 5IB2B 3KPSB 1A4JB 2PXYA 3HCVA 3RL1B 4XNMB 5DC0A 1I7TB 5KSAA 1WICA 2APTA 2WUCL 3HG1D 3NGBB 4UOW0 2E7CA 3HZVA 1TQBC 2VR9A 3QXAB 2DYPD 3TBWA 1FRGH 3QYCA 4YXHL 2HJLB 3O2DA 4ETQB 5LKNA 1RJZA 4YHPB 2F53E 3CCHB 1N59A 1P5UA 4Z5RA 4BM7A 5KW9H 3WDJA 3T0EB 1WWBX 1P69B 2E9BA 1CLYL 4HV8B 1T3FA 1SBSH 5KSBF 4KKLD 3N0PB 2B0SH 4F15B 4KUZL 4PLKC 2BVPB 4MCYA 4P59H 3UTTB 1UXWA 5AAMA 1KULA 2QKIB 1A6UH 4O2CA 2AV1B 5F7DB 2XKNB 4QXGH 3K46A 1K8IB 4H8WL 5F7MC 1EIBA 3WHXA 5IEKB 4FNLH 3KPSE 43CAA 1QFOA 5ABDE 1QQDB 1T1YA 2CPCA 2WANA 3OKLA 3QQ3A 3KLAB 3QAZB 1R6VA 3B9EA 4AEEA 5B8CB 2P8PB 2LFGA 1ZHKA 1XT5A 3P0GB 3KYAA 3TESA 3KAAA 2XZCL 1VGKB 5EU4B 4QRQA 3TA3A 5ISZE 2GJZB 1DL7H 4U1KB 5SWZE 2WV3A 4JFFE 2XWBA 4EJ1C 3D18B 5B8CA 4K3JH 4J8RB 1D5BA 4CN4A 1V5JA 2ZOKB 4ZD3L 3FFCD 3RWIA 4KDTA 3KPRD 1JIBA 2BVUA 5DQ9B 3KYNB 3MO1A 4MJ6A 4NZDA 2V2XB 2KZWA 3QJFB 4XHQA 5IMLB 2PYFA 5FOBA 4UNVA 3V2AR 3BMVA 2JKXA 3QPXH 4IOFD 3V0VB 4EDXB 1I1RA 3LB6D 3FONB 4FQ2L 1A3LH 3MXVL 4OLZL 5EUOF 3ROOB 4NC1C 4Z18A 4PJGE 3GSWB 1I7TA 4WUKH 4LPWA 3U0TB 1I3RB 5J8OA 4X4YA 2FSEB 1EXUB 2VZTA 2EEAA 2QHLA 4GRWB 2H1PH 4HZAA 1JGUL 1O7SA 1T1ZB 4JO1L 4L4VE 3DMMA 4Y5XC 2HG5B 4PS4L 5CEXB 1AKJD 3CFJB 1JWMB 3OMZA 3RBGA 1Q1JH 4O4YL 1JVKA 1N8ZA 4P2QE 4XVTH 2QLVB 4OZIE 2WIMA 2X41A 1CQKA 5CD3B 2XZQL 5I1KL 5DLMH 4L8CB 3MJ6A 1NL0L 5AUMA 5C08E 3KXFB 2LVEA 4YBLB 4NO5B 3LMJL 1LE9B 2EYSA 4MJIA 2QSQA 5D1QD 3ULVF 1HHGA 1T0NA 4PJ5D 5ERWA 4CADB 1MCIA 2P42B 2XPGB 3QUXD 4TPRL 2CKBB 3HE6C 4JM2C 4Y4FB 1MFDL 1BD2D 4X9IA 1AFVL 3MJ7B 5EU5B 1IAIL 3T0ED 1BJ1H 2AEIT 3WJJA 1INEL 1JYVA 3MMEB 4OCYH 1A6WH 5IFAL 4HPOH 3IDIA 3DROB 3CDCA 2WMPA 2R2EA 3LVEA 1XF5A 1KB9K 2EDBA 3F58H 3D48R 4S1QH 4WUKL 1CDIA 1R24B 3I6KB 1JV5A 1QP1A 5DUBB 3CSBA 1GOFA 4K71C 1DSFH 4UIKH 5FO7A 5LAXA 5D2NA 3TBYB 1S5IH 3RKPA 3HE7B 5DQ9A 3RVVD 5D7JB 2FB4L 1UWGH 4G5ZH 5AYQA 4G5ZL 4OCYL 5T3ZD 2H41A 2BY1A 3RA7H 3P77A 1T21B 1ZVYA 3V0VA 1JV5B 2YD6A 5MEND 4YC2C 3WFDH 3O2WL 3ALPA 1RZIA 1IGYB 3ARGC 4NQVA 2VC2L 4JB9H 1FYTB 2X1XR 4KI1A 2IADB 5IMMB 2WUBL 4HWEL 4LNVA 3P77B 2A38A 3DX8A 1RUKH 3NABL 3O8XA 1CICD 1T83A 3OR6B 4HJJL 1IAII 4M43L 1XR8A 3N1QC 1CXKA 3ARFB 3E6HA 2A74B 4O58L 4M1GH 1LO3L 1EEUA 4NM8H 1KIRB 3AREB 5JIPA 4PP2A 1S7UB 4OM1L 5FO9B 1YY8A 1RZKC 2VXTH 1I8LA 5DC9B 2AI0L 1S9WA 1YQ2A 5IM7A 4QNPF 1S9XB 4WU5A 3HMXH 3JV4A 4K3EL 1TJHH 4Q6YA 3SE8L 4HJGA 2BNQB 2VE6B 3EDKA 2E27L 4RMSA 3BH9A 1U8QB 4FQ1H 4XHJD 3W39A 1AHWB 1S7WB 3KLAA 2WUCH 1TQBB 4FABH 4JFED 2BX5A 4ZTOL 3BP6A 1T03L 3GSXB 3CVHH 5ADPL 2BNQA 2VE6A 5GGQH 2NY1D 3T3PE 3GBLA 5JOEA 1LO0L 1WZMA 2C7UB 5LGJB 5SV3A 5DYOB 1OSZA 4HG4J 1C12A 4APQB 2EDKA 3BE1L 5ANMB 5EOCH 3F7YA 3WIIL 5E1HB 5LGHH 4QRTB 5D1XD 3VFMB 1IT9H 5L2JA 3JWDC 5ACMA 3ZE2E 5DRZB 1UB5B 1U8HB 4K3DH 3FRPA 4XVSH 5KS9E 1MJJA 2E7MA 1OSZB 1V3MA 1N0LA 1NBYB 3WXWL 3VI3F 4LSUH 5TQ2L 1BQHB 1C1EL 4J6RH 4OLXL 1T1WB 4QKXB 5DD0L 4RWYL 2BNRD 2Q86B 1G9MH 3S5LG 3S97C 1I7UA 1I3RA 4F15C 3C08L 4PY7B 2F8OA 1ZHLA 4WFHE 4XP1L 5A16A 3IKCA 2HJFB 2YKLH 3ZDYF 3C5ZA 5CKAA 1H8OA 4IM8A 3WIHA 3NPZB 5FHBH 5EA0H 4KKAC 5FF6B 5GSVB 4YBQD 3DV6B 4BUGA 5HYJA 3GK8L 1DVFD 3TO4B 2DQFA 3VXSD 5BVJB 2JJVA 3HAEA 2VDPL 3MLVH 4XX1G 4NRYA 2P5EB 3ZKMD 9CGTA 4GAGH 4QHKI 2DI9A 1S5HB 1CDYA 4K9EH 3VFUA 3I3BA 1MF2L 3AXLA 1JUFB 3CUPB 1CGSL 2V5TA 5L2KD 5GS2D 1P2CB 5FGCB 4YHKH 5GJTH 5L7XL 1T3FB 3TGXA 5F7HA 1ZTXH 2X4UA 5HVGB 3B3IA 2IMNA 2J5LC 1C7SA 4X80L 3VRLF 1DN2A 5DJ6B 4FG6C 3ES6B 4D2NA 2HT2C 1MPAH 2VIRB 1F4XH 4PJBB 5JUEH 3UDWC 2YD1A 4Y1AD 5M95B 5FECB 3BEWB 3MRCB 4U1IB 1HHJA 5A40E 1QFUL 4M4RA 4N90D 3DROA 4GRWH 5INCA 4P57B 1QHOA 3D3VD 3WNOA 4AZ8A 1H9VA 3GBNH 3LEYL 2Q3AA 2VDML 5IIEA 2VDMH 1UJTA 2J8OA 4ISVA 4GKNB 4GQ9H 4MQ7A 3OAUL 5L2JB 5IP4A 4NCDA 4R0LC 1IVLA 1IM9D 5IR1A 4HKZA 4KK8D 2AEQL 2EO9A 1WT5A 3RX7A 4JCLA 4RMQA 4ZFGH 4GG8A 4KZDL 4O5LL 3K0WA 4F2MB 1GOHA 1KCKA 4LLYB 3HE6B 3BO8B 2JK5B 4LPYA 5AWNL 3ULUH 3B2UD 3O2DH 4MJ6B 5IVNA 4MMXC 4JJ5B 1DJSA 4XBPB 4M9OA 1ND0B 5CJXC 2MPAL 4ALAH 2EZ0D 1INEH 2VZUA 4HGMA 4NJ9H 1WFNA 2BVTA 4G9FB 1G7IA 1S9VB 3IDGA 5GRUH 2G75B 1HZHL 1KPVA 4YHML 2VLKD 1J5OH 4OTXH 1BAFH 4G7YH 3MLSH 2PYFB 4KJQD 2GTWA 5HDQH 4J3OC 2CIKB 1I9JH 4NCC1 3KG5A 1QRNE 3MLVL 4NKOA 5TQ2H 4AJ0A 3JVGC 2A83A 1M6OA 1FL5B 4RDQG 5BRZD 3WDIA 5I2IA 2EC9U 3LMJH 1JHLH 3H3PL 1KCVH 5IB3B 3CFJA 1IE5A 1G0XA 3KPQB 3QDGB 1W72B 3WDHA 1CFQB 1MCNA 1ZK9A 2YMXL 3MROB 2DIAA 4I5BB 1RZ7L 2ED7A 2NW3B 1MCBA 3B9KA 3DURB 3P0VL 3WFEL 5JZ7D 1OTSD 4RAHA 5HJ3A 3V6OE 4HS3B 1ZLUH 3D1MC 4RBPH 4GLRH 1CVRA 4ZTOH 5GS0C 4JGMA 4F33B 4XMPL 1U8NB 4NQCA 2YEZB 1AGEB 4DN4H 1FLRH 3VW3L 3JWDL 1AO7D 5T3XD 5D7LE 3GSRA 1NJ9A 3MFFB 2BC4B 1JGLL 1CE1H 4JPVL 1EO5A 1RZJC 2YBRA 2VLRA 1QYGH 4ZOAA 2QADD 4OUUB 3HC3L 4NQXB 1I3GH 4HD9A 4Y0GA 1RIUH 3L5XH 2YS4A 3RI5F 3V4UH 1OGAD 4QRRA 3F7PC 5IQ7H 1V05A 1BGXL 2NY3B 5FM8A 3T0EE 1REIA 3KNBA 2W9EH 4FQ1L 1KJ3L 3LH2H 2Y5EA 4XP4L 5JXEC 1BZ9A 4IRSA 1EMTH 3VMNA 1M71A 4TVPH 3VXUA 1NC2A 2WUBH 3HI6H 4GKZA 4HWEH 2L7UA 2QEJA 2VISB 4PV8B 1FCGA 3L7EB 1QBML 4I0KA 5EIQA 2HT3C 1FO0L 2Y72A 15C8H 1U8PB 4WW1A 3QUXB 3NH7L 3C2AL 3STZB 1WFTA 5HYSG 1KPVB 2A6IB 1CDHA 4OLEA 3I3DA 3ZTJG 2F58H 1YPZA 4JFXB 1LDPH 3ULUL 3K8MA 5KSVB 3SO5A 4XP5L 3UJJL 2F8XC 5LJYH 5F3HA 1OM3H 5T5FH 1D5IL 5IQ7L 1F8TH 2HKFH 1EGJH 3LPWA 2ATPB 4NSKA 1H15A 2J6EH 4G6FD 5JW4R 3U46B 4PRAB 15C8L 5DD3L 1IILE 2I27N 4KTYA 1DANU 2CQVA 4P49A 4HPOL 4PP2B 3RJDA 1KIPB 3BISA 2DF3A 3B2VL 3GNML 4K94H 1WBYB 3QWRA 3U9UA 3HZYA 5EG6C 4LDOB 4PRIA 4WDIA 3IDYC 1H8SA 1IGFL 3HAEG 4YE4H 1RJCA 1OT1A 4TTDC 5JDSB 4N0UB 4QRRE 1CFNB 4DW2H 1TNMA 4M61B 4OZHB 4MQSB 5CJQH 5DVNA 4OI9A 2NLJB 1NMBH 1YEJH 1E4WH 3VXRD 4JO3H 5I66B 5B39B 3KPRA 4BJLA 3V5DB 3QH3A 4HLZG 4FQPA 5CP3H 3MV8E 4MNGE 2BVQA 4ZOCA 1X5AA 4M61A 4OGXH 3MRHA 4OZHA 4LQ1A 1XF2B 2ENYA 1OLZA 2WSKA 3G6JB 5E94A 5D7IA 3WMSA 5MI0B 4U4BA 4BH8A 3S5LB 1KJMB 5I6XC 5C0ND 5KSAC 2BFVL 3LKQB 2IG2H 1NAML 2ZCKH 5HDBE 4PJDA 5GRXG 2XQBL 2VLRE 5I19H 5DF0A 4Q97A 4JFFA 1T83C 3R1GL 4PJ7E 4GXUN 4N8CH 2X4NB 2X4RB 2YD7A 1JTPA 5F7EL 4JHWH 6CGTA 3SDYH 1G7QA 4Y1AE 4IIQB 3F65A 4FZ8L 1YDPA 4PJEF 4HQQL 1U8PA 3EZ8A 5BRZE 1NMCC 3T0AA 4KJWC 3THMH 4JFOA 1KIQA 1RZ8B 1AGCB 4P99A 4G6KL 2AERT 3GMNB 1A6TA 3E0GA 4QHMB 1CD1A 3VGGA 2VERN 3U7YH 2CLVB 4JO4H 4NUGL 4JB9L 3VRLE 1UKSA 3MRPA 3Q6GL 4ODVL 1XIWB 3CVHB 3QFDA 4QRUA 4BK4A 4P4RA 4XCNB 4KZDH 4LSUL 4WV1B 4F7CB 4X7CC 1AGCA 3QXUA 4ONHA 1NGYB 2XNAA 4NQDE 4OJFL 2FIKB 5T1MA 2Q6WB 3UCRA 4LU5H 2DQFB 1UXSA 3GMMB 4HDIB 1NLBL 5AZ2H 1F3RB 2GK0B 4M00A 3C60C 4QRPA 1YECH 4JFDE 1TITA 4NBYB 4RX4A 4ZFZB 3TT1L 4LVHC 4YHYB 1YZZA 3B3IB 3TZVC 2R4RL 2P8PA 2XRAH 3UPAA 5FUZH 2L7JA 4WFHD 5LXGL 4NHCL 1QEWA 1IGCH 3LDBB 5JNYB 4K71B 4OGZA 3D25A 3NFPB 1FO0A 3DGGB 3KYKL 3L5WA 3WLBA 4JCMA 5D7JC 5B39A 4HUUB 4YIQB 4PLOB 4NUJA 3WUWB 4OFPA 3IVKB 5I8EA 1F2XK 4HKXB 1IAOA 3BDBA 3WD5L 3QEQE 3C5ZC 1HHIA 1OQOA 2XV6B 3LQAL 3SGEH 4OIBA 4R3SA 5DDHA 5F9JA 3UJIH 3L1OH 1P53A 4MNGB 1DFBH 5JOPD 1K5NA 2GJZA 5J13B 4OM1H 4G9FD 4LHQB 4LPUA 2VLKA 3FO2B 3T4AA 2B7DT 4EI5B 2EIEA 3ARGD 3FQNB 4F57L 3DMMC 1R3IL 2A6KB 4ZUSA 5HXMA 3MREA 4KRPB 2OX5A 3BO8A 1EGJA 4F7TA 2X4TA 4HIXH 1VFOA 1LWRA 4N0YL 2VXVH 3TBVB 5E9DA 2MTPA 2SEBA 4PUBH 5D93B 1DQMH 5F7KC 3L1OL 1S9YB 3C08H 3GSNL 4D0DB 2GQHA 4G7VH 4LPVA 2V5RA 4ZUTA 2NY5L 1Z0MA 1JPSH 4ZO9A 3GSWA 5C09A 2H32B 4P3DB 1WZLA 5F9AC 3PWPB 4QWWD 4YHOL 5EO9A 4JPKH 3GRWH 1OAZL 4TULL 1FGNH 3Q0HA 4YQXH 4TNWK 1FL6A 1B4JL 1FNSL 1IKNC 5EORL 1SEBB 5TDOB 1E27B 2E9WA 5EOTB 4MJIB 3G5YB 2DQHL 2V17L 1WCQA 2OLDA 3UMTA 4Y7MA 1RI8A 1DBJH 3U0WH 3GMLA 2ZUQC 3S4SA 3SKNB 5CWSA 3MRFA 5I1JH 3NCJL 3S96B 3IB4A 2D0GA 2AKRB 1R3HA 1U3ZA 2C4XA 4M7JL 5JPMA 4O51A 3DO7A 4FZEL 4Z77B 1A4KB 1A1NA 3ZTNH 5JIIA 2V2TB 4QTIL 3EOAB 4PUBL 1A02N 2C3GA 1HDMB 4NN5C 4GUPA 1VFBB 4XAKD 5F96H 2ADJB 4OJFH 3CXHK 4K07A 1B0RA 3UEZA 4WI3A 3CPLA 3O3EB 1JF5A 1MVFA 3ARPA 4L8DA 5E8EA 3WKMH 5T3ZE 3CJJA 5TQ0L 1AGEA 1MCOH 5DUBA 1TQCB 2NY2B 4PTUA 5AEAA 1XGTB 2H45A 4U0QB 3C09C 4NPYA 1F90H 3X11A 1SM3L 2AJVH 4ZS7L 2V9RA 4ZAKA 1E6OL 3ELAT 2VDRL 5J3HC 2YSSA 3UO1H 1EEZB 5ACZB 1XGTA 1KBGH 4HX1A 4R26L 3ZKSD 2DQJH 1P1ZA 3HNTL 3NAAH 4LHJB 1C08B 2CSPA 3BESR 4QNPE 3CDFA 3TYFB 3WNLA 3TN0C 5AYUH 5D8JL 5DR5H 1ETZB 2CR3A 2BNQE 3W0WE 1P4LA 4MA8H 3UJIL 2W9DL 3VWKD 5H8DA 1I9RL 3QHFH 4R7NB 4Y8AA 2XZAH 5AG9A 4EI6A 4J7RA 1IZJA 3H7BA 4BFGA 4YH6A 3TT1H 2D7TH 4DVBA 4U6TA 1FZOA 1U0QA 4EUPH 4P2RB 4YPGB 1V7MH 2IAMD 4RMVA 3C6SA 3HC0A 3V8CA 5H94A 1FAKT 2X9YA 3ZO0A 1T66C 2PXYC 4NWTH 1JNLH 2OSLB 5EBWB 1U8MB 5FEBA 4OZ4B 1G0DA 3BPOB 1MFCL 1CT8A 2R9HC 1C5CH 5EOTA 1OP3H 1I1YA 1D5ZA 2K7PA 2IALA 2QL1A 3AAZA 3EBAA 2BNQD 3AROA 3H9SA 1QPXA 3QG7H 3SKNA 1IQDB 4L4VD 1H0DA 5I30H 2UY7A 1N6UA 5HVHB 2VXQH 4ZPVB 2VDOL 2YD5A 4M62H 5D2NE 3E2HB 1P4IL 5F6IC 1SQ2N 1ZWIA 5FYKH 2C7UA 3PNWA 1AY1H 5IV2A 5I1IH 2C3VB 4J3VA 3H9SB 3VFGL 2BJMH 1IKNA 4YHZL 1IEAB 3CFCL 4I18A 1WCBB 3UJTL 5BVPL 1UENA 5GRYA 1K3ZA 4GAYB 3UP1A 3QUKB 1MJ8L 3DETD 1PAMA 1K6QH 2L4OA 4HFWA 5T5FL 4YO0B 3ARFD 3IXTA 3KPRE 5C70A 5A2FA 4KQ3H 4P23D 1NBYA 2ZCKL 4MAUL 3RUGB 4RAUB 4EKXA 3PWLB 5I1CL 2NY7L 5EO1A 4P5TB 3MRHB 2GTZB 5JOPE 1RZJL 4M48H 3RVWD 3PGCB 5E4EC 1MAML 4XWGH 4TVPE 1YEGH 4W6WB 4ETQA 5DJAA 5KSBE 5KVFH 2VQUA 4ODWA 3BPLC 1KNOB 1OLLA 4U3HA 5GGSA 4PR5B 2EDQA 3PJSB 4DGIH 4L4TA 5GPRA 2P7TA 3LN5B 4KHXH 5BVJA 2QQQA 1UWXK 4DN3L 1MCWW 1YEFH 2WK2A 4QRPD 4N0FA 3BX7C 5KJRH 3IRZA 2V5SA 1U92A 1D5MB 1OTUC 3TJEH 3OL2A 4U1SB 3MCG1 4QRSA 4WW2A 5JXAH 3QQ4A 1RUQH 2I5YL 3FT2B 3ZZ1A 3LQZB 3ZLQC 3IKCB 2ZJSL 3RVXD 4X5WB 1UZ8A 2H6PB 1Q1JL 3MV7B 4KC3B 1AD9B 4Z7UE 2UV3A 4F9LA 2XKSA 3QQNA 3BRDA 2VSDA 1JGLH 5DT1L 1RU9L 5ETUA 4YBQC 2R15A 2Y5TA 3KJ6L 2VNCA 3HAEB 2DQTL 3DYOA 5EU6E 3GSOB 1R3JB 3DYPA 4MXQC 3CMOL 3SGDI 1CR9H 3OKOA 4OUOA 4HH9B 4CAGA 3S36L 1T1YB 2F5AL 2IBBA 3TPKA 5DZLA 4WFEE 3ILQD 2JIXD 4G43B 4MAYA 1B3JA 1L0XA 1DBBL 2AI0H 1EFXB 3CX5J 3QPXL 3HG1E 5HHNA 1U8OA 1J05B 2DL9A 1JN6A 5DD5H 4JFFD 4H5SB 2BJML 3CFDA 2XTJE 4MA1C 3WHE0 3D18A 3DI3B 1QBMH 3TVMB 1MQKL 3V6FA 4N9GB 4JR9L 4AMKL 1YPZF 1NCTA 1LK2B 4L8SC 3U83A 1YN6A 2ZUSA 4HAGA 5IVXF 3WYRA 5C86A 1XAUA 1JPTL 1MNUH 2BDNH 1ZS8A 5E00A 3W81A 2ORBL 4LAQH 5D2NC 3CNKA 4HS8H 3PL6C 4IMLB 5TFSH 3ULSB 1AC6A 3LHPH 4HBCL 4MJ2A 1ZHBA 3H9HA 1DEEA 5DHXB 3FCTB 2DJ4A 1YJDC 3OKKB 5IHUL 4QEGA 1WTLA 3UTPE 3VXQB 4OKVB 4ONFH 1K5NB 2VZ3A 2F8VA 1CXIA 3WUWA 2FWOB 5CEXA 3D2UA 4F7EA 4JFDD 4DN4L 4ERSH 3RPIA 1XH3A 3QWRD 4JLRB 2P43B 1QFWH 3JTTB 3MNVB 2CGRL 3AFLA 3BZEB 2AJ3A 1B9ZA 4X6CF 4FXKA 1QYGL 4OB5L 3IRPX 4JY4B 4XPGL 3B2UC 4XI5D 4OGAD 4I3SH 2HFEA 1BP3B 3LEVH 2YPVL 2GKIA 3OV6A 4BH7A 2MOVA 1P7KA 1KXQE 3K4AA 2WQRA 3UO1L 3I02B 1MQ8A 3MBEA 4PJDE 4JFHD 1UJ3C 1KENH 2DBLL 5HI3D 2DTMH 3NN8A 4X6DB 5HJ3B 1IGIL 4JPIA 4Y4KB 4HS3A 3OX8A 1EHAA 4NQEA 4OZIB 3FB8A 2NTSP 4N1HB 2XKUA 3KPTA 4KGJA 3KXFE 4WU7B 1W72A 3R0NA 1SEQL 3QPQC 5GISL 4N0UE 5HYEA 3DETC 3L3OA 1WC7A 4P46D 1PY4A 3D9AL 4IRZL 1I8LC 4PFEA 1VKXA 5FHBL 3FT3B 3VWKB 1GGUA 1OGAA 2M8XA 4QCIB 3V0WH 4ODSL 2XTJC 3CSPA 5ESVA 5IWLA 4LPXA 1HKLH 4NNPH 3QO0A 4AT6B 5C92A 5IB4B 5I9QC 1BZ7B 4CU8A 1C1EH 2R2HB 5CILL 4CVZA 4X5XA 4NO0D 3U0WL 2X1OA 3WFCL 4V2CB 3IXAB 4TVSa 3SKOB 5ID0A 3LKNB 1PVHA 2Y06H 4KZEL 2UUDK 5DYOA 2DYPA 1OSPL 3SY0A 3V4PH 5B4MC 3BW9B 4L3CA 2PR4L 2VLRB 5FGSA 5KBNC 5IHZB 5KSAD 3VXQA 3L9RA 5KS9F 1TZIB 4G8FA 1OWRM 4XVJH 2NY6C 1MCJA 1CF8H 4X6CE 5DRXB 1M7IA 4JLRA 5JUEL 1JFQH 1XGPB 4DGYL 1NC2B 3A6BL 4MNQD 3T8XB 4DTGH 4DAGH 3CCHA 1PEZA 4C56A 1NUGA 1NC4D 2IFFH 4GAFB 5TPWL 1UADC 5IF0B 1ZTXL 4PRNA 3FRUB 1XCQA 5DJXA 3N1PC 3ZKNC 2EIBA 1GVIA 5FUOL 5I16B 2D7NA 3T2OA 1UM4L 4OF3A 4X6DF 3TNNA 3ZHKA 4UUJB 4PRIB 4NQDB 2MJWA 3CLFL 4N0CC 1YMHB 3ULUD 3SJVD 4GSDL 5E03A 1E28B 3H7BB 1BF8A 1MRDL 1NGZA 2GCYB 2QSTA 4LAQL 3OXSA 4Y2DB 4NSKB 4L3EE 4XBGB 4WFGE 1I9EA 3PXJA 4NGHL 5F89B 3NFSH 3O6ML 1BBDL 1XGYH 4C58B 1JFQL 4KTEH 4TSBH 1JPGB 2YKLL 1U8HA 1RVFL 5ID1B 1F90L 2XRAL 5FYLE 4XPAH 1ZVSA 1NGPL 5IT2L 5DD5L 2FX8H 5CJBA 1HCFX 2CRMA 3V52L 1XGQA 4HJJH 1N5YH 1CXFA 3FCTA 5IESH 5DWUL 4UIKL 4NHUA 5FFLA 4WNQA 1V7NL 3VI4F 4Z95H 1R3KA 1NCAL 1Z9SA 3RWFB 4L3CB 5BJTB 2AJXH 4GKNA 1XCTA 4MQ7B 4MZ2A 2QSCH 5T1DH 5D1ZA 1XGUB 4KKLC 3OG4B 1BIIB 3VFOB 2PW2B 5ITBH 1SBBA 2D0HA 1KTLB 1CFBA 2CLVA 5FYJD 3PJSA 4RMRA 1FGNL 4NZUH 2VDLL 5J9PA 4LIQE 4PGCA 3V52H 3ARED 3MV9A 2AVGA 3QI9D 1CCZA 4LLMA 3DX6A 3SDCD 1KXVC 1JGDA 4IEFB 2FO4A 2LQRA 3ALWA 1EV2E 5EOCL 4IOIA 3CFBB 3VFOA 3O11B 2YA0A 5ALBL 4MWFA 4EI5D 1MAMH 3U79A 4RZCB 4ZTPH 4UDUB 1EK3A 4MMZC 2Z93B 4BZ1L 1LO4H 1RFDL 5GRJL 3X17A 3RWDB 2AXJA 3AS0A 4FTVE 3OBAA 2GYSA 2Z31B 3GZKA 3PDGA 4MXVE 1XZ0A 5MEOA 1FYHB 1H5BC 32C2A 1ROWA 5CEYA 4TNVF 3RWEA 1U8NA 2YUVA