2O6DA

Structure of native rtp34 from treponema pallidum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein, protein binding
molecule keywords 34 kDa membrane antigen
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6dA00
3LZPA 3LZOA 5I0XA 2O6EA 3LZLA 3PJNA 5I0YA 3NRPA 2O6CA 3LZQA 5I0VA 3LZRA 3LZNA 3NRQA 5I0WA 3PJLA 2O6FA 2O6DA
chains in the Genus database with same CATH superfamily
3S35L 4Y2OB 2OI9B 4HKXB 1XL6A 4LARH 2WXOA 5SWZB 2HTKD 5DUPH 43C9B 2BP3A 2HKHH 2PYEB 4JJOA 1MCLA 1BG1A 1EGJH 4RIRA 1U8LB 5EIQA 3V55A 1KTJA 3HOGA 2DJ4A 3ZHLA 1NBZB 2CGRH 3U25A 5HBBA 3CHSA 2BIQA 5I82A 4DVBB 4QOKB 3SB3A 3MRBA 1GGIL 1ECZA 4ILDA 1SF5A 3ENEA 2DIBA 1FSKB 2YRLA 3O9WA 4U6HA 3US0A 4Z7UE 5L8LB 2VDKB 5FWQA 4NT6B 4XNXH 4JLRA 4JRYB 5EOTB 5GRVK 2P8PA 2QMKA 3PPEA 4Z7IA 1J1PL 3C8KA 1OEZW 4YSPA 3UBFA 3C5ZB 2XNAA 3LKSB 4NM4H 1Z5LB 4MA7L 1HZHL 3DXAE 2CR0A 1XGQB 1EDHA 4HFWB 1JERA 3I75A 4Z3TA 2BW4A 4PHZA 1GJIA 2VDKL 3F01A 3BFWA 5FYJL 3VYPA 2ICWJ 3VCLB 4BA0A 1EBPA 1KF9B 4ZDHA 2ATPA 4YXLL 1TYJA 1M71A 5CEXA 1QSEA 2ZSWB 4XR8C 2BC4B 5IEKB 1CFQB 3GZQA 4BKSC 2RR3A 1K9TA 1U2HA 4Y5YB 3VI4F 4BQCA 5KZCB 3NDYE 5E9DD 1IBFA 4P46B 1KTDA 4DZBA 5DEJA 4HIJB 2ESVD 4H8WH 2IGFH 2IWFA 3SKUD 2JQMA 1Q90A 4HYTB 1WICA 3ZTJH 3QFJB 1TU2B 2GG1A 1CFVL 1T6WA 4KKPA 4L8SC 4QRTB 8FABA 4P4KC 3D3VA 3TYFB 1CU4H 1R5WB 2XN0A 4JN2A 4YGVB 2D3LA 4Q6YA 5C71A 5I6KA 5CUSH 2FNBA 1IKNC 1G9NC 2YA0A 1QI4A 4A6YL 1J5CA 3MRGB 3QEQB 1IBZA 2ZXCA 4P2QD 3WNJA 5F2FA 5T33H 4K7PY 3O3AB 3Q43A 4L05A 5D7KE 5I6PA 2EIEA 4JFHE 1TQBC 4BHUA 1B4RA 5CSZA 2EINB 3T0EC 1TTCA 4MA1C 3O2VL 5DK3A 5LJYH 3CFUA 4AGNA 4UV4L 3BP4B 4IRSD 1CFBA 4XBEL 3ARBB 2J8UE 2UYLB 1LO2L 3QIUD 4KQ4L 3EO0B 2WXMA 3BHBB 3EW3B 4M93B 4PJFB 4ABVA 1IT9H 4AV5A 3FB5B 1U42A 3GJFA 2N0KA 3MRPB 4GIOA 1AOZA 2VITA 1O7DC 1NDGA 3ILEA 2V5SA 3MNZB 1S2EA 1KTRL 3BW9A 4YHML 4QUOA 4HHWA 5LGKA 3KPMB 1OK0A 1WH0A 4XNDA 3BVNB 1AGDB 1RZ7L 3L5WA 2VDMB 2QQKH 3MSPA 4Z7UA 5DRXB 1K5NB 2FWLB 1WCBA 4KY2A 3UAJD 4L37A 3TN0D 3ZRFC 2NSXA 3WEAA 5SWQB 4DUWA 5B3NA 5JIIA 2CBOA 1JTOA 1J11A 4PJGB 4RMUA 4AQ1B 2X6CA 4YDLC 1XMEB 4ZO7A 3B4NA 4D9RD 2BPBA 1QBAA 1DSWA 1FI8C 5K33A 3GSRA 2AV7B 3VD3A 2X4QB 2K3HA 3IXAB 1T7ZA 4L4TD 1KJVB 5JW4N 3D69A 2VDML 3SYOA 4GG8A 5JW4Q 2WCGA 4XH2B 2RALA 3O2DH 2NUPB 1FRGL 4B96A 1A66A 2ZOWA 4J27A 4FNSA 4HCRL 1DQQB 1JRHH 3B56A 3NGBB 3S5ZA 3DO7B 3THMH 4L5FH 1SY6L 3GRWL 1DQML 2AQ1A 3MLRL 5BXFB 2LHAA 1UG9A 3ECBA 3W38A 4P8QA 3LN5B 5F7YC 1WFTA 5DR5H 5E2VL 4MHHG 3VO0A 1H3PL 3IPBA 2OSYA 4S10A 1EJFA 3CLWA 1ADQH 5DO2C 4KNUA 1MHEB 2BX5A 1ZSHA 3BZDA 3EJQA 4GW4A 2ZD0A 5FW8A 3QNZB 1V3MA 2QVKA 4OGZA 3QZWB 5E9AA 5ID1A 3LKOB 1TUPA 3FKUS 1FZKA 3NCMA 3B7SA 3QUXC 4ELME 1JBJA 3OB0H 4ACTA 5EZJA 3BAWA 2X4NB 3MNVA 1BWMA 4PWFA 1AE6L 3VFMA 2C3VB 1HILB 1T4KA 2JKJA 3LRHA 2JI3A 2O4EA 1O7SA 3MV9D 3F7QA 4W6XB 1CC3A 3RRQA 4ZFFB 2QTVA 5L9DH 5ESVB 2YR3A 3WENA 3CTTA 1H5BA 3A23A 4L3CA 5BUPA 3CD4A 4IOIA 2ZYSA 3CPUA 4K8RH 1FFQA 1JNLL 3KVPA 3LYRA 1KYAA 1M9WA 2B0SH 1BCIA 1OQOA 3ULVH 1FIGL 5E2UL 2J6WA 4QTHB 3W1ZA 1GYAA 4JJ5A 5F93C 1T1XA 5CGYC 1ZTMA 4XNQB 3X1NA 5CINH 1IGJA 4MKTA 3WXWH 1C16A 4UQ3A 1OSEA 3ARGB 1L3WA 1S7SA 4N8CH 1JGVH 3US9A 4BYHA 2PTTB 4RZCB 1JHTB 4F91B 5I6XC 1YYLH 2VB5A 3HA0A 3EGDB 4NKMB 4YEEA 3T3MB 5FYLL 2ZONA 2E8YA 3P11L 3LZQA 5KANG 3FCUB 3EO1B 4HLZH 3BDXA 5ISZD 4ETQA 4ZAKB 3PXLA 5IROC 4KI5D 4K9JA 1E9OA 5J6GB 1GIGH 1TTBA 1U8PA 4JFPB 5A7BA 4KH9A 4UDTB 4QF1A 2QPUA 3COOA 4WI5A 1UOKA 3MLSH 5AAMA 4CVZA 5EEUA 3ZDYF 1G1YA 1NCDH 4HJSA 2VN7A 4X5WA 4EDWH 1DFBL 4NZ8A 1K2DB 2GSIA 2OX5A 1OF2A 3X2QB 1AOHA 2HLFD 5T5FH 3LXBA 3MXWL 4OD2A 3UTSA 4DKEL 5AW8B 5K59F 5MI0C 4KZEL 1FLRL 3DIVA 4OZHF 4CC0A 3K7UA 1H9VA 1AO7E 3BAKA 2CUIA 1QTYT 1QEXA 1RUPH 2XN9D 3FONB 2C7UB 2B39A 1RUAH 1K4DB 5SX4H 2G2NA 5GRYA 2WQ8A 4PJDF 3VXRE 2OP4H 3OJVC 4LHUG 1IGCH 2BSSB 3C6LA 4WY7L 4QR7A 4DVRH 3RIFK 3NEOA 3II3A 2VL5B 3MRDB 4QXUH 1AR1B 3MTRA 1KB3A 2AI0H 1WZAA 3TBVB 3Q2NA 3GMOB 1WEJH 2EEFA 5IVXB 1TG8A 5JR1L 4MJ6B 2G5UA 2LLGA 4L0PB 1MFAL 1MCPH 3HE7B 2YJQA 3T2NL 1AXSB 5A43C 1G94A 4GAJL 4HK3N 4I85A 3AS0A 3HI6L 4NHUB 3BUQA 2NY4C 3MUHL 3W5MA 4X4XA 4HJTA 5DJ2B 2V5YA 4XVUD 4IBQA 4OZFA 5C0RH 4JQVA 4YL4A 2EE0A 1MRDL 1UURA 2M1KA 2DQGL 2XICA 3PWLA 4ES9A 5C0DA 2JXMA 1WBZB 4LRIC 3T2PA 1ET8A 1MHHA 4YO0A 1URZA 2CE6A 4GO6B 1FG2A 4FFVC 4P59H 2NUTB 4PBVC 1JPSH 4L3EE 1GYWA 3O3BB 4ZW8A 2MTAA 4APQD 5HXMA 1WHOA 2XWRA 3AY2A 3T5WA 1BQLL 3GWJA 4X6CA 1EXGA 3TF7C 5C08E 4RGNB 1B0RA 4X9YA 3VXPB 4K9EL 4U7MA 3OJMB 4GPVA 4HMDA 4I18A 5IQ7H 1EAPB 5BVJA 2CHZA 4PJ5E 4TQEL 4G7RB 3P4NA 4UTAA 4PG9B 5HYSB 4XVJH 4IMLB 4OKVA 4XPAL 1WLHA 2A6JA 2CDGB 3MCLH 4UM9A 4NQEA 1S9VA 3SDAC 3AWEA 2JQZA 5C07B 2F7IA 5IW1B 2H2SD 3FO2A 4P57B 1LEKB 2GFBB 4N2NA 1X6NA 4FLRA 4H25B 1IM3A 3OKKB 4ZFOB 1TTFA 3S36H 5EC2A 2FO4A 5I74B 3NJVA 1L0XA 1GY2A 3L1FA 3QXDB 3CZLA 1ZWIA 2CHWA 4HHAA 5DRZA 4EVNA 1Q9OB 3HS9A 5ENWA 2CJUH 1WD9A 2ZXEB 4AKPA 1J1OL 2BVPB 4NNPH 4FZ8H 4QTIH 3Q2VA 4JO4L 5SX5K 4J3VA 1JF5A 2VDRB 4I87A 4ZG1A 4LFHD 1ID5I 1T2JA 2CLRB 5EMYA 3G5YA 5AW1B 2ZT9C 4B3VA 4JKMA 4ZFOL 3MA9L 5LN8A 3HC2A 1DANU 3JWDL 4ELDA 3FZUC 5ANME 1LO3H 3WD5H 2JKSA 2HJFB 4B3EA 4K2UL 3O0RL 4HJJL 4CU7A 1Q8MA 2NLJA 1UTDA 4L29A 4YWGL 3VXRA 1CO1A 5EU4A 3TTSA 2X05A 1T0OA 4KMTH 2VDRL 4JPWL 2VXSH 2YMXH 4UWQB 4MNGE 3F04A 3C08L 4X7EC 5GGTA 9CGTA 5FO7B 3NFNB 3HHSB 2Z4QA 1IAKB 3CU7A 3ARED 4HG4J 1XGRA 2Q8AH 3T71A 1Q9LB 2KQMA 4FMVA 4XN4A 3ZE0E 3Q8BA 1ZT7B 1EXUB 4NLHA 4GFTB 3VDBA 1I1AB 2M26A 1C5DB 5J6HA 3Q44A 3L17A 4ES8A 1YEEH 5DEFB 3CVCA 4S1RL 3NCBB 4PWJA 3TO4A 1KB9J 3J8F7 3FQWA 3FSOA 2XYCA 3D48R 1VADA 1T7VA 1TOXA 4HWNA 2E27L 4XCCL 4X4YB 1E42A 2FSEA 2PWGA 4OV6F 3CFKA 4PRIB 3IYLW 4IMKC 1GOHA 1YPZA 4M62L 2ERJC 1Y0LA 1ED3A 4G8IA 3VXUB 2YPLB 4LQ1A 4MVBC 3FFOA 1L5GA 4Y9BA 4JE0A 1SDDB 2BVOA 2D03H 3IFPB 3KXFB 4QGTA 4BZ1H 4AX3A 1MCDA 1M2VB 4LSRH 2EICA 2KZWA 4RDQG 3QRGH 2OMZB 3VFWA 4Z3FA 1F6AA 4R2GC 2ZOUA 5TH2B 4D9LL 3ARFB 4JZNA 3JYBA 4ZYKB 2CBQA 3ZTDC 4U1SB 4X6DA 7TAAA 3RWJA 3B7TA 1ZHNB 5DJDA 2NY5H 5HDQL 1MDAA 3M17B 3QQNA 2MHAA 4TSBL 4V1DD 1H8NA 3ABLB 2W65A 1TSHA 5E8EB 1NLDH 1UA6L 1NH6A 4F93B 2CXKA 4MMYA 4UM8A 3NQIA 1DBKH 4NUPA 3L95B 2ARJA 3BIBX 1A3ZA 1ZHLA 5I8CB 4P9MH 4QPEA 4P0DA 1E8ZA 2XV3A 3DKHA 3KWWB 4B7IA 1MCIA 4UQEA 4DEPB 4YVNA 5B39B 3CN0A 3EYSL 4LLUB 4X6BB 3SE4A 3ZE1B 5JORA 4OZIA 3QQXA 5C09D 2HXAA 3HZMA 3S3DB 4YZWA 3QNYA 2XPGA 2WLJA 3LCYA 3E6HA 1J9CT 2B5IB 3DSNA 5DD6A 4ZUUA 5AAPA 2Y06H 3OXSB 3AG1B 1AS7A 4OLWL 2LABA 4G8FB 4Z3IA 5IVXF 2EDLA 2C1PA 4HLJA 5I24A 4JDVB 3M1OA 2QVTA 2AS5M 3IRCA 1ZXKA 4U1JA 5FHAL 2WKLA 3BP7B 3GLEA 4HKJA 3GZPA 3P9LB 4G6AD 3BD5A 4MNGA 4ZPTA 5IQ9A 3UBXI 1J8HB 3G6AB 1S7VA 3FFCE 5E1AB 2VQTA 3S35H 1CGXA 4O51A 1MFMA 5DUBA 2CIIA 4TF4A 4FXKB 5FDWA 4RX4A 4N9GB 5D7IF 1GL4B 5IK3A 3GSVA 4LDCA 1FH2A 2XG5B 4FNTA 2EUWA 4BK8A 4U1GB 4TULL 4U3CA 5DTFA 3UG4A 5T1DL 1SN2A 1T04A 1XGTA 2EAEA 1GGIH 2IADA 3IDGA 5B4MD 4KVPA 2P26A 4JFOA 3QXWA 1NBQA 4HUVB 2F7PA 2XWJB 1ZV5A 4BZ2L 2GB2A 5T8IA 3HKFA 4WWKC 1J1PH 4X4ZA 4ORGA 3GFUA 3X13A 4FHJA 4Y2NA 4IK6A 4MA7H 1HZHH 1RULL 3H2WA 4LLAA 2ISDA 1RJZA 2OYKA 5ALCH 1BVKA 1M6OA 2BP0B 2IAMB 4G83A 2VDKH 2Y7SA 2HTLD 5I76B 4NI6A 5FYJH 4LAQL 1AZBA 3KYMB 1A6AB 5E6YA 5EDSA 2FWUA 3V0VA 4MJ5B 5TK2A 4RFEA 1AZRA 2WNXA 1NOLA 3AW5A 1P1ZB 3GHEL 1U91B 5BO0D 4YDVA 4R83A 3ABZA 1A4KA 3QR0A 4OLZL 2ODIA 3DV4A 1SXSA 1SLWA 3BPLB 3FT1A 1HCFX 1MAML 2DI7A 3LQMA 4F20A 4AZUA 4QY8A 5BRZE 1WC7A 2PCFA 3Q9QA 5DUJA 1OP5K 1OF0A 3QDGB 3OHXB 2OLDA 2EC8A 4PJ7F 3X14A 3EH3B 4L5FE 5DC0A 3WN5A 5IFHL 3FO9A 3ETTA 4XI5D 3QUMA 4JM2F 4JAMA 2WLLA 4KJPC 4M9PA 4HIIA 2M83A 1QX1A 2HVBA 1NJ9B 4W9IC 5KSAB 5EU3A 4EMZA 1CLZL 2ZKXA 2GY5A 2I7OA 2F8OA 2E4TA 5F9WB 4OZFG 4QHPA 4NN5B 2O5XL 3G6DL 2YO3A 3QJHB 3B6SB 1B3JA 4ZXBC 5EF1A 4QO1B 3T08A 1EXHA 1F13A 2C7FA 3KPLB 4AI7A 1WYJA 4XB3A 1EJ6A 3MUY1 5F3BB 5IMLB 3KR3L 3O2VH 4ONHA 2XJLA 2E7LC 3LKNA 2J6EL 2R59A 2VN5A 4UV4H 3TPUB 2ZKWA 1DUYB 4NO0A 4DEWA 1X7SA 5KYXB 1KC5L 4XBEH 1HFUA 5DJXA 1K72A 5EEXA 1DLHB 1QO3B 2I7SA 4OY9A 5DRNB 5TDOB 2OV0A 3Q05A 2XKNA 4JUSA 3L7EB 2IH3B 2KLRA 5D6DC 2K0RA 5INCA 3ULVE 1SZNA 3QDMD 2DWDB 3E8VA 1LMKA 3DWTA 1JPGB 5EUOE 2V2WB 4YHMH 2RIKA 2GIMA 2A9AA 4X7SL 4KKAD 4R7DB 5C0JB 1Q94B 1RZ7H 3KWTA 4QRPA 1YEDA 3KGTA 2ZXGA 3DBSA 4JHVA 3K71B 4LNRA 3HTLX 1UWGH 3WMPA 3NA4A 5AZ2L 1QHPA 4UAOC 1KB5B 4DT2A 2IGTA 2LQRA 4DTGH 4XOAA 4NZRL 2ZYRA 3WE6B 3RVWD 4AYFA 4AUJA 1MCNA 2GJZB 4XT1C 5F7KC 3QZOA 3FQUA 5D7HA 2ZOLB 2VDOL 1PNCA 3QIBD 2R39A 1N59A 2VDMH 2CJ3A 3O3DB 4DOHE 5I6MA 3IGAA 1JN6A 1XB6A 2R0ZL 5I9QC 2HT4C 1DJGA 1JGEA 2WCPA 1EFXA 3GIVA 4OLXL 5E8OA 4HCRH 4WKZB 3T3PB 1SY6H 3GRWH 3HG5A 2AJSH 3MLRH 4HK0A 4LLVA 3BEVB 4C8XA 2BXZA 3BAJA 4F92B 3T8MA 1GC1L 3L1GA 4M7LL 1CL7L 3L3KB 4Z6AT 2C8NA 5KN5A 2B3IA 5FUZH 2ZCZA 3LNFA 2VXUL 2JTYA 1RKRA 2I25N 1MG3C 4BFNA 2EDOA 2F19H 1T1WB 4F2EA 4BWTA 1BLNA 4H8WC 4HPHA 2R23A 1AD0B 2NYYD 5FUOL 1AE6H 3HE6B 4URTB 5I1JL 4Q9RL 3FH5A 5ECGA 3U4EB 4MBOA 5JO5A 4PRPE 1FFOB 4KK9C 3M8OL 5FGCB 1S5HA 3RTQA 4QYOB 3RFRA 5FOBA 4PJHB 2N56A 3H8NA 2N7AA 3VE0A 1O6SB 1A14L 2NY2C 5JIQA 1AXTL 1IGTA 1NIBA 1JNLH 5KUKA 4PPTA 2LR4A 3V9FA 1XVSA 1FIGH 5E2UH 2WKOA 2MPAL 2NXZB 3H9ZA 5IFJA 3MU3A 5K1JA 2OR8A 1A7NL 4YDJB 4LHUD 4NQDB 5C0CE 4X7FC 2BSED 3B2XA 4N3UA 3BQUD 4QLRA 1CGTA 2DY2A 5JHLA 1KT2A 1JJUA 1DQLL 1CFTB 5CBEA 1MFNA 5HD8C 3NCXA 5D2LA 5FYLH 4N25A 3P11H 2GAZA 3L3IA 1SJMA 4Z5RB 5AYUL 2X9YA 3OLEA 5C6TL 1E40A 3NSXA 4MQ7B 2X6BA 4XHQA 4P2OA 1ERNA 2DM4A 3JV4B 4J28A 2FR4A 2XXFA 5KYWB 2X1XR 3HC0A 1SPDA 4OIBA 4JZOA 3TNNB 1OCCB 5AW5B 3B8SA 1VZGA 4NO5A 4GMTL 1UCBL 4ZX5A 1FA4A 1C08A 3VJ6B 4AC4A 4BE6A 3O9WD 5J5EA 1KIPA 5KW9L 2Z8VC 5HHOE 3QJZA 5AALA 1D5BB 3BZ5A 3EFFB 2V9QA 1Q72L 3EYVA 5CILL 1H3XA 4DKEH 4KZEH 5FWRA 1FLRH 3CJJA 2DQJL 2FIKA 4MDRA 3KM2A 4QHNA 4RAHA 3TONA 5DEGB 5DJ8A 3C9NB 4JG9A 1PPIA 4LEOB 4GIPD 4OH2A 3WLBA 3ZTEA 3F8UB 4XB8A 4Z7WB 4WY7H 2UV3A 1E4KC 3L1EA 3DTXA 5K9OA 3APDA 4JDZA 1AACA 4Y8DC 2MIZA 1LLAA 2H3KA 1BZ9A 2G0KA 1YY9C 1E5AA 1KXQE 4GH7B 5EBLB 2HFGH 1R24B 1QSED 1GHFH 2BVQB 3HRZA 3MA7A 3FUEA 4AVHA 4G43B 5D5MF 2XC8A 3IJ7A 2VQ4A 1I3RB 1MFAH 4OSUL 2E46A 2VL4A 1BECA 3HHMA 4G8GB 4WTZA 4XHJC 3T2NH 3VI4E 4HJGB 2PMZA 4Q7DA 1CCZA 5ID0A 4WHTA 2EDNA 4GAJH 4JO8A 4MNHA 5CSBA 2F54A 1T22B 3Q8AA 4F2ME 3HI6H 5JW5B 3QK0A 4A2FA 4JCLA 4UT6H 3HJEA 4LEEA 5HVHB 2R7EB 4IRZA 2J56A 5CD5D 4N26A 3TLRA 2IDCA 4I3GA 1QATA 4TQPA 4XMKL 1MRDH 3D3VD 1BP3B 4WSJA 2BO0A 1KEML 4GO9A 3HMXH 1Y6MR 2EYSB 2ZUSA 4HF5L 3O8XA 2WXNA 3TIDA 5JXEC 2WZPA 2VUKA 1GY1A 2O72A 1KCUL 4LOUC 3N0PB 4N0CC 4PJ8B 1FIEA 5KANI 1BQLH 1LVEA 5ICUA 1JNHB 3ULVC 3MRHB 3WJMA 2J5WA 5T3ZD 1CF1A 2GC7C 4K9EH 1P4LB 1A6VH 1PZUB 1N5AA 1JAEA 4WI3A 3UL4A 4TQEH 1EHLL 2R2HA 1FNAA 4NRZA 2Y07L 4XPAH 5I1DB 3H2PA 1NIAA 4BDVA 4OVUA 5IQMA 3MHZA 4DK5A 4FE9A 1F1DA 4OFDA 2IF7A 3BLBA 3BEWA 3RX9A 3ISRA 4Z3EA 1DJWA 3P4LA 2Q7YA 3QXTA 4NQQA 4LEBA 5CLZA 1J5HA 5BOZG 1EZVX 2H4EA 1DDTA 4FOMA 3A4AA 3TJHD 2XKUA 3P54A 3D2UB 2MTPA 3E0GA 4XCNA 4MMZA 4Q6IC 2VXTL 1HYSD 1X7TA 4BGLA 3ARZA 2JB5L 4EN3C 1J1OH 2DL9A 2Q6WA 5IJDC 4JO4H 1YAZA 5DHYB 4Y1TA 1BQ5A 5MEQA 4N2KA 1A22B 4GBXC 5G4MA 3NZ8A 1K85A 3MA9H 2XY2A 1T1YB 3JWDH 4AW7A 3BWUF 3NAAL 3MRQA 3VFVB 5IOPB 2XWBB 4K2UH 1JXGA 5B3JF 4HJJH 4MCZA 1F58L 4UDUB 3ZE2F 3FTGB 5B1AB 3BP5A 3KMDA 1A9VA 1RZFL 4HKBA 4A7TA 5JPMB 2VDRH 4JPWH 1IEAB 1LJMA 5C2BH 1OTSC 3C08H 1NGZB 3G04A 1J86A 3VRIA 3WHXB 2BNRA 4JZJC 4F33A 4AMWA 2V8MA 5HHQA 2F1EA 3LQZB 4IBZA 2HUEA 4XN5A 5FC9A 3WHE0 3US1A 3DUSA 2WGXA 4L4VB 2X4RA 3WIAA 4BFGA 2AHIA 1G7MB 2YXWA 4NUJB 3UZEC 3ZLQC 3G5XB 5GRXG 4ZZFA 3QYMA 2B1AL 3Q3GB 2KL6A 1C7SA 4JE4B 2DB8A 4Y89A 1RK0B 4AKOA 1FYTB 3QULB 1ZLVK 3BKYL 3FBKA 3HG4A 5I8EB 3SE6A 2DLEA 3WLWC 4B0MB 4S1RH 2AK1L 2YD6A 1E0OB 2X3BA 5FGBC 3GSQA 2E27H 3MUJA 4XCCH 2PCPA 2IDFA 4MMXC 4Q4EA 4D0CA 3GSNA 5EU5A 1BMWA 5E4IA 3DX7B 3ZDXB 4QRRA 1A1OA 1G7LA 1NBCA 3K6FA 1HHIB 2UUDH 1FCCA 2QSCL 3QCVL 2WP3O 1S9XA 3DBXA 1NA8A 3GGWB 1QLFB 2DYPB 3MRCB 1SYSA 4YLBA 3STZB 5KWYC 1GH7A 1SOSA 3TS8A 1T5KA 1KTLA 4MSWB 3SYAA 1Y1UA 5L8KB 4GKOA 3R7RA 2YKKA 3FB6A 1F00I 1H3VA 2UWEB 4D9LH 3MRRA 4FG6C 3DHPA 2AK4A 3NSFA 1G6RA 3N1MC 3CDZB 2QHRL 4IKIA 4JKKA 2Q86B 1KYOJ 5KS9B 1YEFL 2FAUA 5CJXA 4FFVD 1I8AA 4LSUH 2XLLA 3D9AH 5IIEA 3GMQA 1JD7A 2WD0A 3I02B 4PJBF 4QWWC 5B8CA 1EEYB 2DW5A 1UA6H 5LCVA 4Q2ZB 3I84A 5FYJE 4K7FB 1M3IA 1BXVA 4FNLL 3SDDC 3VXTA 3TFKC 1QHQA 5F3HA 3T6WA 1LM8V 1XD0A 4G7SB 1CFMA 3UP6A 1Z66A 3GJEB 2V2TA 5AB0A 4HALA 4E41A 2A9BA 5F7EL 2APBA 2YEZB 1CDYA 5JDSA 3IN0A 5DJYA 4OUUA 4KKCD 3ZDYE 2V9RA 3RPKA 4A7UA 1H3UA 1G1OA 3SD2A 1FVDB 3VGEA 4OD3L 5I0XA 3UJJH 1JYVA 1XF5A 2B2XL 2YA1A 2A6KB 3DIFB 1BVZA 3U79A 3UTSD 2OR7A 4XP5L 1FBIL 1HXMB 4OLWH 5DGQA 2ADGA 5K59E 3F6IA 3O3EA 2IOMA 4AEEA 1IGML 5K1NA 2B4CL 5D72L 4GKNA 3UDWA 2NYZA 4NNXB 2ICEB 5FHAH 3S3PA 3H7BA 4D7BA 1RJLB 3C6LD 2NNAB 1DO5A 1R0AL 3P73A 4YEFA 2D0HA 2DLFL 3QO0B 4ODUA 4PGCB 5I5JA 2WN3A 2ZP0T 4H8PA 4A66A 2LV4A 1MWAB 4PJXF 1JGUH 1P5VB 4J3SA 4HIEA 3H55A 4TULH 1PU0A 1AS6A 5D1ZD 4AYGA 4JGMA 3N43B 4HUXB 3K46A 3ZT7A 2DIJA 4ABQA 3D0LA 3QEQE 1ZLSL 1XSKA 2FJHA 1EZVY 4LCUA 3ZKND 3A67L 3K0YA 4XOEA 4YHNA 1SMDA 4BZ2H 5F9AC 2JJSC 3NP4A 1AMYA 3L2LA 2H8PA 5FS5A 3RWDB 4HISA 1RULH 1ZLWH 3LX9A 1KACB 2JMRA 1CK0L 3KL0A 3C5JB 2ROYA 5IVOA 1FL6A 3KPSB 5B1JC 5FM4A 3DETD 4YSOA 4X7DC 4M61A 2BH0A 1MLCA 1ZT4B 5EFIA 4YFLI 4CSSA 4JRXB 4LAQH 4U49A 3ZDZB 2OMNA 1N0XL 2VLJE 3IEAA 2JKWA 2OPCA 3HCVB 2F0CA 3DJSA 3AXHA 2WLHA 2BNUB 2Z91B 3PUCA 3GHEH 4WWNA 1V7NL 2B14A 2AQ2A 2R83A 4OLZH 1J0IA 1MJJA 3L6FB 4KJWC 5K1VA 3P4OA 3I6GB 4KRPD 2X4TB 5H37H 4CDGC 1EO8L 2VDPB 4WSGA 3STBA 3U36A 3L5XL 2UXGA 2XZQL 4MJIB 2NY5C 4XN2A 2DS4A 2X4UB 4UM9D 4DZ8A 1J9QA 4NQED 3NJGA 5C97A 4YHIB 2Y7OA 2V2XA 3MX0A 1K4CB 2Y24A 3KVDD 1ZGLB 4EZMA 3SCMA 5AD0A 2X4SB 1F97A 5MP6L 5KVFL 3EOYG 3ESPA 4PH8A 1XBDA 2HN7A 3C2AL 1RHHB 1IM3D 1TZIA 4D7PA 1DBBL 3LZOA 3T4AA 1SXCA 3W9DB 3NBNA 1CLZH 3WIIL 4N2CA 3ZZQA 1FGNH 1RERA 2O5XH 3G6DH 3BI9X 1BDYA 4NZJA 4DCQB 1IEBB 4BUQA 3QP3A 5DJCB 4ZODA 1E5CA 4MNQA 1AMXA 2DEYX 3OKEA 4OZHA 3AG3B 4HJ0D 1E5BA 3ULUD 5J9PA 5TE7L 3KR3H 2BSDA 3ROLA 2QSQA 4ZO8A 2J6EH 3D39A 3GMMB 4C4UA 5IHWA 1R33A 1KC5H 4LLWA 3VXRD 4PJDA 1FNLA 5G4NA 5MENA 2EDFA 5CN1A 2HJKB 2FO1A 4AE0A 3IU3A 3H6JA 5BO1L 4OCWL 1WZ1L 2G5BB 5EPMA 3PWNB 2J1WA 1JVOA 3IMUA 5JDJA 1QR4A 2NY6C 3DC0A 3KLDA 4X7SH 2HFFB 4R90H 3KPPB 1OZTG 2H26A 3E38A 1YEIL 4NQSB 3TVMC 4E9WA 5IHZA 4C55A 1LYQA 3ARYA 3FTSA 4IDJH 4K3DL 4WV1C 4P3DB 3BD3A 1BXAA 4FLSA 5HHNA 1UT9A 3UH8A 1OSZA 4B95C 4MA3B 4N2LA 4R7XA 1SDYA 3TO4D 4XPTL 5FYLE 5T3XL 1U3ZA 1J05B 2OI9C 1TQCB 4NZRH 3SOBL 1G6VK 4DJMA 5KBKA 4FA8A 3CZFB 5GJTH 3MKGA 5IB1B 2WOBA 1CXHA 5IMKB 2E6QA 4FJYA 2I9LB 4AQAB 2XY1A 1W6WA 1AKJB 3NPSC 2ZUYA 2R0ZH 3OR7B 3QJQB 1NIDA 3F64A 4M6OL 1BPLB 4OLXH 2DF3A 3PGFL 1XH2A 1YN7B 5CLXA 4OJEH 1AGFA 3H4FA 1FSKC 4HDIB 5ACMA 4NN7B 3D25A 5I17B 2Q7AA 1UKTA 4A2DA 1TQWA 2QQLL 3BPNC 3BZ4B 2WO4A 5D1ZI 5IG7B 1GC1H 3AABA 2YPVA 4M7LH 4PLJD 1CL7H 3A21A 4AIXA 4JFDB 2YAQA 2QFPA 4KVCL 1S8DB 4K0OA 2VXUH 1A6WL 1DVTA 3S7GA 3GNML 2QBWA 3LKQB 5HJ3A 5LWYL 1PZ5B 4S0TD 1AIZA 1Y07A 4UNVA 1RJYB 3TIEB 4OIIL 3PDOB 3QDJE 4WFEE 2GI7A 3J2PA 5FUOH 2FIRT 3WKMH 3BWAB 5I1JH 4Q9RH 1R3IL 4K5NA 1L9OA 3FUFA 3D06A 3M8OH 4U1HB 4PWGA 3JZYA 4QAMB 3T6ZA 4UIKL 1DN2A 4Y5YC 8CGTA 2DBLL 4K5OA 4OR1A 4TSCL 3ETBF 4KDTC 3B3IA 4JBSA 4P46C 5E4EB 2CGYA 3UTPE 3VTTA 2Z93A 1ZPLA 4GQZA 1RK1B 3L3DB 3CFQA 1F3DJ 3EHBD 2H0PA 1KLUA 5FKPA 1MVUB 2MPAH 4HEME 1KJMB 3KH3A 3BZFA 3HHRB 1A7NH 1JCKA 4PW3A 4U6XA 4RAUB 3CPLB 1N64L 3IDMA 3V6ZA 4M5SA 3BUPA 4IGBC 5IVXE 3UTZA 3JWOL 3ORJA 1BPVA 5CCGE 2X42A 3KW7A 4AW4A 2FZ3A 4LQFL 5CU5A 2HUHA 1DQLH 5KOMC 1S7UB 3PNWB 3ARSA 3F7RA 1GZHC 4KOCA 1OB1A 1P69B 3PDDA 1W8OA 2ITCA 4N90D 2YAHA 4PEEA 5AYUH 4KK5D 5KBLA 3SD5A 4FHBD 5C6TH 4OGAD 3UAFA 4Z77B 2HWZL 2YMOA 4RX4D 4R97B 5AEAA 5D7IE 3WCYA 4JFQA 4XN1A 5DSCA 1T03L 3SKJH 3ARXA 3X1FA 2GPZA 1F8TL 3RJOA 1E2ZA 1UCBH 3QJFA 4GMTH 3VWJC 1QFUL 2EDKA 2CO4A 1JPTL 4UV7L 2OMYA 4GXVL 4M93C 4DUXA 2AXGA 5E5UB 4I7ZC 4B9IA 4ZUWB 1Q72H 5CILH 1VGKB 2R4SL 1S7QB 4AG4L 2KC0A 4U2ZA 2BP8A 4BH7A 1RUKL 1Q0XL 2DQJH 3PXHA 3RZCB 4A55A 1ACCA 4LE8A 3SQBB 4I13B 5LDUA 2ATAA 1CQYA 1KLFB 5CJQL 5LG6A 2VKWA 1FO0B 1KG0A 2H2PC 4LOEA 3QUYA 5E9DB 5JOPE 4GRLB 2BOCA 4KXAA 1RP8A 4TLSA 4KKRA 4XX1G 1BVLA 3F7YB 2ADFL 3OXRA 5J1AA 4AQ1C 2JKXA 2PWEA 4W9KC 1HWWA 3HAEB 2NDGA 2YC1A 3HS0B 2W80C 3CSYA 4G2AA 3PE9A 2X4PA 5IFAL 1FO0L 1MW2A 1MIML 5BMFL 4Y0GA 4FXLA 1XSJA 4OSUH 3N40P 1RD6A 2UY6A 2CLZA 3QDJA 4ODVL 5EO9B 5T1KA 4ZOEA 3OKLB 3TT1L 3LN9A 3NGBC 4ZOAA 1JGIA 1TVBB 4K71B 3VXMB 1QQDA 2P24B 2EO7A 4R4BA 4JFFE 4P2QB 3WKNA 5HYEA 3IVKB 3EO9L 4XMKH 3TU6A 2WBJA 1T83A 1KEMH 4HF5H 4EI5B 4JGUA 2BFVL 5HHVL 4WI2A 3V0IA 4HEMA 5HY9A 2BY3A 1K3IA 2PPCA 5ICXA 4UQDA 4HWZA 2ZE0A 2D8KA 1OGAA 3MRMA 4NPKA 4S2SB 1PZSA 1X5XA 4QHLB 1XF4A 2R1XA 3WIHL 3WBDA 1KN4L 3WU1A 4FQQB 5HI4D 1EHLH 1NCBL 2NY2D 5AW2B 4NQXB 4FA6A 3U0PA 4Z8FL 1UWEL 3DVGA 1B4TA 4NO0D 3P3YA 4U6VL 5DC2A 1QW9A 3CXHJ 3HB3B 2WZ0A 1JWUB 5JPNA 4QRUA 1HDMA 3SKNB 2CNYA 5BPPA 3TN0B 1AIFA 2IQ9L 4N2GA 5CGTA 4YC2B 5IKCB 3AY4C 2YPKA 4MDIB 1AFVH 4PRIE 5D7IA 3UEZA 4AUYA 3QWQB 3ARGC 3GPSA 1XCWA 4WFGE 2AJ3A 2MOQA 1ZT1B 3P2DA 4LVEA 1FNHA 3VXUE 2YPLE 4QRPD 1FVEA 1TJGL 3A0OA 4C47A 2VXTH 4Q4IA 1RIHL 5FKAA 2JB5H 3CBKB 4F8TA 4IBSA 2H3XC 2QT6A 2VABA 3UZVB 3T77B 2ED9A 4ALAH 5DQJB 3OGCB 4QEGA 4U1NA 3RVXC 2TRYA 1MJ7L 3QEGL 4L9LA 1NINA 2ZX6A 4ZAKC 4JHUA 1Q38A 1R46A 1CXIA 1P2CB 2P5WB 3NAAH 2EXTA 4XBGA 4HGWB 3LD8B 3GSOA 3LEXB 3UOAB 1F58H 4LKXB 5JZ7D 5E8PB 1FFNB 1U4EA 2VIRA 3D0VB 5F7WC 1QWNA 1EFXD 1F4WL 1K8DA 1RZFH 3M46A 3DJRA 2VR5A 3BUTA 4ADGA 5FB8A 1WFMA 1INQA 3V4VL 3UC0L 3DGGB 2F53E 1LQBC 3RX8A 1V7ML 3I9PA 4JDEA 1YQ2A 1TFPA 3CSFA 3MUUA 1ZVSA 2DQTL 1SBBA 3WTWA 3TBWB 5TTRA 1ETB1 1QOKA 1XGZA 3OHMB 1R3LB 3CX5K 3KS0J 3GS0A 3BVDB 2B1AH 2OTUB 2CO6A 4O2CA 2QKIA 1T20B 3B5TA 3BKYH 1KBGL 2HG5A 4LL4A 1PJWA 4G9FA 4GFXA 3S2CA 4JFFA 4QMEA 4PJ7A 3UYPB 5I66B 2AK1H 1J5IA 4GT0A 3KCWA 1AR1C 3MACL 2XN2A 3OM3B 4KNTA 4K5LA 3ZGIA 5E24E 1FG9C 4FTDA 5IJBC 3RTQD 1X3DA 1XV8A 1S6NA 5AOIA 4IRJB 2IV8A 3QCVH 3KS0H 5L2KE 1KGCD 4IEFB 5HYIA 3ARPA 4WO0A 2NX5B 2JB6B 3NSDA 3VFRB 3G6JB 4FEMA 2VR9A 2XVLA 1S9WA 1DJXA 1IMHC 1E90A 2QHRH 1TJXA 4FI6A 4JCWA 4K9EC 4V2BA 4Y4HC 3K5SA 1HI6A 2DQCH 2W9DL 5F96L 3RUGA 1UD5A 1U8IB 1W0VA 1Z3RA 3CQFA 4R4ND 3JZ7A 4CVUA 3KLSA 4Z7AA 4H5SB 5GZOC 2FECL 1OAJA 2EE2A 3FT4B 4KX9A 4GMSL 1IEHA 5ADOL 4M6ML 1M1SA 4QXWA 5DFWH 1CUOA 4XRCA 1OWWA 1DQJB 3BVTA 4FNLH 4WU5A 4P2OD 2P42B 5D70L 4AIZB 1MFBL 5TK4A 5GSRA 4EQ2A 1WE5A 4K5PA 2E86A 2IANE 3WJJA 2CDEA 2XN9B 5F7EH 1D6EB 4V11A 3WDHA 1FPTL 2W88A 2APTA 4XMLL 2ENPA 4JDTH 3U4BL 4LLYA 2E9JA 4J4PA 4G8EB 2B2XH 2WPGA 4MJHA 2P8LA 1J7VR 2X6MA 3QQ4B 4XP5H 1FBIH 1A2YA 4PRHE 1PQZA 2NCEA 1HEJC 3RDTA 1BYPA 4I0PB 4KFZC 3RX7A 4WW2A 1DUZA 1IGMH 2R9HC 3VWKC 2B4CH 4HJUA 1MPAL 3A5VA 4MAYA 3JWDC 4PD4J 2W60A 4PWHA 5D72H 4NQCA 5F1KC 3X11B 3KYKL 4KMLB 3S5LG 1TT6A 3I9IA 3GSUB 3MV7E 1KV7A 4U31A 4TTDC 2WUCH 4EIGB 3SE9L 1R0AH 3SODB 3R4DA 1G7HA 3V52L 1J5OL 3AAZB 3EJSA 3PS6A 1AHWA 2F68X 1QPXA 3FT3A 5CLYA 4PV8B 3OZKA 3ATFA 4JM2C 3FYEB 1UB5B 2YGQA 2ADIA 3KDMA 4KJYA 4HJIA 4YXKL 5MHSE 5D5ME 3KJ6L 4NWTL 2V8LA 1G4MA 2FD6L 1F90L 4TNGA 1ZLSH 3RYMA 4YAQB 4L2LA 1WWAX 2F54D 3A67H 3B1TA 1WF5A 3IJYB 5FA3A 4X8JB 1MRCL 4APQB 1VFBB 5F7FA 2H41A 3AFLA 4POZC 1DQDL 2GJPA 4EN2A 3PIQB 2TSBA 1DEEA 3VI3B 1TKWB 4NRXA 4RA0C 1CK0H 1U8NB 2WB7A 3O8XD 4W1TA 2WZPD 1CXFA 1ZHBB 2JH2A 3SGKC 3WKYA 3MFFB 3F2LA 1N0XH 3K6OA 1TDQA 2ICCA 4JCMA 2N01B 3AU1B 1SXBA 5F89A 1V7NH 3MNWA 4I5BB 4W81A 5AOLA 3UJTL 1MIEH 4UUJA 1G7QB 4N0FA 1Q1JL 1BZOA 3ZGHA 1EO5A 1QWHA 2OCJA 4PRAB 4DESA 2NZ9C 1EO8H 1EPFA 3L5XH 3DO4A 5CZXD 1WTGT 1FE8L 4Q9CA 3CVHA 2J20A 5JOFA 1NUGA 4LSQL 1PBYA 3K8KA 1RMFL 4X7TA 1QABA 1BAWA 2X1QA 1M9SA 3LH2L 5MP6H 2EC9T 3VXNA 3ARFC 5KVFH 2MMXA 5KVGL 2YUXA 3C2AH 4LF3A 3LXAA 1NAMB 3DA0A 3SBWC 5C9KA 1DBBH 2AABH 2VDPH 2WCSA 4L8DA 5F1NB 4Z76B 3HBPA 4LBEA 3WIIH 3FSWA 4MAYC 4ZS6C 4FQHA 1NEZG 5I26A 3L3HA 4YIQB 5GIRB 3F6LA 2EACA 4GUCA 1LE9A 1CYXA 2OMUB 4HKZA 4X4ME 3GSXB 1P7HL 4WHYG 3NZUA 2GTWB 2CCLA 3REVA 5TE7H 2A6IB 1E4WL 2WAQA 3FU5A 3T9WA 4F9LC 4JFXB 2TSAA 3MBEA 4DAGH 5B3JE 3F85A 3ZE2E 4B9PA 2B59B 2VE6B 1ET5A 1D6VL 3OKMA 4BSVA 4MS8D 5HJDA 1JV5A 4TVPL 3ZKXB 2B5IC 5J3HD 4OCWH 2R2BB 3QI9C 1LMIA 1WZ1H 2BNRD 3L7FA 2F18A 4XO8A 3MLVL 1XIWB 3UTTA 5L88L 3PABA 5FGCE 1OM3L 3STLB 4P99A 1U8KB 4NYLB 4LLQB 4XBPB 4C58B 1E43A 2AQRA 5D5MA 5DJ0B 1YEIH 2AP2A 2FGWH 3DX6A 4G42A 2ZAIA 5FAAA 2IMMA 2WQSA 4K3DH 4FCHA 5AVSB 4PTUB 2C3WA 1QUNB 3QQ3B 4G1EA 2VT0A 1OE1A 1U6AL 3D5OF 2EVJA 4XPTH 4HS3B 2VLRE 5T3XH 1LEIB 2L8AA 4ZPVB 4Y16A 3SOBH 3TXAA 3K1KC 4KI5F 1HK6A 3KCPA 1U3HA 3LDBB 1NCGA 3DX9B 4HWEL 4QRRD 3C60C 5AYTA 2XTJB 2O30A 4AV0A 3BLPX 4M6OH 4HH9B 3PGFH 4F7PB 1MFEL 4WFFD 4Y4FA 4V1DB 2NY0B 2CWRA 1INDL 1OANA 2WXJA 1GGCH 1WPCA 2X28A 2QQLH 3CFEA 2EKSB 3K74B 3E8UH 2O1AA 4IBTA 1NSNL 2CLVA 3KEHA 2PNDA 4A1RA 3TX4A 4MX7B 3GEWB 2AK4D 2VWEE 5AZEL 4D8OA 4KVCH 5H35B 4YDZA 4LBAA 3QZPA 1A6WH 3CHRA 4BE5A 3GNMH 1OTTC 2LFGA 4HIHB 5LWYH 4P5TA 4KXZI 4TNVK 3ESOA 4OIIH 3U0TA 1CXEA 2E3VA 1QVOA 2DLHA 2B15A 2O6FA 4PJBE 1ULVA 2DTSA 1R3IH 5FW6A 2OZ4L 3PWPB 1MJUL 3RFZB 5FECB 3T0BA 5BW7A 1XGPA 1IL1B 4CN1A 3BPLC 4KO5A 2UXTA 4UIKH 2CRZA 2DBLH 1PS3A 4TSCH 5A7EA 4MRCA 4E41D 1AS8A 2A0LD 1A6PA 1HSAB 4V2CB 2Q2LA 3C5SA 5D7JA 3RL2A 2XZCL 3V0WL 1HSBB 5AG8A 1VENA 2R1WA 2I5YL 4JANB 2BSTB 2HVKA 2ZG3A 1GJUA 1XF1A 4J1UA 3DOSA 3RIFF 1JCVA 1N64H 1W0YT 2FDBP 4GUOA 2VTFA 3JWOH 2JCCB 3MJWA 4HJEA 1ZDSA 4LQFH 4WI0B 5F9WC 3OVUB 3GMPA 1XH3B 1U93B 3IF1B 4NN5C 2HPOA 1EZSA 2IBBA 2CK2A 3B9KB 1DJZA 5IEHA 1QRKA 3D4CA 1NFDA 1THCA 4KZ0A 3PP3H 1SEBA 3QEHA 4EXKA 1NOFA 3NRQA 2DPKA 1UXLA 1AD9B 1OWRM 2BS9A 2HWZH 3LKRA 1Y6KR 4MQXD 4XP1L 3GMLA 2ZOKB 2ZCHL 4PJXE 4IU3A 4G6ML 5DFAA 1T03H 2FHCA 3NACL 5BRPA 3DRTA 1F8TH 5CGBA 3W37A 1QFUH 2BIOA 1JPTH 3HUJA 4HX1B 1M1XA 4UV7H 4GXVH 4OLUL 2VLRA 1XL4A 4ODTH 1HE7A 2E47A 2H1XA 1E5YA 1E9PA 3BGMB 5JHDE 2R4SH 4A7GA 4AG4H 2EZ0D 3AM8C 3JTBA 1J87A 1RUKH 1Q0XH 2ZXQA 2GITA 2K45A 2Z92B 1BD2A 5L4FA 3OV6A 4WEMB 1Z9PA 1E5UI 3UERA 3B7UX 3WUWA 3FOMB 3SGDH 4PGEA 1PZCA 5CJQH 1PLGL 4EPSA 5HHME 3WL9B 1SM3L 5HI3D 3SKMB 4ENEC 5GRZA 4PRDA 4N8VB 5FO2A 3T1FA 1MCQA 4NLAA 3DHMA 5IMOA 4HUUB 1FZOA 4RMSA 4KZCA 2ADFH 2YSSA 4NN6B 5EN2B 4F9PC 1LE5A 2ED8A 1VRSA 1GC1C 4PLKD 1G84A 4GW1B 3QS3A 5IFAH 3KPOB 1FO0H 5BMFH 1MIMH 3C87A 2FLMA 3LVEA 4O5LL 5LQBL 3JWNG 1BF5A 4FI8A 3SJVA 4OQTA 1R17A 3IMSA 1P4BL 3TT1H 3NABL 1KYDA 4PJBA 1JL8A 1JUFA 1TCRA 2P8MB 1QA9A 1JGLL 4BK5A 3I3BA 3NIFB 3W3BA 2I24N 4WUUA 2DH2A 2FYYB 3KG5A 4WSKA 3HAEH 3SCMD 2GCYA 4NC1E 2YQBA 3LPGA 5KBNC 2AKRB 4KH2A 3U2SA 3DV6B 3EO9H 3NSYA 3WJLC 5ITFB 3DMMA 4KDVA 2OMXA 3B3BA 3QUZA 4OCYL 4AGPA 3BYTA 4X5PA 5LHDA 4NAMA 5I0DA 2PYFB 4ODSH 3T0AA 3BWUC 2BFVH 5CZKA 4A7VA 3DDFA 3GM0A 5F21B 4HC1A 3RWCA 1NGWB 1MI5E 4JREC 3RVUC 3OMNB 4UU9B 1SF3A 5DS1A 4YQXL 4AGQA 2WINB 2WXRA 4IHOA 3ZR5A 3DYOA 2W07A 2GSGA 4MNQD 3SKOA 3QDMB 5EIIB 1UGKA 4C4BA 3OKDA 4QCIA 2IPKA 3PXJA 4NKDA 4L8CA 3WIHH 2UZXA 1KN4H 5CEZD 2FEDD 3KHOA 1QEWB 1BIHA 1C7TA 1NCBH 3KPTA 3OZLA 4L8BB 4Z8FH 4UTBL 1UWEH 5DS2A 1CI5A 3D39D 4U6VH 3NEXA 1MCWW 4BM7A 5MEND 1AZUA 5AL0A 1IC1A 3VFTB 2KDYA 4PJAA 1TNNA 2IQ9H 1NMBL 1Q0EA 4NO2A 3V0DA 3S96B 1O9VA 5IW6B 2XUWA 3D51A 1NCOA 3BMVA 3ZDXE 2MCG1 2D3VA 3FCTA 2G75B 3VFOB 3BO8A 4Y4KC 3FU7B 3DX8A 5CCJA 3FOLB 1FNEA 2VLKA 1GMEA 4OF8A 2Y72A 4AENA 4AVJA 1OV8A 1F3JB 1BEYH 1ADQA 5JHDA 3FB8A 1L7IL 3NEEA 5EV7A 3QBTB 3RJQB 5IBLC 3U2JA 5BQ7B 2CRIA 4X5QA 1MJ7H 3QEGH 1XAUA 4R96A 4LGPB 3IJEB 2MQ0A 1I31A 4F24A 1OPGL 1YO4A 1N7ML 2VWEC 5TF0A 3ZXAC 2F74B 2IBZX 2HRPL 3U0WL 1A4AA 4WW1A 4YBHA 5HDBF 3FRPG 1CVSC 1F4WH 1YECL 1QRNA 4KK6D 1KNOB 4AYSA 3V4VH 2J12B 3GLAA 5LNEA 4YE4L 3UC0H 4ZTEA 3UIYA 4K07A 4B41A 1V7MH 4J8RB 1D5XB 3PAUA 4GXUM 3VM7A 3S48A 1DSYA 3WY2A 3QEUA 2DQTH 4N85A 2EADA 1QBML 1VFOA 1HHHB 2APSA 4X9IA 5A2LH 1LWHA 1M6UA 3RWIB 4TQ8A 5D9SB 2I07B 3V6FA 1LO5A 2Y7QA 4LOFA 2WTRB 4JRFA 1OCRB 5HI5C 3L9EA 1R3HB 4HXBL 4JO3L 3DDGA 5CP7B 1SJEA 1B0WA 2PO6A 4OZGB 5E9NA 3ALWA 5E8NA 4Y2LA 2FT8A 4N1HB 4WGWB 4DKDC 2DBJA 4RGMC 3FK3A 2PP7A 3MACH 3AUWB 1SFDA 1AQMA 4P4KB 4WENB 4C4KT 2XU9A 4KITB 4ZNCD 4BSWA 4LHUB 1F11A 3Q5YA 1U8OA 1BG9A 1L9RA 4NGHL 3BQUB 2D7MA 4FFZA 4O02A 1WAEA 5HP5A 5IB4B 1JVKA 5C3IA 4M1CD 4PS3A 3O45B 1YNTB 3PFQA 3CHPA 3ZW3A 2Z6FA 1TPXB 1HHGA 4QRSA 43CAB 2C9PA 1UHVA 1TQBB 4UIMA 1HQRA 5JXAL 1LEGA 1U8MA 2W9DH 4RIRB 1PX3A 5ESQB 1NDMB 2KLTA 1HNFA 3MRBB 1WIPA 2OXHA 1H19A 4WWOA 3O9WB 4U6HB 3WS3A 2YKLL 4GMSH 4PJ8C 4M6MH 4Z7OB 5ADOH 1A3QA 4KUZL 1E8WA 2CBMA 3AMKA 3BZEA 1KXVA 4JLRB 2P43B 1VB9A 2P8PB 4L0ZA 3F7KA 4TUOB 3ILQC 4RCAA 4YBQD 5D70H 1MFBH 3C8KB 2X1WL 3VH8A 2E56A 1GTFA 5D2NA 2XNAB 3A4EA 2OMTB 2IH8A 2Z64C 4P23C 4XMLH 1NL0L 3CFBA 4HS6B 4NIKB 2XT1B 3U4BH 2EYTA 1T0MA 1JS4A 5HGAB 1HEZA 2JLLA 3ZDZE 2J1YA 4UNTA 4HT1H 1YEJL 5I5IA 3FU9A 3MOAL 4YL9A 1D5MA 3IFOA 2WQRA 2ATPB 2NY1D 4ZDHB 3SDYH 1DBAL 3MRFA 1M71B 4ZRGA 5CEXB 4EOWL 1RQ5A 1GAFH 1MPAH 2ILLA 2Q76A 4BGDA 3KYKH 2EVFA 1NMCB 4HZAA 2P5EA 3NK4A 3P02A 4KTEL 4N2MA 1BREA 1L6ZA 2DH3A 2BHYA 2WQUA 3QUYD 4MJIE 5JTWA 1KTDB 2LVEA 4GQ9L 4AGOA 3SE9H 3I6LD 1EIBA 5E56A 5HVWA 3QIWC 3V52H 1J5OH 1NOAA 1MW0A 1TTGA 2QMJA 3A6BL 4NC1C 1T21A 1OAKL 2V37A 4GG6B 2COQA 5CD3B 1AAJA 1U92A 5HPOA 8FABB 5MEPB 1NPNA 2PXYA 2EDQA 4YXKH 4OCSL 4JN2B 3KJ6H 3N41F 4NWTH 1DR9A 3KGRA 4I3RH 3QUXB 1SXZA 4GRWB 3QDJD 5T1KD 5JPMC 2IFGA 1F90H 3BH8A 1YVLA 3DO3A 2KZBA 4D3CL 3E2HC 3KYAA 6FABL 1Z3GH 2OK0L 2X1OA 1MRCH 3TGXA 2ZICA 4JFYA 5KYUB 3MROB 2GABA 4JRLA 2D7TL 2WBJD 5L7XL 1S3RA 3C09B 4I89A 1G7JA 1D7FA 5CSZB 3QR1A 3PDGA 1EAJA 1OAQL 4HD9A 1YCSA 2ZUUA 7PAZA 4GUPA 4UILL 5A2KH 1UWXK 1IBBA 4N4YB 3WUWG 5AFAA 3UCQA 4BJLA 1Z1WA 3GJFB 3MO1B 2FEJA 4OI9A 5T3ZL 1TMCB 3KJ4C 1OGAD 2CO3A 2VITB 3HZVA 1NDGB 1ID2A 2YRBA 3BW9B 3FTZA 3UJTH 3BAEL 5I6XB 2XWCA 4OF7A 4PLNC 3L5WB 2DDQL 5FCSH 2V7HA 1FE8H 2H6PA 4F27A 2FUTA 4Z7UB 1CIDA 3U6RA 4M8QA 1I9RL 4LSQH 1WCBB 4OZ4A 1RMFH 3IS1X 1Q9WA 4L37B 4FMKA 5BZWB 4GP4B 3HG3A 2QL1A 2ZKMX 3D18A 2VO8A 1JXDA 3VFSA 4WK0B 3TESA 4W4OA 1VERA 2I85A 1UXWA 2OBGA 1I7RA 3MJ8A 4XXCC 3D69B 3PHSA 2E7DA 1B6DA 4WWPA 4CKVX 1U3NA 3QH3B 3ZR6A 2YUWA 4RMRA 4E9XA 3VXQB 1ZIAA 2EVGA 2XFXA 3BH9A 3ABKB 3I6KA 3I50H 5I71C 2Y7NA 3MTXA 3CC5A 3PJLA 1ZCRA 1ZK9A 2CRYA 4TNEA 2VW4A 4AEIL 3ML8A 4FA7B 4KHXL 3QXVA 4OIFA 4P5MA 2ZF9A 1E4WH 5TGBA 3F7VB 1KCRL 4LLMB 1LNUA 4GW4B 4DFHA 2B4CC 1FNSL 5DT1L 5E1GA 3WIFB 2WXIA 2QQNH 1JZ2A 2K3TA 1R4XA 3SBRA 1D6VH 5ID1B 3IE9A 2VDLB 1FZKB 5EC1A 2E8ZA 2FBOJ 2GTZA 3D7PA 4TVPH 2DEXX 3MNVB 5EZJB 4PJCF 5C0EA 5AB1A 1DHKA 3VFMB 1T7WA 4LP4A 4LCWE 4AVKA 1T4KB 1LO0L 1M42A 1L9TA 1PGRB 2JJTA 4PBDA 4S1DC 3GZKA 4YSTA 3DI2B 1OM3H 1E3ZA 1KV3A 3KYNA 3ATAA 3FTYA 3KWXA 5FO9B 4WO4A 1AQKL 2EDHA 2VXQH 4QT5A 1PIFA 4U1KA 4YK4B 2ICEC 3PGCA 5FUCE 3RB5A 3V0FA 2IALA 1TFHA 5DLMH 4IOIB 4G9FD 4DWHA 4K3HA 4JFFD 3EZJB 1M53A 4F7MA 1GTNA 1WZLA 1CICA 4AYBA 4JJ5B 4IHBA 1T1XB 2AZUA 4JG0L 2WVVA 4BK4A 1JZ8A 3V8CA 1C16B 1CWVA 4KV5F 4HWEH 3L3OA 1W15A 4YHPA 3QXAA 5B7FA 5IWLA 3V5KB 2O5YL 1BVOA 2FX8H 3BP6B 1ANUA 3EG9A 3ESVF 1P4UA 1MFEH 3LN4A 2Y22A 1I3UA 1INDH 1RFDL 2VH5L 3KPQB 4RESB 2ZUVA 1G9ML 5J4MA 2YXMA 1KMGA 1ZXQA 3DJ9A 3B2UC 5C8JA 1NSNH 3K2IA 4Y2DA 5I15L 4ETQB 4YDNA 4PY8J 4PP1C 5AZEH 2L7EA 5T5NG 5GGRB 1RZPA 4QHMB 4DP5X 1LK2A 3T6VA 3D4YA 4KNQA 3JVFC 1T6BX 4FD0A 4CVZB 4PTTB 1YMHA 5ABZA 1OZUA 2JK5A 3RVTD 3RQ3A 2OX5B 1OF2B 5KOVC 2HFTA 4YHKL 1R19A 2OZ4H 1MJUH 4XE0A 5I73C 3WY1A 5I18L 2NZ9D 3ELAT 4EBQL 5I1EL 1JGDA 5I1IH 3WGUB 5E9DE 1F6FB 5IJKA 1IQWL 3M1BA 5A3IC 2ESVE 2ENQA 4MTMA 5DD5L 4AXWA 4J4PD 2XZCH 3V0WH 2W38A 3LXCA 3UMNA 3EYQD 4OCNC 5A2FA 1MHPL 4GP5B 3RDTD 3DVFA 4TNWF 4X98B 1RV6X 1I9EA 4Y2OA 2QLYA 1MW3A 2YAEA 4U4BA 4MAYD 3OAZH 1KIQA 1UT2A 43C9A 4NQCD 5SWZA 2C3XA 1IIIA 4HP5A 2GK0A 4AYEC 4CADA 1U8LA 4ODXB 4ELMB 3MLUH 4JPKL 2LLLA 4JPIA 4DVBA 3L1OH 4NKQB 1J0JA 1S78D 3AXLA 4H8QA 4P2QE 3ILDA 2Y2WA 2APXA 4AEHL 4XP1H 1HWHB 2HLAA 2ZZUT 2NNXA 5DHVB 4D0BB 3FU0A 4OZFB 1T66C 4JRYA 2G3MA 2ZCHH 4UNIA 5I0VA 4ISVA 2R8SL 4G6MH 2A1WH 5EHFA 5AVWB 3NACH 5KBMA 5ES4B 3O2WL 1X4YA 3C5ZA 3QS2A 4CVXB 4YXHL 5E99L 1MHHB 4DKAA 5EF2A 3PNRB 1Z5LA 2AITA 1HQ4B 1NM9A 1P6FA 1XB3A 4OLUH 5DQ9B 4KQ3H 1FG2B 3VH8G 4N2IA 3CZSA 4JFSA 2BLFA 2X7LA 5GS2H 2W0FB 4UMGA 1D5RA 3QORC 5ICZA 4Y19E 4KTGA 2R51A 1MLBB 1L7TL 3HZKB 3VCLA 2K4WA 2AJZB 2D7NA 4WHCA 4N8UA 3CBRA 1QSFA 2Y5EA 3DGDA 1PLGH 3GKZA 4RFNC 4KRPB 1NKGA 1SM3H 1DVQA 3NCCB 2ZKHL 3QFDA 3CVDA 3F5WA 3OAUL 2XQBL 4QGYA 4UM9B 1S9VB 5AB2A 4HMCA 1TQCC 4R2GB 4HIJA 4ZUTB 3IKKA 3BDBA 5C0BA 4D9RE 2Z3FA 3FO2B 2H3NA 4B9KC 3AVEA 5DZPA 1IM3B 4L4TE 1T89C 4UTAL 3FF8A 1TU2A 3QFJA 4RDQF 1KBVA 2CK0L 2FO4B 4O5LH 5EC2B 3VGHA 5LQBH 1JXFA 4NS0A 2NW2A 1QUPA 1RLWA 5DRZB 3TYFA 4EVNB 4J6RL 1P4BH 5ENWB 1KJ3L 3DRQA 4WI4A 2OW6A 1X5MA 3NABH 4NN7C 2GBTA 1ZY9A 4XNMB 4MD5B 2X88A 5I5RA 1JGLH 2F08A 2APFA 2WBKA 4YDIL 2KDGA 5KSUA 3G5YB 3CFNA 4YFLF 2Z34A 4NWUL 4OCYH 3ZKQD 1AO7B 4W68A 5IGXL 3REWA 2KH2B 2EP6A 2IOOA 1UH4A 1IM9A 2D7OA 2VGLM 2BOLA 2FTAA 2NLJB 4L29B 3MJ9H 3VXRB 5A2JH 5EU4B 2Z1PA 1KYUA 5TE6L 3BP4A 1DVUA 2UY7B 4YQXH 3QDHA 3S4SG 1A1MB 4XCYB 3ARBA 4ZTPL 2UYLA 3TTYA 3EO0A 3BHBA 3ULUL 5AVTB 4PJFA 3MGOB 1JZ3A 3MV9E 3AB0B 3MRPA 2X6UA 2BCKB 4XZ4A 4KK8D 4ONOA 4UTBH 2DRUA 3MBED 3MNZA 5E4EC 1KSRA 3JWOC 1GCYA 5FUCC 2GJRA 3KPMA 1VFMA 5J6HB 32C2A 3SE8L 1AGDA 5GGTL 2IAAC 3CNKA 1UB6B 3TO4B 4XXWA 1NMBH 1TIUA 3FQWB 3ZY7A 1BIIA 1Z5YD 4JJHA 1VADB 3V4UL 4OCXL 4YZFF 2ARJQ 5DK0A 2FSEB 1XGYH 2HTKC 3UTTD 3CFKB 5CAYB 1QG3A 1ZD6A 4PJGA 1YPZB 4P5RA 1CJYA 3B2VL 4X6FA 5DFTA 1ED3B 2X4QA 3LIZH 2P52A 4G8IB 1RZGA 4J3XA 1L5GB 1MCKA 4L3EB 2BVOB 1RVFL 1S46A 4XH2A 4BRVA 3LY6A 1I1CA 1E4HA 3Q7JA 3PAVA 3KBEA 3BJLA 3IDUA 4Y19A 1BZ7A 2HH0L 4WWKB 4Y16D 2BK8A 5C08B 1QPPA 5ISZE 1F6AB 3DK2A 3I6SA 3CSPA 1U3HD 4KI5E 1OPGH 5BXFA 1N7MH 4JZNB 4R97C 5KBDA 3PL6A 1SN0A 2HRPH 3U0WH 2XV2A 3TBYB 2Y5TB 4X6DB 1A6UL 1SJHB 4NB7A 1SUHA 1YECH 5DJDB 1NUNB 2NDFA 2ZXDA 1JXKA 3IDXL 5GPRA 4Y4FD 4ZW5A 4YE4H 2MHAB 2Y3AA 2A4CA 1ZIBA 3CCHB 2H1LM 2IQAB 1K8IB 2MFNA 3LKOA 3P3RA 3DTUB 3FQ2A 4ANXA 4UM8B 1CGYA 1QBMH 4LVNC 4NO3A 2ARJB 1W80A 2QPFA 5T1MB 4EUPA 3BLKA 2X4NA 1UVQB 3IJ9A 5AYQA 1HILA 4XWOD 2XN9E 1GYCA 4EO5A 4HXBH 4JO3H 5ELIA 4Y5XC 3VSTA 1AZVA 4UOW1 1NANI 1IGFL 5L8JB 4LHJB 3G9VA 4P5TD 4URKA 4JMXA 2J8OA 3EHBB 1ETZA 4OZIB 1XEDA 2VZ1A 4MB3A 1WFJA 3QNYB 2EEDA 2R2CA 2XPGB 3E6HB 4ZUUB 5DD6B 1IAII 1X9RA 3HS0C 5ANMB 2J88L 4XP9L 1T2QL 3VFPA 4BUHA 3M6DA 3OQRA 2C1PB 4NGHH 5IHUL 2WBWB 1URIA 1W72A 1OP9A 4PHXA 4D94A 5CJOL 3T0VA 4U1JB 4HKJB 5EOQL 2PTTA 4MNGB 3ZQWA 4K71C 4ZXBB 3TPKA 3A3YB 5ABDE 5IQ9B 2CPUA 5D7JD 5M94B 1S7VB 1JZ5A 3B7YA 4DETA 3EGDA 2IWGA 4NKMA 4O51B 5DUBB 2XOTA 3IB4A 1H8LA 5J11C 2CPCA 3IKCA 2X0UA 5FDWB 5IK3B 5D1QD 3GSVB 4FJ6A 2ITFA 3ZMEA 4IRSC 5J6GA 1T04B 4G8AC 4QDGA 4WQOA 2A74C 2YK1L 1IC4L 3QIUC 4JFPA 4UDTA 1OGSA 3F7LA 1TQTA 1P5UC 4KUZH 4RBPH 4X6CF 2DWSA 1NCCL 3VXOA 4ZMNA 3P77A 2HAZA 4MS6A 1UASA 3DX1A 1JMXA 1NCAH 3X13B 2WWMC 3ZZLA 5DQDL 3TO2A 1H6FA 1TR7A 3KAAA 1BVKB 5FO8A 4J5VA 2CIKA 1M6OB 1I8LA 1FUNA 2VLRD 2C7UA 4ZMLA 2VR8A 3UAJC 3TN0C 1YEJH 1NCTA 3MOAH 3V0VB 4J3WA 4RFEB 1GGTA 4TM9A 1DBAH 3FMGL 1F2XK 1B90A 1BD2D 4YDVB 4EOWH 5KVGE 3RNKB 2VL5A 3MRDA 4FYRA 3BMWA 3DV4B 5I9QB 4AQOA 1W0WA 3KBPA 1S7TA 1WT5A 4KTEH 2BSBA 2H6UA 1M7DA 4UT6A 4D8PA 3MCYA 1SGKA 1QYGL 1TETL 2W9EL 4OFIA 4QY8B 1WC7B 4GQ9H 5IBLD 4LLDA 1WG3A 3VB9A 4WIQA 5D6CB 3ZIMA 3UGEA 1BM3L 4AQ8C 3EFOA 4WJG3 5KEZA 3LRSB 2P48B 3HE7A 1AXSA 3A6BH 4LZKA 3ULUF 4P05A 1OAKH 1FFRA 3FO9B 4APXA 3BIAX 3QUMB 5I16B 4HIIB 3LD8C 3PV6A 3ZHKA 5FA4A 4OCSH 5EU3B 1JTPA 4UOJA 3SJVD 4M48H 4JGNA 4D3CH 3T09A 3T2LA 6FABH 2OK0H 1MVFA 2WMPA 4WUUD 3K2KA 4KTDL 1DBML 1UFGA 3QUML 2H0FA 1SLVA 3O4LA 1RZJL 2WO2B 2D7TH 2DYRB 3O3BA 4K7PL 3DMMD 4KO9A 3QUZD 3BYYA 5E1QA 3BIKA 1U8QA 3QAZC 1R3JB 4LGSB 2WUBL 4ZSOA 2NY2B 4ONHB 1OAQH 4GRWH 2OTWA 1W6LA 3LKNB 5DJAB 5B1BB 4NO0B 1WA1X 4IOFD 4OGQC 1EAPA 2YN3A 3KDPB 4UILH 3APNA 3ARRA 1IAIM 4HOMA 4PG9A 5HVFB 4JG1L 4H2CA 2WIIA 4QRBA 5L6YL 1J1XL 2XKNB 5T3ZH 35C8L 4WLCA 2B08A 1H15B 3V79C 5INCB 2XBTA 2CDGA 2VNCA 3K4ZA 2E4FA 5AW6B 5C07A 3TZVA 3AJ7A 2OAAA 3BAEH 4P57A 1MJ8L 4UTCA 2EILB 2OYLA 1WS7A 1RXLA 4IKLA 3Q2LA 4QRPB 1I75A 1YEDB 4H25A 2DDQH 3FUKA 1PVHA 4R84A 2ZJSH 3Q8EA 3GJFH 1U58A 3QXDA 1I9RH 4GAAA 3TH4T 3WEXB 1I8LC 3OQ3B 3QA3B 3ZIYA 5FYKU 3OB0K 1OP3H 2J72A 4KI5C 1WIOA 2X2IA 3FQUB 4PAZA 2AC0A 2CLRA 1A21A 1GVIA 1YHPA 4CGUB 3L8QA 1RZQA 2EQDA 4WI6A 2OJEA 1YDPB 1JN6B 2RFXB 3LHAA 3OPUA 3HRPA 1OP4A 2VLKD 2CJSA 5EULV 1EFXB 3GIVB 5E8OB 4V1DE 1URLA 2DOCA 1UXSB 3RVVD 4YHZL 5JHDD 4F8OA 3S0PA 2DL2A 1MCHA 1DEDA 2YMTA 2HLFC 2VQ1B 3OLDA 3UBXA 2IG2L 1G87A 3HVDA 4KHXH 5A6LA 1TYEB 4PP2B 2HSIA 2NSMA 4UOZA 1KCRH 3HHSA 4OCRL 4DN3L 1FNSH 1MCRA 5DT1H 3VG9B 4XZUA 1IAKA 3VD5A 2AW2A 1GZQA 1WHPA 5HDBE 2YRZA 1QRND 1J0ZA 1WAAE 5ILTL 1CF8H 3MR9B 4ATWA 5C09E 5H8DA 1I1AA 1VZIA 1BLNB 1S5IL 5I1KL 2R23B 3QQ9D 1BOYA 4JFEA 4AV4A 1LO0H 4X4KA 5JO5B 3NIDF 4XPHL 1EVUA 1UATA 3O11A 4K8RD 1AQKH 1S5HB 1ODUA 1WITA 3RTQB 1B4JL 5FOBB 4XVTL 4N2OA 5GSVB 1FH5L 2VDLH 4X0KB 2M8XA 3LTVA 2PO6D 4XMWA 3ZU8A 1IGTB 3C6SB 4KKZA 4JFVA 3GF8A 2WXHA 3ZRSA 4FFTA 3IFPA 3U7AA 5K9JL 4DPCX 5GS3A 2MKWA 4P48A 2GUOA 4JG0H 4XVUC 5IFJB 3CHOA 5K69A 1H3WM 4MXVE 4NUGL 3QZBA 2O5YH 3QSKB 4TUKH 2YXFA 4HJ1A 5TH2A 4AUUA 2C9VA 2JKTM 5HHPA 1S7WA 4ZYKA 4ZUSB 3L5HA 3HG1E 1YMMA 5D7SL 5CBEB 5LBVA 4AQEA 4NI3A 4U1SA 1RFDH 2VH5H 5D2LB 2MRYA 2O61A 2EDJA 3SDXF 2BW5A 1G9MH 3M17A 4APQC 2GAZB 3LZNA 4FP8L 1MREL 3INUL 3E1ZA 5EUOB 4R7NA 1HTYA 5I15H 1GMIA 1MQKL 3IFNL 2PUQT 1KY6A 1YY8A 5GGSY 2X4OA 5JHLL 4JR9L 5E94A 3QZWG 5H94A 2FR4B 3KH4A 1WTLA 3BSHA 1XO8A 3HC0B 3OKNA 4GKZB 4JZOB 2P45B 2N1KA 4NO5B 5AW9B 5FFLA 3QT2A 1OHZA 4EUPG 3KWWA 1C08B 3OJDA 4EIBA 3WO3B 2QELA 4Z7QF 2IOIA 4LLUA 4YHKH 3EYVB 4WCYL 2H2SC 3E9TA 4WFHD 3MV01 3ARVA 4ZX6A 5I18H 1USQA 2AVGA 4QHNB 2H47C 3BC9A 2FQGA 5DJ8B 3OXSA 4EBQH 1H8OA 5I1EH 2GKIA 5C0ND 2KQNA 1CGWA 1AKPA 1FGVH 1IC0A 1LWRA 1CLOL 1VESA 4FQCH 3FN3A 1X5YA 3DTXB 1EZLA 3P9LA 4GBXB 5K9OB 4TVUA 3G6AA 1MHPH 3DHJA 3Q8CA 5E1AA 4Z3HA 2R69A 3HRZB 5DD1L 3ECQA 4DERA 5D96C 2VR6A 2FT7A 4FXKA 2AXWA 2P5ED 4N9GA 5IQLA 1BBJA 2WANA 4KBPA 4JM4L 3W39A 3G08B 1JRHI 4HUWA 4JPKH 1JNJA 2YSTA 3NIFE 1FV1B 4I88A 4JZJB 4HXAL 3C75A 1IQDA 1ILUA 3H9YA 4Z7VF 4PRPB 4AEHH 1LP9A 3PP4L 4Q97A 4D0DB 4LNVA 1KDIA 5EUKB 2ICES 3AREC 2R8SH 1A6TB 1AP2A 2YBRB 3P69A 2PXYD 1IVLA 1XBRA 3O2WH 3TIDB 4WGKA 4YXHH 5E99H 3ARTA 4RSVA 3RTLA 3S37L 2VZSA 3UO1L 3ZKXC 4FKHA 2Y5QA 1TJHH 2FEEL 2IAMA 3HNVL 4FQXA 4CJ0A 4GSDH 4IRZL 5DHVH 3QDME 4FLQA 4OZFH 1OALA 3WJMB 1L7TH 3KYMA 1REIA 5C0CB 1W2KT 4ZW3A 2RCSL 3VG0L 1N5AB 4MJ5A 1Y18A 1ZKAA 3AWFA 3BAIA 3NJMA 4W9FC 1P1ZA 4NEHB 1U91A 3HG1A 1BEXA 1E7VA 3VYNA 4QJ4B 4NRZB 5A6MA 3OAUH 4GXUN 2XQBH 4BDVB 2VRQA 4QD2E 1ZHKB 2Z0BA 3R0NA 4XMPL 5DURB 1YEGH 4QLWA 4R4FL 3BEWB 3UAEA 3QDGA 1CDIA 3OHXA 2OFQA 4ZD3L 4CC4C 5B3SB 1ND0A 3E6FA 1D7CA 4BFKA 5KVEL 2CK0H 3GS4A 1P4IL 1GGYA 2EDDA 4J6RH 4XCNB 1KJ3H 1UJ3C 5KSAA 1TVDA 1I7TA 1EUUA 2Q6WB 1EEZA 4YDIH 5DMKB 5IBTL 2LE9A 2OQJB 5MEQB 3GXUB 3VMNA 4NWUH 4NZDA 1JFQL 3NZ8B 5IGXH 1E28A 3HIZA 4NZFA 1DE4B 5GHWL 4A38A 1FJ1A 3HZYA 3KPLA 1J0HA 2QPSA 2V6HA 4MCZB 4GIAA 3N40F 3ARDA 3BP5B 4HG4K 5F3BA 4LASL 5IMLA 4KY1H 4AT6B 1DCEA 2GHZA 2XYBA 5TE6H 4HKBB 5BV7L 1DUYA 4UANA 3GTNA 3TWCH 5KYXA 1HNYA 4M3KB 4GQPH 3G04B 4OGYH 5IMMA 3VRIB 3ULUH 3RFZC 3CUPB 4Y9FA 4F33B 4BFIA 1KB9K 2VSCA 4K94L 5BJTA 1A7QL 3DUSB 4DPBX 2IH3A 5HYSG 3NK3A 4RA3A 4FFYA 4U33A 2DWDA 1PZAA 2AAAA 2X2JA 1JPGA 4E9TA 2V2WA 3VI4B 5A3ID 5C9JB 5SX4I 3E7JA 4LSPL 5J89A 4G6AC 4R7DA 3MRLA 3SE8H 5HDRA 5GGTH 2BZCA 4F2MB 1TZGH 4GS7C 4S0HA 2EE9A 2OJZL 4O2EA 3K71A 2HKAA 3MPCA 3LSOB 4OCXH 3EADA 3GSQB 3M7OA 2Y1VA 4QXTB 2PCPB 4FQXC 4JFZL 1H8SA 2O6PA 1KB5A 1JPFA 5E00A 2ZNWA 2ROXA 1ZVHA 1LD9A 2BVUA 1DN0B 3EH5B 3GSNB 3PGDB 1A1OB 4WO4D 5E5MA 3WE6A 1ZS8B 4WI9A 3B2VH 2XWTA 4YDKL 2AXFB 2EXWD 2ZOLA 1S9XB 3DBXB 6PCYA 3O3DA 1SYSB 3DVIA 4KPHH 5B4MC 3QG7L 4P4RA 1KTLB 1I8IA 2XZZA 2AVFA 2FQFA 2WGNB 1CICD 2FLBT 4U0RB 2IPUG 1C12A 3GSNL 3FB6B 4HW6A 4DP6X 4XP6L 5C7ZA 1G6RB 4KV5E 1UZGA 5D93C 3QQDA 5E1HB 4ZMVA 3T1WA 2V4LA 3GUTA 1PNDA 3KEDA 1A6UH 5EZOL 1YUKB 2N7BA 3IDXH 4Z7NB 3M45A 2GK2A 5IIEB 2HTLC 2D9CA 3GMQB 4U1MB 4DGVL 1JVLA 4I1NB 3IFLL 1G6RL 1WVZA 4Y2DD 5FGSA 1SFHA 3GXTA 1AD0A 3VXTB 4BBWA 3HE6A 2HP4A 4K7PX 1YA5A 3U4EA 3R8QA 1ML0A 1DQTA 1KZQA 2DWEA 3RURA 1MOEA 2HX8A 1QR1A 5DYFA 4Z78A 5T1LD 4PJHA 1A5FL 5LCVL 1I8KA 1O6SA 4JQIH 4LKCB 1WFUA 5CSGA 1JSYA 4RGOL 4J3OF 5J8OA 2HJLB 2EYRA 4NN6C 1XXFC 4XI5C 4JQXC 1QSEE 2ADGB 2H45A 2J88H 1T2QH 2ZG2A 3FB7A 3O3EB 4XP9H 3L3JA 5IHUH 2MQGA 3N42F 1HJCA 4GKNB 5CJOH 2DQFA 2A83A 1F0LA 4NQDA 5EOQH 1U8JB 3NJJA 4MB5A 1HS6A 1D2PA 1N18A 1S7RA 3H7BB 3MDJA 1UWYA 4LEXL 1QNZL 3P73B 2O26U 1XX9C 4OV5B 4ODUB 2XETA 2UZIL 3EAKA 3SYCA 1N5YL 2L04A 4WEBL 3FTWA 4N0UE 5I75B 2YEVB 1NPUA 3D3VE 1DJYA 1PFCA 4IIZA 4HIEB 3MRJA 3WFDL 5I28A 5SWZD 5TQ0L 3P3TA 3SGJC 3JV4A 4E9RA 3V5DB 3EOAA 1WRFA 2YK1H 2FK9A 3BESR 4S0SD 4FXGA 3VD4A 3RGVA 2FJHB 4LCUB 4MD0A 3SY0A 4GI8A 1NCCH 2VMFA 1M7IB 4PJCA 4CMMA 1X5HA 3MBWB 4YHNB 3AG2B 2Z31A 2QGCA 2NY6B 4PRBA 3EFFA 2KYIA 2KZ1B 4N1CA 4JRYD 1OLLA 3TVMB 4KKAC 3HI1B 1D9KA 4PV1C 5CP3H 5B39G 4WV1B 4ZMWA 3NUKA 1Q9KA 1U4FA 3C5ZD 3O3UN 3TH2T 1FL6B 4AK2A 3FDWA 3SQRA 3MFGB 4JEGB 2FHFA 4C56A 5EFIB 4YE0A 3OAYH 3Q8FA 1F56A 4HIPA 2JIXA 1U8HB 3U6XS 4Z7WA 3RVWC 3ARUA 3NPSB 3QIBC 5IUSA 3A4FA 1MCJA 4DGYL 5EBLA 5JIHA 4E9YA 2G4EA 3QCUL 1QSFD 1R24A 4IOSA 4CSTA 1QYGH 1TETH 2W9EH 2JNZA 5C3LD 3U36B 4LCVA 4BH8A 2DQUL 1JZGA 1BM3H 2FATL 3BPNB 4XE5B 4DZ8B 5KZCD 2H0EA 1Z9NA 3TURA 2V2XB 3MX0B 2IDTA 3NJIA 1IGIL 5C0BD 2OCCB 3K4DA 3VD9A 2HN7B 1QI5A 3RWFA 1TZIB 3F58L 2R7EA 3QFJD 2Z7UA 3CFTA 4XC1L 3HLAA 5GS1C 1KDJA 1DJSA 5TFSH 5DLLA 3A4DA 3AMLA 3ZDYB 1D7BA 1CQKA 1N10A 3KGSA 5EEVA 3ZTNL 1CD1B 4KFMA 1SVZA 1XZ0A 2NYYC 1JZIA 2CCWA 2QJDA 4KTDH 1DBMH 3QUMH 4NJ9L 4UCFA 3U7YH 3V7AG 4MNQB 4RWYL 3CLEH 3GDCA 3OKEB 1RZJH 4OZHB 1U33A 3FN9A 3JVGC 3V6OA 5J9PB 5GGUA 4YSUA 2WUBH 1IM9D 1EA9C 3D39B 5I23A 1KBWA 4LLWB 3SE3A 4A6YB 4DW2L 7PCYA 1SYVA 4PJDB 3LB6D 1HESA 1VGEL 5MENB 2XX1A 4JG1H 3HBQA 1J1XH 5I1DA 3IU3B 35C8H 3ARBD 3ESMA 5L6YH 2XA8L 2XJKA 4FTVA 4G7VL 3LEVL 4N0UA 3OKYA 4A7SA 5EPMB 3CBJB 5CEZL 3KLQA 4NSKA 3FULA 4IGBB 3W0WA 1E3FA 4DFIA 1X7QB 3KPRE 1MJ8H 2JJUA 2X9WA 3BQUC 3BT2L 3PYCA 2XBDA 2H26B 3EH4B 3ZKMD 4DKFL 5IHZB 1B3IA 1JIBA 1AG0A 1RK7A 4G6FD 5HHNB 3CSGA 1KWKA 3MRNA 3IJHA 1TPXC 5ERWB 4PMEA 5FHBH 1FYHB 1Z6JT 4YZFE 2Y6SD 3NJXA 1QAWA 2KI6A 5J57B 1GOGA 4Z18A 3VWJB 4Z7NF 1RZIA 4QRQB 5B1KA 5INDB 3VFVA 5F1OB 4YSQA 5KJ7E 3O9WC 2VLJB 4ICXA 2D0FA 4OD1L 4A2EA 1KCSL 3D25B 4Z0BL 4EF3A 2CDFA 2FH6A 3OWRA 4Y19D 2IG2H 1OK8A 1QZ1A 3O6FA 1NGZA 2WWMD 5LAPA 1S9KC 4LHQB 4OLEA 3WHXA 3PL6D 4OCRH 5CM1A 4DN3H 1A02N 4L0YA 2FQDA 5TQ2L 1NCUA 4L4VA 4P3WA 5HJ3B 2CQVA 1G7MA 5ILTH 5FYKD 4HOZA 3QJTB 4RWHA 1KLGB 3CLFL 3S37X 1FYTA 3DOIA 5I1KH 5I8EA 3UTSE 2Y7LA 2YPVL 3JUZA 3QC5X 3QNFA 2YHGA 1NCWL 3KNBB 1IU1A 1KPRB 2YZ1A 4FYQA 1NMCC 1QSZA 1TZHA 2WXLA 3B7RL 3F12B 1C8QA 2CCVA 4XVTH 1FH5H 2XIBA 3DX7A 3B3IB 1G7IB 4ESKA 1MAKA 4PJ6A 3X1BA 1F4HA 2V3EA 1YSOA 3IMWA 3QGVA 4QHKJ 2E6PA 1FNGA 1QLFA 2DYPA 3HFML 4J3UA 3STZA 1ZE3H 5K9JH 3MVSA 3GMRB 3OPZL 2RMNA 3BZFB 2N7SA 1UUNA 1WCQA 5CD5C 4AIEA 1SOXA 4CVWA 4GRMB 1TJMA 3FH8A 4M4PA 5EBWB 3V6ZB 5HYQB 5A40E 2UWEA 4KKQA 2WWNA 3UTZB 1JYXA 3GIZL 2IWKA 3CDZA 2FZ3B 4ZQTA 5GGSA 5D7SH 5HTSA 2Q86A 4X9FA 3U30C 4CL7A 4KNSA 4MZRA 1IE4A 5IJCC 1Z0MA 1QHOA 1QTPA 1OB1B 2HA1A 1HOCB 1MREH 2HT3D 3INUH 3K91A 2HYMA 1Z0NA 4MAZA 4NAQA 3KPRA 1MQKH 3IFNH 4Q2ZA 2OR9L 4JKWA 3C09C 4JR9H 3RP1A 2VAAA 4JFQB 4NCC2 5HDWA 5DSCB 4AK1A 2ZWYA 2YOCA 4BXSV 1ZLDA 4YVUA 3T8VA 1WWWX 2IDUA 4AJ0A 2GY7B 2OMYB 5JW3L 2AXGB 4H44C 2E75C 3Q6FB 4PB9L 3EJPA 1PG7X 3C5XA 2H32A 4IBWA 4X6CE 1SN5A 2VERN 1BBDL 1FVDA 2BP8B 4N1EA 4BH7B 1HL8A 2VW7A 5DJ6B 1JI1A 1RCYA 3DIFA 2J8HA 2Z1KA 1HXMA 1PSKL 3TJHC 4DHLA 1MNNA 2WXFA 5CO1A 1CLOH 4ZMPA 1NFIA 1HYSC 4AM0A 4Y1AA 4NQEE 4KXDA 2BOCB 5F7AA 1S4IA 2IBGA 1E67A 3AS1A 4J2XA 1BVLB 3OXRB 1RJLA 2JELL 1BJMA 5D1XE 1MEXL 3IU4L 4PGCA 5DD1H 5LKNA 4HEPA 3CSYB 4M43H 4U6TA 2X4PB 2D4FA 5DZOA 1MWAA 3JTSB 5KG9B 4OI7A 3FUIA 3FC8A 3E1F1 4FERA 4JM4H 2UY6B 2CLZB 1PW3A 3QDJB 5T1KB 5K9KA 1BJ8A 1JV2B 2ADYA 4LP5A 5DK2A 5J0BA 4HXAH 5IR1A 3TC9A 4R4BB 3HE7D 3AROA 4FQLL 3PP4H 4MXWL 4FYSA 3ULUE 3WN6A 2AF2A 1PLBA 2B9BA