1AP2B

Single chain fv of c219
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
b'EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTTVTVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MONOCLONAL ANTIBODY C219
publication title A single chain Fv fragment of P-glycoprotein-specific monoclonal antibody C219. Design, expression, and crystal structure at 2.4 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 26
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ap2B00
1TJIL 3AM8A 1AGEB 1CDUA 3GIZL 3RAJH 1D6VH 2MQ0A 1V3JA 3U82B 1XF5A 4WUKH 2WMPA 2HLFD 4UT9L 4ETQA 3UTZA 5KSAD 3B9EA 1WZ1L 4YO0B 5DTFA 4JZNB 4NRYA 3UTTE 1AO7A 3BP5A 1VGEL 2A0LD 5J89A 3DVNB 4P3DA 1M7DB 3ROOA 1JZ5A 4CN1A 4RGOH 5EC2A 4E5XB 3G5ZB 4FMFA 4QF1B 3GSUB 4LNRB 4P2OC 5C3TA 2AJVL 1AHWA 3MXVH 5BRZB 5HGBA 3CFDA 2AV7B 1OF2A 4O51A 5CEZH 1OTSC 5HGDA 2EZ0D 1SJXA 4F57H 5F6HJ 4I77H 4MVBD 3F12B 3VXTB 3BISA 1C5DA 4JFDD 3T1FB 2DQHH 5DFWH 4BQ6A 1CFQA 2OJEA 3IDGA 1I1AA 4M43H 3EDKA 5JOFB 4MB3A 3LEYH 4G8FB 4RZCA 2HAZA 3LKSB 1E4XL 3DUUA 3S9DB 4PGDA 1HNGA 4OT1H 4M7KL 2Z8VC 5FV1L 3TZVC 1CDYA 4UINL 3HC4H 2H2SC 2ZNXA 3PV6A 3B9KA 5ACZB 5CEYA 2H26A 4GUPA 2Y36H 5DC9B 5HVGB 3MBEC 5GGRA 4L4TE 3C60D 3S4SG 2GT9A 4CNIA 2N7BA 2DBLL 5TDPA 4XB7A 2RHEA 3O3AB 3JV6B 5SV3A 1SEBA 1ZLWH 2LV4A 3QH3A 4YC2C 1CI5A 5IB5A 2HFEA 3CXHJ 4LSVL 3HLAA 2D31A 4OD2B 5E8PA 3HPLB 1UVQA 3RX7A 3UBXI 5FM8A 5ADOL 3O4LA 4M03A 4MMXC 1F6LL 5ELIA 3P11H 5KTEH 4M7JH 1PSKL 4RQQA 4GW5B 1NANI 1LILA 3P73B 3FONA 2AGJL 2HFFB 2G9HA 3AS0A 4RIRB 1FL3A 5IF0B 5HVHC 2FR4B 1YMMA 4N0FA 1I7TB 4UTBL 3L7FA 4AIZB 5MEOA 3MRFB 2J1KA 4I5BB 5GRXG 3VXRA 3SKMA 1ORSA 1TQBC 5IBUG 2MQCA 1TVDA 1BLNA 1QBMH 5D9SA 3G5VB 3ESVF 5KZCB 4RDQG 1ZGLP 4JM4H 4G6ML 1RD6A 1CDIA 1FRGH 2R4RL 3D2UD 12E8L 4DZBA 3THMH 1KT2A 3UBXG 4MJID 2PR4H 3VD5A 4YEEA 1XFPA 5A2KH 1A6UL 3U9UA 2A6JA 1PLGH 2A6DB 1YQVL 1IGFH 1BAFH 4JPWL 4Q58C 2XN9B 3RGHA 1OAQL 5MP6H 1MIEL 1VFBB 1U8LA 1CFNA 1V3MA 3TVMD 1LO3H 2NLJA 3KPMB 3KYNB 1J88A 4NQSA 5J1TC 1E27A 4BSWB 2H3NB 2EDQA 2IAMC 5CD5C 2DM7A 4D0DA 3ZKXB 2F53A 3LDBC 1CE1H 2UUDK 1OP3H 1CLZH 3VA6A 3DTXB 4JY5H 5E2JA 1MCLA 3EO0B 3BDYL 3UTSA 5I76B 4HS3A 5IVZB 3DROA 3VFVA 1UQSB 2IGFL 3L3KB 2V5TA 5D7IB 3QP3A 5EIIB 2CRMA 1V7NL 4Y4KC 1CL7H 1DBAH 4P2YA 4UILL 2Q76A 3IXAB 2BSRA 4F7EB 3MBXH 2RCSH 3SGDH 2KPNA 4HKXA 4LGPB 4DK6A 4G9FE 1K9TA 1ZHNA 1NJ9A 4O00A 1MRFL 2W9EH 4P4RA 1IGIL 1JPGA 2DJ4A 1UWGH 3NFSH 3SCMA 1JZ2A 4JKMA 2Y7QB 3O2WL 5INDA 3C9NB 2NX5B 2E6PA 1ZHBA 4ZMAT 1ZHLB 3HUJA 1GPOH 1NFDF 3WJJA 4MA8L 1AIFB 3I84A 3TBSB 1GHFL 2QKIB 2DQJH 5I66A 4LHUG 4ONHA 4L9LA 4JM2D 1YECL 1KN2L 5CBEB 4BFBD 5EU3A 1CU4H 5I1LA 4YHZH 3ZE1F 4M4RA 4WDIA 1TJGH 1XR9B 3T2OA 2X70A 2NY2C 5E8OA 1XGYL 3TIDA 5TQ2H 2R2HA 1KLUB 1WCBB 3BZ4A 1IZJA 4XAWH 5JW4M 1FV1A 3QA3A 5I1KH 3G6JB 4G5ZL 1IM9D 3UDWA 4LRIA 3BGAA 2FEDD 5ACLA 3T2NH 4OSUL 2E8YA 4QHNB 3JXAA 1FNEB 4KJWD 5T1DH 5IMKB 2N56A 1S9WB 5BO1H 2DQCH 4QRRB 1R3KB 4P2OA 5C0BD 3PWVB 4AZ8A 1ZLSL 4NRZB 4BUGA 1M1SA 2DQGH 4M6NL 3MJ7A 4UB0L 4APQB 5C8JB 1ZT7A 1KFAH 4GAGL 4PG2A 2VWEC 3AREA 1OP5K 2ADJA 2PYED 4OCYL 2HJFA 4JG0L 4PV9B 5E8NB 3QDMB 2X9XA 3G6DH 3SKOB 3NIFF 1A6TB 3G08A 3ELAT 1U8QB 3WXWL 3GRWH 1EFXB 5GRYA 4MXWH 3BZDA 4HIEB 2ARJQ 5K9QI 1UWEH 3C5SB 4HUXA 3QR2A 1N6QL 4NC1E 4XBEH 3SE8L 2H2PC 3GSQA 5TDNA 1S78D 4LRNH 1S7XB 3HFML 3T4YB 5JOPD 1QFWH 1S7SA 3E8UL 4YDLC 4OZFA 1JNLH 3KLAB 4W6XB 3RZWA 4NO0A 4OFYA 4Z7NE 1R3IL 1LNUB 3O4OC 5DQ9B 3JWOH 5GSRA 2SEBA 1ACYH 1HCFX 1R0AL 2XWTB 1MCEA 1NGZB 4DJMA 2ZCKL 4PJ7B 2BXYA 1G7MB 2EEDA 2HH0L 3OWEA 3LEVH 3SPVA 4FNLL 5K9QG 1E28B 3BZEA 3UYPA 4KC3B 5IQ7H 4JGJA 4RISH 1F8TL 3GHBH 4GS7B 4S1RL 4DZ8A 4C4KT 5LXGL 2AERT 4PTUB 3ZSSA 4D8PA 3MGTB 5JMRA 3L5WB 3ULUL 3O11A 1IGMH 3HE7C 1ZLVK 2AK4B 2QQLL 1QA9B 4L4VA 3QPQC 3S5LB 2IF7A 5I18H 1JWMB 2W65A 3H3PH 1WICA 2Y6SD 5ICYA 1BZQK 1DQLL 1HYRC 2UWEE 3VXPA 2FB4H 3ARFA 3W0WE 2ESVB 3RGVA 1U3HB 1EUTA 4CMHC 4IDLA 5FGSA 1F3DH 1ZOXA 4K8RH 2DI8A 4O9HL 4KRNA 2OX5A 4P3WA 4LLUA 5E8DL 1VERA 1G9NH 1PY9A 2DWEA 1BQHB 4R4BB 3GMLB 3RIFF 3QDGA 1HHHB 3SE3C 4HUNB 4TNVK 1H3XA 4WO4A 3U48A 2PO6D 3D39D 1LO5A 3DYMA 1D9KB 4WEBL 2B20A 2A6KA 3C5ZC 5CJXC 4QHKI 5TH2A 2NY0B 3JV4B 3EGSB 4XPBL 5ISZA 1TENA 4X5XB 2IADB 3BPLB 4KRPB 3LRSB 4DKDC 1WQVT 4D9LL 1J05A 2H1PL 1BJMA 2FX9H 3SGEI 4Z95L 1EO5A 3GSRA 4F8TA 2AXFB 5C9KA 3CSBA 3LH2H 4HMDA 1XGUB 1C08B 3DMMC 5F7EL 3N50A 4RBPK 5JA9A 4CW1B 3BDBA 4KTEH 3DV4A 5AEAA 1ADQH 4LF3B 2W59A 1E4WL 2ZCHH 1M4KA 2EH7H 2NZIA 2P24B 1YDPB 1A1NA 5KN5B 3I6LE 1MQKL 3WEXB 1HHKA 4LSSH 1BFTA 1J1PH 1J8HE 1KB5L 1T5XA 2BSTA 4JQVA 4HSQA 5D72H 1ZT4B 5D2NA 4O5LH 5FYKL 5ESQB 5EZLB 2MJWA 4GRLD 3EYQC 5HHPB 1EO8L 2XZCH 3VDBA 1MF2L 2PYFB 3VMNA 1JNNH 1JVKA 4WUUB 4Y7MA 1RZIB 5I8EB 1II4E 4PTTA 3LMJH 2PKDA 2N1KA 5DLML 5IBLD 3P9LA 2EDTA 4PJGA 1SY6L 5D1XB 3PP4L 1J0JA 4OLYL 3ET9F 2DF3A 4PUBL 1TITA 2HLAB 3LN9A 4Y5XC 1PYWA 3DXAB 2ADGA 3WIIH 5FO9B 2GW5A 2KH2B 2KUTA 1CLYL 4R90L 3FT3A 3TESA 4F3FB 4LCCB 5F89B 4M3JA 4NO5A 3ZE2E 2NR6C 5DRWB 5IQ9A 1AGCA 1EPFA 4LGSB 2OSLB 2WINA 3TBYA 2EO1A 4JFXB 4ZO8A 2MTPA 5GRVL 3O4LE 5E08L 1CICB 4G43A 3ZLQC 4I0PD 3OJDA 2IWGA 2BOBB 3QCUH 1CFVH 2AAVA 4JHAL 1IQWL 3L3IA 2NY4C 1I7ZA 1LDPL 3NABL 3FCTB 3WIFB 2VDKH 3VW3L 1OAUL 2AJUH 2X4NA 2HTKC 5EO1A 2CDFB 1EV2E 4TQEH 4NRXA 2VKXA 4XVSL 3VFRB 1N5YH 4ZSOA 1D6EA 3UC0H 3WKMH 1E4KC 1N7ML 2HMID 1BF2A 3EO1A 4P59L 4DKAA 1QRNE 4CU6A 3T77B 5GIRB 3VGGA 4XHQA 3IDNB 4PJEB 5BRZD 3Q1SH 3Q5YA 1VGKB 2W0FA 5EC1B 3TH3T 1HHJB 3U0PA 3IVKB 2AEQH 3LKQA 4OQ1A 1EGJA 3LD8C 4G8IB 1IL1A 5LWYL 4N9OB 4U3HA 5AD0B 1IAII 5DRZA 2F53E 4UTAH 4M8QB 3UTTB 3EYUL 5I75B 2RAMA 3MRNA 4GXUM 4JHBA 3UTSE 2OQJB 5H37G 3UZVB 3JVGA 3CXHK 1K8DB 2E6JA 3OJMB 1IQDA 1EHLL 1WGOA 5SX4I 4TPRL 4BFIA 4LCYB 2JTDA 4ZFZB 3MRMB 3HG1A 5GS1C 1TZIA 1NMAL 1KPUB 4O58L 4JAMB 4WFHE 1ZE3C 1CLOL 1XH3B 1P1ZB 3ARZA 1SYVB 1T7ZA 3VU2A 3WD5L 3MUGA 3FHQA 3E6HB 2ATPB 4KQ4H 2DQIH 3HUJE 5F3BB 2VDQH 2JK5A 3MPCA 2ZKHL 4J3OC 1QQDA 5GGTL 4HUWA 3MLSH 4TYUA 3X13B 1U8NA 4ETYA 5F88B 4LLDB 3O41A 4Q0XL 2R1YB 1YEIL 2LABA 2LVEA 1P2CB 4KKCC 3BE1H 5HPMA 3T09A 2R0LL 5F9WB 1DQQA 5MEQB 4KZEL 3SE3A 5E94B 2X2YA 1HIML 3BPNB 1J5OH 4PLNC 4L4TB 4U1MA 2DTML 5EN2B 4QLRA 4Z7WA 3QUML 5KZCD 4X0KB 4Z7UB 4Y16D 4OQTA 4HD9A 2Z93A 5HHNB 2Y4SA 3VXNA 3EO9L 1FGVH 5DJAA 3GBMH 4IEFB 3QNYB 5KAQG 1PW3A 4ZUTB 4UOW0 1UH2A 4RWYH 1AKJB 1P4BL 3MXWL 3A6OA 2XN9D 4CU8A 5L8JB 4S1SL 3VRJA 1MHPH 3MODL 4HMEA 4R7NB 1OGAA 5HHOE 3CVIL 1Z9LA 5JNYA 2DLIA 3B3IB 3QO0A 1U3YA 2VDRH 4PGEB 1WSST 1T5WB 4GRWE 4MDJB 4J6RH 3Q6GH 2FD6H 5BMFH 3B2VH 5L2KA 5EOTA 1R3JA 3LV3B 4LSRH 3RVXC 4H20L 1FO0L 3IAQA 4WJ5A 1A2YB 2DQTH 1A3LL 3U4AA 2A9NL 2H6PB 1YC8A 2AP2A 2A73A 3P0YL 1FZJB 4UU9B 4QHUA 2CKBA 2R29H 4NQEE 4S1QL 4HFWA 5F6HI 1BWWA 2K7QA 1YY8B 3RHWF 3LQAL 1GC1L 2FX8H 5GGUA 2NW2B 5IMOA 3EYVB 3BQUC 4JPVH 1UACH 2XRAL 2EYRB 1HILB 3SJVA 4KMLB 4ODSL 5J57B 3O45A 4LQ1A 1YEHL 1KULA 1TXKA 3FQRB 3K74B 4LLAA 4AEHL 2NX5D 3DV6B 3D25B 3RVTC 3I50H 1KIQB 4NT6B 4TUKL 2J6EL 1MFCL 2KQNA 1L7TH 4LLWA 3MNVB 4MA1C 4K71B 3FO9B 4PYHA 2QHLA 1EJOH 1MREL 4BFEA 4QRQA 5DK0B 1RZ7L 1YNLL 1F97A 1S7UA 2NZ9D 3N1MC 1JNHB 1P7HL 4LSDA 4BQBA 1XGPB 4EQ3A 1RAMA 3OTTA 4NO2B 5D96B 4G9FB 3PHSA 4NYLB 2AQ3A 3EJZD 3C2AL 1FPTL 1Z3GH 2CH8A 4MNHA 2X4PB 3S3SA 4L4VE 2B1HH 5DVOA 1ZVSB 4BZ2H 3CSYB 1A9EB 3IKCB 3HCVB 4KI5D 2VTFA 1KPVB 1NUGA 2BOCA 2Y5TA 3H9HB 5IB2B 1UEMA 5J9PA 4UT6H 1A6AB 3QIWA 4OGYL 1VEOA 4QRRD 5DJ8A 2A9ML 1WWBX 2QHRH 4NWTL 4HCRL 5DD6B 1GZPA 5ICZA 2XZQH 2YZ1A 4GAYA 1Y6MR 4NZRL 1ED3B 3WIHL 4APQD 1LE9A 1JI2A 2XFXA 4JFPB 3A6BL 4NDMB 1ES0B 5IESL 3ARXA 1J18A 1MH5B 5FK9A 5HJ3A 4XP9H 1G7JA 3FO0H 5L8LB 3H6JA 4OCXL 1QYGL 4JFFA 4HFUL 2QQKH 1Q9OB 3QDMD 5HYSA 4DW2H 2DS4A 3BP7A 5SWZE 2HFGL 1S3KL 1NCTA 4EDWH 3DX6A 5ISZE 3ZTJG 2X44D 3FQTB 1S8DB 1EFXD 4PJHF 4ZDHB 5C2BH 1MHEB 1JHTB 5CFHA 5HSFA 3WNKA 1ZA6B 3IFPA 3FFCA 5T33L 4LLQA 3AXLB 4C58B 3S98A 2BSSA 5FB8B 3GSVA 1AP2B 3G5XB 3QIBB 5ILTL 3AC0A 5E9DE 1BD2A 4PJCF 1A02N 2IH1B 4XXCA 2I5YH 3D3VE 3NOIA 1I1FA 4QOKE 2CUIA 3TBTB 4A6YB 1OW0A 5IVXA 4E0RA 5JQ6H 2FZ3B 1OLLA 5GJSH 2CRIA 1EAPA 3EYSL 3HRZB 1W72L 3RVVC 4RWHA 3TH2T 3RWEA 4GJTB 3I3BA 4X6BB 1U95B 1IC7H 1DFBH 1R24A 1RK1B 1XZ0B 4NNXA 4OUUB 4CN4A 1BHGA 1YZZA 1IMHC 1H15A 4TTGA 3PL6B 2K3TA 4RRPA 1EEYB 5JW5B 1FL6B 4PP1C 4KTYA 3OL2A 4M1DL 2BX5A 1FYTA 1BIIA 32C2A 1QR1A 1VACB 2IBBA 4N8VB 4Q6IC 5MHSD 4H5SB 5LBSH 4PJGE 4TRPL 3X11B 2E7BA 4I9WE 2ESVD 3MOAL 4WV1C 4ZS7L 4L8DB 4GKSB 3CNKA 5CCKH 5FA4B 1PG7H 5DQJB 4I18A 5HYJA 2R1WA 1XF3A 3ARBC 4WFGD 5L6YH 3UO1L 5FYKU 4XHJD 4EBQH 3TYGH 4OIAA 5IW3A 1XGQB 2EICA 4HZLB 5JR1L 3WJLC 1RZJC 4TVSa 3V4VH 2WSKA 1D9KD 3PABB 5LGHH 5IIEB 2H32B 3HAEA 1JPFA 2YA2A 4OLVL 2NY0D 4QRUB 2V2TB 3C6SA 2UWEB 5C0FA 4KRPD 2V5YA 3ZYJA 1IGCH 4NQVA 2R56H 5DVMA 4G8GB 3HS0A 3WUZA 4Z9KB 4ZSOE 3ILPB 1NEZA 4JKWA 1N6VA 5ID0B 3NIFE 5DSCA 3BQUA 3RL1A 1AGDB 3IDUA 4ZPTB 4RGMC 5TE7L 4EXKA 3ZDYF 4Z7OF 5CBAA 4XCFH 1EVUA 3UZQA 4O2CA 4L8BB 4MXQC 4R6UA 1I7UA 5EUOA 5F1OB 4DKEH 2AJXL 4X6CF 5CUSL 4JFZH 1FNSH 1XF5B 2XPGA 1P7KA 5MEPB 3P2TA 3DOSA 2Z0BA 5C6TH 4FZEH 4UOJA 5DTFB 1A9BB 3RY6C 2Y72A 4HWZB 4GSDL 1H3PL 2PTVA 3BP5B 1WBXA 3RWDA 2VB5A 4OD1L 4P3DB 5DYOA 2YS4A 4Z6AT 3DVIA 3MJ8B 1DQJA 5JPMA 4U3XA 4WUUD 2JF1A 3ULUF 4QTHB 1U3ZA 3JTSA 3NA4A 4P46C 1YY9D 5HGBB 3CFDB 1KTDA 2UZIL 4PRHA 4XI5C 4XWGH 5D1XD 3HG1E 4LASH 1VADA 2VIRA 1NLBL 3EDEA 2GK0B 4O51B 1NLDH 3ULUC 3LQZA 1V3LA 1UKTA 1F11B 4HAGA 1MIMH 3WNOA 1U6AH 3DXAD 4NN6C 5C0AB 3JTTA 1C5DB 1J8HB 1R3LA 4K3EL 5K9JH 4MA3A 4NM8H 3O6KL 3VFGH 2BERA 1X5KA 1ZXQA 1JGUH 1I8LA 1K3IA 3CFCH 3SGJC 1CICD 4PGDB 1CD1A 1BBJA 3P3YA 2EIBA 5JW4Q 3QWOB 2O5XH 4PGBB 1YEEL 1WBYA 3TNNB 1HK6A 2O5YL 1EFQA 4X7TA 3KXFE 1NMCC 3PV6B 3B9KB 1N3NA 3B83A 4F7MA 2BRRL 5F6IC 1ZTXH 3F62A 5GGRB 4LP4A 1KXVC 2YSSA 2GT9B 4CNIB 2DL2A 5TDPB 1QSVA 4K9EL 4Z7WE 3QFDA 3GK8H 5IEKA 3S5LG 2EDYA 4J4PD 5IMMB 1ZGLM 3SO3B 4BJLA 4QEGA 2HFEB 3EOAA 1MLCA 5BVPH 1IAKA 2D31B 4O02H 3FMGH 3AVEA 1CR9H 3PNWA 3C2SA 1UVQB 4K3DH 5CD3A 3QIUA 2W60A 1X5AA 2BNQA 2J4WH 3GGWA 2HWZL 4U7SA 5AAMA 4RQQB 2BFVL 2DYPB 4B50A 3VXQA 5DD5H 3QYCA 1U8OB 2NY3C 4HH9A 3KPSA 3ARDB 3QXAA 3SDXA 1MAMH 2VZ1A 3TA3A 2V7HA 3L3HA 2IALA 3DGGA 4N0FB 4ZYKA 4HAFA 4Y2DC 2Q8AL 1H3VA 3K1DA 4XX1G 5I1EL 4ZS6D 1U8PA 3QUYC 1ORSB 3MRRA 3UTTD 2R2BA 5E6ID 2CGRL 3T04D 5D9SB 4LKCA 4LKXA 2BVQB 3MROA 3HZVA 2E9JA 4YDJA 3IFLL 3ARGB 1LEGA 5L2JB 4DZBB 2JJSA 1QRNB 5I71C 1HYSC 1T7WA 2VZVA 3NIGF 4GBXA 4LIQL 4V1DE 4KI1A 2A1WL 3QDHA 3RVWD 1JRHL 2B8OT 2A6JB 2ARWA 2VITB 3S37X 4IDJL 1MFDH 1I3VA 4RDQF 3HNVH 3AS3A 1N4XL 3SJVE 4XPHH 1U8LB 5FUCE 4JFYA 1IILE 3EOTH 4TVPH 4M9OA 3HZYB 1CGWA 1E27B 3H42H 5IHZA 3RL2A 4NNPL 4D0DB 1G7PA 1WLHA 3FN0L 4ZFGH 3UTSB 1MCFA 4HS3B 5CZKA 5GHWL 1FNAA 1AJ7L 3OG6B 4PJFA 2CIIB 25C8L 2CMRH 5IW1A 5KVEL 4ALAL 4Y8AA 1NUDA 3FB7B 3OKNA 3QG6B 4OM1L 1GIGH 3V6FA 1A7NL 3QNXA 1EXUB 5FUZH 2PXYA 3IDMB 3BXNA 2F5BL 3UJTH 2HRLA 3SCMB 3QUZC 4JB9L 1CE6B 1FVEA 1UH4A 5FOBB 3A6CH 5D1QB 1FAKT 2HLFC 2OZ4A 4DN3L 5KANG 1MFAH 4M5ZL 4OCWL 1JPSH 3HI1A 1BOYA 3SDDA 2UYLA 1RIVL 5E7FA 5I66B 4ONHB 1AKJD 1TETH 5F7LB 2OJZH 4NC0B 3VFSA 4WW2B 1YPZB 2R9HD 1CXKA 1YNTA 3RA7H 2VABB 4NKQB 1Z9MA 1E4JA 4WDIB 4XNYL 2X70B 5E8OB 4ZUSB 5F7NC 3SGKC 1E6OH 2G60L 1DBKL 1S7TB 2EZ0C 1RIHL 3BN3B 1T1XA 5DWUH 2MCG1 3OF6D 4MVBC 3T65A 4JFFE 5EWIL 3IFNH 4F33A 5L88L 1X5YA 5DI8A 4PRIA 1I7RB 1MCKA 2YK1L 1FFRA 1GZQA 2NTFA 4L5FL 2EH8L 4KJYB 1XGTA 4JRXB 2GCYA 1NDMB 1ND0A 1CGSL 5I2IB 4GLRI 3HC3L 4U6TA 5ADPL 1UJTA 1QVOA 1DCLA 4I2XA 4N5ED 4K23H 1CK0H 2VYRE 1I8MA 4P2OB 2OL3L 4LNVA 1J8KA 4U49A 3VXME 5HHOB 4NFDA 1IBGL 1UCBH 5FO7A 3UJJL 4HKJA 4OD3H 3EJYD 3CDGB 4HC1A 3MYZA 3MRJA 3HR6A 5IOPB 3C60C 3VRLF 4GRWB 4U6HA 2QV2A 4X7SH 1NGXB 5CS7A 3AREB 5HGAB 2AJ3A 4K7PX 5FHBL 4XH2A 2ADJB 4FOMA 4KH2A 5HYIA 3NCJL 1QSFD 2ZG1A 2XY1A 1NL0H 4Y5YC 4NQEB 2WIIA 3KJ6H 4Y4FA 3BAEH 3EYOA 1MJUL 2Q8BH 2F58H 5T3ZE 3G08B 3ZTNL 1NMBH 1GRWA 4XPAL 2YPVH 3TZVB 1LO0L 4X8JB 4IMLB 3QT2A 4B5EA 2HN7A 5MERA 4P4KD 4S11A 4U1LA 3RI5F 3MRKA 4G9FD 4HUXB 3WHE1 5CIPA 4KUCD 1HH9A 4RX4D 1RMFH 3MBEB 4LL9A 3IGAA 4GMSL 3GSQB 4LCIL 4NZUL 4IHOB 1FYTE 5JZ7C 5IMLA 4OZFB 5HYFA 1RZGB 3G9AB 5JW3H 1CDBA 5KSVA 1K8IB 2JELH 3CC5B 4ZXBC 5KVFL 1NCNA 2QQNH 2HKFH 5GSRB 2SEBB 3DECA 3ULSB 4FQ2H 3A0OA 1NAML 1UYWL 4OF5A 5C2UB 5TQ0H 4X6DA 2FX7H 3ARPA 4NZTH 5GJTL 3UEZA 4HS8L 3FO1A 4IRZH 1WUNT 3MGOB 5IB3A 1H9VA 3BZFA 1ZVHA 1JCKA 3MV8A 5JLZB 1XIWA 2D03L 4NUGL 5CINH 2VLRE 3UYOD 1A14L 4K3JH 1ACZA 1I9RH 5HVHB 4HBCH 4WHYG 2FHFA 3TVMC 1U58B 1MJ7L 5HHXH 4GMTH 15C8H 1X5LA 4L4VB 4ZG1A 4PJDF 2V5RA 3WNLA 1NGWA 3BO8A 4WI9A 4ZAKA 5DMKA 3DRTB 4FABH 1MAKA 2YPLA 4TUJA 1ZS8B 2WUCL 1GGBL 1HH6B 1KF9B 4JFOA 4FQJL 5AG9A 2ATKB 3JWNC 3LQAC 1GC1C 4LBEB 1G6RH 3QIBD 4HGWB 3K4ZA 3TO4D 5L9DH 1OPGL 4PLKC 1WWAX 3WSQH 3CPLA 5JDSA 3UYRL 4MD0A 4DAGH 3ZO0A 3ZE0F 1VDGA 1RHHB 5B3NA 3GO1L 5CJQL 3G04A 5DHYA 3LDBB 5JHDA 5KJRH 4Z7VA 5EUOE 2A6KB 3U4EA 5SWZB 3TYFA 4X9FA 4JM2F 5CSZA 3DWTA 3PP3K 4QRTA 2E7MA 3OGCB 4Y4KB 5I1DB 3RIAK 4MX7A 4JM2C 2IFFL 3UJIL 2X1PA 3PL6D 4H1LH 1J05B 4M5YL 5IJVA 4J3XA 1A6VH 3GSRB 3FQWA 1I1YA 5E9DB 4UBDC 4U6XB 3QUZA 2VLKA 5D70H 3DV4B 4AJ0A 2EXWD 3MJGX 3MLZH 5DD1H 2OR9H 3D3VB 1G6RB 3DX8A 4QOKB 2DJUA 4AYFA 1G84A 1L4IA 2P47B 4D94A 1JHLL 2AEWA 4ODHL 5IWLC 4HXBH 1DL7H 1A1NB 3EJJX 2FEDC 2UY6A 1HHKB 4J3WA 4PJ5A 4U1SA 4XZUA 3U0TA 3V5HB 3VGAC 5GRZA 4JQXC 2PNDA 4GFTB 4HH8A 4LDLB 5HGHA 4C56A 2XQBH 4KJWC 4M6OH 3MOBL 2IANA 4PREA 4FFVD 4JJHA 1EA9C 3P0VL 4HW6A 4OV5A 3MLVL 2EDHA 4JG1L 4WI4A 2YZ8A 1QKZH 2VXSH 5GZND 4MA7H 5TE6H 1SJHA 2NY2B 5C0RH 2Q20A 1Q94A 3TWCL 2DRUA 3VDCA 2AEPL 3KJ4C 3MLUH 4PRNB 5HPOA 1AXIB 3P9LB 4MSWB 4YBQD 4OCSL 5GISL 2UVEA 4LARH 4EN3A 3ARUA 3W0WD 2FNBA 5DJ0B 4JANB 2HVKA 1MVUA 4X6EA 3GSNL 1C5BL 3KPOA 4MYWB 4ZNEE 4YDKL 4ZOCA 2J8UF 1LMKA 1CVSC 2BVYA 5EZIL 4NO5B 1JV5A 1AGCB 2DM3A 1XF2B 2WINB 3TBYB 3ETBF 4IOFD 3V7AE 3IDIA 3EFDL 2H8PA 2D4FA 5E2UH 2VQUA 5L0QC 3NFNA 3BPOC 2YWZA 4XC3H 5E1AB 3SDXE 3CH1A 1I7ZB 4KU1A 4FXKB 5EPMA 5EBWB 3S96B 5DZLA 2PETA 5D6CA 2CDEA 4MZ3A 2X4NB 3CFEB 5EO1B 1A6ZA 4CUCA 2GEEA 2YD7A 4NRXB 3GKWL 2C3XA 1D6EB 4OZIF 2X1QA 3V6ZB 4JKKA 5IR1A 4HUMB 5C08A 3EO1B 3H9ZA 3VFOB 2C3VA 3RWGB 3GI9H 1FZOA 3U7WH 1FBIL 4H88H 3VCLA 2M2DA 5FF6A 2W0FB 4R3SA 1D5IH 2ICCA 2ZJSL 5DD3L 1T83A 5ETUA 4Y5VC 2P8PA 3DO3A 2VQ1A 5DEGA 3U0PB 2EDJA 3LKQB 4O2FA 3ZDXF 3UMTA 4YDLB 2YMXL 4EUPA 3I6LD 5T1KA 4ZXBA 3WUWG 1MCWM 1IGJB 1J8HD 2Y6SC 3O4OB 1PGRB 1TQCC 1KIRA 3L3GB 3OAZK 4P23C 4BH8B 3HN3A 4XCCH 3K8MA 1NBVH 3QHZL 2GY7B 4WEMB 2JKXA 4OZGA 3WFHA 2P4AB 4PG9A 5EOCH 1NPUA 4HIIA 5FO8B 2EIZA 4PJFE 1IQDB 1TTFA 4UV4L 2H9GA 4FP8L 4HX1A 1R6VA 1JP5A 1SBSL 1T04B 2Y07H 3VJ6B 3LN5B 4LPCA 2AVGA 3TPKA 3B9KD 3NCBB 1U36A 3TO2A 5DQDH 4GW4B 4L9DA 3HG1B 3HE7B 4HQQL 1TZIB 2PO6C 1BX2B 5A40E 2C1OB 4XCNA 1NCCL 1F3DJ 2A38A 4PJDA 3GI8H 3MUGB 5F1NB 5D93B 4R0LC 1JTPA 4IMKA 3U1SH 3FB8B 1RVFH 4Z8FL 1IGYA 1QQDB 4HWBA 1NUFA 5CJOL 4YDVA 3NH7L 3GMOA 2ERJC 3O4LD 1B4RA 5IFAH 4FHBD 3O41B 4JPKL 2VDLH 2XA8L 4TNVF 2FIKA 4U7MA 3FRPA 3PXJA 5HPMB 1Y18B 5C07A 4WI2A 3JUZA 1KTLA 3KXFB 3MA9L 4G6AC 5GS2D 5DUMH 1Q9KA 3QDJA 1FIGH 3MJ9L 1ZLUH 4HK0B 2GJ6B 1LO4H 4MD4B 3C5ZB 5KS9A 4ELMA 4Z7WB 3D0VB 5EU7C 4LU5L 4ONFL 4X80H 3VFWA 1HCVA 1KJMB 3OKEB 3ARGD 2OBGA 2H45A 4RFOL 4BK4A 1NC4B 1OSPL 1D5XB 3V0WL 4ORGA 4R97B 4RSVA 4MJ2A 3X12B 5EOQL 1VEMA 2HT2D 2QTEA 5I9QC 4I2XE 4F37F 4U0RC 4LCWA 3VRJB 2R4SL 5TE4H 4Z78B 2Z31A 5DK2A 3AAZA 3ULUE 4OKVB 5KAQF 3QO0B 1G7LA 5CMAB 1WAAF 1JYNA 1I9EA 2KZWA 2F53D 1N59B 3NAAL 1A7OL 4NHUA 4HPYL 3GSXB 4JDZA 3ZL4L 3UTSD 4WCYL 3LB6D 1OARH 3BH8A 1IKFL 3P9MA 1KCUL 5HYQA 2GTWA 1SVZA 3LZFH 4HFWB 3KYOA 1BVLA 5I1HH 4V1DB 4NN7C 1KJ2H 5CAYB 2JB5L 2VXVH 5J1AA 2F19H 5IMOB 2UVFA 1J0IA 5FGRA 4KV5F 2IH3B 5CILH 5JO5A 4I0PC 3TT3L 4HLZH 1P7QB 4UNTA 4U6YA 4WFHD 5DF0A 1MI5A 2D7NA 2Q86B 2QEJA 3SCMD 3O45B 3W9EB 3QWRA 5D1QD 3DO7B 1I1RA 1MCPL 3FQXA 5ESVB 1WIOA 1RFDH 3WYRA 5I15H 2CUHA 5LGJA 4OCMC 4Y5XB 5K93A 3VD9A 5CSBA 4K9EC 3OR7A 3EKCA 4ZFFB 2JJTA 5SWSA 3TPUA 3H7BA 4QRQB 1K6QL 4NO3B 5JHLL 4X6DE 2EE2A 5HI3D 3U46A 3EIFA 3WS3A 4HG4J 1KNOA 3MV8E 3PWUA 4XP4L 1H8OA 4Z5RB 1FL5A 4I0CC 1KJ2B 4MB5A 5TPWL 1NBYA 5J0BA 1KJVB 3V4PL 5I1GH 3M45A 1EMTL 4MQSB 4P9HC 4XPFL 4R96B 5TF1H 5ITFA 4YIQA 5E6YA 3V9FA 1HINH 3O0RH 2Y5TB 2F5AL 2YPLE 5CZVH 4WFED 1K5NA 5DJ8B 3ZSTA 3VXUA 3BYTA 2EEAA 2VXTL 1I9JH 1OAZL 1A7QL 2B4CL 3DUHA 4P2OD 4X7CC 4EXPX 5GXBB 4N0YH 5ICZB 3HE6A 3NIGE 1L7IL 5HHOD 4LP5A 4GAYB 4TOYH 2ICWA 1J9CT 5EORL 5IFJB 1G7HB 4HXAH 1A3RL 1YEKL 2MKLC 1ZLWK 1HHIA 4WHTA 4XNXH 3M1BB 4PRBA 3N9GH 3ARED 1AC0A 5FGCE 5FK9B 5HJ3B 4DKFL 4MWFA 5DEFA 5IB4B 1MHHA 1KSRA 4UDTA 1OM3H 43CAA 4JFFB 4FQ1H 5AUMB 3ARWA 5JHDE 2RJMA 3OX8B 4Z7VE 1JGVH 1Q72H 4NQED 2QSCL 2KBGA 3O2DA 3IDJA 2DKUA 1R5IA 5DC4B 1OAKL 3DX6B 5A2LH 1TJIH 1OGTB 3TZVD 2I60L 3GIZH 4OI8A 1I4FA 4HJ0C 4JZJC 1F3RB 2BVPA 2H2SD 3IFPB 3CXDL 5D8JL 1X4ZA 3Q5TA 5IROA 4YR6A 4G3YL 3T0WA 4I1NB 4UT9H 1A3QA 5IM7B 4U2YA 3VXMB 3GSVB 4N68A 1MJJA 5GS1B 2F8VA 5FV2A 1LE5B 5KSBF 3BRDA 1WZ1H 3GMQB 4FZ8L 1MRCL 1I1CA 2MOVA 1VGEH 3IRPX 1B88A 1I1FB 5ERWB 4NO0D 4OFYD 1U2CA 3L3DA 2WBJA 1MFEL 4Y16C 5D7JA 1G7QA 4EI5C 2XXMB 5D71L 3TBWA 4J3UA 1NDGB 2F54A 3L95A 2YD3A 2AJVH 5BVJB 4QXTA 3T3ME 5EBLB 1F4YL 5FM5O 4C56E 1FAIL 1R24B 3U6RA 1ETZA 2XQYK 1DDHB 5CJ8A 1DQML 3SE9L 3NFPA 4R2GC 1O7SA 5IUSA 1OP3K 1GGIL 1U8HA 4XVTL 5IG7A 1YEFL 5GZOD 4L4VD 32C2B 1QR1B 3ZKXC 5DRXA 3IJYB 1BECA 3WS6C 1E4XH 4IRJC 1HXMA 1QNZL 1V5JA 4M7KH 2XTJD 2CLZA 2LAAA 4UINH 4BSJA 1YUHA 1EZVY 2B2XL 1JWSA 3ARFD 2AK1L 3RGVD 1CFTB 3BP6A 3BW9A 1JBJA 1FZMA 4GAJL 4OF3A 4JDVA 1BGXL 3GMNA 4X6FA 2FL5A 2DBLH 1EVTC 2R1WB 3FHAA 2VLRB 3MLRL 2X7LA 1YA5A 2FO1A 3LKOB 3O9WC 3RWFA 3KPLB 1MCDA 2FECI 1DLHB 4A6YL 4H8WC 4LSVH 1CT8B 3F58L 2IMMA 2XIDA 3HAEB 1JPFB 4E42B 5DRNB 5C9JB 4BQ8A 3GB7B 5ADOH 1H3UA 5DMYA 5ISZD 3C6SB 5C0FB 4ZTOL 1PSKH 3U7AA 1QBAA 4NQVB 3ZHLA 4HBQA 2J3SA 2AGJH 3HS0B 5GGRY 4Q9CA 3Q6FA 3F7QA 5DSCB 3BQUB 4UTBH 5C08E 3RL1B 5E9DD 1QFUL 3LRHA 2K9UA 3PJSA 3BI9X 3GSOB 3QZWA 2Q7NA 3D3VD 5E24E 2A74A 3EJZC 4G6MH 4QOKD 4X5LA 3T8XA 2Z8RA 5CP3A 2R4RH 4O2CB 4G9DA 12E8H 4JJ5B 3H9YA 1FQ9C 4KI5F 2IG2L 2FGZA 1NGYA 4MA1B 5CLTA 4O2EA 1A6UH 4KI5C 1NC2A 5ALCL 3PV7A 1YQVH 3LS5H 4JPWH 4OI7A 5D4QA 5JXEA 4JPIA 1OAQH 2AKRB 3F7PC 1MIEH 1GGYA 4OZGE 1WBXB 3RWDB 2JIXA 4HUVA 1QUNA 5ENWB 4JHWL 1BFVL 1BQUA 1DQJB 4MD5A 4MJ6A 4OGXL 4ZUVB 3BDYH 3MYJB 2IGFH 4DGYL 4OTXL 1V7NH 1RUQL 1VADB 1UEYA 4XPGH 3LQZB 4I9WD 2YC1A 4KDVA 3L7EB 4MCYB 4UILH 1DLFL 4PJDE 1LHZA 1N5AA 4OZFG 5DJXA 1R3LB 4MA3B 4CADA 3U36B 1VFUA 1KBGL 1MRFH 4Y4HA 1U91A 1IGIH 5F7WC 1CDCA 1KXTB 3KPNA 1H3GA 1CD1B 1NKOA 1P4LB 1WBYB 5SX5H 3ABZA 2W9LA 4MA8H 1T21A 3GJEB 4KTDL 1GHFH 4BELD 4F7MB 1N3NB 5JTWA 5B38A 5GGSA 2E7HA 2YSSB 4HIJA 4IOIA 2HKHL 1YECH 3ZE0E 2YD9A 1KN2H 1HEZB 5GS0D 4FFZL 4OLUL 5KS9E 4YFEA 5LCVL 5MENA 2BVUA 1CL7I 3DETD 1TVHB 4ZUUB 1XGYH 3CSGA 2ICES 3VXSA 1N2RA 3PWNA 3PNWB 4WNQA 4DVBB 1IT9L 1JN6A 2W60B 3GGWB 2XQYG 4ZO6A 4G5ZH 3VXQB 4D0BB 5F7DA 4OUOA 3STLB 4HH9B 4LCWE 5KSBA 3QXAB 3D85A 2NNAA 2DLFL 4OSUH 3TA3B 5ALBL 3L3HB 4JZOA 4HWUA 3DGGB 2D0HA 4K3GA 4RGNE 1BVZA 3L5IA 3NBNA 3TF7C 3GMRA 3D69B 3MRGA 1KELL 1ZLSH 4GKNB 3V0VB 4M6NH 3HZVB 2X89A 1YYML 4UB0H 3ZKMD 3MUJA 4YDJB 1CDJA 4PY7B 4GAGH 5K9KB 4GBXB 1PG7W 4P2QA 1KB9J 4OCYH 2V2WA 4JG0H 3UP1A 2QLVB 3HG1D 5IVOA 4LLVA 5IV2B 3QPQD 3WS6A 4Q6IB 1DBBL 1MI5E 4L3EA 3MFGB 2Y23A 4IRJA 2FDBP 4BYHA 2PF6A 3WXWH 1RUAL 5AZEL 4N8CL 5IHZB 4KVNL 4KDTC 1NH6A 4KRPC 3KPRA 1G7PB 1N6QH 2VLJA 2PCPB 3SE8H 4QWWC 5TDOA 3C5JB 1P6AB 3PWLA 4PJFB 4MAUL 4NPYA 3HFMH 5JW4R 5SWSE 4QXUL 2MMXA 1EEQA 1MUJA 2J8UE 3E8UH 3O9WA 3BSZL 4XXDA 3OKNB 1FNGB 1R3IH 1B0GB 4UDUA 3V6FB 1MQ8A 1R0AH 2CIKA 2PXYB 3C5ZD 3SDAA 3BXNB 2VUYA 2ZCKH 2DDQH 1FVEB 2HH0H 4FNLH 1PG7X 3LPFA 4WGWB 3VD3A 3PWPE 1F8TH 1DUYA 1OAXL 4LPXA 4S1RH 5T3XD 3CMOL 3W82A 5LXGH 1MHCB 5DJCA 3O6FA 5K9OA 1SEQL 3CJJA 2PTTB 1T3FA 2QQLH 4NQXA 3WXVL 1YNTB 4XPTL 5F70A 3S8WA 1GGCL 1DQLH 3MRCB 1YY9C 1QFWI 2FJGA 2FIRT 5D1XC 5DHVA 5D2LF 4XMPL 4OFDA 5I19L 3RX8A 2XOTA 5BQ7B 1T1XB 1W0WB 3DX9B 4X6CB 1P84J 4HT1H 3DGCR 3T65B 5B39B 1EZVX 4WU5A 3MLTA 3BDXA 4WU7B 5E8DH 4OGZA 2ZOKA 3RTQC 4MJ5B 4V1DD 1WJ3A 1GZQB 1XT5A 2NTFB 1HQ4B 4UV7H 2GCYB 4DN4L 1ND0B 3LCYA 4KHTL 3P30H 3MRPA 1QVOB 4WEBH 5EA0H 4AEIL 3SJVD 4P46B 3K46A 4XPBH 4U1JA 3FB6B 5FO7B 4OGAC 4HKJB 4XNUL 2VDOL 3MRJB 1UM4L 4U6HB 2AQ1A 4D9LH 4NN6B 2H1PH 2DQDL 2R0ZL 3TCLB 3PDDA 2AJ3B 5FA3A 4Z95H 1GJIA 1KCKA 3MLPA 4HV8B 4J4PC 4NQDB 4EQ2A 2DD8H 2WP3O 5F7EH 1B2WL 3EYOB 4X4YA 3B43A 2ITCA 1A8JH 4C54A 3NMEA 5EG6C 1E4WH 4HJGB 1QFPA 1ZA3A 5ABDE 4MAYC 3MNZA 5CIPB 1MQKH 1A47A 5F6IB 4K7PL 1KB5H 2HTKD 4PJBA 2EKJA 1J0YA 2ITDB 2EYSA 2YD6A 1B4JL 5FYKH 3TFKC 1JNJA 5IMLB 4ZS6C 5E6IC 5ESAB 5I75C 1EO8H 1QFHA 4MXVF 4YX2L 1C7SA 1OSZA 4RAHA 3LKNB 4I4WA 1MF2H 3O81A 4F9PC 3BIKA 2CO7B 3L6FA 3RKPA 4X6DB 2B5IC 5DLMH 4F57L 4I77L 1SY6H 3RVWC 4I8DA 4YXHH 3PP4H 1TJHL 4G8EB 4OLYH 4F7CA 1F4WL 3UXFA 1W8NA 5IB3B 4PUBH 3BZFB 3V4UH 4M6ML 4OCRL 1WT5A 1Z5LB 5C0IA 3BUTA 4BH7A 3PDOA 4Y2DB 3NPZB 3BKJH 1CLYH 4R90H 2RBLA 3FKUS 4JFFD 4UIMA 1G9MH 1R5VB 1WAAE 4KKLD 4HWNA 4ZAKB 5E08H 1BVKA 4W81A 2YPLB 5I71B 2XG5A 3TNMA 3C6LA 4M1CD 4YFLI 1H5BA 5DJ6A 5D7LA 4JFOB 1LDPH 1ZVYA 3NABH 3VXMD 3P4NA 1J10A 3OBAA 3X14A 1OAUH 3VW3H 3ZYZA 1AD0B 2X10A 3QJHA 5IBUB 1EO7A 1BD2D 1S9VA 4F7TA 1UA6L 4KV5E 4XVSH 1UB5A 5FGCB 1N7MH 3QCTL 3IF1A 2OK0L 4P59H 5JHDB 5F1SA 3UBXB 1B0RA 3BP4B 2YUWA 3U4EB 2VC2L 3QUXA 5T3ZD 5CSZB 3ZKSD 2DKSA 5C0GA 3HA0A 4FA8A 4MX7B 3DSNA 5A43C 4JO2L 2EDWA 5KBNC 3HB3D 5FGBA 4M61A 4HUUA 2R9HC 5LWYH 2FJFA 3FQWB 1I1YB 1WC7A 3PHQA 1QPXA 4QRPA 4AL8L 4JM4L 1FYTD 2DQEL 1MEXL 3EYUH 1W0VA 1QG3A 3QUZB 3F6LA 3FAXA 3OZ9L 4PB9L 1EHLH 1T0PB 4NFCA 5H35A 1BZ9A 1LDSA 4TPRH 4Q2ZB 4QHLA 5IBTL 2J12B 2YBRA 4U1SB 3FQUA 1P5UA 3L1OL 4WGVB 3LEXA 4C56B 1INQB 1NMAH 1XGRA 4O58H 4PREB 4LIQE 5HBBA 2VLRD 4N5EC 1MFNA 1CLOH 1QO3A 1TIUA 3S88L 3LOWA 3WD5H 5H2BA 1VPOL 5KG9B 4XTRD 5GRUL 1ZHKA 1S5IL 2GUOB 1SJHB 2XZZA 3EJYC 5DZNA 5EBGA 3KLSA 3O6ML 3WFCH 5GGTH 4J12A 4BA8A 4LHUB 5D2LA 3KHQA 1AQKL 4GKZA 4Q0XH 1A1MA 1YEIH 2RCSL 3GDBA 3RTQA 4EN3B 2R0LH 4LEXL 2YR3A 5MENE 2HVKB 5IW6B 4KZEH 3NCCB 4DFHA 2P1YA 5IP4A 1HIMH 3BQUD 3NFSL 2IBZY 5IHUL 5A16B 4KUCF 2DTMH 4RFEB 4EI6B 4XRCA 4P4KC 5I8OL 3QUMH 1T1YB 3PG2A 1DUZB 1YMHA 5EBMA 4GW1B 2BNRA 3IDIB 4R4FL 4ODTH 3QO1A 3C60B 1FGNL 3NFNB 4R9HA 3EO9H 4X4XA 1SJVA 2R0WL 5KSBE 3CH1B 4RMTA 4F58L 2R2EA 1JZ6A 2QADB 5D6CB 1P4BH 3MXWH 4Y5YB 3SDCC 3KWWA 1BFOB 4M7LL 3RWCB 1UXWA 4S1SH 5DURB 1SM3L 2YD8A 2F9BT 4CVWA 2X09A 3MODH 5HYSG 3S36X 1NCWL 2ORBH 3CVIH 1XCTA 5C08B 1CWVA 4XAWL 4GG8A 1UJ3A 4NZDA 3NACL 3HRPA 1FZOB 4J8RB 2X1XR 3CDFA 1FO0H 3T2NL 2AS5M 1A3LH 5CEXA 2A9NH 3VXOA 1JYWA 5F44A 4NSKB 3P0YH 5FF6B 2VR4A 4R3SB 1XR8A 3FRUA 4S1QH 1I3RA 5ETUB 1AXTL 5C86A 2VQ1B 1BF8A 1RULL 4O2FB 3QUMB 4L3EE 1EHNA 1YN6A 4ZXBB 1WZLA 3LQAH 1GC1H 3CDYA 4JKPL 4YZFE 1AY1L 2DQGL 2LTQC 1RZ8B 2P8MA 2XRAH 3KPRE 4JLRA 4F9PA 1RQ5A 4U1NA 1SVCP 2VLJE 4LPYA 4MJIB 3BEWA 4ODSH 5CGYD 1YEHH 4OZGB 3WFHB 4PG9B 1KGCE 2E7LC 4AEHH 4XP6L 2DB8A 1M6OB 1DSFL 2FEEI 3BMVA 3O6LL 3OXRB 4UNVA 3TO4C 2R1XB 5HHQA 2J6EH 1MFCH 2R39A 3GHEH 4OZ4B 1G7IB 4JO1L 3TO2B 1QOKA 4JVWA 3DBXA 1MREH 2X1WL 3EFFA 4RRPG 4OAWB 3VFUA 2EC9U 1WZMA 1YNLH 1UWEL 4PJ9A 5GS0L 4A2LA 1FO0B 4LLYA 4XCNB 3VH8A 4M62L 4PJDB 1PKQA 3WN5A 4GQPH 5KSAA 4XBGB 4UQ3A 2NW3B 4P99A 5C1MB 4P5MB 3REWB 3MQIA 2V7NB 3PL6C 5C0JB 3C2AH 1FPTH 3MV9A 2BNQD 4NC1C 3TJEL 5D7SL 1FG2A 1IEBB 2J8HA 4YJZL 1KB9K 2EDNA 3G6AB 1JWUB 1L9MA 3VRIA 1LEIA 4X9IA 3TA3D 4DUXA 4BZ1L 4Z7NF 4YGVB 5E5UB 1Q9KB 4P2RA 4GG6A 4OGYH 3E2HC 4NWTH 1L6XA 4HCRH 4PYGA 1MAJA 3SOBL 3O8XC 3RVVD 3T4AB 1GCFA 3GHBL 3HAEG 2FATL 4NZRH 3VFWB 3WIHH 4G80A 4JM2B 1T20B 3A6BH 3RPIB 4GBXD 5IESH 4N5UA 3MR9A 5FYJE 3MRIB 4HS6A 4BUHA 4NOFA 4N8PA 4PP1D 1QYGH 3AU1B 2ZSVA 1NEZG 4HFUH 1O5DT 5BJTA 4M93B 3SGEH 1A64A 1MWAA 2HFGH 4LCWB 1T1WA 5DHXB 1S3KH 4KK6D 3VGBA 5E7BA 4K94L 4KK8D 4CU7A 1G7LB 1CG9A 5KVDL 4LCUA 1A6PA 3QHFL 3BMWA 4JDZB 5T33H 2VZTA 4CVXA 2FGWL 3P9MB 1QTYT 1TNMA 3CVHA 4CVZA 2VR5A 5ILTH 1CDHA 3KYOB 1BVLB 4ZD3H 2NMSA 4U1IA 2JB6B 3ZYIA 1GL4B 4W4OA 4IOFC 5JO5B 3AM8C 2A2QT 2PXYD 4J23A 4U6YB 1MI5B 2GSGA 3KJ4B 3OKMB 3EYSH 1W72H 5AWNL 4PJBE 4LFHG 2Z35A 1IEHA 1F6FB 3VG0L 4TNWF 1T2QL 4OQTL 3CFKB 5B8CA 1T6VN 4OM0L 4YHPA 1P84K 2HT3C 4YGAB 4LSQL 1MNUL 1K4CA 5T3XL 5HVWA 3HR5A 3LS4L 4M1DH 1GGUA 5IT2L 3D2UA 3H7BB 3I9GH 1Y0LA 2J8UB 3K8LA 1A6WL 4UNUA 3VFMA 1KN4L 3U46B 1AHWC 3LKRB 4TRPH 3WS3B 5L0QB 1H0DA 1CLCA 3BPOB 4KDWA 5FECA 1KUMA 2QSVA 5HHVL 4D2NA 3MOAH 3HNTL 3MLWL 4XBPB 1NBYB 2E27L 3BPCA 4ZS7H 3SDCA 3RJDA 2Q7YA 5C0CA 1AQDA 5DJ2B 2CKBL 4KZDL 3INUL 1I1AC 3PWPB 3UO1H 1RU9L 5ITFB 1ZSDB 1EDQA 1TVBA 1ZLVH 5JR1H 4MDIA 3U2SB 2VH5L 3C08L 4HKBA 4PRPA 4RAVB 4RMVA 4HZAA 4I3SL 5H37H 5D7LE 4P46D 5E2VL 3HE6B 4OLVH 2ICWJ 4O4YL 5D5MA 2BC4B 3ULUD 2FHCA 1K4DA 4Y5VB 1TZHB 4LLMA 1SBBA 4WHTB 1IEAB 2DQFB 5DEFB 1MHHB 4G6JL 4UDTB 1TQCB 5EOCJ 3LKPA 1S7VA 2VE6A 4P23B 2L7UA 3OKOA 3ZE2F 1UENA 4X5WB 3TJHC 5TE7H 3IDJB 2VDNL 2X4RA 1D5BB 1S9XB 2X42A 2FYYA 3LN4A 3L3JA 2HJKB 3WMSA 1I4FB 2G2RB 4LAQL 5JORA 2BY3A 2AJXH 2BVPB 1KOAA 5CUSH 4MQ7A 4EDXA 3CLEL 4QRPE 2ZZUT 3MZTA 5HYEA 4H26A 4M02A 2PO6B 3PWJB 2C3HA 3TLRA 3GIVA 3SE4A 4WRLA 3X3FL 4NUJA 1H3PH 4MMZC 1UB6A 4OD1H 4R0LB 3L3DB 1JUFA 1OB1B 3NCYP 5D7JB 2GK2A 5T1MB 3NPSC 2BP3A 3L95B 3MNWA 2ERJB 2CRYA 4QXTB 1LK2A 2UZIH 1F6AA 3ZKNC 5F21B 1ETZB 2DLGA 3MV8D 1XIWD 2HT2C 4ODUA 4UTAL 3T0XA 1M7XA 3G5YB 3NFPB 5C0BA 4Y2DD 3SY0A 2BDNL 4H25B 4K3EH 1PZ5A 1U8HB 3BVNA 3O6KH 2BVOA 3I02B 4Z7QF 5DRXB 2FJHA 5D2LE 4ZAKD 2D7OA 3BKCL 3LB6C 3FN3A 2YPLD 1HYSD 1YEEH 1DQTA 5IVNA 1YUHB 1KLGB 5KVGL 1JWSB 2O5YH 3SO5A 5GPRA 1RSFA 3MRDA 3REVA 2VJXA 2BRRH 3Q3GA 1FZMB 3L5XL 5I9QB 1RY7B 4EZMA 4JDVB 4X6FB 3H7LA 2X4SB 1A4KA 4K9EH 4UQ2A 4KK9C 1WCQA 3BD4A 3VI3E 5DJYA 1ONQA 1C8PA 3MLSL 3RWFB 3SCMC 3FQNA 3KLHC 2XKNA 3HUJF 1U92A 5JHDD 4K7FA 3VI4F 1A22B 4UUJA 2YRPA 4GO6B 1T1ZA 3FB5B 2R8SL 3PIQA 3WJJC 2OS7A 3UROR 5T3ZL 1WWCA 2HWZH 3QQNA 4W70A 2BFVH 5BV7L 2R23A 4L9LC 4NJ9L 4ZUWA 4NN7B 1LK3L 4OF6A 3ILQD 2H41A 5J6GB 2APFA 2VXQL 3EBAA 4WVRA 1TCMA 4I0PB 1JTTA 4PJIA 5I1EH 1FN4A 5DUBA 2R2CA 4D0CA 1RJLB 2CGRH 3IETB 3QUZD 2VLKD 1FZKA 1WEJL 4POYA 4Y2OA 1U8MB 2A74B 1FNLA 1HZHL 1S7RA 2GTZA 3IFLH 3EOYG 3QXWA 3VMPA 4LIQH 4I0KA 1NGYB 3UDWC 3BIAX 1TCRA 4LRIC 2HTLD 4O2EB 9CGTA 2FEEL 1FVCB 1JRHH 4ERSL 1NC2B 4IDJH 4J2XA 4C56D 4KQ3L 4MXVE 2CD0A 1N4XH 1D5MA 4JPIB 4NNYB 5IJKA 4J6RL 2FD6L 2JJWA 2G5BA 2ADFL 4LSRL 2V2XA 2JIXB 4G42A 4GRWF 1UM6L 2YXFA 4NNPH 4AH2B 3FN0H 2CO6B 4FQLL 1Q38A 4MJ6B 2ZSWA 3I6KA 3HZMB 4LHUD 4PG2C 3WCYA 5E99L 3AREC 2DWDA 5GHWH 1AJ7H 4LSUH 4BM7A 25C8H 2VLME 5CP7B 4EN3D 4JPVL 2YC1B 4KHXL 1E6JL 4ALAH 1N5AB 1PKQE 5TFSL 4BKLA 4M7LT 2AI0L 4CADB 1A7NH 2C1PA 1IGTB 1BWMA 2F5BH 3VFNA 3ZTJH 3TIEA 4JB9H 1WFUA 3MV9E 3OKLA 3BKML 3WL9A 4DN3H 1KTRL 4OCWH 3MREB 1HKLL 3F7RA 4PJXA 3DJ9A 2IQAB 2E3VA 1OTTD 1RIVH 2NCMA 3KLDA 2Q6WB 2QADD 1UC6A 5B21A 5B38B 4P2RE 1DQDL 4IOIB 4L1HA 1F2XK 1JK8B 5DURD 4M4PA 4TUOB 3AS1A 5MENB 3HNSL 2F74B 4JRYA 1G1YA 3E3QE 4BQCA 5C08D 2EIEA 4JZJB 2FWOB 1IAOB 5DD0L 4PV8A 4P49A 5FCUL 2G60H 3PWNB 1DBKH 3NIDF 4R7DA 1RIHH 4WNQB 1JN6B 4GRLA 1B3JA 1A4JA 2C7UA 1M71A 5EWIH 5JZ7D 5L88H 4YPGA 5F7DB 4NQUA 5KSBB 2BHUA 5GZOC 2YK1H 2NNAB 3D85B 3TN0A 4L5FH 2DBJA 4ZXBD 3RWJA 2EH8H 5A2FA 4OLEA 1CGSH 4Y16B 5ADPH 1EBPA 4EI5B 4PP2A 2PW2B 2XTJC 3GMRB 1X5HA 2OL3H 3ARFC 1W0YT 2GITB 5H94A 1IBGH 4WWKA 3RGVC 1NCBH 4P5TA 3QQ3A 3CGTA 5EZJA 1M05B 2XV6B 2BNUA 2IBGA 4R2GB 5FHBH 3H0TA 5DR5L 2V2WB 3NCJH 4OCLC 3OR6A 5BXFA 4IS6B 4PJAF 3FJTA 4WO4C 3LPWA 3IFOA 4L3EB 1MJUH 4IRJB 3WE6A 1INEL 3ZTNH 4KGJA 1QSFE 5J12C 4XPAH 4OCNC 2YD1A 1LO0H 3KPRB 1QLEL 1KEML 1OY3B 4B7LA 3IDYC 1PEWA 4GMSH 4LCIH 3AROA 4NZUH 4PLKD 5FYLE 5DVKA 4NPYB 1WZKA 3DVNA 4LEOB 2X4TB 2OL3B 4FFYL 4NKIL 3D9AL 4E5XA 3O9WB 3G5ZA 4QF1A 3GSUA 2I24N 5IGXL 5KVFH 4F15C 2RFXB 4UDUB 1AR1C 1C1EL 5FXCH 5AZ2L 3G9VA 1NAMH 1UYWH 2CIKB 4XP1L 5A3IC 3SDAB 4TSBL 3V6OA 2YUZA 5GJTH 4HS8H 5C0CE 2IJ0C 3S34L 3VXTA 1HXYB 3T1FA 4JQVC 2D03H 4NUGH 2E6QA 1A14H 5D2NC 4F7PB 1JFQL 3B2UD 4G8FA 5DJCB 2BXZA 3C09B 3O6FB 3LKSA 4PRPE 5LBSL 1MJ7H 4UBDD 3QEGL 4PLJD 1T3FB 4NQXB 5BS0A 4LCWD 3IJSA 3SHSA 4PJGF 5J6HA 2Z31D 2OYPA 1RZFH 3BFOA 2E8ZA 5D5ME 5ACZA 1OT2A 4YNYB 4RGND 5HHMD 3T0VA 1T0MA 1GGBH 4L8SA 5L6YL 4FQJH 3C8DA 2V5MA 3QAZC 1DTUA 4DCQB 4JCLA 4PS4L 4WU5B 3MLTB 1OPGH 5BOPA 1CQKA 1NAMB 3NTCL 3QEHA 4NN5C 2GJJA 4LDOB 2ZOKB 4CAGA 4FQQB 1MCIA 5ID1A 1AGBA 3HTLX 3HPLA 4QT5B 5JUEL 3UYRH 3GO1H 1RZJL 5CJQH 1I9IL 4ZODA 4GW5A 1K2DB 1MI5D 1MPAH 3P73A 5FEBA 5JQHC 4XAKE 2P8LB 3BH9B 1F90L 2HFFA 3QWRD 4RIRA 4U1JB 1Y6KR 3OXSB 5IF0A 4PBVC 2FR4A 1FC2D 1I7TA 2OZ4L 4AIZA 2GKIA 3MRFA 1JL8A 5F9OL 4I5BA 4Q6YA 2IFFH 3UJIH 5GS0C 2AJSL 4M5YH 5CJ5A 3ZHDA 3G5VA 4EUPG 4PGJA 5SWSD 3DETC 2WWKO 3MCLH 4JFZL 4AM0B 2ITCB 4X4YB 3RPKA 3STBA 1ZA3B 1CGVA 1EJ6A 3MNZB 4TSCL 2A6DA 4ODHH 4I48A 1NBZA 2XN9A 2VN4A 1J0HA 3KS0J 1VFBA 4HF5L 3KYNA 4BSWA 3MOBH 3P0VH 3PWPD 5ICXA 2VR9A 1KLFA 3R8BB 4JG1H 5EZOL 3RIFK 4OIIL 3JVGC 1OSZB 1H3TA 3BD3A 1WTGT 2NY6C 5D7IA 4I4WB 4PD4K 3ZKMC 5EIIA 3TWCH 3BIKB 3W5NA 2AEPH 3F7VB 3L6FB 3HE6D 4ZNCD 3R0MA 2C26A 5J1SC 3U9PH 3IXAA 4F7EA 2EE9A 4F7CB 3PDGA 4B41A 4OCSH 4HC1L 2VZSA 5FKPA 5GISH 1T6WA 1F45A 3FRPG 4H0GA 5C0IB 3GSNH 3PDOB 1U93A 1C5BH 1NGPL 4K94C 4YDKH 2Y7QA 4P23D 3C9NA 5D93C 2NX5A 4QTIL 4YBLC 5EZIH 1RURL 1G9NC 4JFHE 1FORL 4HIXL 3TBSA 2WLZA 1RPQA 2HA1A 4OLWL 1HKFA 1T22B 1U0QA 4P57A 5J3HC 5CBEA 2CK2A 1MCOL 4UIKH 4NIKB 1ZLUK 1FH5L 2CR6A 3DUSA 2Z8WC 5HY9B 1EEZB 4Z7WF 1S9VB 4F7TB 1LWRA 1LVEA 1A7PL 3GKWH 3PGFL 4PJAA 1UB5B 4U1HA 1NEUA 4YH6A 3ROLA 5E2WL 1KLUA 2WBJD 5D7JD 2DLTA 1AO7E 1B0RB 3G6JA 1WBZA 1N0XL 3GSNB 3QUXB 2M8XA 1GOFA 5FUOL 5IKCA 4QHNA 1FNEA 4R97C 2ZJSH 1IM3A 1HWHB 1S9WA 1ZKAA 4QY8B 5IMKA 1RV6X 1KC5L 1RZKL 1Q0XL 2P5EA 4X7DC 4G6AD 2YMXH 5DVLA 3PWVA 4GAFB 1AGFB 3RY5A 4NRZA 2FJFB 4QRPB 1AH1A 5AYUL 3T0EA 3FT2A 5BZWB 3QHZH 1W0VB 3DNKA 3DSFL 4CMMB 4ONOA 2YEZA 4PV9A 1GOGA 4UV4H 4FP8H 4ODVL 1BZ9B 4KKNA 1SBSH 2CKNA 3GMMA 1R5WA 2P5WA 3MRLB 3SKOA 1A6TA 4KRMB 2MPAL 3EOTL 4TVPL 4HQQH 3LEXB 1U8QA 2VZOA 3DRQB 1DVFC 1EFXA 1MLBA 1XGRB 3RU8L 3QB7C 4GKOA 4HIEA 3C5SA 3UCRA 1T80A 4KUZL 1NCCH 4QCIA 4NHCL 5FUCC 3DARA 1S7XA 4TTDD 3T4YA 4PJXE 2ICWI 3JWDL 2I9LB 3LRGA 3VGFA 4Z8FH 5CJOH 3ZZ1A 5D2LB 4GKZB 1A1MB 4JPKH 3W39B 2XA8H 4QHMA 2O5ZL 1LNUA 3OKYA 3RTQB 5F9AC 4LOUC 3MLYL 3QFJA 2J5LC 1VKXA 2X6MA 2XWTA 3MA9H 4JRYE 4QYOB 5JIIA 1G7MA 3MJ9H 4HLJA 4OLZH 2J88L 4FTVA 1MFAL 3R0NA 4FXGA 1F42A 4QNPE 4ISVA 5C0DB 4LU5H 4ONFH 5FDWA 4PB0L 3UPRB 3D0LB 1LEKB 1YMME 3VA2C 4PTUA 5JIPA 3GRWA 2E9IA 3MGTA 1S7QA 3VXRE 3L5WA 4K2UL 4LSTL 4RFOH 2AK4A 1QA9A 1OSPH 2CR3A 1Q9LA 2PUQT 1NC2D 3KWWB 5DJZA 5JXED 3QIWC 1KCVL 2ESVA 3P4LA 4Q9RL 4CJ1A 1U3HA 2JIXD 3N1QC 3VE0B 2Q1EA 4MAYB 3P40A 2FLBT 2EDOA 3W2DL 4E9LA 3AY4C 3NAAH 1A7OH 4HPYH 4PJ8A 3ZL4H 4R26L 4WCYH 3MA7B 1IKFH 2WAHA 3NCFB 3Q2CA 1BQHA 3HMXH 4R4BA 2WV3A 3IAPA 3VXOB 5CEXB 1SMAA 1S5HA 4HWEL 1CXEA 1XR8B 3FRUB 4NKOA 2Z92B 5DFVC 2NY7L 4AY0A 5E6IB 4QKXB 4WHYH 2JB5H 4KKLC 1YN6B 4Z7QE 3S36L 5HVFB 4NKDA 3TT3H 4X5XA 2IADA 1NFIB 2ARJB 4M3KB 4U6VL 1BJ8A 1KEGL 4Y4HD 1WWWX 4M1CC 2B5IB 3MCG1 1HOCB 1MCPH 3QXVA 1QEWA 4W68A 1UCTA 4RFNC 1HSAB 5HHQB 4XXCC 4CW1A 5IVXF 4JN2A 1U41A 2DM2A 4ZOEA 3DBXB 3VFUB 1OW0C 3SKNB 2G75A 3O3DB 1K6QH 5JHLH 4J1UB 4PJ9B 3VI4E 3V6OE 5MEND 4LLYB 3BESR 3VH8B 2ZG3A 3WEXA 3FO2B 1PKQB 2EO9A 4HJ0D 3V52L 1FVDB 5J13C 4UQ3B 5INCB 1ZT4A 4XP4H 5BV7C 4WFFE 1I8KB 4I3RL 5EZLA 1NGQL 1SMOA 3HB3C 3MV9B 5HHPA 1YQ2A 3V4PH 4NQTA 1FG2B 4KAQL 1EMTH 4XPFH 1NQBA 1Q9WA 4WI7A 2PYFA 5BS0E 3VRIB 3D85D 3RHWK 1GAFL 2OR8A 5I8EA 2F5AH 4TULL 5KSUB 1HNFA 3OKDB 4EI5D 4NCDA 5CWSA 5C92A 4NKMA 2VXTH 1OAZH 1A7QH 2B4CH 2HLAA 5I30L 1L7IH 4WI6A 5EORH 2X89D 1ADQA 4OV6F 4WFEE 1A3RH 1JPTL 1YEKH 4G80B 5CEZE 4F3FA 4I18C 5F89A 4N9GA 4YHLL 4PY8J 2MHAB 3MR9B 4R2GD 4W6YB 4DKFH 5ITBL 3R1GL 4JFXA 1KTKE 5E0QA 3CIQA 1CICA 3VWKC 2EE6A 1JE6A 2ZSVB 4EJ1C 3STZA 1WFNA 2QSCH 4XTRC 3QQ9D 1MWAB 4L3ED 3GM8A 5HI4D 3BEVB 2VERN 4FQIL 4IRJD 4M48L 1OAKH 2R0KL 2GAZB 4DUWA 3FCTA 3QZWG 2QSQA 1CG9B 3KPRD 3QPXL 1WISA 3CXDH 5D8JH 2VLJD 3WSQL 4G3YH 4YHIA 4HWBL 1ERNA 7CGTA 3BWAA 1KGCD 1DVFA 3OAUH 4FZ8H 2ZPKL 3T3PF 3T77A 5GIRA 3O9WD 4U1IB 4XGZA 5LGKA 3MCKB 4PJEA 5EUOF 4YAQB 1MFEH 5EC1A 5D71H 5BZDA 3KR3L 3IVKA 2FH6A 3B8YA 2GSGB 5T5FL 3SDAD 4D9RE 5EU5A 5E2TL 3CMGA 4G8IA 1F4YH 1QSFB 3U4BL 3ZT7A 1FAIH 4KPHL 3CFIC 5AD0A 1P6FA 1ZEAL 5LQBL 3S35L 1DQMH 3O3BB 4M8QA 5E00B 5JOEA 3SE9H 4ONGH 1K4CB 3BN9D 3O6FD 3O3UN 3HR5B 2BHYA 4X99B 3V8CA 1BJ1H 1K8DA 4XVTH 5D7IE 2UZYB 1YEFH 2FO4B 4P4KB 3QULA 4NWUL 2DOCA 2A6IB 1CIDA 1B9ZA 2LU7A 1UZ8A 1UG9A 1QNZH 4NJAL 4LCYA 4AMKL 1T7VA 4ZFZA 4DEPC 3NIDE 3B5TA 3MRMA 2OM5A 5FECB 3OQ3B 5I1CH 4LMQI 5I1IL 1XH3A 1P1ZA 4X8XA 3MACL 1SYVA 3SDCB 3OSKA 2XTJE 5C0CB 5I1AB 1AQDB 2VZUA 4DOHE 3E6HA 2ATPA 5B38G 3WLBA 3QQ4B 2XWBA 5L8KB 3MLRH 5FYJD 1YEDB 1I8LC 3GMPA 3HMXA 5CGYC 4MDIB 4MHHI 5EUKB 3X13A 3QWQB 4PRPB 5F88A 5F9JB 4LLDA 4A6YH 3AY4A 5GGQL 3F58H 1J0KA 4U3CA 5CHNA 5MEQA 3QDGE 3R06B 4S2SB 5E94A 4ZTOH 2XWJA 2IPKA 5GQBA 5D1ZC 4L4TA 1N8ZB 1MJ8L 4ODWA 1CFSB 3BKYL 1OCWL 4PJAE 5EN2A 1S7WA 2WW8A 1J1OL 2LTQB 1BM3L 4Z7UA 3S3PA 4Y1AA 3HMWL 3WO3B 3KYKL 1BBDL 3OKOB 1QFUH 3NGBB 3RWIA 1MCWW 5HHNA 3G6JE 3GNML 1CXFA 1U8KA 5BCAA 4MHHG 4Z0BL 2X4RB 1UGNA 3O3EA 1WF5A 4ZUTA 2GJZB 2FYYB 3QIUC 3LN4B 5EO9B 3QEUA 1N64H 3L3JB 1AKJA 3TO4B 3SDXF 1KPRB 5EB9A 5J06A 3C8KB 2IG2H 5JORB 2BCKB 5E4IA 3RNQB 2P5EE 3WUWB 1C5CL 4MQ7B 4EDXB 4NCC2 1QSEA 3SKUD 4YXLL 3TA3C 1EUUA 2F8XC 1F5WA 3T0EE 4H26B 2WQ8A 4ELKB 3QUKB 1T5WA 4MDJA 4HGMA 1J0ZA 3LV3A 1JIBA 4C83B 1HI6B 4H88L 4HEPG 2WUBL 1JUFB 3OF6A 1P69B 4JHWH 4PLOB 1FZJA 5D2NE 1BFVH 1DE4B 2P5WE 4OGXH 2JJSC 2H32H 1YY8A 4P2CG 4GBXC 3MNWB 2IPTL 3LPGA 4OTXH 1LK2B 2OXGA 1FSKC 1RUQH 2X5PA 5JPNA 3KPTA 5SWQA 2I07B 1QSZA 4OLXL 1MCSA 4ODUB 2EYRA 3GJFH 5L7XL 1DLFH 3ORJA 5FKAB 1HILA 1R3HA 4OB5L 3UTPE 1T03H 5DMGD 3WDHA 4KK6C 1PZ5B 5DS8A 2MCPL 3E2HB 4HHAA 4KK8C 3D25A 3MO1A 3O8XB 2ZCLL 3O2DL 1KIQA 1PQZB 4J3SA 4PJFF 5F7HA 3FO9A 3CK0L 4L8CB 1Z9SA 3C6LD 4XMLL 3QFJE 5DK0A 4KTDH 5D7LD 3MMEB 4XVUC 3MRDB 3W81A 1JNHA 3F7YB 4FQCL 3VWKA 3EDDA 3VGDA 4FTVE 1NKRA 4OFKA 4KY1L 1A4KB 4FFZH 2C4XA 1IKNA 5LCVH 3V5KA 2PXYC 5DJYB 1ONQB 2VAAA 5DGRA 4RX4A 4MCZB 2XKNB 1I85A 1U92B 3VG9C 4K7FB 3BX7C 5IFAL 3QRGL 3ARSA 1P4IL 3GJFB 2X4PA 2AK4E 1X7QA 3W0WB 3ZDZF 2EDDA 3IAGC 4QWWD 3PIQB 3CSYA 3QUXD 1IT9H 1OAYL 3IKCA 3HCVA 3K2UH 4JGUA 3SDDC 3WHXA 1KPVA 5D6DC 3H9HA 2A77L 4B53A 2BMKB 5IB2A 5GGVL 4NQCA 4XMKL 4ZUWB 1I3GL 2DLFH 5DD6A 5ALBH 3MZGB 1IAIL 5DDHB 4QRPD 1ED3A 1TNNA 1FN4B 5DUBB 3LVEA 3QG7L 1N0LA 1KELH 1ES0A 1FZKB 5J8OA 4FMKA 4ETQB 2N7AA 1YYMH 2GTZB 3UTZB 4AENA 5DO2D 3S3JA 1KXQE 4WY7L 1WV7T 4NRYB 4YHOL 1AO7B 1CF8H 2WNGA 2XI9A 4EIZC 2EXYC 5TE4L 4LSPL 2WBKA 3AS2A 3FQTA 1S8DA 1ZT1A 2D0GA 4ZDHA 3ROOB 1JHTA 3S6CA 3DX7A 1DBBH 5EC2B 1A1OA 1HDMA 3AFLA 1ZA6A 1FFOA 4NFBA 1AHWB 3AXLA 2V2XB 1Q0YL 1RUAH 5FB8A 5AZEH 4N8CH 1OF2B 4KVNH 3G5XA 1V8HA 2VUOA 5HGDB 4FQXA 5HDBF 4JEGB 2ADIA 4X9GA 2HYMA 2DWDB 1S9YA 1IVLA 4MAUH 1CFQB 2OJEB 4QXUH 2J2ZA 1ZWIA 3IDGB 2NY1B 3RTQD 1I1AB 3F5WA 4CDHA 1P9MA 3OG4B 3A67L 1EBAA 3L9RA 4RZCB 3BSZH 4Y4FC 2B0SL 2CXKA 3HRZA 3DUUB 5GS2H 4LPVA 3BGMA 4X6BA 1MVFA 2C1PB 5I15L 3B9DA 3B9AA 3VFNB 2X4QA 3TIEB 5EIVA 2C3GA 3D87B 4OGAD 1NSNL 3OKLB 5CEYB 2H26B 4N1HB 4GUPB 5D1ZA 3WL9B 5JW5A 1FL6A 4Q9BA 3C87A 4PJXB 4OZHA 1OAXH 1VACA 3CMOH 1X5GA 1SEBB 4N8VA 3MV11 3QH3B 5DT1L 4KMQA 3ULVD 1YN7A 2R69L 3HI5L 2ED8A 5IB5B 1JI1A 5DC0A 4X6DF 3HLAB 3WXVH 2DQUL 5E8PB 1DN0A 4XPTH 5T3XE 3RZCA 1GGCH 3O4LB 5FHAH 1A0QL 3N0PB 4U2ZA 5C6WH 4MAYD 4GKSA 5I1JL 5FA4A 5I1GL 4PV8B 1RZKC 4DGIL 3FONB 1XIWC 2G9HB 4XMPH 5FM5M 5I19H 1OGAE 1FL3B 1Z0NA 4R7DB 1QP1A 4N0UA 1A4JB 2C7UB 1YMMB 1HINL 1QBLL 1M71B 4PRDA 3L7FB 4POZD 1DP0A 4YHYC 5MEOB 2KKQA 3TFKD 3VXRB 4P9HL 4YPGB 3SKMB 5GRVK 5JIKA 5L2KE 1BLNB 1VFOA 4ZAKC 4DN4H 1JYXA 4B0MM 4KHTH 4PP2B 1KACB 3B6SA 3NPSB 4AEIH 1KT2B 4G8GA 1JZ7A 3ILPA 3PHOA 4P0DA 5ID0A 3U9UB 4XNUH 4WHCA 2VDOH 1UM4H 5C7XL 3LIZL 2V17L 4F9LA 1AGDA 4HJJL 4U33A 2DQDH 2R0ZH 4DGVL 1X5IA 1CFNB 1TDQA 3QI9A 2NLJB 4PJEE 4Z7VF 3OR6B 4NQSB 5BXFB 2Z9TA 2VLMD 4L8BA 1T0NA 2F53B 2VMFA 2CUMA 3IFOB 1B2WH 3JWDC 4ACPA 4PJ9D 4ZQKA 3I2CL 1ZMYA 3WE6B 2JCCF 3DROB 3VFVB 5MEPA 1RUKL 1GSMA 5T1LA 3BRFA 1A9BA 3F65A 2GIYA 2XZAL 3HI6L 5SV4A 4MQTB 4JFQA 4K7PH 3ILQC 4HWZA 2Q76B 3MV9D 2BSRB 2V5SA 3OAYH 1B4JH 1B90A 4HKXB 5JDJA 3JZ7A 1SJEA 5EU6A 4UOW1 1CZ8L 1ZHNB 3MJ8A 1NJ9B 3ECBA 4P4RB 1JPGB 2GSIA 4QTHA 4YX2H 1C12A 5INDB 5CJBA 2V9QA 4P2RD 1O0VA 2GK0A 4JDTL 1ZHBB 5E6ZA 3HUJB 4H0IA 1F11A 3T3MF 3Q48A 4FFWC 2XXCB 5D6DA 5C0AA 2WP3T 2HTLC 1TJHH 3NA9L 1J8HA 1U8JA 1F4WH 4L9LB 4CGTA 3EUUA 4GRWH 1FE8H 2YA1A 3MGAA 4M6MH 4OCRH 5EU3B 5F8RC 1Z0MA 5I1LB 3MFFA 1SQ2N 3QWOA 3WFBH 1MFBL 5IK3A 4PGBA 5BS0B 3TIDB 3IJSB 5J6HB 3TNNA 2R2HB 2B1AL 3BZ4B 2YN3A 1IARB 1FV1B 3QA3B 1IC5L 3IDXH 6CGTA 8FABA 4GQ9L 1T0MB 4YWGL 4L8SB 3RI5K 2O61A 4EN3C 1FHGA 4Z7UE 4Y1AE 5IMMA 2VDPL 1UA6H 3QEHB 1DBJL 4L29A 3FFCE 4DQOL 5ID1B 1AGBB 3BT2L 2O93L 2OTUA 4OZFH 3PXHA 4IIQA 2DM4A 3S97C 3QCTH 3MJ7B 4KVCL 3ALPA 2OK0H 1FC1A 4H8WL 1BD2E 4K3HA 1AXSA 1ZT7B 4Z0XA 2DYPA 3U7YL 1U8OA 1M7IA 2VC2H 1ULVA 3ARDA 1QSEE 4YHML 4S10A 1OTTC 2HJFB 2QADC 5IVXE 2FH8A 3M8OL 7FABL 4JO2H 2OR7A 1HQRA 4GXVL 4FN0A 2BVQA 4AL8H 5FYLD 2VDML 2GY5A 2DQEH 3ARGA 1MEXH 5L2JA 1QRNA 3HPJA 3HC0A 3VWJA 2WM0A 2ENYA 1KG0A 5HTSA 3OZ9H 4PB9H 5TDNB 4KMTL 2VITA 4M8VA 1T83C 4I48B 1OLZA 2E7CA 3LS5L 5E5MA 1NBZB 1S7SB 5IBTH 5FFLA 3KDMA 3L1OH 3SDCD 1XAUA 3O2VH 4NO0B 5C0CD 1OD7A 3HZYA 5KVMC 3VFPA 3PF2A 5F7KC 4OZGF 5ICXB 4JO4H 1RUPL 3S88H 4NZJA 3CCHA 5FYJL 1VPOH 1T89C 5GRUH 3VH8G 1S5IH 4PRPD 5HYJE 3SPVB 5DGQA 2CIIA 4XPGL 3BZEB 1A7BA 3O6MH 4ZOAA 2X05A 5J4MA 3WFZA 4DZ8B 1AQKH 3GSWA 3FB7A 3QG6A 4D8PB 1QHOA 1X6NA 4PY8I 4XCYA 2KZ1B 3O11B 5FKPB 3M17A 2BJML 4LEXH 1EXUA 2W65B 3IDMA 5ICYB 1CGYA 2QL1A 1U93B 2VL5A 1CE6A 3EOBA 5IHUH 5FOBA 4YQXL 2XTJB 5D1QA 4DOHB 4KXZI 3VXPB 1RIUH 4IMKC 3ARFB 2CLVA 5I8OH 4CRPA 3K8KA 4JO3L 3RGVB 3QXDA 4R4FH 4YE4L 3V95A 1BPVA 3P4OA 4V2BA 1FGNH 4NQCE 5B22A 4P57B 4LLUB 1OQXA 2R0WH 2WWMD 4WW2A 1YPZA 2DWEB 4F58H 4XAKD 3T3PE 3I6GA 2VABA 5C70A 3QDGB 2Z8SA 3DUSB 4Y89A 1YEJL 3D5OF 2NXZD 4WO4B 4M7LH 4ELMF 5KS9F 4FQHA 1LO5B 1UZ6F 3VMOA 1NBQA 1SM3H 4QXWA 3OB8A 4PJAB 4ZUSA 4U1HB 3R8QA 1NCWH 3ROLB 5J12B 5TH2B 1LP9F 1S7TA 5ISZB 4EEEA 1AFVL 3LSOA 2JCCA 2N4IA 3NACH 1WBZB 4YUEL 4OKDA 1I7RA 3IDYB 2VQTA 4KK5D 4KJYA 5IKCB 3B2UC 3H8NA 4JRXA 4KFZC 1NDMA 1IM3B 5I2IA 1AXTH 1RULH 5F3HA 2P5EB 4PLJC 3BWUC 4M93C 2ZUQB 4P9ML 4F15B 4JKPH 1ORQA 4PRHE 4U1GC 5HHOA 2Z31C 1VB9A 1AY1H 3T0EB 4RGNC 3FT2B 3CDGA 4YHKL 2DMKA 5IOPA 5I8CA 1K85A 3O8XD 4NM4L 1NGXA 5HGAA 4XP6H 6FABL 1DZBA 1T5XB 2YEZB 2BSTB 1DSFH 4HKZA 4N90E 3O6LH 1HWGB 5D2NB 3TT1H 3WFEL 4NQEA 3GMMB 1R5WB 2P5WB 3F6IA 1Q1JL 3HHRB 4JO1H 3HZKA 2AJZA 1NCDL 3TZVA 1MLBB 4X8JA 1MCNA 2LU3A 4IMLA 1CBVL 3KPPA 1I3UA 5GS0H 3OHXA 3RWHA 4QCIB 4M62H 4PTTB 4PJGB 3MBEA 2ENSA 3FZUC 4IHOA 5D7KE 1CDGA 1CS6A 4OZHE 1PYWB 3CLFL 2ADGB 3QAZB 4JFHD 1RZGA 1K8IA 2NY5L 2PW1A 3QNZA 4RCAA 3TJEH 5HDQL 1RI8A 5D7SH 3CC5A 3FT3B 4QHMB 4NN5B 4XCEA 3ARTA 4XP5L 2JJTC 4R4ND 3ULSA 3QFJB 1VKXB 5IQ9B 2AQ2A 1EGJH 4BZ1H 1FLRL 2BNQE 1DANU 4G43B 2DDQL 3WDIA 3D1MC 3OJDB 1WFOA 4FTVB 3MGOA 2LE9A 5JLZA 3KPSE 4FXGB 3SOBH 3MUY1 3L3IB 4ISVB 5FDWB 1V7ML 4N0UE 2FATH 5LJYH 2WBWB 1S7QB 1U58A 2WANA 2HT3D 1AO7D 2NXYD 4ZSOB 1Q9LB 3MSPA 1IC1A 4JREC 3DRTA 1INDL 2APVA 2EIDA 2O26U 2W9DL 5DJZB 1ZS8A 4G8GE 1DANT 3RP1A 4DVRH 1UKQA 1HH6A 1JGLL 4YDIL 1NAKH 4K94H 3SKJH 3HE6C 2ATKA 4NGHL 4LBEA 5LVEA 4HT1L 5KVDH 2FCBA 4HGWA 3QHFH 1S9KC 4PJ8B 4ENED 1PD6A 5CZXC 2FGWH 3OKKA 1IL1B 3BUYA 1S5HB 1RHHA 4UV7L 5F96L 2IAMA 1OWRM 4NKOB 5DRZB 2NY1D 1I1AD 4I3GA 3P30L 2LVCA 3ALXA 4ZFOL 4D3CH 5EA0L 3MRNB 4ZO9A 3KNBA 1T89A 5SWZA 1EH9A 5ECJE 2NY6B 3WO4C 4NKDB 2JJVA 1RJZA 3OGCA 1A5FH 4Y4KA 5I1DA 2D7PA 4OJFL 1BOGA 4PRAA 3NZ8A 4NBZB 4AG4L 4LHJB 5AWNH 1IC4L 4BFIB 5IROC 1A7RL 4U0QB 3TBVA 3VG0H 1QEWB 1JJUA 1T2QH 3P77A 4OQTH 2YA0A 4S1DD 2YD4A 4JY6A 5E9DA 2DD8L 4OM0H 5EU6E 4U6XA 4LSQH 3WNPA 1MNUH 5T3XH 4JN2B 3D3VA 3I85A 1G6RA 3LS4H 4QOKA 3ULVL 4YBLB 5IT2H 3TJHD 2WBJC 2G75B 5D7JC 2JK5B 4F37K 4U05A 2Q3AA 1A6WH 2E5EA 4HUWB 3FOLA 3QISA 1KN4H 1T2XA 4JRYD 5C0AE 3WLWD 3ZDZE 1U8NB 3V5HA 1NFDA 5EFIA 5HHVH 3HNTH 3U0WL 3MLWH 1DQQB 1G0YR 2E27H 3SQOH 3TEUA 1D3CA 1YMMD 3N85L 4DTGL 4EOWL 4U1MB 3VXRD 2CKBH 4KZDH 1Q9WB 3MC0A 3INUH 1RU9H 3TN0D 4H1LA 5E95B 1FNHA 1XF4A 2VH5H 4U31A 4PRNA 3C08H 1C16A 1ZK9A 4JQIL 4YXHL 4MSWA 2Z93B 5CWSB 3R4DA 1LP9A 4NKMB 1OTUD 4I3SH 4PRIE 3VXNB 2ZUVA 3V4UL 5DJAB