2O6DA

Structure of native rtp34 from treponema pallidum
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
158
structure length
158
Chain Sequence
FDEFPIGEDRDVGPLHVGGVYFQPVEMHPAPGAQPSKEEADCHIEADIHANEAGKDLGYGVGDFVPYLRVVAFLQKHGSEKVQKVMFAPMNAGDGPHYGANVKFEEGLGTYKVRFEIAAPSHDEYSLHIDEQTGVSGRFWSEPLVAEWDDFEWKGPQW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Tp34 (TP0971) lipoprotein of treponema pallidum: implications of its metal-bound state and affinity for human lactoferrin.
pubmed doi rcsb
source organism Treponema pallidum
molecule tags Membrane protein, protein binding
molecule keywords 34 kDa membrane antigen
total genus 33
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10634 Iron_transport Fe2+ transport protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2480 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2o6dA00
3LZQA 3PJLA 5I0VA 2O6DA 2O6EA 2O6FA 2O6CA 3LZRA 5I0XA 5I0WA 3LZLA 3LZNA 3LZPA 5I0YA 3PJNA 3LZOA 3NRPA 3NRQA
chains in the Genus database with same CATH superfamily
1XZWA 4P06A 1HESA 4FQCL 2KL6A 3BSZH 4JL2A 4EIUA 1NC2A 3PV7A 1PTZA 1Q0YL 5J1AB 1AMYA 3EUDA 4OI8A 4LLQB 5CWSA 3TH3T 3CSBA 2HAZA 4S11A 3SD2A 3L5XH 3I02A 3NQIA 4LRIA 1YPZB 4R83A 1GSMA 3VD1A 3FZUC 4EI5A 1IAIM 2HJKB 4PU2A 5BPPA 1S7SA 1KBBA 1PGRB 1OK8A 2J1YA 3FQYA 5HYJB 2D3LA 3IJHA 2J72A 5C0ND 3JVGA 1WHOA 5IBLD 4R84A 3ATBA 3MGOA 3OQ3B 3D3VD 1TQWA 3BVXA 5K9QI 3HOGA 4PWIA 5HHME 4PWJA 3KHQA 3B56A 4KMTL 4P46C 3O41A 3O4LA 4O00A 1MI5D 1RURH 2APTA 2FT7A 3FU0A 1NFIB 1BZOA 3GTNA 3SKUD 4Y9BA 4JEGB 1HT6A 1NWPA 1P6AB 3HW7A 5C8JB 4K8RH 3ARGA 4UYQA 4BSVA 4MNGE 1YYML 3BVDB 4MHHG 4NQDD 4YHOH 3Q7JA 5DO2C 4NZUL 3VD5A 4DN3H 4EVNB 5LCVL 1ZT1A 3JT2A 4NI3A 5GSVB 4XVTH 4F2MB 1AKJD 2A6JB 2WO2B 3KLLA 1KCBA 4F33B 1UA7A 4L8BA 3GMRA 2YRLA 2VLKE 3P30L 3US1A 5D2NC 2E6PA 4OLUL 2FUQA 5I8KH 2VLRE 3ARBD 4K9EH 3C87A 1JV2B 3V4VH 5JR1H 5TPWL 2FR4B 4X0KA 4H20L 2CLZB 3HPLB 3PIQB 4CUCA 1JFQL 2XYCA 4LSSL 5J9PA 2ICEB 4FYQA 4PJ7E 1BPVA 4UQ3A 1SJEA 1SPDA 1M7IA 1S9VA 1N6QL 3UABA 4YO0A 4X98A 4GRLD 1DLFL 3ATDA 1BVKB 4WNQB 4NJAL 2VR4A 1RSYA 1MN4A 3ZIMA 2Z4QA 3B37A 3HB3D 5D6DC 2O93L 4K9JA 3F7VA 4LCUA 4O5LH 3T77A 4K9EC 3S2AA 4PJBF 1SEQL 1F8TL 2R4SL 3PFQA 4EXPX 5ID1A 1CYWA 3QA3B 1TVBA 1JWSB 4X5XB 3G04B 5IW3A 1T5WA 4M02A 4OF7A 5IWLC 1KELL 4JN1H 4N87A 4OZGB 1LWJA 1OCCB 1HWGB 3H4FA 3GSXA 3V2AR 2OJZH 2NNXA 3Q8EA 4JO1L 4WW2B 4QXUL 1MCPH 5D9SB 2NXZC 3X12A 1UT9A 4ZMWA 2J4WL 3PWVB 5BQ7B 4OLWH 2IBZY 3GSWA 5KYNA 1WEJL 1FDLL 1AOHA 4PJCB 4HGKC 1U8IA 3WJMB 1B2WH 4BFIB 3QDJB 3UROR 4ANUA 3FQUA 5JIPA 4URKA 5FUZL 4EDWH 2XETA 1IAKA 1NCUA 2AFNA 3VXPA 5DJYA 4UIKH 3RHWK 2IIJA 1UB6B 3LRLA 4JLRA 2J1WA 5EOCL 4L3EB 3MFFA 1A6PA 1QEWA 1VEMA 3K46A 1ORQA 4D2NA 2NNFA 4A6YB 4FQ1L 3QHZL 3G5YB 1UASA 2YD9A 4Y19A 1YNLL 4K0OA 5DJXB 3CMOH 4O2EB 3X17A 4OJAA 4EQ2A 4V2CB 5E8NB 4Y4KB 4U6TA 5IFAH 3L4TA 5IOPB 1WJ3A 5AOJA 5AW9B 4MFHA 1MJUL 1CDBA 4UOZA 2W0LA 3KPLA 3FAWA 4PJHB 1QI4A 3LMJL 3QJOA 4MBRA 2AC0A 4H25A 2XQYG 4HUKB 2IANB 5CIPB 3VX1A 1A21A 3L7FB 2CJSA 2LOEA 1PKQA 1MJJB 2QBWA 1U8JB 3MOAL 4HU2A 3W9EA 3VRJB 5KSAD 4Z5RB 3IMBA 3N1MC 3NVQA 5JXEC 2RALA 1JAEA 1PD6A 1JP5A 2DKUA 5ALCL 3WUWG 5B8CC 5E9NA 5IVOA 1SHSA 2F7RA 3VFUB 2XZCL 3UP6A 3UTQB 4NP4L 3HAEH 5EDXA 2YIHA 4TNGA 3PJNA 4Z23A 1JVLA 3BJ91 1HKFA 2AKRB 1ZE3H 4P2AA 2G3MA 2OX5B 4LCWA 2HRPL 3KBFA 2COVD 2QHRH 4Z8FL 4ODXB 3QUGA 1UOVA 4CAGA 1FFQA 1YJDC 4U1GB 3ZTNH 5KAQG 5ECJE 1Z5HA 2VQTA 5HVGB 3CFKB 4IRJA 2YUXA 4PV1C 1DP0A 4XB8A 3TBCA 1WPCA 1BOGB 2AEQH 1CXIA 3SDXB 2YQGA 4IRSC 3L4XA 1I7TB 3LNIA 2PW1B 1MCQA 4LCVA 1CD8A 1LE9B 2K6YA 1P6WA 4BD4A 5E2VL 3FSWA 1YCSA 2EYRB 2YLKA 5IG7A 2OAAA 4HEMA 4M1CC 1NC4A 2VYRE 4HAGA 1MW3A 4DK3A 5B39B 1TTGA 4ERSH 2FZ3A 1PZ2A 3V4PA 3QZWG 3BDXA 4OZGE 3S35L 1OOWA 4Z7OB 3CHRA 2PW2B 3MRHA 4JM2F 2QLVB 4OFQA 5EC1A 1WFUA 1UWXK 2UWEF 1U21A 2XV6B 4AJ0A 4PJGE 4OR1A 1J8HD 1GGCL 1ZT1B 1KCSL 2COQA 3FB7A 1LHZA 4A2EA 3QJHB 2PO6C 5DVPA 1F3JA 5GZOA 5I24A 5MEOA 4FHJA 2X88A 2ZCHH 3DVNB 5E4IA 5GZNA 1KJ2L 4QYOA 2ZUXA 1E3XA 1XF5A 3TPKA 5DRNA 3IMRA 3U9PH 2G4GA 1JPST 4XMTA 2IDFA 2G75A 4KUCD 3VGBA 4IJ3C 3EKCA 1M56B 1OM3L 2WOBA 1AZZC 4XVJL 3T71A 3K4ZA 4XP6H 1DL7H 3II3A 4WUUB 2EE3A 2VAAA 1BFOB 2O5ZH 3Q5YA 4GAGL 1M7IB 2VDPL 3V7MA 4KK8D 4KH2A 3S8GB 1UKQA 3CLFL 1FV1B 1T1YA 3QUZD 3VJ6B 4DP9X 4M5YH 3U4EB 5EEUA 1D6VL 4WFGE 2JKRM 1HNFA 3NJKA 3DGGA 1R6VA 3GIZL 3RAJL 1T20B 3ARVA 1G7LB 3CFNA 4BCZA 1B6DA 3E9TA 4UM9D 1ZHNA 2NZIA 1NCDL 3VD4A 1QI3A 4WFGD 4HJGB 3RX7A 4DAGL 3HUJF 5AVQB 3GQFA 1C7SA 2JI2A 4OJCA 2GBAA 1JRHI 4UV7L 1BZ7A 1FH5L 5LAXB 2AQ2A 2X4PB 3PJLA 5DQDH 1PY4A 1ND0A 4PJ5D 4WW2A 1CO1A 2CHDA 1YN7B 4OU3A 4AH2B 5GJSL 4PJCA 1TEYA 4FFVD 4U6XA 1HSBB 3HFFA 2BIOA 1TTBA 4GMTH 3MV8E 3JYCA 2EDDA 4JM2C 4YFDB 3FO1A 2DLFL 4ZMOA 3V4PH 4IIZA 3MLZH 1XCXA 2EP6A 2GTZA 4BZ2A 2XT1B 2K7PA 2EVIA 4L2YA 1KN4H 4OFYA 1UG9A 2X3AA 4Y2NA 5IVXA 1RXLA 5FM4A 1CE6A 2VE6A 3RVWD 3FMGL 2KS0A 3FH7A 4JY5H 3GHBL 4AEIH 3KW7A 1NM4A 3NIGF 5DHVH 5DC0A 4XVSL 3WN5C 5FGCB 4OCXH 2AI0H 1CJYA 1T2QL 3K71B 1QG3A 3DRTB 1JWMA 1U2HA 4J3OH 5F3HA 4POZC 1DLHA 1U36A 3WXWH 1EX0A 1H3XA 5AVZB 2YRPA 3LQZB 3ARSA 4JFPB 5GJSH 3HAEG 3BGMA 4S1QH 2E9IA 5H4ZA 3S3BB 4LKCA 4DEUA 2FIRT 5JW4R 3X3GL 3ILDA 4DP7X 3AG4B 1NA8A 1DQDH 3RP1A 4N9OB 3UADA 2VDNH 5D7KE 5MHSE 4ZUUB 3OJDA 2W07A 4MNHB 3QFJA 1B3JA 3OHXC 4U1GC 4OB5H 4M62H 2YOAA 3BEWA 1A6WL 2OL3L 2OZ4A 3R8BB 2WQVA 4L3CB 3WFDH 3T0DA 3U0WL 2MOVA 1N6UA 3PL6B 4WAFA 4RX4A 5FYJU 1KEGH 1E42A 5F0LB 1EHLH 3PWPA 3AT8A 2ZOKB 1H15B 5D1QD 4C83A 5BXFA 4PJEB 2UZYA 1WDAA 5MENB 3CHOA 1PLAA 1PQZB 2VC2L 5FYLE 5HVFB 1P9MA 4Z0XA 2CD0A 4EIZC 2OSLB 3VSQA 3W2DH 3LRSB 1X5FA 3UAFA 3B34A 3IAGC 1S9WB 3N91A 3MV7B 4Y0GA 1Q90A 3DX2A 2AK4D 3IGKA 1M05B 3RILA 2JTDA 3M88A 3CLEL 4NKOA 3DURA 2V33A 4H8WC 4J4PD 5FX3A 3GMLB 3PQYA 3MLWH 4NO0D 1L6PA 4M8RA 3FSVA 4N2KA 1IBDA 4ACPA 2EICA 5ADOL 2A9AA 3NIDF 1MH5B 2XBTA 4YIQA 4ELKA 1K3IA 4IS6B 3PJSB 4JHUA 4JZNB 1T1XA 1A1OA 2YMOA 1OOAA 1JVKA 3MRHB 2J88H 3FSAA 4WEEA 3FU8A 1FVEB 4TSCL 4BH7B 4Q4EA 1GY1A 3FB6A 2Y7SA 5E1AB 3TTYA 5GGRA 4ZTPH 3FNKA 1TZGL 3ZZQA 2DWYA 4BFFA 3BUPA 1F97A 2VXVL 3O3AB 4HFUL 4V33A 3ULSA 4FZ8L 1HCZA 4RIRB 4W70A 5KS9A 1GMEA 1HCVA 4O51A 2Z31A 3OKKB 2ERJC 3P40A 3MLYL 1MCHA 3QIWC 4F27A 1FF5A 3D18B 3CN1A 3KXFB 4LPVA 4XBPA 5T3XE 3MACL 3KPTA 3ZHNA 4G3YH 1QUNB 5D1ZB 4JL1A 1QATA 1U8QA 4JBSA 3THMH 1SQ2N 4HX1A 2DYSB 1X5KA 2ZCZA 4JZOB 2PWDA 5IBTL 3MOQA 3OB0K 2X4QA 1NCIA 4FQJH 1YO4A 4XC1L 4A7SA 5CGBA 1MG3C 4H8QA 1D5BA 3O2VH 1ET8A 3DV4B 1ZLUH 3FU5A 3MODH 1FNHA 3HA0A 1OGAD 4KDVA 4Y1TA 1SF5A 1WD9A 1OPGH 2QHLA 3QUMH 3BQUC 4ELMA 2K9FB 4F2FA 4GYBA 1BW8A 2YEZB 1I85C 4MKTA 1A8JH 2F5BL 5GHWL 3T0WA 43CAA 1M4KA 5KVGL 2VL5A 3TESA 2NDFA 5DJAA 4NO5B 4ABVA 5KTEL 2Y5EA 1JNNH 1LO5A 3ETBJ 3DBXB 1RUMH 2Q7AA 4B0MB 1WBZA 3UDWA 1YN7A 4LGSB 4X42A 1MCRA 2XPGB 4PJEE 4AH2A 5IREA 1ZVSA 4KRPD 1RJZA 2P80A 4TTDC 4TL5A 1ZKAA 3AC0A 1I8MA 3L2MA 4G9FD 3IMUA 2OMWB 5C0FB 5CINH 1NOAA 3K6IA 1IT9L 3NPZB 3PQYD 4PJ8C 1MPAL 5CLTA 5ID0B 3I9AA 1RULH 3MUY1 3Q6GL 4QHNA 4Z7VF 5C09D 3QXTA 5GZND 4YSPA 3QSKB 1E5AA 2RJMA 1OAJA 1P5UC 2YGPA 3IPFA 1MHPL 1L9OA 3RTQC 2W60B 3QEHA 1KJ3H 2WNKA 1TMQA 1AXSA 2XTLA 3HIZA 3MRCA 4MTMA 5FGBC 5GRUL 4B5EA 2EVJA 4MJIE 1E8YA 2HFFB 1KXQE 1KGCE 2NY2D 3PDDA 1M53A 3MJ8B 4PBXA 5JPNA 4Q9RL 1DVYA 5EZIL 2AJUL 2GKIA 2MMXA 4D8PB 5C92A 2YAOA 5FWRA 4PVLA 3EBAA 3ROOA 5ETUB 1IZJA 3O8XD 2VJXA 2CIKA 3OXRA 2P46B 4X6DE 2XXMB 4FYRA 5HHVH 3B5GA 3VXRD 4NUJA 1BF5A 3R0NA 3UJJH 1TVDA 4BWUA 1HCFX 2VDNB 5KUKA 1ODAA 4LMQI 4YL9A 4YXLL 2BSEA 4L3CA 2A7BA 3GLEA 4P2RA 1MWAL 3BAYA 3IGFA 4MZ2A 4DK5A 1J12A 1B4JL 2OW7A 2WN3A 3QJXA 2EVGA 1HH6A 4FI7A 4C83B 3TEUA 5BXFB 1EJ8A 1P7QD 4LOUD 4WWPA 1ERNA 3GMOA 3UERA 2ZYSA 5C0AE 3VA6A 4EPSA 1KTLA 4PRPB 2AQQA 2HG5B 1J0YA 4N1HB 5DUPH 3SE4C 3B9KC 5I8OL 3A6BH 5HGDA 5C0AD 5HVWA 3L3OA 3V79C 1O7DC 3MBXL 1BM7A 1PDKB 3ZRSA 4E5XB 1PYWA 15C8L 3MNZA 4YHMH 5AYTA 1VACA 1NDMB 3EYVA 3WDIA 5JLZA 2EUZA 4LEBA 3GS4A 3EZ8A 1AZCA 3OGCA 5DMYA 3MUZ1 1RZGA 2WINB 2F19L 1XD1A 2GJJA 1T1WA 4K3DH 3FCTA 3FAXA 1W0YT 1OF0A 3M8OH 4LEOA 5CJ5A 5KSUB 3D39B 4AJWA 5HPMA 5TQ0L 4OCNC 1QHOA 1WBYA 4CADB 4XXDB 1XGQB 2ERJB 3IAQA 2WBJB 2A77L 1CPUA 1I1YB 1WVZA 4U3SA 4WI7A 1AI1L 1BLNB 3VI3A 3AAZA 2AJYH 4UZGA 4UDUB 5HI4C 1VEPA 3L1FA 3NZHH 5AW2B 4O02B 2WLIB 4DQOH 2YFNA 2H4EA 5AL8A 2CR6A 4HWUA 2BH0A 3MCKB 4XNYL 1N12A 2MWCA 3LS4L 4DT2A 1U58B 3OZLA 2K70A 3RB5A 2BNQD 5ICZB 2EIEA 4PSPA 5I8EB 2OXGB 1G7IA 3D25B 2JB5L 4FYTA 2O6CA 1HX0A 1O75A 3SDAD 4OI9A 4PJ5E 1EZVY 2H2SD 1M2OA 4MCZB 3DOHA 5ANMB 1LJMA 2A0LC 3TPUA 3FTUA 2W9EH 4TMPA 1LK3H 1V10A 1HNGA 2HX7A 3BE1H 4GO6B 4D3CL 1CL7H 3MJ7B 4WJ5B 1EEUA 1F00I 1UD5A 1Z9SB 2CUAA 5EIIG 1KFGA 1ZLWH 5MEQB 4JUTA 4NCDA 1S9YA 1NLDH 3ALXA 4F7MB 1I8LA 1A14H 3GBEA 2P5WE 1U8CB 3BD5A 4Q6IB 4DVRL 2RQEA 2R23B 4R2GB 5C08D 3K3QA 3QFJE 1OL0A 3CD4A 4JDEB 1QPPA 1U6AL 3RY6A 1BSIA 3EGDB 1AXIB 3MJ9H 3KVDD 4GMTL 2BCKB 2X4UB 3CSFA 3TO4D 4WFHD 3I84A 1NM9A 2X38A 4PREB 5TF1H 4KK6D 1AHKA 4LMQE 4QXWA 4UTAL 5I15H 5F21B 3SKMB 4L37B 3L45A 3MNDA 5AQ0A 3WHE1 4WW2F 5EZLA 4M5ZL 4BKLB 1O5PA 4YLQT 3KWXA 1CCZA 4KRLB 5EU3A 4AG4H 2AK1H 2OJEA 3C5SA 3WIHA 4X9GA 1JSYA 4R7XA 3TN0A 1AFVH 2EIZA 4MJ6B 1YAZA 1ZIBA 2HCZX 3ESPA 1TFHA 4M6NH 1PLGH 3IKCB 3HB3C 1CICD 2D73A 1RIHL 5E8EB 4HIHB 1FG2A 4LARH 5DK3A 4QRPE 1RUQH 4J4PC 4QYAA 2BS71 4JZJC 3SD5A 4DO5A 3WNIA 3U0WH 2R8SL 5T1LD 2C7UB 2CRZA 4P5KA 2IC2A 1XSIA 3LRMA 3MLWL 5GIRB 2QL1A 4QRTB 2E7LC 4PRPD 5GGQL 2WZPD 1V7ML 2CKBA 1U3HC 3MCLH 2M83A 3TBBA 1OCRB 2CDFA 4KHXH 2B4CH 2Q7YA 3V95A 3AABA 2F68X 4R96A 3UTZA 1UVQA 5C2BL 3NN8B 2MFNA 1C16A 3QO0B 2ZXGA 2VM9A 3BUIA 2RMNA 3ARBC 1TQCB 3BPLC 2K9UA 2AQ1A 1XGUB 1KTKE 3O11B 4PJXA 3AY4C 5I1DA 2XN9D 1KPVB 2GJ6B 1ES0A 5FYJE 2F18A 4HIXL 1T2QH 3RUGA 3U9UA 2WZ0A 3UYRL 1F2QA 3DMMC 4J6RH 2G9KA 4QHKI 4X7SL 3FQTA 4GOSA 4OV6F 4I9WD 2VTFA 3MBEC 5CJXC 3DSFH 1UXSB 3OKDA 3N04A 1KYOK 5FWQA 2Y7QB 1MELA 4U1SA 4W93A 1IB5A 2H1LM 4IHBA 5JOPE 1BM3H 4YNYA 4HXAL 2BY2A 4B96A 1A4KB 5E23A 1BMZA 3QUYB 3C5XA 1QBMH 2F9BT 2YPKB 3HG4A 3BWUF 3MNVB 3ZSSA 1JZDC 3N1FC 3MRJA 4HLZH 3UPAA 4ONHA 2IFGA 1NCBH 2OMTB 4Q14A 5CCKL 1E7VA 4Y7OC 4N90E 1C12A 1NIDA 4HSQA 3PFUA 5C6PB 1XWVA 2XN1A 1ILUA 1I7ZA 4HOZA 5CEZH 5EA0L 4PY7B 3LV3B 5IR1A 2VXQH 4B95C 3LPOA 3CSYB 4G59C 4UILH 4EBQL 1QPKA 3DOIA 2BSSA 2GFBA 2Q10A 5DUJA 2D0FA 3IXTB 3CPUA 2NX5B 1DBKL 4ENZA 5E00A 1G87A 2X6VA 2BNRD 4YHKL 1N64L 2CH8A 2EILB 3BIKA 2ZUSA 5DJYB 4F91B 3CK0H 4PJCE 1U0QA 1HAUA 3IMTA 4HS8H 3TBSB 3TBYB 2AEQL 3LCYA 5B38B 3WJLC 4QHUB 4WDIA 5EFIA 3HMXL 5D1QC 1ORQB 4YFLI 4KK5D 2QGDA 2BSRA 4MD0B 2J6EH 4B9CA 1RPKA 1BHGA 2HT2C 2V2XA 2ZOOA 3F01A 4MQ7B 1J5OL 3IDIA 2ZXBA 2RBLA 1TYRA 3ZDXB 1FAIH 2Y6SD 4KKAC 3RL1A 1A1NB 3CDCA 2B59A 5JQHC 4YHNA 1KXQA 4EN2A 3WIAA 5C0DB 4MAYB 4PJHA 3BUYB 3OD3A 5H37A 1Z9SA 1KIQB 5MEQA 2BP5M 3U2IA 4K15A 4J3UA 3GMRB 1X5JA 4HF5H 1O6TA 1CL7I 4X4KA 4QRPD 1GS7A 3JWOL 3VI3F 2VR3A 3QCVH 5J4MA 5KSBF 2OXHB 4HZLB 1OM3H 1FGVH 2YD6A 2FR4A 4AVHA 2GEEA 4HUNB 4LSPL 1JTOA 2F54B 5C0NC 2XPZA 3PP3K 2NY4D 4MJID 3ZUCA 1FFOA 3FU9A 5IFAL 5G2NA 2MJWA 4GBXC 5EZIH 1IKNC 4X98B 3WJJA 1YYLL 3W39A 4AKOA 2HZHA 2G9HB 1DQTA 2XG5B 4IBUA 4KTDH 4B7LA 3BVUA 4I77H 4JAMB 3ZTJH 5GRUH 4NLHA 4WU5A 1OWWA 4Q8BA 3CNKA 2L7UA 4WHDA 4TPRL 3JWOC 3SDXA 1FNAA 2QFRA 4P46D 2FLRT 4Z7VA 2QVMA 1WUNT 2Y1YA 5KSBE 4B3EA 2JELL 4TRPL 5GIRA 4NLAA 4E41E 3P3TA 5EBMA 5FCUL 4KO9A 1UB5B 4ZI8A 3ES6A 5L8JB 5CD5C 1URIA 2AMUA 2D2CC 4HK0A 3T6WA 1IGYB 2AJXL 1PFOA 3ECQA 1P4IL 1ZAGA 1JYVA 4FABL 5I73C 2OJ1A 1EXUA 1QTYT 2JSFA 2RB8A 3HLKA 4IGBC 2O30A 1BVNT 2GW5A 5DTFA 3SDYL 1A22B 2H2SC 5EU4B 1OP4A 2PYEE 1CTMA 4I8DA 3GINA 2VSDA 5IVZB 3B3BA 4Y88A 4PJXB 1RD6A 5CMAB 1E2ZA 2VITB 4FOMA 5EU7C 3D4YA 5EU6B 1TZAA 3AGVA 4R7NA 2BFVL 1KFAL 2NT0A 3MLTA 3KVQA 2CNZA 3P4NA 4OZFG 2CJUL 2AV1B 2BSED 4ZUTA 4ATTA 4YE4H 3LKPA 5KBDA 1AMXA 5IOPA 3BD3A 1JNHA 5SWQA 5CLWA 2IV9A 1LDPH 2PPFA 4M8QA 1QVOB 3LZFL 1F1DA 1U3HB 3H9SE 4OI7A 1MJUH 2P5EA 1NLDL 5JW5B 1B4LA 2X6CA 3DHMA 5K1NA 1IRAY 1E0OB 1DQDL 4R0LC 5KYYB 1P4LB 1FL6A 5LG1A 4LHUB 4WO4C 1B90A 4IU3B 5JIDA 4HFWB 4YE0A 3J8F7 3QAZB 5IK3A 1VFBA 3S4SG 1W8EA 4S1SH 3RVTC 4LSQH 5L0QB 3OXSB 1IAIL 4HJTA 1YDPA 2F5AH 1S9KC 1ANUA 3GSRA 2RR3A 3LHAA 5DQ9A 3BXNA 4I89A 1AHWB 2FGWH 1IGML 1F3DJ 3FT9A 3KH3A 3T2OA 1G7MB 4ALAL 3WTXA 1WIPA 3ALPA 4OCWL 1BWMA 1B2WL 3VW3L 12E8L 5CZVH 3BP4A 2WJ5A 1CLYH 2DM3A 4O4YH 4A2LA 3VD2A 5F96H 1RERA 5IJKC 1KB5B 3A23A 2GTZB 2FH6A 1EAOA 5C0BA 3HN8A 1G0XA 4NJ9L 3MV8B 2CRMA 4KNTA 3DXAD 1EIBA 2EDYA 3INUH 5LBSL 4PV8A 3HMWL 1JUFA 4WNSA 2NY5L 3GBLA 2Q2EB 5IMLA 4N5EC 3FTVA 3D0LA 4XXWA 1II4E 2ZX6A 3MBED 2AJZA 4KGJA 3WUWA 4JFDB 5KSAC 2ATAA 1DBJH 5HHOE 3BUTA 5L4MA 5A2BA 3VQLA 5TDNB 1U8KB 4GUCA 5T5FA 5DVKA 2Q3ZA 2VOTA 3U36B 1PMYA 4DCQA 1BQKA 4UTAH 5IUCA 2NUTB 4F7EB 1N7MH 1U4FA 1SEBA 3GPSA 3QQ9D 2L3BA 3H9HB 4MJIA 4NYLA 4ABUA 5CF3A 3IB4A 3VM5A 4MS6A 1G9NC 4IBLT 1ED3B 3FUJA 4FXKA 2WWMC 3TASA 4XB3A 3UPRA 1WC7B 1EBAA 3HLAB 5H35A 5E4EB 4UWQB 4LLAA 1CDGA 1NMAH 2ED8A 1V7MH 3CWGA 3V0WL 4GI6A 1I3RB 3D2UB 3ZKXB 2CLVB 1I9EA 3JVGC 3VWKA 1IBZA 4F9LA 3L3HA 2YO3A 4W9GC 1YRKA 2OPCA 3BFOA 1HTYA 4O02L 1FRGL 1J0KA 3MXWL 4X5PA 1M7DB 2XIIA 4L9LC 4P46A 3ULAB 1MLBA 4YSAA 1T6BX 1X5GA 2ZX9A 2ED7A 1CR9L 5HDQL 2BPBA 5K9KA 2Z91B 1DBAH 2QELA 4CGUB 1MFEL 4XP9H 5C0BE 1LMIA 5L0QC 2GY5A 1HSAB 2FBJL 5FECB 3SGKA 3GHEL 4X5QA 4I48A 5E6IA 5ESVB 3QRLA 4HUUB 5AZ2H 2VUOA 2MIZA 4W9IC 2D4FA 3ZL1A 2H7WA 1DJXA 3MZGB 3MGTA 1EEQA 4HMCA 1ZY9A 4CSZA 2HLAB 4LP8A 4M1DL 4GG6E 3CVIL 4XP4H 2OCJA 3QDGB 1RHHB 2BM3A 4XVUC 3ULVF 5DZNA 3F84A 1FH5H 5HJ3A 1O6VA 2DN7A 3PWVA 4M7LL 5BMFL 5BQ7A 4Q2ZB 4GAYA 1N68A 1YEEL 2M8XA 3QDJA 1IGJB 1ZLSH 1MWAA 3QJHA 3UTSE 2K3HA 2FEDD 5L88L 1TJGL 5JHAA 5D1XD 3PWJB 4X5WB 3TVMB 4MAUH 4IBZA 4Z7WA 1R3IL 4P9HL 1I9RH 4XCYB 3BZFB 2BERA 2SEBA 3IBOA 5F97E 1H6UA 4EJ1C 5ADPL 2D3NA 1JF1B 1SYVA 1J86A 3D18A 1MLCB 3EOTH 4NBYB 5D7HA 4CMHC 2VRAA 3CBRA 5EEYA 1RLBA 4FJZA 1XB3A 5C2BH 3OAWA 2EO7A 1CGXA 2ZUVA 2R69H 4IK7A 2E27L 5DXWA 2HTLD 5A2LH 2HH0L 5B8CB 3LKOB 3QFJD 5JHDE 2OCCB 3BZ4A 2DIAA 3TWCL 3WY3A 4H1LA 3VXMB 1T1YB 2GBVA 1U3ZA 2CDEB 4U1IA 3VJ6A 1WA0X 1D5BB 4AQOA 4HIXH 4TUKL 4XC3L 5J12C 4G7QB 1F3DH 2ISDA 5F6IB 4ZW7A 4DKEH 4XPGH 4BV1A 4RFNC 5CBEA 5JW5A 3VWJB 1QFWH 1ZHNB 4L3ED 3GPEA 1AHWC 5HDBE 3TWYA 3ESNA 1EJOH 3MV11 4FC3E 3TURA 1A9BB 5E8OA 3P2DA 4JUSA 2JCCF 2DQHH 4YSQA 4MX7B 5IV2B 3T2LA 1A7QH 3JZ7A 4NO5A 1Q94B 1UYWH 5TK4A 3EH4B 3MRBA 1VGEH 2D7PA 5DLML 3UGXA 4Y4HD 1PFCA 5DGQA 3ILEA 1RIUL 2NSQA 5DRZB 5F9WB 1AS8A 3O45B 2DQUL 4Y1AE 1AGBA 3CVHA 1LEKA 3ZYIA 3ESOA 1XF3A 2CO3A 4JRWA 1PX3A 3FO2A 3CBKB 3SPCA 3ZR5A 1R3KB 3FOMA 2IAMD 3O81A 4MVBC 3MODL 2YPLB 2VDOB 3DURB 3V0EA 2ARJB 4QRPA 1TQVA 3T2PA 5J1SC 1WCQA 4HMDA 4M6OH 4WZ9A 3S34H 4WI8A 1MH5A 1OAQL 3V8CA 1UWFA 4LCCB 3HC4H 3NIGE 4X50A 2NNAB 3DKHA 4GRWF 3ZDYF 4WI9A 1G1CA 2FD6H 3TONA 2CALA 4H88H 2NUTA 1MFBL 4KO7A 4QMEA 3FQ4A 1P4BL 5EU7E 3S5LA 1NAMH 2J43A 2WUBL 1JPTL 4JHZA 2RTTA 2IJ0C 3BP6A 3GRGA 5FYJL 4DOHB 1FO0A 1INEH 4OJYA 3E8VA 3G5VA 2NY2B 3MROB 2BNQB 1KCRL 2HWZL 1H3TA 4CSPA 1I7UB 4G6ML 4NUJB 3LQAL 3N44B 2G75B 4XT1C 4LSSH 3Q6GH 1KN2H 2YA0A 2AEIT 5DEZA 4S1RH 3Q9PA 1LK3L 5EUOF 5CKAA 1K8IA 2ZUQC 2EAEA 4AYSA 1N6QH 3ZE0F 5GGVL 5DZAA 3D0VB 4RLDA 4YDIH 2VAAB 5D4JA 3MRGB 4BIKA 1T66C 3MACH 3GXFA 4HKZA 3ARQA 4HAFA 1PQZA 1FBIH 2V9RA 4GH7B 3PS6A 1QPXA 4L3FA 1NJ9A 2R9HC 1P7BA 2FIKB 4MVBD 1KBWA 3HE6A 3BRFA 5JHDB 1NANH 4CMMB 4PI2A 4E9TA 2EXWC 3WSQH 3PL6C 3ABZA 3DX4A 1F8TH 3O6KL 5HGBB 3VH8A 3IETB 5JIIA 4N20A 3P9MB 1HCYA 1AD0B 3LHPH 1AGDA 4NQEB 4AYEC 5JHLA 3FPYA 3KCPB 3BEVA 4AOFA 2P42B 3MYJA 3VXUA 1SY6H 2CM5A 1WGVA 3PXJA 2Z1KA 4YHOL 4F8QA 1T1WB 1EHNA 4ZUVA 5GGVH 2MQ0A 2J4WH 1MWAH 1XGPA 2YUWA 3TA3B 4LBEA 3RGVB 4LSTL 3LKRA 3DPBA 2A6IB 2FX8L 4H2CA 3P0GB 3T5WA 1OTUC 3BC9A 4LIQE 4LL4A 4E42B 3O6KH 3RWFA 2E76C 1HEZB 3IDUA 3QQ3A 2OULB 1ZV5A 2UXFA 2HT4C 4GKZB 2VZ1A 4HP5A 2GABA 5I8EA 3QZWB 4FFYH 5E9DE 2ADIB 1RSFA 3WYRA 1KWKA 3RFZB 4KMQA 2OYMA 1EQWA 2F54D 4P5TC 3L2LA 3UJTH 3FSOA 3OJMB 1IFGA 1P7QA 1H9DA 4G43B 2H1PH 4GRLB 1TTAA 2EZ0D 4E9QA 3E6HB 2Q9OA 5IROD 5GSVA 2N1TE 2A6JA 2FX8H 1F6LL 2NYZA 3ZY7A 1CS6A 1ID5I 2NY5C 5EO0A 2ZAIA 2VAJA 4N8VB 1GZQA 4PY8I 4WW2C 3C6SA 5HDBF 5CBEB 3G5XA 1BGXL 2P5WB 1VESA 5K9OA 4POYA 3LEVH 5CEZE 1S5IH 1JZ7A 1OB0A 3L6FB 4ZUWA 4U0RB 3EDKA 1P6FA 4TVPL 3X14B 4RZCB 2VLJA 4TL4A 4EO5A 1JXFA 4BKLA 2AK1L 4MX7A 5BOPA 4RAUB 3UJIH 3ILQC 3K4DA 4XPFH 1X7SA 3LIZA 3SPIA 2AITA 2MPAH 3O3EB 1TVHB 3IEAA 1HH6B 4LGPB 4X6BB 5BNXD 4FFWC 3FQXB 2XY2A 4P23D 4PTTB 2EIZB 3MNMA 2EECA 4QI3A 4LVEA 2DPKA 1CR9H 5HDQH 2LVCA 1ZRUA 2QKIA 5DRZA 2XTJB 3PHAA 5AENA 2XWRA 1H3WM 5T33L 2EYTA 2YSSB 3TNNA 1UD3A 3RL2B 4DKEL 5DA0B 2NT1A 1V3KA 3ESMA 3RDTA 1EGJL 2P5WD 3Q8AA 1KCWA 3I3DA 5EBLA 3VI4A 3VO0A 3FQRA 2I24N 2GB2A 1BF8A 1NDMA 1QFPA 3DJZA 2HVKA 3PL6D 1JPSH 3SY6A 3PNWA 1N70A 4HD5A 1KCUL 4Y2OB 1Y18A 4KHTH 4M9OA 5EOCJ 3IDGA 1FFNA 2EEDA 1MFEH 1D5IL 1ZWIA 5GGTL 1GS8A 1ZK9A 1UJ3C 5AZUA 4NC2B 5AZEL 3HHMA 3L7EA 1NLBL 3RJOA 2NXZB 4PAZA 1UADC 4PJDB 1KULA 3RIKA 4DP2X 2WXMA 2PTVA 1YC8A 1L4IA 3G5YA 1Y0LA 5GRVK 2L4OA 1QBLL 2H3NA 2DMKA 3KM1A 1Q4NX 3ECUA 5HTSA 2D7TH 1V3LA 4WUUD 4QRQA 4BQ9A 3BCDA 4OIIL 1OSPL 4EKJA 3FT3B 1Y6KR 2E74C 4CC1A 3TBTB 4RDBA 3VXOB 4NFDA 1M1XB 3T08A 1OGPA 5FLUA 5D1ZA 2DDQH 4ISVA 2ZXWB 3L3IB 4AUUA 4DH2A 3L3GB 3AU1A 2FE0A 1FIEA 1OALA 4MA1C 2BLFA 2CCLA 4OUOA 5DMIL 1NLBH 4XBGA 2L0DA 5EDSA 4ZMQA 4CJ0A 1MIEH 1RK1B 5DZOA 5I82A 4CMMA 3X1FA 4FLQA 3IT8D 3MNZB 1BREA 1SUHA 2X4UA 1XIWB 1EV2E 4HDIA 2XKUA 2CPUA 4X9HA 1CLOH 4XNUH 3U9WA 4AKQA 2Y36L 2OZ4H 2QMJA 1DQML 3EO9H 2P49B 1RZIB 5KSUA 4J12A 4PJ7A 4GMSH 5AOKA 5DEFA 3QJQB 5IW1A 1XH3A 3ZTDC 3QNZB 4HJSA 2DMHA 4LDEB 5A6LA 3GXIA 1OSZA 5JDSA 3T0EB 4UDUA 5DMKB 1SDDB 3ZK0A 4OW6A 4JG9A 1Q8MA 4NWUL 1B6UA 1ZLVK 4U6HA 4Y5XA 1NDGA 3NFPA 6TAAA 4MXVE 3PPEA 4XI5C 5CEYA 5BZDA 4Q6YA 1SN0A 1ZOXA 3D25A 3JWDC 2AK4A 3UCQA 2DYPA 4YDVB 5DK0A 4DSYA 4Z3JA 1IARB 1Y1UA 5JHBA 2F1EA 2FJHB 3MA7B 2FJGB 4D0CA 2GK0A 4QRBA 4BSVB 4YDZA 5C0JB 3LN9A 4R96B 4XOEA 3U0TA 3AS2A 5HGAA 1VENA 4IRSB 4GRLA 4F2MA 2W0FB 4FMKA 3WIHH 3U7YH 3OAZK 1BQHA 2WANA 1J7VR 2YARA 3Q48A 4A04A 2DQ6A 2XV2A 1TENA 2A38A 1UXMA 1T0MA 3BPNB 4PW9A 3WY1A 1JRHL 2CR0A 3T0BA 3QUMB 5DRXA 2R7EB 4YXLH 4RRPM 5ES4B 1P2CB 3FN3A 3BP7B 4MXVF 5HGGS 4F7KA 2OMNA 2BFVH 2BHUA 2HVBA 4XNQB 4PGDB 5DSCA 2HB0A 2OFQA 4ODVH 2GSIA 2NPLX 3GIVA 2WB1A 2VO8A 1GKOA 4PM1A 3SGJC 3GBNH 4ZPTB 3US0A 2XZQL 1RK0A 1E28B 2VXSH 1DVFD 5BVJB 3MREA 4PP2B 4PEEA 2ED9A 1HI6B 1D9KC 4G82A 5TQ2H 4IRSD 4IMKA 4AG4L 1V7NH 2D03H 5GGSY 2YA2A 1FZMA 5HHMD 2W9DL 2F53E 4NQVA 3BAWA 1G4RA 1F4WH 1SDYA 3QPQC 2R83A 4JFWA 2X3BA 4XPAH 2A9DA 3SGEH 1VADB 5FA4B 1L0YA 5ABDE 4G42A 2YGNA 3GF8A 5T3ZH 4OFYD 4PRIA 4WO4D 1DDHA 3LKSA 1E4KC 1OLLA 1CWVA 3I75A 2AZUA 5HYEA 1BJ8A 4FP8H 3EYVB 2J2ZA 1ND0B 2IWGA 1Z2KA 4GSRA 1TPXC 5LNDA 4XX1E 1HHJB 2ATKA 4JO2L 1FC1A 3MX0B 7CGTA 1J0IA 2VXQL 5IQ7H 2Q8AL 1FVCA 4PH8A 2Q0ZX 5I1AA 3IVKA 2V37A 3MUHL 4NZFA 1INQA 3KWTA 5CCGE 2Y2WA 5B3SB 4M7KL 4LKXA 1A7NL 2YQ3A 3FBKA 3RUGE 4B97A 1A3ZA 4TSAH 2X2IA 2VDPB 4NQTA 1HINH 4YHLL 3OKYA 4HQQH 5KS9F 5EFIB 2NYYD 2MSPA 4WK0B 4N24A 3HMWH 5FYKD 2XICA 3INUL 5LBSH 4QUOA 4R7NB 3SJVD 1HN1A 1KGYE 1OZTG 3IS0X 4PUBH 5D1XA 3S5ZA 4ZMXA 1D5XB 5F3HB 2CAKA 2CG9X 2NQ3A 3FRPB 4M93C 3VD7A 5AOIA 2WMPB 5KVFH 1TETH 5DQJB 4KC3B 4UB0H 4WKZA 1A7BA 1EZVX 1HHHA 4HV8A 3JVFC 5IKCB 1DUZA 2NR6A 2BY3A 3CC5A 2CJ3A 5FUZH 4EDWL 5EUKB 2UUDK 4L0PB 2W65A 3VFMB 3X2QB 5L2KA 4HJJH 1P5UA 3K2IA 4ZPVA 1HYSD 3GZKA 4JO4L 3DA0A 3F7LA 4XMLH 5A2JH 1IIIA 3CSTA 5T3XD 4DK6A 3IPBA 1PAZA 3NAAL 5BO0D 5DVLA 5KW9H 3PF2A 4IU3A 2OJZL 4YEEA 5TH2A 5IK3B 3IDYB 2GCYB 2JCCA 1EXGA 3QWOB 2NXYD 2X41A 3WTWA 5D6CA 3LAFA 2V7NA 4AVIA 4LCIL 3S5LG 4ODTH 4HALA 2V0AA 3EBGA 3OLDA 1TETL 5I18H 1YPZE 5D2LE 1E4HA 5DQ9B 5K9QG 1QRNA 4G80B 5D7IF 1E5CA 4MJ5B 1T03H 3GSOB 2B3IA 3EOBA 3EJCA 4WGVB 3OHXB 1H8NA 1Z3RA 2JK5A 2OJEB 3C5SB 3F7PC 4XCFH 1WIOA 4KTEL 3EJQA 4XPHH 1FDLH 1WWCA 2I07B 3UZQB 2R8SH 4HA1A 1IGFL 3CPLB 4BJLA 3GXTA 4KTYA 5HYSG 5JDSB 3T0EA 4W4NA 3ABLB 3NIFB 1QA9B 2BDNH 1T5KA 5DU7A 3JV6A 5IEHA 2XQBH 1YEHL 3V9EA 1G9MC 1JPEA 1B0WA 1T83C 1SDAB 1JUFB 3QZOA 1DVUA 3O2DL 4PR5A 5C07B 1JWSA 4X5XA 2E7HA 5B39A 4PRNB 4KI5E 3ML8A 2WWKT 4M43L 1NKOA 1DZBA 2EDOA 3B9KA 5A2KH 3OPZH 4MNGB 5AVVB 2LE9A 4JR9L 2B59B 4D0CB 4GRWB 4K94C 4PRHD 2JI1A 4AQ1A 2PCXA 4Y16A 1F11B 3I50H 2DS4A 5FYKH 4HK0B 4LF3B 1WLHA 4DWHA 5J6GB 3L9EA 35C8H 5DHEA 3RWEA 1WT5C 3D30A 2Y0SA 1ZSHA 3MBEB 4QYOB 2LU3A 2QDWA 4IBQA 4MAUL 5DRNB 2J55A 4XO3A 1N3NA 4HK3J 1NZRA 3S88L 4RAHA 2ALAA 3ZN6A 4K8RD 1SM3H 1PX4A 2C9PA 1NCTA 1SZNA 3OC8A 1MNUH 3GO1H 5IVXE 2KC0A 3ZE1B 4H0LC 3BP7A 2R4RL 3PHQA 2J8UE 3N5AA 4P2QD 3H3KA 5IT2H 2R69L 2AV1A 1NOLA 1BFOA 2ZWZA 4Y4KA 1BEYL 5D2NA 2BWQA 4P2QE 5CCHE 3TA3D 1E28A 4FG6D 3O8XB 2J5LB 3JTTA 2HTLC 5CJQH 1JNHB 4OCLC 1MQKL 1J5IA 1E27A 1ZXKA 4TUKH 4XC3H 4UT6A 2E7LA 1AXTL 4XPTL 5CLYA 2WXRA 2CBTA 3H56A 4F8PA 2MOQA 1G7LA 3MRRA 4RWYH 2LTQC 4HUUA 3KPNA 1AIFA 3AQYA 3AB0C 4G42B 3KLDA 3WNNA 4NQSA 4HCGA 4K07A 3FMGH 4AZUA 1C12B 4Y1AD 2I85A 3DX9B 3QP3A 1WAAA 3QZNA 2P5PA 3VFOA 2KQMA 3HCVA 3UIZA 2W91A 3BDYL 1UB5A 3CN3A 3QDGA 1CGTA 2XX0A 1RPQA 4FQ2H 4OSUH 5TQ0H 2OX5A 4LCWB 5IESH 3U7WH 3VAEA 1UQSB 4X8CA 5ABAA 1SMDA 1A3LH 2J56A 3OM3B 3PUUA 4J3OD 1KB3A 3S3SA 4YXHH 3DIVA 3BX7C 4OZFA 2WXOA 5F8QC 4YLCA 1A2YA 2G3XA 3U1SL 3IVKB 1KTRL 1NGXB 4DVBB 5CJXA 2EEXA 1IQWH 2IALB 5FO7A 3ZHKA 3EGXB 4DKDC 3HS0C 1BOGA 3LZNA 1KEMH 5SV3A 1LE5B 1AGFA 3UTTB 4Q4IA 5B7EA 3ROLA 4KKQA 2JB5H 1BZ9A 1QWNA 1WG3A 3NIFE 4MQ7A 5IMOA 2CQVA 4MA7H 3ASNB 3TT3L 3VFSA 3W0WA 3DUUA 3FH5A 4YSRA 3O6FD 4JZJA 1MXDA 3RL1B 1KEGL 5B7MA 4HEME 2Z7YA 3LH8A 2VDOH 4XP5L 2YJLA 4OKDA 4XO4A 2WNXA 3B8YA 5EO1B 4M7LH 1W72H 1L0PA 3GDBA 3CHXA 4K3GA 4NHUA 4YGAB 1K8DA 1A7OL 4BUHA 3TIEA 1UACL 4LVNB 2XJLA 5FOJA 3MLZL 1KBVA 3RTQB 3U6XA 3PHOA 3SDCD 5AKTA 2KPWA 3ZUNC 1Z9NA 1DE4B 3D33A 4XODA 2VXUH 2BXZA 2UZXB 1J1PH 3NA9L 3OR6A 1RIVL 2P45B 4FE9A 4PW4A 3WELA 2VO5A 3V0WH 1L7TL 4GEIA 1SN5A 4M5ZH 4PG2A 2VDOL 3VG0L 3QI9D 2F5AL 3UBXB 3FU7B 4QOKD 4NQDB 5FO9B 4KOBA 4H2AA 1FFOB 1G6VK 4XP1L 4ZAKA 5H94B 3JYBA 4OZHA 2OMXB 5GJTL 2AJYL 2WKGA 3FTZA 5FGRA 2C9XA 3O45A 3P54A 4JQVA 3IE4A 3PWNA 2XG5A 5DZ9A 1KIPA 1N10A 3U4BL 5A6MA 4JAMA 2QSVA 4ZZFA 2K1MA 3VXSD 1N2RB 5EOTB 4NENA 2D0HA 4EUPA 2YC1A 3IXAB 5KVGE 1G7JA 5IHUL 3NT0A 4PJAE 5HGHA 1NAKH 4IOIA 3G5ZB 3BMWA 4L8CA 3WKMH 4X9BA 1NEZG 3DUHA 4LCCA 4D3CH 4GXFA 5H2BA 4HXBL 2GQHA 3HJ0A 2ZAGA 3UEZA 4AL8C 3LEXB 4F7CB 2DOCA 3SBRA 4S1SL 4C4BA 4DP5X 4ES8A 3W38A 2FEEI 1ID2A 1SLUA 4XCNB 4P48A 3VMOA 2QADC 2J1ZA 4CKQA 3WHXA 5DUMH 1HHKB 3X11A 1L5GB 2WLIA 4E9WA 2JIXB 3IDJB 2VISA 4U1JB 2X7LA 3HZVA 3MRDB 3TZVA 1IGMH 2YBGA 1TQTA 4ENEC 1DANT 2LABA 5JYMA 1T6WA 4NUGH 4WSKA 4DN4H 1UWGL 5HI3C 1ZHKA 4P59H 2K8MA 2NY5H 2X1WL 3G9VA 4OBRA 3SYOA 2P24B 1K4CB 4Y19E 3AMKA 2IH3B 3N43B 3TJHD 3CH8A 3ARGD 3LRHA 3UYPA 3CFBA 5F44A 2Z7ZA 3VXQB 1UZ6E 1I4FB 4HHAA 1J9CT 5D2LF 2IBZX 1M6OB 3DARA 3SIKA 3VMNA 4HVBA 1UWXH 3BJLA 1MIMH 4NN6C 4KJWC 5GZNC 3OR7B 4KJPD 1RU9L 4KKLD 3OPZL 1PY9A 3MRNA 4XGZA 3LXUX 3KDMA 3UMNA 3ARDC 5IB3B 3TFKD 5AOLA 2KKQA 1G7HA 4UQ9A 2PXYA 4JE0A 3L48A 4RISL 2FWUA 4J7RA 2CBPA 3ENEA 1KV3A 1LO2H 4XX1G 3VH8B 5HGBA 2Y06H 4PJBA 4ZAKC 1BLIA 5F1IA 1S5IL 2FWLB 3P4OA 4LFHG 3VXTB 4F1ZA 3MYJB 3VXUB 3NZSA 1S9XA 3O6FA 5E70A 4CW1A 5HJBA 1QSFB 4I4WB 4OAWA 2NCEA 2FBRA 1G0DA 3QUYD 5EZLB 3GSQA 4G8GA 1PJWA 5ICXB 4YQXL 1RUKH 4GW1B 3WI9A 1WWBX 3WY4A 2CLRB 3PWPE 4I18C 2VDLL 3OZ9L 4B41A 3BKCL 3WL9A 1EJFA 3FO0H 3KYOA 1DJWA 4G1MB 3WFHA 4NQDE 3I6GB 3ESUF 1NUGA 3NJVA 4YBQC 4W9CC 5C08A 5AAWC 1FL3B 3FCUB 2O6EA 3GSNH 4LLVB 3LKQB 3EXLA 1JNNL 5TE6L 9CGTA 1AS6A 3O6LL 4Z7WB 3CZEA 1AP2B 2Y06L 2QFPA 3NG5A 2HRGA 4GXVL 5E6UB 1GXEA 4FNLL 4G11A 5F93C 3RU8H 1OEZW 5KSBB 4LP5A 1XR8B 3V9FA 5IIEB 1XH2A 1PVHA 4PJAB 2D3JA 1FH2A 4F37F 5DD3L 1AKJA 3F8UB 2WHVA 4ZFFA 1NICA 3GJEB 2CIIB 2N01B 3RGHA 1TU2B 4J3BA 1OB1B 4K8RC 2ATPB 5I30L 2J71A 2BK8A 1LP9E 4F7EA 2WYIA 2A1WH 3HZ3A 3IU4H 2EIBA 2W1NA 6CGTA 2CIKB 2M26A 3OXRB 4M48H 2K6ZA 4PLJC 2MCG1 4EXKA 3PHOB 3BP6B 2GI0A 2YD7A 3SDCA 2VABA 3C2SA 5IQLA 2UZXA 4GW5A 3GKZA 5JIHA 4G8GE 2R1WA 4P2RB 5F9JB 5HSFA 4PJIE 2PXYC 1JZ6A 4EBQH 4R2GC 4P2QA 1JK8B 4D7PA 1Q94A 2E9GA 4FCAA 5GS0D 2XLLA 3QH3A 4K71C 3LQAC 1CURA 4HCFA 2YSTA 2VDLB 3L3JA 1LXMA 4P49A 2XA8H 1B4JH 2G30A 5AG9A 5D7JC 4IBTA 1TXKA 3HE6B 3UL4A 2WK2A 2HH0H 4WVRA 4NKIL 4NKQB 4NP4H 1PDKA 3CAFA 3WFCL 1HIMH 1I1RA 2V5SA 5F7EH 5GRJL 2DKSA 1A0QH 2EH8L 2ZSWA 2C9QA 3VI4B 2D9QB 4JY4A 1DJGA 1WFTA 3FFCD 5AKRA 4RFEB 2XI9A 4XVOA 4FJYA 2WWKO 4N0UA 4OZHF 4EE2A 4ZZKA 2IPUG 4NP9A 1O7DE 1TDQA 4KK6C 4KU1A 1XEDA 3ORJA 2AJUH 1QSFE 3PRZA 1KTBA 2H9GB 4J3OC 3KYKL 1LO5B 1TJGH 1BVNP 1AQMA 1RJCA 2BW4A 4R4FH 4HZ1A 1IE5A 4FQPA 1ZGLB 1S7UB 3C5ZD 5ADPH 3BH8B 2KH2B 3MCKA 4K5MA 4K5PA 3Q3GB 4OUUA 5L4JA 4Z3HA 3MTXA 5D8JH 2DD8L 3NUKA 4UM9B 4W6XB 2BNQA 4YSOA 4KO5A 2OSWA 4A7UA 1OO2A 1TQCC 2J6EL 4PG9B 3V4LA 1YNKH 2C1PA 2FATH 5DEGA 2GSGA 4QWWD 1ZTXE 2WJ7A 2WQUA 4Z7UF 3NEXA 4L3AA 1VIWA 3E1F1 3OAUL 2VERN 4FGMA 5HYSB 1AGEB 2ZWLT 4UF7C 1AY1H 1K85A 4W6YB 1NKGA 3EGSA 2EE2A 2NY2C 1I3UA 2VDML 1A1MA 1JPFB 3W11D 1E9PA 3PAUA 1H6FA 4NZTH 4A67A 1BJ1J 1FPTL 4O2FB 3APDA 3D3VE 4JFSA 2PXYB 4YBLB 1JRHH 2FEEL 3BPOC 2AAVA 3KL5A 1JE6A 4R7DB 4MAYC 1EUUA 3RIAK 1JIBA 2UUDH 1NFDE 3FT4A 4I18B 4XVSH 4EMZA 4GQZA 1EFXB 3QYCA 4QRUB 1EDYA 1IEHA 2YZ1A 3CHSA 1MF2H 4PJFB 3CQPA 3L9BA 1S7RA 1YMMD 1YQVL 2HUHA 1NBYA 3SQOH 3WE1A 4HETA 4FXKC 3C2AL 5FYJH 2TAAA 4GSQA 4GP8B 4K94L 2NOYA 2AVFA 1H8LA 5LG6A 3U83A 2HFGH 3CFQA 2B4CL 1KPRB 5F1NB 1GKEA 5DVOA 2NY1C 4P2RE 1QX1A 1G6RA 4B9KC 2VZVA 1D6VH 4MA7L 1NPNA 3I85A 3RPKA 2NW2A 1UH4A 3B9KD 2VZOA 4LOVA 3GMOB 4MMZC 4KAQH 1KTLB 3U2SB 1E6JH 1KZYA 3RVXC 4PP1D 1WFMA 1GGTA 4JANB 4Q89A 5AVYB 2H0FA 1JFQH 2QGEA 2ENYA 4LLDB 4RISH 2WQAA 4QRRE 4GBXB 3TA3C 5CFHA 2P52A 3VFTB 5FEBA 2PP7A 3NABL 1ZS8B 2G0KA 3V0FA 3S97C 4S1DC 5DHVB 3SBPA 5JQ6L 4N86A 4JVUA 2CBOA 1PX8A 5C0JA 1MUJA 2UY6B 4KROD 4YC2B 3QQXA 3V5DB 4LEOB 5HXMA 2HRPH 2H6UA 4OIBA 4R0LB 3NFNB 3L4WA 3MRIB 4LDLB 1CLZL 4G6JL 1JV5A 4GPVA 1SXBA 5EULV 5HD8C 1KLFB 1QZ1A 4KQ4H 1ZXQA 1UH3A 3VGFA 4ACTA 4AK1A 5IGXH 1MRCH 1I82A 5E1GA 1UH2A 1X5YA 4F3FB 5C09A 3IRPX 1T5XA 3S0PA 3UAJC 5EOCH 4L4TA 1KTCA 1V3MA 2ZJSH 2R15A 2YPLD 2VKWA 5AZEH 3CVDA 1IFRA 1ZEAH 2NYYC 2R0ZL 2A0LD 4ZYKA 4Z7IA 2UXVA 2WBXA 5FGBA 4BYHA 3SE9H 1DSWA 1L3NA 4TQEH 5T3ZE 5MEPA 1RP9A 2FL5A 3BZ5A 4N5UA 3MRQA 5JPNC 1ORSB 3KH4A 1XH0A 1TOXA 3MREB 3QXWA 4PP2A 4U4IA 4DETA 1NL0H 1SBSL 2BOBB 2PNDA 3LNHA 3B8SA 4OJFH 2GVYA 2NY6C 3FK3A 1XFPA 4J3WA 2W95A 3WY2A 1FZMB 4NQVB 4HS6B 3NZ8A 4WTXA 5E6SB 5IJVB 1SOKA 4YDKH 1P53A 4XBGB 3LZLA 1FNGB 4X6CA 5I9QB 5B22A 1ZJAA 5DUML 4ODSL 4PJ8D 3RURA 1ZT4B 5D93C 1UUSA 3U30B 2JXMB 4FLSA 1RJLA 3ZJAA 1EWHA 2OI9B 3M7OA 3I3BA 1N5YH 3TJPA 1MVUA 2HVKB 4MMZB 3NCBB 1HHJA 3ULUF 1CB4A 1KPUA 3RZCA 2DYPD 1AHWA 2NLJB 3DTUB 1YNTA 1G7MA 5SWSA 1V5JA 2VJ8A 2ZSVA 3VFNA 2WAQA 4LLYA 1XH3B 1G1OA 3EF4A 3L3OC 4F80A 4JDVB 3WFZA 1INQB 1HU8A 2YQBA 3LH9A 1KCVL 4L8SC 4D9LL 5HPOA 4EF3A 3UZEA 4C4UA 5BUPA 5BS0A 2WVSA 1KGUA 1G9NH 1NCAL 1W72A 1ZVHA 1QTPA 2BDNL 2WTPA 4WDIB 2P8LB 3FB5A 5A3IC 2DV6A 1MAML 2Z31D 1GGBH 4LLMB 4ZUSA 5D7EA 4DIXA 4NB7A 5ISZB 4PJ7F 2NQCA 2AK4B 5EBWA 3HKFA 1QMUA 4HH8A 4KJYA 5FDWA 1QLEB 3U6XS 1N5AA 3QJZA 3UAJA 3C60B 2C7FA 5A43C 4G83A 2V2WA 2XWDA 4ISVB 3SDDC 1U93A 1ZA6B 2EDJA 2X10A 2BSCA 3CC5B 3ZT6A 1N59B 1AH1A 2W65B 1T0NB 2VR8A 2VN6A 3L1OH 4YHKH 4CVXB 5E08H 2K7QA 4U3CA 3HC3L 4IHOA 3QEQA 4N90D 4F9PA 3DMMD 4JFHD 2YFOA 4X6DA 5T1LA 2GJZA 4MJ4A 1ULVA 3L3KA 3HAEA 1EAJA 4L48A 5JZ7C 2XG4B 1I3RA 1P1VA 2R29L 15C8H 3X3FH 2OMYA 2C9AA 4HKJB 4W68A 3STLA 2PP8A 1HZLA 1I1AD 3QHZH 2X4OB 3BSZA 4AQEB 4PGDA 4ELMF 1Z66A 5DSCB 3BKMH 4FMVA 1CGSH 3M17B 3WKPA 2DQCH 3FUEA 5DS1A 3FTGB 3QNZA 3HE7C 4JY6A 1VFAA 2A74C 1MFVA 3BSGA 5MERB 2BP8A 3OF6D 2OM5A 1M9WA 4K3JH 4AYID 5IF0A 1EO7A 4LSRL 1NCGA 4GFXA 1HXMB 1MJ8H 3TO4A 3RZCC 3JV6B 4P99A 4YC2C 5CEYB 2OMTA 4NQEE 2C4XA 5IEKA 2WIMA 3MCG1 4OFDA 4DGYH 2WZAA 3FKUS 1M42A 2L7EA 2ZG3A 3MA7A 3SE8H 1E40A 2FX7H 4MNGA 1LWHA 2BNUB 4JFYB 4OSUL 2IBGA 3UZVB 5K59F 4WY7H 1N0XH 4P3DA 2KT6A 4G8IA 1QFHA 4H26B 2ID5A 4PI0A 1FAIL 5HGAB 4HD9A 4AZ8B 4RA0C 3RX8A 4TRPH 4E0RA 2W0FA 2XA8L 4LLWA 4GKSA 2J8HA 1UOKA 1EXUB 3IXTA 1PSKH 3H42L 3V0IA 4JFOA 1EVUA 2BINA 2GJ6E 2ADGB 2NY1B 4F57H 1CF8H 3J07A 3K6DA 3KPRB 2WPGA 5DFTA 4LAQH 2VITA 1ZGLP 5T1MA 4GIAA 3SDDA 3IU3A 4JRYA 2W0PA 2EC9T 1VFOA 5C70A 3DETC 1AVAA 1XDTT 3IWVA 4U1MA 5CP7B 4B5ZA 4ZUTB 2DWTA 4HGMA 2DTMH 1SYSA 1WTLA 2IGLA 4PV9A 2VDRB 3BWZA 5CZXC 4A68A 1LQSR 1HI6A 1M1XA 2H6OA 3K4AA 3S36X 3RWCA 1MZZA 2V9TA 2VR5A 2XBZA 3PGCA 1JZHA 3IFLL 4AW4A 2AQ3A 4PRDA 4WCYL 1CF8L 5DC2A 5KYYA 1DCLA 2O4EA 5JUEL 2Y07H 2YS4A 3KPRD 4GSDL 5T3XH 4G9FE 1G7QB 4MD4A 3V0HA 3FOLB 3VE0A 2A74A 3G04A 4L1LA 1RURL 3KGUA 3CFEB 3SZKC 5E8DH 2F54A 4HDIB 5FK9A 4XNXH 3RVXD 1JVOA 2IQ9L 2VMJA 4OGZA 3VYOA 1RZIA 4X6EA 4IBWA 1EVTC 4PJGF 3U1QA 2XWBA 2MHAB 5I75B 2NX5E 2W9DH 2WIIB 3QDME 4X5RA 2VN7A 3A4EA 1IQWL 5BRZA 1JCKA 1PU0A 2JB6B 3FQ1A 3J27A 4OFIA 3ELAT 2AQRA 4P4KA 3TYGH 3Q8CA 2O61B 3P73A 4I0CC 3NJHA 3DHPA 2JJSA 2CDGB 4F20A 3L5WA 1KBGH 2OYLA 2YAMA 1YMME 4QHKJ 1Q72L 4QTIL 4LASL 4WSGA 1NAKL 4R4NC 2E6QA 4XNMA 5F9WC 4AM0B 1H8SA 3DX7A 2CO6B 4M8UA 1DEEB 1RZ8B 3ZGHA 4NZUH 4ZODA 4DN3L 1AC0A 1KZQA 5DD6B 3V8OA 2NNAA 2CBMA 2WXIA 4PBDA 2X53A 3U82B 4G7VL 2DQEH 2DYRB 3EDFA 3UTTD 4XAKD 3DDFA 3BAEH 5E51A 4DQOL 5IROC 1RY7B 2P26A 1KB9K 2XN2A 5EUKA 3VFMA 5ICYA 5B1JC 2QPDB 4YSEA 4P4RA 3PUCA 3UC0L 1HINL 3ULUH 4GQRA 3WO3B 3HE6D 2ZUTA 3DVIA 1BEXA 1BVLA 4XMLL 5MI0B 1UXWB 1GC1H 2DLFH 3KPQB 1XXFC 5F0JB 1KEML 2X2HA 4KRMB 4NKDA 4X9IA 5LQBL 4UCFA 2GC4C 1GPOL 5BUAA 2G5RA 4AMWA 3EFDL 4HUMB 3RZWA 3KLHD 1OW0C 3GB7A 5KJ4A 4K7PH 5DLLA 1A7RH 1PG7X 1Z32X 2AMGA 3HG1D 1R75A 5I5RA 4ONGL 4A39A 2W0KA 3VU1A 4Y5XC 5H94A 1FNLA 1I8IA 2HMID 4JKWA 2HT3C 1SXCA 2MOGA 1AC6A 4HIIB 1TZIB 4MMYA 3PY9A 1OCWH 1H3VA 1UZGA 5T3ZL 1BD2E 4C47A 4JCMA 4OM1H 4R4ND 5D1ZC 3GBDA 3OGOE 3KBPA 3F7VB 4LCUB 5HBBA 3T77B 4YX2H 2IVFC 4GRLC 1XBDA 4R8WH 2PW1A 1FL5A 3KPNB 4GAJH 2HKHL 2ZWNA 3SKOA 4NQSB 5FFOA 4MD5A 1RIVH 4E41B 1THAA 3JT0A 5K59E 1NC4B 4OZGA 1NL0L 1SBSH 3MRMA 5AWNL 4ZW3A 4K5LA 5EZJA 4U1LB 2ZYRA 3FONA 4H40A 4FLHA 4KJQC 4OFVA 2XIBA 4YN3A 3TFKC 4LSUH 4G8IB 4IMLB 2BCMA 5FKAB 3APMA 3NACH 5F7LB 3GSWB 4EZMA 1IGFH 1XZ0A 4WWKA 4FL4C 1RZPA 2VLKA 4JGJA 2QGBA 4ODWA 4BFIA 4E42A 4RBPK 5DYOA 4M9PA 2GK2A 1U8NB 5J13C 4KKNA 4I3GA 5FW7A 4JFOB 4WF7A 4P57A 1UB6A 3G6DH 2ADIA 3FUFA 4I7ZC 2A6KA 4KY2A 4YH6A 5JO5A 1AGFB 3GNMH 5JORB 2D7TL 4FG2A 4B50A 2JIXD 2IFFH 3WIIH 1NBZA 5GQBA 5F2FA 5I1KL 1NBVL 4Y19B 4N5ED 1N6VA 5DJXA 4EUPH 4N8PA 3ZR6A 5I8CB 5FYKL 1NUNB 4AIXA 3SKJL 1BEYH 1SRDA 2A9MH 5EH1A 1KCVH 5MI0C 4H1LB 2JTYA 3GKWL 4JKNA 5F6HI 1E4KA 2X4RA 4A1RA 5MHSD 1D2PA 2H5UA 1KXVA 4I2XE 1OP9A 4L0ZA 3HG3A 1W0WA 2ZTBA 1MJJA 4Z5RA 2VDKH 3A6OA 1F02I 4P04A 1EJ6A 1DL7L 3HG2A 4PYHA 4P2OA 3VI4F 2H0PA 5D7KD 2WBJC 5KYXB 1KNOA 1NMBL 4AYFA 4OIAA 1UJ3B 1RZJC 2XXCB 2P7TA 4XO8A 2X2YA 4XNBA 2XXGA 1NC2D 3R06B 5CWSB 2IG2H 3TF4A 3MRBB 3UX9B 3F5WA 2HA1A 4MMXB 2BJMH 3GJFK 4OZFB 1M2VA 3ZX1A 4RNRA 2JF1A 2BIIA 2Z91A 1W9XA 2O5ZL 4GAGH 4BFBD 3FO2B 2CXKA 4XN4A 4NBXB 3FOMB 4Z95L 3PWLA 5D7JD 5AYQA 4CILA 3QCTH 3SOBH 1PS3A 3RVVD 4HWEH 4R90L 4M43H 5CBAB 1G1KA 3IMVA 5DDHB 1U8PA 4HWBA 4MCYB 3V6OE 3KYMB 5DCCA 3MXVH 1IVLA 4XAWH 2BVPB 3O4LB 3O41B 4TULL 3BRDA 1KMGA 3PNWB 4MA1B 2HX9A 4GEJA 3DI3B 3DUUB 3NP4A 4FZEL 4M4PA 3UPCA 4GG8B 3RWDB 1XGTA 1WAAF 1NMCB 1OGTB 3IMWA 4AQ1B 4GSXA 4DTGL 2NDGA 3ATFA 4L5FL 5LBGA 5EO1A 2W9LA 2A77H 3FN0L 2AQSA 4AXWA 4GAYB 1A02N 3GLZA 5FPIA 4LPTA 4BSWA 3VFVA 1MWAB 3VM7A 3ESVF 4LCYA 2H2PD 4LDCA 1TIUA 1R5WA 4MB1A 1HEJC 4JRYE 2Z35A 1RL1A 1JF6A 1J87A 2FCBA 2CR3A 2J1KA 3AG1B 3L2NA 1FVDA 2F74A 2I60L 3QWQB 1JV2A 4TULH 2BMKA 4S2SB 3DRQB 4NUQA 3C09B 3T0EC 2NUPA 1CG9A 3QG7L 1OSPH 5KANG 2QVFB 4KVNH 4A7GF 2HLFC 2Y7LA 1YNTF 1SJEB 4DGYL 2GG1A 3QPXH 4CGTA 1S5HA 2VGLM 3BQUA 3QJFB 2OSLA 4AGPA 4P2OC 3VFPB 4WFED 5JHDA 4U1IB 4WWOA 2Y5TB 3G08A 4AK2A 4AGLA 5C0GB 4JG1L 5DWUL 1N2RA 1JHKH 4O5LL 4LQFH 1P84J 4UT9H 5EOTA 4M8VA 5E4AA 1G7JB 2PP9A 2DBLL 4JO3H 2V7HB 1H6TA 3QEGH 4WWNA 3H42H 3D69B 2RAMA 2UVEA 3LB6C 1L7IL 2UYLB 3R4RA 1MF2L 3KCPA 4N25A 3OB0H 4CNIA 1EMTL 3RX5A 1AIFB 2WP3O 3F00A 3WEXA 2GBTA 2XA3A 2XTJC 1U91A 3DGDA 4PCKA 3AADB 2XKNA 5D7IA 3VRIB 4ELKB 4L4VE 3U1PA 4FQIH 3QXDB 3ZKND 3GMMB 1MCPL 1KLUA 3VTTA 5C1MB 4KVNL 1NSNL 1OP3K 4JHVA 3UAAA 4P8QA 3FT1A 1UQSA 2G0LA 2OTUA 3DO7B 5E6IC 3AS3A 1G9MH 1AE6L 1B0IA 1FVEA 4BH7A 1YY9D 4EQ3A 3QFDB 2P4AB 1EH9A 2BVOA 4OZIB 3OZ9H 4PRHE 1A2YB 3AM8C 3GBMH 2WLYA 3K2KA 4NSKB 3FO9A 2JKIS 4Y5XB 3F05A 2DICA 1U33A 4Y1AA 3TS8A 2BY0A 1R3KA 4IKIA 2O72A 4P5RA 2YD3A 1ZVYA 1IJNA 3EBIA 2YPLA 5IB2A 1YY8B 4FQ1H 3NSXA 4K7FB 4APXB 3UYPB 3KXFA 5BUGA 4OCSH 4RETB 5KYUB 2DAVA 3G6JF 2BSDA 1JS4A 1FNFA 3B2PA 3C8KB 2WLHA 3VDCA 2XRAL 4NO3A 4HIJB 5HHOA 3NRPA 3K81A 3VFSB 3W0WB 1EAQA 1BJ1H 1T83A 2G5BB 2HTKD 4HKXA 3F04A 2VLRD 1V55B 5LGYA 2X4QB 2KUTA 1E9PB 1DBAL 3W2DL 2AEPH 3HG0A 3QR2A 2AQTA 3V9CA 1DQJA 5DHXB 5GISH 2NY3B 1JZ2A 2YEQA 2CHZA 5E5MA 1BM3L 2EDMA 3DO3A 4YZWA 4KZ0A 3N1PC 4UINH 3IFOA 4WI3A 4AIEA 3AY2A 2IMNA 5DZPA 5H37G 4WHYH 3ULVH 1KTJA 1KTDB 1T1ZB 2J8UB 3GXMA 4H20H 3DV6B 1JCVA 2YEZA 2H2PC 3QDHA 1C5BL 1YEDA 4KBPA 4NEHB 1CD9B 1LNUB 4K2UH 4AV4A 2PCYA 3FFCA 3QQ9C 5CSZB 5D72L 3O2DA 2ZOKA 4M7JH 2CUHA 3U46B 3D34A 1ZHBB 2A83A 3C5JA 1KJMA 2V9QA 4PRHA 2YXMA 1L9TA 4MZ3A 1GRWA 2MCPH 4RNRB 1QWUA 1RJZB 4K7PY 3THML 2BHFA 3HRZA 3PWNB 4Z77B 1VADA 5CAYB 4YDKL 1EDQA 1S9WA 2D7OA 4P9HH 2X1OA 5FYJD 4FXGB 5CD3B 1DVQA 5CP3A 4XRCB 1I8KA 3WOVA 2BW5A 3MR9A 4L18A 3OSVA 5CBAA 2RGSA 2R29H 3X3FL 4FNSA 4IRZH 3ZLQC 4PS8A 3N41B 3FTYA 3WBDA 4GRMA 5I19L 3UGUA 4O02H 3HI5H 4Y5VB 1T1XB 1FVCB 3LOWA 1MDAA 1PG7H 3JTBA 3WGUB 2H9GA 1LP9A 1DFXA 1KLFA 1KIUA 1IM3B 3TX4A 4Q0XL 4D9LH 3QG6A 3CZUB 4Q9BA 1MRFH 4XMUA 3T4AC 4DZBA 1OGAE 4X8JA 1R5WB 1OAZH 2QR0A 2Z65C 2XWEA 3BAJA 3ML9A 1T21A 2N7BA 2Z31B 4EZLA 3HS8A 5DR5H 4PJIA 5B1KA 3UTSD 4MCNA 1UT2A 1UCBL 3NBNA 3RFRA 4F5CE 1S78C 2UY7A 1ETA1 4LSUL 3TBTA 5IB5A 4WKZB 3DRQA 1H0DA 3GLDA 2DH2A 4HV8B 2VT0A 3AG2B 3AXHA 3A67L 4JPWL 2ADYA 2APFA 2X6BA 4W9ZA 4JZOA 3NCCB 3BQUB 2V2TA 1NGPL 3L5HA 2QSCH 4X9FA 3BKJH 1MCWM 1FNSH 4OLZH 3U4EA 3WUZA 3PQYE 3DGGB 2VLRB 4G7SB 1MW1A 1VGKB 2GCYA 2JCCB 3B7YA 5DO2D 2IEPA 5A6IA 4ZX3A 3FT2B 5KN5B 3WTTA 2XCMC 2JE8A 2IAAC 5DGRA 2PCFA 2XXFA 3IWUA 3ZQ9A 5D7IB 2Y1VA 3PGFH 2ZT9C 4ZX5A 4IKJA 4AMXA 3QRBA 3LVEA 5DURB 4FFZH 5IP4A 4S0SD 5L4FA 2NY0D 3HE7D 5DMKA 3FQXA 2CCVA 2NW2B 5JW3H 4G1MA 3ZKMD 1EERB 3Q44A 3I6GA 3WNKA 3S3JA 5DD5L 2YAQA 1FNEB 4JCWA 3FO1B 3B43A 2EDLA 4OIIH 2CMRL 3ARBA 3DYOA 4QEGA 3GHBH 1RZQA 5I0VA 1ZPLA 5CSBA 5SV4A 1ACXA 3H9YA 3VTAA 3SPGA 1QD0A 4FULA 4A7VA 3DJRA 4NN5B 5D6DA 2ENPA 1YJDH 2WXFA 4ORGA 4M03A 3OAUH 3N06B 3L1GA 2E86A 2FDBP 4Y4HB 3EGSB 4NZDA 3R18A 1L3WA 2CJUH 4ES9A 5JXEA 3IYLW 1HQRA 3FJTA 5IWLA 4LPXA 2OS7A 4JHBA 4O2FA 2N0KA 2ESVD 2AQNA 4JFXB 1U8CA 5DD1H 4JFEB 4H8PA 3ARDD 2EKJA 2FECL 3EZJB 1DEDA 1P2CA 4HBCL 5B1CA 3QO1A 5EUOB 1S2EA 3BO8B 3CN2A 1BQLL 4HLJA 4PJFA 5LGJB 4V1DB 4BFOA 1U8OB 1KTDA 1OD7A 1T1ZA 3SQOL 5BVPL 2H32A 3PP4L 5FKPA 2H3XC 2VW7A 4QRQB 4GW5B 1AO7B 3U7WL 2FB4L 5CNHA 3KPPA 3LXCA 1L0QA 4DGWC 1JK8A 1XCTA 4FF9A 1QQDB 2ICWI 1FZJA 4N2CA 1FPTH 3L3IA 4QTFA 5CEZD 1P4BH 4Z3FA 2XN9A 2CRYA 3UG4A 3LIUA 2FSEB 5CM1A 3L1EA 3BMVA 2W80C 2J73A 2ZXEB 5KVFE 4H0GA 2HG5A 1LVEA 4L5FE 3SZ6A 5IQNA 2ZOLA 3G5WA 2AV7B 4N2MA 1QOKA 3SKNB 2NTSP 1HILA 3AXLA 5E56A 1QSEB 4UTBL 4JJ5B 2FHFA 3PQYB 3KVPA 4JY4B 1DFBH 3WDJA 1DJSA 1WZ1H 4FNRA 2AJSH 4JRXB 3HG1A 2EVFA 2WZPA 2Q7YB 1MFMA 2GUOB 5INDA 3T4AB 3UTZB 4ZOBA 4X4XB 1ZLDA 2E7CA 3QJSB 2OP4L 4MZRA 4RQQB 5DEFB 3JWNE 3FQUB 2Y7NA 1IC5L 3UC2A 1F86A 4XXDA 1HHIB 4W9KC 5LUMA 1T66D 1OSZB 1TKWA 2VDRL 5D7LD 5LCVH 4Z7WE 5DYFA 3S8FB 2Z4TA 4GS7B 5ESAB 3A6BL 4UTAA 5I6XC 1IC0A 4HC1H 4UNUA 4P59L 4AC4A 4CN6A 1OD9A 2LQRA 1J1OL 1P1ZB 2AXHA 4M6AA 1L9MA 3PHSA 3WS6A 5CEXA 3H0TB 1HHGB 3OJVC 1BQHG 1DFBL 2XWJB 2JJUA 2XV0A 4PG9A 3QK0A 1FN4A 4QJ4B 2ZP9A 3OKMB 4G6FB 4Z76A 2G60L 1UWEL 3GM8A 3A21A 3EYFA 1N0XL 2F1BA 3QQDB 3LS5L 3KPLB 5KYWA 4GLRH 4WLCA 3SBQA 2NZ9D 3SN6N 4J2XA 1J5DA 4FEIA 1M3JA 1K8DB 5SX4I 5LWYL 1KDJA 4JKPH 5IBUB 1GZHA 1AQKH 1KB9J 1EO8L 1HAWA 2HWZH 3OKNB 1U8JA 3W9EB 2DL2A 2XV3A 4UBDC 4WI4A 1LO4H 1LEGB 3INOA 5CR1A 5F96L 1WO2A 4HYTB 1CXHA 4IIQA 2APXA 3D52A 1EK3A 4ZX4A 1A9VA 4A63A 4PUBL 4X0KB 3B2VL 1HC1A 4KOCA 3DHUA 4JRFA 3WLWD 5K69A 1XGRB 2F7IA 1MCCA 2WXPA 1RUKL 3FU7A 4J8QA 5FOBB 1H3GA 3HNVH 4LESA 3AXIA 1AO7E 2XVBA 1Y7VA 2CXGA 3K0YA 1TQUA 2FO4A 3JBG7 2BSTB 4NCC1 5D93B 3U30C 2ITCA 3QAQA 1XV8A 4ADIA 1B3IA 3QNYB 2Q8AH 3OB8A 4OJFL 4NN5C 1S7WA 2BOLA 4CL7A 1A4CA 1VDGA 4G2AA 4QHUA 5E8EA 4U2ZA 1HXMA 3TO4B 4AQAA 1MFCL 2JJWA 2WXLA 3NJLA 1OPOA 2GIXA 4QF1B 4XPHL 4WHTB 5E99H 4LLMA 4ZUSB 5ID1B 5JZ7D 2VNCA 1TVBB 3VFTA 1AANA 1EA9C 3ARBB 4PJ5A 2C7UA 4U49A 1DQVA 4WFFD 4HISA 1OV8A 2APSA 5JHLL 1Z1WA 4UOQA 5FDWB 3TN0D 1QZNA 4ABWA 2J12B 5I18L 4JFFE 1K2DB 4NM8H 1Z5LB 1TR7A 4JRYD 1UVQB 4DERA 1BBJB 5CEZL 5I30H 5DRWB 3NN8A 3NSCA 3RI5K 5DI8B 4L8BB 1JXJA 1TJIH 5JPNB 1IAKB 3VXPB 3WSQL 2ILLA 4R5TA 1BMGA 4FA8A 5GGVY 3QHFL 3WFBL 4X6DB 5T1LB 4YPGB 1XGUA 1BPLB 4KPHL 2XG4A 3D07A 5ETUA 5E1QA 2WBWB 3VXQA 5A7BA 4S0HA 4PB0L 1UGKA 1OT1A 3BO8A 5EIIA 4OF0A 1M6OA 1J8RA 4CU7A 3EAKA 1GZHC 4RSVA 3Q5TA 3CFMA 2QQLL 5D2NB 4BELD 1JOIA 3L5XL 9PCYA 5BRZD 5AW1B 3OKDB 3CVIH 2Y7QA 4U1SB 4JGNA 3HMXA 1QHQA 2UXGA 2F53B 4RGNC 2XN9B 3M45A 3QHFH 3TNMA 2RCSH 4BZ1H 1NFDF 3SGJA 4L8DB 3DXAB 1NFDB 5IB4B 2Y7OA 4MNQA 1JZEA 5TH2B 1QRND 2H32H 2ZOLB 3MDJA 3DX9A 3SKNA 1L0XA 4ABQA 3T04D 2FNBA 1BZDA 3CFEA 3FUIA 5ICXA 5EZJB 4JFYA 3UZVA 4YWGH 2YQ2A 1HQ4A 4LLQA 2BC4A 2EDQA 4NFBA 1RZGB 4CC4A 1CU4H 2GUOA 3JQOB 3I02B 2DIJA 4NC0B 1YAIA 1QFOA 2OMUA 2EO1A 1KV7A 4OCYH 5F9OL 1NAMB 4XVTL 1GSKA 2VLKB 3G3LA 3T3PE 4BQ6A 5AUMA 1XGQA 4H4NA 2HX8A 3ZDZF 3EGXA 4CKVX 3QEQD 1J0ZA 1BLNA 1MNUL 1T7YA 3GO1L 4YDMA 2CZNA 3VI3B 1LE5A 4HF5L 3VXNA 3U79A 4G5AA 4L1HA 4E9SA 4IJTA 1XF4A 5ESAA 4X0NA 4OZIF 3SDDB 2WGNB 2I9TB 3BGFB 1U58A 3D9AH 1UEYA 4XZUB 1MCSA 3UAJD 1BXVA 1NIAA 4AM0A 5CP7A 3O2WH 2W5PA 5C6TL 1KYDA 3BD4A 1FLRL 4ZFOA 3BKYH 4RGND 3F7KA 4N0CC 3HHSB 3HUJB 3Q6FA 3ZMRA 2WQXA 3RWCB 4ECNA 4WTZA 1C5CH 1QVOA 3NACL 4QIRA 1RH8A 2EZ0C 1KXTA 2VDKL 4PJDF 3QEQB 3V7AG 1JHTA 2VMEA 1KC5H 2FRGP 1F3RB 4O58H 4JDEA 2F6AA 2EACA 2VL4A 4YJZL 3P11H 1DN0A 1EAPB 1NCDH 4G9DA 5BW7C 5DS8A 3UZEC 2EKSA 3QT2A 3ULVE 2AKRA 3CFUA 4JFZH 1NWOA 4ZMYA 1PKOA 4LPYA 2ZWSA 3GUFA 4Z7UB 1FCGA 2MHAA 2QSCL 2OYPA 1P7HL 4YO0B 1I8IB 2WIIA 1BZQK 4PJ8A 5D2NE 2AXFA 2ZAHA 3KWVA 3PDOA 3N85H 3ZQXA 1VFAB 1QBBA 3MV7A 2YAHA 1CFNB 5HI4D 5MERA 4EDXB 4FQHA 2CDGA 1GY2A 3I6LE 3T6XA 3KDPB 1G9EA 1A5FH 4I0PA 4DUVA 1VLXA 2X1XR 4BZYA 5FO8A 3PAZA 3GMLA 3OL2A 4HIHA 3CSGA 4ODVL 4OM1L 4YHZH 5C07D 4PB9H 4A6YH 4MSWB 1FG9C 4Z6AT 3CTTA 2CSPA 3DX7B 3P11L 3QS3A 4Z7VB 3C6LA 1WHPA 3LPFA 2X1PA 4U31A 5DD6A 5D7JB 3VFOB 4DGVL 3GGWA 4RDQF 2FGWL 4ZFGH 5EHFA 2XIDA 4K3DL 1PEWA 2F19H 4JQXA 3TT3H 4GINA 1QFUH 3KWWA 3WTVA 2IANE 1IAIH 3N85L 4UOW1 3AQDA 4QJ3B 3WHXB 4I0PD 3VFVB 4L9DA 4C56A 4JN2B 3TZVB 3T0AA 3Q3GA 3QIUB 4OUUB 4BE5A 3IRCA 1FZKB 2C9VA 1I85A 4OGQC 3BWAA 1TQSA 4NN7B 2Z35B 1JPGA 3IFNH 4JFUA 1UA3A 4OQTH 3ME0B 1ADQH 3MA9H 4QR7A 1HE8A 5IVXB 1EFXD 4DZ8B 5D1XE 2HMIC 1A7PL 1OGAA 3K1KC 4L8SA 5T1MB 1MOEA 2Q3XA 3ZXAC 3TCTA 5I17B 4RSYA 2VXTH 2DM7A 3QNXA 2XBDA 2R29A 1KBGL 1HYSC 3QXVA 2WCSA 1KF9B 2R0WH 1JTTA 3DSFL 3EFFA 3P3UA 4KXCA 4PVMA 3RB7A 3H6JA 4OD2A 3STZA 4HX1B 3QS2A 4PV9B 4RMTA 1YVLA 3ALWA 1LQBC 1S5HB 2DWSA 1MLBB 2W59A 2F8IA 3APCA 4ZBJA 4KTEH 1VFMA 2N1KA 4LVOC 4TVPE 2X3CA 3DV4A 3GMQA 1NOFA 3MBWA 5CN1A 1ZHLA 5JOFB 5LQBH 4LQ1A 3RTQA 2DEWX 1NGWB 3U6RB 1IC4H 1JPTH 4Z7AA 4JO5A 1EFXA 4LXFA 1E9OA 4IYKA 3SJVB 5KJRL 1I31A 4QGYA 4XOBA 5TTRA 2NTFA 4TUUA 3RIFK 4XMVA 1O6SA 1QLFB 1KPRA 2FEDC 4P07A 4Z7OE 2XWTB 4C56D 4ZMPA 1EHAA 5TDOB 1YZZA 2XZZA 1RHHA 2YA1A 4NNYB 1YDPB 2X89D 4I0PC 4IBVA 4DW2L 4B9YA 4LRNL 5D96B 1I3GH 4C56E 2EYSB 3Q8FA 4UV4L 1GR7A 4NJ9H 3AJ7A 2IV8A 3GTVA 2PYEA 3L4VA 1E3ZA 3NAAH 4QTIH 1MEXH 3P2TA 1ZMYA 3H3BC 1TTUA 5I1GH 2N3JA 2WLNA 1S8DA 1PLGL 1IC4L 4OZIE 2V5MA 4NZRL 3HE7A 1OAXH 4EI5D 3O3BB 4HJJL 1QTSA 1NGZB 1ZDQA 4A2HA 4WSJA 2B1OA 1R4XA 3OLGA 4FQXB 4MCYA 2FYYB 2EXTA 3NIDB 5BOZG 3EDDA 1J0HA 1NBZB 2BRQA 2IXQB 1QWHA 4XPFL 2ZKXA 3C8KA 3M46A 2OK0H 3V5DA 1E30A 1JI2A 1BOYA 2ARJQ 2FZ3B 2Q5BA 3N9GL 3LQZA 1S4IA 2JQMA 3D39E 4JFPA 3CDYA 4XXCA 5AW3B 1A25A 3BN9D 3L81A 4F2ME 1J10A 4ELDA 5HP5A 1BIIB 3P9WB 4X99B 1WIUA 4BSWB 4ZD3H 1T0OA 2TRYA 5GGRB 1S7QA 1ZA3A 2G3ZA 1CVRA 4U6VH 3TF7C 1CBJA 4OGYL 1KIRA 1OAXL 1YEGH 3TH2T 3LXAA 2J8UA 5L88H 1OP5H 2NY7L 1RUPH 1S7XB 2AF2A 2EH8H 1AYOA 4N2NA 3HZKA 4A2MA 3PL6A 4UU9A 1DN0B 1EAPA 5E99L 2BOBA 4A7GA 5FM5O 1QUNA 5DT1L 4WIQA 4JK0D 1MCIA 2F7PA 2Y2TA 4KTDL 1Q1JL 1UTDA 1RUML 2LW3A 3VNZA 4TSAL 4OF5A 5KZCD 4WU5B 2WOYA 3KL3A 5HYQA 1BQ5A 1PBYA 4OZ4A 3QORB 3PNRB 1FJ1A 2QQKL 4WEUD 4HCRA 3LEVL 1S46A 3FUNA 1CGYA 5E95B 1MPAH 4PCSA 3V0JA 4WGWB 3BGAA