4PJFE

Structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
198
structure length
197
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAAEDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSFACANAFNNSIIPEDTFFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
publication title A molecular basis underpinning the T cell receptor heterogeneity of mucosal-associated invariant T cells.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 197
sequence length 198
chains with identical sequence G
ec nomenclature
pdb deposition date 2014-05-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjfE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4pjfE02
5LQBH 1CGUA 5F1KC 1TQBB 1J8HD 1PZUB 1G6RH 3ARGB 1IM9B 3VXMB 5C2BH 3SGDH 3QXTA 3DETD 3L3JB 4H20H 1EERB 5DVKA 5GGUA 5IKCB 5EULV 2A83A 5GJSL 1S7RA 4F33B 4R7NB 1N8ZB 1MI5A 4P5TD 4GW4B 3VD3A 5I76B 5BOPA 3BGAA 4TULH 3IKCB 3JV4A 1PFCA 32C2B 3BW9B 1BF2A 2V9RA 4LASH 3SKUD 5L2JA 3OKMA 4AH2A 1QSFB 1KT2A 3DX7A 1T20A 3E6HB 5D96C 2APFA 5C0FB 4LVNC 2BY2A 3G08A 4MJIA 4O00A 4GAYA 4MSWA 2XXCB 4NIKB 5E8DL 2X10A 2QADB 4NN7B 1ZLVH 4AQ1B 1IQWH 4R2GC 1LDSA 5SWSB 4P2CG 4DTGL 4LP4A 4H26A 2YWYA 3P9WB 8FABB 1SY6H 3PGFL 4GAGL 5IWLA 2EC8A 1LQSR 1P4BH 3RKDD 1RK0B 1FCGA 5I1GH 5KANG 1VPOL 4R8WH 3ARSA 3KPLA 3DGGA 2G5BA 4MXWH 2V17L 2DQFB 4OFDA 3MC0A 5EFIA 4NN5B 1P4IH 4OCSH 4DVRL 3D39D 5J3HC 4Z5RB 4P4KB 1GIGL 3PWLB 4X6BA 2MWCA 1KGCD 4XPGL 4XVJL 1BZ9B 3WNOA 4LLWA 4FZ8H 4OJFL 2YUXA 1BQSA 4LLDB 2PW2A 3P9MB 3FT4B 4J8RB 1DFBH 3V5KB 2VUOA 1D5MA 4LLMA 1GXEA 5DS8A 3BIAX 3MGTA 1D5ZB 3SE8L 4DVBB 2FWOB 4FG6D 5IB3B 2EO1A 3A67H 5FUCE 2VDOH 1ZAGA 3E3QC 4ZSOA 2ICEB 12E8H 2PW1A 1A7OL 5IVXA 4NKMB 2JB6B 5HHPA 2IPUK 4CMMB 2J8UE 5GGQH 5L8KB 1IGJA 3HE7A 2EE6A 3V6ZB 1T1WB 4ODVH 5EWIH 2CJUH 5M95B 3DLQR 3SDAC 2IAMD 2J8HA 5FK9A 3C6SA 4KKBD 2C26A 1TJGH 3CLEH 4V1DE 4Z7WF 4UMGA 5GSVA 5I15L 1VACA 3UZEA 3VRLF 4J2XA 1RULH 4NSKB 5C1MB 2CDFB 2YEZA 3MLSL 1Y18A 3NIFF 4PPTA 1FHGA 4JHAH 3IRZA 3QISA 4Y4KB 1KENL 3P4OB 3MLRH 1NBZA 1MREL 3BIKA 4CU7A 2J3SA 1OAXL 3RTQD 2DMBA 4JFQB 2J8UB 3GGWA 1A5FL 2CUHA 4LCCC 2AQ1A 2WBJA 4BA8A 1UZ8B 4X5WB 2HFGH 1TDQA 1EAPB 1JZ2A 3QXUA 1A3QA 3KYNA 4FQLL 4GOSA 2EDJA 3QXDA 1NCAH 4PGBB 5C0BE 1A6ZA 2YKLH 1UENA 1IT9L 4XMPH 3VGAB 4V1DB 5GGRY 2BHYA 4UAOB 3EO1A 4QXTB 2ITDB 5DJ2B 1U3HB 4LIQL 2HAZA 3TBYB 2I07A 1KELH 1ZGLB 4PS4L 1CS6A 2Z8WC 1FGNL 1FNAA 2B0SH 5D7LA 3GSNA 3KHQA 5D7KE 4ZNCD 2V2XA 4NM4H 1QNZL 5GGSB 5E0QA 3T08A 1XF2B 2OYPA 5CJOH 1JF1A 2BVQB 4EIGB 2IQAA 4FFVD 4U05A 3SDCC 3VMPA 3HMWH 3MV11 5M94B 3KR3L 1S7QA 2CXGA 3CMOL 4IMLB 3CK0H 4JFPA 2YD4A 5C0BB 3V4UH 1A6VH 3BXNA 3C09C 3S3JA 1JYVA 3JV0A 1F3DJ 3K80A 1FRGL 3QO1B 5DUBB 5CJ5A 3LS4H 4Q2ZB 1U8JB 1CXFA 5ELIA 4TTDD 3HC0A 3KPPB 1XF5B 5HDLA 5BW7C 1OAZL 4JVWA 5E9DD 1L4IA 1CXLA 1T5XB 1GZPA 3RWFA 5K9KA 4YHIA 5MEOB 3FB8A 5J11C 2F74B 4XI5D 5JW5B 3I6GA 1LMKA 4IOIB 3C2AH 4Y89A 3O8XA 5DWUL 2H1PL 5JOPD 5JDSB 1NGYB 1GGIH 3ISWA 4OM1L 5DJYB 4OBSA 4ZODA 1YNLL 2DOCA 3VXOA 4K3HA 4HIXH 4MDJA 1QPPA 2FBJH 2A74A 3O4OC 3U6RB 4UTBL 2ZUYA 3ZYJA 5JQ6L 3DO7B 2R0KH 2EXYC 4JKPL 3BFOA 5KSUB 4OZFB 5I17B 3MBEB 4OV5A 1OT1A 5IJKA 2VR4A 3L3KB 3FONA 3LEYL 3ABZA 2EIZB 3PHOA 1PYWB 1NLDH 3BP4B 1AD9A 4OLXH 4HEPG 5DK2B 3C8KB 1N0LA 1XGTB 4QGYA 1AFVH 3DXAA 1CLOH 1KENH 5ENWB 4QRUB 3LHPL 4DN4L 1NGZA 4XTRC 3MFGB 3NOIA 1BD2A 3GSQA 5JR1H 2AJ3B 3BZEB 2WUBH 3LIZL 4KRMB 3WJLC 4KWUA 1HEZB 4HZAA 4NKOB 4Q9QH 4KVNL 3LZFH 5KSAB 4O51A 5E08H 1JWMB 4BM7A 4PJHE 1CFVH 3I6KA 3FRPA 1KLUA 3BKJL 1NDMB 4WTWA 3VWKA 2AAVA 5MERA 1J0ZA 3A6CL 2XTJC 3V9FA 4X4YB 2DM3A 3ARED 3OJ2C 1HSBA 3QG7H 4NOFA 4XNXH 4DW2L 1CGSL 2QLVB 4O58L 5TE6L 3KPOA 4PS4H 3EYQD 4I9WE 1FGNH 3ILQC 3WLWD 3HZYB 3OAYK 1ERNA 3MXWH 2BMKA 3A6BL 4G8IA 4LPYA 5L7XH 1WT5A 5HHXL 3VCLB 2NY3C 2X1PA 1EFXD 2YK1L 3T4AA 5C3LD 3UAJC 2CO6B 5DO2C 4J3SA 4BUGA 1BECA 4LKCA 4G6FB 4MNGA 2FX7H 5C0ND 1HXYA 4WJ5A 1KXQE 3MPCA 2ZSVA 3BMWA 4PJHB 4I4WA 1U8QB 4XPAL 4CN1A 4GQ9H 1G7HB 3BRFA 3L95A 1KIUA 5I1KH 2Y1VA 1ZVSB 3QHTC 2VIRB 4P2YA 1FJ1A 5C0DB 2QQKL 1OM3L 2JK5A 3LEXB 2EDLA 4GKSB 1KJMA 3TA3A 1B0GA 1H5BC 3I2CL 5ESQA 1AXTL 1JPST 2UWEF 5D6DC 1RZJC 3D85A 4F58H 4UQ2A 5I73C 5EBGA 5F9OH 3HG1A 3DYMA 4JFEA 5AD0B 1A4JA 3NGBC 3U0PB 4OM1H 1LNUB 3VRJA 2AJVH 3UZQA 1IFHL 3L9RB 4JANB 3KNBB 5F1OB 1HE7A 2ZCKL 3RWJB 2QQLL 2NY2C 2XN9D 4QRQA 4YWGL 1N3NA 5IB2A 4OCNC 43C9A 3HPLB 1IGTA 2VABA 2DQCL 1F4WL 3H9HB 4Z0BL 1UXWA 1MJUH 4F3FB 2QSCL 3WIHL 4PJ8B 1AR1D 2DQDL 2JELH 5I1AB 4HGWB 3SBWC 3EZJB 4XPBH 1C08B 1DQLH 3FFDA 3KDMB 4WFED 4Z95H 4M48L 1XF3A 2X4RA 3EW3B 1OW0C 2H2SC 3EYSL 4JRXE 3BP5B 5I1LB 5DVOA 3DSNA 4OM0L 1BM3H 2CXKA 3QQ9C 2CK0H 1SVZA 1YEDB 4HJGA 2IANE 3Q3GB 2YR3A 4HX1B 2F54A 4WI4A 1LHZA 3RIAK 4POYA 3EO0A 1WQVT 3K2MC 5AAWA 4X6FA 5D2NE 4WO4D 1A2YB 3GB7A 3GSRA 1N5AB 3BKJH 3QRGH 4P2QD 4XTRD 3S88H 4XBPB 2R9HC 1AGFB 1HZHL 3WHE1 1DEEA 4ODSL 1T21B 3SDAA 3SDXA 3STLA 3G9AB 4JFDA 3H3KA 4KRPD 5E6IC 2DJ4A 1CFSB 3MRQA 4PLKC 4JRXB 5DHVA 3BEWB 4W68A 3OXRA 4F7CA 4M7KH 1UVQA 5KZCD 1M05A 1U42A 1NLBH 4S10A 1I1FB 3TN0A 4PD4K 1S78C 4OZHA 5KG9A 4KGLA 1CL7I 5D2NB 5E56A 4AZ8A 4Y16B 3QEGL 3CXHJ 4PGCA 2DTMH 5IB1B 4U2ZA 2KH2B 2Z93B 2MHAB 1KCSH 4LCCA 2XRAL 3BN9C 2JLLA 2XFXB 5DRNA 4L3AA 4EOWL 1LK2A 1T0MA 5DJCB 2Q3AA 1A6WH 3UAJD 5F7EL 4D0CA 1RFDL 4PRPA 5FFLA 4NRYA 4GFTB 2YN3A 1KTDB 4YFDB 2FDBP 4WW1B 4YHOH 3WE6B 4FQJL 3TNMA 2E7BA 4MJ4A 5FOJA 5TF0A 4PJEE 1S8DB 2RQ8A 2Q8AL 1UQSB 1B4JL 3L5JA 5IROC 1OGAE 3C5JA 2FEDC 1R5IB 3ULVE 4YWGH 4NKDB 3JVGA 3LKNA 4Z0XA 3VGFA 4NQDA 3DVFA 2JCCF 3GIZH 4TNVK 5F72S 5GRVL 1KCUH 4G80A 1B6DA 4PTTB 2V7HB 3SDCA 1JP5A 3G6JA 4NQSB 3WFHB 2EDHA 3VGDA 1TVBA 5LXGH 2RB8A 1JUFB 4JPWL 5DJZA 2NY2D 1WSST 4HG4K 3DUUA 3EYSH 4L8BA 2JTDA 2HKFH 3O2DL 2BNRA 3T04D 2APXA 4FTVD 5ISZD 3Q6GH 4LCUA 4S1RL 1YUHA 4JN1H 4LNRB 4AEEA 4UOJA 2NY0B 4PJEB 3ZSTA 3PQYE 5DEZA 1QFWL 1J0IA 3CFBB 2IPTH 5BW7A 1OGAB 2GSIA 5L9DL 4RMVA 3NZHL 3O4LD 5CUSH 3VXNB 1CDHA 1XH3A 4GAJL 2IAND 4K7PL 5C07D 2WWKT 4KRNA 1SEQH 3ZHLA 4NZRH 1KC5H 4HUWA 1CL7H 5FO8A 1UXSB 3MODH 4PR5B 3CX5J 3G9VA 5T3XD 4HKXA 5EU3B 2EYRB 1QRKA 1DTUA 2C9AA 4OZ4A 1OP3H 4O2EB 5F71A 2C4XA 3FMGL 4RNRA 1ZT4B 5TDOB 5KVDH 4QTHA 4AY0A 2F53A 4PJXA 4AT6A 2GY7B 4LSUL 5KW9H 5I19L 3EOYG 4JY6A 3WJJC 5IIEB 1U0QA 4PYGA 1JGUH 1XCQA 2EYTA 5FYJL 3PQYB 4NUGH 2FYYA 2IH3A 3GJFB 5DQDL 1NJ9A 2NY7H 4BH8A 5EG6C 4CAGA 2Q86B 5GRUH 1U8OA 3MA9H 4MA7H 1RIUL 1A14H 5D7IE 3ZTNL 3QT2A 2F58L 4I2XE 1G7LB 4PJDA 3WJLA 2A9NH 4JO1L 3VFWB 3WIHA 4BJLA 1ZLSH 3P30L 2PTTA 4L4JA 5C09A 1OCWL 4LFHG 4EDXA 1KJ2B 3DV4B 3PWUA 2ZNXA 3IJYA 2FGZA 3T65B 1AIFA 3UZVB 3M07A 3QUYD 4X5XA 1B4JH 3F6LA 4YFLF 5SX5H 1T22B 2DAVA 3V4VH 3S7GA 2W65A 3VWJC 2LFGA 4PG9B 3QDJA 5IB4A 2OJEA 2NY0D 4X6DE 1OTSC 1UM5H 5F7KC 1K9TA 4M7LL 2JKXA 3HI6H 4WHDA 3DIFA 4OTXL 1CU4H 2BY0A 2EXWC 3CH8A 4AG4L 4TUKH 5D7IB 1J88A 4I2XB 2P43B 3PE9A 1Z9OA 4NQTA 3W9EB 5HHOD 1FVCB 3EFDH 4G6AD 5E8EA 2W0KA 3QFDA 4LSRL 1BLNA 3EDKA 3RX5A 1PX3A 2D7MA 3B6SA 4ZPVA 3UTZB 3LEVL 3TWCH 2DWEA 2V5YA 2CLRA 3I75A 5ADPH 4PJEF 1KJVA 1ZHKA 1NUNB 4XPTH 1MFCL 4HCRH 3T0EE 5GRJL 1H5BA 3AM8C 3VMOA 3ZHKA 3QI9B 3ARTA 5J12B 5D6DA 4X6DB 3UO1H 2PYEE 1PQZA 4HFWB 5E5RB 2DLIA 2UUDH 3S35H 3HUJA 4XRCA 4H88L 4AEIH 1UA6L 4LAQH 1KPRA 5ID1A 3V6BR 1T83C 2YXMA 1L7TH 4ISVB 5C0EB 2E27H 5HYEA 1HI6A 4GXVL 2MNUA 4QNPF 3ARDB 4X0KB 4XX1E 5TDPB 1KSRA 4K3EL 2WP3T 3TO4C 1FNGA 2WIMA 1JGDA 2QQNL 4G43B 1BWMA 4XMKL 5IHBA 3HI5H 4KJYA 1T1ZA 1YEGH 3BDXA 1UH2A 3WNPA 4P5MA 3ILPB 2XWJB 4TNWK 2AXFB 2HFTA 5DYOA 1YECH 3U0WL 3AAZA 3VFPA 1H8OA 3B5HA 3SDDC 4HK3N 4EUPA 3RVVC 3T0VA 2VN4A 3T0EB 1LEIA 1INQA 2JF1A 4JDVB 1XCTA 3OKOB 1DVFB 1OW0A 3N9GL 3P4LA 1Z2KA 2PYEB 1A21A 4ZDHA 3QH3B 4CVXA 4KQ3L 4PJ7F 2NY4D 4CVZA 1S9YB 5EOTB 5JOFB 3N1QC 4XMLH 3IYLW 1BX2B 3HS0A 1ZHBA 3GI8H 4M6OL 1A6PA 3UC0L 5ITBH 4K3GA 5JXEA 4JGMA 4X9IA 1GGBH 5GGVL 3F7VA 2PUQT 2NZIA 3O2DA 3VFUA 4S1QL 4HKJA 4HFUL 2BY3A 4HMEA 2P7TB 1MQKL 2OZ4A 1MCQA 4RMWA 4I0PC 4JZNA 4UB0L 4M7LH 2RIKA 5E6IA 1IJ9A 1NMCB 3X11A 3D9AH 1NL0H 4P49A 1KFAL 4OTXH 4RISH 2X4SA 3IDMB 3RVUD 1MI5E 3U9PL 3U46B 3ZT5A 3X17A 4OZIF 2E8ZA 3OKKA 3ULSA 2OMBA 4GRLB 1RVFL 2OSLA 3DUSB 5I1CL 3K74B 3WO4B 3QWOB 4MJIE 2RBLA 2V2TB 4Z78B 2DJUA 4YDVA 4E5XB 1T4KA 1OB1B 4XCCH 1PLGL 4HMCA 3ARFC 1HKLL 4LSRH 4YC2C 2DWDB 2JJTA 4NRZA 3SOBL 1CK0L 3IDIB 4LCIL 4D9RD 1Z5LA 1DSFH 5DD1L 4P9HC 4OLUH 1FNHA 5JIIA 3VGBA 4DKEL 2NQCA 2J2ZA 4JHWL 1SYSA 4X6DF 5KTEH 4K7PX 5GGUB 4JFXA 2A83B 3PP4L 3S35X 3W82A 1S7RB 4JPKL 1QBML 4FQCL 2D0HA 3SE4C 1ZGLM 1DCLA 3BHBA 1MI5B 2HT3D 1MIEH 3NCMA 2CQVA 4CNIA 3JV4B 5IROA 4IRZL 1J5OH 5FYKE 3OKMB 4AH2B 1KT2B 4XZUA 3DX7B 1T20B 3LH2L 4XVUD 5D1XD 1I3GH 5TQ0H 4MJIB 2HG5A 2QQNH 4DQOL 4GAYB 4RDQG 4MSWB 5KAQG 4QY8A 3TP4A 3B9EA 4JHBA 5D5MA 3ESUF 2F8VA 4KMTL 2CRMA 3V4PH 3KPSD 5AWNH 4H26B 5DMGC 3UJTH 3NACH 1FC2D 4ZSOE 2ZUWA 2AEQH 3S4SA 4OGAC 4Y5XC 1RU9L 4NZTL 5IVXE 4NNXA 4QRPA 2DQUL 2MCPH 3MJ6A 3TO4D 5BV7L 4LVOB 3H2WA 5D7JD 3KPLB 2FIKA 2G5BB 3DGGB 4JKWA 9CGTA 3PNWB 5T1KD 1E6OL 1PDKA 1JGEA 1YEKL 4KQ3H 4PY8I 5EFIB 5E2WH 5T3ZH 4LRNL 4D94A 3QA3A 3MCG1 4X6BB 4CUCA 4LLWB 4H25A 1WFOA 3F7YA 1IKNC 2Y5TA 4Q9RH 6FABL 2KBGA 2Y36H 3UTSA 5GGVH 1D5MB 5J6HA 4LLMB 5DS8B 1JNLL 3MGTB 4J23A 3KJ6L 3B2VL 3V52L 1LO4L 2OCFD 5A16A 2CD0A 4ZSOB 3QFJA 2I60H 2PW1B 4RCAA 2FEEI 1CVRA 5IVXB 4MA8L 5HHPB 4UB0H 4YEFA 1QG3A 2R15A 1T2QH 3NAAH 1IGJB 1KFAH 3HE7B 4RWHA 1XGQA 3IJHA 5DVMA 4P9HL 3SKJH 3WJJA 1A3RL 5ESAA 5FK9B 3C6SB 2VB5A 4XCEA 1MI5D 2L7JA 5GSVB 5E1HB 4KI5E 3MOBL 1VACB 5TQ2L 5DLML 5C0AD 3QNYA 2YEZB 1YEEH 2ICCA 4NN6B 1Y18B 3MFFA 4ODTL 3I6LE 5EOCL 4OLYL 3CPLA 1C7SA 4J4PD 1NEZA 3IFLH 3HC4H 2DLGA 4OGXL 1ZE3C 1F4AA 1NBZB 5D7LE 3BIKB 4MHHG 3F6IA 3L5XL 1CGTA 5K9QI 2PN5A 4WFHE 1AJ7H 3GGWB 5I9QC 4JO4L 1ODAA 1R3JA 2WBJB 2VXVH 4KC3B 3KYNB 3QXDB 4GRMA 4BZYA 4DZBA 1A6ZB 3QCVL 3VWJA 2B2XH 2IBBA 1URLA 2CUIA 1JVKA 2RCSH 1GPOH 1J86A 2DICA 4HEME 3EO1B 4LCWA 3K7UA 3OHXA 3MOQA 3BDBA 2Z8RA 4UV4H 2I07B 5GQBA 5CJXC 3KS0H 2MQ3A 4JGUA 4PJ5A 5ITFA 5A2LH 3GO1H 3SJVD 1MHPL 3KJ4C 1DQML 1JNHA 5D7LB 3GSNB 5TPWH 2EDRA 2V2XB 2AERT 2HWZH 4ELMA 1A7NH 2ICES 4FQ2H 3SKMA 1JF1B 3RWIA 2IQAB 3OX8A 2IG2L 5T1LA 4A2LA 4QHMA 1YEKH 3CDCA 5C2UB 1QBAA 5DFWH 4MX7A 1M6OA 1S7QB 4JFPB 4GH7B 5HXMA 3IAGC 4H1LH 1JZ6A 1DDHA 2KL6A 3AM8A 3BXNB 2LAAA 3MTRA 4YHYB 3KLHD 2YD9A 2CKBL 1I1AD 35C8H 4ONFH 1GOHA 1F4XL 3VXTA 5BO1H 4UT7H 5HVGB 4LDEB 3HC0B 1JNLH 2EDWA 3PWPA 3DXAE 3KJ6H 1FFNA 4MB5A 1GZPB 3RWFB 5K9KB 4YHIB 2D9QB 3FB8B 2EDEA 2D2OA 3MRMA 3REWA 4JO3L 2P5EA 5IVXF 3SGEI 3CFCL 4MQXD 3I6GB 3ZKQD 4WY7H 1BD2E 3O8XB 1ZS8A 2YZ8A 1TFHA 3KXFD 4PP2A 3UJJH 4HWZA 2XKNA 3T4YA 3TYGL 2HLAA 5I1EH 3VXOB 3EDJA 3D1MC 4MDJB 2ZG2A 2A74B 3I9GH 3SDDA 2H32A 1FZJA 4OV5B 5FYKU 5JQHC 3HNTL 2OI9C 15C8L 3FONB 2WLYA 1AY1H 3PHOB 4H1LG 1NSNH 1V7NL 2H3NA 3ESVF 1AD9B 1WAAA 1T7VA 4KI5D 1PSKH 1U8NA 4Q9BA 1I8LC 2ZOLA 1HXMA 3DXAB 5DQ9A 5FV2A 4J6RL 1G9NC 1OWWA 1NGZB 4UDTA 4E9LA 4J12A 1S9WA 1BD2B 3GSQB 2GAZA 1IAOA 1UWXK 2Q20A 4RBPH 3GM0A 2Y7QA 1BEYL 1TNMA 4RGND 4MNGE 2YA0A 3ZYOA 4O51B 3B8YA 2VJXA 3BSZH 2NTSP 5FGRA 3I6KB 3QCVH 1KLUB 5GS0H 4I0PA 4KI5F 1KF9B 3VWKB 5MERB 2VXUL 3K1KC 3BKMH 5CFHA 5C08A 1HSBB 2EH7L 2B1HL 2GK0A 1DBBH 2B39A 1CGXA 3KPOB 3MX0A 5E5UB 4MXVE 1HIMH 1NUDA 2FO1A 1SBSL 1DQMH 4HH9A 2BMKB 4G8IB 3HG1E 4JFEE 3HAEH 3TH2T 1CFQA 1VERA 3ARFA 5J89A 3SGEH 3T4AB 5J9PA 4MAYD 5BCAA 3O8XD 3OB0K 3VGEA 4M93B 4LKCB 4MNGB 2RAMA 3K3QA 1HXYB 4WJ5B 1ETZA 3LN4B 2ZSVB 4L4TA 5E70A 4I4WB 4TRPL 3F12A 4G8EA 3O9WD 3L95B 5F96L 3MLWH 4OUUA 1K4CA 1JTOA 2PETA 2DQTH 3CMGA 3GJFK 1FJ1B 3ET9F 4IOSD 2JK5B 3EZ8A 1KJMB 3TA3B 1B0GB 2UZXB 4LIQE 3OL2A 4HAGA 5IFHH 1RZ7L 5ESQB 4LLVB 3WL9A 4JO3H 3AMKA 3D85B 5D96B 3CFDA 3SQOH 5GXBB 1NCCH 1B6UA 4UQ2B 4LVNB 4PBWD 1YMHA 3HG1B 4JFEB 4DAGL 2GW5A 5DMYA 4MQSB 1A4JB 4FFZL 3H7BA 3UCRA 3VRJB 4JJ5A 2ZJSH 4C83A 4HJJL 4OF0A 1BJ8A 4R2GB 2F54E 4MAUH 3W0WA 1G9NL 3V2AR 2H6PA 3HAEG 4QRQB 3E3QE 3AS1A 1N3NB 5IB2B 3OSKA 4Y5XA 43C9B 1RIVL 1IGTB 2VABB 4ENED 3S98A 3CVHH 5CZXC 15C8H 2R8SH 1UXWB 1Z9SA 4LLAA 2E7CA 4ZUSA 1BJMA 4KHXH 4UIKH 1G1YA 4F15C 4HK0A 3SDXE 3WNMA 4JFDE 1BJ1J 2ITCB 3FFDB 2WANA 5CJQH 1JGVL 1HH9A 3H3PH 1NC2D 1XF3B 2VRAA 2X4RB 4Y4HD 3BZFA 1CBVH 3OMZA 2VLJA 1TIUA 1F8TL 2DKSA 2X9YA 4C59B 4HBCL 4RA3A 3MLPA 1J1XH 3BZ4A 5AG8A 2YRZA 1BEYH 1EK3A 5L2KD 4HJGB 4ZO9A 3V0WH 4PJAF 3RPKA 2F54B 4KQ4L 3D25A 3EO0B 4OZHE 4FNLH 3GMRA 4X6FB 3U1SL 1OSPL 3GB7B 3GSRB 2Z92A 1SJXA 3T0WA 3OQ3B 4WU7A 2VDKL 2CKBA 4PB0H 1VB9A 3TBTA 5BJTA 4LDLB 2Z91A 4CJ1A 4OB5L 2NX5D 3ULUH 3E8UL 3SDAB 3SDXB 3STLB 4JFDB 4PRPE 1P53A 3LKOB 1LEGA 3VXPA 4ZXBA 1EVTC 4Y19D 5J57B 4X9FA 1M7XA 2H2PC 3MRQB 1FO0L 5DHVB 4YX2L 1F2QA 3TZVC 2V7NA 3OXRB 4F7CB 3TPUA 1MIMH 5KVGL 3DECA 4UT6H 3BPLB 5CEZH 3E1F1 1UVQB 5TGBA 1M05B 2F15A 1VDGA 3W5NA 1WZMA 3TN0B 2FX9H 1NMBH 1A0QH 1VADA 1HYSC 4OZHB 5KG9B 3P3YA 4FQIH 2P47B 3IAPA 4PGCB 2O5YL 5F1NA 1HWHB 4PY8J 2EECA 4LCCB 1JN6A 1H8SA 1X7QA 3G6JE 4NPYA 1LK2B 4NHUA 1T0MB 4PJBA 1KEGL 4L9LA 1F45A 5IHZA 4ZS6C 4M5ZL 5IBUB 1WISA 4D0CB 4PRPB 5D72H 4JLRA 4RFNC 4NRYB 1G9MC 4MD4A 4XBGA 2BNRE 3KS0J 2Q76A 4G7YL 4NP4H 1LWRA 3WDJA 3TNMB 1R24A 2WLZA 5CP3H 4K94C 1K85A 3O3AA 3OGCA 4UV7H 2BX5A 3C5JB 3NA4A 3VXUA 3W11D 4NWUL 2D7OA 5FEBA 1FGVL 5CJXA 5LJYH 4Y5YA 1IEAA 4LHUA 3LKNB 4Z0XB 2FB4H 2NR6C 1HHHA 1RIVH 4LEXH 4NQDB 3UEZA 2F54D 3HRZA 3BYYA 2ZKHH 3OXSA 1QBLL 2Z31D 1FZMA 4G80B 3NFPA 5MEPA 1TMCB 3MRBA 4IRSA 3RDTC 3SDCB 3D87B 5LVEA 2DM2A 3G6JB 2J5LC 4E41A 2DB8A 4OCXL 2OTWA 4Y4FA 2E7LC 5JUEL 1TVBB 3DX9A 4DK3A 5DJZB 2F53E 3P9LA 4PBXA 4PJXE 3B2UC 3DUUB 3C09B 4L8BB 2KQNA 2BNRB 3QZWA 4P48A 3W2DL 4XNYH 2QEJA 1RHHA 4LCUB 1IAIM 1YUHB 1HINH 1P7KA 5J06A 1FDLH 1T5WA 2GSIB 1E0OB 1LP9A 5DJ6A 4K55A 1H15A 5E2VL 1TLKA 5J11B 1OSPH 1NGXA 1XH3B 5DD6A 4GMTH 1IM3A 3R4DA 5F70A 3TN0D 3QUKA 1X5YA 4KTDL 5L0QC 4HUWB 5FO8B 4PJDE 4ZUTA 3U7YL 4HKXB 5C09E 1MY7A 1U36A 4OZ4B 3GJEB 1MELA 4HWEH 4RNRB 2YD1A 2H26A 5HDQL 2XWBA 4QTHB 2F53B 3LQAC 4PJXB 4AT6B 5IK3A 1VGEL 2IEPA 2XTJE 1QVOA 4JR9H 2VC2L 5E8OA 4JY6B 4X4XA 5LGHH 4MDIA 1FSKC 5L6YH 4B5EA 1XCQB 2EYTB 1CDUA 4YHLL 3T0XA 1D9KD 1UYWL 2FYYB 2OJZL 1CE6A 3H42L 3QDJE 1I8LA 2IH3B 2UV3A 3X3GL 4OZHF 5HYIA 4GMSH 4C57C 5AZ2H 1NJ9B 3FFCA 4BH8B 2P46B 2AJUH 3JSSA 4K94L 4XVSL 4GG6A 1U8OB 1Z0NA 1QBBA 3GK8L 3VFTA 1JHKL 4YR6A 4PJDB 2DQEH 2PTUA 2VTFA 3VDBA 1FIGL 2QSVA 4OCWH 1WFUA 2ADFH 2PTTB 3Q5TA 5I8KL 5C09B 5T33H 5K93A 2C4FT 3BYTA 1KCVL 5INDA 1QYGL 1A6TA 4EDXB 4G5ZH 2IPUG 1UWEH 1TQCC 1K3ZA 3RA7H 5KSBF 1PKOA 3PWUB 1H9VA 5CD5D 3IJYB 3QUMA 4I1NB 5DZLA 1AIFB 4NWTH 3WNKA 3RVTD 2XTJB 4X5XB 2BJML 4R90L 2AXGA 2W65B 4NWUH 3WHXA 1S3KL 2MFNA 3INUH 3QDJB 4XC1L 5IB4B 2OJEB 3GMOA 1ZLWK 4M1DH 1S7XA 1QLFA 1QRND 1TZHA 1AGCA 3DIFB 3BRDA 3HUJE 1KOAA 3WO3B 5KS9A 4UBDD 2VLKA 3EJYD 2NY3B 3AFLA 1P7QD 4HUVA 4TVPL 2A6DA 2PF6A 3F58L 2Q8BH 4QT5A 2GUOA 4OI9A 5E8EB 3QFDB 1OPGH 1BLNB 1YYML 2NR6D 4CADA 3W2DH 1CR9L 3B6SB 4ZPVB 4M43H 1ROWA 2DWEB 2HT4D 2CLRB 3I75B 4YH6A 1KJVB 1ZHKB 1FO0A 1WWCA 2Q87A 1T6WA 3RI5F 1H5BB 4QTIL 4I0CC 3WN5C 1E6JL 5E2VH 5ICZA 3Q5OA 3QB7C 1GAFL 3EYUH 4GT7A 4W4NA 3X12A 1PQZB 5C0JA 5HI4D 4NO3A 5I73B 1OAYL 1HSAA 5KOVC 3HUJB 4XRCB 1KPRB 5ID1B 1KB5L 3NGBB 3RP1A 5HYQA 3S5LG 1IGYA 1HI6B 4HSQA 4WFGE 4PJCA 3UPCA 4ZFGL 1FNGB 1FQ9C 5AEAA 1JGDB 5HY9A 4YGAB 4PJXF 4M6ML 4KJYB 3O3DA 5EBWA 1T1ZB 4P5MB 2HLFD 5F6HJ 3VFNA 5DYOB 2DIBA 3VFPB 3AAZB 4DN3L 3MCLL 4EUPB 1RZKC 1OTUD 1LEIB 2NZ9D 3HNVL 5MEND 4YBLC 1DUYA 1MJ8H 1INQB 3S34H 4KHTH 1XCTB 2J6EL 5EOQH 4L4VD 1Z0MA 4ZDHB 4MCYA 5TF1L 4CVXB 1NCWL 4P2OC 1DBJH 1JHKH 4MMZC 4CVZB 3EO9L 2R39A 3MV01 3C60C 5HD8D 3CDFA 3R1GH 5DVNA 5C92A 4Q0XL 3HS0B 4LFHD 3TCLA 5EUOA 1MRDL 1R0AL 1N4XH 4M4PA 3DNKA 4ETYA 1OAQL 4LMQE 4WW2A 3NH7L 3QJHA 1RIHL 2O5ZL 3ARYA 1JTTA 3BZDA 3F7VB 3VFUB 3BESR 4HKJB 2AJYH 4RFEA 1MCOH 5FYJE 1V8HA 1UH3A 4F57H 4JZNB 1LO2H 5D7SH 5E6IB 4OFIA 3X11B 3HE6C 3OAYH 3ZKMD 2X4SB 1C7TA 3L7FA 2DQJH 4TVPH 3DSFH 3OKKB 3ULSB 1B0RA 2OSLB 3LPFA 3W9DA 5H94A 4N0YL 5CHNA 1U6AL 1R3IH 4YDVB 3OKEA 1T4KB 3RGVC 2VN7A 5E2JA 5ANMA 5D5ME 1YYMH 1MCDA 1Q72H 4NRZB 1S5HA 5EZOL 1Z5LB 3VJ6A 5J1AA 2XZAH 5E2UH 3X3FH 4QRPE 2Y06H 1SYSB 1ORSA 4MJ5A 4YDJA 4JFXB 5J13C 1VFAA 1OAYH 3GBML 3KGRA 3BHBB 5IQ7L 5EZIL 1NGWA 1RZKL 4CNIB 1EAJA 1YQ2A 2HVKA 2VXSH 2NY6D 4XZUB 2VZSA 5ILTH 4R4FH 1LVEA 3GMMA 2HG5B 1O7SA 4U4BA 3QWQB 3ARBD 4QY8B 4MZ3A 5D5MB 1RZIB 3UTSE 4KROC 1L9MA 4XP6H 1DBML 3RDTA 5JXED 3QFJE 4DN3H 3S4SB 3D0VA 2JIXD 2YUZA 1IILE 2UYLB 2E7LA 4L8CA 4NNXB 4S2SA 1BVLA 4QRPB 3JXAA 3U9UA 2FRGP 4WHCA 2FIKB 3MJ8A 4HS8H 1JGEB 3QWRA 5ID0A 1EGJH 2YD5A 3RY5A 1GH7A 3GBNL 5EBMA 5C0RL 3GBLA 4W70A 2E5EA 3QA3B 2GKIA 1W2KT 2XWTA 1XGYH 1VEPA 1CGYA 4H25B 1VFBA 3F7YB 3O3UN 2Y5TB 4YXKH 5J1TC 2I27N 4BFIA 4OLZL 1FH5L 4JG0H 2VO5A 2O5ZH 2XQYK 5CJBA 3UTSB 5J6HB 5HI3C 3RL1A 4N0UA 4N8VG 4HQQL 3L3GA 5A16B 1V7ML 3QFJB 4MXQD 1T66D 5TE7L 2FBOJ 2P48B 3LS5L 5GPRA 3UROR 3BD5A 4KUZH 1OQXA 1NCDH 2FX8H 1XGQB 5FYLL 1W72H 1UFUA 5ESAB 2RR3A 4XCEB 1KB5A 3UTPD 1LD9A 4KRLB 1MFEH 4DOHE 1MCPH 1BQLH 4JB9H 1WIPA 4LCWE 5DUPH 1BVKA 2R1YA 3QNYB 5GRYA 2EEBA 4FP8H 3MFFB 1R3LA 5SWQA 5ICYA 3RWEA 3AS3A 1MFNA 3P2TA 3CPLB 1NEZB 5EZOH 1J1OL 4UT9L 3RU8H 4PJ5E 5FDWA 1NBVH 4JM2D 3QDMA 4K9EC 4ELME 1X4ZA 4XNQA 2J7LA 2AK4D 1AI1H 1M7IA 4U33A 1TJIL 3MLVL 1R3JB 4O2FA 4NQCD 2B1AH 2HMID 3TV3H 2J6EA 1BFVL 1S5IL 2QHRL 1FAIL 1EJOL 3RX8A 1ES0A 2VXQH 2VZVA 3I84A 4GRMB 4UILL 3SPVA 4DZBB 2YPKA 2D7TL 4WWKD 3VWJB 1I1RA 3PWJA 5KVFH 5JPMA 3QIBC 4DOHB 3HC3L 4O5LL 1ZT7A 4LCWB 4FQPA 1YNKL 4JM2F 3OHXB 4RX4D 3PWPE 1GGTA 4JGJA 1XIWA 3MBXH 4LHQB 2P5EE 4PJ5B 1JNHB 4R0LA 4TOYL 4TPRH 5FYJU 4ELMB 2IFFH 3SKMB 2EICA 4FFWD 3RWIB 3OX8B 2K3TA 5T1LB 2YD2A 3J8F7 4QHMB 5JNYA 1S7SA 1WBZA 1M6OB 4MX7B 2J4WL 4APQD 2NW3A 1LK3L 5KAQF 1FLRH 1DDHB 5LGKA 3VG9C 3T2NH 1H3UA 3WN5A 4JE4B 5C6TL 4GS7C 1FH5H 2ZG3A 3VXTB 1WAAE 5D1ZC 4LDOB 5GRWA 2NXZC 4PGDA 3PWPB 1PD6A 3GIVA 1FFNB 3WS3A 3UPAA 4HULB 3REWB 2P5EB 4JY5H 1CFTA 2BVEA 3D6GA 4M3KB 4NKQB 1ZS8B 3V5HA 3ZL4L 2ADIA 1MCSA 2P24A 4PP2B 1EO7A 4HWZB 5BMFH 2XKNB 3T4YB 2O61A 1DLFL 1U8HA 2HLAB 2YSSA 4YXLL 3H9SA 5DA4A 1ZWIA 4WV1C 4HUNB 3FQUA 4K9EL 3SDDB 2H32B 2R2HA 4PJ9A 2A0LC 3BPOB 1FZJB 1U8LA 2N56A 4LSSL 1J11A 1RJZA 2BVUA 2IALB 1AKJA 5T3ZD 1TENA 2H3NB 5EIIA 2WMPA 2X89A 4P2OA 1U8NB 5F7NC 3TGXA 2ZOLB 1HXMB 2PYFA 5DQ9B 3C60A 2F5BH 3BQUD 5DD3L 4ZS7H 2R0WL 1LO0H 4UDTB 1CZ8L 5KN5A 2O5XL 1S9WB 2GAZB 1IAOB 1IGCL 5DUML 5GJTL 2AK1H 1JBJA 2G2RA 5BV7B 5HYFA 2Y7QB 3ZDXE 1NCBL 3DROA 3VFRA 1INEL 3QEQA 3SCMA 2G5RA 3U0TA 4BFEA 2P49B 3N85L 4L4TE 4XCFH 3OKDA 2X70A 4I0PB 1KIQA 2F5AL 3MZTA 3QUZD 2R2CA 3RL2A 3HE6A 2HT2D 5C08B 2GK0B 3AGVA 3GEWB 4GBXC 2VZTA 4PRDA 3U82B 1S7WA 4X6CA 3DVNA 3BO8A 4HH9B 1QHOA 3RGVA 2PR4L 3BAEL 1CFQB 5L88L 4QOKD 3ARFB 5J9PB 3V95A 1W0VA 4YC2B 3NABH 4FMKA 3W0WE 2BC4A 5DZOA 4NZUL 1LK3H 1Q0XH 1ETZB 3QDGD 3HFML 4LQ1A 3ALPA 1I75A 1C12A 4L4TB 1XT5A 3F12B 4G8EB 3SKNA 4NBZB 4OUUB 1K4CB 3JTSA 3IDNA 1GGCL 5D93C 4HXAL 2HTKD 2E6JA 3GMPA 5C0CD 4M6NL 1ZTXH 3IFNL 1PG7L 3W81A 1OL0A 4PV9A 4L3ED 3WL9B 2A1WL 3CAFA 2VLJE 3CFDB 1Q1JL 4EDWH 5B3NA 1MUJA 5AYUH 1YMHB 1F42A 2R56L 4ZTPH 4KK8C 4OZGA 1JHTA 3H7BB 4L29A 4JJ5B 3SGKA 3VD7A 4C83B 5D1ZD 3W0WB 2H6PB 3UMTA 4HPYL 2LU4A 2YPVL 3MNWA 2IGFH 2ZCLH 3VXSD 2K7PA 3OKLA 4Y5XB 2VDLL 1KBGL 4EJ1C 1YY9D 4JFZH 2VITA 2BERA 1X3DA 4I3RH 3TCXA 1HHIA 1DBKL 3GDBA 2VAAA 4RQQA 4ZUSB 5IHUL 1WAAF 3CFEA 3V5KA 3ZKXC 4HK0B 3PDGA 5FA3A 1SM3L 3L3OA 3MV8D 4LVHC 1HH9B 1FBIL 5DFVD 4XWOC 5JXAH 1F58H 5DD3H 3BZFB 4ZO8A 1L6ZA 2VLJB 4EI5A 2GT9A 4P59L 5IEKA 3CZFA 4P23A 1KYOK 4HKBA 3BZ4B 5IFAL 5ALBH 1MHHA 3CJJA 4LVEA 3U7WH 1N6UA 3VXQA 2A73A 2G9HA 4N8CL 4YDLC 3D25B 3EHBC 1YEIH 3GMRB 3QIWA 3R0NA 4NBYB 2CDGA 2WNGA 4YZFE 5HGAA 4O2CA 2Z92B 2HJKA 4YPGA 3TH4T 4KH2A 3MLYL 4NSKA 1ZKAA 4PRHA 4WU7B 4G7VH 5FUOH 4U6VL 2CKBB 4PJBE 3TBTB 5BJTB 1P6FA 2Z91B 4QXGL 2Z4QA 3P4MA 4PD4J 1A3LL 1OARH 5DSCA 5LCVH 1LEGB 4EBQH 3VXPB 5I0DA 4ZXBB 4NJAL 4NHCL 4PBVC 1X5ZA 4U1HA 2I24N 4EKXA 1HILA 2V7NB 3TPUB 3EOTH 1Y0LA 5TGBB 4HXBL 4OZFH 5TDNA 1P2CA 1ZA6A 3M17A 1VADB 4WI2A 4K2UL 3BPCA 2VZ1A 2VOTA 4FOMA 5D2LA 1WZ1L 2W91A 2EDFA 4KAQH 3BKYL 1JN6B 1X7QB 4NPYB 3DO3A 4NHUB 4PJBB 1N7ML 5LWYH 2X1QA 4L9LB 4IDJL 5IHZB 5GS0D 2R69L 2Z8SA 1PG7H 1OTTC 3C2SA 3TJEH 4KK5C 2BXYA 1H3GA 1MNUL 4JLRB 3TT1L 4XBGB 2D03H 4MD4B 5GRVK 4P9MH 4HDIA 2Q76B 3QIBA 3RAJL 1B90A 2QKIA 5K59F 1CIUA 1R24B 3HMXH 2DQIH 2W60A 4UQ3A 3WFDL 2XA8H 3O3AB 3OGCB 3BKCL 1L7IH 3TYFA 3VXUB 1LP9E 3HCVA 4Y5YB 3CXDH 3S3SA 1IEAB 4LHUB 4HG4J 1BFTA 1HHHB 3KJ4B 3QO0A 1NC4A 3HRZB 1OQOA 3MJ9H 3OXSB 4JQIH 1UACH 4AEFA 1UJ3C 5LKNA 1FZMB 3NFPB 3R06B 5MEPB 4HK3J 5JOEA 3MRBB 4IRSB 4OIBA 5HVHC 4E41B 4F80A 5DMIL 2B5IB 2OTWB 3KWWA 5I1IL 4Y4FB 4G6KL 4M5YL 3DX9B 3KYOA 3P9LB 2VLMD 1T7XA 4LSTL 2OLDA 5ALCH 3QZWB 4HMDA 4Q74A 5I30L 1RHHB 4ZXBD 3TESA 5JDSA 1P7KB 4QO1A 3RPIA 1T5WB 4FN0A 4BQCA 3NFSH 1LP9B 3FFCE 5DJ6B 4P3CH 1H15B 3F8UB 1NDGB 1NGXB 1VCAA 3QNXA 5DD6B 2JJWA 1IM3B 4GG6E 1QEWA 3BH9A 4X80H 3QUKB 3PUCA 4OD3L 2Q1EA 4LOUC 3KPRD 3NTCH 4P2RD 3HNSH 4OT1H 4JPIA 1J05A 4YGVA 4ZUTB 4DKFH 5DI8A 1JIBA 2FECL 1CICA 4Z8FH 4GQPH 4K71C 5HYJD 4KZDL 2Z9TA 4U0QB 4WV1A 4YDIH 3QUXC 2H26B 2FJGA 2LVEA 2G75A 1RY7B 4WVRA 5C3TA 2ORBL 2OI9B 5IK3B 1HNFA 3GKZA 4BYHA 1QVOB 3VXMD 5JIPA 4LPXA 4RIRA 5E8OB 5T5NF 1WUNT 4X4XB 2WP3O 1UCBL 4MDIB 1FG2A 3QQ4A 4WUUA 5ECJE 1CE6B 1JWMA 2DYPD 3MUHL 3FFCB 1INDH 2X5PA 3KYKH 4YZFF 4QXWA 2FHBA 3UYRL 5KS9E 2VLKE 1NDMA 3C8DA 3C6LA 4G8GD 1J10A 4GG6B 1F11A 3VFTB 1F13A 3BKYH 4XP4H 1WBYA 3GMNA 4YR6B 5TE4H 2A77H 1DUZA 2YPLD 1QFWM 1N7MH 5JZ7C 1PG7X 4IRSD 5INDB 1A6TB 3TT1H 1E28A 4YFLI 4JAMA 4Y4FD 3QUMB 3ULUD 2CRIA 1KIRA 3B9KD 3SQBA 1CLZL 5BRZD 1WEJL 3MRGA 4UUJA 4XPFH 3O6FD 2AXGB 4GBXA 4Y1AA 3WHXB 4RMUA 4YHNA 3ZYZA 5DFTA 2AABL 1T04A 1JNNH 4LKXA 3GMOB 3PDOA 2ENYA 4U1GC 1S7XB 1QLFB 3RGHA 1TZHB 3GUTA 2CLZA 1AGCB 2X6MA 1ZMYA 5E1AA 5KS9B 5CEZD 1JGLL 2VLKB 4XP9H 4D0DA 1MJ7H 4HUVB 2A6DB 3VI4F 3NCYP 3O0RL 4PJCE 4YBQD 4DGVL 2MKLC 3NCBB 4QT5B 4OD1L 2GUOB 3ULUF 1J0YA 5IT2L 3DTXA 4DGYL 2B4CH 2NMSA 3TH3T 2N7BA 4CADB 3N1PC 3THML 2APBA 2XYCA 2YUVA 2ED8A 3ZT7A 4WI9A 1FO0B 5HGDA 5T1DH 5T5FH 3PP3H 4X7SL 5EU6D 2A9ML 1JPSH 5ICZB 3X12B 4YE4L 2R4SL 5C0JB 4NO3B 1HSAB 3ARZA 4HLZH 4PTUA 4R97B 2VDNH 4DKDC 5HYQB 4TSBL 1IGYB 5D1QD 3UJIH 2OL3L 4O02H 5EUOE 3I50L 2AJSH 4M00A 2A6KA 2F19H 5HY9B 1FN4A 4KK6D 3Q2CA 1NKRA 3O3DB 5EBWB 3OJDA 4X83A 1G7JA 4H8WC 2D3VA 2FD6L 3IU4H 3MJGX 3VFNB 1IBGH 4DCQA 4F15B 5FO7A 2VKXA 4YAQA 4Y8AA 3TJHC 3U30C 1QLEL 3MRHA 1DUYB 3MOAL 1RPQA 4JFHE 2P44B 1Q0YH 3UYRH 1AH1A 3O2VH 3KYMA 1UEYA 4MCYB 5JHDA 4LQFL 5ADOL 1B2WH 4YHZL 1WCBA 1EEYA 5KVEL 3T77B 1UWXH 1MPAH 1RK1A 4ONGL 1YYLH 1FFPA 3TCLB 1ACYH 1TETH 5EUOB 1FFRA 4OCYH 4HLZG 1T03H 5CBEA 3HRPA 4HPOL 4F8TA 4WW2B 4XNZC 3LKSA 3QJHB 4KDWA 1I8MA 2X9XA 5HSFA 4D9LL 4RFEB 4ZUVA 3TNNA 2FHFA 4LSVL 1RHFA 3ULVH 2PO6D 3LB6C 3QXVA 2NY1C 3RZCC 5KS9F 1WBXA 2ZUXA 4NO0D 1D5IH 2Q3ZA 4FFYH 5IV2A 4QRSA 1IAIL 2IH1A 2ED7A 4YUEL 5BS0D 1B0RB 5C71A 1YPZF 4HF5L 2PXYC 2IFGA 2NCMA 4TSAH 3W9DB 5H94B 4LLYA 5JW4R 1BFOA 4XWGL 5CHNB 1FPTH 3OB0H 3H0TA 3OKEB 4U1JA 5ANMB 5E99H 1DN0A 1H3XA 1X4YA 2VLRA 4LPTA 2Z8VC 1CE1L 3THMH 5GISH 5SWZA 5D8JL 4KDTC 1S5HB 3FO0H 1UQSA 4X7TA 4Y2DC 4BKLA 4Z7NE 5J1AB 4K3JL 3GJFH 3FO1A 1OLLA 1ZHNA 1R5IA 2A9MH 2DI8A 4NQED 1ORSB 3PHSA 4MJ5B 3NCJH 4YDJB 5E2TH 1JNJA 1EA9C 2FGWH 4H8WL 3FOMA 1IAII 1VFAB 1LO5A 3MLXH 3TBSA 25C8L 2VDRL 2ICWA 1BREA 1V3KA 4OI7A 3WXWL 1NGWB 1U3ZA 5E4EC 4JRYA 4C4KT 4OF7A 4LNVA 5GGRA 4CN6A 4XVTL 4PJCF 5LGJA 2HVKB 4HBQA 4Z7VF 4KJPC 3UTTA 2YD6A 4ZAKC 1KJ2H 3GMMB 3STZA 1KTKE 1IC7H 4U2YA 4P46C 2ZUQC 1CLYL 1N6QL 3NA9L 4JQVC 2EDOA 1MCKA 1UJ3A 4N0UE 4KVCL 4XPHH 5J0BA 3RDTB 3QXAA 3FN0H 2J5LB 3H6JA 4OGYL 4UZGA 3D0VB 4R26L 4L8CB 4S2SB 5FCUL 5LBSL 1BVLB 3W5MA 2D9CA 3PL6C 3U9UB 2DLTA 3MJ8B 1RUQL 4RFOL 3F5WA 5ID0B 1PJ9A 1D5XA 3GNML 5EBMB 2XWTB 3RIFK 3ALWA 1FVEA 3VFGH 1VFBB 3WIIL 4WW2F 4BFIB 4MCZA 1U58A 3CSPA 3RL1B 5FDYA 4N0UB 4QF1A 4D2NA 3L3GB 4D9LH 4ONHA 2AVGA 5GGVY 2E9BA 1YQVH 3QDME 5GZNC 4PREA 3WFZA 3QUXA 2W9DL 3ZKND 4POZD 4XAWL 5H2BA 3B9DA 3S36L 3M8OL 5DT1L 4WTZA 3O6MH 1IAIH 1KCRL 4YHKH 1FSKB 2E8YA 1UWGH 2YA1A 1KB5B 1MEXH 1LD9B 3VFWA 1QSVA 4XWGH 4B50A 2EYSB 4G42A 1FAKT 2OL3A 3IXTA 2VISA 1BVKB 2R1YB 1ZHLA 3DMMD 3HB3D 2BFVL 4NNYA 1JCKA 1CE1H 1R3LB 5SWQB 5ICYB 2EO9A 4M7JL 3RWEB 3MUGA 2VDMH 4OD2A 1XFPA 5DHYA 3VRIB 2P8LA 3GRWL 2IBGA 2VSDA 5FDWB 2DQGL 4KK9D 3FJTA 3QDMB 1EHLL 2BDNL 1A7QH 4XNQB 2P1YA 1ZEAH 1M7IB 1TQCB 4O2FB 1ZLVK 1EDQA 3KPNA 1D5BA 2WBKA 4KU1A 1RMFL 5JA8B 1ES0B 4WI7A 5ACLA 5IF0A 3SPVB 1MY5A 2CGRH 2IADA 3RQ3A 1B3JA 2YPKB 2IPKA 3DETC 4X5LA 3QIUA 3VW3L 3GSOA 4KZEH 3PWJB 5JPMB 1I4FA 2XNAA 4GXUM 4HUUA 1JFQL 4HGMA 4WCYL 4TVPD 1ZT7B 4X98A 4OFYA 1MCWW 5BZDA 2V5TA 4P5TC 2OXGA 5EU4A 3QDHA 3MACH 3QXWA 1XIWB 1UM6L 4J3OC 3OAUH 4Z7NF 2VH5H 3MLTA 4NNPH 1IC4L 2BCKA 3AB0C 3LSOA 4R0LB 5FCUH 5I18H 5LBSH 5DZNA 5TFSH 4CJ0A 2W07A 3ARWA 4ZYKA 4OFPA 3H9SE 2VDQH 5JNYB 3ROLA 1S7SB 3OJMB 3OPZH 1WBZB 2NW3B 1Z3GH 5DJ8A 3VDAA 1XEDA 4K8RL 3RKDC 3FAXA 1NGPL 4RA0C 5GGTH 1FNSH 2AV1A 3WN5B 5I8CA 3WIIH 5JMRA 3FQWA 2CDEA 4J3XA 1OP5K 4OCRH 3PABA 3QNZA 4PGDB 2OP4L 3GIVB 3WS3B 2R29L 1DBAH 1VHPA 1CFTB 1KTLA 3BMVA 4QRRD 1SJVA 5J56B 4HS3A 4Z7OE 3WKML 3V5HB 2ADIB 2P24B 2O61B 4RRPG 1YJDC 1U8HB 5DT1H 2YSSB 2CLVA 4AMKL 4FG6C 3H9SB 2EEAA 3QEQE 4XP1H 1ZWIB 2HRPL 5JOFA 3FQUB 1I9RH 2R2HB 4PJ9B 4UTAL 3RVXD 1U8LB 4YBLB 4F2MA 4GXUN 1TQBC 2CKNA 1KEMH 5CINL 4MA1C 2Y07L 1RJZB 1YEJL 5HHVH 3EJZC 3WEXA 4B7IA 2BFVH 1AKJB 1N5YL 3MJ7A 1U8PA 3D3VA 4M03A 5EIIB 1IAKA 2IAMC 1X5LA 4JCMA 4P2OB 4XXCA 4KKBC 5BQ7A 2PYFB 1ACZA 3GSNL 3N0PB 4X6CE 3C60B 1AO7A 3PHQA 5IHLB 1F4HA 3GMQA 2BDNH 5B8CC 4FQXD 5KN5B 1REIA 1XIWD 1EUUA 2ADGA 5DA0B 4OSUL 4V2CB 1YN6A 2DMCA 2I25N 5CD3A 2G2RB 2XZQL 3DARA 2QADC 1KN2H 5FYLE 5TJWK 3DROB 5CGYD 3VFRB 2OR9H 3QEQB 3SCMB 3U0TB 5FYKH 1MRFL 1UGNA 2ID5A 3JWOC 4C56D 3E6FA 1DQDH 3O6KL 1LDPL 3OKDB 5CIPA 2X70B 1MHCA 1KIQB 4JFOA 3CLFL 1OB1A 3TLRA 2XT1B 3RZCA 4E42A 1GHFH 1ZLWH 3RL2B 3RIAF 3HE6B 3B83A 1N2RA 1MOEA 2R0LL 3C5ZD 3GHEH 4D3CL 4N0RA 1T7YA 4PRDB 1S7WB 1ULVA 4JPVL 3N1GC 4X6CB 4MNQD 3LKPA 3CGTA 4W6WB 5AUMA 3DVNB 2QR0A 3BO8B 3V0AC 1TJHH 5F8RC 1FC1A 3RGVB 1F90H 4OZGE 2XZCL 3TVMD 4PLNC 1YMMA 1A6UL 1YZZA 4K3DH 4L3CA 3UPRA 1W0VB 2BC4B 4P57A 1JHLH 4I3SH 3SEPA 4YIQA 4UIMA 2W0FA 4EN3D 4Y2DA 3L5HA 4Y5VC 3K4ZA 2AI0L 3LPGA 5IOPA 4K8RH 5K33A 3MV9A 1C12B 4ERSL 4OLVL 2WWMD 1Q94A 3SKNB 1RQ5A 3RUGF 1D6VL 1YJDL 2QBWA 5J13B 1EO8H 1PVHA 4FFVC 5CSGA 4U7SA 3JTSB 3I85A 3IDNB 1VFOA 3MSPA 5F3HA 4DFHA 5F7LB 4QXUH 4U0RC 3ZDZF 3GMPB 4IRJD 3FOLB 4N90D 4PV9B 3HZMA 1QKZL 3GRWA 1N0XL 3OF6A 4ZAKA 2MPAH 3GSUA 4KKNA 1MUJB 3Q1SL 3S36X 1A4KA 4CKVX 1MSPA 1F4YH 4OZGB 1JHTB 4P46A 4L29B 1E4WL 4TTDC 5EUKA 3PNWA 4KROB 2W9EH 4JQVA 4PLOB 3HR5A 4XT1C 2BNUA 3MNWB 2BRRH 3OKLB 4XI5C 4I13B 4ALAL 3FZUD 4F7MA 1X6LA 3MXVH 5KJRL 1RUMH 4S1DD 2VITB 4UINL 4ZD3H 1HHIB 2VLLA 4HIEA 5FUCC 3PL6A 4PRHE 2VAAB 4RQQB 2DI7A 4U6XA 1QFUL 4IOFD 2JB5H 1N5YH 4WENB 4PJIA 2NXYD 4Z7UF 2A38A 3CFEB 3JWOL 5FA3B 5GHWH 3L3OB 1RUPL 3GSNH 4TNVF 2AEWA 1GC1H 3NIDF 3ZE1E 4JO2L 4G3YL 1GJIA 1KIPA 5JW3L 1FL3A 4EI5B 2GT9B 2L0DA 1P6AB 1WK0A 4ZFOL 5IEKB 3CZFB 4P23B 3ARGD 1IM9D 1CF8L 1DR9A 4HT1H 2FCBA 4HKBB 4HWBL 5EO1A 3V7MA 3EJZD 2VXTL 1MHHB 4XH2A 3VXQB 2A73B 2G9HB 2IQ9H 2YC1A 5MP6H 1MFAL 1U3HC 1BVZA 3QIWB 4TN9A 5K9JL 2CDGB 7FABL 4LPCA 5D2LE 5HGAB 4BFBD 4O2CB 4IS6A 2FH8A 4ODBD 2HJKB 4Z77A 4YPGB 5B38A 3JWDC 4PRHB 1QSFD 2RJMA 3G6DL 5I8OH 3P11L 2WV3A 4EEEA 3LD8C 4OIIH 3BI9X 2Z4QB 3P4MB 5DMKA 1KJ3L 4BQ9A 2QADD 1R5WA 4JPVH 5DSCB 1AGBA 2AQ3A 5SWSD 1QSZA 4NM8L 1FORL 4X9GA 3UBXA 2XZCH 4U1HB 2Y9RT 3AREC 4LARL 4G6ML 1HILB 5GJSH 3S8WA 2GITA 1R3HA 2HTLD 1FZKA 5E8PA 1Y0LB 3VH8A 4YHML 2LU7A 5JW4Q 2VQTA 4YJZL 3EYVA 3EYQC 3WLWC 4YFEA 3R0MA 5TDNB 1P2CB 5GRXG 1ZA6B 4X7FC 3M17B 5I1HL 1IEBA 1ZVHA 3BPCB 5HHME 5D2LB 1RD6A 4ODHL 2FJFA 5E8DH 4P4KD 5M7QA 2BNQA 4MQ7A 4QLRA 1OY3B 4RWYL 2XI9A 5C0NC 4F7TB 2GJ6A 4Y0GA 4DTGH 2DIJA 1J8HA 5DC9B 5JO5A 2DL9A 3PGFH 4GAGH 1F3RB 4LBEA 4EVNA 3LDBC 2YS4A 3CVIL 4IIQA 5FKAA 4WGVB 4HDIB 3QIBB 1U8MA 5C0GA 3ZKSD 4EXKA 1VPOH 2QKIB 2W60B 4UQ3B 2VDPL 4P5TA 1CTOA 4EI5D 2HVJA 2V17H 2HYMA 4LRIA 2RGSA 3TYFB 3HCVB 4HIIA 4DVRH 5H35A 4RGOL 1GIGH 2K1MA 3QO0B 4XPGH 4G9FA 4XVJH 1NC4B 4UINH 5HHMB 1R3KA 4OJFH 3QIWD 1CFBA 5GIRA 3I02A 1NCNA 2HJFA 2OXHA 1P69B 3KWWB 5CJ8A 3SE8H 3V8OA 3T3ME 3ZDYE 1C5CL 3KYOB 1Z9LA 3GZKA 2VE6A 3WSQL 4JZJC 3VG9B 1A7OH 4M1GL 4Y4KD 1ORQA 2DM4A 1RJYA 3ARXA 3ORJA 5D6CA 3HLAA 1AR1C 4GS7B 3LRGA 3RWCA 3SE3C 5B4MC 3MA7A 2Y5EA 2RFXA 1UADC 3RPIB 1C5BL 2KKQA 3CD4A 5GS3A 4WUUE 2NXZB 2FATL 3D39A 1MFAH 4FQQA 1EFQA 2DD8L 3QNXB 4NT6A 5CZVL 4ONOA 1QEWB 3BH9B 5I15H 2K7QA 3SE9L 3CCHA 1QQDA 3FRPG 4JPIB 3JV5A 4Z7WA 1J05B 4YGVB 3MLSH 4MJ6A 5DI8B 3GHBL 1OAKL 5ERWA 1CICB 3QULA 4V1DD 1KJ3H 3MMEA 4X6EA 4WV1B 1CDGA 4WO4C 3ZE1F 2FJGB 1U3HD 2G75B 1MREH 1J0KA 3QCUL 3TBVA 1SHMA 3EOAA 3U2SA 1OAXH 2J8UF 3TPKA 3F7PC 4LARH 4RIRB 4G6MH 5ICXA 1A5FH 5CGTA 1FG2B 1T2JA 3QQ4B 2IAMA 4Y1AE 3L7EA 4KRPC 4WUUB 4FQLH 5EDXA 1RSFA 1I1CA 4O4YL 4L8SC 3VD4A 1IT9H 4TNWF 4TYUA 5B8CA 4FMFA 4P3DA 3C6LB 1KUMA 1F11B 3VE0A 2XQYG 5C0BD 5IBTL 4XC3L 1WBYB 3GMNB 3WFEL 2AGJL 1DUZB 1H3PL 2YRPA 4LIQH 3P0VL 5T1MA 1YC8A 3IVKA 1W8OA 1E28B 1AXSA 1IC1A 3RTQA 3MRLA 4JAMB 2NY5C 3GM8A 4ACPA 1BGXL 1QNZH 1FG9C 1PKQA 1DL7L 3DWTA 1KIRB 5IESL 1L0XA 4ZMAT 3MRGB 4UUJB 5D7KD 1K2DA 2IJ0C 4ZFZA 4NQXA 4F37K 4ZFOA 4GBXB 3KR3H 4HWBA 4Y1AB 5DRXA 2C5DC 4YHNB 1T04B 3CMOH 4LKXB 3WFCL 4AEHL 3PDOB 4LPVA 2M8XA 3LN4A 4YQXL 3GUTB 1XR8A 2CLZB 5E1AB 2HN7A 3C08L 1AC6A 1FRGH 4F9LC 2X4PA 4D0DB 3MBED 5DJDA 2CUMA 1MWAL 4HC1A 5I1JL 1NANI 4LLUA 1EV2E 1B9ZA 1OAZH 2XQBL 4OQTL 4P0DA 4Y5VA 2E6PA 4LLVA 5MHSE 1QA9A 3DTXB 2C3HA 5DHVH 4N0CD 5HI5D 3IJSA 1NGQL 2H1PH 5DWUH 3MGAA 4DEPB 4S1SL 1YNTA 3RJQB 3V5DA 5HGDB 1YNLH 1C5BH 1CD0A 4ZUUA 3T2PA 4XAKE 4UTBH 5JQ6H 1GCFA 2AJXL 4JKPH 5IMOA 2DD8H 4WTXA 1EUTA 5KSAD 1ZLUK 5JHDE 3V8CA 4TUOA 4XNMA 4U7MA 3LEYH 1IGFL 4U6YA 1D3CA 4PTUB 5B4MD 5C9JA 1BHGA 5E9DA 3IF1A 2YMXL 2ITCA 1TTGA 4RZCA 1DQJA 3T3MF 2A6KB 1FN4B 4M1CD 4ODWA 4KI1A 1P7HL 3LHPH 4DN4H 3KG5A 2XKSA 3OJDB 5D2NC 1PZ5A 1G7JB 2A2QT 5F88A 3LIZH 1TZGL 2EH8L 2CSPA 4DZ8A 4DCQB 5FO7B 3ZKXB 3PWVA 4TSCL 4YAQB 4KVNH 3O3BA 5CS7A 2GI7A 4LVHB 1EPFA 2KZ1B 2CIKA 3MRHB 1SMOA 2R2BA 2NY5L 2BSRA 3ZE0E 4U3HA 3FQXA 3ZHDA 4WFFE 4G6FD 3KYMB 2YUWA 4N0FA 5JHDB 4PJGA 2I9TA 1F6AA 4XHJD 1WCBB 1EEYB 3A6CH 3QQNA 1C1EL 3SKOA 3GKWL 3QPXL 4DW2H 1RK1B 3BT2L 1NH6A 1CGSH 1SQ2N 1UM4L 1I3RA 4O58H 5TE6H 4YDLB 1FFPB 5D71L 3LKOA 5CBEB 5FGCE 1NANH 4X99A 2DBLL 2VLRE 3A6BH 5IBUG 3LKSB 4JKLA 3R8BB 5SWZE 5IB5A 5B39A 4FRWA 3NFNA 5HHXH 1I8MB 2ATPA 3ECBA 4I9WD 1DANT 1J12A 1ZANL 2Q7NA 2YK1H 5FECA 1ADQL 5I6XC 4ZUVB 4KPHL 3TNNB 4YPJA 1RZJL 3WFCH 4OF8A 3O2WL 3HN3A 3L6FA 3BGFB 1JZ7A 4PJHF 1EZVX 1WBXB 3TM6A 4I77L 4XPAH 2HJLA 3QUYC 3F62A 5IV2B 3AREA 2C1PA 2UVFA 4JRYE 5SX4I 2QQQA 4QRSB 2IH1B 2QQKH 1OM3H 3UTTE 3VFOA 1BOGA 5JHLL 2NY0C 4LLYB 1BFOB 4W4OC 1JWUA 4PJ8D 1JYXA 3I2CH 3H0TB 1HOCB 1AXTH 2J88L 4U1JB 4ZFFA 1DN0B 2IWGA 5FGCB 2VLRB 3L3HA 2UWEA 1L0QA 4KV5E 5SWZB 1EFXA 1CDJA 1XR9A 3MRRA 2LABA 4OAWA 1A9EA 1IFHH 1QFOA 4BKLB 4X7TB 3BPNC 1U9KA 2ZCKH 3FO1B 1ZHNB 2QQLH 4IJ3C 1VEOA 4G6AC 1CD8A 1GOGA 3MRKA 1BZ7A 3OB8A 1A1MA 1XAUA 2X9WA 3FOMB 3TBSB 1LO5B 2DQCH 1K6QL 1F4WH 4Z0BH 5T3XL 1OAUL 2ICWB 4JDTL 3L1OL 2QSCH 4Y8DC 4JRYB 3WIHH 5GGRB 3U36A 2DQDH 3EYOA 5CEYA 4ZTOL 1JPFA 5LGJB 5JHDD 4M7ZC 3UTTB 4MB4A 4NGHL 4PGZA 5EN2A 2Y6SD 4M48H 3STZB 2FLRT 2Y23A 4K23L 1H8NA 5CP7A 4X4ZA 4PGEA 4PJFA 1UJ3B 2FZ3A 4NZDA 3K0WA 3QAZC 3WD5L 4Z6AT 2B7DT 1FFQA 1VKXA 4OM0H 1UEMA 3QXAB 2OZ4L 3MYZA 4KKLD 1ITCA 2DF3A 2XN9A 4JRXD 3SO5A 2F8XC 1HDMA 4WEBL 4JZJA 1FLTX 2ZCHL 5IR1A 1IKFL 2GQHA 4ZG1A 1X9QA 3DX6A 3SE3A 3F5WB 4Y16D 1D5XB 3QPXH 1B4RA 1RZFL 3MR9A 1HZHH 1UB5A 4ODSH 5SX4H 1FVEB 3B5GA 1NFKA 3LMJL 3GJEA 1MWAA 1NAKL 1NPUA 1K8IA 4TQEL 2CMRL 4OQTA 4MCZB 5DD0L 1QFWI 1U58B 2NY4C 1N64L 2WQ8A 2ZPKL 3FB7A 4QF1B 1EEQA 1RAMA 4ONHB 4K71B 4KPHH 4NKIL 5SWZD 5DK3A 4PREB 2OTUA 3C5SA 1K8DA 1RZJH 2AEPL 1J1PL 3QUXB 4WO4A 4Y88A 4RAVA 5H2BB 4U1MA 2LVCA 3QEGH 4P2QA 5FM4A 2XRAH 1HCVA 2APWA 4EOWH 4LMQI 5F7EH 4G42B 1RFDH 2OL3B 3IXTB 2VISB 4L8SA 5I2IA 1ZHLB 3MRPA 4U31A 3RVUC 4N1HB 4NNYB 3DPBA 3WXVL 1ND0A 4FQJH 3MUGB 1H0DA 4OD2B 4EUPH 5DHYB 4YDKL 2P8LB 2Q8AH 5HHNA 4IM8A 3I3EA 3MLUL 3RX7A 3P73A 4QWWD 4BK5A 1JPTL 4QGTA 5C7XL 1OGAD 1ZT1A 3U4AA 2LTQC 1J9CT 1OAUH 4FQHA 5CCKL 5F7MC 3KPNB 5J7CC 3ULVD 1D5BB 3WUWA 2JCCA 1CT8A 1YDPA 1MFDL 5IF0B 3BGMA 2IADB 1NMAL 2IPKB 4XGZA 1AXIB 3G5YA 1SEBA 2WQRA 3QIUB 3GSOB 4W6YB 1I4FB 1M1SA 3X13A 2XNAB 4HUUB 3GI9L 4JPWH 4U1GB 4X98B 3ARPA 5HPMA 3CC5A 1U2CA 5BZDB 3VA2C 4LU5L 2HT3C 3O2DH 4O9HL 5EU4B 4KV5F 4F9LA 4W81A 4S1RH 3FB6A 1MAML 2OZ4H 4PUBL 3MLTB 4XVUC 1QFWH 4GRWE 5D1XC 2X1XR 2BCKB 3LSOB 5L9DH 1ADQA 3NZHH 3ULVF 4L5FL 4EUPG 3TBWA 3PQYD 4GAJH 1CN4A 3PGCA 4K7PH 4ZYKB 2VUYA 2IC2A 1CXKA 3ROLB 1PY9A 1RZFH 4KY1L 5DJ8B 2WZPD 3FMGH 2AV1B 5D7JC 5IVOA 5I8CB 4XBEL 3NN8A 3FQWB 2CDEB 4FTVA 5ISZA 3TO2A 1UKTA 2V9TA 3D3VE 2VNCA 3BUTA 4MZ2A 4LSUH 3PABB 3QNZB 5I19H 1RUAL 2BVOA 1AO7E 3SBWA 4Z7QE 4NKIH 4X4MA 5FYJH 3O4LA 4U1KB 4GRWB 5FKPA 1KTLB 4GRLC 4HGKC 4JY4A 1NAML 4HS3B 5DQDH 3DHMA 2IANA 1J18A 5C07A 5AG9A 1E4XL 2DQHL 4JFYA 5DR5L 5EZJA 1QP1A 1RIUH 2CLVB 4LSQL 3ZTNH 1EH9A 2F58H 2GY5A 3WFBL 4JO1H 5GZOD 1DANU 3P30H 3U30B 5CILL 3ROOA 1OCWH 4F2MB 1S9KC 1I7TA 1B88A 4OF5A 3WEXB 5I75B 3RBSA 1TPXC 4BFGA 3MJ7B 2K9UA 1U8PB 3D3VB 4NJ9L 1MF2L 3WXVH 1ZV5A 1IAKB 3DYPA 4NO2A 1FL6A 4MA3A 3UP1A 1KPUA 5BQ7B 2ZUUA 4N5EC 5IP4A 5J8OA 2N7AA 5GSRA 1AO7B 3PHQB 4LEOA 3VFMA 3GMQB 1E4XI 2GFBA 3DVGA 3QEUB 3LV3A 3HI1A 4WNQA 5EO9A 2YOCA 5C7XH 1YMME 2ADGB 3MLZL 2IBZY 4XNZB 1KG0A 1XGPA 1YN6B 3QI9D 5CD3B 2R0ZL 5JA9A 3NVQA 3TFKC 4J4PC 5D7IF 4AG4H 5F6IB 3MUZ1 3S97C 5IMKA 1HQRA 3MV9E 3E6FB 3NIGE 4JFFB 5DK0A 1K3IA 5C86A 5CIPB 1I9IL 4MHHI 1MHCB 5IWLC 2NY1B 4JFOB 1EX0A 3ARDD 3RZCB 4E42B 4BSJA 1N2RB 3QUYA 4CU8A 5F97E 3LEVH 4JZOA 2D7NA 5E95B 4A6YL 5J4MA 2X4UB 2HKHL 3QCTL 2XKUA 1MFCH 1KXTB 2PXYB 3RWHA 3LKPB 5GRJH 3A0OA 5AUMB 2QR0B 4W4OA 1LO3L 1GL4B 3S4SG 2WK2A 1YMMB 3UPRB 4L3CB 3T0ED 3H9YA 1J87A 4H88H 1UA6H 4P57B 1DVFD 4YIQB 4UIMB 2BRQA 2W0FB 2PYED 1AE6L 1IGIL 4Y2DB 1FYTA 4GXVH 5HHOA 5IOPB 3AC0A 3MV9B 4K3EH 1CXEA 4U1LA 3DI2B 2J1KA 3CNKA 3GSXA 4LHJB 1Q94B 1CI5A 4Z76A 2WUCL 4XMKH 2QL1A 5HDOA 1ZA3A 3QJFA 4PJIE 2NPLX 5E4IA 1RZIA 5EH1A 1WZKA 2DLFL 4GUPA 5F3HB 4I48A 5JPNA 5E4EB 5DEFA 2ZOKA 3IDYC 1IC5L 3U0WH 3BE1L 3HZMB 3KLHC 2FR4A 3BH8A 4URTB 4ZAKB 3GSUB 1I1AC 1Y6KR 2UYLA 1VEMA 2V5RA 1A4KB 1YY8A 3N9GH 4P46B 1A7PL 4NFCA 1E4XH 3IXAA 5EUKB 5BVPL 3LN5A 4LSQH 3HR5B 4NN6C 5GRZA 2BNUB 4M4RA 1Q9LA 2DDQL 4PJ7A 2VMFA 4MQXC 1JRHL 1P5VA 2OM5A 4F7MB 1SMAA 4MJ2A 5CILH 4OGZA 2IMNA 2VLLB 4HIEB 4GRLD 3PL6B 1KYOJ 4Q7DA 4M6OH 4U6XB 3UC0H 1BJ1H 4PJIB 1CLCA 1AP2A 5I71B 1RURL 3IDXL 2ZSWA 1ZXQA 3OR6A 4S1QH 3VG0L 4HFUH 3FL7A 4HZLA 5EIQA 2E9WA 1MQKH 4MNHA 1KIPB 1NEZG 1L6XA 1FL3B 4BQ8A 5JIHA 2OK0L 2UZIL 5GGSY 2BVTA 3FQRA 3ES6A 1A64A 4KI5C 5EO1B 4OLWL 5FO9A 3U9PH 4OV6F 4XH2B 5IW1A 4MVBD 2YC1B 3T1WA 1RUKL 5I1CH 1RVFH 2GHWB 4N8PA 5TH2A 2XY1A 4OZIA 1P9MC 4N5ED 4IS6B 5EO0A 1QR4A 3SN6N 4Z77B 2BNQE 5B38B 1GC1C 1PLGH 4QRTA 1HKLH 1N59A 4RGNC 4XB8A 4MJID 3WYRA 2GJ6E 1JK8A 3SOBH 5DMKB 1CK0H 3TFKD 1XMWA 1J8HE 4LCIH 1R5WB 1MH5A 1YEHL 1I9JL 1AGBB 2BP3A 5DD1H 3C87A 5LQBL 3KYAA 5DURB 4DKEH 2R23A 4JHWH 3NPSC 1G6RL 5C2BL 3UBXB 2CIIA 1VSCA 3PP4H 1NAMA 4H20L 2GITB 4JPKH 1QBMH 1R3HB 2GTZA 5E8PB 1FZKB 2ZP0T 3VH8B 4FQCH 1YA5A 1CFNA 3EYVB 2H32H 3WCYA 3G5XA 1I8IA 1AE6H 1IGIH 3UDWC 2C3XA 1IEBB 4IRZH 4TULL 1BQHA 3NIGF 4G9FE 1Q9OA 3LH2H 4LASL 4DQOH 2FJFB 2COQA 4HUMB 1DLHA 2BNQB 4MAYC 4MQ7B 5I74B 3O8XC 5FYKD 2F8OA 4NO5A 2GJ6B 4KMTH 1J8HB 1IQWL 5JO5B 4EVNB 1NUFA 4LBEB 1MCIA 1RU9H 4NZTH 4IIQB 3O9WC 5FKAB 1SY6L 1U8MB 5C0GB 2DQUH 1JV5A 5BV7H 5E24E 1P4BL 4MGXA 5FV1L 2N4IA 5I1GL 2Q6WA 1J0JA 5C8JA 4P5TB 1E6OH 1Q38A 4R8WL 2X4QA 2HVJB 3D39E 4FXGA 1VA9A 4MXWL 4HIIB 1KGCE 3HE7D 5EB9A 5H35B 2P42B 4LRNH 5D1XA 4M62L 5FXCH 4OCSL 5A1AA 2YA2A 3AB0B 4G9FB 1I7ZA 4KJWD 1R3KB 4Z7WE 4FZ8L 1ZK9A 6FABH 5GIRB 3I02B 1O0VA 1HN1A 3KPSA 2HJFB 4K8RD 1JL8A 3IDXH 4EIZC 2P4AB 1DFBL 1T83A 1WLHA 1IGML 3B2VH 3V52H 2DKUA 1LO4H 4ENEC 4HLJA 4A6YA 2VE6B 3A67L 3TO4A 2VDOL 2L7UA 4MA8H 1BPVA 1ORQB 1RJYB 2UZIH 4MD5A 4QHLA 12E8L 1CCZA 5D6CB 3HLAB 5D7JA 3IETA 5T1KA 4L1DA 3RWCB 2BXZA 3MA7B 1K4DA 3QYCA 5GGQL 2RFXB 1W8NA 4KKAD 3DJ9A 4LSDA 3D39B 4ODVL 4P9HH 5EWIL 1A3RH 2CJUL 4PLJD 2WBJD 4Y4HC 4FQQB 5DGQA 4NT6B 5I16A 4UNTA 1TJGL 2UY6A 3MOBH 5TQ2H 2VQUA 3CCHB 1I1YA 5DLMH 1QQDB 3TIEA 4Z7WB 1DJSA 2IALA 4HH8A 4MJ6B 1OLZA 1RULL 1HHKA 5ERWB 3QULB 4ODTH 2ZG1A 4M8QA 5EOCH 1G6VK 3MMEB 4OLYH 1H3TA 4X6EB 4JHAL 4CGTA 4OBRA 4MS8D 8CGTA 4OGXH 5HJ3A 1TZIA 4ZOCA 3VFSA 2QJDA 3I6LD 2BHUA 2GJ6D 3L5XH 3MLRL 3TBVB 3EOAB 4YLQT 3U2SB 1PKQE 3CSYA 3OBAA 4MA1B 4JO4H 5ICXB 5D7LD 2AXJA 5HDBE 2IAMB 1LEKA 3L7EB 4WFHD 1PG7W 4KTEL 5IMLB 1WFTA 2HFGL 3TA3C 4HIHA 4NRXA 2EDNA 1NCAL 5DEGA 5B8CB 5C0AA 2WIIA 2YKLL 4P3DB 4XMPL 3VE0B 1CWVA 1IRAY 4CDHA 1VFUA 1U2HA 2SEBA 4G9FD 2XG4A 1KPVA 2N1KA 3HZKA 4J4PA 5F6HI 3FO9A 5T1MB 4DUVA 2J8OA 5C0IA 3IVKB 1KELL 3RVWD 2PNDA 5CAYB 1AXSB 1MHPH 4TUJA 5KOMC 2EZ0D 1J7VR 3MRLB 3RTQB 3P4NA 2B0SL 2EIBA 1PKQB 1MRCL 4NM4L 1A9BA 4DK6A 3DBXB 2IG2H 1JMZA 1MAKA 5CJOL 1K2DB 4ZFOB 2X4TA 4NQXB 4ZFZB 5CLWA 1BF8A 3U48A 5DRXB 3HMWL 1EEUA 5D9SA 3ZO0A 5ESVA 4M62H 3CK0L 5A2JH 1XR8B 1MCFA 2HN7B 3V4UL 1CDYA 1A6VL 2CKBH 2X4PB 5E6ZA 1HWGB 5DJDB 3C9NA 4IMKC 2XOTA 1F4XH 3LS4L 3W11C 3SE4A 5E9DE 4LLUB 4RMRA 2NYYD 3X14A 4ZOEA 1F5WA 1UH4A 2V5MA 1IGMH 3VFVA 2DL2A 3SJVA 5JW4M 4Y5VB 1QA9B 2D0FA 5JOPE 3CFCH 2Z31C 4B7LA 3DXAD 3IJSB 5FF6A 5A40E 5F9AC 2MOVA 3C2AL 1YNTB 1G6RA 3V5DB 3TYGH 1GGIL 4ZUUB 1BD2D 1OP5H 4U0RB 3AY4C 2R2EA 3PXJA 4HIXL 2FBJL 5MI0C 3EBAA 5IMOB 5JORA 1I1AA 3HNTH 2R0KL 4PJGE 4TUOB 4XNMB 4U6YB 5IBLD 2BVPA 3V6OC 1V7NH 4Z9KB 5C9JB 3VWKD 3CFKA 4ZUWA 5E9DB 1NLDL 3IF1B 3BPLC 4RZCB 4OLXL 1DQJB 3ALXA 4ODWB 2ZUSA 4J6RH 3TN0C 1AFVL 3QUML 1ZSDA 1CLOL 4C4KO 1IKNA 3KXFA 1PZ5B 3ZSSA 1SY6A 5F88B 3O3EA 2HFEA 4DZ8B 1XZ0A 1QOKA 5JR1L 3PWVB 2WUBL 3O3BB 1KN4L 4KTEH 5T5NG 2CIKB 4Q9QL 2R2BB 3LZFL 4U6TA 2BSRB 4AIZA 5E08L 3FQXB 1CFVL 4N0FB 4PJGB 2I9TB 1F6AB 2VWEC 2UY7A 2VXUH 5E6YA 1TITA 2LAGB 3EIFA 1D9KC 3SKOB 2OR7A 4IBLT 2EH7H 1IQDA 2B1HH 4OKVA 3QG7L 1I3RB 4XNXL 5JW4N 1SBSH 4X99B 1P9MA 3TA3D 3UYPA 3JVGC 1IL1A 1QR1A 2UWEE 5IB5B 1VGKA 5B39B 3MXWL 3ZMRA 2YD7A 3NFNB 1MRCH 5L7XL 3QRFM 2ATPB 3ECBB 3D85D 5FECB 5HDBF 3LD8B 3HG1D 4JFED 1NBQA 5ACMA 3L6FB 4NQDE 2FX7L 5CD5C 4R2GD 4YK4C 4KJQC 3RHWF 4TRPH 2HJLB 3OG4B 3RVTC 1RJLA 4LHUG 3RJDA 3GMLA 5F96H 3AREB 1NCUA 2C1PB 3RFZC 4GQ9L 2AQ2A 3OR7A 3VFOB 1TXKA 5I1KL 4NQVA 1BOGB 2X09A 1JWUB 1RZ7H 3IFPA 3UDWA 4MXVF 4ZFFB 4UBDC 3EJYC 5HGBA 1L0YA 4PJFE 3QG6A 3L3HB 2UWEB 4JEGB 4F58L 3MRJA 1EFXB 5J3HD 4DAGH 1XR9B 4MAYA 5F9OL 3ME0A 4FFZH 3MRRB 4OAWB 1A9EB 4KKCC 3QZWG 3QEHA 4HJJH 3IDJA 2XN9E 3OAZK 2AJVL 4MB3A 1G7QA 1G9NH 1YN7A 3FTGA 2GJZA 3MRKB 1BZ7B 5MEQA 1A1MB 3LDBB 4GJTB 3O9WA 2W0PA 5F7YC 2HT4C 5DTFA 3SDYL 3R06A 2EDDA 3U36B 2X7LA 3EYOB 1MJUL 4WFEE 5CEYB 3RY4A 1JPFB 2JELL 1OWRM 2APTA 5EN2B 1JGVH 4XPBL 3CDYA 5HI4C 1DQLL 3DYOA 4Z95L 3QUMH 5J6GA 3KPQA 3SDAD 1EHNA 4JFDD 5CP7B 1F8TH 4PGEB 4PJFB 5A2KH 2FZ3B 4OCLC 4HBCH 1VKXB 4JRWA 2XN9B 1BM3L 1NQBA 1KN4H 2A6IA 2CK0L 4JQXC 4KQ4H 5LAXA 1HDMB 1RZ8A 3U1SH 4PJAA 4JZJB 4P2QE 1NDGA 4WI3A 5IR1B 2HLFC 5HVWA 4PJGF 3AU1A 3DX6B 5DJXA 5DQJA 2VDKH 3QRGL 1OTUC 4MLSA 3MR9B 4JHZA 2NZ9C 3S88L 1UB5B 2XACC 4OB5H 3SDXF 1NC2A 3E8UH 2C7UA 2O93L 3O4OB 1MWAB 4Y4HA 3LKRA 1K8IB 2BVYA 1BBJA 5EOCJ 3RNQA 4I0KA 3NCEB 2D4DA 2ATKA 4PRPD 1FO0H 4YX2H 3FB7B 3OZ9L 5HD8C 5L2KA 4AL8L 5KVGH 2DLEA 1OOAA 2OTUB 3C5SB 4R6UA 1K8DB 4YEEA 4M7KL 4WO4B 1G9ML 4RAVB 4U1MB 1NLBL 3HR6A 3AXLA 4P2QB 1F3JA 1M71A 4ESKA 2O5YH 3UTQA 2JCCE 4WUKL 2DTML 4NQDD 2FHCA 1M7DA 2NX5A 1KCSL 1KEGH 2XV6B 2D31A 5IJVB 3K2UL 3WIFA 3MGOA 4KRPB 4HW6A 4M5ZH 4Y19A 3SDCD 1A6WL 3WUZA 4L8SB 4DJMA 5I2IB 3MRPB 3ZKMC 1U93A 2E7MA 1A7RL 4G7YH 3EFFA 4PRIA 4KJQD 1ND0B 1WVZA 1H0DB 4YHOL 4WIQA 5DD5L 3EGSA 5KZCB 5HHNB 2BNRD 1DQQA 2XIDA 3P73B 1MVUA 1FGVH 3BVNA 3MO1A 3MUJA 2VL5A 1ZT1B 2JJUA 4FQHB 4QEGA 1A6AA 1QBLH 3SDYH 3GIZL 3WUWB 2JCCB 1CT8B 1YDPB 5GS2H 3BGMB 3G6JF 1KCUL 3O41A 4XGZB 4KKCD 3G5YB 4OCXH 1SEBB 1UT9A 4GKOA 3F65A 1WICA 4MLIA 1QD0A 2V2WA 3X13B 5JUEH 3AMLA 5L8LB 3L5WA 4FTVE 2ESVA 1MAJA 4OFKA 5ISZE 5HPMB 3CC5B 5LXGL 4PJFF 4NC2B 2EXYD 1JYWA 2OX5A 2HKFL 2F53D 3G04A 5CBAA 3FB6B 4IMKA 1EXUA 3Q6GL 4X4ME 2NY6C 1KNOA 3O4LE 4JN1L 1IE5A 3JTTA 3QPQC 4Q97A 3LQAL 5C07E 2IPTL 3ARBC 4JKMA 1CIDA 3TBWB 1P1ZA 3PGCB 5CUSL 2Z31A 3IDUA 4KTDH 2W0LA 2EKSA 1NBYA 5T3XE 5JXEC 1SEQL 3TIDA 4NZRL 3U7YH 1KC5L 1CL7L 3MODL 3QHFL 3AY4A 1WCQA 2NY2B 4GSDL 5BZWB 4EXPX 1JZ3A 1BBDL 5HDQH 2WW8A 4LGPB 3NN8B 4FTVB