3C08H

Crystal structure the fab fragment of matuzumab/emd72000 (fab72000)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
223
structure length
217
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKASHWMHWVRQAPGQGLEWIGEFNPSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYDGRYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Matuzumab Fab Light chain
molecule tags Immune system
source organism Homo sapiens, mus musculus
publication title Matuzumab binding to EGFR prevents the conformational rearrangement required for dimerization.
pubmed doi rcsb
total genus 37
structure length 217
sequence length 223
ec nomenclature
pdb deposition date 2008-01-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3c08H01
3FZUD 1SVZA 3ZL4L 4PJ9C 4FQQA 1OTUD 2DKUA 4NM4H 3CFJA 5HDLA 4OFKA 4JPVL 1HXYB 1MAML 3W81A 3CGTA 5E1HB 5HHOE 5F9WC 5DD6B 5EBLA 5KAQF 4KUCF 1F2QA 5T1DH 3WUWA 3O81A 4YE4L 2AI0H 5GRVK 4JRYE 4IRSA 3CXDH 3TBSA 3MV8D 3V4PH 4P46A 3T4YB 5ESAB 4APQD 1KBGH 3QRGL 4LVHB 4PR5A 4UDTB 1UWGL 1FN4B 2AS5M 2Z8WC 1VFMA 4Y1AA 4GAFB 4QWWC 4D9QD 4BFEA 2R1YB 3MOQA 4KROD 3GBML 2VABB 3BZEB 3QDMB 1SJHA 2WBJD 5HPMA 1TETH 3H9SD 3X11A 1FZOB 3BO8A 3VWJA 4ZXBB 3T77B 3U4EA 2VL5A 3B8SA 2KH2B 2AEPH 5D2LE 1X5HA 4P46D 5IWLA 5BV7H 1NAML 1MPAL 1BFOB 1WZKA 1Q0XH 3WHE0 2AERT 3BT2L 2XTJD 4GAYB 2Y7QA 1ZVSA 4JPWL 4E0RB 4MDIB 3QIUC 2QSCL 4OI9A 2Y36L 3MGAA 3MGTA 2CDFA 3QUMB 3L5HA 2X4SA 4J3OC 4GG6B 4JM4L 1XGRB 4HIXH 1R5VB 3WNOA 3CXDL 3U4AA 1BLNB 4RX4A 1BEYH 3B2VL 4WNQB 1PEZA 5B38B 3IAGC 3FCTB 2J3SA 2F53E 1JNNL 3MUHL 5F9OH 1YEGH 1AGDA 4U1SB 1A6AB 4K23H 3TA3D 3LRHA 4JPVH 1CE1L 3OKDA 2I07A 4JZJB 4XP9L 1IFHH 1IC1A 4AEIH 3SDAC 2ESVD 5F9DC 3RWHA 4Y4FB 2D31B 2NY5C 4KDTC 5B39G 5E8OB 3AM8C 2X9WA 2YA0A 3UP1A 3MBEC 1CXIA 2ATPB 3PL6B 4X6CF 5B38G 3ARBC 5CD5C 5F6IB 5LAXB 3B4NA 1CDYA 1U41A 1MHEA 1CL7H 4DUXA 4IOFC 1RULL 3GJEA 4PJGA 1G7JA 1R5WB 2WWMC 4NO0D 2X5PA 15C8L 3S4SB 4LPCA 4UBDD 3GKZA 1KJ2B 2WP3O 2XA8L 4HMCA 3FOLA 3LRSA 4NKMA 2IALB 4ZUUB 4AM0A 1LO3L 1UACH 2VITA 4HIIB 3P9LB 3TT3L 5F7KC 4X8JA 5FYJH 2JJTC 2PO6A 2X4TB 1R24B 3LRGA 2XA3A 3DV4B 5I15H 4M5YL 1NKRA 5JDJA 2AJUL 5IBTL 3CVHB 4P2RD 3RVWD 3JWDL 4M1GL 4M7LL 1RK1B 1EUUA 4Y16D 4Z6AT 1PBYA 5GGUA 2FIKA 5LWYH 3NFSH 5SWZD 5EZOH 4HIIA 1FYTE 3HZVB 5C07A 4ZDHA 4IHOA 4PV9B 5IG7B 1BHGA 1D5BA 4HUMB 1UKQA 5DHYA 3ZDYF 4TOYH 3RWJA 5CJQH 2C3WA 3O11A 4POUB 4NBZB 1OM3H 1I7RB 4I3RL 3QUYD 3FO9A 3UTZA 4O4YL 4ZUTB 3HB3C 2P24B 3C6SA 1AI1H 5LGJA 4FZ8L 1OQOA 4HPOH 3QA3A 1N8ZA 2BDNH 2DQDH 2OBGA 3OTTA 4MX7A 5E8DH 4G9FB 1QKZH 1BAFH 1R3KA 2M2DA 2YN3A 1LGVA 4ZD3H 1XMWA 3UTPE 4PJ8B 5I1HH 3IU4H 3UYPA 5IKCB 1KCRL 2I27N 3EO9L 4RAHA 5D6DA 2X70A 1OT2A 4BFBD 1P1ZB 3SDDB 2BFVL 4QHMA 5HDQH 2VXUH 1D5IH 1CL7I 1CFSB 4HS6B 1P5VA 4NO5B 1JV5A 1MNUL 5HHOD 4Y4KA 3WFBL 4NRXB 4YPGB 3WKNA 3K4DA 4X5WA 3JV6B 2EIZA 1F42A 4EDXA 4Z77A 1FRGL 1U8OB 2VZVA 3V6ZB 1H15A 1MCSA 1MCKA 2Z35A 4X98B 2EIZB 1WIUA 4PJXE 3ARPA 5J3HC 1I1AB 3CFJB 3R4DA 4GT7A 3CLFH 1CZ8L 5L7XL 4EXKA 2PCPB 3JUZA 4KQ4L 5IJVB 2W0FB 3B2VH 5C0AD 2X70B 2BHYA 4MQTB 1NAMH 3OGOE 5FGBA 3UTTD 4XPBH 5E99L 1IM3B 1B2WH 1LNUB 1RIUH 3QJFA 1FVEA 1MCDA 3L6FA 4LKCA 4NZUH 1R3LA 5FM4A 5HDOA 5MHSD 4XC3H 3IAQA 1OW0C 3PWPB 2APVA 2VWEC 3PDOB 4EOWH 1TETL 2CD0A 1A9EB 1AKJB 1XF4A 1OLZA 1JHLH 3NVQA 3NAAL 4XCNB 2I25N 4YDJB 3EHBD 5JA9A 4TSAH 4YFLF 3VJ6B 1A9EA 4MLIA 2MSPA 5BO1H 5L2KB 1ND0B 1T1YB 1X5LA 4JQIH 1DBKH 1I1AA 1U3HB 5MP6L 5J7CC 2DLFH 2L4OA 1C5DA 5EBMB 4BH8A 3SQOH 3EYFB 3LQAC 1HYSC 4LP5A 5J89A 3T0WA 2C3VA 1MWAA 3UZEA 3BUYB 2X40A 1P6FA 5T1LA 1PAMA 3BPLB 3MREA 5E8PA 4NWTH 2P47B 5JHDA 4JG0H 1Z9OA 2WIMA 4IIQA 1G6RA 3BIAX 1IGYA 2YZ8A 4Z7VF 5BMFL 4ELKB 1I4FA 2AQ3A 1LQSR 5HSFA 4ELMA 5LGHH 4PY8I 2HMIC 1M7DA 4Y8DC 4HDIB 2JJWA 4MJ4A 2ED9A 1CL7L 4K3EH 3WSQH 1JV5B 1VB9A 3B9DA 5F97E 3CSYA 3PXJA 3SKJL 4OLWH 2Q86B 4BM7A 1ZLVK 5HGDA 3X3GL 4XCCL 4LEOA 4YHYB 4HIHA 3D48R 5FYKU 1U8JB 4HUXA 2ESVB 1KTDA 4KDTA 1MJUL 4IMLA 4G7YL 4QYOA 1JPGA 4LPYA 3K1KC 1Q0YL 4KJQD 3WDHA 2IH1B 3FMGH 1LK2B 1XF1A 4S11A 2J12B 4LNVA 2X6MA 1M05A 3OG4B 3KPMB 2DF3A 2WUBH 3SJVA 5K59E 4FFVC 1F3DJ 2DKSA 3ARFB 5HHMB 2ED8A 3S6CA 5LXGL 5KZCD 1EAJA 3WIFB 3LMJH 3HZKB 4ZDHB 1CT8B 3HG1A 2DQEH 4G42A 5CS7A 1G7LA 2ADJA 4HWEL 2NXZB 2NXYB 4JR9L 1TVBB 3AVEA 1TTFA 4CVXB 1CDGA 5IEHB 3TN0C 2DD8H 4QXWA 5HYJB 4J3TA 3WNMA 2EKSA 1OW0A 4PY8J 4WEUD 5I8OH 3B2UD 2Q1EA 2NTFB 3OMZA 4PJHA 3ZDZE 4EUPA 5CJQL 5TDPA 2Y36H 3GSRA 3LRSB 4NKMB 5C6TH 4LVNB 5JIHA 3TH4T 4P2RA 4OLZH 4LSRL 1S5IH 2IMNA 3N9GH 4DGVH 5F89B 5TPWL 1T0NB 5K33A 1A1OA 2F58H 4P59H 3IDUA 3MLVH 2ARWA 3W0WD 2VLKD 2D7TL 5F7LB 3MGOB 1G6VK 1F02I 1VCAA 4ZUUA 3RUGF 4AM0B 4ZFGL 4DZBB 2IPTL 4BQCA 3HR6A 3HE7B 1MIMH 5I1CH 3ELAT 4OF8A 4F80A 2AEIT 1X5XA 2WBJA 3NN8A 4D9RE 5E8NB 2NLJB 2MKLC 1CFTA 4J1UA 3LKPA 1UXSB 5DZNA 1I7TA 2NY0D 2PNDA 3MNZB 4H8WL 1HSAA 1A7PL 3ZYJA 3WFCL 4CN6A 4L5FL 1PEWA 1ZS8B 3LKSA 4WWKD 1NC4B 5KVFH 5I6XB 3CNKA 2N1KA 1SM3H 3ARDA 4CN1A 1EK3A 2FJHB 2QKIB 3QUMH 3EJJX 2FGWL 4QRUB 5JNYB 3MQIA 1QFOA 5D7KE 4ORZC 5TFSH 5E5MA 1IL1B 2LQRA 4FXGB 4YHNA 2X4RA 4D3CL 4ERSL 4F3FB 4FQHA 5JMRA 1X4ZA 5D1QD 5DRWB 2Y5TA 3MRGB 1U95A 4HC1L 5IHUH 2VDPH 4JQXA 1J1PH 4KQ4H 4YHIB 5I8KH 3V4VL 3MLUH 1HZHH 1GJIA 1S7UA 3MGTB 2ZWLT 2VLRB 4NYLA 2V7HB 2IPKB 5DXWA 5EC1B 3DOSA 2ZUXA 4JPIB 4BKLA 3QXUA 2ZCLH 3WSQL 5SX5K 2NZ9C 2V5TA 4L3EB 4JKLA 4NNXA 2DM2A 2XWJA 1SBBA 3ILPA 4RIRA 5AEAA 3RDTC 2HLAA 2UWEB 2F53B 4KKAD 4ZUSB 4I77L 1RMFH 2LABA 4HUWB 4UIMA 3VFUB 3PHSA 1CXHA 2EDOA 3MJ9H 1DUZA 3BP5B 1WWCA 2HFEB 4Y7MA 1RUPL 3SDCA 3X11B 2VAJA 3V52L 1NC4A 1TNNA 3VFOA 1MRDL 5C08E 3C6LB 4CNIA 1K8IA 4DCQB 5D70H 1QRNB 1QYGL 4GRLD 3FTGB 5FUOH 3TBWB 2GY5A 3BPOC 1TZHA 5EUOB 1GZPA 2WK2A 1OPGL 4U1NA 4NRYA 2BC4A 4HFUL 1FYHB 2ADGB 3SGDI 3DTXA 3UTOA 5A3IC 3U0PB 1NAKL 1Q9KB 3F6LA 3SO3C 4QOKE 2VB5A 1D9KD 3E6FB 3MJ7B 4C4KT 1AGFA 4X9IA 2VRAA 4JRXD 1CFNA 2Z92A 2W0KA 4NJAL 5GGTH 4JHZA 5CWSA 1PYWA 3SDXE 3QXWA 5CUSH 2XZQL 3UTPD 1P84J 4M62H 2YK1L 1QFWI 3MA7B 5A2KH 3O2WH 3UJIL 4BA8A 2MQCA 3LKQA 4L8CA 1ZK9A 2CLZB 1D6VL 4F7CA 4MA1B 2XN9E 5F3HB 3SPVA 1YN6A 1U3JA 2CLRB 4XHJC 1T5WA 5C6PB 5DMKB 5BS0A 1A4KB 3AY4C 2ZUTA 2DQGH 5GJSL 1IKNC 4YHLL 5J56B 4GSDH 3MRQA 4CADA 2PYEE 3BP4B 3DRTB 5GRVL 1JGDB 1KB9K 5SWSA 2H26A 2NXZC 1IEAB 1D9KC 5CBAB 3NMEA 1MFCL 4P5TD 3CFDB 4HKJA 4JFZL 3MRRA 5KJRH 5IMMB 5SWSB 5GSVB 2IBZY 4TUOB 2CUHA 4EDWL 2IH1A 1HXMA 5DK2B 1L6ZA 2IGFH 3KLHC 1NCDH 1FL5B 4TUKH 5JXEA 1HZHL 5L2KA 1A5FL 1L9NA 1LNUA 3L6FB 1JTPA 4B50A 2CK0H 4J6RH 1LK3H 3RTQD 3PL6C 1AKJA 5I1EL 3S37L 1BOYA 1MLCB 3GI8H 5HHOB 1JZ5A 3EYQD 3GRWH 3RZCB 2CDGB 3QPQC 4JFZH 4QT5A 4NDMA 4Z18A 5I1LA 4W81A 3SDAB 1INEL 3FT3B 2AJZB 4I18C 3W82A 3LEYH 2NW3A 4ODSL 5L6YH 4WI7A 1LO5A 2VDLL 4CU8A 4HQQH 4JGJA 3WUZA 2XQBL 2HWZH 4U1HA 3O4OC 3TBVB 1YQ2A 3Q6FB 5I1EH 4PJXB 1NCTA 3LIZL 3MLXH 5F7UA 1SHMA 5F7FA 3RWEB 5FEBA 3SKMA 3V79C 3HC0B 3QZWG 1BPVA 1G7PA 3VXQA 1VSCA 5C0AA 3GKWH 5DQ9A 3RUGE 5TFSL 1DQQA 1I75A 3GRWA 1IGIH 2P5WD 4S1DC 4PJ7B 4JRYD 2H32B 4N90D 3L9RB 3DYOA 3QIBB 5C0CD 1UQSB 3VH8B 4WU7B 1VKXA 2D03H 4D9LH 1CU4H 2D7NA 3TA3C 1ODAA 1SMAA 3RWJB 1FH5L 3G6JE 1BD2B 3ARDC 3ZDZF 5T1KA 4L9DA 5F72S 4XPHH 4WDIA 1FYTB 1Y6MR 5LGJB 5DRXB 2ZG1A 3HC4H 2BHZA 4N8VA 3HZVA 1V7NH 5I30L 4Q9RH 4YEEA 1QSFA 1S8DB 3OB0K 5C0JA 3EDKA 3KPSD 1I7RA 1QLRA 3HMXA 1KB5H 5GIRB 5B3JE 3HTLX 3QCTL 4IBLT 1EUTA 1MCPH 2NNAA 3DI3B 1BJ1H 3ARBD 4L9LA 4PY7A 1MEXL 1LE9A 2QQLL 4MHHI 4WEBH 4JN2A 1DL7L 3VXRD 3GK8H 5CHNA 4FMKA 3L95A 5JZ7C 2XN9A 5IHZB 1K4CA 3PHQB 3OZ9L 3VXSD 4S1DD 2FIKB 3GNMH 3O2WL 4PLJC 5HYSB 1NH6A 1IAIL 3MO1A 3QUXD 4NRXA 3IVKA 1CF8H 2X9YA 1T0PB 3EDDA 2E9IA 4G6JH 3C60A 2OJEA 4J23A 4YDKL 1JGEA 1CE6A 4LARH 1FDLL 4LLVA 3RWFB 4PJBB 3G04A 4PJHF 2NYYD 4P49A 1CXLA 2AJXL 1OAXH 5HYFA 4PJAE 4N5EC 5DFVD 1FNEB 3R06B 4Y5XC 4R7NA 1BD2E 4L3EA 1J87A 2IH3B 5FUOL 3F12B 3SGEH 5IJKA 1QRND 1JZ8A 3R06A 4N9GA 5AG8A 3UJTL 4IRJC 4B7IA 3LEYL 3H7LA 4N1CA 2WIIA 4RNRB 4N9GB 3T3PF 4EBQH 4FQPA 3MV9A 4K71C 2YD4A 4YDLC 1X5KA 3BX7C 3QNZB 2VISB 5JOFB 1B0GB 5FO8A 2X05A 1EZVX 3TN0B 5JOEA 1K5NA 5LQBH 2AJSH 3GBNL 1FVDA 5FCUL 3IYLW 2VL4A 3O3DB 4F57H 4JRXA 3O8XC 1QSFE 4TQEH 1TVHB 2EKJA 4Q0XL 3MV9E 1BGXH 1QSEB 5FYLE 5I9QB 3GHBH 2BNUA 3W11D 1IKFH 4U6YB 2PUQT 4GXUM 3MLTA 5GGVH 1T03L 3MA9H 2Y4SA 3AS2A 3TJEL 1JWMA 5JW3H 2GJ6D 2GT9B 2Y5TB 4GRWF 3BHBB 4J8RB 2R2EA 3VFGH 4MMZC 2ENYA 1ZHBB 4ZNEE 3TPUB 4KKAC 4P9ML 1R3HB 2Y7QB 4HWBA 5CLTA 4JFXB 3IKCB 1ZVHA 2VE6B 1NBYB 3OB8A 4N8VG 5HTSA 3I6GB 1T0NA 2VDMH 3H9SE 4L4TD 4XPAL 1K3ZA 2FO1A 1UJ3A 4Y4FA 3RGVA 1FZOA 3KPSB 4PJIE 1IQWL 1ITBB 3O6LH 5ALCH 1BFVL 2IEPA 1DQQB 1Q94A 4DUWA 2UYLA 2XT1B 3RGVC 1Z2KA 2EE2A 2BY3A 5E8NA 1HKLH 1CXEA 1UH2A 3KYMA 2ZOLA 4WNQA 4QWWD 1WAAE 4PRPE 3VWJD 4PRNB 5DJYB 1RJYA 1P2CB 2QR0A 2RFXA 4PJDE 1P7KA 5KSAC 1GGIH 1AIFB 3OWEA 1FLTX 4DQOL 1I9JH 2KUTA 2EEBA 2AJZA 5FYKL 1S7XB 1YMMD 3KYKH 3P4LA 3IFNH 2CDGA 2EIDA 2EDKA 1S5HB 3S36X 5E2UL 2HG5A 1AGEB 4TVSa 1BD2A 3DO7A 5I17A 4NC1C 4UILL 1FE8H 3U79A 2EXYC 2AXGB 4ZXBA 4E9LA 4I0PB 3SDXF 2P8PB 4LHUG 3WIHH 3QZWA 5ABDE 2EZ0D 5BS0E 2OLDA 2PTTB 1WCQA 4WHTB 3MSPA 1N3NB 2A9NH 4U05A 3U4BL 2BZDA 2L7UA 1WBXA 2MKWA 5D5MF 4PLJD 4TNWK 5IBTH 3FQNB 3QG6A 5KANG 4JO1H 4N90E 1IT9H 1YPZF 2A83B 1C5BH 3O9WB 4NN7B 2H26B 4M61B 3HFMH 1YNLH 4UIKH 5DDHB 4QNPE 1KG0B 4PFEA 3TZVA 3MROB 4M62L 2EXWD 1IBGL 3HE6D 3L5WB 2IANA 1IGCL 2Z31B 2Y9RT 4CDGC 2AV1B 3ESUF 3BESR 4DVRL 1OF2A 4L1DA 5CZXD 1F3JB 2MMXA 3WDJA 5DS8B 3FB7B 2FZ3A 1WWAX 2ESVE 2YS4A 3VFMB 4JHWH 2V7NB 1FZJB 3FQUB 4OM0H 4QHMB 4R26L 2NY5H 4Q0XH 3JBG7 3ALWA 3FB7A 4OZGE 5IFJA 4LLDA 1DVFC 1YNLL 1Y6NR 4JN1H 4UIKL 1FNHA 3I6KA 4I9WD 4TPRL 5I1JH 4ZYKB 3IDYC 2V17L 3BPNC 4ZNEA 4WUKH 5C9JB 1RUML 1M7XA 3C6SB 2ICCA 3WS6C 3EKCA 2FHCA 3JZ7A 4GS7C 5DJ6A 4HH8A 4TVPH 5C0EA 3PWVB 3I02A 5CFHA 4PGDB 1MHHA 1TVDA 1X9QA 4JPKL 4MAUH 5C71A 1T1XB 5DVMA 3ARBB 1XCTB 1H8SA 3O0RH 5IBLC 4CNIB 3JV0A 3VXSE 1JPST 1W72A 1GOFA 3MRLB 4O00A 4Y4KD 5DMKA 4M3JA 1RFDL 4X5WB 3KPSE 4PJIB 2FECL 2B1AL 1DQDL 2JIXB 2XYCA 1RUQL 2XTJC 4NGHL 4UIMB 1EVTC 1FGNH 1QLFA 5HBBA 1T7YA 3VFGL 3H3KA 3LQAH 1A7OL 5D7JA 3UBXA 3AGVA 5C0GA 1PQZA 1IM3A 3MUGA 2W9LA 4GXVH 5JR1H 4PGBA 1BFTA 3M45A 2F5BH 4F3FA 4YHNB 1BZ9A 4MX7B 5B8CB 4JO4L 5GGVL 5C0CE 3QUKB 2D7MA 5MEOA 1A6VH 1NGPH 2MCPH 3MXVL 3NFSL 2R23A 1H3XA 4HIEB 1AXTL 1RV6X 4KKNA 2NXZD 3KPRA 4PJEA 1BM3L 2ADIB 1WGOA 3W9EA 5J1AB 5DGQA 4DN3H 1OARH 5D1XB 4ZUWB 2G60H 4OGYL 5C70A 4KK5C 3IJHB 3T2PA 1DUZB 1J5OH 1N5YL 5GGSY 3I6LD 3BKMH 1U3YA 3BRGC 2D7TH 1ETZA 3Q6GL 1ZT7A 1NBYA 4OD1H 2YUXA 2P7TB 1FAIL 4NZDA 2FR4A 1CD1B 1N64L 2IADB 1N0LA 1ZHBA 4N0UA 1F4XH 1OARL 4FP8H 4OKVB 3H42L 4XXCA 5C09D 2VLLB 3SKOB 3VWKB 3EO1B 5KSBA 2MHAB 5L9DL 1XR9A 4JO3H 2VH5L 4NO0A 5E2JA 1NGYA 2VLLA 5MERB 1KIRA 1WT5C 1J0KA 3KPNA 3CDCA 3T4AB 4H0GA 5FCUH 3QXAA 3FONB 2YXFA 1CFQB 3X14A 4CW1B 3D0VB 1G7LB 5DK0B 3FRPG 3RDTB 4EUPB 1QSED 2R0KH 5C0IA 4QRTA 3SJVB 5AD0A 2D31A 5HYJA 5INDA 3H9ZA 2R15A 3QDGA 5DJZB 3W0WB 3DSFL 4XPGL 3UJJL 5TE6L 1AXSB 1Z9LA 4KK9D 3T0XA 2MQ0A 1UCBH 1WTLA 2VITB 4J3SA 3V0WL 2CRYA 5JXAH 1JPGB 4G6ML 3B5TA 3VG0L 3KPMA 1MFBL 1T7WA 2QV2A 3BJ91 3EOTH 5T3XH 4JHWL 1A22B 1U8HA 1QRNE 4WWKC 4FFZL 3AREA 2C9AA 1NLBH 3EJYC 5T5NG 5FGSA 5SX4I 3DXAD 5E00A 4HGWB 4GKZB 3VRJB 3B9EA 1HDMB 5BQ7B 1QBLL 1GPOL 4TRPL 2HFTA 2ZJSL 3K2UL 3MNWA 4WUKL 1NFDF 5KW9L 5AZEH 3OJVC 4WFGE 4BUHA 1S9YA 5CJ5A 1FZKB 1PFCA 1D9KA 4M6MH 5IEKB 4QTIH 5FYLH 3MLZL 3OXRB 1KIQB 4L8DB 4PP2B 4G7VL 3VFRB 2O61B 3UMTA 4GMTL 1G9NH 5CJXC 1SYSB 1U8KB 2JB6B 1OSZA 4ZQKA 1MEXH 3QPXH 4KUZL 1GHFH 1SQ2N 3QDJA 2UVFA 3ULVF 1HH6A 5I8CA 1K85A 3QUYA 3QPQD 3P77A 3WEXB 3IDGA 4KI5D 1K4CB 4MJ6A 4PJFF 1BOGB 4G8FA 3VE0A 4C56B 2ZJSH 3KPLB 2FLBT 1T1XA 4JEGB 5I76B 4QCIA 3NZHL 5DRZB 1QG3A 4G43B 3I84A 4JCLA 3RDTD 4P5KA 1FGVH 4P9HH 4YHKH 2OL3L 1KEGH 4CJ1A 4M5ZL 2ITDA 1QNZH 4P5TA 5D72H 1YYLH 2YD9A 3BIKB 1U91A 3GSXB 4K7PY 1P9MC 4R0LA 4G6AC 2OMBA 2QSQA 2W9DH 4HH9A 1TJHL 1IAIM 1FVEB 3WL9A 2AABL 1DQLL 5LXGH 1J88A 3TT1H 3C5ZB 1TIUA 3DMMA 4NQUA 1BIHA 4HJGA 3QAZC 4M9PA 4OLYL 4JGMA 1W72H 3GMNB 4ODVH 4CRPA 3W5MA 1CICA 3RPKA 2V7NA 2LAGB 2PCPA 3RUGB 3S35L 4PD4J 2A77H 5IMLA 1N5AA 4EUPH 4PTTB 1T1WA 3P4OB 4QRPD 3WYRA 4BFGA 1N2RB 2WINA 1ZAGA 2VQTA 5L88H 3ULUC 2YPLD 3S37X 2CIIA 3T4YA 4E41D 4Z78A 4EUPG 1UEYA 2DQIH 3TVMA 1K2DA 1ZLVH 3A6CL 4XZUB 3ZYOA 2Q76A 4WWKA 5EC2A 1DBMH 4YXKH 3MRPB 3QQ9D 2WINB 1KEGL 5C0RL 5TDOB 4GQPH 1YYLL 2GQHA 2X09A 5FGCE 3H8NA 3C6LD 5I73B 3QDJD 2LAAA 4TSCH 4Y19A 4BK4A 1E28A 4M3KB 4YDLB 4WI6A 2VDKH 3NCEB 1OT1A 1KJMA 3QFDA 3D69B 4PP1C 4CN4A 5FFLA 4LQ1A 1OAUH 3VH8G 2AEWA 2MQ3A 3TWCH 4JLRA 2WAHA 1IGTB 1F11B 1A7QH 4FQLH 2XWBB 4WW2B 4ZFOL 2PXYD 1K8DA 2YUZA 5GSVA 1G0YR 3TC9A 2X10A 1NJ9A 1FG9C 4PRBA 1WTGT 4Q9QH 3BHBA 3V0VB 3ZE2E 1M1SA 3HNVH 2J6EL 4RAUB 3BKJL 1S7SB 1P7QB 2CIKB 1GXEA 3QIBC 4X6CE 4XNXL 3JTTB 4MNGA 2WQ8A 3TJHD 2X4NA 5FGBC 1HCFX 4I0PC 2HKHL 2AJYL 2UYLB 2DI7A 1Q94B 4K3DL 2AXFB 1P69B 1U0QA 3C08L 5ESQA 1NFIA 1H9VA 4N9OB 5ESVB 3OR6B 1W2KT 1UT9A 2F5BL 4KRLB 4AQOA 3F7YB 1RHHA 2XNAA 3RGVB 1FFOA 2DMBA 5T3ZH 4JDVA 3VFPA 3SGJA 5HPOA 1IMHC 1DEDA 4ZFZA 3HLAA 4JY6A 4AYFA 5JIIA 2IG2L 5IW6A 1XGPB 5FYLD 1C12A 4PJCF 4TUJA 1AFVL 1JMXA 1S3KH 3P4NA 1OB1A 2B5IC 4X4XB 1DDHA 1U6AL 3D5OF 4NQDE 3JUYA 2O26U 5DVLA 3U30C 1FCCA 2XZZA 4NKDA 4X6EA 3QO1B 4OSUL 5I75C 1KCVH 5CSZB 4UAOC 5HYQB 4CL7A 1AE6H 4H20H 2OJZL 2QQKH 4GBXB 1FFRA 3MRMA 4QRRB 1G7MB 3H9YA 4M1CD 2BSED 2ATPA 1VGKB 1FGNL 3IDMA 1GH7A 5F88A 4UZGA 5B39A 1CGSL 1AFVH 1S3KL 2XG4A 3W0WA 5F7MC 1UKTA 1DN2A 5JQ6H 4J7RA 3RWHB 1BZ7B 1OAXL 3MRDB 5B38A 2ID5A 5IMOA 1VADA 1K4DB 4JDTH 1FGVL 5JO5B 1MFNA 1W8OA 4JE4B 5IFAL 3MRKA 1RURH 2CO6B 2F19H 4W6YB 1I3UA 2N4IA 2R69L 3S5LB 2W9DL 3LSOB 3MJ6A 3OXSA 4BSVA 1I1YB 4WENB 4TNVF 3THMH 3VXSB 3HCVB 3P9LA 1BBDH 2YD3A 2GHWB 4S2SA 5ACZB 1T0MB 4Q9BA 3D18B 3JXAA 1KXVC 1JRHL 4KKLC 4JZNB 4HKBA 1JWSA 4NNYA 5C0CB 5IW1A 4X80L 2AXJA 3ECBB 2GSIB 2NYYC 5DD0L 5KSAD 4CUCA 3RPIB 5I30H 3HMWL 4Q9RL 3BEVB 4YHPA 1ZWIB 1S7RB 1S9VA 3QFJA 5JORA 3KYNA 4OV6F 1JNJA 3AUVA 1BX2A 4NKOB 4WUUE 2FATL 3MYJA 1Q8MA 4Z9KB 3O6FB 4G8GB 1VKXB 4Y5VC 2JJVA 1X5AA 4JM2F 2A9MH 5D2LB 5FOBA 2PF6A 1A6WL 4X4MA 5HYJE 5DT1L 4N8CL 2HN7B 3O3BA 3OAUH 4DEPC 1KPVB 1I3RB 2P5WB 3O41A 4R3SA 5INCB 1V3JA 4AEEA 5HGHB 3LEXB 3VGBA 2BJML 4QHUA 3HPLB 1AO7B 4G6KL 4RAVB 3S7GA 3WHXB 4C54A 3QJHA 2VDQL 2XN9B 1XH3A 2F58L 3HI1B 4B0MM 3IXTA 4YNYB 5IWLC 1MUJA 1EV2E 4NUJA 4XCYB 3HUJF 4CVZA 1AXIB 3NPZB 4HZLA 4LASL 1FIEA 3ULUH 1NBZA 3GMOB 2NNAB 3DVFA 3BKYH 4G9DB 5DA4A 2DQJH 5JPMB 3MLWL 1ZA3A 1OY3B 4XVSH 1T3FB 4OUUA 1L9MA 3QEUA 3LEVL 3GSVB 5EU5A 4HEPG 1XGQB 2X1PA 1G1CA 5ILTL 4K3EL 2DWEA 3ARVA 5DJ2A 2FBJH 4I2XA 3W9DB 5C09E 3U36B 4XBGA 4YDVA 1LDPH 3VDCA 5TQ0H 1DVFA 4EBQL 4OZ4A 1C7TA 1LO4L 2HMID 4LCCB 3U9PL 4QHNA 3LQZB 4ONGH 2VXUL 4G8IB 4JCMA 4JZOA 5C07E 4HBCL 4QOKB 4QHLB 1NUGA 2R1YA 2UVEA 3GMMB 3OKMB 4KHTL 3CUPB 5I0DA 2DBJA 1G1YA 2OZ4L 4QRRD 1HXMB 3EO0A 3BOVA 4P2OD 3VCLB 2B20A 2M26A 4FZ8H 5E9DB 5C09A 2C4FT 2RBLA 5GZOD 4Z7NE 1IEAA 3LD8C 1WZMA 2XPGB 3TF7C 3Q1SH 2ARJA 4LF3A 4MB4A 1T4KA 4NC0B 2CKBH 5F44A 4W6XB 5C8JB 1JFQH 1SJEB 3BQUC 4JFFE 5MI0B 5CIPA 4QYOB 3RTQC 1B90A 1RD6A 4X99A 1JMZA 5IM7B 1VESA 3V5HB 3HFML 2X4OA 3MJGX 3PIQA 4LEOB 1UB6A 4N0FB 3VGFA 4NFCA 1VPOL 2AKRB 2G5BA 4ZOCA 3NCBB 1F13A 3VXNA 2EYRA 1H0DB 2HKFL 3RU8H 4R96B 5F1KC 1A6ZB 1H3GA 4K8RD 2P5EE 3U4BH 2BSTA 1F4YH 5CD5D 5HY9A 2AI0L 3CXHJ 4WWID 3NIDF 5DMJB 4FTVA 1YEDA 5JW4R 2APXA 4C4KO 1I8LA 2XZQH 3QRGH 3NCCB 4KI1A 4ODWA 5SX5H 3MRNA 1P7HL 2XV6B 3OHXA 4PRHE 4NN5C 5DA0B 3MCKB 3G6JB 5KVEL 2RGSA 1OAKL 1YY9D 1CG9B 3BN9D 3QXTA 5KSUA 4MA3A 5E2VL 3VDBA 4L4TB 3I75B 4JO4H 5A3ID 2XG5A 1JL8A 5JW4N 4LSDA 3FTGA 4MDJA 3RHWK 1JYWA 4M43L 3RX7A 2R69H 3ZE0E 3MLSL 3PQYD 1CDCA 5DJ0B 2W07A 3VU2A 3B3IB 3IAPA 1D5ZA 3M8OL 3DSNA 4PG2A 2I5YH 3CVHL 3S97C 2YHGA 1TITA 3V52H 3VRLF 2YPLA 4ALAL 1RY7B 2H6PA 2IAND 2FBJL 2P8LA 4RFNB 5D8JH 4O4YH 2Q7YA 2G75B 1KXQE 3D3VB 5I66B 3BGFB 5T5FL 2JF1A 3BD4A 1Q72H 5J57B 1J0YA 2I9LB 3EFFB 3AM8A 5ITBL 2RJMA 3DUUA 4LDEB 5DQDH 5C2BH 3N1MC 4HX1B 2RFXB 3RVXC 4LASH 3EOBB 1SJVA 4O2FA 1RIHL 4YHYC 2Y06L 3V4VH 3IGAB 1JN6A 4G3YL 5DJYA 2GSGB 5MEND 4U2ZA 2DAVA 1T66D 2R4SH 4JN2B 2XTJB 4QHUB 3KWWA 1FJ1A 3NZ8B 2Y23A 4F2MA 5DWUH 2XXMB 2E5EA 5BW7A 1ORSB 2WUCL 5CCKH 3KLHD 4MZ2A 4O02H 3GSWB 1RZFL 1JF1B 4Y4HA 3ZTNL 1SBSL 3GSUB 4DAGL 2YD8A 3WFDL 4OZIA 3KPPA 5IBUG 4K7PL 3LAFA 1YQVH 2DOCA 1GL4B 3HMXL 3QHTC 5DD1H 5KVEH 1EVUA 3VXUB 2R0WL 2V5YA 4OZIF 3MCG1 1S5IL 1QVOB 3M17A 4M7ZB 2DYPB 4MNQB 4X4YB 4R2GC 4PJCB 2V9QA 32C2B 4I5BB 1KCUH 4LAQL 1WEJL 4OFIA 1YEJL 2W0LA 4KMTL 3WFHA 3ARGA 4Z5RA 3B43A 2EXYD 3LN9A 5KSVB 4X6DA 3UTQB 1ZGLA 4GMSH 1FSKB 2W60B 3FN9A 2BNUB 3ARUA 4NN6C 1JHLL 3I3DA 3O9WC 2FECI 4NN7C 4PJ8D 3GUTB 3KXFD 4TSAL 3QG7L 3T2QA 4FQCL 1RZFH 4PRPD 4UOW0 4R8WL 4ZSOE 2Y07L 1C7SA 3BE1H 3PQYA 5BV7B 5IMOB 4AH2B 5LCVH 4ISVA 4CBPA 1LO2L 5GS2D 2ZOKB 5HD8C 4MLSA 1JTTA 1O7SA 4LKXA 4LOUC 4KTDH 4LLYA 5D1XD 1AE6L 4H20L 3ZTJG 4PGCA 1NGWB 3ROOB 4L4JA 2NY1D 1JK8B 1B3JA 1HILA 4L4TE 2EH8L 5ALCL 4AL8L 4LLMA 4E42B 5KJRL 2ERJC 4RDQG 1YEKL 4S1QH 2Z9TA 3QXDA 3VI3E 4MNGE 3HG1D 1HKLL 2I60L 4UMGA 3IJYA 3EOAA 4Q2ZB 3GMRB 4WEBL 3L5XH 3TYGH 2NY7H 5HHVH 5A2IH 5DEGA 5I18H 4OZHB 4YHLH 5D7SH 3J8F7 2XRAL 2ICEA 3CDFA 5IW6B 4KQ3L 5D71H 2V2TB 2I5YL 3BP4A 3CVHH 3BZ4B 4G8EA 3RVTC 5IB4A 2LFGA 2N7BA 5EOCH 4Z7OF 4P2CG 4AZ8A 2R1WA 4NO2A 3GB7B 1X6NA 5AAWA 3HI5H 4YH6A 4OFPA 4GW4B 1BIIA 4XCCH 4XPHL 3N1PC 1NFIB 5EU7E 1S9WA 4ZUVA 2D9CA 3EDEA 2ZCKH 3RWDB 4ELMB 5GRWA 3UPCA 4N0YL 3SDAD 1LMKA 1G7IA 4LLUA 3UBXI 4RGOL 3T0EE 1XF5B 4C55A 2CIKA 1F00I 2EDJA 1OP3H 5ICXB 5DVNA 5JW3L 4P2OA 3Q6GH 1HHIB 1UB5A 4Y2DD 2QTEA 3HI5L 2XTLA 5JIPA 3ES6A 3O3AB 3ULUD 4M1DL 4JFEA 3QRFM 1YEHL 3PWNA 4MD0A 1XCQA 3TBTA 4OF7A 2YC1A 1WZ1H 5IIEA 3A6CH 4JAMB 5J13C 1HOCB 4CGTA 5EUOA 2XKNB 4QRSB 4Y19E 4YFLI 4PJAA 2X42A 3VJ6A 3WO3B 4S0TD 2BVPB 3V4UL 2ZUUA 1CIUA 1UWGH 4XP6L 3LB6D 3CDYA 5I1IL 3VFWA 3RVVC 5DYOB 3L1OH 2VN4A 5ANMB 3VXRA 2FEEL 3WNNA 4LCCA 2J7LA 1R3LB 2NPLX 4F58H 4Z7VB 5JLZA 1MREL 1M7DB 2X1QA 4ZFGH 3L3HA 3JWDC 1LO3H 4KJWC 4NCC1 5B8CC 5DK0A 1MI5E 4ODVL 5SWQB 4NQTA 1T5XA 5KVGL 3L3GB 4OFYA 3OPZL 5D1ZD 1GRWA 4PYHA 5IVXA 3PP4H 3PV7A 2ED7A 4PTUA 4L3CA 5ID1B 1TJIL 4IRJB 4YBQC 1QUNA 2JJSC 3CSGA 4JZNA 3QIUB 5EZJA 5IB2A 1MCFA 1T22B 2DYPD 4MNQD 1M71A 4U1GC 1YPZB 3L3OB 4LCWB 4EDWH 4DVBA 5I1LB 3MV11 4I13B 1QEWA 4GW5B 1J7VR 4MJ5B 1DE4B 1YMME 4ELME 3C60D 1U8IB 2Y07H 1FDLH 3LS4L 4MJID 1UM5L 5FM5M 3ZHDA 4LLWA 1KELH 4KJYB 4LAQH 4RA0C 4GSDL 4X7FC 3BMVA 1J8HB 4M7JH 1FIGL 3QUXB 1LHZA 1XIWB 2X4PB 1ETZB 3L5JA 2YBRB 1IAOA 2BOCA 5C0NC 1J1OH 4U6TA 5ICZB 3HMWH 5F88B 1HIMH 3QFJB 3ZHKA 3CU7A 1A02N 1QSFD 3K81A 4N5ED 2MNUA 3QEQA 4XPFL 5KSBF 3VW3H 1ACYL 1KACB 3BH8A 1EPFA 4X6BB 5BXFB 1J0JA 2IQAA 4U1JA 2IBBA 3L3JA 5FA4B 5FKAA 1ZTXH 4JQVA 3GI9H 3FQXA 4XP1H 5C07B 4MCZB 5EO9A 1I3VA 3FO0L 3MOAH 3CU1A 1VEMA 3IDGB 4H26A 1E27B 3GSNA 3HPJA 4F7PB 3FT2A 4RMWA 1AQDB 4KK9C 3FRPA 1U58B 3DUSB 4QY8B 2XZCH 4NT6B 1MRFH 4S2SB 4DGVL 4J4PA 2J8HA 5TH2A 1A1NA 4FNLH 4L5FH 1NEZA 5EU6B 2Z93A 2BVOB 3D1MC 2IPUK 4D0CB 5SWZA 4M5YH 5BZDA 2DQTH 2F54E 1J1XH 4JDZA 2WP3T 5EU4A 1HHJA 1OGAB 2XRAH 3MLXL 3T0ED 2N7AA 5BW7C 1U58A 4Z7UA 1ADQL 3CK0H 4BSWB 3VA2C 5IVNA 3IU3A 1LP9A 2AK4E 3O3UN 3OR7A 5D7LA 3JV4A 3TYFA 3THML 3KGRA 5J1SC 3QP3A 5LKNA 4DAGH 5EPMB 1MHHB 5GGVY 3KS0J 4WO4A 1MCOH 4OCRL 4KMLB 5C9KA 2ZG3A 3FOMB 1MFBH 4LVNC 3U6RB 2FJGB 2NZIA 1A5FH 5L8KB 2Z91A 3DBXB 2BNQB 1RZGA 4XMLL 5I1AA 1CWVA 2R29L 2UUDK 5GGUB 5F7DA 1G7HA 3HE6A 2AEQL 2W65A 3MRBA 4KI5F 2MFNA 4KWUA 1T20B 4UT7L 3TO4D 5EPMA 2APBA 3RVUC 1ED3A 4I48A 1F90L 4PG9B 2HLAB 3QG7H 5HHXL 4XNMB 3TYFB 1BVKB 1S7QA 4LARL 1TDQA 3D2UB 1HHKA 1NGQL 1YY8B 4BKLB 3QQ3B 2PYEA 1NEZB 3VMNA 1KCVL 1GCFA 4V1DD 4ETQA 1T21A 1FL6B 3OZ9H 5BZDB 4HUVA 4KI5E 5C0FB 1RVFH 3BAEL 4P2QB 2NXYC 3QHZL 3SKOA 3VWKA 1KN4H 2EEAA 4XVTL 1N0XH 3D3VE 4TULL 3KNBA 1MCPL 3L3KA 1UYWH 1P7QA 1U8PB 2A0LD 1KB9J 2J8UF 3VD4A 5ISZB 4DKDC 2NX5A 4U1GB 2EE3A 2VDRH 3TBYB 2X2YA 4O2CB 5CJOH 5C0DB 5F70A 3O6MH 2Z31D 5BOPA 2JKXA 4Y8AA 4LSPH 4U7MA 4Z0BL 2C7UB 4LLAA 3VXPB 4LCWD 5FA3B 3OF6D 3BKML 1MRFL 3UJIH 4FQJH 3O2DH 5GRZA 4JZJA 3T8XA 4K71B 1LEGA 3UTSA 2C5DC 5KBNC 2FEEI 5KN5A 3LH2H 3ARTA 1DVFB 5EIIA 3Q5YA 4GAJH 5EFIA 3CD4A 4NQXA 1NMCB 4PRHB 4K3JL 2HG5B 2W0PA 2Q20A 4OQ1A 3PWUA 4E41A 1XCQB 1P5UA 2VXQL 3QJFB 3DX6A 5C08B 1MCRA 2R0LH 1YPZA 1GHFL 2P49B 4LCWA 2CO7B 4KPHH 4HULB 3TNMB 1DQML 1TCRA 4HCRL 3WO4B 3C9NA 4MWFA 1ORQA 3VD5A 5A1AA 1RJYB 3WIIH 1P7QD 3F58H 4EZMA 3X13B 3AC0A 4R4FH 5EA0L 4DN4H 1MHPL 3KYMB 1FFQA 5ADOH 1ZANH 1S78D 4PYGA 4HC1A 3HAEA 3I3EA 4JG1L 1UM5H 3GGWA 2CRMA 3U46B 4M03A 2XA8H 2R0ZL 43CAA 5D7IB 3T0EA 3K1DA 3VI4F 1BIIB 1BREA 2V2WB 3AROA 2J2ZA 4HF5L 1WK0A 2AABH 3SBWA 1CT8A 2ICWB 1T04B 3U30B 5GPRA 5FV1L 3ARFA 2VZOA 3MYJB 3MNWB 3ILQD 2IGFL 4I1NB 4JFDA 4LNRB 3VFNA 5J0BA 2KPNA 1LO4H 5GS0L 4RISL 4PS4L 3TNMA 4G80A 4ELMF 2A6IA 1E4WL 4R97C 2C3HA 4HKZA 25C8H 4X7SH 4OUOA 4NCDA 5JW4Q 2EO9A 1E4KA 4JFHD 3AXLB 4LSPL 1NGZA 5DUML 1XZ0B 1C08B 4WFFD 4LQFL 3MOAL 5A40E 3BN9C 3L1OL 4KKCD 2YD1A 4Z0XA 3E6HB 3HNVL 5A16B 4JFDB 3QUML 5FO9B 3I2CH 3LN5A 1IAIH 5JA8B 1U8NB 1LILA 2K1MA 3SE3A 1LEGB 3FL7A 2VQ1B 3IFOB 3KXFE 2OK0L 3PDGA 4FNLL 2ZPKH 3CH1A 2LVEA 5D7LD 3CAFA 2FZ3B 2WNGA 3UDWC 1MI5B 1Q38A 4QXTA 1WEJH 3PXHA 5EDXA 3NFNB 1FNGB 1BMGA 2C3GA 3H42H 3SDXB 2R2CA 2AV1A 4BZ1L 3S34L 3W2DL 2CRZA 3HI6H 5GSRB 2CMRL 4WTXA 4DVRH 1MH5B 2AXHA 4LSVH 4PRAB 3H2WA 5EO1B 3F7VB 1IGJA 5ECJE 2J8UB 2V2XB 1A6WH 5DF0A 3C5SA 3L3IB 3EGSB 4X6DB 3SCMC 2R56H 3CJJA 3FO1A 3G6AB 3ZDYE 4HGWA 3SN6N 2VLKB 4NO2B 3QI9B 4PJDF 4YC2C 4ZAKD 3G6DH 2ZP0T 4U1LA 1A3LH 1RIVL 3EAKA 4JGUA 1WWBX 1LK3L 4NQCB 3NTCH 4ZTOH 3O6ML 5K9KA 2AJSL 3GBNH 1QHOA 5D70L 3QIWA 3GMQA 3O6KH 4NRZB 1HHKB 2ARJQ 3ZZ1A 4U3CA 1MY5A 2AW2A 1P4LA 4JFPA 1N59B 3LHPL 1ZA6B 3DSFH 4XPGH 2VLJE 4U6HA 3PABB 2FX8H 5DC9B 2CKBB 1BM3H 3NCMA 5FO7A 3K7UA 1BQHG 3R8BB 1DLHB 4P57B 3HZMB 3RNQA 4JG1H 4PJIF 2J4WH 3FKUS 3TIDB 1AQKH 4IDJL 3IF1A 2FD6H 3TO4B 1KJ3L 3OKEB 2OJEB 1O7VA 2DQTL 1AKJD 5IFAH 2IMMA 4QKXB 2W0FA 5ETUA 1HYSD 3WJLA 3LV3A 3G5YB 2C26A 4P5MB 1WVZA 4PUBH 4NHUA 1T1ZB 3N0PB 2YD5A 3OR7B 3NACH 4RFEA 5DO2C 4GRWE 4F7EA 4CKVX 4P5MA 4Y0GA 2DBLL 4P9MH 1NDMA 4AG4L 3GO1H 4FP8L 2J88L 3MOBL 2VERN 4UTAL 4HV8A 3O8XB 1FZMA 2OTPA 5IMKA 5E56A 1IQWH 1ZGLB 4PBWD 4F7TB 3DRQB 4IJ3B 3V6FB 2FX9H 4GAYA 5D7JB 3SGDH 4GRMA 2D4FA 3SKNA 3UAJD 3TLRA 2VZTA 1CF8L 4AEHL 4A6YB 1QBML 2N56A 1OGTA 3MRHB 3SKNB 3QEGH 3IKCA 3VFTA 4OBRA 3BPOB 3PL6D 1YEHH 5C0BA 3P11H 1IEBA 5DJ0A 1D5MB 2ZUWA 3VFTB 4C59B 5DJDA 1FZMB 3K0WA 4HK3N 5DURD 1T80A 5I71B 1JF5A 2GFBB 2BRRL 4XI5D 1VFBA 3U0WL 1RJCA 2R0WH 4PJEF 3WLWD 4JKMA 4NUGL 4EI6A 4PTUB 4GFTB 2BSRB 2D7PA 5E6IC 1SY6H 1QBBA 2DIAA 4JFFA 4YR6B 4XC1H 2DMKA 1QSZA 3QCUH 4KVNH 3CFEA 2GJZA 4PJAF 2I9LA 4M6NH 4RSVA 3KHQA 4RQQA 1QP1A 3ARWA 3PP4L 2F74B 1A9BA 4YFDB 2NR6C 1LEIB 3VXNB 1UWXH 5LQBL 1I8LC 1NCWH 3MRJA 2B2XL 2X44D 5DC4B 3DUUB 5TQ0L 3A67H 4IEFB 5FK9B 3NBNA 4I77H 1LE5B 5ALBH 5CEZH 2J8UE 3L3OA 1BQLL 3MR9A 4UV4H 2CRIA 3HE6C 4JREB 1JP5A 3PJSB 3CC5B 1YEEL 3QNXA 5HYSG 4Q7DA 3KXFA 4WFED 3SCMB 1EFXD 5IB1A 3RWCB 2EDTA 1ZT1B 1WIPA 4OCXL 1KELL 3OX8B 4FFWD 4CMHB 3W11C 1NSNL 5KS9B 3HAEG 1Z5LA 1H3PL 4P4KA 1WFOA 2EDYA 1B2WL 1RIUL 5CEYA 2DJUA 5B22A 1CBVH 1WBZA 3DV6B 1QLEH 2J8UA 2V2XA 4AQ1B 1H8OA 2ADFL 5H35A 1UC6A 1B4JH 1DQDH 2PXYB 1GGBH 1VFOA 2VLMD 4OLYH 1MSPA 2PR4L 4HGKC 4LLVB 1HEZB 5D1QA 2OSLA 2D7OA 3AY4A 4KVNL 3QUYC 2ATKB 4MA3B 3BT2H 4NFDA 4D0DB 1P4BH 1A3RH 5EBWA 1NCNA 2BVPA 1YMHB 5EZLB 1JGVL 1WJ3A 4P23B 3GSNH 3GJFA 1AGEA 3DPBA 4MQ7A 2J6EA 4KKBD 1U93B 1NANI 2GK0A 2O5XH 5H94A 3VRLE 1BFVH 1CI5A 4FQXA 1XGQA 2OQJA 3RHWF 2BVQA 3L3DA 1W72L 5FO9A 4APQA 4NJ9L 3WDIA 3ARFD 4Y4HD 1KIPB 5F9WB 3L5WA 1CFVL 1MCHA 2J5LC 2OR7A 4JO1L 3B5HA 5DDHA 4V2BA 2OI9B 4ZFFB 3FQRB 1EHLH 3X3FH 4AIZB 1F2XK 3KJ6H 3FHAA 3MODL 4ZFOA 1ERNA 2XKUA 3E2HB 5IB3B 4D8PB 1A0QH 4NSKA 4OCWH 1D6EA 1T04A 1S9KC 1A6VL 1BQHA 1B0RA 4MB5A 4K7FB 4L4VA 3KLSA 1BJMA 3G5XA 4YPJA 1IGIL 4RGND 4RGOH 1PKQB 4OZFB 1A2YA 1ZLSH 2YOCA 1KEMH 2YPKB 2CGRL 3RGHA 4QRPE 2ICEB 3HAEH 1KJVA 3V8CA 3LPFA 4HLJA 1S9XA 3FJTA 1CK0H 2OI9C 1AHWA 2V5SA 5D5MB 4LFHD 4PUBL 3VXME 1EXUA 4X9FA 1VEPA 1X7QB 4BYHA 1CDJA 4LRNH 4PRPB 5KZCB 1N6VA 4M6OH 4ZFOB 4Z5RB 4H25B 1GGYA 2ZSVA 4ODSH 5L6YL 2HLFD 5AAMA 3HN3A 4LLUB 2BXYA 1JRHI 1WCBA 4Y4FD 5FGRA 3ZKXC 1QVOA 5IK3B 4J3UA 1CBVL 1NL0H 2CK2A 2VLME 2JK5B 5HHNA 4AEIL 4F58L 5FB8A 2HJKB 5FXCH 1XFPA 3G08B 3FQWB 3R8QA 4K9EL 1CTOA 3VXRE 5M94B 4WTZG 2UZIH 4XVSL 4XAKE 3WS3A 2ITCB 4EIZC 4EN3C 4GG8A 4UQ2B 3NCYS 4JY4B 2NY5L 1VACB 4R0LC 4WTWA 4NZTL 1OGAD 5EUKB 3ZT6A 4OLUH 1U8MB 3T0DA 2FYYB 3SOBH 3TBYA 3V6OA 3MBEB 4Y5YB 5FECB 2AK4A 5D7LE 3DXAA 4I3GA 1I7TB 4LMQI 5DMIH 2C4FU 5GS1B 1FP5A 5H37G 3TPUA 1V7MH 2KZ1B 2BVEA 4JQXC 4FQXC 2DQUL 1MJ7L 3BVNA 2C7UA 5EOQH 3ZKMC 2P5EB 3HZYB 4E42A 3QB7C 1CLYL 4NSKB 3O6LL 1I9IH 2NR6D 4JANA 1DBJL 2AVGA 2XY2A 5TJWK 2BVUA 3PHOA 1GAFH 5DHVB 1TLKA 3BEWB 5MEOB 3C8KA 3BN3B 2RR3A 3MV7B 5CBEB 1P4IH 4R7NB 2QQLH 1OD9A 5MEPA 3MRJB 4OD2A 4EQ3A 3KJ6L 3ALPA 4HFWA 3BQUB 5BRZA 2OMNA 1U3HD 4ZFZB 4M1GH 1CQYA 7CGTA 5F7NC 1EEYB 2Q3AA 2O5ZL 4EN3D 4YE4H 3DVIA 3F7YA 1PZUB 1AY1L 1OWWA 1ED3B 4JFDE 1FVDB 1XIWC 1ZEAL 3MV7A 5CBEA 5FKPB 4NO3B 1QPPA 4F2MB 4KTYA 3PV6A 3EJZC 4RMRA 2Q8BL 1CD9B 2VISA 4P2OC 4X4ZA 3N1QC 3N85L 3QI9D 1IKFL 3UPRA 3IGAA 5HI4D 5J06A 1DCLA 4UBDC 1ES0B 4OGXH 1NGXA 2HRPL 5HYQA 4XP4H 2AK4B 5J6GA 2C1OA 3EO9H 4QOKD 1B4RA 3O4LB 4LRNL 4XNZB 4BH7B 1FVCB 4ZD3L 3MCKA 1ZT4B 3OPZH 4S10A 1QD0A 3EUUA 3QWQB 3HR5A 4X5XB 2ENSA 2APTA 3O6FD 4G8GD 4LRIA 4RMQA 2ITCA 5I8OL 2GK2A 3TIEB 3RWCA 3GSQA 2EDLA 2H6PB 5D7SL 4OI8A 3O45A 5E94A 3CC5A 4XMLH 2F54D 2W1NA 5I1GL 4WW2C 3RZWA 3D2UD 4P46C 5FUZH 5L88L 4PJ7A 4WY7H 2UY7A 5GRUL 4IMKA 2P46B 3QFJE 4TVPD 5C0AB 2OYPA 1EO7A 4HIJA 2Q7NA 4MD5B 4OM0L 5EO9B 4FFYL 4P2QD 3FAWA 1WBYB 2FL5B 2VXQH 4MCYA 5JW5A 1R3JA 1OAYL 1NFDA 3H0TA 4MXQD 4D0BA 2Q87A 3SE8H 1UCTA 3T2OA 1WBXB 2ZCHH 1XR8B 1T89A 4PREB 2VXTH 3BRFA 5D6CB 4TTGA 4U1JB 4JVWA 3IRPX 3V5KA 5CSGA 5ETUB 5JUEH 1CICB 5DYOA 4XCYA 4Y16B 3D85A 3OJDA 4ONHB 3JWDH 3UYRH 1G9NL 1RZIA 3C2AL 1BQSA 4LSRH 4NBYB 5DK3A 2BRRH 1GVIA 2ZUQC 3QDME 5TQ2L 4OTXH 5DJ2B 2RIKA 3JWOL 5K9KB 4BZYA 3WXWH 1CICC 3L7FA 3ZSTA 4N8PA 2F5AL 1CYGA 2AQ2A 3H9HB 1G7QA 3EYUL 1G7PB 3MRIB 1MAJA 1N59A 3TP4A 2XQYK 1GSMA 3LDBB 1J8HE 2Y06H 3LQMA 4LVEA 5D93B 5ERWB 4XVJH 4P5KB 5HXMA 2AJUH 2X4QB 4OV5B 3PWPD 4ODTL 4GAGH 4XX1G 4DFHA 4CVZB 3IJSB 5DHXB 3QH3B 1KCKA 2QQKL 3DURA 3Q5TA 1A2YB 4LBEA 4HXBL 5DSCB 3BXNA 3SE8L 4LQFH 1AJ7H 4OLZL 1EMTL 2VMFA 3FT3A 1K2DB 3KLDA 4XMKL 4Y4KB 5JQ6L 3G5YA 3KAAA 1HSBB 1LO2H 4E5XA 5IK3A 3NACL 1A3QA 3EOTL 5T3XL 4JFED 4ONFH 2IQ9H 3P9MB 1RSFA 1UADC 2R29H 4YHML 4PGEA 4Y2DA 1YECL 5TF1H 5IM7A 4NZTH 5LBSL 5F6IC 1YEFL 2DL2A 1WF5A 2KQMA 3C8DA 1S7TB 3SKUD 1HDMA 5BQ7A 4Z7VE 2ICWI 4WY7L 3RUGA 1V3LA 4XCEB 4U6HB 2VZSA 1G6RL 1A7NL 1U3HC 1H5BB 1A47A 1BQHB 2HKHH 4QF1B 5CLWA 1MF2L 1W0VA 5ID0B 1HN1A 1ZLUK 1G9EA 1L0YA 3Q5OA 1FO0B 3FFCE 5HYEA 1RI8A 1IM9A 2BNRE 4LEXH 2YPKA 4V2CB 3TGXA 5HGBB 3UTSB 2AK1L 2BSSA 1OVZA 1REIA 3MPCA 2ITDB 4HUUB 4M93B 4E5XB 3QUYB 4NQDD 2YPVL 4ZTOL 3JWOH 5IVXF 2XI9A 4P2OB 1JTOA 1NEUA 3TFKD 4S1SL 5CD3B 2YRZA 2A6KA 5H2BB 3WLBB 1JHTB 4ODHH 5BO1L 2YSSA 1OAUL 3P73A 1MVUA 2EDFA 1EEZA 1V5JA 2BNQE 4UT9L 2EDNA 4XXDB 4LVOB 1JHKL 3PQYE 4UQ3A 3IXAA 2A1WH 4QEGA 3SE9H 3UC0H 2BCKB 1RUKH 1S9WB 4UB0H 3L7EB 4TSCL 5D2NE 1FHGA 4P2QA 3RVUD 2CH8A 4ACPA 2DWDB 2HT3D 4F37F 4GUPB 1Y18A 1NC4D 5DO2D 1HIML 4KAQH 2DQFA 4HLZG 3BPCA 1DLFH 1F6AA 1T83A 4BK5A 1DBAL 4JM2D 1FFNB 3IFLH 3RI5F 1V05A 5DQJA 4M48H 3D0LB 1N6QL 5ID0A 3MR9B 2P7TA 4NKIL 2XWTA 3TO2A 4GW1A 3N1FC 4YQXL 2B8OT 4EOWL 2KKQA 3PWUB 3PDOA 3RY6A 4E41B 3MLPA 1LEIA 3VXPA 3TZVD 1AP2B 3HNTL 4NQXB 3HR5B 5I8EB 1NDGB 5DJCA 2BSRA 5FK9A 1XAUA 2MOVA 4WGVB 5KN5B 3GSWA 3ZT7A 3OR6A 4O2CA 1GYAA 3ZKMD 1J9CT 4YAQB 4JFFB 2A0LC 4GKNA 3OX8A 4PLNC 3NOIA 4TYUA 3EYSH 3BKYL 4MA1C 1UZ6F 4Z7NF 2X4NB 1NFDE 1TMCB 2X89A 1R0AH 1OCWH 3VGHA 4HF5H 1OQXA 3PWJA 1AR2A 1E6OH 1AI1L 4QRPB 5KSBB 1VDGA 4OQTH 5FYJE 2FSEB 1BWWA 4JZJC 2AGJL 4JB9L 2VDOH 1MCWW 3LZFH 2ZUQB 5EULV 5DQDL 1HHGA 4Z7UF 4EVNB 2DRUA 5C2BL 1KCRH 1UJ3C 3TCLA 2VAAA 1LP9F 5J12B 4Z76A 1CLZH 1YEGL 2X1OA 3GSQB 4XVJL 2XY1A 3L7FB 3KHOA 3RU8L 1N8ZB 3QNYA 3LDBC 3GM0A 4ZAKC 4XGZB 2C1PB 2NY6B 4JM4H 5EIIB 3T09A 4HBQA 1X6LA 2NY4C 3QEHA 4UINH 5GS2H 3MV9D 3RY6C 3WXWL 3O2VL 2UZXB 4ONHA 2SEBB 3G5VA 4GAJL 2IQAB 5LGKA 3CFIC 1T7ZA 3S98A 4X5XA 3MRPA 2NY2C 1JPSH 5IV2B 2DLGA 3PGCA 2GAZB 3S34H 3W2DH 3BZFA 3DHJA 3RGVD 5J6HA 3SE4A 4GG6E 4GAGL 1N7MH 3GIVA 3NFPA 2FJGA 5IV2A 3IDNB 4NQVB 2ICES 3F5WA 3GEWB 4XBPB 3T2NL 3H0TB 3WIHA 1T7VA 2DL9A 4KVCH 4U6XB 4Y88A 1IAII 3N9GL 4H5SA 3PWJB 4LSQH 3VFVB 5GISH 5HVGB 3BW9A 4L3EE 3NFNA 1JYNA 5CSBA 4KHTH 2V9TA 2EDBA 3BPLC 3TCXA 1KGCE 1FIGH 1CGYA 3EYVA 2VZ1A 4UU9A 2GJ6A 5EU4B 3FFCB 8FABB 4HV8B 3BJLA 4FG6C 2E6JA 2FB4L 1PQZB 3MUGB 4WUUD 4LVOC 1F97A 2HVKA 4YGAB 3DYPA 1I1FA 1J8KA 3QQNA 4JJHA 4WWKB 2VZ3A 1XCTA 2YRLA 3AMKA 5I19L 3P4MB 1YNKL 3X12B 1EEQA 4GBXC 3E8UL 1EEZB 5ENWA 3SGJC 4MSWA 2F15A 4F33A 5KSAB 2J1KA 3SDXA 3TO4A 1RZGB 3DBXA 3VCLA 5C3TA 1N2RA 1HQRB 4NQCA 2YMXL 2VSDA 1VACA 5EN2B 2AEQH 1R6VA 4XRCA 5DZLA 5FKAB 1A4JB 1TFHA 2B5IB 4OLUL 4LGPB 1AR1D 4I0PD 2VDQH 3FO1B 3MBEA 1EFQA 4WO4D 3S9DB 4JM2B 5D2LF 1I8MB 1ZHKA 1AJ7L 3GMPA 1YJDL 4UQ3B 5EUKA 2ZNWA 2CLZA 4P3CH 5ITBH 3D39A 1E28B 5CP7B 4JFOB 5DTFA 4I2XB 2YC1B 5SV4A 4OKDA 4N8CH 2CPCA 3ZDXE 1W0VB 3GIZH 3S35H 4DZ8B 3MA7A 4OB5L 1P9MA 4KZEH 1OD7A 5ADPH 3CLEH 4GG6F 1QO3B 4OCNC 5F7EH 4JFFD 5EOTB 4MYWB 2O5ZH 1NBVL 4HG4K 2ZKHL 4PRNA 1OOAA 4JFQA 1TXKA 1DBAH 1SY6A 5DTFB 1J0HA 5CKGA 1TZHB 3B9KD 3FO2A 3DLQR 2VWEE 1B0WA 1J05B 4YZFE 3RP1A 4EI5A 4J4PC 5T3ZE 2GUOB 1MAKA 2P45B 4MB3A 4OJFH 1ULVA 2A6IB 1JI1A 1LP9E 1A4JA 3PWPE 4WFFE 4QTHB 2K7QA 4NNPH 3TVMC 1PLGL 3WD5H 1TPXB 3BWAB 1CD0A 4Z7VA 1KC5L 2Z4QA 3VGDA 1BVLB 2MPAL 3WS3B 3VXRB 3FB5A 1ACYH 1NAMB 2H1PH 2Z8RA 2AP2A 2H9GB 3CFBA 3K2MC 2YMXH 4M7LH 3FONA 3FB5B 1QQDB 3FQTB 3K3QA 3U46A 3QNXB 3QQ9C 2R8SL 4OGAC 3VG9C 5DD6A 5E2TL 1T83C 5EBLB 5E6IA 2XKSA 3BWAA 5ICXA 3MLYL 3CPLB 4LU5H 4GUPA 4S1RL 5F9JB 3ARGC 2BXZA 3U9PH 3PNWA 5CGMA 4JB9H 4WU5B 3TEUA 4ODHL 4KROB 5DJZA 4PP1D 3E0GA 3EDFA 4FTVE 3KPOA 5IR1B 3CFBB 2AJXH 3RAJL 3H3PL 5MENE 5DSCA 3OGCA 4HD9A 5EORL 1TJIH 3WLWC 4D3CH 4ERSH 2VXSL 4U6XA 5FYKH 3MRDA 1AO7A 5H2BA 3WLBA 5LVEA 1R3JB 2EIBA 3IDJA 3L3HB 2YEZA 3FB6A 3ULSA 5D7JD 4PJ7F 4TTDD 4NIKB 1J1PL 3MTRA 5CZXC 4K9EH 3QHFL 2IBGA 3ARYA 3MNZA 1Z9SA 3KLAA 4GKZA 5DHVH 5KS9A 1EAPB 4HJJL 3RFZC 4GMSL 3ECBA 2IFFH 4FQIH 3VXMA 5CEZD 5D6CA 1RJZA 2WLYA 1CN4A 2R2EB 1NCCH 1PG7L 5T3ZD 2QLVB 1D5IL 1MFDH 4L8BB 1BX2B 5HGAB 1CE1H 2HVKB 4XMPH 1JZ7A 1GIGH 5HI5D 1C5CL 1EHNA 2IC2A 5CEYB 3B9KA 2GJJA 3MRFA 3UCRA 2CDEA 1M7IB 3BKJH 1UXWB 4HJ0D 4D9QE 4HIXL 3V2AR 4OCSH 5HD8D 3AS0A 4I48B 2YD2A 5GISL 4BSVB 1WZ1L 1NCBL 4OFVA 4RBPK 3MMEB 4N68A 4YHZL 2H1PL 2L0DA 5IVXE 1DR9A 1CU4L 3MV8E 5FDYA 2HJLB 5GGTL 3WIHL 4ETQB 3WNKA 1QRKA 2E8YA 2NZ9D 2JIXA 5FUCC 1X3DA 2BNRB 3DV4A 1S7VB 1M4KA 3HE6B 5HYSA 2YXMA 4LRIC 1MOEA 2GIYA 4XC3L 5JOFA 1YC7A 2ORBH 3CMGA 3QXAB 4WW2F 5BZWA 1CDBA 3BP6B 3D39D 4MCZA 4MD5A 4P48A 1LD9A 2NY3D 4TNVK 3Q0HA 4QRQA 5FM5O 1OAQH 4JY5L 4UINL 3FOMA 4H5SB 2ZCKL 4XRCB 4C57C 2BNRA 2DTML 5F7DB 2B0SL 1RIHH 4JDZB 2HJLA 3O0RL 4OZHA 4HJ0C 4MD4B 3UTQA 3ULVE 4JJ5A 12E8L 1EO8H 5C6TL 1Q9LB 3I9GH 4X80H 2YZ1A 3F12A 5EOCL 3DI2B 4R7DB 2OTWB 4K2UH 3VXUA 1GOHA 1KBGL 3J7HA 4EKXA 5F93C 2VAAB 4R7DA 2E7BA 4L9LC 4NT6A 4NKQB 1RMFL 4LPTA 5GHWH 1UQSA 1A7NH 1G7HB 4WIQA 3VH8A 3VMOA 4Z7UB 4GLRI 5JR1L 3HPJB 4F7PA 3WO4C 4XI5C 3QNYB 1E0OB 2Z91B 2VABA 3PGCB 2GAZA 2BFVH 3T65B 2VXVH 5HDQL 2GJ6B 1OGAE 3OJDB 2P5EA 3HZYA 1U8QA 2WZPD 2HA1A 4N5UA 4YJZL 2HYMA 5EU6A 2O93L 1IC4L 4XP5L 2GJZB 4IIQC 1JF1A 1I8KA 2V6HA 3BWUC 3HNSL 4BSWA 5GGTA 4PGZA 4XT1C 5LCVL 3UTTB 4NO3A 1HHJB 4BZ2L 3QDHA 1JHTA 3C09C 3KS0H 3S3PA 4K94L 4F15C 3ARZA 1VFAA 1N5AB 3AU1B 1EEYA 1KXTB 3EJZD 3RNKA 4J2XA 4A2LA 1FLRH 4P57A 4GKNB 4U0RB 1S7VA 4R4NC 1RU9L 4K07A 3HI6L 1N26A 5I71C 5FECA 3MRCA 2D2OA 3T65A 3C5ZA 2A6DB 2FATH 2DI8A 2A9NL 3GHBL 3QISA 4K8RH 4NRZA 3BO8B 3VWJB 3ULVC 1KCUL 3MLZH 1DQTA 4KV5E 1FO0A 4M4RA 3EZ8A 4H1LB 4PRIA 1RZKH 1CR9L 1F6AB 3DROA 4M48L 5CUSL 4CDHA 3C8KB 1UENA 1Y0LA 2FBOJ 3ES6B 3O3AA 4ZG1A 3DXAB 3PWVA 3QHZH 3SDYH 2H2SD 4R6UA 4F15B 2LU4A 5KOVC 5GS0D 1RU9H 5IBLD 1IQDB 1BJ8A 3QR2A 3ULUE 3HA0A 5I8EA 1SEBA 1BGXL 1T5XB 5GS0H 4JG0L 4GRLC 3OGCB 2ZSWA 3CMOH 1A7OH 2Y6SC 2W91A 4GW1B 5ID1A 1ZGLP 1K6QL 4U1HB 2BCKA 1EJOH 4QXTB 1J05A 3BDXA 3CX5K 4L3ED 4LEXL 2B1HH 2GTWB 2XIDA 2G9HB 2QQNH 4APQC 2H8PB 6CGTA 2OS7A 4WU5A 4HUUA 2W59A 1P53A 4XVTH 4HGMA 3W39B 1JZ3A 4UT6L 3MXVH 5EOTA 1MI5D 2HTLD 2OK0H 1OF2B 3D3VA 3R1GH 5I66A 3UX9B 5ADOL 4ONGL 3OL2A 4HFWB 5BRZB 1PSKH 3P0VH 2YN5A 3LZFL 1UB6B 2P4AB 3PGDB 3FN3A 1TNMA 3BUTA 3ZKQD 4P9HC 5IVXB 3GNML 3FRUA 1JWUA 4IS6A 2VKXA 4X7TA 1KGCD 3LN5B 4QHKJ 4YWGL 1IRAY 1INQB 3B5GA 1CK0L 3HNSH 5GGQH 1FL5A 2HFFA 2LU3A 4AEFA 4I3SH 4JO2H 3VWKC 4P4KC 2B39A 5L2KE 3P77B 1XT5A 3QZWB 4M6OL 3WEXA 1DVFD 1YECH 5TF1L 4RCAA 4H0IA 4HWBL 3SE4C 1CG9A 4XWGH 5EN2A 5IHUL 1YN6B 4OCRH 1F4HA 4QCIB 2BDNL 5I17B 4LAJH 3HAEB 2GJ6E 1S9VB 4MQXC 3ULVL 1MFCH 2GK0B 5AZ2H 5I16A 4PJ9A 4ONOA 5HDBF 3HHRB 3TZVC 3PGDA 4OV5A 3ALXA 4PLOB 4GRWB 1D6EB 5EBWB 3F58L 1ZEAH 4RRPG 2IFGA 2H41A 4F57L 3MZGB 3TA3B 4A2MA 2VUOA 3UDWA 3WN5B 1C5BL 1WSST 1CFVH 4LLYB 1MVFA 2VR4A 3V4UH 4P23D 4ZFFA 1T0MA 2B0SH 1H3WM 5I1CL 5H35B 4ZNCD 4UU9B 1KJ2H 1I1YA 3MODH 4Z0XB 5SWSE 1T3FA 5A16A 4EIGB 3D39B 4XNUL 1HSBA 1MHEB 5GZND 4X7TB 1A8JH 4ISVB 4HAFA 3QXDB 5D1ZA 3ILQC 3O41B 4D0DA 4M6ML 3LKNB 4XCEA 3WD5L 1N64H 3W39A 3ARDB 1JI2A 5ELIA 1U8HB 1J0IA 1IGFL 5FCSH 4PV8B 2VDOL 2A1WL 4G8EB 1F4WL 2AQ1A 2IFFL 4FQIL 5CIPH 5I1AB 5KAQG 4BZ2H 1ZHKB 1QR1B 2CUIA 5K9QI 5KSAA 4QXUH 3C60C 2FLRT 2HJFB 3IDXH 4QRRA 1RZKC 3LKOA 5L8JB 3MZTA 5JIKA 5AUMB 3W0WE 5HI5C 4NQEE 5L8LB 5IESH 3HE7D 4PJ5E 4Y4HC 1LP9B 3M17B 4TSBL 4MAYD 1HINH 5KW9H 1NGWA 3ROOA 1LE9B 3Q48A 3MBXH 3SBWC 4MSWB 1DN0B 32C2A 3ARFC 2O5YL 1NFDB 4WHDA 4IDJH 3RZCC 3GSVA 5EU5B 2DLHA 2IAMB 5DUPL 4P4RA 5E1AA 5SWZB 5D93C 3GIZL 3HRZA 1JGVH 3QDJE 1XR8A 3RIFF 5FYKE 2VLJB 3DRQA 1CE6B 4G6MH 4JFHE 1GGIL 3VD3A 4DOHE 3ZKXB 2YRPA 1BECA 2CLVA 3QUZC 2HT3C 3EYSL 4UV4L 2Y25A 2R0LL 4X5LA 2H32A 2B4CL 1I8KB 4R3SB 1VFAB 2OL3H 1T2QL 4QXUL 2JCCA 1PG7W 4LSSH 1NMAL 5AWNH 5DURB 1IE5A 4U3XA 3RRQA 4NQCD 1IJ9A 3B83A 4LFHG 4IM8A 4W4OA 3V6OC 5ESAA 5DJDB 1RZJC 1OSPL 4UT9H 2C1OB 4OT1H 1TJGL 3MRNB 4Z8FH 3NGBB 1Q9OB 1AGBA 3REVB 3X12A 5FKPA 5CINH 4WCYH 3QIWD 3SCMA 2PO6C 4U7SA 2ESVA 1O5DT 2OTWA 3SHSA 4HIEA 1D5ZB 3QDGE 3U0WH 4AMKL 4P4RB 5E1AB 5E8EA 4OLXL 1XGYH 4IOIB 3IDYB 4HKXA 1BZ9B 3MRCB 5DD5H 5J6GB 1MPAH 5E8EB 3CX5J 3O4LE 2PKDA 3UBXB 3TESA 1NAKH 1YUHB 3MOBH 5CIPB 4XNZC 4IRJA 1CD8A 4IIQB 2P8LB 4Z7WE 5ESVA 1PW3A 1G84A 4TUOA 1ACZA 4P2RE 1AGBB 3MRBB 1NC2B 2FYYA 4BH7A 5HVFB 3O4LA 3I50H 5IT2H 4BH8B 2VN7A 4MAYA 3ULUL 1NDGA 5HY9B 1F11A 3EIFA 2Q7YB 4QOKA 4L8SC 4X6DE 2X4PA 4I0KA 1MHPH 2NY7L 3UZQA 1RPQA 5BZWB 3QEHB 4HBCH 4NQEA 3BEWA 3OHXB 1NKOA 4KJPD 2E3VA 2Q86A 1MCJA 3MMEA 5E95B 1AP2A 4L8BA 2AGJH 4BELD 1V8HA 4QXGH 1DTUA 1HH9B 4KI5C 5DD3L 4HH9B 5DQ9B 4IS6B 5C8JA 5JXED 4RGNB 1MJ8L 3MXWH 3T3PE 2HVJB 1AGCB 1UXWA 2CDEB 3BKCH 3WJJC 4NGHH 4P2YA 1MI5A 1RIVH 5HGDB 4PRPA 3ZKNC 1WFNA 1YC8A 4K3JH 4APQB 5JZ7D 5DRZA 2A6JB 3KPRE 4PJEE 5IVZA 5C7XL 3MJ8A 3PIQB 1MHCA 2FSEA 1KG0A 4M00A 4FQXB 3F7RA 5CJBA 5LG1A 1E4KC 3O6KL 4J6RL 4PJ9B 5E7BA 1N4XH 4GOSA 2PTUA 5E8DL 3WFZA 5HHQB 3TA3A 3MJ9A 3ZYIA 5HVHB 3EGSA 5BV7L 3ARGD 4B41A 5D5MA 3RIAK 5FM8A 1L4IA 4I3RH 3VFOB 3SDDA 1F3DH 2NMSA 3PGFH 4NQCE 1ZLWK 2QADB 1EJ6A 4K7FA 2HAZA 3ZMRA 4I0PA 1KJVB 1OAZL 1TTGA 2CXGA 2D0FA 3IDJB 2J6EH 3KPOB 3E3QC 4Y4KC 5F6HJ 4B53A 5IR1A 2PTTA 1S5HA 3B9VA 2XZAH 1MJJB 4R4BB 5EZOL 4HMDA 3CH1B 3MUY1 4ZS6C 5D1XC 1C08A 3INUH 3LKNA 3LIZH 4P3WA 2MCPL 2VO5A 1G7QB 1FBIL 5HGBA 4NYLB 1AXTH 1VA9A 4U1IA 3QFDB 3HI1A 4HKBB 4AEHH 2Y1VA 3QWOB 2ZG2A 2DQEL 4M7ZC 3L3DB 4D9RD 1NLBL 1L7TL 1WCBB 2I24N 3RI5K 1BVZA 3C5ZC 4OZFH 4U1IB 1VGEH 5IG7A 1ZV5A 4IHOB 4IRZL 4LHUA 5DJXB 2WSKA 4IDLA 1RUKL 2RQ8A 4MXQC 3OKLA 3RVXD 4F7MB 1IBGH 3G6JF 1GPOH 4TRPH 2NY4D 3G6AA 4HXAL 1YEIH 4U7KA 4MQXD 4G43A 5EOQL 3D3VD 5BCAA 5IB3A 4DZ8A 2Y72A 3BKCL 5C0DA 1QFUL 4XP5H 4L1HA 3P9MA 4PS4H 1F4AA 4MJ6B 3FQRA 1A3RL 3V7MA 5IB5B 1MFAH 3U7YL 4FQ2H 2YWZA 4JPKH 4PJ8A 1HQ4A 4YPGA 1IQDA 4HXBH 3IS1X 4URTB 2B7DT 5IMLB 1MIEL 5KSVA 1S7RA 1X5JA 4RMVA 1CFSA 2AJ3A 3IJYB 3MLYH 4LMQE 4ZTPL 1VFBB 1Q72L 1U95B 5IGXL 4GQ9L 2EC8A 4N0UE 5GZNC 1OTSC 4LLMB 1T21B 5DRWA 5DLML 3QWRD 1HQRA 3TPKA 2WBJC 3KYOB 2B2XH 2DS4A 4R9HA 3E1F1 5FHBH 3GJFH 1EA9C 5ENWB 3BEVA 1HINL 1KTRL 2R4RL 3PUCA 4LCUB 1R0AL 2DLTA 2QSCH 1L6XA 1UM6L 2E9JA 3L3KB 2VXSH 4X9BA 2BVYA 3DROB 3NTCL 5E8OA 1KLUA 3UYRL 4K9EC 1QSEA 3RVVD 5E9DD 4G6KH 1EHAA 2AEPL 1TQCB 5IF0B 3GMPB 2XZCL 3OKDB 1U92A 3C60B 4XBEH 2R56L 5I74C 4K7PH 1CDHA 4P5TC 4NP4H 5CP7A 2ZOKA 1JHKH 4NOFA 5E08H 4F7EB 3WJJA 1NCUA 5CZVL 2YUVA 5KVDL 3NA9H 2ZSWB 2IALA 3K80A 2R23B 4L8SB 4XNUH 4KJQC 2YD7A 2MHAA 1U8QB 4KUZH 4S1SH 1XEDA 4R90H 3UTTA 5IB4B 5CSZA 3QUMA 3HG1E 3BGMB 1G9MC 2NW2B 4WUUB 5M95B 2MPAH 4KRPB 2WWKT 3S36H 1GAFL 1G7MA 1OSPH 4X4XA 4F9PA 4RDQF 3FOLB 4JLRB 3WFEH 1OGTB 3MRHA 4NJ9H 1MRCL 1ZT1A 4GXVL 5C08A 3T1WA 5I74B 5E6ZA 5J1TC 3DNKA 1HH9A 1KJ3H 3VI4E 4FXKB 4XVUC 1X5GA 2QBWA 3BDYH 2XN9D 5ICYB 5BVPL 1YNTB 4Z0BH 1LE5A 3WN5C 3MFGB 3MLVL 4X9HA 3G9AB 5T3XE 4GBXA 5GGRY 3B9KC 2VDNH 4ELKA 1EGJH 1PGRB 3H3PH 1HHGB 4MAYB 4UTAH 3VG0H 3WE6B 2XNAB 5DVKA 2VTFA 4PRBB 5EORH 4ENEC 3RWIA 3PV6B 1IEBB 1BF8A 3PG2A 5ADPL 1H5BC 3H7BA 3MO1B 3FFDA 4HPYH 1S7WB 4KK8C 4L8SA 1HHHA 3RKDC 1CGTA 3CIQA 4HWEH 3S96A 3GSOA 3HLAB 4JY6B 4MJIE 3BSZL 1R3IH 4HUXB 2BERA 1EEUA 4XVUD 1U8IA 3T3ME 1MRCH 2BRQA 4RFNC 1HCVA 2IAMA 4TVPL 2DYPA 4MNQA 5DFWH 2RAMA 1QEWB 4HWUA 3U7YH 1CS6A 3DUSA 4CVXA 5IEHA 2VLJA 2C1PA 4OZGA 3O9WD 4PJ8C 3VDAA 3NCJH 1DJSA 1E27A 3GSNB 2ZNXA 1IAOB 4EVNA 1G6RB 3BH9B 3GSOB 1IKNA 4Z76B 1AHWB 3U83A 3HC0A 1M6OA 1M7IA 4LLWB 3FFDB 3KLAB 2HJFA 4WFHD 1C16A 1IC7H 2QSVA 4JPWH 3N85H 1ZHNA 3OAUL 4F8QA 1DE4A 3ARRA 1IGJB 1IT9L 4LDLB 1Z3GH 5A2JH 3WE6A 3DX9A 5EUOF 5FAAA 3QPXL 3SO3B 1AHWC 5BVPH 2CIIB 4EJ1C 2GKIA 3QI9A 1T22A 2YPVH 1N4XL 4N0CC 4ODXB 1KT2B 3VGGA 1WAAA 1NBVH 1UH3A 1CZ8H 1DZBA 1HQ4B 5L7XH 5D7JC 4RGNE 4O2FB 2DM3A 4XBGB 4YDVB 1JNLH 5IROA 2EYSA 1C8PA 4DKAA 1R5IB 4G5ZH 1AC0A 4PV8A 3AS1A 4FZEH 3V5DA 1U2CA 3S35X 2OX5A 5F21B 2EDHA 4F9LA 2KDGA 3BIKA 2XQBH 3NA9L 5I75B 3C2SA 1A1NB 5CILH 1E6OL 1NBZB 1T66C 3OKLB 4F7MA 1DBJH 4M6AA 3CZFA 1U36A 3IU4L 1JNNH 4EI5C 3LPWA 5EH1A 5I8KL 4PRDA 4CVWA 4POYA 2VJXA 4NOBA 3QWOA 5AG9A 1GZPB 4P23C 5HGHA 3DYMA 3RKPA 4QTHA 2EH7L 2PXYC 3H9SB 3IXAB 2VLKE 4OZFA 2EDRA 4Y1AE 1DFBH 4MVBC 1KYOK 3KJ4C 4UV7H 4HWNA 1KIQA 3U1SL 2PN5A 3DMMB 4NQSA 4WGWB 4YK4B 4KU1A 5CILL 4HXAH 3BZ4A 2PYFA 4OGXL 4U0QB 3CLFL 3R1GL 2ICWJ 5IHLB 1Y6KR 4XXDA 4DW2L 3U82B 3MV7E 1FL3B 1I3GH 2XWJB 3CVIH 3EOAB 2KBGA 2VDML 3WNPA 3HKFA 3QFJD 4TVPE 5JQHC 2FH8A 1GGUA 4U31A 5EUOE 2FB4H 3FQWA 2XWTB 4PJGF 3H9SA 3TO2B 3KNBB 2VLRA 3TH3T 1KLGB 1CCZA 1SYSA 3QCVL 5EZIH 1HILB 5EB9A 2EYTA 3EDJA 1HOCA 2X1XR 2G5BB 1UKSA 4W68A 3VMPA 4LHUD 2R1WB 1DEEB 1JPTL 2EE6A 3BPCB 5K9QG 3BYTA 4GBXD 1I7ZA 4GH7B 3RJDA 4NRYB 2R9HD 2VZUA 5IHBA 1ZA3B 2GTWA 1DBKL 1A14H 1QO3A 1EXUB 3HMXH 3D2UA 3OAZK 2K7PA 1AGFB 3ORJA 5JUEL 5C0IB 3SDYL 5D7IE 2H2PC 3Q2CA 2DJSA 1WISA 5E9DE 5SWQA 4TTDC 3QDGB 1WQVT 4YR6A 4XX1E 2NY2B 1L0QA 2HLFC 2PXYA 1L0XA 3GMLB 4ZUSA 3QNZA 2EDEA 5J3HD 3MX0A 4L4VD 2JCCE 3FFCD 4GMTH 3MBED 3QUZD 2Y5EA 5D7IA 3T0EB 1A7QL 3L5XL 3TYGL 2ADIA 3D9AH 3W9EB 3MACL 4PJAB 4G7VH 5ACMA 3UTSE 4OLEA 3B6SB 3DUHA 5EIVA 2WUBL 3IB4A 5EFIB 2IADA 1J0ZA 4M02A 2R9HC 2HT4C 4DZBA 1JWUB 2OJZH 3X14B 2CDFB 1JFQL 1FNFA 1XGPA 3KR3L 3STBA 4X8XA 3GDBA 2F53D 5JMOC 2GT9A 1OWRM 5EU7C 4DK3A 4QRTB 4OZGB 4Q9CA 5D7KD 1DBBL 5E4IA 2OTUA 4K8RC 3QIBD 2EKSB 1A6AA 2H8PA 3NIFF 4QRPA 1YEFH 4NQVA 4I3SL 1CGXA 2F74A 1RHFA 1PX4A 1SJXA 1KT2A 1IC5L 4OZHF 4R2GD 4HAGA 2M8XA 2DICA 3HG1B 3BW9B 2FJHA 4Y16C 3O45B 1ZT7B 5E94B 5B4MC 1HHHB 5D1QB 5C86A 4PG2C 4RAUA 4X0KB 1BZ7A 4UDUB 4YAQA 4K23L 3T04D 2HT4D 4MCYB 5JW5B 4Y4HB 1YEEH 1F58L 1K8DB 2Z8SA 1ORSA 4XGZA 4XP6H 5ICYA 1DDHB 3QQ4A 2MWCA 4XTRC 1PDKA 2YPLE 5ISZD 4OFDA 2YBRA 4NZRL 1FJ1B 4KK6C 3V7AG 3H9HA 3MRIA 4Y5XB 2IAMC 3BD3A 3AB0C 2BY2A 3I6KB 4RA3A 1U8JA 3A6BL 1JK8A 1JN6B 4Y4FC 5MP6H 4Z8FL 4WFHE 1KC5H 5DD1L 1QBAA 2D03L 4D9LL 5I15L 5HDBE 4OGZA 4PLKC 2BY1A 1JCKA 5CJ8A 1FNEA 1C12B 1EJOL 4Z7OE 1F58H 1MY7A 4WO4B 1M71B 4X6FA 5F3BB 1FNSH 3I02B 4XAWL 4NFBA 5DGRA 3DX8B 5HHPA 2PYED 3BP6A 1KIUA 4EEEA 2L7JA 3TO4C 2GY7B 3ARBA 3Q1SL 3BH8B 5BXFA 4PY7B 3A0OA 5GSRA 3QG6B 2WWMD 2W60A 5E0QA 4PB0L 1E4XI 4K55A 5T1KD 4M7JL 3IDIB 3B2UC 4NDMB 5DWUL 4N1HB 1MWAH 2X89D 4V1DB 3SY0A 1WUNT 2J5LB 3NABL 2VIRA 1INEH 3DO3A 1II4E 2P8PA 2QJDA 4LPXA 1QBLH 4AT6B 2NXYD 5EU6E 3SDDD 4ZTPH 5C0BD