1AP2B

Single chain fv of c219
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
EVQLQQSGAELVRPGASVKLSCTASGFNIKDDFMHWVKQRPEQGLEWIGRIDPANDNTKYAPKFQDKATIIADTSSNTAYLQLSSLTSEDTAVYYCARREVYSYYSPLDVWGAGTTVTVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords MONOCLONAL ANTIBODY C219
publication title A single chain Fv fragment of P-glycoprotein-specific monoclonal antibody C219. Design, expression, and crystal structure at 2.4 A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 120
sequence length 120
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ap2B00
5DVKA 5JDSA 1F97A 4ZD3H 3L3GB 4KTDH 1M6OB 4K9EH 4JANB 4HHAA 3TPKA 3GSWB 1KEML 3FB5B 3HE6A 1FORL 1YY9C 4GRWF 2YR3A 4M3JA 4O2CB 2Z4QB 2DI9A 5DURD 5IVXB 4J3XA 2IBZX 4YK4C 3E6HB 1G0YR 1QO3B 5SX4H 2VR9A 1HEZA 4R97C 4EDXA 4MDIA 1WZ1H 4P4RB 3OKNB 3IDYB 1UGNA 5GJTH 3U0TA 2DTML 3B43A 2R0LL 4L4TB 4N0CC 4WW1B 1DBBL 2DD8H 1A2YB 1A1NA 5CIPB 1RUAH 5MERA 4WGWB 2BVEA 3I6KA 2NNAA 4LU5H 5IOPA 4W6YB 1CGWA 3TVMC 4LCCC 2YHGA 3MNWB 5SV3A 3L1OL 4WU5B 3WEXA 4LEOB 4TNWK 3B8YA 1MHEA 3T0EC 3AM8C 3BD5A 4X6CB 4NQCD 2UZYB 4V2BA 1AH1A 5EU6D 3F12A 5IB1B 1JGUL 2F54E 4I0PA 4NQSA 3HA0A 2X7LB 3HC0A 4X9BA 1I85A 3TYGH 3DXAB 4XVSL 1J12A 2Z9TA 3GNMH 5EFIB 3C08L 2DQHL 1F13A 3WN5B 1DN0B 2BHUA 2GKIA 4ZFZA 2A73A 1NJ9B 4PJCA 3K1KC 4MVBC 1DP0A 4OCSL 5ERWB 3SE3C 1QTYT 5DVMA 3MBED 4OIIH 1UM4L 1YEGL 3PJSB 4PJ5A 3FZUC 4L8DA 4R4NC 2YD5A 5E5MB 3EJJX 4HKBA 5BRZD 4E42A 5IB4B 1S7VB 4OGZA 4MAUH 5JQ6H 2ZSVA 3M17B 3TBVA 1XMWA 2I9TA 3E6FB 3QXVA 1P7HL 5BJTA 1MNUL 1U95A 2VDQL 4A2MA 1WQVT 1X4XA 3RVUC 5HHOA 3S34H 3TA3B 3D0VA 5F3BB 5HVGB 1TJIH 5T1MB 4IDJL 3VFNA 1T20B 3RGVA 1L0QA 3H9SE 2Q3ZA 2ADGB 3MACH 1K5NA 4MCYB 5IW1B 5TJWK 3ARDB 3U1SH 1E4JA 5GGRY 3S4SA 4PS4L 3W0WA 3ZL4L 5J9PA 2R23B 3FKUS 2Y7QB 1FCCA 1IBGL 5CMAB 4OLZL 2BNUA 3LPWA 3RY6A 3MUGB 2BY2A 2DWDA 2B5IB 3QA3B 3WL9A 3PWPD 4OTXH 2C26A 4FTVD 4Y5VA 3BEVB 1UC6A 4Y5YC 5DDHA 5DS8B 4G5ZH 4UILL 4N68A 1UZ6F 1N2RA 1IL1A 3ARWA 3QISA 1JGLH 2OS7A 5HTSA 1R3LB 3D18A 1WFOA 1FIGH 1XGYL 1KCSL 2HVJB 1U3HB 5GRJH 1RVFH 1BLNB 1T1WB 2P5EE 3TWCL 4OZIE 1CBVH 5IVZA 1UJTA 1P4LA 3QUZB 3B9EA 5L88H 3ARBC 1LD9A 3HNSH 4IRSA 4UBDD 2J5LB 3WKMH 1MCOL 1IQDB 1EMTH 4DN4H 1YN6A 1IEBB 3WE6A 5I17B 2BXYA 3CH8A 1WC7A 5EZLA 4LPTA 3H9ZA 1RJZA 3NA4A 4XPHH 2BVOB 4NP4L 1NCCH 4CN1A 3PP4H 3I02B 1AC0A 4JGMA 5I1IH 1DANT 2ZNXA 5E9DB 2BRRH 4NHUA 1WZLA 5IB5A 1JYNA 3L5HA 3LIZH 2EE3A 2EKJA 3PXJA 4NQCB 5I8CB 3SDAD 5IW6B 5FCUL 4LSTH 4U1GC 3S37L 1SEBB 1XGRB 1S9XA 3QUKA 3VFGL 4MA8L 5GS1B 2GTZA 4X98A 1UVQA 1M7DB 4OZHA 3VFOB 3G5VB 1FZKA 1CLYL 2BSSB 4F57L 3IDGB 5ICXB 3MV9A 1BVLA 2IALA 3NIGE 5GGSA 3QUMH 3VXPA 1MAJA 4CU7A 1YEHL 4BZ1L 4Q9QH 2Z92B 1UQSB 2P24A 1Q94B 4NQXB 4U3CA 1VKXA 4TN9A 2ZWLT 2NW2A 2Q7YB 4L4VE 4FFZH 4PJFA 1F8TL 3HC4H 4N9GB 3EJZD 4MB4A 4RA3A 1PLGH 2KH2B 3IFOA 5H2BA 3TBWB 3IYLW 4P2CG 4HS6B 3MV7E 1HYSC 1CQKA 3IJSA 3ILPA 4LP5A 4XI5D 1X5YA 3SE8H 5IWLA 4P3DA 5FO8B 3G04B 3K0WA 2SEBA 4R4BB 1DQDH 4PJ9B 1KLGB 3O8XD 3ZKND 5IB3B 4GG6E 4U05A 5E08L 1PQZA 2HWZH 3O4LD 1XGQA 4LLWA 3BKJH 1CT8B 1QBAA 5I1CH 1MI5D 3T1FA 2D7PA 5CJ8A 3KPRB 4OGAC 4NFBA 1J8HD 1IKFH 3G6JF 5H8DA 1XCQB 5F93C 1IRAY 5I66A 4Q9RH 2IFFL 4U6HB 2VWEC 3T77B 2W38A 3RUGE 2JIXA 4PJGB 4CL7A 3N1FC 3OJ2C 5D1XC 4OFDA 4YR6B 4G7VH 4NJAL 2YPLA 5DD6B 5GGQH 2IADA 3O9WB 1ADQL 2J8UA 5I15H 3QRFM 1HHGA 2HN7A 3RNQB 3AY4C 3DUUA 5TDOA 3GJFK 5F71A 4ZTPL 1YPZA 1UJ3A 1FPTL 4MA3B 2QL1A 3VFMA 3QFJB 1MQ8A 3C8HA 5FUCE 4F80A 1CICD 3T2NL 1I9IH 1YQVL 4DEPB 4KAQH 1K2DA 2LQRA 4DCQB 3QDJE 3MODH 3RIFK 4E5XB 4HK0B 2RIKA 2OXHA 3BZFB 3EGSB 5INDA 1T4KB 5IEHB 4XPAL 3QQ4A 1TMCB 5K59E 3QDGD 1CGYA 3ME0A 3HPJB 2ADJB 2P46B 4UB0H 3CVHL 5CEZH 1CGUA 2FATL 4W81A 1NUFA 5E8NB 5TQ0H 3O41B 4P2RE 4WGVB 2H2SC 3BDYL 5EOTA 4Z7VB 2HKHL 1BM3L 1ITBB 5DC0A 5DEFA 1MFEL 4P2QD 3KJ6H 3MLTA 1IAIM 32C2A 4XVJH 4NZUH 2E7BA 3HNTH 3PV6A 5IVXE 1EEZB 3ZKMC 5E6IC 3MLZL 5IMKB 4LSVH 4DN3H 3N85L 5C0FB 3ISWA 2AGJL 1E4XL 5KAQF 1OD9A 2JJWA 1XGUB 4L4TE 1G7HA 4X6DB 4LKCB 4Z7UB 1OQOA 1MIEH 5E2WL 1E4WL 2GEEA 2J88L 4HV8B 4AENB 3CMGA 4XWGH 1MF2H 2VDKL 5IJKC 1EERB 5C71A 1J0JA 5I1KL 4ODHL 3MROB 3GM0A 3WNMA 4WFED 4HFWB 1RFDH 2JK5B 3OGOE 4N1HB 4QXWA 5JHLL 2FB4H 5HGDA 2ITCB 1A3LL 2IAMD 1MSPA 4OIBA 4NOFA 5F7NC 1NMAH 4UQ2B 3FB7A 1TJGH 4I77H 2VXVH 4F7CB 1FLRH 3MUJA 5D2NC 5DD5L 2GJ6D 3VXQA 1I1YA 3WNLA 3O2WH 5ITBH 1TTFA 1EK3A 5CILH 3EOAA 1G9MC 5I1EH 4P5MA 4M8QA 4D8PA 2VDNL 4I48A 1FVDA 4P9MH 3RZWA 2FO4B 2Q86B 1MLBB 1HDMB 1NBVL 4YHML 2WUBH 1BAFL 3WFCL 4YDIL 3TZVB 1MUJB 3P4OA 3MOAH 3OZ9L 4ZPVA 1AJ7L 4PRBA 5FA3B 1E27A 2F53D 2MTPA 4XTRD 4PV9B 3BMWA 3L5JA 3GDBA 1INEL 1KLFA 3T3ME 3AY4A 3FFDB 1S7RB 2ICES 3RWEA 3HC3H 4KK9D 3CH1B 2YMXH 3PGDB 2GTWB 3I3DA 4RZCB 2FL5B 4J3TA 5M7QA 1WF5A 1QYGL 3MOBL 3S3SA 4LDOB 1SVZA 5MEOA 3PWUB 4G8EB 3GIZH 4G9DA 4XMLH 4V1DD 5DD0H 1KG0B 2GFBB 4OZGA 2X89A 1AKJA 3RI5K 5D70H 1ZS8A 5GJSL 4EOWL 2XKNA 3SCMD 5GS2D 1I8LC 2R2EA 1HCFX 4KJQC 3P11H 1D5XB 2R4SL 2CLRA 4GQPH 2V2XB 2YXMA 1FZMB 3SO5A 4H1LH 5D1ZD 1UG9A 3GMMB 1M4KA 5HPMB 1A7OH 2BVUA 2WM0A 3TO4D 1PX3A 4M5ZH 1QSFB 3U46B 3SDDD 5SWQA 5DZLA 2UVFA 3CVHB 5EORH 1V7NH 4OSUH 4QYOB 4YZFE 3MREB 3TFKC 4QHNA 2F58H 3REWA 5E6IA 3K81A 4UT7H 5DQJB 5DJ2A 1ZE3C 1TZHA 1JK8B 4JRXD 4LQFH 4IOIB 1DBAH 4OLEA 4XMPH 1U8NA 1FNGA 4AEEA 3ROOA 4BZYA 1QLEL 1RUPH 1VACB 2C3HA 1XF4A 3KYKL 1ZVSA 1OGAB 5SWSD 5GRUL 5J13C 1EHAA 3GHBL 3L7EA 3D0LA 4HWZB 1I7ZA 4BSWB 3PABA 5F1IA 2ICWA 1DBKH 1MPAH 2P8MB 2WWKO 3TCXA 4AL8L 4NDMB 3QT2A 1ES0B 4NNYA 3IF1B 5ECJE 2OR8A 4HJ0C 2P7TB 4U4BA 2IAMB 4OFYA 3P4NA 2AJVL 5BV7B 4JQIL 4XBEL 5HHNA 4MDJB 4ZDHA 2BXZA 4J3WA 3MLRH 1NUNB 4C56D 2CR6A 1EUTA 4RGNC 3HMXA 3VXRA 4K3GA 3HHRB 4QOKB 2APWA 2EYTB 4F7TA 3O45B 4Y19E 5B3NA 5CGMA 1TPXB 2DIJA 1F3JA 1SYSA 4S1SL 2FGZA 1IM9B 2H26A 3D9AH 2OK0H 3MLWH 1QA9A 4ZQKA 2A1WH 4FN0A 1KGCE 1MAMH 4G7YL 1MCSA 3U48A 5K9QG 3EOTH 2NY4C 3JTTA 2C3VA 2FEEI 5KG9B 2HLAB 4UU9A 3FOMA 4CKVX 1MAKA 4JKWA 1U3YA 1HXMA 4Y16B 5MEND 3G08B 4HK3J 2B2XL 2B1HL 4FFWC 1EGJL 4YHKL 4AY0A 5EO0B 5AZ2H 1OTUD 1ORQB 3OB0H 1JGVH 1KELL 5JXAH 1L6ZA 3CFJA 1X44A 4ORGB 4NPYB 4LSSH 1IAOB 2Q76B 3MV01 3V0VB 1QHOA 1HH9A 5DQ9A 4RFOL 4J4PC 4WVRA 1VFBB 2UUDH 3KPRE 2FWOB 3AREB 2XXMB 3REVB 1I8LA 1NLDL 5DQDL 1BQSA 1EO8L 1MFBL 3ARGB 1JN6B 1ZXQA 2VLME 4B5EA 1HNGA 4P49A 4AMKH 3MRHB 5I8KL 4M43L 4P9HH 4PJGE 1OW0A 4QO1A 4OZFB 2VQTA 5DJ0B 3ZSSA 4ORZC 1H15B 3UZVB 2FJGB 4ONFL 1MVUB 1KPRB 4P59L 1IGIH 1QFWM 4K8RL 2MCG1 4J23A 2O5YL 3VD9A 1J88A 5LVEA 5B38G 1KEGL 3IRZA 3GGWB 5K9KB 1OTSD 2CDEB 3OJVC 4PUBH 3QFJE 4DK6A 2EYRA 1CFQB 3S35L 2Y6SD 4NKOB 4P5TC 3MRFB 4L1DA 1PZUB 2W07A 4Y4KC 4X99A 5JIPA 1A14L 3R8QA 5DXWA 4RBPH 4XP9L 1UWGL 4FQQB 4ODXB 1RJCA 5F7EH 3FT4A 5IM7A 2V9QA 5DZNA 5CSZA 3P77B 2GK2A 3HE7B 1NCTA 2UYLB 3EDKA 3DOSA 5DMGD 2VAJA 3RZCB 4U1IA 1IQWH 1UYWL 4Z7VE 2PYFA 1ZVHA 4LRIC 5B39A 3LN4A 2E8YA 3PQYE 5TPWH 1IGYB 2NY0C 3GSRA 4HQQH 2X1WL 5FYLL 1XCTB 4WUUB 1GCFA 1GHFH 3GI9H 2V2TB 3VGHA 1FFPA 1FH5H 3PHQB 2QQNH 4MS8D 2AK4A 3FQTB 5HD8D 1K6QH 1MCEA 4KTEH 5K33A 1JZ6A 2NMSA 3SE9H 2BRQA 4PLKC 3RWJB 1VERA 3QNZB 1NLBL 3MRKB 4X6DE 2CKBH 4Z7UE 3VFSA 2F5AH 3VFPA 2BSRA 1I8KB 1RJLA 4GSDL 5C3TA 2X4QA 1S8DA 2R1WA 1FO0H 4OAWA 1Y18B 4OZIF 4IJ3C 1LP9A 4J8RA 3IAPA 4I2XA 4RX4A 3O4OC 5E8EB 1VGEH 1A9BB 2XTJD 5KVGL 1LNUB 3DO7B 2QQLL 5B39G 3EYSH 1NCWL 3QP3A 1OAQL 4UINH 4AIZB 5JPMA 1EEQA 1IGFH 3W39B 3JV4A 2DQTH 4QRPB 5I8EA 4HUXA 3A6CL 3U30B 1NFDB 3RBGA 5E99H 3P9WB 4NO0D 4CMHC 5F72S 2J7LA 1JHLL 4NT6B 4ALAL 1OVZA 4GRLA 1P4BH 1T21B 5AYQA 5BQ7B 4MWFB 5HDQH 2XN9B 4P4KD 3ARRA 4YHYB 3CFCL 3D3VA 3QIBA 3AFLA 4K3DL 2BVQB 3H8NA 1FDLH 1ZLUK 4QY8B 3L3IB 2ED8A 5ESQA 1FV1A 4QF1B 1SY6A 4HS8L 5F7MC 4P23B 2Y1VA 4KK6C 3SPVB 2R1YA 3O6KL 1EXUA 3VW3L 2JJTC 3Q48A 3NIGF 3TYFA 4PY7A 1F4XH 4G43B 1QR1B 4YC2B 3WIFA 1DE4B 4HWBA 3QQ9D 4QRRA 1CIDA 2WBKA 4S1RL 5INCA 4YX2H 1DEEB 1MRCH 3VXNB 2IQ9H 2A6KB 5HI5D 4Y4HB 2VLJE 2C4FT 4M6OL 1ZAGA 2XZQH 3MRNB 4P2OB 1XT5A 4YPGA 4CVWA 4HIHA 1E6OH 2DMBA 5F7DB 1T6WA 3ZE0E 1A4KA 1PG7X 4Y4KA 1NUGA 3DRTB 4MD5B 2PNDA 3TPUA 1IEAB 2YK1L 5HYSA 1JTOA 1RK0A 4JO1H 2VXQH 3I6LD 4XP5H 4UUJA 5DJAB 2BVPA 5T3ZD 5E1HB 2J4WL 3SDCB 1KJ2L 2A6IB 1E6JH 1I1AB 3UTZA 4KVCL 35C8H 1S9KC 1NGYA 2F74B 1OF2B 2ARJA 4F7PA 1AXSA 4NBYB 4GAJH 4GG6F 2DQFB 4MQ7B 4FQ1L 4DZ8A 2N1KA 4KRMB 5EN2B 1AE6H 4Y2DB 3LPGA 4LSQH 4EVNB 1HYRC 4LRIA 2B1AL 1Q1JH 3QIWC 4I4WB 2FGWL 2C4FU 3QHFH 4XC3L 4GAGH 4UI2A 4Z8FL 3CFBB 5JW5B 4JM2A 4NQEE 4JO2H 3JVGC 3IFLH 4JN2A 1C1EH 4MA1B 5E94A 3VXUE 3EW3B 3RUGF 1JWUB 1KB5A 4OT1H 4N1CA 4AEIH 1G7LA 5HYSG 1MREL 3MJ9H 5ALBL 1UH3A 2HFFB 3BPLC 1OAZL 4NZTH 3O2DA 3LRGA 1JE6A 3EDJA 4QRUA 4XGZB 4AQ1B 4LVOC 4YDVA 3TCLA 4RQQA 3NZHL 5HYJB 1J1PL 4YO0B 4JVPA 1GZPA 5DJCB 5C0AA 1W0WB 3ZT7A 1OGAE 3RAJL 3C6SA 4MMXC 3SKJL 4X4MA 4PG2A 5FOBA 8CGTA 2YD2A 2MCPL 5DYOA 1K8DB 2W60A 4QT5A 5F9JA 2X6MA 4M7ZC 2A77H 3PWNB 4FQ2H 1UA6H 4O2FB 1T04A 4OI7A 4L3EB 1KN2H 5JW4R 3O3DA 5D9SB 3SDYH 4PTTB 4U1NA 3LDBB 2VLLA 3BESR 2Y5TB 4HAFA 5K59F 3GEWB 3UTSA 3QIUB 2ZSWB 2E5EA 2WZPD 3ZT6A 4BQ8A 2Q6WB 2Z91A 1DFBH 1MHPH 1XR9B 2OTWA 4HXAH 1G1CA 4W6XB 3VGGA 4NBXB 1ZGLB 1KC5H 3ARFB 4POZC 3T2QA 3DVFA 1BF2A 2EIZB 1UM5L 3OTTA 1T0MA 4IHOB 3EZ8A 5IFAH 3HI1B 1WEJH 3FFCD 3SOBL 5FYJH 3BKYH 4NWUL 4ZS7L 4ONGH 3GI8H 1X5FA 4WHYG 4KY1H 4MNQD 5BCAA 5FECA 3MC0A 5DJXA 3UYPA 3IXTB 1NC4A 3DARA 1FFRA 2JJTA 1JHTB 2QADC 3BOVA 5IVXF 5C09A 4XWOD 3V5DB 3ZE1E 2D3VA 4X8XA 3M45A 5D72H 2XIDA 4ZAKC 4HUUA 4XPFL 4H26B 3QNXB 5GGVH 1R3KA 5A16B 2FSEA 5BO1H 2DS4A 5KS9A 1U58A 2DIBA 5C0CE 2EC9T 2JE8A 3WFDL 1JNHA 4X80L 4CADA 2VL5B 3G9AB 5EUKB 4KUZH 1YEJL 5IGXL 2AKRB 4MXWH 3U4EB 3KS0J 2EE9A 4O02H 4XPGH 3GSNA 2LU7A 1N6QL 3BP6A 3CDCA 3FO1B 2NY2C 4XCYA 5TE7H 1QSED 4WO4A 4NRXB 3EHBD 5D7KE 1D6EA 1SBSH 1XH3B 3KGRA 5EUOB 5HDLA 5KSUB 1XF5B 5GGTA 4S10A 3ULVH 3SGKC 5C0GA 1MFDH 4NIKB 3VFRA 2Z0BA 1HCVA 3QIWA 1LK2A 5KSBB 2GW5A 1A6VL 1DUYA 2AEWA 5LAXB 3WXWL 4WENB 1W72L 2A74A 2EC9U 3JVGA 1Q72H 2OR7A 2R2BA 1YMMB 3QJHA 1KJ2B 4GW4A 3D39D 2DQGL 3LS5H 2GUOA 3NGBC 1U93B 3RVXD 4CJ0A 4NGHH 25C8L 2C3GA 2QEJA 3VD4A 4UV4H 1IT9L 1F4YH 5LWYL 1BVZA 2W9DH 1DSFH 1R6VA 1EFXA 1OP5K 1G9NC 4JO3H 1WBXA 3JWNC 3QAZC 4HDIA 4JZOA 5TE4H 2WINB 4R0LA 4K3EH 2W9EH 3T3MF 1INDL 1Q9WA 5EB9A 2HKFH 3UTTD 5IHZA 2X4NA 5F6IC 3UPRB 3MV8B 2YD8A 3P4LA 1TCMA 5CJOL 5CIPH 4QHLA 1P1ZB 4IRJB 2OZ4A 5HVFB 1H3PL 3EYFB 5JA8B 3FO0H 4IMLB 5SV4A 1NGQL 2FH6A 4E41D 1I1RA 5ID0A 5MEPA 3SDXB 1X9QA 2DBLL 2OQJB 1BD2A 2X1PA 3UJJH 4HGMA 2X1OA 3OKKB 4U1SA 4XX1E 3AUVA 5DJ8A 3B9VA 3VXSB 4HF5H 4JRYD 4KUCF 1T1XA 4PTUA 5GZNC 4WWKB 4NKMA 5GIRB 3VXMD 4MHHG 5T5FL 1LILA 3P30L 4Z7WB 3RFZC 1BZ7A 1MFAH 2OTPA 4MJIA 4K07A 5I71B 5LKNA 1YNTB 4XXCA 5FYKL 3VGAB 3EFFA 4X6EB 5H35A 4DOHB 5D7SH 1VEOA 4KROD 3HPLA 5I0DA 1P2CB 3G6DH 3ZKXB 3LQMA 3QCUL 3FTGB 5L0QB 1CLOH 3C5ZC 4YZFF 5ESAA 2VYRE 5E2UL 3OAYH 2NY1D 4X7SL 2FCBA 2YN5A 3ZMRA 4M6NL 4MQXC 1KBGL 3V6ZA 3BKMH 2VXSH 4W6WB 2VB5A 2K7PA 5EU5B 5HHXH 1A6WH 1Q0YH 1J05A 2EECA 3BGMB 3OBAA 4Y4FA 2VDPL 2A9MH 4QRPE 4L9LB 2X05A 4NJ9H 1YC7A 5CP3A 2ZOLB 1TQBB 5DJYA 1YNKH 1NFDE 3GSUA 5LGJA 3PP3K 4QGYA 4QXTB 2HYMA 3DPBA 5IIEA 1WBZB 1P4IL 4OCYL 1BECA 3HZVB 4ONHA 4XP6H 1X4ZA 5AG8A 3LEYL 5SWZA 5BVPH 4J3VA 4ZUVB 5GGVY 1KF9B 4WDIA 2EXWC 1MJ8H 3OJMB 2R9HC 1XGTA 2GCYB 4KRNA 2XN9E 3ARZA 2PETA 2KBGA 3HUJE 2XZZA 3V6OA 3SGKA 1M7IA 43CAA 4MD0A 3HRZB 3V6FB 5IESL 5HHVL 4KZEL 1HI6B 2VISB 3IXAA 4OZIA 4Y2OA 1EBAA 5AUMA 2VXUL 4PJXA 2BOBB 5FUCC 3QEQB 4LSRL 1ROWA 1OAKH 1BZQK 3LV3B 1U8QB 2CK0H 5E00A 4H20L 5IMLA 4X9HA 1KIPB 4F58H 1BD2D 1NBZA 4PJ8C 5E4EB 3K2MC 1U8KA 2LV4A 3KPSB 3DX6A 3GK8L 1WCBB 1LO3H 3NAAL 2HRPL 1GGCL 1PSKH 5JZ7C 3QQNA 5JO5B 2GJZA 1W72B 5ISZB 4HZAA 2NQCA 1H9VA 4UIMB 3BYYA 5DHYB 3KWWA 1QRND 1FVCB 1X5JA 3CXDL 2UY6A 1X5IA 2BNQD 3L9RB 1NC2D 5DHVB 2NXYB 4BKLB 4K7PX 1KEMH 2H32B 5C86A 5F89A 2L7JA 4I18B 3KLSA 1KTLA 1PDKA 5BS0A 2HT4C 4XCEB 1RMFL 2C7UB 3RL2A 4TOYH 2BX5A 3F7VB 4LLDA 1OGTB 2E7HA 5IQ9A 2A6DA 1IAIL 4APQB 1G7PA 2BMKB 1I3RB 3EYVB 2MWCA 4LHUD 2R0LH 3KPLB 4HKZB 3QG7L 1OCWL 3EDEA 1KCVL 4ZOBA 1OSPH 2AJXH 5T3XD 1ZT7A 1EUUA 2OMBA 4JPVH 4JE4B 2PO6D 4M7JL 15C8H 1JL8A 5CJXC 2W59A 1Q9KA 2E9IA 4PJGF 1T0NA 1M71A 1Z5LA 5JMRA 3IVKB 3L1OH 1YEIL 5EZJA 4R7NA 3V7AE 5FYLE 4FFVD 5J1TC 1BVKB 2MKWA 3MLUH 1LEGA 3V8CA 3B9KA 3WV0A 1OLLA 3GMPA 1ZLVK 4KI1A 3QZWG 2HTKD 1GGUA 3SGJC 2HT2D 1I7RB 3KHQA 4W4NA 1KJVB 4NSKA 3ARXA 5GRWA 3FQRA 5DD1L 4BH8A 3UTQB 3K2UH 1MJUH 4L5FL 4ZYKA 4L3EE 3GRWH 4DZBB 4GBXD 4XVSH 1BOGA 3GMNA 3W2DH 5CSGA 2DM2A 5E70A 3FCTB 1P7KB 2BY1A 1T0PB 4UQ3A 3OKEB 4LCUA 2NW3B 4LARL 5EU7E 5ADOL 5HHPA 3RUGA 5JHDD 3BAEL 4JDVA 5IV2B 4MNHB 3BUTA 2ZZUT 2PW2B 2WLYA 3IU3A 4I3GA 1N59B 1ZSDA 4FZ8L 4Z7VF 4JY5L 3V52L 5JDSB 1NAMH 1U3JA 2O5XL 4WEBH 5EZIL 1KIQB 2EIDA 4RAUA 5TGBB 2QLVB 1MNUH 5KSVA 2CDGA 2VDQH 3UJTL 4HHAB 2Z31D 2UWEE 3PUCA 2I5YH 4KMTH 1S7WA 2NY6C 3HE6B 3FQWA 1YY9D 4V2CB 3TA3C 3P9LA 5GRXG 3LH2L 3PGFL 5IROA 1Z6JT 2W92A 3QI9A 4OJFH 1FYHB 3UPAA 1HEZB 1WSST 4MDIB 2NTSP 4EDXB 2C3XA 4ZTOL 5GGRA 4FQIL 3MRBA 3U0TB 3QO0A 5L7XL 1LEKA 1UEYA 4X6DF 4IRZL 3ZL4H 4N0CD 4PJ8A 4Z7UF 4U7MA 3CFDB 4KRPC 1IBGH 2IH1A 1A7PL 4PJAB 1A1NB 4YQXL 5DVNA 3PL6D 1U8JB 1AFVL 4PB0L 4U3XA 3DURA 5MERB 5AZEL 2PKDA 3I6KB 3FB8A 4NQDD 5T1LD 2NNAB 5F9WB 4JHAH 5D7IA 5IOPB 4NCC1 4NN6B 3TVMD 4JAMA 4GG8A 2FIKA 5DUML 3V4VL 1WIOA 2RBLA 1N4XL 3WEXB 1MHEB 3FQNA 2X9XA 3T0ED 4FRWA 5DK0A 2BHYA 3HR5A 1XGYH 4H8WH 3F12B 3QDMA 1JGDB 1FGNH 1A47A 3TWCH 4I0PB 3HC0B 5EIQA 3RDTA 2MQ0A 4XT1C 2VKWA 1HKFA 4OLYH 5DD3H 3F7QA 3HFML 1YMME 1HIMH 2A73B 3B2VH 3AAZA 4PJCB 4KFZC 4WCYH 1CE6A 5KANG 1NL0H 2X4OA 4F37F 2C1OA 1FZJA 3TGXA 4PJ5B 1KPUA 5EU4A 3INUL 5KVEL 4XNYL 1D5MA 4L8DB 4R4ND 4NP4H 4GUPB 4N5UA 5DJ6A 4HKBB 4PJ7A 4E42B 1ZGLP 4N1EA 1AR2A 2ZSVB 3C2AL 4F9PC 3LQAL 2NR6D 5FGCB 3TBVB 2I9TB 4HPYH 4BH7A 5BJTB 1U95B 5EOCL 3R06A 1FRGL 3MV8E 2PF6A 3S37H 4RDQF 4G8GD 1UCBL 4R9HA 5IT2H 3D0VB 4MA7L 5FHBH 2E3VA 4MA8H 4MAYC 1Q9OA 4J1UA 5GS1C 3VFNB 3RGVB 3UO1H 3ZE0F 3QNYA 1CLYH 3LEVL 1K5NB 2IPKB 2XZCH 4PRPD 3T0AA 1YEHH 3S4SB 4BZ1H 5J9PB 3W0WB 1CK0L 3VXSE 1AP2B 3MFFA 2V9TA 3SGEI 1Q8MA 2BNUB 4JEGB 3O6MH 1QHPA 1JF5A 1NCDL 1G7IA 1W0VA 2DWDB 5HI4C 2E7MA 3O81A 3WL9B 1F8TH 2IEPA 1S7TA 4KI5E 1QR4A 4Q74A 4N8VA 3FMGL 4DOHE 1LO0H 1N2RB 1UKQA 5IK3A 1NPUA 5F3HB 4DAGL 1IL1B 4G9FA 2LAGB 4PJEB 1D5BA 1BX2A 3HMWL 1TTGA 4FG6C 4KMLB 3MLYL 1ZHBA 5IVZB 1P4LB 4YK4B 3HB3D 5ACMA 4M6AA 3ARBD 1LD9B 2IBZY 4IRSB 1MCHA 4FFYH 2AJSL 3SGEH 2YA0A 2BCKA 1YN6B 3V4PL 4FXGA 1U8LB 3WE6B 2W0KA 3I6GA 2OTUA 5EZLB 4I9WD 4YHOH 4UIKH 1RJZB 2IFFH 3TVMB 4N8VG 4DGYL 4PJIA 3RWHA 3BD3A 4ZSOE 2FECL 3NIDE 5IB5B 2IMNA 2GAZB 4NJAH 1F4WH 3SO3C 3KXFD 1A1OA 3QHTC 1F4HA 3O9WC 4U6YA 3H7LA 4XVTH 3MCG1 1S9XB 2L0DA 3QUKB 3WLWC 5LGHL 5AD0A 4ZTPH 1UVQB 3DV6A 1C16A 3JTSB 3IU4L 3C87A 1T03H 1PD6A 4IIQC 5DMJB 3I3BA 1FZKB 3LKOA 5C7XL 4QXUH 5I19H 1HINL 3MV9B 1BVLB 1KIRA 2IALB 3L3HA 5GGSB 4W4OC 3QEQE 1P7QA 3VXPB 4GW1A 1RD6A 1ZLUH 2P24B 1VKXB 3WHXA 1IGMH 1E4XI 2NW2B 1KNOA 3VXOA 4PJFB 1WV7T 3MNVB 1NEZA 1Q38A 2D7NA 5ALCH 4XXDA 4JN1H 2FATH 3TIEA 4AT6A 5H2BB 1GYAA 4WI6A 2FNBA 4JZNA 5T1DL 4F9PA 3ZE1F 5ISZE 1IC4L 4G6JL 1HYSD 3ILPB 1DCLA 4UT6H 3LKPA 2QSQA 2VLRD 3O3BA 1GGYA 4EJ1C 4P3DB 3PHSA 4JQVA 3U4BL 2HKHH 1RU9L 1DDHA 3TEUA 1NBYA 2SEBB 3FHQA 1X6LA 4ODWA 3RPIA 5F7UA 4MAYA 4J7RA 4QTIL 5I9QC 2XI9A 1LHZA 2VLKA 1PQZB 3UROR 4TTGA 3KS0H 5DT1L 1XGQB 1U2HA 1AXIB 4AG4L 1TDQA 2BNRD 3T1FB 2AJUL 4J12A 3BPOC 1XZ0A 3WS6C 4Y19A 1QRKA 3C60C 4PLJD 1E4XH 2IAND 2C1PA 5AYUL 4O5LL 3QBTB 4OM0H 5I66B 5HGGS 5DJZA 1T83A 4WNQA 3QUMA 5BV7H 2J88H 2F8OA 5GS0L 2JIXB 4MZ2A 1EV2E 2HTLC 3RY4A 3KYOA 2AI0H 2GY5A 3PWJA 3F6IA 5D1XD 4HUVA 4ODHH 2YPLB 2IADB 2BVTA 2BFVH 4IS6A 3QXAA 1S7QB 1JUFA 4PLOB 1HHGB 2HN7B 3M1BA 4Z77B 1T7XA 3Q6GL 3DUUB 2OJEA 5TDOB 1KJ3H 4X7FC 4YE4L 1YPZB 1UJ3B 5FK9A 1NSNH 1UWXK 1C7SA 2YD1A 1IKNC 5FYKE 3VFMB 4LFHD 1JZ3A 1NMCC 4CVUA 3OHXA 1BOYA 1K2DB 1DVFA 4M03A 5DR5L 4ERSL 2OMNA 4G8FA 2CMRL 4WI2A 5INDB 4IOSD 2VZ1A 3QQ4B 3IDNB 2NX5D 4GKNA 4Y1AD 3CFEA 1B0WA 2VDNH 4MJ5A 4WUKL 1AQKL 2P8PB 5C0NC 4QGTA 1NBVH 4Z78A 2DLTA 4PY8I 1A6AB 3OKDA 1RHFA 2H2SD 2FX7L 3D85D 3TZVC 5EOTB 3TNMA 1WAAE 2D7OA 3LPFA 5I8OH 2AP2A 1IILE 1KB9K 3P73A 1EHLH 3CLFL 1INEH 4PRAA 2B0SH 5D6DC 3ZT5A 2X40A 5FUOH 5DEFB 4CAGA 4JG0H 3MLTB 4IIQA 32C2B 1BJ1H 5GS2H 1YJDL 2YPKA 3ELAT 3QHZH 4IEFB 3ZKMD 3SBWC 1QYGH 3OF6A 3EOBA 4PRID 1EVUA 5EU3A 1I3GL 4OZFH 2QSCH 1QVOA 2VIRA 1G7HB 1LO4L 2GITA 5JUEH 3BT2H 3GMOA 3IFPA 2AK1L 3ULSA 5EC1A 3U9UA 4EOWH 3DTXA 2KPNA 4KJPC 2XWTA 3S36L 4XPBH 3RHWF 6FABL 2R4SH 2VITA 5IVNA 2GSGA 1CG9A 4TTDC 2Y36L 3RWCA 1T3FA 3KPOA 1BZ9A 2AJYL 3AS1A 3HMXL 2D7QA 2VR5A 5FV1L 3RWDA 3SKMA 5FF6A 2VOTA 4O9HL 2P5WA 1G9ML 3PQYA 3PGCA 3BP7A 4N90D 4U0RB 5HGDB 4EQ3A 3DV4A 3FB7B 4M62L 1DR9A 1NFDF 3WNKA 1FYTD 4M1DH 4OFKA 3NFPA 3VXQB 2M2DA 3FRUB 3C60A 1I1YB 1A6UL 4TQEL 3X3GL 5F96H 3EOAB 4P5MB 2BDNL 3BVNB 2IQAA 3CPLA 4TNWF 2C9AA 4M8QB 4D8PB 4I48B 2XYCA 1FVDB 1VPOL 3HUJF 1BBDL 1NCBH 1ZT1B 2DKMA 3TN0A 2CO6B 5DJDA 3QUXC 1NAKL 1A0QH 2VXTL 3P4OB 3FONA 3V4UL 2VDLL 5C9JA 4ZPVB 1E27B 1H5BC 4FP8H 1Z0MA 3WDIA 5ANMA 3NA9L 5F1KC 3S97C 5CP7A 3H42L 3GKWH 4Q97A 3LKNA 4YBQC 1CCZA 5HHOE 4JQIH 3RWEB 4LBEB 4XBEH 1KYOK 2H3NA 1IKNA 3N06B 5HVHB 1OP5H 4YXKH 5MP6L 3J7HA 4FQXD 5GRVL 5MEOB 2EDJA 4LEXH 1CU4L 3EJYC 4G9DB 4JR9L 2NTFA 1C5BH 4OZGB 4XNXL 1AKJB 4HUWA 2H41A 4JFDA 1GSMA 3EYOA 4Y1AB 1ZS8B 1Z9LA 2DOCA 5T5NF 4R4FL 4ZOEA 4S1SH 2RCSL 2XKNB 1FFNA 1JPTH 2XZAL 3FN0H 2QQKL 2R2EB 4EN3D 2VZUA 2I27N 4KJQD 4EBQL 3H9HA 2O5ZH 1RZKL 3DIFA 5JORA 1OPGL 3LRSA 5D1QA 3OB8A 4HUMB 1JFQL 5D6DA 4OCRL 1PBYA 2EDLA 4FHBD 2B2XH 2B1HH 3K7UA 5SWQB 1EGJH 4Q58C 4WY7L 4HS3B 5JTWA 3TFKD 2B8OT 2JELH 3VWJA 3REWB 5E6IB 3O11A 4QRSB 5DJ2B 1U6AH 1MI5E 3BP4A 1CI5A 1JP5A 1TZHB 2XG4A 3FO2A 1U8NB 4NNPL 3WIIH 3HTLX 2V9RA 3C2SA 2XKSA 4RFOH 1RZGA 1FNGB 3ROOB 4FNLL 4OFIA 2PR4H 1XF4B 5C9KA 4LSUH 4FQCL 3AREC 3B6SA 4XB8A 1V8HA 1ZVSB 8FABA 1MFBH 2NY5L 3L7EB 1A3RH 3D0LB 1DL7L 1I9RH 4M43H 3STZB 4Z0XB 3BUYA 5F1IB 2ICWB 3M07A 4NNYB 1AO7D 4WHCA 2VSDA 4HJ0D 4RGOH 4K8RH 1YDPA 3GB7A 4NQEA 2YSSA 4UAOB 2E7LA 1RIUH 3MOQA 3P4NB 1NCUA 2O5YH 3JWOH 4WFHD 3AC0A 1PKQE 2B4CL 4H1LA 1W2KT 2ESVD 1YMHA 3P40A 2D7TL 4OZHE 3VXUA 4ZDHB 3UYRL 1T7ZA 3BP5A 5IBLC 3G5YA 3GIVA 3MV9E 4HIXL 4LMQE 4RGND 3VXRB 1H8NA 4F7TB 1A14H 1BQHA 5TF0A 4OUOA 5D7JD 5DA0B 4TNVF 1UWGH 1F3JB 1SYSB 2OJZL 2H26B 1OAXL 1C08A 4PJFE 1IGTA 4OD2A 1OP3K 1QA9B 4ZQKB 2UWEF 3DNKA 3DUHA 5MHSE 2R8SL 3QUXA 3LKSA 1QZ1A 1MELA 1N0XH 3JTTB 1H5BA 1MJ7L 4TSBL 1OM3L 1TETL 3KR3L 4UU9B 3FOMB 3OX8A 4S2SA 1UYWH 2PYED 4KKLD 4LL9A 3RTQC 3B4NA 3CCHA 2DKUA 4FFWD 3WUWA 3MCLL 4H1LG 2P45B 1HHHB 1K3ZA 2PXYC 3TC9A 1F58H 4BQ6A 2RR3A 3QWRD 1HK6A 5MI0C 3CFJB 4WTXA 5DK3A 1YZZA 2YEZA 2Q8BL 5DFVC 1HH9B 3VDBA 5DQ9B 3HNVH 4Q7DA 4J4PD 4TUJA 1X5GA 1S9YA 2WW8A 1LDPH 5FOJA 1MCIA 2DLFL 2EEAA 5CZVH 5D7LD 4GT7A 3VXTA 1I8MB 4HWBL 4KKBC 2LVCA 1CWVA 4GSDH 2X4RA 1KIUA 5HHQB 3TM6A 3VFTA 3LKRA 2E6PA 1IVLA 1N5YL 3WUWG 2VN7A 2ZUYA 4O2EA 2BVYA 3ZDXE 2J8UE 4M48L 5F21B 4AEHL 5C08A 3GHEL 4P99A 5D71L 1YPZE 5C0CA 4L3CA 5DUPL 2FHFA 1GGBL 3VFWB 5C0IA 2DB8A 4P5TD 2R0ZH 1ZLVH 4X99B 1UENA 3DGGB 5IM7B 4WEMB 3HRPA 5C07A 4P5KA 4ZFGL 4YHYC 5CSZB 2GT9A 4M1CC 2F53E 4HS8H 5IMOA 5GISL 3GBNH 5GPRA 1FSKC 2HRLA 2W9LA 4U1IB 1KB5L 5EBGA 2KL6A 5L6YH 4TSAL 2D0GA 2PYFB 4OKVA 2BSED 2AV7B 3O2DL 4L3AA 1ZLSL 5B39B 3LN4B 4P46C 4LPXA 4XCFL 3NOIA 2NY0D 1MQKH 5T3ZH 4S1RH 5EOCJ 3MLXL 5LQBH 1FG2A 1EAJA 3DGCR 4Y4HC 5IEKA 1FFPB 3LS4L 5J1SC 2ZUVA 4KI5F 2Y07H 4YXLL 1GZQA 2AK4B 1OARL 4P2OC 5A1AA 4RFNC 1D6VL 4PLKD 4OQTA 2YK1H 4P3CL 2OXGA 4O4YL 3KDMA 1HH6A 1LVEA 3VFSB 3BQUC 4Z95L 3VFPB 4OF5A 2BSRB 1RJLB 1KJ2H 2DYPD 1S8DB 4KVCH 2R1WB 1AHWC 1AR1C 1I1AC 2NY4B 1LP9B 2A0LC 4J8RB 4ZFFA 3MRLA 4FQ1H 4I2XB 2CRZA 4KK5C 4JFEA 5DMKB 3RTQA 2DQEL 4YGAB 2R4RL 1P53A 1YYLL 4CVXA 2N7BA 2FGWH 1P69B 4XC3H 5JPMB 3DVGA 5T1KA 2EH8L 2PXYA 1TENA 1UXSA 4D0DA 4Z8FH 3JV4B 4BFIA 4HWEL 3V0WL 2VNCA 1KULA 5I8EB 1JPFA 4HUXB 4D3CL 2M8XA 5EULV 2X09A 1IGCL 3QUYA 1RZJL 2QSVA 3BKCL 4IDLA 3RP1A 5HVWA 4XC1L 2MJWA 4HX1B 4JFPA 3NH7L 2AJ3A 3F58H 1PY9A 1MREH 3THML 1RURL 2X70A 2XPGA 4I3RL 3NIDF 2QKIA 3SJVA 2A6JA 4GRLB 3MRJA 1MCWM 5KJRL 4Y8AA 4JFQA 1A1MA 3NZHH 4U0QB 1YEKH 1FQ9C 3D3VB 3QIBB 3OG4B 1ZHKA 3CDFA 2AABL 2JB5H 5ESQB 1FV1B 4UTBL 3DROA 4R2GC 2NXZC 5IBUB 4BUHA 5KSAC 4YGVA 1QLFA 2R1YB 4EKXA 1EXUB 2MCPH 3RVWC 4QEGA 4WFFD 3GUTA 3EYQD 3TYFB 1BBJA 1R24A 4PY7B 5CCKL 5I16B 1CR9L 1PG7H 2GK0A 4N0FB 4R8WL 3NCYS 5F8QC 3GSNL 4QRRB 1BQLL 1B2WH 1RZFL 2CLVA 4ZUSA 3C6LD 4K3JH 3MJ6A 1WJ3A 2NPLX 4R90L 5DGRA 1VESA 4X8JA 4LIQL 3QIUC 4X4XA 5GGTL 3MRMA 4YPGB 3SQOH 1QKZL 4HIHB 5EU7C 5JOPD 3S5LA 1A4KB 4Y4KB 1TNMA 2DI7A 2YD9A 2XA3A 3TPUB 1F2QA 2HLFC 5EA0L 5HYSB 1AGDA 4OZGE 1FNHA 1RK0B 1LMKA 4OLWL 4UUJB 2BVPB 4G6KL 3AU1A 5I75C 1JMZA 5JXED 1CF8H 2W0LA 1MHCB 4ZS7H 1IC5L 2YBRA 5K9JH 1NGYB 2ARJB 4F7PB 1JZ4A 1AXSB 4R96B 2FX9L 4XNUL 5I30L 1T1YA 3BGAA 4DZ8B 3CJJA 1EHXA 5MENE 2EYSA 4D9LH 4P46A 2H1PH 4WJ5A 3I2CL 2CXGA 1XIWA 4XPFH 4JM2B 3BZ4A 5ACLA 2F8XC 3KAAA 3AMKA 4JN2B 5E94B 3S5LG 1U0QA 2FIRT 1XGPA 4MJ4A 2GQHA 4B7LA 3ULUL 1V7MH 1KB5B 3GBLA 3JV5A 1RQ5A 3VG0H 1G7LB 1S7XA 4YXHH 4Z5RA 2JJSC 3K4ZA 1SM3H 2OZ4L 5KW9L 5I18H 3Q1SL 4QRUB 4CVZA 1AGBA 4YDVB 4D9QD 3TCLB 1KCLA 4RQQB 3BQUA 4HWUA 5JIKA 4TUOB 4Z76A 3KPQA 4F7EA 2MKLC 1GZPB 4HSQA 4S1DC 4EI5D 2F19L 5C0AB 1AHWA 4ZXBC 1CDGA 1NGPL 3C6SB 4KQ3L 4LCWD 1KTDA 1YUHA 1RZ7L 5FOBB 3O4OB 4PRHA 3KPMA 5DYOB 2F54D 2AEPH 3BSZL 2W60B 2WSKA 4QT5B 5F9JB 3X13A 1A6VH 1G7QA 1T04B 4LCYA 4U1LA 4DGIL 3WXWH 5EBLA 3NCYP 3WYRA 4OBRA 4S1QH 5JW4Q 3O3DB 1W72H 3GSVA 4U1NB 2VLLB 2HMIC 3DO3A 3UCRA 3UTSB 5EPMA 1EVTC 1X6NA 5DRXA 1DUZA 1TZIA 4GKSA 2OTWB 25C8H 4CMHB 4KHXL 5EC2A 3HG1A 2H32H 4POZD 3EO9L 3RU8L 1IT9H 3VXRE 1T0MB 4YUEL 3K8MA 2CUMA 1AY1L 1WAAF 4PV8A 1OY3B 2MQCA 3AXLA 3VG9B 5CZKA 4TSCL 1INDH 1NH6A 4B0MM 1T22A 1B0GA 1T6VN 3MQIA 5FECB 3MJ9A 5DJXB 1NC4B 5CJOH 4URTB 2VDOH 2QADD 3MGTB 2AERT 4K7FB 5C09B 5DUBA 2YUWA 4IRJC 4DQOH 2YD6A 4JPKH 4ZAKD 1NGQH 3H9SD 4HUUB 2ZUTA 2DBLH 3X3FL 2NCMA 1R3KB 4ZFOA 4JPWL 2FSEB 3DHMA 2AEIT 3VE0A 5KS9B 1U58B 2CIIA 2J2ZA 5C2UB 2FEDC 1HXYA 4R7DA 4XP1L 4L8CA 3MTRA 4PGZA 4WWKC 4XHJC 2LAAA 4CADB 4LASH 4KI5C 5DLML 3GSNB 5FYKH 2I07A 1DQJA 3BP6B 4JKLA 4RSVA 3VGAC 2HH0L 2ED9A 2NY2D 4XCYB 4WO4B 4HBQA 4KMQA 1D6EB 1M7XA 2HAZA 3QCUH 1XF3A 2UWEA 1ZTXH 5IR1A 1FL5B 4UDUA 5I1HL 5C0GB 2NLJA 3VFRB 2P5ED 1PKOA 3QIWB 1LK2B 4BUGA 4M6NH 1DUYB 1KBGH 3VWKC 1C8PA 3T8XA 5KVFH 2PUQT 1FAIL 4HJJL 1CYGA 2A74B 4Y5XA 1CXLA 2R2BB 4GW4B 3QJHB 3LD8B 2V2WA 3BW9A 1AGFA 4WW2A 1RI8A 2WBJD 2GUOB 2YD7A 4L9LC 1NDMA 3HZYB 3BPLB 2ZUUA 1JF6A 1U8IA 1CD8A 1P4IH 5D2LA 4JFFD 3IAGC 3SKUD 3LEYH 1F6FB 4U1JA 4JFXA 1WBXB 4HDIB 4JZOB 5L2KD 1Q9WB 3SQBA 3IETA 4ZXBA 1TJHL 5IHZB 2X4NB 1TLKA 4NKDA 4LGRB 3LAFA 2FYYA 4TPRL 3GSQA 1PG7W 5IESH 4X4ZA 1EO5A 3K4DA 4QHLB 1R5WA 2R56H 4RMVA 2JLLA 3N0PB 5ID0B 4RISL 5MEPB 4LSRH 1Z3GH 5D93C 4LLMA 4X9FA 2FD6H 2JB6A 5DJ8B 2IG2H 4H20H 3WMSA 4NFDA 5GHWL 5I2IA 3A67L 1T1XB 4PTUB 2MNUA 5DF0A 5J56B 3D2UD 5E4EC 2J1KA 5CBAA 4L4VD 3RWFA 3GK8H 4RWYL 2AK4E 1BZ7B 3NAAH 2HRPH 1INQA 4MJIB 5C6TL 5EOQL 1CFBA 2N7AA 5ACZA 4N0UA 5HYEA 3HPLB 3B2UD 3MV7D 2DKSA 3UZEA 3O6FC 1CDUA 1A6TA 3C5ZD 1QFUL 4MX7A 5T3XH 5IFHH 4LPUA 5ESAB 1LP9E 3GJFA 4I2XE 4I18C 3V6ZB 3ESVF 5IB2A 3OGCA 3B5TA 4OV5A 1CFNA 5IQ7L 1YECH 3NPSB 1JNLL 4M9PA 1J05B 4APQC 4PRDA 1KXQE 1MCRA 5ESVA 1D9KD 2VZ3A 2P1YA 5DJYB 3GSUB 5LGJB 1QSZA 3DMMD 4OGYH 3QB7C 4ONHB 2CGRL 1OAYL 3E0GA 5TE6L 4WDIB 4M4PA 3VCLB 4FQHA 4LNVA 1B3JA 1OTTC 1NCAL 1YEIH 4X6CA 5HJ3A 1NFKA 5GS3A 3ET9F 5KTEL 1XGTB 4ODSL 5JLZB 3D3VE 1IC7L 1QEWA 1M7IB 43CAB 4YDKL 4DTGL 2P5EB 5JW3L 3IXAB 4OZHF 4CDHA 4OZIB 4U3HA 5JR1H 3PDDA 2DAVA 2D2OA 1KOAA 3U82B 5AUMB 4F8QA 1G6VK 4PJXB 1PJ9A 1IFHL 2DQUH 5C0BD 3VFUA 2MOVA 5E8DL 5E00B 3PV7A 5CHNA 5IMLB 4QRRE 3QDJD 5CJQL 1F6AA 2FZ3A 1NBZB 1QG3A 3QSKB 4PJFF 4A6YA 4LARH 4KVNH 1F42A 4M61A 5J89A 1QFHA 1U8KB 5ADOH 3DX6B 2D4FA 5JIIA 4K7PH 1EIBA 4Z7OE 2GJZB 2F5BH 4C54A 4ZSOA 3QAZB 4CRPA 4P2RD 4FZ8H 4ZD3L 2ICEA 2O5XH 2W0FA 3VGEA 5EZIH 5ID1B 3GSOA 1ZEAL 4JY4A 3UJTH 5F3BA 1LE9A 4I5BA 3EO1B 1Y0LA 5F89B 5CD5C 1KTLB 3HE6C 5BS0B 1T5XA 3PNWA 3LH2H 3PGFH 2HT4D 2JCCE 3RL2B 1WZ1L 4LLDB 5I73C 2YRZA 3TT3H 4ZTOH 3NABL 5IQ9B 2A6DB 4GW5A 1G7PB 4K2UH 4UMGA 1EZVX 3MXWH 4L4TD 2YA2A 1ZT7B 3LMJH 3BE1L 4PB0H 5F70A 4LU5L 3RRQA 1Q9KB 1T0NB 1M71B 1Z5LB 2ADFH 1RAMA 3MJ8A 5F9WC 3W11D 4NN6C 5DUMH 3V4VH 1N4XH 1KXVC 5EZJB 1UCTA 4R7NB 3ZDXF 2J8UF 1NGXA 1LEGB 2HVJA 4ZG1A 3B9KB 3GMPB 3L5WB 3QEUA 2V5TA 4RMRA 5C0AE 5J1AA 4GRMA 4MJ6A 1X5XA 2UUDK 4X4ME 1YPZF 3SY0A 3TYGL 4NSKB 3FQRB 4I0PC 4BH8B 3GNML 4ZYKB 1I85C 1N3NA 1FC2D 3D39E 4JQXA 3DXAD 1BOGB 5C70A 3GMNB 5DSCA 3BD4A 4K55A 3D87B 4UQ3B 4OIIL 4LCUB 4LDLB 2X1XR 4M7KH 5HHPB 3RUGB 3INUH 1V5JA 4PGDA 4JREC 3IU3B 1P9MC 1ORSA 1ZSDB 4YDLC 5T33H 4NQCA 1N7ML 3UTTE 5I8CA 3VRLE 1NMBL 2V7HA 4GJTB 5LXGL 5DK2A 2WQ8A 4RAUB 5EU6A 1SEBA 4OCWL 1BIIA 4OD3L 4NYLA 5KSVB 3T4YA 3TV3H 2D03L 1CVSC 5CKAA 3D69B 1TJIL 1S7WB 1IC1A 1UCBH 4Z6AT 1IARB 3FQWB 3FQUA 3P9LB 3TA3D 3B3IA 4MA7H 3VMPA 2BY3A 4E41E 2BSSA 5A2JH 4WHDA 5C09E 3MACL 3QI9B 4I3SL 3LEVH 1YEFH 2M1KA 3RGVC 3ZSTA 1OP3H 5GGRB 1VENA 3MRBB 2E6JA 3QO0B 3SE4A 3I50L 1LEKB 3MBEA 4PJ8B 1JF1A 3ARDD 3VXME 2IH1B 2HJLA 2HG5A 2BOCA 5KS9E 3D25A 3S3PA 3T1WA 4OTXL 3RY6C 3DURB 2AXFA 3FB8B 5BRZA 3S96A 1QBLH 2VQ1A 3GRWA 1P84J 4G5ZL 1ZHNA 3HCVB 4OUUB 4Y5VC 4JAMB 4GG8B 4PJBA 1RULL 2FIKB 4FQJH 1WAAA 3FMGH 4L8SA 3KYAA 1MLCA 2FECI 3FQNB 4ZS6C 2P4AB 1FIGL 3NBNA 5DK0B 1MFCH 5FKPA 3HR5B 4LIQE 4NRZA 3NCJL 3QDMB 3PG2A 4K7PY 1U3HD 5L88L 1TFHA 4AQOA 1F11A 2DI8A 4GO6B 1NAMA 3RDTB 4BELD 3HNSL 5E2TL 3QUZD 4TRPH 4ZO6A 1H0DA 4WHTA 4IRSC 2FLBT 1HSBA 4PP2A 1EMTL 1OAUH 4DN4L 1YEEH 3DX9A 3AAZB 1B4RA 1CE6B 4HLZH 2X4OB 3PWPA 2VSCA 2C1OB 1UZ8A 2DF3A 1FZJB 4FTVA 3IJYA 5E5RB 1ACYH 4TVPH 1NCCL 1KPUB 5EU4B 5I1IL 1D5MB 2BRRL 2NZIA 5DJ6B 5IF0A 2GJJA 4PJ7B 4DGYH 3S8WA 3LIZL 4LNRA 3V95A 3MRQA 5E9DD 2YWYA 4BH7B 4LLUA 2X4UA 3R06B 3L6FB 4JFOA 3ULUE 3DSNA 4M93C 4FZEH 5LGHH 2VDML 1Q9OB 4J1UB 4LRNL 4RMQA 3WCYA 3KLAB 3QUML 3QNYB 1XF2B 2PTVA 2RFXA 1HINH 2PW1A 5GGSY 1CGTA 4OZGF 1BD2E 1RZIA 1LEIA 2EDRA 3MFFB 2IJ0C 3H9YA 4Z0BL 5GGUA 3OR6A 3HC4L 1G7IB 1OD7A 4HFUL 1W0VB 4F3FA 5I0ZA 1PLGL 1UFUA 3GMQA 1O5DT 1P9MA 2CSPA 4DUXA 1KGCD 2Z8RA 4M7LL 4MJIE 5GRYA 1QRNE 4GRWH 4N8VB 3SDAA 3OQ3B 4I0CC 2BNQE 4G6JH 2R69H 5IK3B 4LSPH 1UB5A 4G9FB 3UTPE 2H2PC 1D5BB 1BX2B 4BQ9A 5IWLC 2NY6B 3DVNA 1DQDL 4KH2A 2R2HA 5I1AA 4FG6D 1ERNA 1Q0XL 2Y4SA 1CGVA 2OP4L 5DO2D 4YHLL 1CIUA 1ZHBB 2HWZL 4OLUH 3B8SA 2OL3B 1H3WM 3BIBX 4QTIH 4OZ4A 4PJ9D 4XP4L 3BKJL 2D0FA 2Q20A 4WIQA 1S5IH 3WDJA 5I1CL 1IEHA 5DT1H 4G80A 3QXWA 4AG4H 4X6BA 5EIIA 4KJWC 1QNZL 3LQAC 3S37X 2AJUH 4KRPB 2XXCB 5EBMB 2DL2A 1IKFL 2BCKB 2DWEA 1A02N 3E3QE 4FXGB 4Q9RL 3KPRD 5AYUH 3I6GB 2OTUB 3TO2A 3FQXA 1FGVH 4HC1H 2OX5A 4PJIB 3RWHB 4LGPB 5SWZE 2X4PA 1BF8A 1JHKL 1JI1A 5E8OA 5I15L 1A1OB 1AGEA 1TVHB 1QQDA 4XAKD 1CD9B 3O9WD 5AAWA 4U6YB 3O8XA 2WIIA 3RJQB 3V6OE 2P49B 1OSZA 1NQBA 3O4LA 1J86A 4UQ2A 3WLWD 5AD0B 4YE4H 1C16B 1UJ3C 1MI5A 3LKOB 1I9IL 1FBIH 4KAQL 3WNOA 1FZOA 4JDTL 3L3HB 4PJXE 3RKPA 3QFJD 6CGTA 3MODL 4HIIA 1P7QB 1J8HA 2V7NA 4GW1B 3WFBL 5DR5H 2ICWI 3TT1L 4GH7B 3WHXB 1GOGA 3PDOA 4DW2H 4UB0L 1KNOB 3VXOB 1DQLH 2FO4A 2IF7A 4KJYA 5CEZL 3O6LH 4HXBH 2Q86A 4X7TA 1NEZB 2H9GA 5TQ0L 1QBML 3FOLA 4WUKH 1AQKH 5CJBA 5ICZA 1KB9J 1GAFH 3TIEB 5HDOA 4AT6B 2FJHA 1CL7L 4ODTL 3R1GH 1H8OA 2D0HA 1VGKA 2FX7H 4ZUUA 3RNKA 4QNPE 4JKPL 1MEXH 3DSFH 1DDHB 1K4CA 1NBYB 1I7UA 3G5ZA 4ODWB 3RPIB 4XVJL 4MAYB 1PKQA 1CICA 3HNTL 2FL5A 5BS0E 3NACL 4LSVL 4DN3L 3UXFA 4ODUA 1CLZH 3EOYG 4G8EA 1HHIA 2VKXA 1KG0A 4ELMA 3DHJA 1XZ0B 3QDGA 1I3GH 5BMFH 4F9LA 4Y19B 4O58L 4KZDL 3UDWC 1NGWA 2YXFA 2C1PB 4OI9A 5LBSH 4NQDE 1DANU 1G7MA 5DA4A 3SCMC 3QPQC 1MF2L 4XBGB 2ATPA 5DJZB 1F6LL 4WNQB 3QUMB 5IMMB 1PZ5A 4FQPA 3S36H 1Z2KA 2HTLD 3KYOB 4PLNC 5HPOA 5D1ZC 4X4YA 3L3DA 4HUVB 1Q9LA 2Q8AL 3T4AA 3LRHA 1I4FA 1FHGA 1EH9A 4IS6B 3U46A 2QHRL 3QXAB 4O9HH 1U36A 1JV5A 2FB4L 4P2QA 3S9DB 1JUFB 1G9MH 3M1BB 2OJEB 4U0RC 5FK9B 1O7SA 1UKSA 4Q6YA 3MR9A 1LQSR 4M62H 4NN5C 3WD5H 2KZ1B 3IS1X 5E2VH 2AJZA 2DQCH 2D31A 4DFHA 2NY3B 3L95A 1ZANL 1NGZA 3O2WL 3OHXB 5CILL 1DVFB 1A6UH 5F7HA 5I1EL 4G8FB 4TQEH 1F5WA 1OHQA 3S7GA 4JKMA 4P9ML 2CUIA 4HGWA 4GKNB 3CFEB 1KCUL 5C0RL 2I60H 3I9GL 5A3IC 4MJ5B 3VD7A 5F9AC 1BBDH 3K3QA 4DUWA 3MOAL 4Z78B 2EDDA 2P8MA 3OKDB 2ZKHH 4KGJA 4PBWD 4XB7A 4MQTB 3SO3B 3TZVD 3CFKA 3QDHA 3TNMB 2CXKA 1VFAA 3P73B 2YN3A 4PR5B 2IAMA 2MFNA 2EDTA 5HI3D 3LKQA 4MXQD 1RUML 5DMYA 2OSLA 2M26A 4IIQB 3IKCA 2ENYA 3MJ7A 5GS0C 1UACL 2YPKB 2GJ6A 1J0HA 2VLJD 1RV6X 1L7IH 1BEYH 2YWZA 5BVJB 5HVHC 4JO4H 3BH9A 1LK3H 3EOBB 1RIVL 5EU3B 3H3PH 3FL7A 1CU4H 3MYJA 3LN5A 5D70L 4JR9H 4ZOAA 1LGVA 4NFCA 4XNXH 1QVOB 2VIRB 4AH2A 2GITB 2EO9A 3TIDA 3GMOB 3IFPB 2KQNA 3DYMA 1HNFA 3X17A 5L9DL 1U8HA 3ULSB 4R4FH 5EC1B 3U9UB 3DTXB 3P11L 3JV0A 2HVKA 3J8F7 5IJVA 5GRZA 2XWTB 5AEAA 5EH1A 4RGMC 3CU7A 2F53A 1LP9F 5D7IE 2VITB 1F00I 3OJDA 3S88L 1CG9B 3U7YH 4EBQH 1QPXA 1U91A 3RWCB 1T3FB 3KPOB 1BZ9B 4CNIA 3NPZB 3SKOA 4M5ZL 3RWDB 1OPGH 5FF6B 1JFQH 2CRYA 2P5WB 4QXGL 3PQYB 3PGCB 4OCRH 4OSUL 5EO0A 3BP7B 4XNZC 1IE5A 1FL6A 1QSFD 5IHBA 2DM3A 1F2XK 2EDQA 3QDME 5I9QB 4WY7H 3VD3A 3DV4B 1YN7A 3HI5H 2JF1A 4WI7A 3QCTH 1MFNA 4LQFL 1DBAL 4OQ1A 4LCIH 4V1DA 4ENED 3NFPB 4ODBD 3X12A 3BPOB 1D5IL 2HT3C 4HKJA 3C60B 4OV6F 3UDWA 3OAYK 1RUPL 3T0VA 1SMOA 4XPTL 1BFOA 2LTQC 2IQAB 2EE6A 3CPLB 3SCMA 3SEPA 4FQCH 1JN6A 3PDGA 3UBXA 4MMZC 1G6RH 3TH4T 3TN0B 1YJDC 2NY5H 5D1ZA 1OGAD 1WBYA 5DJDB 1DBKL 1DL7H 3TO4A 4PJ7E 5C9JB 3IDUA 3LN9A 3SDDA 1JPSL 1N8ZA 5ANMB 4F15B 5ENWB 5CP7B 1YNLH 2W0PA 3LKNB 4UAOC 5J6HA 4JG1H 2H3NB 2WAHA 4JRXA 3MLRL 1RUKH 4ZNCD 1V05A 2D7TH 3BO8A 3U7WH 1NMCB 1EAPA 4Z7OF 1GXEA 1J5OH 2V17H 3EJYD 3MZGB 2PCPB 1KPVA 3MGOA 2ARJQ 4HUWB 4JFDB 3EYOB 4QOKD 3UBXG 5SWSA 1ND0A 3D9AL 2ZG3A 4XCNA 2CJUL 2A1WL 2OJZH 1I9JL 1KCRL 1TNNA 1FFNB 3CMOH 4OZFG 3EOTL 3HZMA 1IM9D 2R8SH 5F7LB 5DMGC 3W5MA 2ZOKB 3MRCA 2OI9B 3RZCA 2JCCF 2X10A 1MJ7H 2PTTA 1TETH 5JW4N 3DIFB 5JORB 3LRSB 2JJVA 4U49A 4PGJA 3VJ6A 4G9FE 1MCKA 4ZNEA 5I76A 2P43B 4KHTL 1T7YA 3RWGA 1U41A 4JM2F 4AJ0A 5AZ2L 4Y16D 5HGBA 1JGVL 5JXAL 2VLJB 4LF3A 3QWOA 4C56A 3A6BL 3RGHA 3VWJB 1U2CA 3O11B 3BP4B 3TNNA 3FO2B 5C0EA 2Q8BH 1SY6H 4OIAA 2DTSA 4UNTA 1J18A 1RZGB 1A4JA 1EBPA 3WUZA 3LEXA 4HJGA 3ARED 2ORBH 4HWBH 8FABB 4AMKL 3KNBA 4P9HL 3CXHJ 5D7KD 2FEEL 2AXJA 1T1ZA 2LFGA 3ARGD 2X5PA 3VGFA 1YYMH 4PJIE 3BUYB 4N8CL 2XTJC 4R26L 5MENA 4DWHA 1OW0C 2W1NA 2ICCA 3IFNH 4WWID 1KTRL 1IGIL 5HY9B 4PGCA 5HYFA 4NQEB 3GB7B 4OQTL 2YSSB 4K23H 2J6EH 4U1MA 2UZIH 4Q2ZA 5D71H 1YMHB 4PUBL 3VXUB 1A9EA 3BP5B 5DUPH 5IBLD 2IWGA 2YRPA 1MHHA 2GY7B 1RZKC 4LQ1A 1HOCA 1XR8A 1J0KA 4LVEA 3HR6A 4HH8A 2E9BA 3VRLF 4LLQA 5F7EL 5BQ7A 1BQHB 3BGFC 3QH3A 1L7TH 4P4KC 1SVCP 3OKOA 2XQBL 3FO9A 3U7AA 1C08B 1QP1A 1IGTB 3Q5OA 4OD2B 3QUXB 3LKSB 4CW1A 3DWTA 1H5BB 3HE7D 5CD3A 2ZG2A 5GISH 4UOJA 3OX8B 4U31A 1CFSA 4S2SB 3SKNA 1JRHL 1KB5H 2OR9L 3RZCD 5LJYH 4TSAH 5CINL 1R5IA 4MCZA 3CCHB 1JGEA 2VRAA 5HI5C 1SBBA 1GHFL 3GI9L 1QFOA 5KS9F 5LCVH 1J0YA 4OI8A 2NY5C 1FH5L 3F5WA 3MRGA 2QQNL 4WUUD 2VLKE 3X14A 2H45A 1K6QL 4KTEL 4YXLH 3SE9L 5CEYA 1GC1C 2NY7L 4TUJB 1VEPA 1S9YB 3MLVH 5HGAB 3KPPA 4PJHA 1N5AA 3CK0L 2F5AL 2UY7A 4FQLL 1X4YA 1H8SA 4Z95H 4WU7A 2B4CC 1RUQH 2X4RB 4XAWH 3S35X 2W65A 1J87A 4MJ2A 3VFTB 3LKRB 5GSRA 5B4MD 2I9LB 1UZ6E 3JBG7 1R3JA 4UINL 5FYKU 1A21A 2J3SA 2DQEH 4N90E 4JFZL 3CFBA 4O2EB 2J8HA 2DN7A 2DQTL 2EH8H 2ADIA 4HWEH 2MMXA 3E8UL 5C0CB 5LG1A 1BREA 4QRPD 3MRIA 2FR4A 3GJEA 5E99L 5B38A 5TH2A 3BKCH 4R6UA 4HBCH 3EO0A 3C8DA 5C0IB 4UOW1 5ILTH 3QEGH 3AB0B 4XC1H 3NCBB 4X9IA 3IJHA 1P6FA 2ZUXA 1P4BL 5DTFA 3THMH 4I3RH 5J6GA 4GRLC 2COQA 3DVIA 4GS7B 3RKDD 5C07B 4P5KB 4HAGA 4QRTA 5FO9A 3WO4C 2XN9D 3ULUF 2GT9B 3QIBC 3U0WL 3FAXA 1II4E 4UTBH 5IMOB 4FXKA 4JM4H 3PWNA 3QRGL 4NZJA 4P23D 1F4XL 5JDJA 4FOMA 4OKVB 5CCKH 4K3HA 4YX2L 3GSNH 2IQ9L 1SEQH 1N6VA 4EUPH 1FG2B 2ZP0T 3WFEL 2XZQL 4OGXL 1AI1H 1C7TA 2AEQH 3B5HA 1E6OL 4NO0A 4LIQH 4Y4HD 5IEKB 3M8OL 1QKZH 1GZQB 4P2OD 3Q3GA 1G7JB 2YC1A 4XP5L 3P3YA 1TVBA 4P4KA 1F02I 4DGVH 4K8RD 1I8IA 4YWGL 3KDMB 1HH6B 4OLWH 1MCWW 35C8L 2AXGA 2BY0A 3P0VL 4UNUA 3SDCD 4POYA 4GAJL 1K9TA 1I1AD 5IBTH 1AE6L 2FX9H 4XNUH 5I1GH 4LSQL 4XWOC 4EIZC 4ZFFB 5I30H 3MRLB 2VH5H 1Q1JL 4HMEA 4I1NB 3PWVA 5CSBA 5F1NA 5C2BL 2CRMA 4KK5D 3MBXL 4JFEB 4GAGL 4HCRH 3RTQB 4Y2DD 3NTCH 4CVXB 4H26A 3ORJA 2P5WE 2IPUK 3IFLL 3DVGB 4D0DB 5CEZE 2PXYB 1X7QB 1UXSB 4BFIB 3U2SB 5DRZA 1C1EL 4JM2C 5MI0B 3U83A 1JPFB 4X6FA 3EFDL 3QUYB 4OT1L 4GMSL 3MJ9L 1A5FH 2CRIA 4NZTL 4JFPB 3U4EA 1UM6H 4LKXA 4B53A 1AD0A 1NDGA 4C59B 2X70B 2XPGB 2QKIB 3SJVB 2A6JB 5KW9H 2Z8WC 3MRJB 3Q1SH 1A1MB 4GAYA 5FUZL 3EBAA 3EHBC 3QPXL 5FYLD 5HYJD 1ZHKB 4JY6A 1SQ2N 2F19H 4D9RE 4ZFOL 1F45A 4KQ3H 3DROB 5C1MB 5IG7A 4N0YH 5KSAD 4YGVB 5KSBA 2G5BA 4PG2C 5DVOA 4FQ2L 2G5RA 3BSZH 5HYQA 3GUTB 4PJXF 1A7NH 1KN2L 1IMHC 3BZEA 1R24B 2IGFH 3SDYL 3L5XH 1GH7A 5ANME 2GK0B 4DGIH 4WFHE 1JWMA 3GMRA 4ZUWA 4L3ED 1WICA 2VABA 2CLVB 4ZUSB 4C57C 1MHPL 3MMEA 1V3KA 3RVXC 1S9WA 2V5MA 3QO1A 4X8JB 2BSTA 3QIUD 4X4XB 1KC5L 1U9KA 2EZ0D 2JJUA 3MRMB 4OCNC 3C9NA 3PHOA 3LZFL 4NKIL 3S5LB 2H8PA 3ARFD 1WEJL 4YUEH 4U2ZA 4QNPF 1AY1H 2HLFD 1AGDB 4HG4K 3CIQA 5FYJL 4JFDE 5E5UB 2IBBA 3AU1B 3BJLA 2CIKB 4ONGL 3VG9C 1MRDH 1U8MA 2E6QA 4KY1L 4TSCH 5D5MA 3HUJB 2PN5A 2YBRB 4TULH 1RZJC 5EZOH 4P57A 4PBVC 1FSKB 1T1YB 3EYUL 5CP3H 3RA7H 4XMKH 5KVDH 3SDXA 4P46B 2IC2A 4WJ5B 5GGVL 1MRFL 1XIWB 5C8JA 4CGTA 3BZ4B 5BO1L 2IPTH 4JPWH 4F2MA 3MCKA 3U9PH 1XGPB 4OLXH 4XP1H 1HHJA 1S7XB 3OPZH 4YHNA 4NM8L 4O02L 4Z5RB 1QLRA 4RFNB 4WFGD 5E8PA 1CDCA 3S3JA 3FFCA 1FNEA 3NN8A 2VN4A 5DLMH 1KFAH 4CVZB 3CX2A 3TJHD 1AGBB 1GIGL 3BQUB 1FE8H 1KT2A 2E27L 4MNQA 4Z76B 3KPQB 4F7EB 1SBSL 4S1DD 1AHWB 2LU4A 3ULVL 4WO4C 3RIAF 1MFDL 2WIMA 1KTDB 2EXYC 3BXNA 3U36A 4PRHB 3UZQA 3KPMB 2JCCA 3X13B 4LAJH 1G7QB 4LCYB 1Q72L 5EBLB 5E95B 1G9NH 4KTYA 4BM7A 3OG6B 2HMID 5I1LA 1YMMD 3LD8C 1AXTH 5EPMB 4G6MH 3RL1A 4NGHL 4JGJA 4G6FB 1R3HA 5DRXB 1DUZB 1MCPL 4GKSB 3ZYZA 1BFVH 5EC2B 3HG1B 2ZPKL 2OLDA 1DSFL 3R0NA 4OLVH 1J11A 4MSWA 3UEZA 2ZCLH 4JFHE 4PV8B 4YJZL 1DBML 1QSEA 2W9EL 3G5XA 2HKFL 3F7PC 5M95B 2GI7A 4E0RA 4HMCA 4Z9KB 4G6AC 4R0LC 1T22B 5KBNC 1B0GB 4R2GB 2NXZB 3MV8D 2R0KL 5KSAB 4JFYB 3ULUC 5C92A 4LAQL 5ADPL 3UMTA 1AQDA 1HKLH 5DUBB 3RBSA 4OD1L 4IRJD 3HAEH 3V8OA 1A7BA 3D39A 3LV3A 3UJJL 2CDFA 3VMOA 5FGSA 3MO1A 4HF5L 5C0DB 3MA9L 3VRIA 4OF6A 4ZFOB 3UAJC 1MCNA 3VE0B 4PJDA 3KLDA 4U1KB 5GHWH 3VXSD 2CIIB 3A67H 5FKAA 5A40E 1A7RH 1JZ2A 1HXYB 4R7DB 3KLHC 4L8CB 1WFTA 3NIFE 1BFSA 4WWKD 4XHJD 1IGJB 5D7IF 4FABL 5C6TH 1TZGH 2I07B 1DQJB 1ZA6A 3UC0L 3UTTA 3ARYA 5D8JH 4TYUA 4XXCC 5I75B 4D0BA 1ZGLM 3WJLA 1X5ZA 1HSAA 1XF3B 2UWEB 5IR1B 1LDSA 4OF3A 3O0RH 4UDUB 2NLJB 4A6YL 4E41A 3BKML 2VXSL 3T2PA 3CGTA 5KANI 3T8XB 1A6WL 2IMMA 5JOEA 4LDEB 3HI6L 2WMPA 4NQTA 1RZ8A 4JRYA 4G3YL 4Y5XB 3ILQC 1JNLH 2V2WB 3BW9B 3JZ7A 3NFNA 5C08E 1AGFB 7FABL 3NPSC 4NJ9L 5AWNL 2UV3A 3VXMA 5HBBA 4PP1C 4Y4FC 2PO6C 1YNKL 1N64L 1AD9A 3E3QC 2O61A 4NC0B 1JZ7A 1NDMB 2NZ9D 4CN4A 3IVKA 3VMNA 1U8IB 4KDWA 4Q0XH 4N8PA 4PJ7F 5D2LB 4NQUA 5D6CA 1OAYH 3H3BC 2CLZA 4U1JB 5TE6H 1ACZA 4L29A 1K8IA 1NCAH 3L5IA 4ZXBB 3IETB 5KTEH 4ODSH 5C07E 4NKDB 1U42A 3DBXA 3TBYA 2HTKC 2HT2C 5B21A 3GSQB 3V6OC 4YDKH 5I1JH 5J06A 1F90H 4DTGH 1W0YT 1AGCA 5K9OA 1WVZA 1R5WB 5C6PB 5DWUH 4AYFA 3WNNA 4GBXC 4DZBA 3BRGC 5SX4I 1JWSA 4WRLA 4LLMB 4S0SD 1GGTA 4F58L 3QEQD 2JB6B 2VO5A 5I2IB 3GBMH 3TJEL 2XACC 3N1QC 3U6RA 4LVHC 4RA0C 3PWLA 1HZHH 1TCRB 5CBAB 3RWFB 2DLIA 5IV2A 1KTKE 4MNHA 1DQQA 3CZFA 3KPSD 1R3IL 3LB6C 1INQB 4JHWH 4HUKB 1DZBA 4ZODA 5H94A 3BX7C 1S3KL 1VEMA 3U4AA 5ACZB 3BMVA 4N0UB 4XBPB 3NMEA 2HFEA 1KIQA 5ISZD 1EEYB 5TGBA 1S78C 7CGTA 2WQRA 1Y6MR 1ZEAH 3RHWK 3O6FD 2Z31C 4D2NA 2ZCKH 1A6TB 4JHBA 1PYWA 2CH8A 4MX7B 3IDJA 4HH9A 2NXYD 1M1SA 4TOYL 3GJFB 2R29H 3IDXH 3WIHH 4JFEE 4NNXA 5IB2B 2DQDL 3OGCB 4OV5B 1CFNB 1L0XA 3NABH 2VAAA 4QCIA 5IHUL 2AW2A 3CFDA 4PJAA 1OSPL 2AJXL 3CLEL 3JWDC 4PRDB 4JPVL 4APQD 3PL6C 1WK0A 5ESVB 1U8JA 1QPPA 15C8L 5CWSA 1FNSH 3GZKA 3WNPA 4AZ8A 4BFGA 3BE1H 3C8KA 4PJIF 1O7VA 4D9QE 1QRNA 5HHME 3E1F1 3SJVE 2BNQA 4FQHB 1TIUA 2WNGA 4M1GH 1NC2A 3MLUL 1OTTD 5HJ3B 4LCWE 4PYGA 5B8CA 1QEWB 3MJGX 3B9KC 1JGDA 3QQ3A 2EKSA 3LVEA 5ICYA 2R1XA 4KC3B 3K2UL 3VWKB 1MJUL 3L3JA 5DVLA 1MWAA 3T09A 2CO7B 3GRWL 3QWQB 5FYKD 3MLPA 3W2DL 4LHUA 4LLVA 3VFUB 5CGYD 4JB9L 3V9FA 1L6XA 5CHNB 2VJXA 4H88H 4RMUA 1F6AB 2PO6A 2FZ3B 5JNYA 5KZCB 4MLIA 1G84A 4A6YB 4M61B 4GUPA 4G42A 4XNMB 4KK8D 2D9QB 1A7QL 2QSTA 5E24E 5ITFA 2OL3H 4ZSOB 1NAML 4WEBL 2NR6C 5HYIA 1ZA3A 4C58B 1N7MH 2ICEB 4JPIA 1NMBH 4KKAC 2W0FB 1U92A 2E7CA 2EDOA 3GSOB 5LXGH 3GO1H 2D9CA 2V5SA 4KMTL 2I5YL 1UB6A 4OCWH 3ARPA 4JY4B 2J12B 4OD3H 4UV7H 5DI8A 2D03H 3H0TB 1LE9B 3GKZA 1PGRB 4I5BB 1Y0LB 2KQMA 3V5KA 5CD5D 4HEME 3HE6D 1T5XB 3PNWB 1RHHA 4OJFL 4U6TA 5I74C 3ZDYE 3LSOA 4GBXA 4LHUG 43C9A 5IROC 4FMKA 3ECBA 4I3SH 2IPKA 4UTAL 5D93B 4YEEA 3RQ3A 3L3OA 3QI9C 3WDHA 1T80A 4GW5B 1B4JL 1AP2A 1YEDA 3D6GA 3I50H 4CDGC 3X11B 2RAMA 5EO9A 5JHDA 2XKUA 3JUYA 4PBXA 4GXVH 4TUKL 4NZRL 4UDTA 1ONQA 4JHAL 1DTUA 3BPCA 1J1XH 1RPQA 4H0HB 4JLRA 3MJ8B 3DUSA 3QDAA 1RULH 3MGAA 5EWIH 5F3HA 3VDAA 3ZE2E 1JNJA 4PJEA 4LLYA 2VZTA 2UVEA 2XWBA 3MXVL 3O6FB 2Z31A 3V2AR 1NGXB 2XG5A 4H8WL 5DC9B 3BRFA 3BFOA 3DI2B 5H37H 3QEUB 3ZO0A 4Y89A 1FGNL 5J1AB 3KPTA 4GRMB 4MJ6B 5CUSL 5DURB 3SY0B 3NCJH 4OM1L 1PVHA 1FORH 3HB3C 2P47B 4PRHE 3W5NA 5ELIA 3W9EA 3QZWA 5FA4A 1JYXA 4I0PD 3S4SG 1ED3A 4OLYL 5E2TH 5DD3L 3HLAA 1N3NB 3RDTC 1U8PA 1HIML 3B2VL 5DSCB 4WCYL 1NL0L 4K9EC 3QULA 2DTMH 3PL6A 4IBLT 4M00A 1U8LA 4H0GA 1DBBH 3WSQL 4NQDA 2VE6A 5M94B 1GOHA 3MUZ1 5T1LA 1UXWB 5J3HC 3TVMA 3BDBA 4LCCA 4JFFE 4RNRA 3WLBA 3HG1E 3F7YA 4PJ5D 3STLA 4MNGE 4PGDB 4C83A 4IOFD 1ORSB 5L2KE 4TNVK 3T0EA 3AM8A 5BW7C 2GAZA 3BH8A 4HPYL 2V7HB 2XWJA 4DKEL 3N9GL 5DK2B 2RHEA 4N9OB 5EU6B 1V3MA 4RMWA 1BIIB 5IT2L 4NYLB 3T4YB 5FDWA 3OXRB 1FL3A 5FHBL 3V6BR 1J8KA 3JTSA 3FQUB 1JGUH 5HHOD 3B3IB 3UO1L 4I13B 5JIHA 3BIKA 2VDMH 5FXCH 3CUPA 3TBTB 4LRNH 4P2YA 1FAKT 4XNQA 5CBEA 2XZCL 5FAAA 3RGVD 2MPAL 2DQHH 3C08H 3LY6A 3ESUF 4AM0A 3SE3A 3MBEB 3MRPA 3O6ML 1NKRA 1JF1B 3F7RA 3W0WD 4OCSH 2HJLB 2HG5B 2BOCB 2EDYA 4Z0BH 3MNVA 4RMSA 3D25B 4HFUH 2AXFB 1UM4H 1YEGH 4PRNA 3S96B 5BRZB 4JGUA 2VQ1B 2LU3A 3CNKA 1ZHNB 4M7LH 2OBGA 1LO0L 4PJBB 2CK2A 3DX8A 3BWAA 4L8SB 1MLCB 4BZ2L 5JW4M 4ZS6D 1DQML 2IH3A 4G8GA 1FFOA 3CC5A 3EDFA 1VA9A 5FKPB 1OL0A 3DRQA 4NRZB 2BJML 3FT2A 4M6ML 1Q0XH 2OP4H 4YHLH 1F11B 3K8KA 3P0YL 1NAMB 4IDJH 4XP4H 5I73B 4PRPA 5FYJE 1H0DB 4FFYL 3EZJB 4U6VL 4WHTB 4WI8A 4PLJC 4IRSD 1HSBB 1QNZH 4PP2B 3DX9B 4PS4H 3C5JA 1EZVY 3PWPB 2YOCA 4OLZH 1UZ8B 3K4AA 4YHOL 4UIKL 4NRYA 4FTVB 3IJYB 2ATKA 4Y5YA 3TLRA 1IAKA 3I75A 1PY4A 4JJ5A 3ARTA 1Z0NA 4JZJC 3GSXA 2B39A 1NUDA 5IF0B 5D2LE 1CL7I 1GGIL 4LNRB 1F4WL 4UILH 1JHKH 3MRQB 3OXSA 4HW6A 4LLUB 1S7QA 1WUNT 2X4UB 4Z77A 4XVTL 4NO2A 4JFOB 2AVGA 3CVIL 5F7YC 3IDIA 2BHZA 1KCSH 4PD4K 1T03L 3ARBA 4NQSB 4QXUL 5I19L 4X5WA 1Z9SA 4DK3A 5C0BE 2ED7A 2G2RA 2HJFA 5DRWA 2RFXB 4JDTH 2PW1B 2APXA 5K93A 4BSVA 2WP3O 3MV9D 3IAQA 4P3WA 4ZFZB 1CXIA 1RZIB 1IGML 1LEIB 1MCOH 3WFBH 3ULVE 5IHLB 3IDNA 4MVBD 2ITDA 3TT1H 5TF1L 5GGUB 3OR6B 5DRNA 4PGEA 5ALCL 4F3FB 4JN1L 2P8PA 1HHKA 1QBMH 3GMQB 4JREB 3FZUD 2FX8L 5MHSD 5TDPA 4YDLB 1A6AA 1CL7H 2EH7L 4HPOL 5BW7A 3KXFA 4UT6L 3SDAB 3F6LA 4ODTH 1SJVA 4N0UE 2Y72A 1UB5B 4JKPH 2H2PD 4X5XA 2QTEA 4ZO9A 5FCUH 3WS3A 2GSIA 3DVNB 5I1AB 2R2HB 4JQVC 4HGKC 3RVUD 3OR7A 1T2XA 5HHOB 2O93L 1L0YA 3MRDA 1LO2L 3VFGH 4K71C 4OZ4B 2CD0A 3NACH 5DHXB 2FH8A 5BXFA 4F57H 1LE5A 1QUNA 4G80B 4X6BB 5EIIB 5IUSA 4KJWD 2N4IA 3QCVL 4O58H 4KZDH 2DWEB 4OM0L 4GXUN 3HS0A 2Y5EA 4PG9A 4AEFA 4YBLC 3TO2B 5BV7L 3O3AA 3FQXB 2AI0L 1CDIA 4Y5VB 5BZDA 4NO5A 5DDHB 1T83C 4OB5L 4HLZG 2JIXD 3MNZA 2VLRA 4FXLA 1A6ZA 2X4PB 2Q8AH 1U8OA 3PXHA 2BFVL 4XH2A 5E8OB 4X6CE 1JTPA 4S0TD 1AGEB 1ZWIA 2YPLD 1REIA 3D18B 2QHRH 1QQDB 3O8XB 4CN6A 2WIIB 1KJ3L 1X5KA 5J12C 3ARVA 1OSZB 4KKCC 1NSNL 3O4LB 5FHAL 5FO7A 1DQTA 5F7KC 1EX0A 2BNRA 2VR4A 1MI5B 5E08H 1CGSL 3DXAE 1FZOB 3S6CA 4OKDA 3FRUA 2A38A 2IANA 4HIIB 1ZANH 1J8HB 2NY3C 2V7NB 4D94A 4UT9L 4MB5A 5JPNA 1DVFC 3BVNA 1ZHLA 5TDNA 5GXBB 3PDOB 1TQCB 4NC1E 2FJFA 1WC7B 2RJMA 3VRJA 5CZXC 1HN1A 4KJYB 5E1AA 5C0RH 3ARQA 1KCUH 1ZT1A 4X7TB 3I9GH 2H9GB 1MIML 3FOLB 2EDHA 5D1XA 3NCEB 4JZJA 5ICZB 2FJHB 4EZMA 2APTA 5I8OL 4NHUB 2O26U 1VGKB 4ZUUB 3RNKB 1EHLL 2VDRL 2B0SL 2DDQL 1ADQH 4ZO8A 1MVFA 2V5RA 2AQ2A 5FUOL 4YHIA 5HXMA 4GKOA 1K4CB 4M93B 3T65A 2XA8L 4JG0L 1FJ1A 1I7UB 3G5ZB 4HC1A 4LBEA 1RUMH 4LPVA 4TVPD 4ZMAT 1SYVA 3U0PA 1PKQB 3QHZL 2GTZB 1CICB 4Y0GA 4X98B 4OZHB 1FPTH 1UACH 4FQXC 3NIFF 4ODUB 1QFWL 3AS0A 4FMFA 2YD3A 1E28A 1ETZA 2VZSA 3T2NH 3OKLA