2O6DA

Structure of native rtp34 from treponema pallidum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Membrane protein, protein binding
molecule keywords 34 kDa membrane antigen
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6dA00
3LZQA 2O6EA 2O6CA 5I0WA 3LZPA 3LZLA 3PJLA 3LZRA 5I0VA 3PJNA 2O6FA 2O6DA 3NRPA 3LZNA 5I0XA 5I0YA 3NRQA 3LZOA
chains in the Genus database with same CATH superfamily
3PHSA 1L0XA 2Q1EA 4WFFD 4XX1G 4ZSOE 3V6FA 4NYLA 1OZTG 1KFGA 4GQPH 1K4CA 3SE8H 4IRZA 3W9DA 1UASA 3U1QA 1DJWA 4LASL 4L18A 2YPVH 3SPGA 5EH1A 4I18B 1UJ3B 4NPKA 2R0LH 5AOKA 1TYEB 4PLKD 3O6FC 2WV3A 5ISZD 2E76C 3DBSA 3BN9D 3TA4D 1M2VA 1I8MA 2AZAA 4FXGC 3S36L 1KCKA 3CX2A 1UT9A 3IFNL 4E9RA 5C0BD 2VC2H 3MTXA 4LP5A 4HZLB 4ZFOB 1ONQB 2VLJE 3K2UH 4LNRB 4C56E 3MRMB 3IK2A 4XO3A 4FL4C 1J5IA 2EE2A 4IW4C 5EU5B 2G9KA 3HE6D 1T22B 2IMMA 2WVTA 5IBUG 3G6DH 1QPKA 3TTYA 5C0FA 4PCTA 1EGJH 1KGUA 2J1KA 4BRJA 2X7LA 3HVNA 4D0BA 2MCAA 4PRAB 2AEQH 2O5ZL 3EGDA 5TTRA 4G80B 5CBEB 3S4SG 2V9UA 1G9NC 3D4ZA 1N10A 1CXKA 2DIAA 4X6DB 2ZJSH 3QEGH 5E6RB 4L1HA 1TJGH 1KCVH 1J12A 3HI1B 3UYOD 2ESVB 2CJ3A 3TEWA 4KU1A 5IEKB 4G6JH 4IOSA 5AW2B 2BOCB 4JDEA 5E2JA 1OWRM 3BQUB 3MRNA 2H4EA 3T2NH 2CJUL 4Z7VF 1SZNA 4MNHB 4PJGB 2BVQA 4KNUA 5FOBB 1UFGA 1NC4D 5TPWH 3Q9QA 1LM8V 2P7TB 4GG6A 4G3YH 4XPFL 1IAII 1HCVA 1S9YA 1ADQA 1WBZB 4I3RH 1CDIA 3L5WA 5HHME 4CC1A 2F8VA 4F37K 4ZFOL 2YARA 4P5RA 3IFPA 3E1ZA 1ADQH 2ADIA 3JTTB 1BECA 1QSFA 1UJTA 3VXUD 3L4YA 1RUQH 5ERWA 1ACXA 4LF3A 4ZS7H 4JM4L 6PAZA 3ISYA 1URLA 1ZJAA 5D1ZB 5C08D 2FHBA 2NNXA 2BVYA 3DX7A 3L4XA 4M5SA 5FGCB 12E8L 4H0GA 5JXEC 3BLKA 2X7LB 3F7QA 4JDTL 3SDDD 3UP6A 1HOCA 1YNKH 1ZPUA 3HMWH 1XGPA 4I0KA 2CCVA 2E7LA 3ZO9A 2BNQB 4WTXA 1FAIL 7FABL 4AVHA 1TXKA 2FE0A 1R5WA 1IAOA 1TVHB 5LGHL 4G5ZL 5C0AB 2LLLA 3QHFH 3GS7A 4NCC2 2DQDH 3H0TB 3VYPA 1PLBA 3OC5A 2CGRL 4F2MA 4YAQA 4S11A 1U92B 2X6MA 4GKZA 4GUPB 4KUZH 4XO8A 3S98A 2FYYB 3HAEH 1MCLA 4OKDA 4PJ8C 4F3FB 2ZXEB 4D3CH 3O41B 5JIIA 1UT2A 3KYNA 2F53B 4E5XB 4JG9A 2UUDK 4O2CB 5DJXA 4DKTA 3MCG1 3Q0HA 4UIMB 1MW1A 1W72B 4YH6A 1U41A 3OKKB 3QIUC 5IVOA 1CZ8L 4MVBD 1JYXA 4K9EH 4GLRH 1OF2B 4WI0A 3RPIA 1G9ML 2BK8A 4U1GB 2ILLA 2ICWI 2OZ4L 2WSDA 3EGSA 3MJ9L 4NZDA 2FX7H 3UJJL 5E8NB 3TZVB 3BEWA 1P4IH 4Q9QH 3X1BA 4PN6A 2XKSA 2XTJD 5J12B 1JK8B 3ZW3A 4TOYH 4ZXBA 5F9WC 3R4DA 5LBGA 2R56H 4A1RA 4XN1A 1K4DB 1CCZA 4ANXA 4M29A 4OFIA 3EZJB 3N44F 3OM3B 2AEWA 3ZQ9A 1JPTH 3F3HA 3C2SA 4KK9C 4PI2A 3KAAA 1UCTA 2CR0A 1QI4A 1T5KA 4AC4A 1N4XH 1S9VA 3QJUB 3ALXA 3IPBA 2YUVA 4TUJA 5TE7L 1U8IA 4F9LC 1E30A 1JV5A 4OZIE 4N8VB 5LGJB 1OSPL 1EDYA 4UZUA 4EUPA 5MI0B 2NUTB 4N26A 2NY5L 4M5YL 2X2YA 4TLSA 2DWDA 4P2OD 4LLDB 2BVOA 5C8JB 4JFFD 3NFNA 3DV6A 3VX0A 1KB5H 1FVDB 3LYRA 2M26A 3MN8A 8PAZA 2QSVA 1XH3A 2V17H 4YWGH 5BV7C 1SXSA 3PPEA 1N6QL 1Q0XL 2DM4A 2WVVB 1Z9OA 1N5YH 3RAJH 1OCWL 5MI0C 4PBDA 5HDBE 5T1LA 4Y19A 1SJEA 5FA4A 4C56D 5IQMA 3QSKB 2QQNL 2NR6C 5GRYA 1U58A 3PGCA 1OGAA 1DO5A 1IAKB 4M56A 1AQDA 3D18B 3HW7A 2QMKA 3FUFA 2IWFA 2OMBA 3ARFC 4HPOH 5DD3L 5LJYH 1N70A 1RH8A 3U4EA 3D6GA 4HETA 1WBXB 4BM7A 1ADQL 3I75B 3GB7B 4W9HC 2ROYA 3LB6C 1LP9A 4OLYH 4DP4X 1KTKE 3QH3A 8FABA 3KE0A 4KZDH 4JFFB 4HP5A 1ZCRA 3TVMD 3ESVF 4J6RL 3B9AA 4OT1H 2Z31D 4FJYA 1F6AA 4MGXA 3ULUC 4MTMA 1PKQE 4AUJA 3O4OB 2WW8A 3WJJC 3QDJE 5HY9A 5HYSB 5IFHL 4HIXH 2BHUA 4PJDE 4P23D 2WXHA 1IEAB 3EG9A 3FFDB 4JG0H 2RQ8A 3MAWA 4WDIA 2BW4A 3BKCL 4BKLA 3P3YA 4K7PX 4OR1A 3WHXB 3M8OL 4DVRH 4QNPF 3IXAB 1EHXA 3QCTL 2YPLB 1RVFH 3CHPA 3W57A 1MVFA 4P2YA 4Q9RH 2E3VA 4W4NA 3TBTB 3L13A 4QPEA 2I60H 3W2DL 4PWJA 3QDJA 5DRWA 2WNGA 3OB8A 5IK3B 2ROXA 1XEUA 4HCRH 3G04A 1FFRA 4KHTH 2CNYA 2BS8A 5ALBL 3TV8A 1AO7B 3D3VD 3FMGH 5CIPA 3X3GL 5I6OA 4QUOA 3BE1L 3AWFA 3BP7A 2JKSA 3UL4A 3GB7A 2J8UB 1OAUL 2JCCB 3QH3B 4JCMA 5GRUL 3WFDL 4ABWA 4J1UB 8FABB 1LJMA 2XKUA 3DMMD 2HUEA 4RRPA 5IB4A 5AYUL 3QIBD 3WUWA 2WNXA 3MUY1 4U1MA 5BRZE 2B3RA 2QLVB 1T4WA 2W0FB 4KXBA 4L8DA 2DQCL 1GYVA 5F1OB 4CVXA 2O26U 1SJXA 3KWXA 2AXFA 2WQRA 1UT1A 4P5MA 3FQ1A 4BELD 3TOPA 2J5LB 3QCVL 5FFLA 4KZEL 3FPYA 3WEOA 2RHEA 2J43A 5DZJA 2B20A 4NKDB 4AEFA 5FA3A 3QPXL 2WXIA 1MIEL 1E4JA 2A6JA 4IRSD 4JZNA 3GWJA 2VABA 3MOBH 2YA0A 3MLSL 5HGAB 1C16B 5HHPB 4PR5B 4G83A 2DQUL 3D7PA 3H4FA 1FVCB 3DX0A 4ZNEE 3UABA 1M7IA 4IEFA 1PMYA 1GW0A 1L5GB 1R24B 4QXUH 3TGXA 3TIEB 1QLEB 4E36A 2WYHA 2VITB 4U1JB 1RULL 2X4TB 4P9HL 3H42L 3NIDE 1PVHA 1T1YA 2ENJA 4JRYA 4M6AA 4HAGA 4LEOB 3U6RA 4XXWA 5IV2A 1T1ZB 4OQTH 5KBDA 4PRNA 4PB9L 4GAAA 4TQ8A 4CNIB 3A4EA 3BIBX 4FFYH 1PDKA 5KBPA 1PZ3A 5DD6B 4NFBA 2CRZA 1LP9F 4WWKB 5INDB 2QHLA 5LO7A 4KXAA 1JDDA 1ZWIA 2Y7OA 4KKPA 1L9QA 5DS1A 5ICXA 4OLWL 4IRSB 3CH1A 4FG6D 4Z7OF 2CU9A 1U91B 2HT3C 1RU9H 1J5OH 4O5LL 2W59A 1OP5K 2XICA 2AHIA 2C1PA 4GB9A 2J88L 3KVDD 1FFOB 3K0WA 2YMOA 4GRMA 4EOWL 4DGVL 5CMAA 5EMYA 3HAEB 1BX2A 3VMOA 4ZFZA 3EBHA 1C5CH 1H15A 1VEMA 2NYZA 4Z7VE 4QOKE 2FT8A 4MA1B 1B6DA 1HNGA 4FA6A 5JPMC 2EIBA 3LN4B 4A6YL 4LSSL 1RP8A 2NY6B 2YGOA 3K2MC 4LIQL 3WFBH 2R1WB 2XPGA 4BWWA 3WTSA 2DH2A 5F6HI 1AXTL 1I1RA 4C55A 3HC0B 2X38A 4NSKB 1UD6A 2NLJA 2NXYD 1WA0X 4KPHL 4AXWB 2BP8B 1CFQA 3NN8A 2XG5B 2OI9B 3S5LB 5D5MB 5D7LD 2DLFL 5AAPA 1MKFA 3EFDH 4PGJA 1ZHNA 2GSIA 3B5HA 1YCSA 3LTVA 4JFFE 5GS0H 5IUSA 2X28A 4RISL 2MJWA 1ORSA 5TDOA 5DRXB 2NDFA 3AJ7A 4LXFA 2BOBA 2R4SL 5ENWB 2B1HL 3HFFA 5DD3H 4QWWD 2H8PB 3T6QC 3V6ZB 3GRWL 4QYOA 5D2NC 1IQDA 1LTXA 4PGDA 3MLZH 3POCA 2V8MA 1RLWA 2IH1B 1NGZA 3NSFA 4LARL 1A02N 2XG4B 1MRDH 2B4CH 3WNPA 4BWUA 1NL0H 3UTSB 4OW6A 2HLAA 4ERSH 4IRJB 5FF6B 3INUH 1YDPB 2IBGA 2WUBL 3MLPA 1KDJA 4H0LC 1TVBA 5CJBA 1NAMB 4RMTA 5F3HB 4LCWE 4M4RB 4WV1B 4XPTL 2XN9E 4NM4H 4P04A 1KV3A 1RZGB 3IDUA 2DBLH 3SDCC 2IANA 3T65A 1C9SA 4OV6F 1ZANL 4DERA 5DZOA 4HOMA 2D0FA 5FGBC 1AKPA 4FABL 3KYMA 3WAKA 1BEYL 1YEKL 3M7OA 5DEFA 5KSAD 4PGBA 2XWJA 3KWUA 5GZOD 5M94B 1TQUA 2IBZX 2LW3A 1U8NA 2VMCA 3HEIB 4MNQD 4GBXC 1CDHA 4JFXB 4DP0X 3GMNA 4S1RL 1J0HA 1TIUA 4KKLC 5IMMB 2GAZA 1BVNP 5C0FB 1JPSH 4WENB 5FYJD 1AGDA 1Z7JA 4JHWH 3OGCA 1QSFD 3QQNA 3G08B 1B9ZA 2HH0H 3KPQB 1PEWA 1U2CA 2R8SL 4Z7NF 1UD8A 5GGTA 5SWZD 4K8RL 2GPZA 3WO3B 2DIBA 4UQCA 1R19A 5F6HJ 2UUDH 5AYTA 1Y1UA 2BSEA 3QORB 3B9KA 4Z76A 4YBLB 4CSZA 1KNOA 1EEYA 4XNBA 4B50A 3RYMA 3RX9A 3GKZA 5BO0D 3QA3B 4GMSH 5J4MA 3FUEA 2WBJD 3FT1A 3CK0L 3CZJA 3LNGA 1OT4A 5I6KA 4LLYA 4W9LC 4EIBA 3CSYB 1WS7A 4R7DA 3EO0B 1HH9A 4HXAL 4HK0A 4XC3H 1ZIAA 4DWHA 4L48A 1A5FL 1E6JL 1Z9SA 3VXPB 2WWKO 3D5OF 2DKMA 3GXTA 1FSKB 1MFUA 2VSMB 4PJXE 1XF5B 1CD0A 4OZ4B 5DJ8B 3QDMB 3ZBMA 3FU0A 1JGEA 3CN1A 2G3NA 3T2NL 5DI8B 2GY5A 1UADC 2R2HA 3P2TA 3NMEA 4MXQC 3V10A 1A4JA 3IJHB 3JTBA 3PDOA 3TCXA 3P0GB 3P2DA 4PCKA 5SX4H 3U0WL 2G2RA 4ZUSA 3QORD 1S7RA 2XRAL 4MS8D 4H8QA 3GXIA 5BZZA 4XC1H 1FO0B 2ADGA 3T0EC 1I1AD 3DK2A 4TF4A 5ICUA 3MV11 2R2BB 3MV8E 1JWSA 1DBJL 1AD0B 3ZL2A 1G6RH 3ARBB 4G2AA 1OB0A 1F4WL 3MBED 3I02B 3NZHL 1G7QA 4JJOA 3KH4A 2VDRH 2IMNA 1JF1A 2D9CA 2UZPA 2WCPA 3OPUA 1KJ2L 4PRDB 4LDEB 4O58H 3VFNA 1E28B 4L4VE 2R7EB 1UM4L 1CVRA 4GXVL 3PGFL 4XH2B 4I5BA 5AENA 3NSXA 3FW6A 1OP4A 1E4HA 3V0VA 3GSXB 1DN0A 2YPVA 5ACZA 1NMBL 2WSKA 4L3EA 3MRGB 3SE9L 4AIEA 4CL7A 1EJOL 5A6LA 2R2EB 3IPEA 4JVWA 4DZBB 5KBNC 3EZ8A 4KQ4H 1NCCH 2YKKA 2WBWB 2QTVA 5C09E 4G7SB 1NBCA 4TS6A 5D1XB 1AZUA 3V55A 3IN0A 4Z5RB 3DETC 4QDGA 1OP5H 3O6KH 1NMBH 1HOCB 1FRGL 1KXVC 3C6LD 5T1KD 1D5IH 1GA2A 1LXMA 3U6XS 1C5DB 1JK8A 4I7ZC 4ZXBB 5HBBA 3JV5A 1FV1A 4WWID 3ZE2F 1QFWI 4XCEB 4GT0A 4X98A 3NCFB 4P4KB 3CIQA 2LVEA 3IM1A 5BQ7B 3RKDD 3OAYH 1DBKH 1F58L 5CWSA 3FL7A 3P77A 4WFFE 1JI1A 1AC6A 2CUAA 1AIFA 1VKXB 4WW1A 3BAEH 3CVHA 3BVNA 4UDTB 5BO1L 1IC5H 1K3IA 3Q8EA 5D2LF 3ZTCC 1J1PH 2F54E 4HC1L 1PCXA 2ZYRA 3O3BB 1LEGA 2CO7B 3FUHA 3M86A 5CS7A 4B9YA 1U2HA 4RISH 2OXGB 1SHMA 1KLUA 4YXLL 2BY2A 1KTDA 4WI9A 3SDCB 1KIUA 2CLVB 4G1EB 1X9UA 4XP1H 3SOBL 2WB7A 3UZVA 2YKLH 1S3RA 1KCSL 2EILB 2PXYA 3HG2A 5AAMA 1BQLH 1LK2A 3BXNA 3RFRA 5A40E 1X5MA 5FM5O 3BT2L 2JCCF 2WQUA 3WDJA 2UY6A 3LVEA 4DUWA 5IMKB 1BQRA 1MFCH 2ICEC 2O6CA 2AJYH 3U1SH 5BS0A 5G5DA 1E9PA 1FQ9C 1U8HB 2QZ5A 5DVKA 1NCDH 3WFEH 3B9KD 4A2LA 5HP5A 1BZ8A 4AG4L 1CS6A 1FJ1A 5GS1A 4UDUA 1ZLEA 3Q2LA 2FLRT 3PXLA 2ZOUA 4BH8A 1INQA 4HWBL 3WS6C 4N0FA 3AU1B 5DS8A 4Z7OE 2OMWB 4G43A 2CWRA 4IGBA 2O30A 4X8CA 4ZW6A 3WE6B 1ET8A 3K8LA 4B7LA 1R4XA 4U1SB 4DOHE 4NJAL 5D70L 1IM9D 4X9FA 2BXZA 2J71A 1VEPA 4WWPA 2PO6D 5HHXH 2B59A 1LYQA 5HHOA 3FQTB 3BN9C 4HS3A 2HRPL 2JJWA 5JHLH 1UD2A 3ARXA 5CJOH 2BP5M 3WTTA 2NYKA 1KXTA 2QFPA 3EJZD 4XCYB 3KPPA 2EDTA 1YEDB 4P8QA 1DUZA 1KGWA 3FRPB 1QFPA 1JPSL 1X4XA 3NDYE 3WEAA 5I8OL 2AEPL 5IHUH 1T0NB 3OXSB 3I2CL 3WFEL 3SZKC 3FQRA 4S1DC 5DHMC 2ESVA 1BQHG 3WE1A 1CICC 4FHBD 1CBVH 2FWLB 3GEWB 3SCMC 1HFUA 1UB5A 3JV4A 1ED3A 4MJIB 2CO1A 3ZZQA 5TFSL 3A6BH 4U1KB 1NPNA 1EIBA 3NP3A 2AK1L 4G8GB 5DEZA 5FM5M 4AENA 2A77L 4NJ9H 2YK1H 2O93L 3CMGA 5EEYA 4GW1A 1YO4A 4LLWA 4QRTA 2GY7B 4PLJD 1CTMA 2YQGA 4NO5B 2E9IA 3HHRB 4M7ZB 4E9XA 1WZAA 4DKFH 1OAXH 1PIFA 1CFVH 1AXSA 2FBOJ 2VR5A 2MKWA 2P8LB 2OR9L 3BSZH 4B9JA 1AYRA 1EXUA 2OMVB 5AOZA 2JB6A 1DCLA 1U42A 4N68A 1IGJA 1A14H 2HTLC 1HL4A 4CVUA 1P6FA 1P7HL 4HK3N 2I69A 1BVOA 3NT0A 3KXFE 3H53A 4Z0XB 2AC0A 2VE6B 3JTSB 2HFFB 4BRVA 2ZCLH 3NEXA 4FEMA 1BZQK 3JV4B 1GJIA 3NH7L 4OZHA 1SQ2N 3PWLB 1Z3RA 5T1LD 1E5UI 2F53A 4E5XA 2FO1A 4TYUA 2J5LC 2N56A 4F57L 4ORGA 5CF3A 3EHBC 3K72A 2PTTB 5JORB 4OGZA 3ZTJH 1UM4H 1XH0A 5BRZB 5HDWA 1E4KC 1NC2A 3SE3C 4QT5B 2Q8BH 1QP1A 3OZ9H 4KI5D 4Q9CA 1AD9B 3FHAA 2W65B 4MQ7A 4NP9A 4N28A 4PJEA 3AREC 1YNKL 3HMWL 5IB2B 3ARDC 2XU9A 3B7RL 4IU2A 4X5RA 3SIKA 3JT2A 4N8UA 5HGHA 2P8LA 1BFOB 4KDTA 1BM7A 2GAZB 1NJ9B 2Q3ZA 5DO8A 4XMPH 1DVFC 3QEHA 1Q9KA 1BFSA 5EEXA 1DDHB 1OT2A 2WQAA 5F1SA 1RZ7H 4KJWC 3P9LA 4IKLA 4KXZH 1X9QA 3ZDZF 4W1TA 4LL9A 5IMLB 1OB1B 5GS3A 3RWIA 4U3SB 2HRGA 1IKOP 1VCAA 2NUTA 5D2LE 4GLRI 2IWEA 2IFFL 5CINL 4G8EB 5GJSH 3STZB 2UXFA 2JJTA 4KKRA 4P2RD 3ARYA 4JFQA 4QHPA 1WC7B 1ZVHA 1FLRL 3ZY7A 1TCRA 4NKMB 3VQ2C 5AAWA 1ETZB 4HWZA 3HNTH 2YS4A 3CLWA 4LCCA 3IGLA 1TENA 3Q5OA 1MCRA 2A83A 3UXFA 4OZ4A 2AQRA 4ZFOA 5DFWH 3OAUL 5T33L 3BYYA 4GNKB 3H55A 2AAVA 2JXMA 3D85D 1CR9L 3PWNB 3MLYL 3ARGA 4L29A 1KC5L 2XN0A 1YMME 3ZT6A 2R9HC 5IIEA 1I82A 1EJFA 3JWDL 3U7AA 4Y5VB 1KCWA 2OKMA 1E5AA 2QQKH 2G2RB 3LN9A 4FLHA 5E1HB 3BQVA 1WVZA 4X6FA 2BOBB 5ENWA 4NQDA 1BZDA 3TJPA 1K4CB 3UTTE 1FNGB 3D33A 5I74B 1W91A 4MNGB 3SYAA 3GSOA 3MV7B 4MD0B 5INCB 3AXLB 5B21A 1WICA 3ZDXF 1T0MB 2LU3A 3MOAH 2FD6H 2H5UA 3PWPA 4O02H 4PRDA 2CBTA 4J3OC 5J1SC 1SFHA 1HX0A 3APFA 4MXVF 4ELMF 5FF6A 2W92A 3KEDA 1R3KA 1ZV5A 1MHEB 4LT7A 4WUUB 5BQDA 4HULB 1GAFL 3ZKNC 3OJDB 1BAFL 5D2NA 1Z5LB 4YSEA 3SB3A 4Z3EA 5D6DC 5DFVC 2ZICA 3PUCA 4K9JA 1JXDA 4LPWA 3I85A 4EVNA 4LOUC 4X4YA 3HRZC 2HWZH 2V0AA 3SGDI 5CBAA 5C9JB 2X12A 5BZDA 3ULUD 5GIRA 3TNMA 4YK4B 2VLRA 2VJ8A 2XA3A 3D4GA 3N40P 4EUPH 3P54A 2G5BA 3PIQB 4N2IA 1MQ8A 4JY4B 4CDHA 4N2GA 3FSVA 1Q90A 1ZTXE 5L2JA 4PJEF 5T1JA 2DM7A 3GXMA 4HJIA 2HKFH 5E9DE 3S5YA 3VXUB 1AZVA 4A7SA 1WA1X 3QIUA 5GGUA 1MIEH 1MHHB 3MJ7B 2EDEA 2BFVH 3G6JA 2YRBA 3EHBB 5AOIA 3ULVE 2VDOH 5GGRB 5MP6H 5IHLB 1S7QA 3IF1B 3O2DA 4F1SA 1ACCA 3UTSA 4UZGA 3MV7A 2HP4A 4PQXA 4WUUD 5IKCA 4F33B 2R1YB 5D1QC 1SPDA 5E2UH 2CO6A 5FK9A 1BZ7A 3WO4B 4L9LC 5DHVB 4PU2A 2VZ3A 5I1JH 3QR2A 2AJUH 4G11A 2P5PA 3PREA 3RDTC 4I0CC 1CDGA 2WYZA 5C0JB 5J5EA 5KSAB 4ACTA 5JO5B 3ZGIA 4OZFB 1EAJA 1W9XA 4Y7OC 5DMGC 2VDKB 4KKCD 3FTGB 4AGPA 1X7TA 2F53D 1ZGLM 4FI7A 2V9TA 3DYPA 4KC3B 4OZHE 4G82A 1MN4A 1FJ1B 1BF8A 2O4EA 3QRGH 3V5HA 1C5BH 5DHYA 4K07A 1UTDA 2Q10A 4WEUD 3S96B 3RJQB 4BE5A 1WZKA 3WIAA 3QFDA 2FBJL 4OF5A 1DLHA 3QULA 4LO9A 2JMRA 4PP2A 2J44A 2HKHH 3FF8A 4BFJA 4UQEA 5KSBB 1U6AL 2X40A 3PDOB 2X4TA 5D1XE 1DSFH 4ZX4A 5T5NG 3NCCB 4F9PC 4KQ3H 1QABA 4NRXA 1WPCA 3L81A 5JW3L 3EFOB 4BZ1L 3CE1A 3MLTB 3F58L 3QQDB 5I18H 4LMQI 3NABH 2MCMA 2YD9A 4F7EB 3GSNL 3WKQA 4J8RB 4HUWA 1QRNE 1PX8A 1NAML 3EGXA 5B22A 1E2ZA 1P5UB 1WZMA 5HHNA 1HIML 1WEJL 1TEYA 4GRLA 3V4PL 1T0NA 3OVUB 3A4AA 1YPZA 5JIDA 1J11A 2DMBA 4ES9A 2FB4H 1AR1C 1K8IB 4EN3B 5T3ZE 3FFCE 4I5BB 2CPCA 4OV5B 1KLGB 1PG7L 1BVKB 4LBEB 5CJQH 4Z18A 2ICEB 3SE4A 3VXNA 2L7JA 5E5MB 3W82A 3FKUS 2FATL 3D9AL 3NA4A 5GZND 3IYLW 5DURB 3SO5A 2YEQA 2HRHA 5A2KH 2EDYA 3O4LB 2D7NA 3TIEA 1SJEB 2RCSH 1B2WL 5DHYB 3CFBB 5IJDC 2ESVE 5KYNA 3P30H 5FLVA 4EBQL 2P5WD 4APXB 2Z31B 2IH3B 3BMWA 5DRNB 3HBZA 3OKMB 3LZRA 1S5IH 1QUNA 1XR9A 4XPBL 5I6NA 1AOZA 4G7RB 3OKNA 4IJ3B 3RU8L 3UTZB 1KWKA 1JGUL 5HHOE 4N2CA 4DP7X 2QKIA 2FAUA 1SY6H 4RCAA 1MUJA 1ETB1 1FUNA 5EIVA 2E7BA 3KJ6H 4AVKA 2XNAB 4F1ZA 3D0VB 3S34L 4CJ1A 1KPRA 1MFMA 1XO8A 2PP9A 3JWDH 4ABUA 4MSWB 4XAKE 1C1EL 1IGJB 2LAAA 4NT6B 4PP1D 3LQAC 3VXMB 2E9WA 2NXYC 1WAAA 2AERT 3LD8C 3MRLB 1T83A 2YKLL 4A6YB 2O5XL 4ONHA 5I17A 1YEHL 3FT2A 5D1XD 3B2MA 3D0AA 3ARDA 1CXIA 1W8OA 4XNZC 4JFYB 2OV0A 5H4ZA 2LHAA 3C6EA 1XTMA 3HKFA 2GTQA 4JKKA 3HG1B 1X5KA 2P44B 4QHKJ 3AFLA 2IIJA 3T2LA 1PAMA 3DURA 4MMZC 5GISH 5T5FH 4DGYL 4UUJA 1RCYA 4U7SA 4JB9H 1Q9WB 1BAGA 4V33A 3I50H 4HOXA 2IO5A 4JX0A 1QYGL 1T2JA 4P2QD 1I8UA 4WF7A 4U2YA 1WFOA 2EKSA 1HQRA 3CPLB 4K7PY 3X2QB 4P2AA 1Z0MA 2Y22A 5KVFH 1GR7A 2BMKA 1DCEA 1Q94B 2ZX9A 4G6MH 3W5NA 3SDCD 2E4TA 2XETA 3MZGB 4JEGB 3VTTA 4ELDA 1NMCB 3UCRA 1UH3A 4G5AA 1O7VA 4RSVA 5CNHA 4YSUA 1MEXH 2VXVH 5DD1H 3VSTA 1AHWA 1IAOB 1LDPL 3KXFA 2ZNXA 3QJHA 3MJ8A 5LG1A 3KGTA 4QAMB 4P5KB 4WFEE 3QVAA 1P84K 1EH9A 1SRDA 1SN0A 3I6KB 1QSEE 4E41E 1NSNL 1U93A 1HU8A 1JTPA 4XZUA 1H8NA 3JWNG 4XOBA 5KG9B 1OAXL 2QPFA 4P2QB 1V3JA 1CVSC 3FSAA 3GS4A 3V4UL 1ZHLA 1KB5L 5IY5B 5CJOL 3LS4H 1INQB 4LF3B 5T3ZH 3K80A 5I73C 2C9RA 3RVUD 5C3TA 5LAXB 3TN0A 4PS4H 5EPMB 3QXTA 4H25A 1OGTA 4IQHA 1SYVB 4J1UA 5D72H 3LQZA 5LCVL 3UPAA 4OM1L 3L3DB 4XWGH 5EN2A 4RSYA 2XQYK 2VDPL 3LN5B 1BF2A 4LLUB 2EXSA 3ZHLA 4XVSH 1CL7H 1QBBA 4WJKB 3QDMA 2J8OA 1KELH 1U0QA 3VACA 1EO8L 3V5DA 4RGMC 2DLGA 3VFGH 1UM5L 3KPPB 3D07A 4HEME 5K69A 3TBCA 5C0AA 3QRGL 4M5TA 5JQ6L 2BNQE 2H1PL 4NQVA 4YAQB 1SGKA 5KANI 4HEMA 1IBFA 2VGLM 3BWAB 1RZIB 5E1IA 5I8KL 4JKMA 5IOPB 2AJVH 1N59B 3RUGB 5F88A 3OKYA 4B7IA 4XBGB 2IWGA 3X12A 2CA3A 4MJID 4X50A 2X6BA 1KCVL 1G9MH 2ZKWA 1A3QA 4EKXA 5G4OA 3UG3A 1I85C 3KPSE 2PYED 4GO8A 4PWIA 3WUZA 5AW7B 1DVTA 3VXRE 5HDBF 4UQ9A 2VM3A 3F7KA 3KLLA 1PZBA 4PY8J 3D2TA 4NUGL 2VZTA 2ZXBA 5ISZA 5TDPB 2ISDA 3K72B 1LEKB 5BO1H 1ACYH 1MREH 3SJVA 1KGCD 1FL3B 2Y25A 2Y5TB 1Y6MR 2MFNA 3DSFH 4NQCB 4UAOB 5F7EL 3W39A 1CF8H 3RY5A 5JZ7D 2Z4QA 2UVFA 2R2HB 4ANWA 4HBQA 1F4XL 1UWGL 3CZEA 3LN5A 5D1XA 5TQ0H 2HX8A 2XIBA 1DQQB 3BUIA 4L3ED 2H2SD 4GY4A 3BKMH 5JTWA 5I1CH 4U6YB 4OKVB 5F72S 3D18A 5T5FA 1AKJA 3NCEB 4BEIA 3D3VE 1F90H 2PYEE 4IS6A 43CAA 1XCQA 5D7IE 4NN6B 3DX2A 4O00A 1EJ8A 1U3NA 1VHPA 3V8CA 5C7XL 1T89A 4R90L 4J2XA 1O9WA 1BD2A 5A16A 3OC8A 2Z8WC 2C1PB 5CWSB 4AVIA 2FHFA 1RKRA 3MGOA 4HPHA 1J0KA 5FHBL 5SV3A 3VXSD 4FMKA 2WINB 4RIRB 1RFDL 1FVDA 4FG2A 1M2OA 2AEOA 2A4CA 2GBUA 3DO3A 2CO7A 2H6OA 3C08H 1A6VH 5LXGH 2HMIC 1HESA 2PWHA 1NM4A 1XGUA 2H7WA 2NY6C 4LEBA 3WI9A 2VZUA 5B8CC 2QVMA 5GJSL 2BOLA 4LSRH 3SO3C 2YC1B 3T3ME 3LS5L 4IBSA 3NGBC 5DRZA 2DEWX 3ARVA 5FFOA 1WIOA 3QO0A 4MA7H 1IVLA 2VIRB 2VZOA 3GMLA 5SWSB 1E27B 2D7TH 3QNYA 5BNXD 2I07B 4EXPX 1ZHNB 4LCCB 1P0SE 4A67A 2OTWB 3WFCL 3SOBH 1U8CA 2J3SA 4A7GF 3WTVA 2XWXA 3HFMH 3QWQB 1LP9B 4H40A 3ZYJA 3V6ZA 1R75A 2XKNA 3VXSB 3CFKA 4JFFA 5CIPB 2V3DA 1S7XB 3D08A 4GINA 1WSST 3VWKD 1WFJA 2OJZH 1L7IH 4MA1C 3MCKB 5JPMB 5DA0B 1ZHKA 3Q48A 4NHCH 4MNQB 3M17B 5KVEL 5ACLA 4HIPA 1A7RH 2Y7SA 1DBKL 1ESOA 3QDGB 2JIXD 3OKLB 4HIIB 3FO0H 1EVTC 4HS3B 1WP6A 4QLRA 1CURA 4U1NB 1BMWA 1DQMH 2VSCA 4M61B 4KVCH 1DUZB 5KS9F 2VRKA 4OFDA 3NJNA 1YEEL 3TV3L 5TE4L 4WTZG 1XGTB 4DPRA 1YPZB 4W9GC 1O75A 1B0WA 2VXVL 3VQLA 1XZ0B 4NLHA 3VXMD 2MHAA 2XTSA 4AITA 4BKTC 5I66A 4YPJA 3S8FB 3AG2B 4A39A 3PXJA 5BVPH 3FQXA 1KJ2A 1H19A 2J8UF 4X9YA 2Y36H 4S1QL 5CGYC 5SX5K 3QXDB 2EYSA 5DD5L 5BS0D 1W6WA 3GMNB 1LWHA 3EJZC 1G9MC 4MCZA 4Y16C 1I1AB 5KJ4A 3UZQB 4QEGA 3UEZA 3F5WA 5TK2A 4EZKA 4L3CA 5E4OA 3WNMA 1TTAA 3QDGD 3DROB 4UIKL 3FO0L 4W6XB 1JGLH 4FHKA 1ZV9A 4L05A 1S7SA 4JFZL 4Q74A 3H9SE 1X5YA 4N0RA 1NMAH 2ZCZA 3OMZA 1TQVA 1M56B 3RNQA 4BFEA 1W0VB 5DJ2A 1F5WA 5EZLB 1YEDA 2MSPA 5FUCE 4JL2A 2FEDD 3QRLA 2XQYG 2YR3A 3S3JA 4UYQA 2JKWA 1B9KA 3O2VH 1RSFA 4HDIA 4HBCH 4CC4A 1JXGA 2PPEA 3H3PH 4N5EC 1ZHBB 4HAKA 5I1KL 1SDDA 4HKBA 3SKOA 1HCYA 3M7FB 4YDIH 4PJIA 2BP3A 2VLLA 3HC4L 1I75A 1KN2L 3JV6B 3QAZC 3GHEH 5A2JH 3SE6A 3F8UB 1ZY9A 1E7UA 3IDJB 1KYAA 4TUOA 5D7SH 3RQ3A 3W38A 4M8UA 2VDKL 1J8RA 4YUEL 4UT6H 3GKWL 5MEOB 4NNPH 5L9DL 1IGYB 4XB8A 3DX8B 2GJZB 5I18L 3CX5J 4UZSA 5I30H 2WXJA 3GUFA 4LLMA 5CR1A 4JRYB 4RDQG 5HYSG 1ZEAL 4CBPA 2G60L 1DJYA 3BPNB 4WW2B 3DPBA 4HEPG 5I0YA 3HC0A 2YMXH 5BZXA 4NLAA 4QY8B 2DL9A 2Q8AL 3F84A 4MQ7B 2XJLA 2IADA 1XF4A 2K4WA 4X5XA 1HQRB 3BFOA 1QO3A 3PF2A 4JDZB 4AK1A 3FRUB 3ARUA 1NCBL 2IQ9L 3TO4D 4MHHI 5ADOH 3BGAA 4ZO7A 1NGYB 1ORSB 2BY1A 1I1YA 4GW5A 1AHWC 1FZKB 2DKSA 2O6DA 1HYRC 4MYWB 4XH2A 1F90L 2DN7A 4U33A 5IEHB 4KROD 5IB5B 4F7PA 1MWAL 2G4EA 4KI5C 2ZKXA 4NBYB 3B7UX 4UILH 4KK8C 1TCMA 4JAMB 5I8EB 5CD3B 3CJJA 4PRBB 3KL3A 2O72A 3M45A 2NXZB 2BVPA 5KYXA 4PJAB 4JRYD 4AYBA 1BSIA 2K7QA 3CQQA 1OO2A 4F7MB 4I18A 5KS9A 2GSMB 4L4TA 4YLQT 3BDYH 4OV5A 3M1CA 2WVSA 5C71A 1NAMA 5F3HA 1N67A 1DVFD 4W4OA 5H37H 2FO4A 5F1NA 4FXKA 5CGTA 5LGKA 1MJ7L 2JJSC 3WKYA 2VR3A 2XVLA 3TF7C 1WC7A 4ECNA 2BP8A 4KJWD 1G5AA 2EVFA 5I73B 4ZD3L 1U3HC 1CBJA 3WFZA 2NY1C 1H6EA 1SJHB 2WO2B 3F65A 3ISWA 1FCGA 1F42A 1SHSA 1VIWA 3NK4A 3DI3B 1QKZH 3PABB 4Z6AT 4LOFA 3IVKB 2QSCL 4NN7B 1G1CA 3VNYA 5K9JH 3BAWA 3QWOA 3OKMA 3MRPB 3LKQB 3WHE0 4UQBA 1D6EA 4FQ2H 5C7XH 5J6HB 5AD0A 1KCRL 3MYZA 3TBSA 3P9LB 1UVQB 1KT2A 3MJ9A 2OZ4A 5FUZL 4NHUB 2V17L 3OR6B 4FADA 3BLPX 1JZFA 3RKPA 3IDXL 2UXVA 3MRKB 1N6QH 2VLKB 1QR1B 1FA4A 5KVDH 3RFZC 2C9XA 2AJYL 4LK4A 2QFRA 5D7KE 4WNQB 2K6YA 1M7DB 1ZANH 3L1GA 2J6EH 1FFQA 1VGKA 4YZFE 3R7RA 3WHE1 2B39A 4M6OL 5DURD 4E41A 3EOTH 2APBA 3HPJA 1P53A 3ET9F 3IEAA 1MJ8L 4J3UA 4JG1L 5F3BA 1KJVB 5E24E 2ZAIA 1J7VR 2MCPL 3GYRA 2NQ3A 4JFEB 3LIZA 2CGRH 4LSQL 1RK7A 3CSYA 2O61B 4MXWH 1RIVH 3MX0A 2GFBA 1FDLH 4JQIL 4QCIB 1ID5I 4X7DC 1I8AA 2R23A 5J1TC 4XNAA 1TQCB 1FYTA 3BUTA 4EXKA 4OZIA 2ORBH 1YEJL 1IM3B 1HAUA 2CGYA 2F7PA 4UOJA 1XAKA 3UTQB 5ADPH 2VT0A 4JY5L 1S7WA 5IHWA 5JNYB 2OK0H 3VI4F 4Y5YA 5GRWA 1PJWA 4YMPA 2YRLA 2XA8L 1EUUA 4WJ5A 4GI8A 4NC0B 2JJVA 5E70A 5GRJH 3IRZA 1BAFH 1AGCA 2AXGB 2XV2A 5DO2D 1RZJH 1MWAA 5I0DA 3RTQD 2DLIA 3ME0B 3ZDYF 2EJ1A 4OB5L 4OLVH 2ADGB 3U30B 4KKZA 3QCTH 4H5SA 3VXOB 4TVSa 4XXWC 5IFHH 3EYUH 4EI5B 3ATDA 3QJRB 2WQSA 4A68A 4P5KA 1PU0A 5IW1B 3UO1L 3H54A 3HI6L 5TE4H 2JIXB 3RWEB 5FDWB 5D2NB 1IE4A 1PZAA 5LNGA 1X44A 3BAJA 4W9CC 5IQ9A 1NFIB 4NX0A 4KZDL 1YRKA 1HXMB 1OAZL 4Y7MA 2V33A 2WNKA 3Q6GH 3PNRB 1WFTA 4CMHB 5JHLA 2IAMC 4EI5C 1KJMA 1MEXL 3TS8A 2E9BA 3NPZB 2MH4A 4WIQA 1HYSC 3L9RA 5EN3A 3MV9B 1QFWH 3FQUA 3RTQB 4KKNA 3QUZB 3HTLX 3GIZL 3ULUF 3E8VA 5KVFL 4GEIA 2VUKA 3VD7A 1EMTH 1D5BB 4TN9A 35C8L 1E4XL 4ODWB 1E2WA 5EU6B 2CM6A 3O9WD 2WXRA 3C75A 2OCCB 4E42B 1WD9A 4RBPH 3NQIA 3ZE1B 3QPQC 2ED6A 4B96A 3I02A 5JXAL 4NKIH 1ZVYA 3TYGH 1HEZB 2C7UB 4M5ZL 4U05A 2HKFL 1YUKB 3F7PC 1UZ6E 3I6KA 3QCUL 5EC2A 4IHBA 5IB4B 3LEXA 2IAMA 1ND0B 1QZNA 3ZDZE 3QXUA 5L88L 4C4UA 3QJFB 5FUCC 5DQ9A 2BIOA 1A9EA 1NSNH 1B2YA 1IEBA 2WQVA 3PQYD 1CDJA 4GXFA 2QR0B 4PSPA 4PS3A 1J9CT 1OTSC 4LVOC 4BK5C 1BD2D 3HLKA 1DSFL 3NZUA 4ZO8A 3UZVB 4ZO9A 1IBBA 5KANG 3RRQA 3W0WD 2IDTA 4G42A 1IGCH 1TJHL 1YEFH 1X5IA 4JFDA 3VMNA 2CRIA 1MRCH 5IBUB 1XVSA 3V5HB 1IJNA 1QBLH 5DSCB 5D96B 4HV8B 1E7VA 3ELAT 1DYZA 5GGRY 3EJPA 4UQ2B 1NUGA 5C0GA 1WEJH 3MJWA 3PAZA 4LBAA 2CDGA 1FF5A 4LCVA 1WDAA 3MQIA 1Q9KB 2RMNA 3QCUH 4M3KB 1AOHA 1Y18A 2OMWA 1KCLA 1MCDA 2ZUXA 5MERA 3GUTA 1T03H 4PEEA 4XN7A 4PY7B 3CH8A 3WLBB 4Y4KC 3UC0L 5FYJU 2AVGA 3LXCA 5DJ2B 4NWTL 2ZCKH 3HMXA 3R06B 4NZFA 2PW1B 3D34A 1T5WB 1X5XA 1U6AH 4HUXB 3MV9E 1KLFA 2EEBA 4G7VH 4K5PA 3RJOA 3FMGL 4MZ3A 2Y6SC 2VCOA 2ZXQA 3KWVA 4MSWA 1BQHB 5JA9A 3EUUA 4CADB 5J1AB 5FECA 1DQDH 3EFFB 1WWBX 1JZ6A 1KJ2H 4RFEB 4PJ5A 4AEHH 3B43A 4FQIL 3V4VB 5PCYA 3KS0H 1D5MA 4ZPVB 2MTAA 4TUOB 5AZ2L 2HX7A 3AROA 5FWQA 1YYMH 5BZWB 1UQSA 3S34H 4BFBD 1G0XA 2PN5A 3RUGF 4KO5A 1R5IA 4IGBB 3WE6A 4XOAA 5C07B 4OM0L 1ZLVK 1C8QA 3CXHK 4AGNA 3L3KA 3VRLE 2CK0H 4LDLB 5C09A 3DPBB 3LIZH 4LQFH 1L7TH 2K9FB 3RX5A 3T4YB 4UNVA 3JUYA 4A7TA 1IUZA 2A9CA 3JZYA 4LIQE 4FQJH 2J55A 3OR7A 4JM2D 4EBQH 4L3EE 3PQYA 1MJUL 3D05A 5D7JA 3SDYL 2HUHA 1T5WA 4HUXA 2ZWKA 2G3ZA 1AXTH 2W0FA 3I6LE 4CUCA 4ATWA 3MRJA 4H7VA 4P0DA 3KLHD 2XWBB 4Z7UB 3N1FC 4NRYB 2R1YA 5DZVA 3KHQA 4TNVK 3VXRA 3E8UH 2XVGA 4F2MB 2IOMA 3UJTH 3TEUA 4L37B 4PGZA 4FULA 1BZ7B 4ZMLA 5CN3A 3TIDB 4JN2B 4W9DC 4CN6A 2P5WE 2FDBP 2WXLA 1EVUA 3BSZA 2H6UA 1W72L 1GHFL 1OZUA 2QGBA 2YMTA 3MVSA 5LVEA 3U4BL 3HI6H 3ZK0A 2NY5H 3V0IA 4A66A 2N7AA 3GSRA 4R2GD 3NIGE 2GK2A 3NIDB 2RTTA 3IDGA 2VMJA 3BISA 1JSYA 5I1IH 2QVIA 2ZWNA 3L7EA 3QDME 4QT5A 3WNOA 1MNNA 2YGNA 2ZUTA 4GRLC 1HKLL 4S1RH 4L3CB 3FF7A 5E2WH 1CXEA 2CCLA 4U0RC 2C3VA 3J07A 3M88A 2LTQB 4PM1A 3CLFL 4WFGD 2NNCA 3HMXL 1MW2A 1LWJA 4G7YH 2F1BA 1E8YA 4YXKH 3C8KA 1P69B 1QFOA 2F54D 2VDKH 3V4LA 4OBSA 2DJUA 4K9EC 3UTOA 1UB6B 1MIML 4FKKA 4NQED 3N55A 1D2PA 2IDFA 3RZCB 1A7BA 3IDMA 3MRBA 3C6SB 1Q1JL 3LHPL 1T6BX 3UBHA 3T8XB 3UZEC 4FNUA 4JVPA 4ANVA 2EDXA 3QNXA 5JOPD 2Z34A 4AL8L 1KB5B 3L2LA 4B5ZA 3TV3H 1NGQL 3M1BB 4GUQA 3SY6A 4IKJA 4AYFB 3K6NA 5B3JE 4NGHH 4OIIH 3II2A 4W9JC 3T09A 4N6RA 4JO1L 4K4KA 2FSEB 4KH2A 5FB8A 4UQDA 2FD6L 2PW2A 2QJDA 3RVVD 3G6DL 1BVNT 3IDIB 1SY6A 4AZ8A 5TF1H 4EN3C 1AR1B 4KTDL 4U49A 4AYID 1D5ZA 1ODUA 3BESR 3UYPB 2AJSL 1VGEH 1MFEH 1QLRA 3WTYA 2V5SA 4G9FB 4MFHA 3O8XB 1KELL 2E9JA 2X9ZA 4KDTC 4DT2A 2VN3A 2FK9A 4BQ9A 1E50A 1RIUH 3AADB 1SF3A 3IU3B 2JI1A 4JFHD 1NCBH 2IQ9H 3AB0C 4NC2B 3QUZD 5A2FA 4FF9A 2IH8A 2UZYB 4MB4A 4TQIA 5HHNB 1PD6A 5E9DA 1ZSDA 1OANA 2WLIA 3GDBA 3ULVD 4UANA 3C5JB 4Q58C 3DBXA 3HZYB 3V7MA 1X9LA 1DUYB 5I75C 5B1AB 3GBEA 5KJ7E 4O02B 5FYKL 1NGPH 2A1WL 3VXMA 1XCXA 3E2HC 4JFSA 4UINH 2WHVA 3GSOB 5I8EA 3K2UL 5CD3A 3FYEB 2AXHA 1K72A 1CFTB 2DW5A 2X4PA 3MXVH 4J3XA 4ZPTA 2NTSP 3BDYL 4NSKA 4LSDA 3K4ZA 1HXYA 2EE6A 4OIBA 4UT6L 4DW2H 3VD1A 2LE9A 1DBJH 1TZ8A 5AUMB 4BV1A 4LCWB 5CKAA 3GHBH 4TSCH 3O3AA 4Q4EA 5DUMH 3HE7C 5KBLA 2XBDA 3PWUA 3UYRL 1RIUL 3L3IB 2A9BA 5I1EH 5E6ZA 1KCUL 3T0BA 5K9QI 1AQHA 1H3VA 2CKBB 5LBVA 1AAJA 3HG0A 5I1LB 1TZIA 3ECUA 3TT3L 1CK0H 4L1BA 2QLYA 3CU1A 1HEHC 3DDGA 3QUZA 5EBWB 5H94A 2DTML 3WJMB 4R6UA 4NCDA 1UWGH 5CN2A 2PP7A 4PY8I 2QELA 4OLEA 4APQA 4F7CB 3OGOE 4MA7L 2CR3A 3BAEL 3BX7C 4MCMA 1UZ8B 3FQWB 3FU3A 4QHMA 3UC2A 4EKJA 1RUAH 2UZXA 3B2PA 1NEUA 1ZLVH 3BD5A 3MCKA 5ES4B 1U21A 1KGYE 1FLRH 2QQQA 4A38A 4ZNCD 1P5VB 1YMMD 1JXJA 2GTWA 2ITEA 3STBA 2E6QA 5L4IA 1A7OH 3CHSA 4YHKH 1N0LA 1NFAA 2FH8A 4FLOA 1AP2A 4YWGL 4E9YA 3UG5A 5C0AE 2BW5A 2EDWA 2A2QT 3BFWA 5DZLA 5AUMA 4PJCF 3FFOA 3IGUA 2B77A 1I1CA 4A7QA 4G70B 3KPOB 4R4BB 1AG0A 3SE8L 1RJZA 4FX5A 3GMPB 4TUKH 5TQ2H 3UO8B 3EJRA 1C16A 1DANT 1N6UA 2WZPA 3FZUD 3KLSA 4DVBB 1WZ1H 1LP9E 4N24A 5BW7C 3PGFH 3MRCB 3KPQA 2FBRA 2OMYB 3EFDL 3ILEA 5I82A 4TUKL 2H32H 3U48A 5I76B 3VJ6B 1OTUD 1MFDL 2JQMA 3S48A 1KCRH 3US9A 4F7CA 2NQDA 3L3HA 1TQSA 5I6XB 3TBVB 1EAPA 3QULB 2EDNA 5E23A 2VC2B 2C1OA 2EYRA 3ILDA 3B7TA 1FLTX 3ZTNH 3LIUA 4ODVL 1BEXA 1UUNA 4BFKA 1LO2L 4YSTA 2X4QA 4XMZA 1JZIA 5F3BB 1MVUA 1VFBB 2WBXA 1HH9B 4XVUC 4PJ5D 4XE5B 3QK0A 2CALA 3BKCH 1C08A 2BLFA 3VAEA 1RK1A 4GPVA 1E5BA 2JH2A 4PJ8D 4V1DD 4HUVA 4GRWH 4BZ2A 2P80D 5GRXG 4AQZA 5BVPL 4FQCH 3SQBB 1RJZB 2QPSA 4FS0A 1GGYA 1E67A 4DGIL 2QZQA 1E5CA 2CO2A 3K5SA 4HXAH 3J7HA 3BVVA 1VACB 4PRID 1K6QL 1YEEH 1RPKA 4RMQA 1CE6B 2FEDC 2NY4C 4B5EA 3OKDB 3TO4A 1M2VB 4NQXA 4EDXB 4XWOD 5FKPA 4XN2A 3DOSA 4PW3A 1KCSH 1EPFA 4TLKA 3BWZA 3QEGL 2VLJB 2EDJA 2PKDA 1NFDB 2AQPA 2WO4A 3GXUB 3GIZH 3P4LA 3H9SB 1LO2H 1S7SB 3GHBL 4TSCL 3UAJD 3X17A 5D7JD 2G9HA 3B9EA 4U6YA 4WHYH 5DWUL 5AW4B 1BQKA 5EEUA 3ZHDA 5GSVA 1Q0YL 4KO6A 2K6ZA 3VGAB 4H44C 1YC7A 4KK9D 5KYUB 4D0BB 4PJGA 4EI5A 1T6WA 5D6CA 2R7EA 2PLTA 4H8UA 4BZ1A 1X9RA 4YL9A 1O7DC 2VB5A 2HFEA 1V8HA 1DLFH 4Z7UA 1GSKA 4JRXB 1UH2A 5T3XL 4N6QA 4ZS6C 1GPOH 4F7PB 5IB5A 3CVIH 4X7SH 4WDIB 1WH0A 4Y2LA 4Q97A 2UX6A 4XC1L 3SBPA 4X6DE 2HH0L 2IJ0C 1EAOA 1OGAB 1JHLL 1R5VA 2CJUH 5MENB 3W56A 4F8NA 3G9VA 4HLEA 2ZSWA 4U6XA 3MO1A 2Z93B 3UC0H 5E2TL 1JNHB 3V0WH 1U36A 5L8JB 4P4KA 1BPVA 5I19L 1MFEL 2C9SA 1HC1A 1XCQB 3BZ5A 3US0A 1J9SA 3QHTC 2AJXH 3GMOA 3U4KA 1YY8B 3O2WL 1KB9J 3UTZA 3CSGA 2OYLA 3FB5A 2WPGA 3P0YL 3PUUA 4PRPB 5E94B 3A67L 3TEYA 4TOYL 2PUQT 5JOEA 3I3DA 4JREC 3GZOA 4K7FB 4ODHL 1SM3H 3LB6D 1TJHH 1X7QB 4DQOH 4Z77A 2BMKB 3EYOA 1K9TA 2PXYB 1N64H 4HZ1A 4G8FB 4XPGH 2GBAA 1YA5A 1IBHA 1WHPA 3IAQA 3BKJH 3F6IA 1U3HD 2J73A 4Y9FA 4X6EA 5E2VL 3BH9A 5DRZB 2JI2A 1QWNA 3CVCA 3RVTC 4PW4A 3QJHB 2R29A 4DZ8A 1BQLL 1ZK9A 4PJ7B 5GXBB 4JGNA 4P23C 3FCSB 5SWZA 2D9QB 2FHCA 4ZAKB 4JZNB 1D7BA 3BKJL 4XN4A 4LSSH 2MOGA 4HF5H 1T3FB 4AEIL 3DURB 3G5WA 4XZ4A 5J56B 3RPIB 4F7KA 1HHHA 4UU9A 1QQDA 4D9QD 3AUWB 4O58L 1RERA 2WLZA 2ZWZA 1WZLA 4GKNA 4IYKA 4WEBL 1I8IA 1S9VB 1ACYL 3SQRA 3UZQA 1L7IL 3D0LB 5A2LH 4OLZL 4F37F 4B9GA 3DO4A 5H2BB 5DDHB 1ROCA 4ICWA 3C5ZD 5EN2B 2C34A 2XZCL 1UXWB 1PNDA 4PV9B 2BSTB 1IC4H 3ETBF 1JNNL 2JB5H 1FFTB 2W0PA 4UTBA 3DO7A 5KN5A 2W95A 3HE6A 4PWEA 4I2XB 5DA4A 3THMH 1A4CA 1W16A 2ALWA 4HMEA 1UA3A 3REWB 3J8F7 4KK5D 5FAAA 1I53A 4XXDB 5A3IC 4TVUA 1G7JB 1UEYA 5C08A 1KJ2B 5IF0A 2WOYA 4JGJA 4WFED 5T3ZL 3NJJA 5GISL 4LL4A 5DFTA 5L8KB 4LKXB 2AQ3A 2BY0A 3RWJA 4LESA 1UZ6F 1JRHI 3PWLA 3ZE2E 3VFTB 5MHSD 2DB8A 2MRYA 5HI4D 1H5BB 2A73A 3LMJL 4V2CB 5CEYA 2XWDA 3Q8AA 2HJFA 2NCMA 1QQDB 4X5WB 4A2HA 3C5ZB 1J0YA 3VGFA 2EVJA 1QLEL 3T71A 2EVIA 1AQ8A 3DX8A 1WGVA 2V37A 4PG9A 4OM0H 2DQTH 3EOYG 1IC4L 2QPDB 4LLMB 3ZKMD 3GLEA 2NLJB 4M48H 2Q3AA 1PZUB 2PR4H 2OBGA 3RGBA 5HYJB 2R51A 4FP8L 1BM3H 5DUPL 3VSQA 1VSCA 43C9A 4NDMA 4OLXH 4PRAA 2OMNA 3VH8B 2OMVA 2J8HA 2YAHA 4FLSA 5GS2H 4YN3A 5JIMA 2P24A 2WMPA 2P48B 3EJCA 4LARH 3GHPA 4LRIC 3U0PB 4PD4K 1NCGA 4IIQA 4NQUA 3HHMA 3UGUA 3EF4A 3T3PF 2UX7A 3VYNA 4FRWA 1TFHA 3UMTA 2CO4A 2F1AA 3HN3A 2DWXA 1D5BA 4QAWA 3EJTA 4WEMB 1BXXA 1IU1A 2P5EB 5EZIL 5AW9B 3KG5A 5C0DB 3EYQD 3N42B 2VZSA 3RTLA 2WKLA 2IH1A 1MCKA 3B9VA 2HCZX 3ETTA 3NEEA 4XNUH 4PJGE 4NUGH 1ZAGA 4FG6C 5CEXB 2Z3FA 1FNHA 3FT4A 5CU5A 4BINA 5HDQH 4KHTL 1YJDC 3BAYA 4OF6A 4XBPB 1QTYT 4NCC1 9PCYA 1XL6A 4N2NA 4YBQD 3OAZH 3AQZA 4N5UA 5D2LB 4H1LG 5AW1B 3RP1A 1SOXA 1QFWM 4M8QB 3WFDH 2WN2A 3AQDA 4M1GL 2FO8A 3WEMA 4HD9A 1KTCA 2ZXDA 2E0PA 4KJPC 1HHKA 5EF0A 4MMZA 5I16B 2D7QA 2ZP0T 1CI3M 2FQDA 2Z91A 3BCDA 4HWNA 4Y16A 5DYFA 3L3JB 2CBOA 3ARPA 4FFWD 3VGEA 4YPGB 5E1QA 5TF0A 4DP5X 3QDAA 1NCJA 1BFVH 2OMYA 3QW9A 4HJTA 4XCNA 3TC9A 4YDZA 1DQDL 3OF6D 1DVZA 2HVBA 2WLKA 3E9UA 3LRHA 4FQPA 2HSIA 4XT1C 4XVSL 4AYSA 3MXWL 2VERN 4PUBL 2BIHA 1FZJB 5E8PB 3OV6A 5AG8A 5F9OL 3ZN6A 1OPGL 5C6WH 1TFPA 3CBJB 1YDPA 4A7GA 1OP9A 4QRRD 2EXYD 3OR6A 3Q2VA 1U3JA 3SZ6A 2Y1YA 3GI8L 3LKSA 1NAMH 2D31B 2VLKA 1GZPB 3NP4A 4J3OF 1ZLUH 4LOEA 5DMKB 1DUYA 1SLVA 1F0LA 5ESVB 4EN2A 2DQDL 3S3BB 3K4DA 3LPPA 3OWRA 1AR2A 1ZVSB 2WLYA 1MFVA 4U0QB 1UHVA 4PMEA 2P49B 1NIFA 2O5YH 3UBXA 4FFZL 3TH2T 1Z5LA 1RZ7L 5IT2L 4UOW1 3H9ZA 4FXTA 4JFXA 4MJIA 5KUMA 1YNTA 5E56A 3TJHC 3TEZA 1IVTA 3PS6A 4OGAD 3VXQA 1KGJA 2RCSL 4OFQA 3C5SB 3JVGC 5T1LB 1MH5A 1RZKC 4FG4A 4HJGB 5FV2A 1UA7A 4YXHL 3PHOB 4MCZB 5ISZE 1R24A 5DF0A 3MOQA 2ETWA 2YAOA 4NHUA 3OLGA 4WWOA 4XTRD 1NEPA 3WLBA 4H8VA 5EBWA 2L04A 1BWWA 1MI5A 3PJNA 4XP5L 2AK4D 2JCCE 5T1DH 4P23B 2V2TA 4M7JL 3SDDB 4FDWA 2G3MA 2D4FA 4X4XB 1EEYB 2WY3B 4NXSA 4N3TA 3K91A 3OR7B 1RIHL 1MY7A 2BIQA 5K9QG 4QRPE 1AQKL 1GMIA 4XC3L 5C09D 2BERA 4P07A 4ODUB 3JWOL 3CH1B 4P5TB 3EFFA 5F71A 1QBMH 1IGML 5AKVA 4Z0XA 3AWGA 4Y1AD 2DQHH 3VRIA 1G7LA 2F5AH 4O51A 1CFSB 2Z8RA 4O5LH 3KR3H 1BPLB 4XOCA 4U1HB 1TG8A 3TX4A 1JWMB 1GCFA 5AW6B 3O3EB 4Q52A 1JL8A 2ZYHA 2JJSA 4ZMWA 3TBTA 2A99A 3BZ4B 3LRLA 3TXAA 4OVUA 2AK4B 2B16A 4WWKD 5CILL 3C12A 5E99L 3SPHA 4WTWA 2VL5B 5IR1B 4YDJA 4E9SA 4S0SD 4RWYL 2HLEB 1URIA 2DQJH 2E59A 2DL2A 3FNKA 4KAQH 4R7NB 4YSOA 4KJYB 2A4ZA 5B1CA 1QEXA 3ME0A 2EIKB 3N91A 5D9SB 3R0MA 3RHWF 32C2B 2WLHA 3VXOA 4WW1B 1KWGA 3QORC 1VCBC 2HLAB 4X5XB 2GJRA 2DQJL 2K9UA 1KEMH 2ZUWA 4OGXL 3N9GH 1OAUH 5I0VA 4EQ2A 3T0ED 4KUCF 1NCCL 4B9ZA 3MLYH 4RMUA 5EU6D 2B1AH 2TRHA 3RFZA 2NY7L 3X14B 4QD2E 2DICA 3NJKA 1UKSA 4GRLD 3D85A 1N12A 1ZT4B 4YSRA 4W9ZA 4AW7A 4YQXL 1WAAE 1OCWH 3L48A 3UJTL 4TUUA 4LP4A 4XP4H 1O9ZA 2JKLA 1J5DA 4X6CB 3ZZ1A 3M1OA 5BXFB 4YGAB 4OF7A 1G9NH 2FYVA 1IRAY 4TKWA 3WS3B 2RR3A 1EEQA 2EIJB 1RK0B 3FO2B 4ODWA 2XWJB 5C0GB 4HHAB 1BGXL 1KENL 1DQJA 5L7XL 5HPMA 1MCOL 5JXAH 2YAFA 4JQXA 3VH8G 1BBDH 5EZPA 4X9GA 3K6OA 3TF4A 4G9FA 4U6VL 3SY0B 2APXA 4IRJD 3IVKA 2EVHA 1J8HD 4A2GA 5CCHE 4W68A 4YIQA 2VDMB 3MRPA 4YXHH 5E08H 2FIKA 2HJLA 1LK2B 2D8KA 3I9GL 5D6CB 4UMGA 4H2CA 4J2QA 3TBSB 4MDJA 5C0RH 1RP9A 4KKBC 2ZTBA 3PWJB 3Q7JA 1B0GB 3VXNB 2K45A 1OP3K 2H0JA 1B4TA 4AYFA 4AJ0A 2Q6WA 1NLBL 5FDYA 1IIIA 1Z5YD 2VQ1B 3MGAA 1G43A 3HUJA 2WQ8A 4L4TB 2FB4L 1KGIA 3VWJA 3VDBA 4H88H 1XF5A 2ZX7A 4F20A 2B2XH 1T2QH 4M7LH 4UAOC 4FA8A 4J39A 1XF2B 3CXFA 3DOSB 2FNWA 5D70H 3QEUB 5C0IB 3A24A 2Z0BA 4APXA 2RBLA 3K6SA 4G8GA 2X9WA 4TVPD 4JRXE 3STLA 4L4VB 4JM4H 1ZLUK 2ODHA 4P3DA 5CEZE 1HQ4B 2KERA 2BHZA 2R4RH 3GGWB 4HLJA 4KV5E 3VFRB 3BZDA 3B9KC 2ZOTA 2ENQA 1XIWD 4FFZH 5I30L 4Y1AE 4N86A 5LXVA 3BKML 2VLRB 5E5LA 5EU5A 3E80A 1TUPA 4JO4H 3NSCA 1RULH 4L1DA 4Z9KB 1RJYA 2CJTA 3IAPA 2W0LA 4X7TA 2X05A 4QRPD 4ALAC 1YN7A 1CD1A 2CLRB 2Y4SA 1KXVA 3DV6B 1B3IA 2PO6C 4NQSA 1A6UL 4APQB 5HYQB 3I6GB 5IB1B 3K8KA 1N7MH 2N0KA 4OCMC 4FN0A 3BIAX 1YNLL 4KXCA 5GRVK 2GJ6E 5MENE 3FXIC 3GMRA 3R19A 3MRQA 3MYJA 2CK2A 1BV8A 1CU4L 2YD0A 2ZSWB 5CCKH 2ZZUT 4J3BA 3L7FA 5DD0L 4GG6E 1D6VH 3A67H 1REIA 3FULA 1O6SA 4GAJL 1F13A 3T0EA 2ZT9C 4FJ6A 4OSUH 2WYTA 5JIPA 1JPGB 1GSMA 3SCMD 3WJLA 3GPEA 3I74A 4Z7NE 1E6OH 3UOAB 4RH4A 4KUZL 4PTTB 2EKSB 5C0EB 3OPZH 1EEUA 4PRPD 1QSFB 1IFGA 3O6ML 4ZNEA 3IDGB 5IVNA 3QC6X 3MBEB 2EADA 1N5AA 4PJEB 5I26A 5CIPH 3QXVA 3WLWC 2E56A 2JVUA 5GRVL 2VUYA 4YS4A 4PV8B 3QUYA 4GSDL 3MRFB 1TSHA 1KCUH 5CILH 4M6MH 1BXAA 2ZCLL 1U3YA 4PLNC 2Y72A 3ABLB 4PV9A 1I8LA 2N1TE 3UBXG 4F9LA 3S97C 6FABL 5DZNA 3P77B 2DDQH 3KPRB 1EJOH 3ILQC 4F58L 2DWEB 3TIDA 3BWAA 2VXSL 2ZG2A 4LEXL 4IGBC 2QV4A 4OVVA 5F88B 1W72H 2H47C 2Y1VA 2KYIA 2R29L 3D50A 3UTSE 1A22B 3MACH 1QBML 3WY1A 1KB9K 1HCZA 5FYLD 3OHXA 4RQQB 3SQOH 1KPVB 2F8XC 5HVFB 3GO1L 4AKOA 5AQ0A 5EPMA 4ABQA 4RAHA 1OTUC 3SDAA 2ED9A 2IFGA 3MUGA 3F83A 1KFAH 4NO2B 4JFOA 2JWYA 3OF6A 4OD1H 3TFKC 4JFPB 4RAVB 4LE8A 1SJVA 4WSGA 5CP3H 4IU2B 4JHZA 1PKQB 1FNSH 2QDWA 3HG4A 3MBEA 1VACA 1CTNA 4NN5C 4UT9L 4NQCE 1DR9A 3FUMA 5F7UA 1MI5D 4N9GA 2CDEB 1KTJA 2P47B 4N0FB 2BIMA 2H32B 5HGDB 2H9GA 3OJVC 4FQCL 5CJ8A 4Y5VA 43CAB 3U0PA 3RZCA 4MD4A 4AVJA 1DO6A 3A22A 2XVBA 4FE9A 5C70A 3LSOA 1Y0LA 2RJMA 2JELL 3VRJB 4R5TA 1BVLB 2V2WB 4E9LA 2RAMA 3O41A 3AACA 3IRCA 4Q0XL 5FGCE 4JKPL 2R2BA 3HN5A 1TNNA 2NY4D 4P3CL 5ANHA 2Y69B 2EZ0C 3T4AA 1TEGA 3DRQA 3O3UN 1PNCA 4RGOH 1O5PA 2GI0A 3QHZL 4AQAB 4AG4H 4U1KA 1CGSL 2MMXA 3MNMA 3GJFB 6TAAA 1ETZA 1H5BA 2A73B 4M93C 4HWBA 1LEKA 2N4IA 2OXHA 3D06A 3LHPH 2XC8A 4ZX5A 2KZKA 3BEWB 2E7DA 5HHMB 4DKAA 1EHKB 2YEZA 2DF3A 4XNXH 5TGBB 5HYJD 4NWUL 4YC2B 5FO9B 1JYVA 1QVOB 1FO0L 1J8HE 1PZ2A 2JXMB 3IJ8A 3PWNA 5HJDA 4D0DB 4FZ8L 4ONGH 1KOAA 5C9JA 5JIKA 3ZE0F 2X4NA 4PH8A 1JI2A 4Q9BA 2L8AA 2A9MH 3W37A 2HN7B 4JZJC 1A14L 1LNUB 1E6OL 1N3NB 4XPAL 4LU5L 4XP9H 4JO3H 1FGVL 4Z7QF 1BP3B 4PJIE 3P4MB 1BVLA 2V2WA 4PS4L 4LAQL 4MA8L 5CGBA 1LO3H 3O6LH 5AVQB 4Y2DC 5FGRA 1Q9OA 4HT1L 5GSRB 1EZVX 3QYMA 1S9WB 5DMJB 3NFNB 1GGIL 3RBGA 3OWEA 5M7QA 3KLDA 5AVYB 2QKSA 3V0VB 5FX3A 2CO6B 1JZ3A 4DVRL 4Z7WF 5I8CA 1IC5L 1NLBH 1G6RL 1OGAE 4HIJA 1KTDB 3HB3C 4JFZH 3SDCA 4LSTH 3ZE0B 5I24A 5JQ6H 2HFFA 1AP2B 2DS4A 3HIZA 1CGYA 4NUQA 1H3UA 1XGRA 4M03A 3L3IA 3MO1B 5T3XH 2YD1A 4DIXA 3HZKB 4DZ8B 1S8DA 1XZWA 2GEEA 4NBZB 3CVIL 2BCMA 3GTNA 1H8LA 4YDLB 1WT5A 3IU4H 1I7UB 5I19H 4GIAA 4ZQKA 4WTZA 3NCMA 4Y4HA 4KQ3L 3GJEA 4U6HA 3LZFH 2F1EA 5JA8B 2L7UA 3THML 4KGJA 2EABA 3C5XA 3ECBA 5C07E 3F5WB 3CDGB 3MNDA 4HWEL 3U0TB 2YFNA 3M17A 3PL6C 3UYRH 1KIPB 1TO4A 4HLZG 5AAWC 1B0IA 3QIWC 4K5OA 4JMXA 4GJTB 1CXHA 1Z32X 5FM4A 5FYKU 1T0PB 2NOYA 4ZFFA 2VLRD 4KWUA 4H8WH 3VFSB 4BZYA 3QEQE 3QUXC 1NANI 3BZEA 4AEHL 1RU9L 1J5OL 3DUSA 1CLYL 5EG6C 1A0QH 3C60D 2IANB 4GG8A 3IU4L 4JPQA 4ODUA 3TASA 4XBGA 3X12B 4QIRA 3FS9A 4DNLA 1BYNA 3GMPA 3FDWA 4IMKC 5D8JH 2RA1A 5KJRL 4MX7B 4PJHA 1ZMYA 4GAJH 2ZP9A 4NKDA 5HJBA 3CDZB 4PB0L 3TL5A 3GSRB 1UJ3C 2K8MA 4YFEA 2DBJA 1I9RL 3RWJB 3PHQA 4OJFL 4AUUA 1F41A 1QUPA 5IVZA 3J27A 2YA2A 2HXAA 2RD0A 1TZGH 3APCA 3HE7A 3BP7B 4H0IA 4QHUB 3X1FA 1JTOA 3L95B 3STLB 3CLEL 3V0JA 2EUVA 4AYEC 1CFBA 3CFDB 3OGCB 1NL0L 1ODAA 1JPTL 5FW7A 1NH6A 3VFWA 4L8CA 4G59C 1MAJA 4X6FB 2XLLA 3Q3GB 2PCFA 4C54A 5A3ID 5DQJA 2OK0L 3ETSA 2B59B 1IGIH 5B1BB 5GGVH 3ZKXC 1S3KL 3ML8A 3NZSA 3S2CA 5KSVA 4E0RA 3NIDF 4FL4B 1HK6A 2CA4A 2NRDA 4U0RB 5IIEB 4PLOB 2ERJB 3PFUA 3OLEA 4ELME 32C2A 1G7IA 2CAKA 1QHQA 2ZSVB 2B5IB 5DK2B 4RGND 1YEWA 1T04A 5A7BA 1N8ZB 2A9ML 2BVEA 4X7TB 4N8CH 1NDGB 5E4IA 3OXSA 5IQ7L 5JW4R 2ZYSA 2YOCA 4H1LH 3NJMA 1UXLA 4X8JA 5E7FA 4FFVD 3S0PA 1XD1A 5FCSH 5E4EB 3AY4A 3DBXB 3HZYA 4RDBA 3JSSA 5HGAA 2GJJA 5I71C 4PJHB 3B2DC 2IC2A 2FJGA 3D39D 2WXPA 1NANH 3EJYC 4KK6D 5EOCL 3ZKSD 3LXUX 2DM3A 2WGXA 3MROB 4I4WA 5C2UB 4OJYA 5HD8C 1QG3A 1S5IL 3HCVA 4NQDE 5DI8A 2GITA 3DSNB 4OJAA 5ID0A 3HG1A 1L9RA 4GG6F 3T08A 1CMOA 1MCPL 5E0QA 1FGNH 1VPOH 1E4XH 5E8DL 1ZJBA 3VI4A 1T1ZA 2BRRL 2YIHA 3Q8FA 1PQZA 1VADA 5D9SA 3LQMA 4PJFE 4CKQA 5BW7A 2Z4TA 3IMRA 5D4HA 4UIKH 3KD4A 2QV2A 3VGAC 2AI0L 3WENA 3SD5A 3EDDA 2AABL 4PWKA 1U3HB 1UG9A 2UZIH 4NS0A 1JP5A 3IN2A 1L4IA 4NT6A 1JPFA 3LXBA 1OTTC 4PJ9D 3RVWC 3AM8A 4M7LL 2NY0C 2LVCA 4P99A 3DVGA 3D3VA 1MRDL 2BVPB 1EHLH 2NDGA 4J4PD 2YAQA 2IWKA 3KNBA 5DZPA 3AY2A 4F7MA 5KS9B 2R39A 1L0PA 2R2EA 4NYLB 1JHTA 1QA9B 3CZUB 3U9WA 3NABL 2EXWD 2FGWL 3ZO0A 2Z93A 1A6WH 3VB8A 3D4YA 2P8PA 1GVIA 1VESA 4ODBD 4Y2OA 1MXGA 4YLCA 1S5HB 3IWUA 1BVZA 1I9IH 4P4RA 3CHRA 4PVLA 2OW7A 4JFPA 2BFVL 2V4LA 1MSPA 3GMQA 4IDLA 2X6CA 3ECQA 4WHTB 3LPWA 4B0MM 1DVFB 1XX9C 2F5BL 4YPGA 4EZJA 2GSIB 2VDOB 2I5YH 2XZAL 4XNMB 1P7BA 2N59A 4M1DL 1AGBA 3F2LA 3U7YL 1T0OA 2WWMD 3RNKB 4ZUWA 2RH0A 2YD7A 3PWPD 4JLRA 3TPUA 2HJLB 3UAJA 4OCXL 1QR1A 4LHUA 1KF9B 2I9LB 3MHZA 1VFAB 5IBLD 1NGPL 4KHXH 4WK2B 3N50A 1A21A 2WXMA 4YZFF 1YG9A 1EGJA 1A8ZA 1KULA 2CMRL 3ORJA 3QCVH 2V2TB 1IAIL 1U93B 4UT6A 4HKJA 1I1FA 3IJEB 1JTTA 2ARWA 4XNZB 4NUPA 1DQTA 4XGZB 2DQCH 1A4KB 1P7KA 5DEGA 4Z78B 3KCWA 4FD0A 3GTTA 3CHOA 4HZLA 2GFBB 5IF0B 4HWZB 4MAYD 4YX2H 2C9AA 1UA6H 1CDYA 4G71B 1JERA 4C59B 4KVNH 3VXQB 5C3LD 4HJSA 1BVKA 4NN7C 3OKOB 3D0LA 2VW6A 2DMHA 1MDTA 3OZLA 5EC1A 2IXQB 2PWFA 4FNLL 1RZ8B 1KJMB 4Y4FD 1ZIBA 3MLRH 3VG9C 2EDQA 2XPYA 4MBRA 5ANMA 2CKBL 3AW5A 4XP6L 1F4AA 1P4IL 4BQ6A 3ASOB 5EZOL 2I24N 5F0LB 3ROLB 2LT9A 5ANME 2Z31A 2Q5BA 3EOBA 2JQZA 2DPKA 3AUVA 4JMNA 2B9BA 4QY8A 4PV8A 3NRPA 4I2XA 2VUOA 3KR3L 5CXPA 2BSDA 4HQQL 5I5RA 3I9AA 3KLAA 1E4XI 1JN6A 1PW3A 3QIUB 3WN5C 4DCQA 5FXCH 2YGVA 4FABH 1KNOB 3A21A 3LZOA 3FRUA 1CLVA 2WTRB 4PJIF 3N1MC 4BUQA 4Z8FH 3MUUA 2OSLB 3Q6FA 1GOHA 4QTFA 1BLNB 3NAAL 4I1NB 2B0SL 2ODIA 3ZOAA 4LPCA 1WO2A 5DHEA 1RIHH 3PE9A 3OKKA 3SEPA 3UROR 2YPKB 1KPVA 1EHLL 4K94C 5D1ZI 4JGUA 4KJQC 2PPCA 4Z0BL 4Y4HC 2X6UA 4DN4L 2XT1B 4M8QA 4AC2A 4F58H 5EU4B 3VD4A 1VFOA 3WBDA 2VL5A 3OAUH 1RPQA 5AW8B 4QYAA 5DJ6B 3BUBA 2BNRD 4D7BA 1CR9H 1WFUA 3H9SA 3WS6A 3R1GH 5E5UB 2DQGL 1UGKA 3JWNH 4E42A 2ZAHA 3VD3A 5KTEL 4OT1L 1I7ZA 3A0OA 1JBJA 2IPUG 1FGNL 1VPOL 3ZSSA 5IHBA 1IC0A 4NO0D 2FYYA 5AYQA 5HYIA 4TRPH 5MERB 4X9IA 2WINA 4JFWA 4RIRA 2PCPB 2XZQH 1SN2A 3CN0A 3E6HB 3EYSL 2ZXAA 2W81C 3RURA 4N0CD 3RVXC 3FB8A 3WXVL 1SDAB 4TXVB 1OQXA 4K3HA 4BSJA 1KLFB 3V4UH 4GUOA 1E42A 1SMDA 3SGEI 4J6RH 4YBHA 1OF2A 3V2AR 3SQOL 3CZLA 4XPHH 4YDIL 5TF1L 2ATKB 1OARL 4NZTL 1DJIA 1N9PA 4X4ME 1RMFH 3TJEH 1RZJC 4JFDB 3O4LD 4CU8A 4RAVA 1XGTA 4FFTA 3QFJD 5IBTH 4ZFGH 3H3KA 4RFEA 1UJ3A 1QLFB 1JNHA 2SODB 3GIVA 2OL3L 2R83A 1D5MB 1EGJL 1NZRA 2IDUA 4V11A 4ZPVA 4IK7A 3MNWA 5GGSB 1DJHA 2UY7B 4NO0B 5F9DC 3S3CB 1I8KB 2OCJA 2VKXA 3QIBB 1QSED 4KKBD 1JS4A 4PJBA 1XMWA 3QEHB 5GJTL 2HLFC 5SV4A 1ANUA 1CYXA 3GSWA 5L2KB 1CT8A 2K0RA 3HNSL 5JHDA 4ICXA 4WK0B 4DAGL 4W4OC 5JNYA 1N3NA 3BE1H 4ISVA 5E6IC 3WD5H 1O6VA 2OMZB 2N01B 5GRUH 5GJTH 3HRZB 3PLYA 4ODXA 4OCYL 2A6DB 1XSJA 1QBLL 4LHUD 3TN0C 3DX3A 6CGTA 2VYRE 5CSZA 4X7FC 5LLIC 3HPLA 3MV7E 4QKTA 4PJ5E 3VO0A 4H5SB 1YUHA 4P2QE 2DMCA 3BQUA 2FX7L 3MRNB 3F00A 3GK8L 3KYOB 4PV1C 1BOYA 5B4MD 3UJJH 1KBKA 3DXAA 4PVBA 5AKSA 3H6JA 2P7TA 5D7LB 3GIVB 5JQHC 3LPGA 3P4NA 3V4PH 3WNIA 4XMTA 2M1KA 1ONQA 1FN4B 3R8QA 5JDJA 5GGSA 4TULH 1JMZA 4GKNB 3SDDC 5IWLC 1J18A 2HPOA 2YGQA 5DJYB 2RFXB 4Y1AB 1AJ7L 1PF3A 2HJFB 1ORQA 1GKEA 2GIYA 2CHDA 3GLAA 3VI4B 2VQUA 2DQFB 3AREA 1PQZB 1VADB 3VD5A 3ENEA 4Y16D 2ZWLT 1ETJA 1W2KT 5DT1L 3BHBB 3QXAB 1FYTE 5FHAH 1BJMA 4MNGA 2O6FA 4FQJL 4NO5A 1FG9C 1NFDF 5F1KC 3US1A 3AAZB 1MCJA 5FO8B 1PS3A 1BQSA 1ZHBA 1AXSB 1UKQA 3IFOA 4W70A 3VTAA 5EU6A 2GCYA 2WJ5A 4HIJB 2PWGA 3GXFA 3LS5H 1MHEA 4TMPA 2OZNA 3UDWC 5EO0A 2IPKA 4UAHA 5IW6B 3L5WB 4JY6A 4YDKL 2ENYA 3Q06A 4F3FA 1FVEB 4R0LC 1G7HB 3PDGA 2Z1KA 1CDUA 3BMVA 4N5ED 3T0EB 4EZLA 4UIMA 8CGTA 2BCKB 3C5ZA 1QKZL 2QR0A 5JHLL 4H1LB 5GGSY 5KYWB 3V95A 1Q9WA 3NAAH 5JHAA 5B7EA 4K3GA 1NBVH 2Y9RT 4WNJA 2ZUVA 1M7IB 4AYDC 43C9B 2X3BA 4ZMQA 4CW1A 4N2OA 5GGQH 4PSRA 3L95A 4U4IA 5DSCA 3N42F 2IDSA 2VMEA 5EWIL 1PKQA 5DVLA 4NIYE 1OP3H 1D5IL 2H1LM 2JB6B 4I8DA 2YXFA 2VDQH 1T66C 4R7VA 2AQ1A 4S1SL 2NY0B 1YPZE 4HCRA 4JQVC 4U3HA 4XNXL 4ZW8A 1D9KC 2IANE 4HK3J 5KYXB 1B4RA 3FH8A 1V7ML 1ZHKB 5CLZA 3RPBA 5JMRA 3EO9H 3F7VA 3MRKA 5E9DD 3RAJL 4X5PA 3Q01A 5KSAA 4ZUUB 5LBSL 4K3EH 4MXWL 1PX4A 4AX3A 3PXHA 3TFBA 2JKXA 5ESAB 4LFHD 4X8XA 2ENPA 2MEJB 5KWYC 1GYWA 2B4CL 2A9DA 1NC2D 2NQCA 4EAEA 1YHPA 3CFQA 5C9KA 3WSQH 4AV4A 1HL9A 3E3QE 4FQ1H 2EIZB 3TPKA 4DPBX 5K39B 1MG2C 4PRNB 3OKOA 3FQXB 4WU5B 1H6UA 2HJKA 4IJ3C 4KRPD 2BZ7A 5B39B 1OOWA 4JPIB 2HPTA 5IVXF 3IU3A 1O9VA 3RNQB 3VXRD 4EMZA 4J5VA 1UKTA 4WWKA 3MRIA 5INDA 5AFAA 1EDHA 5AWNH 2Z31C 1KT2B 3E7JA 3QEQA 3C2AL 4XR8C 3H85A 5CKGA 3QDMD 1PTZA 3D2UD 4WJ5B 3UGXA 2Y2TA 2FCBA 3GF8A 3B3BA 3EH4B 1B4JH 1GPOL 1WFIA 5DCCA 1E90A 2J4WL 2PF6A 5JOFB 1K8IA 4EN3A 4AJWA 3F64A 1T83C 1AQMA 1IAIM 4NUJB 3TVMB 1AKJD 2XG4A 3QHZH 4AW4A 2NSMA 3SCMB 3P3UA 5IROC 2V9QA 1I8MB 1S7TB 5GSRA 4HS6A 1EV2E 3QQXA 3N85H 4KRMB 1IGYA 2OULB 1LK3H 1P7QB 2NUPB 4BXVA 3I6SA 1PZ5B 1JOIA 5FDWA 4TQEL 2UWEF 2XV0A 1KGXA 2XN9B 5IVXB 3QUMA 4DKEH 3VFPA 2G3XA 4HPYL 4FERA 4TPRL 1CBVL 3WNJA 3VRIB 4Z95H 1EFXA 1HKFA 1KN2H 1FE8L 4PD4J 1I4FA 3FCGA 4P4RB 2C8NA 2YWZA 5AB9A 2GJZA 3MXWH 4PUBH 2AK1H 3DX6A 1RZPA 2F8IA 1RJYB 1WTGT 2A9AA 3BDBA 4TPRH 4ZT1A 4M8VA 1N64L 4WI5A 4XPGL 1FE8H 2GT9A 1NAKH 2MOVA 2Z65C 2G5BB 3PIQA 1AO7D 2UZIL 3D3VB 4GSRA 3H9YA 3RWFB 1D5RA 3HUJE 2HVKB 3CQPA 3SHSA 1E3ZA 2O6PA 2V7NB 4KTDH 1XF4B 4XVJL 4ZBJA 1PYWA 2Q8AH 3BIKB 3D30A 3LX9A 2FWUA 4HIQA 5HDLA 4YNYA 3GMRB 3TYFB 3IF1A 4GUPA 3LAFA 4IOIA 5IGXL 3F7RA 2KT6A 1LQBC 4HF5L 3CLEH 1FL6A 5IJKC 1A1NA 2GG1A 1BMGA 5AVVB 3IDMB 3MRBB 5ILTH 4G8AC 5FHBH 4KOCA 1UURA 4XVOA 4U1HA 3DK0A 3MLXL 3QIWD 4TTDC 3WN6A 1BYPA 1XGZA 1NTDA 4DQAA 4NO3A 5ICZB 1LWRA 2VR4A 3LNHA 5I1HL 4FQXD 5I66B 3ZDZB 4G6AC 4B41A 2J6EL 5JYLA 2C3XA 3IPFA 4HUCA 3ZTJG 4DUVA 3UTTB 5C2BH 4KY1H 1A0QL 2LFGA 3KGSA 4MNGE 1JMXA 2ZX6A 2IAMD 3DHMA 4OZIF 3S4SA 3QDHA 4MHHG 1J1PL 4W9IC 2DI7A 1J1OH 4GQ9H 5DGRA 3L9BA 2FJFB 3NFSH 3NQKA 4R8WH 2R4RL 5DJAA 1UD3A 3GQFA 4FQ1L 3BH8B 5F7KC 2DM2A 3QFDB 3QORA 2XJKA 1RQ5A 3MJ8B 2AKRB 1YEIH 1NBYB 2VSKB 3FB6B 4XP1L 2F7RA 3KYNB 1AH1A 1TTFA 2QSCH 1LDSA 1YMMA 1C08B 3O9WC 1J88A 1J9RA 2X1QA 1DDTA 3V0AC 3DTXB 2VO5A 4FHJA 1TLMA 4AMKH 3W9EB 3OMIB 3KPSA 4FNTA 3ZT7A 3MX0B 2O5NA 1CXLA 1T5XB 3DYMA 2NY4B 5AVZB 3DXAB 2P42B 4R7LA 3VA2C 3WMQA 4UOW0 1SY6L 2YPKA 4Y2DB 4DFIA 2CBQA 2NXZC 5CMAB 1JNLH 3K1KC 5CFHA 4NKQB 3MNVB 3AMLA 3G6JF 1IZJA 4RGNC 3BGFB 4OCWL 2P26A 3QR1A 2IQAB 1LMKA 3OD3A 2B08A 1D9KB 2AV7A 3O4LA 1J05A 2Y36L 1JK9B 4S1QH 5F7BA 4ADIA 1AIZA 5C92A 4NQVB 4I1RA 1U8IB 4GP8B 1AD0A 3L3GA 4UWQB 4FQHB 3KLAB 5BUPA 3FT3A 2BJMH 3CFNA 3FCUB 1IAMA 4XAKD 5CJ5A 5IHZA 5T33H 1MF2H 3MRRA 1XB8A 4HUNB 3FB5B 4WZ9A 5BJTA 5D7IB 4GH7B 5L4MA 3INUL 3AGVA 1HOEA 2VDLB 3MGTA 5DRXA 3TH3T 3GSVB 1OSEA 1UWXH 4Z7NB 3HC3H 4FG0A 5HY9B 3HI1A 5K9OB 3AGWA 3D0VA 2VN6A 2B0SH 2DDQL 3GBMH 4LGSB 1N2RA 1DJGA 2ADFL 2PXYC 1DBBL 3CCHA 3I6GA 3L5XL 1H9DA 4HJEA 2EVGA 3OJ2C 4Y0GA 1L0YA 5DWUH 3BWUC 1UOKA