2O6DA

Structure of native rtp34 from treponema pallidum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
b'FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 34 kDa membrane antigen
molecule tags Membrane protein, protein binding
source organism Treponema pallidum
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6dA00
5I0XA 5I0YA 3LZNA 3LZQA 3LZOA 2O6FA 5I0VA 3PJLA 3LZRA 3PJNA 2O6CA 5I0WA 3NRPA 3LZLA 2O6DA 3LZPA 2O6EA 3NRQA
chains in the Genus database with same CATH superfamily
5IOKA 5JO5B 4OCRH 1R0AL 3QORA 4CVWA 2J88L 3ABMB 3BE1L 3LS5H 4CC0A 2EXTA 1B2WL 2AANA 1MJUL 3WI9A 1RSFA 5CGYD 4BFGA 1ACYL 2UXVA 2YPLD 4NRYB 2VMJA 4AEFA 1KTLB 1RUKH 2HX7A 5D1QA 5D7LB 2Q8BH 3DPBA 4PJ9A 3VE0A 2J71A 4LF3B 2VDMH 3FT3A 1EZLA 4R0LC 4JFZL 3FTGA 2OMXB 3OGCB 1FAKT 1FFPA 1JPGB 3FH5A 4XE5B 3ZYIA 3QK0A 4FN0A 3TBTA 1UB6B 3QXUA 3GS7A 1XBRA 3MNVA 3FQYA 1DBAH 4H1LA 1B4TA 1T5WA 4RMRA 5C0CB 3WO4C 4M1GH 4GIOA 2FX9L 1P4IL 2CKBA 2G9KA 5JNYB 4P2QE 4TUOB 3CE1A 5TDPA 2M26A 4R9HA 1NDGB 3AWGA 2H1XA 1DQQA 3MUY1 3CVCA 3DVNA 1G7PA 4PWGA 5E08L 4AKQA 2QL1A 1MFMA 1EUUA 4HS6A 3EYUL 4Y2OB 5BS0A 3A47A 1ET7A 4PJGB 2VDNH 3EO1B 1A7NH 3OB0K 1QRND 4KTEL 3H3PL 5FA3A 1I8KB 5B39B 1SLXA 2D3NA 2ICWB 1FFQA 4WTZA 5EZPA 2OMTA 4Y4KD 2W8CA 3JTSA 4B9JA 3VYOA 3B1UA 3ROLA 2J8UF 4ISVB 5BOJA 2QPUA 1ADQL 3FO0H 3C87A 2IANE 1NLDH 4PJFB 2J1KA 1WISA 5L9DL 2JJTA 5IB5B 3ZKMC 4YXLH 1K3IA 1AS8A 1XH3A 3P0VL 2JIXD 3JUZA 4PJ8D 4YHPA 2H1PH 2X9YA 1BF2A 3QI9B 3DIDA 2EILB 3IJ8A 2OSLA 4YPJA 5EDSA 4O51A 3G9AB 2FBRA 1HSBB 3LQAH 3BKJH 3T2QA 3RNQB 3EJYC 2GIMA 1OB1A 5CJQL 4NOBA 1D9KD 3TA3C 5IQOA 4XH2B 1IBZA 4Y2NA 4YHNA 1I4FA 3NTCH 1LK3H 1CIUA 1OD9A 2UXGA 3ZE2E 3LN4B 1S7VB 2YAFA 5LBSL 5A6IA 2I9LA 3IDJB 2GVYA 3TV8A 4HHGA 4GBXB 3PWLA 5ITBH 3P2TA 3O6KL 2WMPB 5FW6A 4ZFZA 3LQAC 3PS6A 1FVCB 1XR9B 4PP1D 5A3ID 2APXA 1ANUA 1N3NA 4Z95L 1OW0C 3MLWH 1MSPA 4XC1H 5ES4B 4S1SH 3GSQB 5LHDA 4PVLA 1P5VB 5E9DB 4HSCX 5F96L 4AEIL 5HDQL 1LEGA 3C08L 1N19A 2P4AB 1FE8H 3ESMA 3FB8A 2FECL 3HCVA 1A4CA 1U8MA 2FD6L 2APFA 3CFMA 4FQIH 3SDCB 3FTSA 1URZA 3E2HB 3CMOH 5HI3D 1QBLL 3WIIL 3QXDA 1GGTA 4OIBA 1GHFL 2QDVA 1YQVH 12E8L 3IBEA 4JBSA 3T4AB 3PXHA 4ZMTA 1NFAA 4TOYL 5CF3A 4BCXA 1D5MA 3GUFA 2FWOA 3L48A 1LD9B 3LH2L 3MSPA 3FCBA 4JDTH 2BP8B 4WGVB 3SOTA 2F1BA 4GMSH 5CIPA 2R2HA 4JEGB 1J8SA 2EDHA 1TYEB 1NCAH 4K5PA 2WLIB 3CU1A 4JRYE 4Z0BL 3N6YA 1U41A 3MUHL 2JK5A 1KNOA 3L3HA 1XH2A 4UQDA 4YHOH 3FB7B 2EE2A 3S2CA 3VRLF 1F86A 3TN0D 3E2HC 4MCNA 3CFDA 4PRHB 4X4KA 3Q9PA 4DAGH 1TTGA 4UNIA 4Y16B 2WZPA 4L9DA 1INEL 1YC7A 2ALAA 4OQTH 1KBVA 4NXSA 3ECWA 4U1SA 4GKNA 4L4JA 5I0VA 4MJ5A 4OM0H 4DFHA 5HPMB 5AOMA 2DQDL 3KNBA 3X13B 4WHDA 1CE6B 2YR3A 3BCFA 5I6LA 3WKMH 3U7AA 4J3OH 1QBAA 1RUML 2BHZA 2AXHA 2CWRA 3VB8A 5IW6B 2WO4A 3VWKD 3ZDXF 3GUTA 1WICA 3EGXA 4TUJB 4LAJH 2APVA 3BP7B 1E67A 3OKOB 3BSZA 2G60L 2X10A 3CSYB 1JXGA 4U4IA 3BKYL 4AC2A 2WNWA 2EXWC 2O5ZH 2ATPA 4U1GC 5CCJA 2P45B 1UD8A 2VCOA 3UZVB 1JK9A 2PR9A 4N2LA 2ZUTA 3X17A 3JV0A 1NGXB 2VZVA 4S1DD 3FPYA 3KS0J 5GJSL 3OX8B 2NXYC 3NJLA 3CLEL 1T4WA 3QJFB 5FDWB 2DIAA 3PHOA 2V7NB 1VFOA 3GSNL 3PY9A 4XVTL 3NEXA 4PJ7E 4X83A 5FF6B 3PDDA 4ZFFA 1Z5YD 2CIIB 3ESVF 4Z7VA 1VHPA 2CK0L 4X7FC 1M53A 3F7PC 5BRZD 1GYVA 4P2QA 4LHUD 1AI1H 1OAZL 2NY6D 2VDPB 3NA4A 2YD5A 4TYUA 2VN3A 4HXAH 4NLHA 1KFAH 4PQXA 3VI4F 3NJIA 5KG9A 4JFHE 4ETYA 4AL8L 3QCVH 1C5DB 4X0KA 4JGUA 5ICXA 3ZE0B 4M56A 3NIFB 1SXZA 1SYSB 1H5BC 4XC3L 1JTOA 1T83C 6FABH 2BSCA 1ETA1 2X70A 1KF9B 1R19A 1H3GA 2UVFA 3CCHB 4G9FD 5LGHH 5I9QC 3FB5B 1W6WA 2BSBA 2WTRA 3B6SA 3IGFA 2XZQH 3TT3H 1BD2A 3VXMA 4FG4A 4ZO8A 4OAWB 5I1AA 4JJ5B 5CSGA 5H37G 1QSED 3NIDF 3MODL 4XP1L 3TBSB 4Z3IA 5AW5B 1Z7JA 5SWQB 3BN3B 4ONFL 3L3KB 1UUSA 4J6RH 2KZKA 2VLKB 2XETA 3EOBB 1JOIA 4IMLA 4J4PD 1DVZA 3BZ4B 1VDGA 5I1DA 1FSKB 5ETUB 1B2YA 1L9PA 5JA8B 4WWPA 2W94A 1GJUA 32C2B 3QJQB 2ZWYA 4G7VH 2EADA 4QHMA 4XMZA 4P06A 3WFDH 3F2LA 3QORD 3ESUF 3WFHA 1NAML 3QPXL 4P3CL 1J8KA 4PRBB 1CCZA 1G9NC 4Q56A 1X7QB 4FNUA 1RMFL 3CDCA 2EDJA 5I1KL 1O9ZA 3LKPB 5F97E 3Q1SL 1A9EA 2VJ8A 3HZMB 4K5OA 2OMYA 1KGCD 1UKTA 5HJ3A 3KBFA 1MW2A 1UT1A 4IKNA 4L8SB 3S35H 4WWKC 2DWEB 5B8CA 1TZHB 1WK0A 1JPEA 2QDWA 4MNQE 4I0PD 2R83A 3VGHA 4D0CA 4FYSA 4PS7A 5GRUL 3AVEA 5L0QB 1FG9C 5IQLA 5GGTH 3T8MA 4AUUA 1DFBH 4N2OA 2HLEB 4PGCB 1CLOL 3EFDH 4Y1AE 3ULVD 1CFNB 1NIDA 3EYOB 1RLWA 1IKNA 3FSOA 4HBQA 4TS6A 1QSFB 4XPFL 3ULAB 2FE0A 4P9HH 2YA2A 3HE7B 4E5XA 4X2UA 3RDTA 4NZTH 4BINA 3BP5A 1E27A 2XRAH 3FUIA 4TNFA 1UWGL 5FGCE 1DLFL 3EJSA 2GJ6A 5IWLA 1KB5L 3NK4A 4M29A 1REIA 5HHME 1G7MA 3V7MA 3X1GA 4DZ8A 3D07A 4WHCA 1MFEH 3IDIA 1QRNA 4L0YA 4QRRB 3H9SA 3JWOH 3C5SB 5DJ2A 2DL9A 5DD5H 2A0LD 5E23A 3VRLE 3DTXB 2ZOWA 3GGWA 3V6OC 4Y2DC 5I15L 1EERB 4M7LH 1RZFL 4KFMA 5E6YA 5FA4A 1IEBB 4HMCA 4PSPA 2J8OA 3QQDB 4RWYH 5LGKA 4W1TA 2H8PB 1FLTX 1AP2B 2JJWA 3LIZH 1A4KB 2CLVB 2D73A 3RDTC 4XI5D 2HH0L 1MNNA 3OHXB 5IVZA 1DHKA 4H0HB 2QGDA 4WSGA 4DKEL 4XNBA 2XBTA 1HI6A 1IKNC 3GJEA 4XN8A 4M8QB 5EZJB 5TD4A 2ZUYA 1Z66A 4I77L 3NAAL 4I2XE 4PJXB 2Z1KA 1N8ZB 3D34A 3R8BB 1ODUA 4TSBL 4OLVL 3ZLQC 2LE9A 1H8SA 2Z1PA 3D08A 3MLSL 4WWKA 3RUGB 2VSKB 2WK2A 3IYLW 2M1KA 3KAAA 4P9ML 3BUYB 4RCAA 3RX8A 4E9XA 5J12B 3LEYL 4OVUA 2D8KA 3LXBA 2R51A 2D4FA 3I74A 3MNDA 2BVOB 3DURB 3EADA 5DQDH 1YVLA 5E00B 4M6NH 3CDZB 3F7KA 1HQRB 2R0LL 4LVOB 3G5YA 5LGJA 3UTTD 2C34A 1MF2H 4G5ZH 2VGLM 6PCYA 3EH2A 1VKXB 1I1CA 5DTFA 1QR4A 3CZFB 1HKLL 1H3UA 4HALA 3PGCA 4L5FL 2E7LA 3VJ6A 5D6CB 1ZIAA 5F96H 4AEIH 4UV7L 1YEEH 4XMPH 4ALAC 5LDUA 4JRWA 3OWEA 2V5RA 4Z7VF 4XP4H 5LG1A 5D93C 3KXFE 5I71B 2IMNA 2AI0H 4FQ1L 4XBGB 3BD5A 1ZRUA 4GH7B 4KDWA 3VCLA 3QHFH 1X7SA 3O4LE 4BA0A 1VEMA 3QNZB 4Y4FC 1QSVA 5H37H 1MAKA 4Q9RL 1CTOA 2VR4A 4PY7B 1CGYA 4X7TB 3N42B 5I30H 5JQ6L 3Q2WA 3WMPA 3K5RA 1NWOA 3GM0A 5DQ9B 3ABLB 1PPIA 3K6NA 3KPSB 2LGNA 4DTGH 1H5BA 2X4PA 3TIEA 1T20B 3G5XA 3WMSA 5JHLH 4P23B 2UY6A 3T0ED 2Z35A 4OGAD 3QIBD 1J86A 4R2GB 5SWZD 3OKNA 4F20A 2EVFA 1NGYA 2EH8L 5CWSB 3IJHA 5JHDD 3KBEA 1D7CA 5GGSY 4X6DE 4JY6B 2HKHL 1FO0B 2VB5A 3GK8L 3RIAF 4NQUA 4EIGB 2ICEA 2VXVH 1XO8A 1S7RA 1TSRA 4L18A 3VFMB 1CXEA 2R56L 4IEFB 3BDYH 5CJOL 3U2SB 2AK4A 3QRBA 4FNQA 1OZUA 2OYMA 3GRWL 2ZXDA 5EDXA 2P5PA 4KKBC 3X11A 4E9VA 2YUVA 1DO6A 3B3IA 3OGCA 3QNYB 1U8NA 5DJ2B 2VDRL 2E47A 5KVMC 4IBWA 3VI3B 1IU1A 3ZMRA 4FZEL 4JVUA 4JRXD 3KWWA 1OD7A 4QWWD 4K2UH 1WBZA 2VMCA 4WF7A 1O5DT 1ZD6A 4WI0B 1FV1A 3POHA 3ZQWA 3E6HB 1JZ8A 3BEWA 4XCCL 1NGPH 4B3EA 4Q0XL 2PWDA 4GW5A 3X3GL 3I2CL 4ELME 1DANT 4HGMA 3FSVA 3FRPB 3PDOA 5MERB 5FW7A 3G5ZB 3PV6A 1MH5B 3A22A 1A4BA 1X5KA 1WA0X 4KHXL 3DARA 4D9QE 4EPSA 2VISA 3JTSB 2YQ2A 4XVUC 4TVPD 1IAIM 4FA8A 2BK8A 4NYLA 3EFFB 2XVKA 2OMWB 3F84A 4ZW7A 2OTWB 2QPSA 2QSVA 3PL6D 4BIKA 4JHAH 5BQ7A 1MJJB 2D3VA 1OF2A 1JV2B 4TQPA 4AEEA 4HFWB 1KB9J 3AFLA 3DOSA 5J3HC 2NY5H 3HS0C 3ZL4H 1K4DA 2KI6A 4E41D 1OALA 4PCSA 1UQSB 3UFIA 4XP9H 2VQUA 3CFCH 1CVSC 1EXHA 4M7KH 1ZMYA 2AK1L 2JCCB 1KGIA 2V33A 4DPRA 3VXUA 4GRWF 1NGQL 2V9RA 4PJIA 1NM4A 4LHUG 3L9RA 4C47A 2P5WD 4C8XA 3GSVB 4IU2A 4ZYKB 1IAIH 4NRYA 4XWGH 4G1MB 3ARWA 5ID1B 1V05A 4LF3A 1WCBA 1Z9MA 4NQEE 3GNML 3LPOA 3I02A 3IFLL 3MNWB 1I75A 4PY8I 2I9TB 1KMGA 5IEKB 1AQDB 1I1RA 1N7ML 1Y07A 1IC7L 1CF8L 4G7QB 2XN9A 2GAZA 2MIZA 2H7WA 2TSAA 1TTBA 3RTQD 4HUVB 5FECA 3HFMH 2BNRE 1G1OA 2VUYA 2D0HA 2WO3B 1HWGB 3HUJF 4TLSA 4AJYV 3MRIB 1OGAD 1QEWB 2B0SL 1U8QA 5HHOB 1PF3A 1I31A 1ZXKA 2YQBA 4PJCE 5C07D 3WN6A 5IK3A 5E1QA 3AJ7A 4OZHE 5MENB 2WB1A 4HS8L 1I1AB 2GB2A 1XF3A 3CG8A 4GLRH 4OJAA 4JQIL 3BKML 4F91B 5EUOB 2N1KA 1NFIA 2FYYB 3FSAA 4JRLA 1ZJBA 4NN5B 3FFCD 5B1JC 4PJ5D 4QIRA 2C7UB 5BZWA 4B97A 3P9LA 4JFSA 4X6CE 3L5IA 5CIPB 1D2OA 5FV1L 1QLFB 4N2BA 3BHBB 3TEXA 1JYVA 3RDTD 2QGBA 4ODTL 1Y0LB 4YHLH 1U3YA 4AW7A 1P2CA 1HL5A 3RJQB 1Q72L 4LSUH 2WZ0A 4P05A 5KBDA 2Z4QA 4DP8X 2JJSA 1RHHA 1D3CA 3RUGE 1BAWA 2Y6TE 1V7ML 4HD5A 1IKFH 4LKCA 1X4YA 4PJHA 2J44A 2ZCZA 4Z7VE 3O6FA 1WS8A 3KVPA 4WUUD 5D2NA 1L7TL 4I4WB 4Q6YA 1U6AL 5C8JA 5LKNA 3ARFD 1RJLB 5D7IF 3WFCH 4KKRA 3X13A 4RFEB 4L2LA 2XIIA 4R96A 5D7EA 3MV7B 1E4XI 3D09A 3TVMA 3B9KD 4Z8FH 3CWGA 1HZKA 3IMVA 1HIMH 5C0FB 4BGDA 3S4SB 4MMZC 4HH9A 3VRJB 5DS8A 1BBDH 4QRQB 2R8SH 1G7LB 4DGUA 4XNUH 1BG9A 1JPGA 4GQ9L 3VFTB 4ETQB 3ROOB 3F3HA 1AH1A 1T1XB 4M7ZB 1B2WH 4XP5L 3FCSB 2BIIA 4DVRH 1NGXA 1MCQA 4RA3A 1FH5L 5C71A 3WIHH 4H26A 9PCYA 1R33A 1FCCA 3CBKB 4QXUH 4DP4X 2ZWZA 5SWZE 3RPKA 3VTMA 3P2BA 3FYIB 1HCYA 5EUOF 1K72A 5HHNB 3L3DA 1DL7L 4FFZL 2FVNA 3S37X 1LP9A 3ARSA 4YJZL 3EDJA 2Z8SA 4ZW5A 1Z2KA 3WKPA 3QAZC 4M5SA 4GT0A 4KGLA 3KPTA 3PWUA 2BP0A 4AQZA 1M2VA 4NNYA 2HG0A 4X4ZA 1AFVL 5DR5H 2H2PC 4J3WA 4F7TA 1B0IA 3TJHD 5MI0B 4EJ1C 2J6EH 3KYAA 4P23C 4X5PA 4XWOD 5IHWA 1T89C 4H20L 4N2DA 3BUPA 5ADOL 5FOJA 1FDLL 1H6EA 4LSQL 1COBA 5LUMA 5MP6L 1JPSH 1NCUA 3VD1A 1PMYA 1JVLA 1XD1A 4LXFA 4RFNC 1BBJB 1IAKA 3MRJA 4UM8A 1UKQA 1P1ZB 5IJVB 4DUVA 3JZYA 3AXLB 1CFSB 4I18A 1NM9A 4M1CD 2E9JA 1BJ8A 3UTTE 1NPNA 2CR3A 3KPQA 4P5MB 2EYTA 2E3VA 3DVFA 3VYPA 2K4AA 4WSKA 5I1KH 4ZAKB 1S7TB 4MRCA 4JJOA 5FGSA 5I30L 2C3WA 2NY4D 3ZK0A 1GS6X 2BPBA 3Q1SH 3SJVE 1DE4B 2DI7A 1J87A 2UV3A 4YXKL 5J89A 2VC2B 4O4YL 3GI9H 3U48A 2DLFL 1MELA 4WI7A 1RZ8B 4FTVA 2QPEB 2NY6C 3QIWB 2GSGA 4NP4H 2ORBL 4AJ0A 1R3LB 3D51A 2HFFA 1O9VA 2VDRB 1WYJA 5CBEA 3LJ3A 1BZOA 4JQVA 5AB0A 1QHOA 2N4IA 3VXPB 2ITCB 3IGUA 1U0QA 2X6MA 3L4ZA 2R7EA 4KVPA 4S1RL 5HYSG 4HEPA 1C1EL 2WP3O 3G9VA 5CEZD 1F4WH 3PHOB 3HE7C 1OAQL 1JDCA 4KXAA 4AG4L 4L8BB 2DM7A 4DP1X 5FIEA 1BFOB 2X4TA 4UCFA 3ARYA 1ET8A 1Y6KR 5K9QI 2CHXA 2NY5C 4PREB 5KYYB 1HZHL 1S5HA 5F21B 3K1KC 1MFCL 1TQCB 3QEQD 3S7GA 4C4BA 4OT1H 5HGAA 1SZNA 1A5FL 3RGVB 3TT1L 2X4QA 5DDHA 1DJHA 4MJHA 1F18A 1T1WB 3ZHLA 4F92B 3ZGHA 1X6NA 4HJTA 1B9KA 1F11B 3HE6D 4FFZA 3VFSB 1TCMA 4MJIB 3HRZB 1JERA 1VFAA 3ZR5A 3BQUA 4XPAL 4BRJA 3G5VA 1J0HA 2X5PA 3J07A 4GRLA 5D2NE 5AW4B 1GMEA 1FJ1B 3K72B 4OB5L 4GRWB 2R27A 1GY2A 4LIQE 4Q0XH 3V0DA 1KULA 4PRIA 2F54E 3IB4A 2HVKB 2GI7A 1JNLL 4KK6D 1BYPA 2KDYA 2ADGA 4GO9A 2OI9B 5EU3B 5AALA 3W57A 3DVIA 1JD7A 2QSCH 3ZL1A 1AO7D 1BCIA 3O3DB 4FFVD 3MREB 2IWKA 3DIVA 3M45A 1IFRA 2VE6B 2Y4SA 1LHZA 4C4KT 1EZVY 3FT0A 3NT0A 4ONOA 4U6VL 2ICWJ 1KACB 4H7VA 4LPUA 4M6OL 4QHLA 3KLHC 3JT0A 1FIGH 4FI6A 1N5AA 3GBNL 1SHSA 4R4ND 5EO1B 3RWFB 4IRJC 1IQWL 1HI6B 2PPAA 3C8KB 2DL2A 3QZLA 4Y4HD 1BMZA 3MUZ1 1U2HA 1HVXA 1TJMA 1NBCA 3OD3A 3V95A 1H0DA 1LO5B 1L9RA 1G6RH 5DSCB 4NSKB 4X9GA 3DX8A 1NLBL 1SHMA 4U6TA 2G9HA 1YJDH 5KSBF 1YAZA 4ODUA 1UOVA 2QQNL 3UAFA 1XXFC 4IQHA 4YHYC 3TCXA 1JS4A 4OF5A 2D31A 4XMPL 4JE0A 2D0FA 4G3YH 1VA9A 4JFFA 1G9HA 2GBAA 2A6IA 5DJ8B 2DS4A 3MV9D 1B4JL 2IC2A 3QJZA 1SBSH 4L3EB 4PJEB 3VXRD 4D8OA 4IRZH 1AMYA 2ZX9A 3Q9QA 2WWMD 5GZNA 3WNLA 3ZL2A 3B2DC 2HVBA 4U1NA 4UQ3A 4YPGB 1BX2A 2LR4A 4O9HL 4IKIA 1ADQH 1DVTA 4YDKL 5JOEA 4G9FE 4DKDC 2KZ1B 4I3RL 1YEKH 4JX0A 3ARDB 4Y7OC 1UC6A 3ILDA 3ISYA 3MLXH 1ITBB 2DEYX 3CFIC 3JUYA 3OQRA 4K07A 3T0EC 5FB8A 4MNHA 5IB1A 3ULSA 2LAAA 4GJTB 2OMUB 2XWRA 4MCYB 2WC7A 4OSUH 1THCA 3UOAB 4HOZA 5CUSL 2CKBH 1GKEA 5HGDB 4AL8H 1EANA 4LSPH 3VXMB 2YZ1A 4CNIA 1ZT1B 2R23B 4C58B 1DZ0A 4LNRA 4XN1A 3W0WB 2Y3NA 2PTTA 4YZWA 5IFJB 1UA7A 5T3XH 1HWWA 3L3KA 4LLWB 5IMLB 4NENB 1N0LA 2H8PA 5F88B 4QDGA 3B7UX 3HUJB 4GP5B 1KOAA 4AZUA 1ZT7B 2BP3A 2GSMB 3BD4A 2JKTM 1J9TA 1XCQB 1J0YA 1W8OA 1DDHB 3L95B 4LLAA 5CNHA 2FLMA 5HI4D 2FHCA 2HT4D 2ZE0A 3CFUA 4PRPE 1G1CA 4ELMA 3FDWA 3VQ2C 3PNRB 4PRBA 4N8UA 4FP8H 3VXTB 4AWJC 1EAPB 1RUPL 1ZVYA 4JO5A 5EFIB 4ZSOE 5EZIL 3LKPA 2BCKA 1W72H 5DJCA 1INQA 4HWBL 2O6FA 2VO5A 4PRAA 1KELH 2BVUA 4AQ1B 2ZPKL 4J2XA 5LBSA 4XNQB 1GZQA 4TNWF 1YRKA 3QPXH 1DTUA 5IR1A 4TTDC 2BNUB 4AMXA 3TWYA 2LLLA 3X14A 1EK3A 2WM0A 5E8PB 3B2VH 5HHVH 4CSTA 2O72A 4N20A 1CFNA 4G8GB 2JIXB 3LDBB 4PJ8B 1WSST 2EECA 1YEFL 2FNBA 3TA4D 4GMSL 3GEFA 3ASNB 1S7UB 4GEJA 4HCRA 4BUHA 1A4JB 4HUXB 1L0PA 3D4GA 3T8XB 1JZGA 4APXA 4Y5XA 1NJ9A 2GJ6B 5IFHH 3QUXA 4UT7H 2CAKA 1DFBL 4MAYB 2PYEE 5DEGA 3KWTA 1GVIA 1WTGT 2IQAB 1O7VA 1GPOL 2EIDA 3OWRA 2FCBA 1GR7A 4IDLA 2F19L 2BDNL 3C5SA 3UIZA 2P24B 2VSMB 1J9CT 3N50A 4K7PL 4YNYA 3BVNB 4BK5A 5C6PB 4F8LA 3GGWB 1H3PH 2P26A 2H3KA 5DQJA 1Y18B 4UBDC 3RBGA 3TX4A 1A7OH 3OMZA 2AKRB 2BSRB 3DO3A 4MMYB 3QFDB 3DHJA 3OF6A 2GSIA 3GRWA 5DJXA 1RK0B 3BKYH 1G9MC 2D7QA 2R2EA 4UZGA 3PUCA 3RPIB 4XWGL 2NXYD 4OJDH 4RGOH 1XR8A 1M05A 4J8RB 2GITB 2V7HA 3CJJA 2Y7MA 4M3KB 4R7LA 4X42A 3FHAA 3QJXA 4UILH 5MP6H 1BQHB 4GW1B 4XN4A 3FK3A 3UMTA 2D7NA 1FORL 1BOYA 4FG6D 1E5UI 1IGCL 1Y1UA 4HKBA 2MCG1 2O30A 1EEQA 1JMZA 4LEEA 1RUAL 2AK4B 5AVYB 3QRFM 2K3TA 3VWJD 3VWKB 4RBPH 4P2OD 1CFMA 2LHAA 4Y89A 2CDGA 3QWOB 1BFVL 1HHIA 1IGFL 1SOXA 1N4XH 3Q2LA 4NZRH 3Q01A 2AJXL 5TDNA 3T6VA 1PKQE 5FW8A 4HS8H 1MHPL 4EUPG 1H3TA 2PPCA 3RWHA 1K5NB 4NN6C 3M17B 4I2XA 4EO5A 2GJZA 4L8CA 1EXUA 3MRIA 2R29L 1I7TA 4XVSH 1ETZB 4J3SA 4HS3B 1JCKA 3QW9A 4CVXB 3RIFF 3G5ZA 2PWEA 2FJUB 5E99L 3D39E 3PHQA 4AXWB 1FAIL 4GT7A 2NY7H 2XFXB 3OR6B 4QLRA 4GRLC 3JWNE 5F2FA 4LPWA 2L8AA 2Y72A 5TPWH 2Z8RA 3OKMA 1HC1A 3P0YH 2BO0A 3BI9X 1WFOA 3ARVA 1LO2H 5HYFA 4GAJL 5FFGA 1QRNE 2WZ6A 2O5XL 1WZ1H 2MWCA 1A1OA 1EPFA 5FO7B 3TIEB 2F7OA 3W38A 4BE5A 3QIUA 2C3VA 4PRID 2ZG1A 2FYVA 2OSWA 4MSWA 3U9UA 4L4VA 3KYMA 3N2JA 3WS6C 5I75C 1RMFH 1UQSA 2G2RA 1MLBA 5LBGA 4JO4H 5B7MA 1I8MB 5CAYB 3CVIL 4KNQA 4N0CD 1SRDA 1MRCH 4N3TA 3SPGA 2AQ2A 5D2NB 2B1HL 4U1HB 1KCSH 5HDBE 1WPCA 2GJJA 4PWJA 1DLHB 2HLFC 3CVHA 3Q6GH 5I5JA 5DGRA 4WTZG 3VYNA 4XP5H 3RY4A 1OHQA 3WHXB 2EVHA 1IM3D 2QZ5A 5D9SB 3WEAA 2YUZA 4ZYKA 3NIFF 5J8OA 4B6ZA 7PCYA 3A4AA 4ZNEA 4FCHA 3MFFA 2EDYA 5D4IA 2PXYC 5JLZA 5IQ7L 2YBRA 3ASOB 3I02B 1KYOJ 1RZJH 3UMNA 4HV8B 4YSAA 1DZBA 3BH9A 4HISA 3MGOA 2AQNA 4JZNA 4D8PB 2FQFA 3COOA 5BO1L 4WLCA 4XX1E 2KZWA 2WBJB 2RALA 2FSEA 2GEQA 1AIFA 1EFXA 4LT7A 3Q43A 3ET9F 3FTUA 3JWOL 2YXFA 4MQSB 3VA6A 3NN8B 1N0XL 4NCC2 3Q1EA 3KPPB 2JQMA 3UAJD 5HHNA 2XRAL 2Y24A 1DLFH 5MERA 1XCXA 2QFRA 5EU6B 4PG2C 4PWFA 3GI8H 4MDRA 3RP1A 3AXIA 4MNGB 4QXGH 2HFGH 4Y1AA 5FUOL 2B15A 2CJ3A 3CSPA 3GS0A 4NQCD 1NANH 5AKSA 4UQIM 2V17L 1GS7A 4F9LC 4ZTPL 1U3JA 4POUB 1YN6A 1BD2E 3WG7B 4JR9H 1J1XL 1D5XB 1DBKH 5LAXB 5GGTA 4ZZKA 3QFJA 2PTUA 4GXVH 3T0DA 1NCDL 1CUOA 2YD0A 4O58H 2YBGA 2QHRH 4MA3A 3ZKXC 3MRRB 4Z7WB 1JZ7A 3VXRA 4KK8D 1NUDA 3V0VA 4U0QB 1SBBA 1J10A 2XTJE 3MLSH 4P9HC 4GKOA 4XN2A 1OQOA 2QQLL 3LD8B 5ITFA 1NBVH 4YBLB 3ZPDA 5FM5M 3MLRH 1OE3A 4RMUA 4YSOA 4Z0XB 5DRWB 5AG8A 3MCKA 3IF1B 4N0CC 1P0SE 1I7RB 1PG7W 3CX5J 4JDEA 4FTVE 1VERA 1NANI 1DANU 3EH5B 1JNHA 4JFED 5EU5A 2EYTB 3WGVB 1EZUA 1MUJA 3WAJA 5KSUB 2BOLA 2ZOKA 3J8F7 2JMRA 1H3XA 3APNA 5FUZH 1S9KC 4ZUWB 1GMIA 2JF1A 4M43L 2IADB 2VDOH 2BIPA 3QJUB 4BD4A 5HY9B 2B8OT 2OZ4H 5DZOA 2O61B 1XIWB 1DEDA 2EJ1A 4LQ1A 2HP4A 3L3JA 3UGXA 1MCSA 1SN0A 1AR2A 5D2NC 3O6FC 5T1MA 5C92A 2AI0L 3HZ3A 5K39B 5ICYA 3VI4E 4HS6B 1E8WA 2WGXA 3PWPA 4ZFOL 4QRPD 4YDJA 4L5FH 5FA3B 3JT2A 3LHPL 2ED8A 3OPZH 5EN3A 4CA4A 3DSFH 4WEBH 2R0WH 4W4NA 2WTOA 1TQUA 4QRPE 4R4FH 2V5YA 4N5UA 4ZO6A 4ZS7H 1KB5B 2PXYB 3ZZQA 4PREA 4ZQKB 3V0WH 5BZDA 2HT4C 4KQ4L 5D2LB 3D12B 1LDSA 2YD4A 2J72A 3ULUC 1QA9B 1FFNA 3R18A 2ZPKH 4RIRB 4Y8AA 3UJJL 2VO8A 2A9BA 2YQ3A 4WK4B 1J5OH 2H32H 5JOPE 4IGBC 3BP4A 1AACA 4F15C 5E6UB 4OW6A 2RCSL 2XNAB 4B7IA 4HEMA 1BW8A 2FIRT 3ECBB 3QS2A 4NQSA 4C57C 3PXJA 3VU2A 5FCSH 2EDEA 4XE0A 5JO5A 4K5MA 3BW9B 3UIYA 1I7ZB 4I3GA 3ZT6A 1TXKA 3UEQA 1H9VA 4LKCB 3R0MA 2NXZB 3G04B 5AZEL 1C8PA 1W0WA 4ZFZB 2ZF9A 3L1FA 3RL2A 1I8LC 2WAHA 1CYXA 1KDIA 5E4IA 4GUOA 4Z95H 1UZ6E 1SJXA 5ANHA 5CINH 1WO2A 1FG2B 2RQEA 5FO9A 4YE4H 5HDQH 2Q7NA 3ARTA 1ZKAA 1K6QH 4NUPA 3ULUF 1FBIL 2OJ1A 3GRWH 3MO1B 4YLBA 4HH8A 3RRQA 1AGEB 3U9PL 3BYYA 1GGUA 4PS4L 1OXYA 4E9YA 4LRNL 3NSFA 1S2EA 1SVBA 2RJMA 2Y25A 3ELQA 5JNYA 5GGQL 2NNCA 3WY4A 1SBSL 4HG4K 2FUTA 4NSKA 1OTUD 3LVTA 4Q58C 3UZEA 4E41E 5CR8A 2B3RA 5DMKA 4YX2L 4KHXH 4JRYB 4FXKC 3IMSA 4UT6H 3LH2H 4ODBD 4PLNC 5SV3A 2NW2A 3WSQH 5F1SA 1TZGH 5D6DA 2GUYA 1GCFA 4QCIB 3HS0A 4BFIB 1Z9SA 1SXAA 4Z3TA 5I23A 1IE4A 2VUOA 5EUKB 1LP9B 1FNEB 3PWPE 5FO2A 3SBPA 2W1NA 3FUNA 4Z3JA 4F93B 3RVWD 3AU1A 4QHNA 5CLXA 4JPKH 1MCJA 3NUKA 4GXUM 1N4XL 1IC4L 4YDZA 3EBGA 4NHUA 2HTKC 4KJWD 1F8TL 4DKTA 3C09C 4EOWH 3AB0C 2H41A 1RIHH 4K5NA 4M7KL 2AQPA 1M1SA 3L9EA 2YPVA 3C5ZA 1ZSDB 4PJBA 4NNPH 2XTJC 4U2YA 5F6IC 5F0JB 1CQYA 4P46C 4KKLD 2AK4D 2DRUA 2IANA 4PCTA 3L4XA 3P69A 1G87A 4P2OB 4QRBA 1M71B 1LEKA 2VSDA 3FFDA 3IJEA 5DJDB 2W0LA 4LNRB 3PIQA 4FF9A 3H9SD 4HIEA 4WW2C 3T6QC 5HVHB 4Z78A 1W80A 5EEXA 1CGTA 4XXCC 4KJYB 1LO4L 5DHVH 5D2LE 1XCTA 1ED3A 2IAAC 5B3JE 3RZCC 4GKSB 3L5HA 3S3BB 4Y19A 1S7TA 1D6VL 5E2WH 4CJ0A 3FB8B 1CGXA 1KY7A 1KIUA 4FQLH 3AG2B 3NEOA 3NJXA 4YFEA 1QWHA 4KX9A 3L3OA 4ZX6A 3OX8A 1F3JA 4R97C 3L7EB 1P1VA 3O11B 4ELMB 1OT4A 3E1F1 3WIFB 2A6JB 4RFOH 1RZJC 1B0GA 1E9OA 2WVTA 5KVFL 3FQXA 3HC3H 3NJGA 2NUPA 2XBDA 4XNXH 4LGSB 3WLBA 3K6DA 3WNOA 2OR9L 2E74C 1OSZA 4NB7A 3IGLA 1KYAA 5I16A 4H25B 5KYUB 2HTLC 4OF8A 2ZT9C 3PL6A 3ULUE 2DKUA 1HHKA 1YAIA 1FYTA 2E56A 3L4TA 3OG4B 3WEMA 4MAUL 3T1WA 2HUHA 2QMKA 2XWBA 4JDZA 4DFIA 2X4SA 3PF2A 4E42B 3W2DH 2ZUQB 1HS6A 4WU7A 4OM1L 1BX2B 2W0FB 2AJSL 5GZOD 3ILQD 2DPKA 4EDWL 1BXXA 2C9PA 4ODTH 4Z7NF 3I50H 5FOBA 2HWZL 3BSZL 3VG9B 4OZHA 1JZ5A 4KVNH 2B5IB 3HC2A 4JKMA 2QPFA 4M1CC 4N86A 5E2VL 3GC3A 4LLQA 3VD2A 5JIMA 1FVEB 1W16A 2R2BB 4PJ5B 3NZHH 2YRLA 1A3LH 3ZTNL 2Q7YA 3EJPA 5EU3A 2DICA 2W59A 5EBWA 3S3DB 2FH6A 2VR9A 3WIAA 2WVVA 4Q6IB 3K6IA 2BNQA 3A6CL 2VDKB 4LZKA 1C7SA 1KWKA 4JQIA 2YXVA 1W2KT 3KHQA 1NMAL 3VO0A 5T8IA 2DOCA 4FE9A 2K8QA 4OZFG 4W9JC 4N8CL 1RIVL 3H3KA 2WNGA 3WFHB 1CL7L 3PGDA 1UXWB 4QHUA 4NJ9L 2E75C 1BWMA 5IJBC 4OZ4A 1ES0A 2X05A 3FBQA 3MNMA 4YVNA 2VAJA 3SDDA 1A9EB 1X6LA 3MXWL 2DJ4A 3FN3A 1U58A 1OGAB 3UP6A 3ARFB 2ROXA 4L8SA 1J1OL 1JWUA 5KN5B 4M7JH 3W11C 1RULH 1LO5A 4UU9B 2ADFL 4KKCD 5B8CB 3ZTJG 4FQJH 3LTVA 1D9KC 5HYIA 1EHXA 3IE9A 4FHKA 1MJ7H 3RNKB 1XDTT 2B4CL 3DIFA 4MYWB 3FTWA 2DQTH 3NYKA 5DR5L 2FX7H 4Q9CA 5F7DB 3QUMH 2E9IA 4J3BA 3W37A 4N0FB 3MGTA 2V2TA 2YA0A 1Q90A 5KEZA 5KZCD 3QSKB 3LPGA 3GO1L 5JQHC 1KJMA 4IMKC 2VDOL 1BXUA 5CLYA 1NC4A 2EUXA 4OCYL 3O9WC 5HHMD 5F0MB 1EH9A 1KEMH 4K3GA 1I1FB 3KGRA 3NSYA 2D03L 3FUJA 2FB4H 3DTXA 3FYEB 3VH8A 4ZNEE 4GG6A 4L4TB 2R0ZH 2AEWA 3ULVE 1NCWH 3DSFL 4J3OG 4M48H 2IAMB 1CXHA 5IB3A 3H53A 4TV3A 2WQAA 3IE4A 4IS6A 1NBYB 4ALAL 1ZVHA 2AABH 2FO4B 3FQ1A 1CDJA 4O4YH 4PG9B 4FJYA 4MWFB 4OCRL 4B5ZA 3BZ4A 2X2YA 2W65A 1R0AH 3ZW3A 2RH0A 3BE1H 3I6LD 4UZUA 5F89A 4DUWA 5FO7A 3Q6GL 4NEHB 3S5LG 2DLGA 3HA0A 4JFPA 1QUNB 4GAFB 4HXBL 4F1SA 3FUKA 3VGBA 1XWVA 5C09E 2XXCB 1ZOXA 5B38A 2Q86B 3GMOB 1XR8B 3KLQA 4GFTB 4X5LA 1VB9A 3MGAA 4IOSA 1T66C 1MDAA 1UURA 1X7QA 2OMVB 2AC0A 1F6AB 1S9VB 5CP7A 4GLRI 2VDNB 3IDMB 4ZO9A 3F05A 1AR1C 2WLYA 3RGHA 4X50A 3EXLA 8CGTA 3UP1A 2LU7A 1R5WB 3ARBB 2W9LA 2V8MA 3BKCH 2NT1A 2ZXGA 4PAZA 1J1PH 3S5ZA 5I6XC 3TBWB 1QFOA 3MYJB 1IARB 2DDQL 4LOEA 1MRFH 3EYVB 1HEJC 4FS0A 2JSFA 2I7SA 1N26A 5CGBA 2G2NA 3D87B 4DESA 4N0UE 5DO2C 2VDNL 4NCC1 3HPJB 1BXVA 1WA1X 2J7LA 4XP4L 4DSYA 5IQMA 5ABZA 1PKQB 5FKPB 4L8DA 1KENL 3NPZB 4FC3E 4OGXH 1CXLA 3GSXB 1IAII 1GCYA 1ORSB 1S78C 3FQWA 3ZIMA 1YMHB 1DQDH 2IBZX 1SJEA 4G1EB 3TZVB 1JCVA 3L3IB 1HHJB 3FQ4A 2CO6B 2OCFD 3DGDA 4N3UA 3HLAA 3CAFA 4NP9A 4X7TA 3T4YA 1JYXA 2WIIB 1YUHB 3F01A 1AXTH 1J05A 2L4OA 1RZIA 2BW4A 3U0TB 5JPNC 3NABH 5I18H 3RIKA 4TULH 3PAVA 2OL3L 2OSYA 1NBVL 4KKNA 4UNVA 3OAUL 1MRDH 4HIQA 1KUMA 5EOCH 3ZSTA 3BGMB 1A9BA 4UT7L 3V2AR 1UZGA 2BHYA 4Z7WA 2PP9A 2W80C 3S8FB 4S0HA 4F7EB 4MMYA 5ITBL 4P4KB 3QIWD 3KDMB 4JFFE 5IOPA 4G71B 5CP3A 2H45A 3CZJA 4UIMA 2RHEA 1W72A 5E1GA 3ZHDA 1QLEL 2R56H 1CR9L 1W8EA 4G59C 1E4XH 4P46B 2R69H 4LLMB 3L4YA 1DBBL 4KKQA 1ACXA 4S11A 5ABAA 1XAUA 3MCKB 3MUUA 3WTXA 2CRMA 2OJEA 3TCTA 4AIEA 3EFOB 1IGTA 4RLDA 1N2RA 4BHUI 3BPNC 2LAGB 2GJ6E 3QEQA 5DVNA 5BQDA 2UYLA 3SYPA 1KG0B 2XQBH 4CC4A 4F7KA 3ML8A 2VERN 2C9RA 1LJMA 2VLJA 3S6CA 4JHUA 1PZCA 3MFFB 3QEUA 4F58H 1PFCA 1L4IA 3FH8A 3INUL 4H5SB 4UQ2B 4AYSA 2CDGB 1HHIB 2AEQL 2A9NL 3LVEA 5A16A 4P59L 2OA9A 4TXVB 4YDMA 4ZS7L 3ZQ9A 1KYUA 1IEAB 2PPEA 4YDIL 4C56A 3AAZA 1MHEB 1BJ1H 2PWFA 1OOAA 2Y2TA 3W82A 3DUUA 3IEAA 4PTUB 1KZYA 1N5YL 2XG5A 3NGBB 2B9AA 4FL4C 2X3BA 4KKBD 2BOCB 5IBTH 3MRHB 1IGFH 2FZ3B 4YC2B 4KOBA 3LRSA 5KW9H 3LKRA 3TLRA 1HHHA 3ARGC 2CJUH 3UDWA 2XZCL 4RGMC 4YDLB 4Z0BH 2ZSVB 5K5YA 1AGDB 4RX4A 3P1VA 5FYJH 3ORJA 5AZ2H 4NYLB 1MHPH 1ZVSA 2AXFB 4Y16C 4FFYL 4MXVF 3L9BA 4WDIB 2OP4L 1XV8A 4R83A 2OK0H 2IPUK 4MNGA 3HZKA 4JFDB 4AMWA 3WTVA 4E9SA 4EIBA 1ZLSH 3UJTH 1FFNB 4GO6B 1XTMA 2AV7A 3EKCA 3E9TA 3PNWB 2DM2A 3Q48A 3THMH 2CRYA 4BZ2A 3FQRB 4XP9L 5F71A 5B4MD 3KW8A 3M7FB 4FQPA 1TTAA 4CSSA 3H55A 4PRNA 5AVWB 2NXZC 2WXQA 4G6ML 1ZV5A 1YNLL 5HHPB 1NCJA 2EIBA 5MEPB 3RGBA 2G5BB 3KYMB 3H2WA 3CHSA 1WA2X 4RSVA 3U0WL 5B39A 3VXME 1JVOA 4FQ2L 4LK4A 3VXMD 2ADJB 2G60H 1QLEB 5DU7A 3RVVC 4G1MA 1BECA 5FYLD 4BXVA 3HLKA 4LPXA 4XMLL 4HWEH 3RFZA 4TQEH 2AW2A 4KC3B 4UYQA 2UZXB 5AW2B 3HC0A 2CMRL 1V7NL 3RX5A 2Z3FA 1S9XA 2V3EA 2I7OA 1OW0A 5I8KL 5H35A 5LGJB 4QY8A 2Y07H 1YYLL 1CK0L 4G43A 4PJDE 1DJYA 4MYPA 1DJSA 2F6AA 5IBUG 1OOWA 1XBDA 5KVGL 5HY9A 2LFGA 3IDGB 4KO7A 4FQCL 3LNHA 1BQUA 3H2QA 3MRPA 4D8PA 4ZODA 4YSDA 4Y8DC 5AOIA 2BIOA 5DD1H 3NQKA 4KVCL 4DF9A 4TLTA 4JREC 4PJ7A 2SEBB 1R47A 4ZTOH 1GXEA 5IK3B 4KU1A 4JQIH 1E8ZA 3LMJL 4X9YA 1GJIA 1PZ5B 4Z76A 1P7HL 2A2QT 3NDZE 3CLFH 2XU9A 1MI5D 4AUJA 5IW6A 4AOFA 5CEYB 4HK3J 3KZ8A 2C7FA 4KUCD 4EOWL 5AB9A 2W91A 3V7AG 1JUFB 5G4MA 3WJLC 1VGKA 3JV5A 4N2NA 5DRNB 1J18A 1XB6A 3VFPB 2NY3C 1P5VA 1SQMA 3BZ5A 3AS2A 2XT1B 1FRGL 3FO2B 4PLKC 3FB6A 4YXHL 1LEIB 4ZOCA 3ARZA 4GQPH 2AFNA 3T6ZA 3KLAA 3ZKND 3QYMA 4OF0A 5FM5O 1AQ8A 2WSPA 1MWOA 4UM9B 2BOBA 1MIEL 1X5GA 2BM3A 1X5IA 2GJ6D 4S1QL 3SJVA 4PJHB 2IFGA 1UWXK 4N8VA 1N9PA 1QFWH 2O5YH 2ZWNA 3IGAA 3AREA 3KYOA 3JV6B 4ICXA 3NRFA 2TRHA 2WW8A 4ONGL 3UBGA 1D5IH 2Y6SD 3BN9D 4WUUE 1AHWB 3SYCA 4F8OA 1VFBB 4TL4A 2WB7A 2R4RH 4Z7NE 3WFDL 2H3NA 2H2PD 1EJ8A 2VQTA 4A37A 3LRLA 2J1YA 4K23H 4R7XA 2CGYA 2UUDH 3ES6A 2H0JA 2UZPA 4LNVA 4ADGA 4GUQA 2ZXEB 3TYGH 4HJ1A 4MVBC 3DJSA 3KWXA 2Q76B 5I1GH 1OPGL 4M9PA 3IDXH 4PJXF 2GK0B 2YRBA 2R39A 5HHMB 2VDKH 3MU3A 3Q13A 3RTQA 3NA9H 1MCWW 3IU3A 1A3RH 4NQTA 4G8GD 2IADA 2DQMA 3TWCH 2FJHA 4YR6B 4F2MA 5FYLL 4AT6B 4YBQC 4L4TD 1I3RB 4B9CA 5A1AA 2COVD 1IFHH 3KNBB 2WQWA 5FUZL 2AEIT 1KLFB 3TJEH 4OM1H 4WVRA 4NZTL 4UTAH 2ZXQA 5I8OH 2PWGA 3P0YL 4J28A 5DMGC 4XCYA 5IZ7A 1UKSA 5DA4A 3U6RA 2EC8A 5B1BB 4KI5D 3T0WA 1GW0A 3JBG7 4NKMA 2A38A 4GXFA 3WNIA 4R26H 4FZ8L 4IOIA 5F8QC 1CQKA 4HZAA 2XTSA 2BSTA 1G7HA 1BVNT 3Q8CA 4L3FA 5FLUA 3V4UL 4YHML 5F7UA 4XGZB 3SCMB 4EZMA 4B9GA 5CILH 5DVLA 5TQ2H 3CVIH 4NDMA 1WZ1L 4PJDF 5LB1A 2WO2B 3LIZL 4AMKL 4ZMOA 5IB2B 2X6VA 4P0DA 3GXIA 3OSKA 3B9AA 2CKNA 2N0KA 1CGUA 3SDAD 4KO5A 1P6FA 3UJJH 2E86A 1WZKA 2NX5B 4B0MB 2AQRA 1NCNA 2VR7A 3SSGA 4NJ9H 3BW9A 4NX0A 4ZXBA 2MJWA 4PJDA 2WQVA 4U31A 2W60B 3VNYA 4IU2B 3DO4A 1F4YH 2F15A 5E4AA 1A7RH 3MTRA 1AXTL 1WLHA 2X1XR 1SLWA 1Z3RA 2JKIS 2WN2A 4Z78B 4XB7A 2PCXA 1AXSB 3FQUA 3GKWH 1W0YT 5JOFA 3NABL 3VFOA 3TYFB 1MJUH 3V0EA 5EO9B 3K8MA 5ACZA 3LKSA 1MPAL 3WJMB 2P7TA 2OULB 1KT2A 1MJ7L 4L37A 2CNZA 2P52A 1KBGL 4I8DA 4XOEA 3PGDB 1T1XA 2OYPA 1BMWA 2HG5B 1WZMA 1CGSL 4UQAA 5LNDA 3ILPB 4U1JA 3X1NA 1HHGB 4WWNA 4A6YA 2XZZA 1R5VB 4ENZA 1VZHA 3T5WA 4TQHA 4DN4L 1TQVA 1YEHH 5FDYA 4R6UA 2Y7QA 3CBRA 2XKNB 4JG0H 1BZ7A 4YHKH 3HI5L 1OAXH 3US1A 2Z65C 1K6QL 1IM3B 1NTDA 4KH2A 3SZ6A 2BWDA 3O41A 5IW1A 2A73A 5C0BD 3IU4L 1P5UC 1QFHA 2BSDA 4S1DC 3NCXA 4DGVH 4FXKB 2E7BA 4Q9QL 4KJPC 3VXSE 1UM6H 4M6AA 4UOW0 3EGSB 4PRDA 4PJXA 3AU1B 1ZAGA 2WCSA 1FJ1A 2XWTB 3GHBH 5HBBA 5BMFL 4H8VA 2IEPA 1RAMA 4PRIB 1SYVB 1RZQA 5L9DH 2W81C 4POZD 3Q6FB 2R4SH 4HLZG 1SY6L 2G0KA 4FYTA 3GXUB 4G72B 2G5RA 4LVNC 3LX9A 3KPMB 5IVXA 4EZLA 5E8DH 5KS9A 1SN2A 3RDJA 2VERA 5D1QD 4OCXH 4HXBH 3LPFA 4N8PA 5T33H 5HHQB 1HNFA 1T04A 1A1MA 4KKCC 2MNUA 4D0CB 3EDFA 5JTWA 5FYJL 5AZ2L 4M6OH 2HJLA 2IGLA 1BVNP 3T4AC 4S10A 4KTGA 3R06A 5F1NB 1NIAA 5KSVA 1NKOA 3K2MC 3GJFA 3MNZB 4LP8A 4NNPL 3S4SA 1S3KL 1YMME 4KNSA 2QGEA 5IEHB 5ISZB 1JVKA 4HF5H 4BSJA 1AZNA 2PCYA 3F7VA 3L08A 3BXNB 3Q2VA 3ZTDC 2AJZA 3VQMA 1KIUB 3AG1B 2KLTA 1AQKH 4ES9A 1WH0A 3LHPH 3O6LH 4J3UA 3IM1A 5GS2D 3ULUL 5E9NA 4RVBA 5DK2A 2YD3A 2FWUA 3VFVB 3BIKA 2DWXA 3PABB 4U1MA 5K59E 3ETTA 2DV6A 4PJIE 1PNDA 4BQ6A 1X5FA 2ZWKA 2NSMA 4GBXC 4H44C 1KPUB 5AENA 4JGMA 1WC7A 2N7SA 4JFYB 2NUPB 1G84A 5E1HB 1GAFH 1CL7I 4AUYA 3Q5TA 3QQ9C 5DVOA 5T1KA 3VMPA 3O0LA 2EVGA 3OHXA 1AAJA 5IVZB 3V0JA 4DGWC 2CXKA 3BLPX 3F5WB 4X7SH 4BKLB 4BFRA 3MRLB 4MRBA 3GJEB 3G08B 5FGBA 1UA6L 4F7TB 1B0RA 5J6GB 4FKHA 2DLHA 1XCWA 3QPQC 4O5LL 5T3XD 5C0IA 3EXJA 3AC0A 2G0LA 5D7IE 43C9B 5L6YH 3EBAA 5IVOA 2OL3H 1INDL 2GTWA 4HT1H 3T3PE 2YD2A 5F1IB 4MCYA 5IW3A 2B7DT 4KVCH 4Q97A 5A2BA 3VFUB 2QTEA 4LASH 4LOFA 1JF6A 4X80H 4BV1A 4V1DE 4HX1A 5E00A 8FABA 2F61A 2P8LA 3ARRA 3MBXH 3DMMD 3LN5A 4KUZL 4Y5YA 2CGZA 4PLJC 1FVDB 2VIRA 4Y0GA 2WTPA 4NBZB 2R9HC 1NBYA 4JHBA 4OJCA 5C0CD 2HUEA 2DI8A 3W39B 3X3FH 5ERWB 4J3OF 1TITA 3L13A 5AG9A 1FRGH 3P4NA 3LDBC 4PJ8C 5KVEL 1PD0A 1U95A 4MKMA 1IV8A 2YSTA 1DDHA 3WUWA 2KYIA 5E2VH 4YE4L 1F2XK 2BXZA 2DQFB 2PKDA 3C8HA 3IRCA 3ULVL 4V1DB 2WXGA 4GAYA 5B38B 2Q86A 3WJJA 2X3AA 3EUUA 1GYUA 4NRZB 4PBDA 3GXNA 4R5XA 5I66B 5IHZA 3CGTA 2IV8A 2NXZD 2RIKA 3CFEB 5B3NA 4ODXB 1IL1B 3EOAA 4GSUA 3B56A 2GBVA 1PX8A 4X98A 3VRIB 1YN7B 4NQXB 4AJVA 2QGCA 1R5WA 3J7HA 3BZDA 1N64L 1S6NA 3PAZA 2PXYD 4IJ3B 2R1WA 4L8BA 4U3CA 3UBHA 3VI3E 5AOZA 4AVJA 4PY8J 4QJ4B 4I0KA 3QYCA 3DOSB 4UQ2A 3IFOA 2F53A 3B2VL 2QEJA 5I1CL 5CSZB 4Y1TA 3DIFB 3LKOA 4WUKL 1OLZA 3LS4L 3H54A 5IM7B 1UH3A 5DDHB 2RA1A 4AJWA 3VSUA 1NGYB 4J3OC 2VQ4A 1WG3A 3AQYA 4KQ0A 3IDXL 2LU3A 5KTEL 5ALBH 2WLMA 3N41F 5GIRB 5B1CA 3VXUB 4L9LA 3SDXB 2P5EE 3IPEA 5K9JH 3OC5A 3O45B 1KJMB 1Q0YH 5H8DA 4HIHA 3H8NA 5KSBA 4GBXD 5CZXD 5GGSA 3L3IA 3A4FA 3M8OL 2CO6A 4HPYL 4Y1SA 5CGYC 4YGVB 5JW5A 3FTVA 3VQ1C 4R8WL 2YEZA 5HGDA 1T3FA 5HD8D 3BT2H 3SPIA 1QASA 1AOHA 1LM8V 1T1YA 4OIIL 3SKJL 3MLYL 4PJGF 4L4TA 4UDTA 1T7XA 1DUZB 3FUDA 3MZGB 1PAMA 5IFJA 5D7SL 3MREA 1NEPA 4WKZA 3D5OF 3UPRB 4FQ2H 1ODAA 1L9NA 4XP1H 1TYRA 4J6IA 2X4OB 2A74C 4IW4C 2LABA 5C2BL 1PX4A 4OD3H 2CGRH 5DLML 1XCQA 3HIZA 3EJZC 3AT8A 4KXDA 3K0YA 5J9PB 3PV6B 5MEPA 4XMVA 2A9ML 1CBVL 3WUZA 3TL5A 1SOKA 5HGBB 3WDHA 5FUCE 4ZXBD 1OEZW 3CXDH 4WW1B 5E5MA 4JKPH 4D9RE 1UJ3A 3M1BA 4GMTH 4S0TD 3D1MC 3WKNA 4GQ9H 4IIQB 4LCUB 2C3HA 2CM5A 3I3EA 3CZUB 1PG7H 1MCPH 3S36L 1S7SA 3ZDYF 3B7TA 4FFTA 5IQ9B 3LOWA 4POZC 5DFVC 4N0YH 2VWEE 2Z34A 3MBEA 5TDNB 2VLJB 4LGRB 4XOCA 1GGBL 1UD6A 4XMKH 1IZKA 3VXSD 2P46B 3OKLA 4PP2A 5IMMB 2R29H 1MHHB 1NIFA 4JFTA 3ZRSA 3FUMA 2VABB 4IOFC 4P3DB 1UWGH 2W0KA 4AGOA 3SE8H 5J6SA 2Z91A 1I7UB 4RAUA 5FX3A 1T4KA 4OZIF 5TE6L 1SEQL 2YOAA 1Z3GL 2QKIA 1OCCB 2NX5D 4R96B 3QQ3B 5ILTL 4JKKA 1UVQA 2WXLA 3GHEH 5EC1B 5G5DA 3NZHL 2P42B 3EYQC 5BZXA 2WXKA 3DX1A 3B9KA 3Q0HA 5JXED 1SJEB 2OR8A 2Y1ZA 4G1EA 4CMMB 5DO2D 5EOQL 4EAEA 2KL6A 1KIPA 3HMXA 1ZVSB 2AXFA 2FEEL 3JTBA 1AE6H 2ENPA 4YO0A 3WELA 4JB9H 1KPRB 4LSDA 2IDSA 3GJFK 4LCYA 4ONGH 4YLQT 7FABH 1E43A 3KPLB 3T77B 5FK9A 1C7TA 2JKRM 4KKPA 5DRXA 4UQBA 1J0KA 4WGKA 4AYFB 4IHOA 1WFUA 4EN3A 4HJEA 4W9FC 4G8IB 4NS0A 2L04A 2G2RB 2H0PA 4K23L 3BUTA 3D4ZA 2AJVH 1YNTB 2DD8H 2VMEA 4N0UA 3SBRA 5CZXC 5E95B 1Z5HA 1JK8A 1QYGH 4QT5B 3RFRA 1TUPA 1CMOA 1SY6H 3MOBL 2WZ5A 4WFFD 5C9KA 3RWJB 1RH8A 1IGJA 3FZUD 4GI9A 3T1FA 4A67A 1AOZA 3RFZB 1DSFL 3NCMA 4A2MA 2VXUL 2YN3A 2WWNA 4JPWH 3SO3C 4IDJH 3NCFB 3TPUA 4P4RB 4L1BA 1MF2L 4J3VA 1KCVH 2F5AL 1AMXA 1UACL 1UJ3C 2HPTA 4UNUA 5IT2L 4OCNC 3WV0A 1MW3A 4ACTA 1F4WL 5KJRL 4ZFOA 4DVBA 5E6IB 1ND0A 1TQCC 4UDUA 2HJFA 3ZT5A 1J88A 1U2YA 1S7XA 3F04A 1BOGA 4X9FA 4BBWA 3GMMB 4QNPF 3LEVH 4AGPA 3O3BB 4M1DL 3REVB 1FNGA 2CO3A 1Q8MA 4XCEB 3RY6C 4ZFGH 1S7UA 3EYUH 4BUQA 5D1QB 5DMGD 5C08B 4AV4A 3AMKA 2Z31B 3ZHFA 3FT3B 1UOLA 4F58L 5J57B 3ZTCC 3PHQB 3PJLA 4RSYA 3MRHA 1CG9B 1QG3A 2ZOUA 3N9GH 5T1JA 4XPAH 2PW2A 3MJWA 1ESOA 3SCMC 4PWHA 4BFJA 2VLKE 4WHYH 4AMKH 2H26B 1IC5H 4NPYA 1OGTA 2YD7A 5D8JH 1YNKH 5IVXE 3DSNA 3QFJB 3TGXA 2NOYA 1Q1JL 3O6MH 3QH3A 4M48L 1YG9A 4OD2B 3BAYA 2QQQA 4UT9A 2Z7UA 3VXPA 3HN5A 4LE8A 2E4TA 4TNEA 5INCA 4LL9A 3FQRA 3TN0A 1NA8A 5BS0B 3T3PF 3MLTA 1O0VA 4RMBA 4WFED 1CN4A 4PTTA 1EJFA 3BD3A 2X6CA 4H8UA 4KITB 2MQ3A 5AVTB 1PD6A 5L6YL 1U8KA 3HG1D 4U1HA 4JE4B 1FIGL 1IGML 4PJHF 2IAMD 4Z5RA 3O6KH 4IBSA 3CN2A 3B1TA 5DUBA 2PCPA 1P7KA 1XHHA 4XPHL 1PKOA 3MN8A 1JWMA 3AG3B 4EZJA 1E28A 1DSWA 2NY0C 3APDA 4G6AC 1NICA 3VWKA 2FQEA 4S1SL 1NEZB 2HFTA 4ZUWA 1OB0A 5F9WB 2J1WA 1D6EB 1PEWA 4O02B 4BGLA 3F64A 3FTGB 1OAXL 1TSHA 3WJMA 2P7TB 2WLHA 3S34L 1S9XB 1KXQE 2IF7A 2OW7A 5E4OA 1A6VH 4U6XB 4UTCA 3MCYA 1LGVA 2FLRT 5BUPA 1J5CA 3V4PB 4K5LA 3IU3B 3DXAB 1LDPL 1JWSB 4UF7C 3LN4A 3QORB 3PWPB 5D7IB 3CC1A 4CDHA 3SKMA 5D71L 1M6OA 1YYCA 2AITA 1BZ7B 1JPTH 5BRZE 4MXWL 4QOKE 4GUCA 4TPRL 3JVGC 3NIGF 2AV1A 3D30A 4CVXA 4HJJL 1YYLH 3DMMB 4JDTL 2CR6A 3I2CH 1M9WA 1ZDSA 3TEWA 3GSQA 1QOKA 4GQZA 2DQHL 5JZ7C 2EDNA 4P57A 4P2QD 2ICWA 5E8EB 4PJBE 3S8GB 1N5AB 3TBTB 1V55B 2ENJA 5EZOL 2PP7A 3ESOA 4FQXB 1S7WB 3WMQA 4YOKA 3NJJA 3JWDC 4PR5A 1PS3A 5SWZA 4MD5B 2Q9OA 2GSGB 4JFQA 3D25B 3TP4A 4LB8A 5T33L 4IRSD 2DMBA 4MXVE 1MVUB 4V1DD 5TDPB 3ZQXA 5I18L 2XWZA 4YK4B 5J1AA 4Y9CA 3ZU8A 3FOLB 3EJYD 1WHPA 4E36A 2JXMA 4HIIB 3OMIB 4QXWA 4Y2OA 3VMOA 4N1EA 3VXNB 4JPVL 1DBBH 4YL4A 4FMVA 4HDIA 5C0AD 3KPMA 1DJWA 3D4CA 3IT8D 2CPUA 35C8H 3OKDB 1NSNH 2EEXA 4R3SA 2NCMA 3OHXC 4NT6B 2OL3B 2WP3T 4IU3A 5GS1C 1IAIL 1IO4C 2E9GA 2WSDA 4KXCA 2E7DA 2BC4B 3UG5A 2NY3B 5EU5B 3V8CA 2ZKHL 4MD4B 1MXGA 3QJVB 4GBXA 4U1NB 4UQ3B 4KKZA 5GZND 1R24B 4OIIH 1MCFA 1HYRC 1AGEA 4XCNB 3F85A 2YBRB 4WV1A 4HWBA 4O2FB 3HI6L 5C0RL 3LKSB 2DZEA 2BNQD 4OFVA 1I8IB 4G8EA 3D3VD 5IHUH 1T5KA 1XIWA 3UERA 3V4PH 5AWNH 1QWUA 2IBZY 4P46D 3TPKA 3ZJAA 2CLRB 1GGCH 3R8QA 3T71A 2AEQH 4QRPA 1TETL 4JRYA 5CD5C 3D0VB 3PU7A 3P30H 1CLZH 4WNQB 2N01B 3ZVVA 3TZVD 4ECNA 2WMPA 3OMAB 3L1OL 3PAYA 5DZNA 3T4AA 4TF4A 4IJTA 1LO0L 4ZPVA 5CBAB 3PLYA 4K8RC 2ZKWA 4MS6A 2X4RA 2GTQA 5C6WH 4WJ5B 3GM8A 2YRZA 2RMNA 3QDGD 5SV4A 4NQDE 4K71C 4FNLH 4WW2F 3MLPA 2I60L 5L4MA 4NHUB 4EIUA 1VPOL 4FI7A 3B37A 1AC6A 1HILB 2MSPA 3C5JB 2CU9A 1ZGLP 5CKGA 4PGZA 1BM7A 2J12B 1WGVA 1XGUA 4P99A 4TMPA 4P4KD 4AL8C 4ZFFB 1IKFL 5CMAA 4HG4J 5E03A 1J0IA 4HPHA 3QNFA 1U8HA 4FTDA 1JFHA 1JGDB 3S96B 1WUZA 3QR1A 3OAYH 4N6RB 3PIQB 3WFCL 3OXSA 4BJLA 1YNLH 1ZLUK 5HJBA 5DRWA 3LV3B 4A2FA 4AM0Q 4MA8L 3ZBMA 3EYQD 2A6IB 5DJ8A 4AIOA 5FS5A 1ZLWH 3LH8A 1ED3B 1NUGA 1T6WA 2AVGA 2X44D 3RURA 4AV5A 5C0NC 3QFJE 5D7HA 3P3TA 2JV6A 2OQJB 1L7TH 1N12A 2DQIL 3ATAA 4JN1H 1TCRB 2BVQA 3P4NB 4D0BA 2J43A 4A2DA 3FRPG 5IVXF 3CCHA 1BZ8A 3QIBB 2DAVA 5ESAB 4OZGE 5GPRA 5EO9A 1BD2B 3DETD 2D4DA 3D2UA 5ECGA 1LMKA 4L37B 5JHDB 4ZO7A 4NRZA 3C8DA 5MI0C 3CVDA 3O2VH 2Y5QA 1JK9B 1QPXA 1XGZA 4MNGE 5KANG 2WWOA 2OMUA 1IL1A 3EOAB 3OKEA 4LLDB 5DMKB 5K39A 3CDYA 5ICYB 1R3KB 3V9CA 3I9PA 1QQDB 2JFCA 5EIIG 2MHAB 2PCFA 3AWFA 2IVFC 3CSFA 1ZHKB 3OSVA 2EAEA 3OKYA 3CFKA 5F1KC 1DVYA 3KS0H 4L0PB 1C5BH 1SDDB 2XUWA 4BZ2L 3O41B 5IW1B 2CIIA 4DK3A 4W9DC 3OF6D 1KN4H 1JRHI 5CKAA 1QLRB 5IV2A 1RU9L 2XWBB 4JDZB 1G0YR 3KHOA 1WD8A 5JW4N 3F12A 3WL9B 2XX0A 1TYJA 2ZUXA 3DBXB 3U2JA 1VENA 4KAQH 2CHNA 3GRBA 3D39A 4PRDB 5ICXB 1CBJA 1FZKA 3QJFA 2VLME 3B83A 1T0PB 3BP4B 1SYSA 1OAUL 2EC9T 2M8XA 5TGBA 5D1ZB 2VLMD 3NSJA 3DRTB 4P4KC 4LLQB 1BIIA 5L8LB 4KBPA 4AW4A 2B1OA 1W6LA 4P2OA 4BWWA 2AZAA 2E7HA 1F13A 3G6DL 4PRAB 2C26A 3RUGF 4HX1B 3ZMEA 2I07B 8FABB 5HYQA 5J11C 1UD2A 1XH0A 3X1FA 3GHBL 4AVIA 4IK7A 4U6HB 2OX5B 1FO0L 4ZMYA 1NMBH 1E7UA 3II2A 3BH4A 3QUYA 3QR0A 4JM2F 5E6ID 1WFIA 4UQ9A 4DKAA 1EMTL 4OJEH 4GKSA 5F9AC 1TJXA 5IUCA 3PQYB 1RZKL 1I7TB 5DUPH 5E8DL 2Y23A 2EDWA 5ETUA 2VN4A 5HDBB 2EIMB 4R4NC 4PWIA 1XSOA 5CJ5A 1RUKL 2Q8BL 4OKVB 4JCWA 1NCBL 2QZQA 3T65B 5I1GL 2O6EA 1JHTB 4NZJA 4ZUUA 3F7VB 2Q6WA 5SWQA 2A83B 4HAKA 1B0GB 5T5NF 1G6RB 4KDTA 3BIAX 1SPDA 3PE9A 5E4EB 4AGQA 4AV0A 2OCCB 2W5PA 4XR8C 2D9CA 4DP7X 3VSQA 4BSVA 5HYJD 2CLVA 3QIBC 1AC0A 1KLGA 1MI5B 3ZE1E 4Y4KB 2J4WH 1EQWA 5D1XB 2MQGA 3QWQB 4HP5A 3UTSA 3OMNB 4MA1C 4W4OA 3OLDA 5JPMC 1T6VN 4RISL 3TFKC 4DKFL 5LCVH 1DJGA 2PABA 1AQKL 3BZEB 2NUTB 1WBXB 4FG0A 4QHMB 5DZPA 5JHLA 4JM2C 5KSAC 3BPCA 1M05B 4J8RA 1JHLH 2NR6A 1PZSA 3UAJC 3N1QC 4H2CA 5DYFA 3V52H 2NQCA 3LRMA 3HG1B 2AMGA 3P3YA 3C09B 1U4EA 1BSIA 2K6ZA 4X8GA 4O2CA 1UXLA 2I32A 1D9KB 3KWUA 3PDGA 2MKWA 1J1XH 2CR0A 1NCTA 2H0EA 3V0GA 5CEZE 1R34A 5DI8B 3WTTA 1N59A 4NZ8A 4U3SA 5I1IL 4XAWH 2EO9A 4HJ0D 5D72H 5B4MC 4BE6A 1QO3B 3RB7A 2DQ6A 4KHTL 4UTBA 4R7NB 4XNYL 3WFZA 4LCYB 1TT6A 4IKJA 3ZY7A 3RWHB 3MLRL 1G7QB 1P6AB 1BV8A 3MAWA 3QPQD 3GSNA 5J11B 2V2WA 4NN6B 3O4LA 3R0NA 2KLSA 5AUMB 3RWDB 3TA3B 5FYJE 2XJLA 3U0PB 3I6GB 1J8HE 4OZ4B 1ES0B 3CTTA 3WNKA 2VXVL 2K78A 4KTDL 4N5EC 4L1LA 3KL3A 5BNXD 5J9PA 3BDYL 4XXWA 4B9KC 5DHXB 5IT2H 5AVVB 1HDMA 4Z3EA 5KJRH 2ID5A 3L2NA 4M03A 3O11A 1YYMH 2ZCLL 4JCLA 3C6LC 1A6AB 2K4WA 1UJ3B 3M1BB 3I84A 1IEBA 4QAWA 2GBUA 4N9OB 4ERSH 3IWVA 4JG0L 4LU5H 4N2FA 4JFDE 5BW7A 3OKNB 4FQIL 4MHHG 1JF5A 4FYQA 3MBEB 4JQXC 1TTRA 3ILQC 3MRRA 1TMCB 3OLEA 2X4UA 2E7MA 4NI6A 4BWTA 2QJDA 3SIKA 2HJFB 2NYYD 4ELKB 1VKXA 1UFUA 1WD9A 2H6PB 3ABKB 2YZ8A 3KXFA 2VABA 2W92A 4QEGA 5C0RH 4IEFA 5C0AE 2DQGL 4MMXA 5KYWA 4QO1A 1N64H 1NBZA 3D9AL 3SGKC 2DQJH 2XZAH 5AVUB 1HESA 1PX3A 25C8H 4I1RA 3A23A 2CKBL 5G5DB 3RVTD 3ZDZF 1A4AA 2EO1A 1RJCA 3DYPA 2L3BA 2YD8A 4HC1A 5A2AA 4YEFA 4JHWL 2ARJA 3N40F 3CZFA 4BFBD 2O61A 2L0DA 4MWFA 3KPSA 2YS4A 1JN6B 4I0PC 1CXIA 1YHPA 5AOKA 3C2AH 4WWKD 1H6TA 2FHFA 4ZS6C 1K3ZA 4LPCA 2FSEB 4XHJD 3U1SL 3CFCL 1S7QA 2GCYB 2GFBA 3QHZH 3TC9A 2C9AA 1R5IA 3GMRA 5CZKA 3UCRA 4RGND 3V9EA 1YY9D 2BZCA 1L9OA 1NFDE 5AYQA 4TNGA 2Q8AL 1XEUA 1KCLA 5DJ0A 3HG2A 5C86A 4AZ8A 3LXUX 4CADA 1A66A 1RK1B 3MJ7A 4LARH 3P73A 3C60C 2A4CA 4G7YL 2G4EA 1S7RB 3ARFA 3FAXA 5DEZA 2OTWA 1GIGH 3QEQB 4LCIH 1XT5A 3C2SA 1GAFL 4WU5A 1TQWA 3TBWA 1HINL 4I9WE 1YPZA 1MAML 4G7RB 5KVDH 1WVZA 1L0XA 1EHLH 3PJSA 3X11B 5GRVL 3N0PB 1JHKH 1UA6H 5IROA 2Q3ZA 5DFAA 4CU7A 2ZAIA 3ZDXB 1I53A 1XGRA 2JCCA 4BFOA 4V2BA 2APSA 2J73A 3OJMB 4PTUA 1TU2B 5IMKA 1L9SA 3IDNB 1UB5A 5KW9L 4M4RA 3L3GB 1MFDL 4AGNA 3HC4H 4NC0B 1VADB 1FNGB 4XCEA 3GJFH 4CVZB 4D7PA 3IF1A 2NCEA 2GUOB 4BRVA 5FYLE 2V37A 5C70A 4OI8A 6TAAA 1U8NB 1KV7A 1PLGH 1J05B 1RY7B 5JPNA 4UMSA 4NERA 4HD9A 3ZN6A 3U0TA 3ECUA 2CBOA 4Z7UF 3CN1A 2XN9B 4MTMA 2NY0B 4KY1L 3T04D 5I0YA 4IS6B 5LGHL 1GPOH 4OLWL 3SKNB 4BDVA 3FO1A 4UMGA 4PYGA 3MRFB 4HJIA 3SGEH 3GIVB 3MRBA 4NO5A 3ZYOA 1JV2A 1KIQB 1X5YA 2TAAA 3GHEL 3MODH 4UV4L 3SOBH 4TKWA 4KZEH 1XAKA 3CN0A 3D50A 2PPDA 3MYZA 1VESA 4JQXA 1RJZA 2YJQA 4J1UA 1AE6L 1BAFL 2ZOLB 5GRXG 4AKPA 2ERJC 2C7UA 5BZWB 4YHZH 1HYSD 2FATL 4LIQH 2AXGA 4QKTA 4RGOL 2EVJA 4B7LA 3EFFA 1YEDB 4NFBA 4XPTL 4RGNC 5AAMA 3G6JF 3QB7C 3U1QA 3CXHK 2YKKA 3MCG1 3ARBA 1UADC 3BVXA 1FL6A 3NFNA 1KEGL 2AQQA 2YK1L 1CTMA 4YBQD 4FQXC 5IGXH 1WP6A 3A5VA 1T21B 5C97A 5DD6B 1N67A 4F8PA 4OUUB 1X5ZA 3KDPB 4H40A 4NKQB 5DC0A 2CHWA 1IEAA 3EG9B 4WCYH 5KTEH 3N91A 3ECBA 4NFCA 4NQSB 3V4PA 1NWPA 3SQBA 1PLCA 1JMXA 3IPFA 3MJ9A 1F90L 4FNPA 3LIUA 1ZV2A 3GF8A 3MR9A 1KJ2A 1A6ZB 3O3BA 5I6OA 3ZHNA 4R8WH 1ACZA 2HPOA 1KTCA 2BCMA 5CHNA 1OHZA 1P4UA 3W0WD 3VDAA 1M7IA 3DMMA 3HLAB 3KYKH 4P04A 4YUEL 5H94A 3TBCA 3N55A 3O2WH 3VRJA 1V10A 4ACPA 5GJTH 3U36B 1YUHA 4Y19B 3INOA 4YDNA 5EIQA 3FCTB 3PFUA 5E99H 2R69A 2RTTA 4YBHA 2YAHA 4PVBA 4LVNB 3PNWA 3CZGA 3BT2L 3EZJB 1C8QA 3NFPA 4NNXA 3B2PA 3D48R 1E6OL 3NACL 4MB1A 1EX0A 5JQIB 4HK0B 2XX1A 5EA0H 5CN3A 2RAMA 4G7SB 1IEHA 3GSRA 4K94L 1J5DA 1TZOA 4QWWC 5I8EA 3AABA 5D1ZI 3N9GL 5JDSA 5F44A 5I15H 1CBVH 4V11A 3FQXB 3A6CH 3L5XH 1GOHA 1DUYA 1G7IB 1X44A 1BZ9B 1K4CA 1SJHB 3EOYG 1JGDA 2F7QA 1KCSL 4ZMAT 5C2BH 3HHSB 2LVCA 2HH0H 2VDMB 1PG7L 4N4YB 1J9SA 4A66A 4HWUA 3QCUH 1L5GB 4Z5RB 1C16B 5E6ZA 1B88A 4OVVA 5BOZG 1SM3L 1A22B 3VFNB 4OLUH 5CLWA 3TVMB 1MZZA 3FL7A 5BVPH 2IPKA 3TV3L 1JGUL 4RNRB 2GK0A 2BH0A 2VR3A 4HUUB 5IMOB 3I85A 4DUXA 5AL0A 4YIQB 3UZQB 3GZOA 3TONA 1NCIA 2X89D 3SDDC 3RYMA 1NKRA 2VMDA 3VFTA 3ROOA 2ERJB 4YWGH 1ZSDA 4U7MA 4YHIA 2CDFB 4G6KL 1Z3GH 4GW4A 4AKOA 1EZVX 4HCRH 3WEXA 1V8HA 3O4LD 5TDOA 1OAJA 2Q7YB 2WINB 4G5ZL 4ANKA 5IP4A 2P49B 1ZEAL 3U1PA 1P7QB 4E2OA 4Q6IA 4P2OC 3NVQA 2GIYA 3E9UA 4M1GL 3KPOB 2XWXA 3NCYS 1BQHG 2ZSWB 1UHVA 1SDDA 3CFBB 1JGVH 4NWTH 1ZPLA 4URKA 3K0WA 1NOAA 3S37L 3IKCA 2DQUL 2NXYB 5E8EA 1CICB 4JFXB 4YAQA 2FB4L 3V4UH 2A4EA 4LPVA 2FT6A 2X6AA 5IESH 4P5SA 1LNUA 5CILL 2F1AA 3S9DB 5I6KA 3I6KB 4OZGB 5SWZB 2X1WL 3RA7L 4PLOB 4EXPX 3CZEA 1JI2A 1HCVA 4GP4B 2BINA 1KDJA 1BFOA 3VXOB 3L3DB 3V79C 3FONB 1ZS8B 4P2CG 2JXMB 1L9QA 4O58L 3QUZB 4C4KO 3BDBA 4F2ME 1AO7E 3OL2A 4C83A 2NRDA 4ORZC 3A4DA 5HYQB 3OXSB 1C5CH 3P11L 2X9ZA 2XQYK 5D7LA 3DPBB 2IH1B 4PJ9B 3VFSA 5LWYL 2CM6A 5AKTA 1CICC 2DWDB 2IJ0C 1BGXH 1G9ML 2E0PA 2QV4A 2YGNA 3UPCA 4B9IA 2HRPL 3MV8B 4YDVB 4XTRC 3L4UA 1F97A 1L7IL 4ORGA 2HXAA 4HZLA 4E41A 2J4WL 3PWVA 5HI3C 5C0CA 3DI2B 3JQOB 3GBLA 3ZX1A 2FJHB 1KBWA 3D4YA 1R3LA 3O4OB 1I8IA 4G8EB 3VU1A 4LGPB 3SDAC 4NQDB 1F3RB 3WNMA 4I18B 1GHFH 4BCYA 1SJVA 2OZ4L 4LLDA 4PJ7B 2PN5A 1ULVA 4KNUA 4PVMA 1QQDA 2X53A 3FJTA 3GTTA 4L1TA 5ECJE 4AVKA 1WAPA 1BPLB 3V0WL 5D5MA 1EVUA 5GGRA 3VTTA 4ZPTB 1S5IL 3X3GH 3BGAA 5FUCC 1Z1WA 4NHCH 1S5HB 2GJRA 3U30B 4ODWB 2H9GB 2YMXL 3D85D 4U1LB 3KG5A 4HBCH 3PAUA 1Q0XH 1TIUA 3VB9A 1H0DB 2AJYH 2BERA 3VX1A 2CE6A 2XWTA 3QUKB 2IQ9L 3DBXA 1E4WH 3CV5A 2XVLA 4I5BB 5CJ8A 3CDGA 2YD9A 4R4BB 5KBNC 1PZAA 4UANA 3HRZA 3KGTA 3G5VB 4GRLB 1QD0A 3TIDA 5KN5A 5HVGB 3DRQB 3OAUH 4BQBA 2LLGA 2KPNA 5T1DH 5T3XE 3GTVA 4XNZC 4BZYA 5MEOB 4ZMLA 1BIIB 2MOVA 1UOKA 3KYOB 4FCAA 3LNGA 5CMAB 5AZEH 2X38A 3Q8FA 1WIPA 3HZYB 3HAEA 4RX4D 5C0JA 4XMWA 3M07A 3TCLB 5D7KE 1FZJA 4N6RA 4J27A 2H4EA 1U3HB 4C55A 1PY4A 5JIDA 5D6DC 3SY0A 2OXHB 1PLGL 3MBWB 4HJGA 5BRZA 1YJDC 5JW3L 2OX5A 2OPCA 3CZKA 3BQUB 3ATEA 5IEHA 1OT1A 5DXWA 4EF3A 4AQEA 4L8DB 5BS0D 3UZEC 5AUMA 4BELD 3DO7A 3C6LB 4KUCF 4PGBB 5CD3A 1BVKA 3AU0A 3LKQA 2AJZB 2Q2EB 3ILPA 3OAZK 2XQBL 1KXVA 1YZZA 3VXUE 1Q0EA 1XD0A 2R0KL 1DR9A 4OKVA 4H8HA 4GINA 5GJSH 3SDCA 2MCAA 4YX2H 4U1MB 3DROB 4U1IA 5HHOE 4DCQB 1DBML 1MCBA 1RZIB 1W72L 1YO4A 2A9NH 1AKJB 1H15A 1LDPH 4YHZL 3EH4B 1URLA 3SBWC 5FYKD 4ODUB 1U3HC 3HE6A 4FGMA 3F83A 4N0RA 4U2ZA 2FWLB 1X9LA 5E5LA 3V5KA 4JAMA 1H8OA 4Y4KA 4NQQA 4B3VA 1LD9A 5F3FA 1AI1L 1OAZH 2A9CA 1YECL 4F7EA 2WUBL 4NKIH 3X12B 1MW0A 3PV7A 4KTYA 3DXAD 5IGXL 2DF3A 1CS6A 3II3A 2HVJA 1KNOB 4EI6B 5JXAH 4NO3B 4PFEA 1G7HB 3QZMA 4IGBA 1KTDB 3HS8A 5AZUA 2P8MB 2NZ9C 4QRAA 2DWSA 5K9QG 1IC4H 1G0XA 1O7SA 3OLGA 3MV01 3BESR 1RU9H 4LDOB 5BXFB 5K33A 3WNPA 4HOWA 2NYZA 4ZMVA 4Y5YB 4XC1L 2NX5A 3BJ91 3FSWA 3P3UA 1I9JH 2VDQH 5L4FA 1DO5A 1UH2A 4MJJA 3X3FL 2JKLA 5JPMB 2YFNA 4MASA 2NTSP 3R06B 5F1NA 4DERA 1RHFA 1HQ4B 1YQ2A 2IDUA 3QJHA 2YSSB 5EB9A 4FNRA 2VM9A 3UJIL 1IGYA 3NP4A 1D7FA 4Z7WF 3QIUD 5ACZB 1HH6A 4F2EA 3MA9L 1GGCL 2NTFB 4RAVB 1ZCRA 1PZUB 4PJFE 3PQYA 4C54A 5ENWB 4I48B 4QLWA 3DDGA 5C0AB 3L4VA 2F7RA 3LKNB 3G6AA 2EXYC 4G70B 2BHFA 4JVPA 1KGXA 2ZX5A 5ANMB 1CLZL 3CDFA 1JYNA 1R5VA 2Y07L 3EBIA 3H7BA 4X98B 3O0RH 3VRIA 5IHUL 3QQ4B 1HDMB 1M57B 2R9HD 5LCVA 5KAQF 1H9DA 4LL1A 2OR9H 1HNGA 1EMTH 3P4OA 4KZ0A 1LO0H 5KVGH 2Q6WB 1TKWB 5CJBA 4DGIH 1XGTA 2AQTA 1FNAA 2Y5TA 4FQCH 3QDJB 1U8CB 4MVBD 2TRYA 5K9OA 4FQQA 3I9GL 4JS7A 1RSYA 4P2QB 4PJAE 3K2UL 4ZUSA 5MHSD 1HCZA 3KJ4B 4O2EA 4NRXA 3BGMA 4MCZA 3GSUA 1G1KA 4OLUL 3HC3L 1H3VA 2YWYA 4QXUL 1MG2C 3GIZL 5CEXA 3RILA 3L54A 1XTLA 4R2GC 3L95A 5JDJA 2WXOA 5C3TA 4RDQF 4NUQA 1UM5L 3GXPA 3OV6A 4XBPA 3ILEA 1XL6A 2N1TE 1LVEA 2X4NA 2BFVH 4K9EC 5KVFE 2B77A 3SYOA 4MD0A 2IO5A 2OJEB 4FEIA 5JW5B 3QDMA 2ZWLT 3CQPA 4M4PA 4Y9GA 2YEZB 1YMMB 1RUMH 4KX8A 5BZZA 3SKJH 3HBGA 3UPAA 4BH8B 5L2KE 1F6FB 3ARDC 2AXJA 3ZE1B 3SOBL 3O3EA 4HKXA 4LKXB 3V0AC 1A6WH 3ZTNH 4Z7WE 2NNFA 4R0LB 3TFBA 1MFBL 4RMTA 1T04B 1LO2L 1HTYA 4H5SA 2NY3D 3UPRA 4PG2A 4LHQB 3LZNA 2DWYA 5L4IA 2X0WA 4L8CB 1II4E 1RZGA 1S8DA 3OAYK 1EEYA 3FH7A 2ZKXA 5DQJB 2VLRB 4R7NA 3O2DA 2EZ0C 3MRPB 3MRBB 3EJQA 4NO5B 1TTCA 5FYKH 1U8PB 3D3VA 2MQ0A 4HS3A 1IT9L 3RWEA 3L6FB 4RRPG 1TJIH 4L4TE 1QW9A 1R5IB 3GMRB 1UYWH 3O4LB 3RA7H 2IQAA 5JW4Q 1R3JB 3A6BH 2J88H 5A3IC 1ECYA 4DW2H 3MUGA 1VGKB 3UTSE 1LE5A 4IBUA 4NZDA 5F9WC 4EBQL 2XN0A 3P73B 3QS3A 4NN5C 3DC0A 2RFXB 1HXMB 1B9ZA 1XH1A 1QTYT 1Y6NR 3FB6B 3QXAB 1DVSA 4G8AC 4AX3A 5LAPA 5F0LB 1FYTD 4KK9D 1MLCA 1RK0A 2RGSA 3FF7A 2F53B 3SGJA 4KY2A 1VGEH 4KXZI 3EYSL 2ADFH 2X40A 3Q44A 4G9FA 3HVDA 3TURA 3LCYA 4UB0L 2Z0UA 5T1KB 3HR6A 2P5EA 4I1PA 5GGVH 1TEYA 1X7TA 4LBAA 2EXYD 3IGAB 1UCBH 2Z91B 5DQDL 5HHPA 4NUMA 1T5XA 3WS6A 4QRRE 1B0RB 5J6GA 2HMIC 1F41A 3LEXA 2PMZA 3ZKMD 4GW1A 1HCFX 4PI2A 4B9ZA 1HZHH 2WYTA 3CHRA 1TJGH 3AXHA 3MR9B 2MQCA 1TVHB 4FQHB 4IBQA 4MA7H 2ZUWA 3OR7B 1FL3A 1FVCA 1XR9A 2B20A 4R7VA