5DJ8A

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
total genus 34
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A01
2CMRH 3MLWL 2LVEA 4WW2B 4DAGH 5T1DH 1X5LA 5AZEH 3T1FA 3U4EB 1I1CA 4IRSC 3IGAA 12E8L 4MXWH 5A16A 1Q0YH 3CMGA 4UNUA 2WBJB 2JLLA 5MEQA 1MCBA 5HHNA 1FV1B 4LFHG 1FCCA 1H8OA 5KVMC 4HCRH 2XZAL 3T04D 2VLRE 1QOKA 4GLRI 1KGCD 4JM2C 2ZUWA 3MRFA 5D70L 4UV7L 1BZ7A 2P7TA 3TNMA 1A1MA 3X17A 4A6YA 1W8OA 5T3ZE 2F9BT 4JREB 1UFUA 2WWKT 4PR5B 3HS0B 1YNKL 3FT4A 1I8LC 4ZS6D 2OSLA 3V5HB 3CVHH 4RA3A 4LCYB 1UXWA 5F21B 4JO3L 3NA4A 1BF8A 5FAAA 3TA3D 4DK6A 1CD9B 4C56B 5I1LB 5GIRB 3U0WH 3FT3B 4S2SA 1HDMB 2ZPKL 3DO7B 4AIOA 1BOGA 4RMWA 2YD2A 1RUKH 1FJ1A 3N1PC 1NBQA 3NN8B 4YWGL 3KXFA 1Y0LB 5CBAB 1ZANH 3TZVD 5IMMB 3WIFB 3QNYB 5FK9B 1QFWM 4X7TB 1IE5A 2NXZC 1IAMA 5I1EH 2R0LL 3CSYB 3KLAB 5SV4A 1QRNA 4NO5A 4LSRH 4QHKI 4K2UH 1A7BA 4Z7WE 4JQIH 1A1NA 4MWFA 3BHBB 1C5BH 1A6TA 2ADFH 3BH9A 2OX5A 1MQKL 2Z4QB 3RTQA 3RDTC 3KXFD 4P2QE 4LPWA 1V3MA 5FGBA 1AGBB 1IAIM 4HUNB 4ETYA 2AJZB 2BVYA 2G60H 1HSBA 4LEXH 1K5NB 3TCLB 1Q94B 1ZSDB 2GI7A 1J86A 3D3VA 3GK8H 2Y5TB 2R1WA 1RFDL 4HS8H 4MLSA 4J3OC 4HWBA 2BVTA 2QEJA 4HK3J 4Q9CA 5EA0H 1AQKH 4JFHE 4ZSOB 1JYXA 4D9LH 4IEFB 1YMHA 1HIMH 2XY2A 1UZ8A 4LSDA 5GZOD 1AO7A 4Z7NF 4PJIB 1HHIA 2DQCH 1I8MB 5IW6B 2KUTA 3P9LA 3VCLB 1RZ8B 4HF5H 2X4OA 1WIOA 3SCMC 25C8L 4N90D 5EBWA 5I1KL 1N8ZA 1FNEA 4QRSA 2NY6C 2G75A 5EO0A 3UZQA 2DKMA 1IGML 5IBLC 3T3PE 2NNAA 3QPXH 4NQCA 4JKMA 2VXVL 1OP5H 5F6HJ 4MS8D 1LK3L 2R2BA 4NC2B 1AJ7L 1UCTA 3PUCA 5FDWB 5I15H 3DJ9A 4ZDHB 3UYOD 4UIKH 5D1QC 3GIZL 1AO7D 3S3PA 2DB8A 3WFHA 1VACA 3IXTB 4DGIH 5F7KC 3EOTL 3QUYD 4XGZA 4WO4A 3L9RA 3WN5C 4PGJA 1L6ZA 4NGHH 1U3ZA 1F6FB 4EN3C 3MCKA 4WTWA 3RY6A 5L8LB 1BQLL 4N0FB 5FCUH 1FFRA 1KNOB 4MZ3A 2FIKA 3VG0L 1T5WB 4PRIA 5DURD 1CICB 3MJ9H 3BRDA 1M6OA 4FFZL 1UB6A 4XCNA 3SE3C 4EI5B 3GSXB 2GCYA 4JRXB 1JZ7A 3HR6A 4UMGA 1Z9SA 2Y1VA 5CMAB 2UZYB 5DD0H 1FAIH 4PY7A 3UYRL 2F8VA 4LLVA 4DKAA 1A14H 1NCNA 2GJZA 5JQ6L 4PRID 4K8RH 4XCFL 3TGXA 1KACB 2I60L 4P2RB 3KVQA 3F12B 2UWEF 4YQXH 2D9QB 2FBJL 5FDYA 3V4PH 1T4KA 3VD3A 1EHAA 3PNWA 2XWBA 1KJ2H 3PWVB 2W07A 2VDKL 3ZKQD 1B6DA 3T0XA 1CIUA 1UM5L 2XWJA 3KDMB 4GBXD 5ACMA 4IRSA 3M45A 5FUZH 5HHVL 4JHZA 2D7OA 4TVPE 1R3IL 4XMKH 5T1KD 1FVCB 2Q1EA 2BC4B 2EDTA 3RVVD 3QPQD 1N26A 1G7PA 1YY8A 3SOBL 3GI8L 2Z93B 4WY7H 4TPRL 1OTUD 1X4XA 4M5YL 1G7IB 2G5RA 1T2JA 3IDGB 2ESVE 2FX9L 5I16B 3LQZA 4F7CB 4K7PL 2NTFA 4R2GC 4N0CD 4OUUB 2HFGH 1RJLB 3ZKND 4XRCA 1BD2A 1I8LA 3PP4L 3VI3F 4NQDB 4GRLC 3U7YL 3D69A 4JLRA 5EC1B 1KYOK 4LKCB 4KMTL 4HS3A 4KROB 1SMOA 2C7UA 4P3CH 3MUY1 7FABH 1E27B 3MO1A 3UAJC 5KTEL 4XPBH 4FA8A 1LO4H 4LCWE 4NNPL 3FO9B 1ZWIB 4J3WA 3T0AA 1LK2B 4PV8A 1NAMA 3DX7A 3GIVB 15C8L 5IKCB 2XQBL 3CFCL 1FLTX 5DUBA 3DXAB 1KN2L 2QSCL 3TWCL 1HWHB 5AUMB 3VXSA 1IGFL 5KVGH 3O81A 4XBEH 4IRJC 2J8UE 5EBMA 3PWLA 4G43B 3E0GA 4JJ5A 4QRPB 1MFDH 1MI5A 3LKRB 1S7UA 2R39A 1L7IH 4ZUVB 3OJDA 1V05A 3BQUD 3SKNB 2EC9T 2OL3L 3AS0A 4UI2A 5D7JA 3HMWL 4P4KB 3EFFA 4Z76B 4DFIA 2XN9B 3WHE1 2XNAB 4HUXA 3BIKB 1I7UA 1MLCB 3EIFA 4QOKB 3QEQB 4LNVA 2MPAL 2VLKD 3BWAB 3EYUL 3FN0L 3GMMB 5FO7A 4CVZA 2P8LA 4M1DH 5JOPE 4EUPG 1IBGH 1OWWA 4KAQL 3VFWA 1LP9A 1K9TA 2MNUA 4BKLA 1R5IB 2AQ2A 2I26N 3VXRA 4Q9QL 5DEZA 4DVBA 3LQAL 4M5ZH 1JRHI 3ZDXF 1CN4A 1L7TL 3CH1A 3O4LA 4LSVL 2B7DT 4G6JH 4P9HC 3GMNB 2GY5A 1KPRB 1QEWB 3VFPB 4GG6F 4MCYB 2FHCA 3SCMA 4HJGB 3PWUA 3TIDB 2NPLX 3U0PA 4H20H 5SX4I 3IJYA 4G9FB 1NL0L 4OV5A 4KUCF 1DL7L 5LCVH 1FPTL 4MXVE 1UXSB 5DXWA 4MD4B 3PF2A 4HPOL 4OLVL 4CVXA 3PQYD 4G6FB 5I0ZA 2B2XL 5J9PA 1AD0A 5CD5C 3LKPB 4QCIA 1KJVA 3B6SB 4YHOL 5D1QA 4H8WL 3B9KB 3G5YA 1FORL 1YY9C 1VFAB 9CGTA 2QSVA 1T1ZB 1HOCA 4LOUC 3WO3B 2P24B 5ITBL 3EYFA 2R1YA 4CU6A 4UINH 1BMGA 1Z2KA 5DRZA 3RVXC 1PG7H 1UACL 2YA2A 3JTSB 3GB7B 3W0WD 2VL5B 3I6KA 4ZFOB 5FA3A 1CDUA 1DQJA 1U8OB 4LPUA 1OB1B 4NQVA 1FZMA 3JWOH 1HXMA 4H1LG 2FX8H 2KZ1B 5T1LA 3TYGH 3ES6A 4JRYE 1NMAL 2JKXA 4XAKD 5JIHA 3TVMB 3MBEC 4HIEA 1S9YB 3BFOA 4UT7L 1U3HC 3QB7C 4BQ6A 2BNRD 4PS4H 4E41E 4D3CL 2E27L 4MNHB 5HPMB 4LLQA 1CG9B 1QZ1A 4POUB 4WHYH 5TDPA 1N6QH 1BGXL 3GSWB 1KCVH 2YPLA 4JG1L 1QLEH 5A1AA 1Y6KR 3MOBL 1JZ8A 3ULSA 1S3KH 1NFDA 2X2YA 1S7WB 4NQED 2BRRL 1G9NH 3S88H 1FL6B 4KJQC 5ENWA 2AAVA 3KNBB 4Z18A 3OKLA 4MYWB 5C07E 5KS9E 1A7RH 3O2VL 5CSZA 4DKEH 2EDLA 1N7ML 4KVCH 5DJXA 3V7MA 1JYVA 2NY7L 2YD1A 4MJ5A 4RIRA 1YYLH 4NKMA 5EU6E 2QR0A 2JJWA 1OAZL 3RNQA 2VR5A 1CWVA 5GS3A 3TO2A 2IG2H 3C5ZD 3MNVB 2Y25A 3C2AH 1EBAA 5E99L 1HE7A 1KLGA 5GS2H 4OSUH 4PGBB 2NQCA 3KPQA 1D5XA 2B8OT 3BP7A 5KAQG 4AL8L 5JW4M 2OJZH 4X8XA 4YFEA 5KANI 4LL9A 4AM0A 4JDZA 3SE9L 4WRLA 4XXDB 2FD6L 1HILA 4B50A 2WIIB 2PO6B 2WINA 1DBMH 2GTWA 2YD4A 1X5IA 4WV1C 4GKNB 1RAMA 1FFNA 2FYYB 2UYLA 3DVFA 5E1AB 1MLBA 3BW9B 4GS7B 3O4OB 4HFWB 3FFCB 4LLUB 1QNZH 2EEAA 4LBEB 5DD6A 5FECB 5E94B 2ZUVA 4LVNB 4MAYB 5I76B 2X4QA 3L3DB 4FXGA 3ZKXC 4JG0H 5HI4C 3RJQB 2EDQA 3JWDH 1CE1H 1IC7H 1WAAA 1X5HA 3LKOB 3LSOA 2GK0B 4LHUA 1XIWD 3SDDA 3QH3A 3MC0A 3QZWA 4UT9H 4X5LA 1IFHH 1RIUH 4JY4B 3NOIA 3EOAA 4FXKA 4QHNA 1KJMA 2OR8A 2VISB 3G5ZA 4KKNA 3V6ZA 1OL0A 4Y1AD 4M61B 2DL9A 5TPWH 1LE9B 3FONB 1EHNA 2N4IA 4HZLB 1UM4L 2OZ4A 3JUYA 4OZGF 1WF5A 4K07A 3DVNB 3SQOH 1D5MA 4BSJA 3P0VL 4X0KB 1NEZG 5CZVH 4BSWB 1QLFA 2PTVA 3QQ3A 1TTFA 5HHME 1INDH 4YXHH 2VJXA 4AENA 1OSPH 1JRHL 5AWNL 1OQOA 3MYJB 3SQBA 1WZ1H 2IEPA 2AK1L 2NXYD 4QRQA 4YX2L 1J11A 4S1QH 4N8VG 4FTVA 4OUOA 2AXFA 4OCXH 1A7PH 3IFOB 4P2OD 4ZUSB 4FFYH 2IPTH 3I02B 1JHLH 4NYLA 4XMLH 2XKNB 2PW2A 3ARDC 2B1HL 3STZB 2EDEA 3U83A 4YHMH 5F6IB 3CH8A 4R90L 3V4UH 4UTBL 3GSQA 3S9DB 5CP3H 3MRCA 4XBPB 3T2OA 4GW4A 5C3TA 3IF1B 3AVEA 3MXVH 2HAZA 1FZJB 4QY8A 1CDGA 2BY1A 2Y07L 3D85D 3RZCC 3TBTB 2F5BL 4NC1C 5MP6L 3UTTD 3HCVB 3NA9L 5EBLB 3S4SA 2IBGA 3D39E 5KZCD 4L4VE 1P7KB 5K59E 4QRUA 5JW4Q 1GC1H 1FLRL 4OJFL 2CK0H 5HD8C 4TVSa 3AREC 1L0QA 3BIAX 4R96A 4UBDD 3R1GH 1N59A 3WS3B 1S7SB 2V2TB 4ZYKA 1HYSC 1I4FA 4Y4HA 2WLYA 5D1XC 3MBEA 4WI5A 3T0VA 1U3HA 4ZFFB 2H26A 3K81A 1NCAH 3KPRB 1CDJA 3CC5B 2CPCA 3STLB 4P46C 5KSBE 2NW2A 3VWKC 3HN3A 4HUVB 2H8PB 3WJJC 3RAJL 1JN6A 2WM0A 3LKQA 5HBBA 1AXTH 3A6CL 4B0MM 5J1AB 1EFXA 2DD8H 5IGXH 4PB9L 1MJUH 4KV5E 4YHIB 2R69H 3NAAL 1R6VA 3HI1B 2ATPB 3L3HB 4WU7A 5AAMA 2YRPA 2B39A 4JKLA 3ULUD 4RFNB 1MY7A 2QKIA 1X5KA 3UTSE 3TT3L 1UVQA 2VN7A 4FNLL 3WIHL 1KB5L 2CRYA 4ORZC 5I71B 3BT2H 1MIMH 1G0XA 3FQRA 3D0VA 4OLEA 4HC1H 2BFVH 1PQZB 4NKOB 2AERT 2WWMC 2HN7B 5C09D 3N85L 4X5XB 2X1PA 1N5YH 5HYFA 3H42L 4X5WA 2BMKA 3SDCC 3ARGA 1UKQA 4ONGH 4PY8I 2XOTA 5I1AA 3OB0K 5FM5O 1IEBB 3UPRA 4WW1B 3FQNA 3W2DL 4LSSL 1J0IA 3TJHC 3RQ3A 3ESVF 3G9AB 4WV1A 3Q5TA 3L3IB 4FZ8H 5IK3B 1NH6A 4G8IA 4JFXA 5E2UL 4U6XB 1HHKB 4RDQF 5IESH 3E6HB 4H0GA 4JO4L 1W0WB 5D7KE 5C08A 2FWOA 4HKBB 3SO3C 3ARGD 4AY0A 5JDSA 2WBKA 3ZT5A 3H0TB 5HJ3A 5ESAA 2VDPH 4Z8FL 1NJ9A 1YPZB 5FO9B 3RNKB 4M93C 2GFBB 5I9QC 4FQCH 4QTIH 1Z0MA 1FG2B 1PX3A 1YC7A 4QHLA 4DJMA 4LIQH 1LO3H 4C83A 3IT8D 4BZ1H 4C58B 1VGEH 5E6IA 3IJHB 3O6FB 5DQ9B 3QCTH 1P2CB 4MMXC 4U7SA 5LAXB 1I3GH 1TJHL 3BWUC 2HMID 2YSSA 5IMKA 2AEQL 3GBNH 2NZ9C 5FHAH 1NCDH 2ESVA 1KCRL 4PJDA 2IBZY 4JCLA 4I5BA 1A7OH 3LMJH 2YOCA 2AW2A 5CJOH 3BDYL 2VH5L 3TO4D 2H2SD 3EFDH 2KH2B 4H88L 3BP6B 3NIFF 4UUJB 4PJXF 3H7BA 4X6DF 3VXNB 1HQ4B 4OZIF 4KRMB 3LZFL 3VGEA 4L4TE 2Z31A 1AGFB 1X5AA 1AY1H 2BOBB 1URLA 3QXWA 5B3NA 4K9EL 2PYFB 3BH8A 1NGZB 1A2YA 1MUJA 1I7TA 1DBJL 1KIRB 3TFKC 2BNUA 3OXSA 5EZOH 4L5FH 5I17B 5C9JB 1KJ3H 3MLXH 4XTRD 5DUPL 3ARDA 1T21B 1W72L 5DEGB 1MJ8L 3H9HA 1HWGB 2A9MH 1ZLSH 1CR9L 4BFBD 3VH8A 5DD5H 3VFOB 1A0QH 2HT4C 2Z31D 1G9ML 1EJOL 4DCQB 4JKPH 1SJEA 4LCCC 3QIBB 3EGSA 5D72L 2Q76A 4PRHE 3W9DB 1MCPH 2E9IA 5DFVC 5BQ7A 2XZQL 2YD7A 4A2LA 1GGIH 3D9AH 3HI5H 4Y19B 4JAMA 5BVPH 5IEHB 1S9WB 1SBSH 5FYJU 3SKOA 1F58L 1BFTA 4JO2H 3WUWA 3WFCL 3GJEA 5FA4B 1Q72H 2ORBL 2WP3T 4ODHH 5DR5L 5IMLA 1H5BA 4P9HH 2K1MA 2EIBA 3IRZA 4NRYA 3AREA 1CLYH 4R97C 1TVBA 4ZAKA 1IAII 4YR6A 1KPVA 4G42B 1AFVL 2A6IA 1HNGA 3QFJA 4LK4A 1QO3B 1NMBL 1UYWL 1KCUL 3U2SA 2DQIL 1FBIL 2F54B 2P8MB 3QQ9D 1U6AH 3GSNB 3ULUF 1XZ0B 2DBJA 3H2WA 1Z3GH 3QXDA 3VWKA 4LLDA 3IFNL 4PD4J 4ZFGL 5CBEB 2CIKA 5C0DA 4YGVA 1S7VB 3P77B 4RGND 1AKJD 2X42A 4XNZC 3HE7D 4JFZL 2J6EA 4WI3A 5E6ZA 4ZMAT 3KJ4B 4H5SB 4JRXE 5ALCL 5KSVB 3QFJD 1FNLA 5L88H 1UWEL 1A6ZA 1FO0H 4GOSA 5LGKA 1MNUL 2Z8RA 2WV3A 5H37H 5GGVH 3C9NB 2DM4A 3DV4B 2EH8L 3DMMD 1TDQA 2NY4B 2EDWA 2R0KL 3OKYA 5SWSB 3N06B 5CJ8A 5I8KL 4R4FL 5FKAA 4OF3A 1T5XA 1RURH 3DARA 2BY2A 3BKCL 4NZTL 1ZGLM 5ANMA 4TN9A 1S5IH 1ED3B 2DTSA 3MA7B 4JFYA 3K4ZA 4UDTB 3T0DA 1IT9L 2XTJD 4E41A 4RWYL 1IM9D 4XWOC 1J88A 1INEL 5DJDA 4Z7OE 3BGFC 1BM3H 2KPNA 3CZFA 3C5ZB 4MXQC 1DFBH 5ESVA 2VRAA 3PWPB 1JJUA 1MJJB 1V3KA 3DUHA 4QEGA 1QVOB 4XVTH 3ZT6A 3EJJX 4XAWH 3TIEA 1F4YH 1D9KA 3FQXB 4M1CD 5KS9A 3WD5L 3UZVB 2NTSP 2MKWA 5F44A 5E0QA 1LO5B 3QIWC 2IANA 3B83A 3IVKA 2JK5A 1CFSA 1I8KB 3J8F7 3FQTA 2HFEA 5CEZE 4I18C 4NC0B 1EHXA 3BESR 1GPOH 1ZS8B 3BO8B 1XH3B 5BO1H 1D9KD 5A3ID 1C5CH 1NUGA 1F4XL 1QFOA 3DV6B 5D96C 1T0NA 2ARJQ 1X5FA 2E9JA 4PLJD 4WW2C 5KVEH 4ODSL 3AU1B 1T7YA 1EVUA 4F58H 3I85A 2WBJC 4ZTPH 4DFHA 5DJZA 5BS0A 1X44A 4PJ7F 5C0CA 3WL9A 4QRPE 1K3ZA 4OGAC 3AY4C 1AHWB 1P4IH 4Z0XB 4DGVL 4YHNA 1A22B 1DLFH 5BRZA 3U82B 5C3LD 5D8JL 1RU9H 1RZFH 4JFPB 1XGRB 1A7NL 2XN9E 1EPFA 3QJHB 3U9PH 4JREC 4PP1D 4UT6H 4YNYA 5TDOA 3QEQE 4YHZL 2XPGB 4I0KA 1H8NA 2Z8SA 4F7TB 4Z7VB 1IAKB 5B38G 4AZ8A 5BRZD 4Y5YC 4OCMC 1B0GB 4WEUD 1EMTH 1A6AA 2OMBA 5BV7L 4PBWD 4NBYB 5H8DA 5GJTH 2B1AH 4YDLB 3FQUB 4PG2C 3O9WB 4HWBL 3MLWH 5ICZB 3MRPB 1WV7T 3ULVH 1KJ2A 2EZ0C 3O0RL 1J87A 4YDVB 3MV8D 4G9FE 1G0YR 3LRSB 4U1IA 1CFNA 3IDMA 4AG4H 3WLWD 3SGKC 4G9DA 4PJXB 4X6DB 1IAIL 2YZ8A 4V1DA 1NQBA 4MNQA 2DBLL 4TRPH 2XZAH 4KDTC 3LB6D 4NSKA 3T77B 3PWJB 1FYTD 4MD5A 5E8EB 4TTGA 3VJ6B 1U8JA 1I9JH 4Y16A 5E9DA 4G6MH 2EYRA 3BE1H 1T7WA 2JJTC 2V7HA 3MFFA 2A74B 3HZKA 1U8PA 2E8ZA 3IU3A 4OZ4B 4N0RA 1BVZA 3U0TA 4KZDL 3SJVA 5E8OB 1X5XA 2CKBL 1EJ6A 1QUNA 1M71B 1MFCL 3AMKA 3JTTA 4N5UA 4JO3H 2IQAB 4Y16D 4WWKB 3QDGD 2E3VA 5HGDA 2Z8VC 4QKXB 5GS1B 1QQDA 2ILLA 4KK6C 1E4XI 2XXMB 1MREL 1N0XL 3CXHJ 4GRMA 4GAGH 4JHBA 3DX6A 1H8SA 3SJVD 5LXGL 5GISH 4TULL 2J3SA 4JY6A 4OCRL 3OZ9L 5JO5B 2BSRB 5D93B 4M3KB 4HBCL 2G5BB 3D39A 3QO0B 2EYSB 2R0LH 4L4VA 3MYZA 3BD3A 5DQJA 1JVKA 1PYWA 1LVEA 1VSCA 5FYLL 3VI4E 3SDAB 3QAZB 2VC2H 4NJ9L 5K9OA 3T0ED 1DVFB 4OCSH 4ODBD 1OW0A 5C0AE 5DHVH 4DGYL 4Z7QF 3OGOE 1GGUA 5F8QC 5HYQA 1YYMH 3ZHDA 4KJPD 1IGIL 5GRXG 3NH7L 2JCCA 2JTDA 3NZ8A 5FYKH 3WE6A 2D31A 4HIJA 3DLQR 3P0GB 3DRTA 2EDJA 5KSAD 3P4OB 4HIXL 1FNHA 4BH7B 2AV1A 5F70A 2VZTA 3JVGC 4PJBB 1QFUH 1LGVA 2J4WL 4PG9B 3WXWL 1GGCH 4URTB 2CRIA 5F1NB 2LVCA 1AR1D 1NBYB 2HJLB 4U1HA 2OTUB 1QFPA 3ZE2F 3NPSC 4LP5A 3QI9C 3RWJA 5DJ8A 1CFQA 2DKSA 3ARRA 4YUEH 1CTNA 1KXQE 4G6AC 1WICA 4NDMB 5CJXC 2A1WL 3A0OA 1IGMH 5HVGB 5JXEC 1ZLWK 4GUPA 4ORGB 3LRHA 5BMFL 3IKCB 1K85A 1MCWW 1DLHB 3RWDA 2IWGA 5EZLA 1HKFA 5F72S 1F6AB 3DRQA 2HTKD 3FFCE 1WFNA 4ELKA 3LCYA 5CHNB 1TZGH 3WIIL 1R24A 3HUJF 3TN0D 1NMCC 4K7PX 1NSNL 3O2WL 1RUMH 3TV3H 2UV3A 5DO2C 4TTDD 4UTAL 2PN5A 4JZOA 3T2NL 5IW1A 3BGMA 4M7LH 3ZHKA 5DRXA 4LSQL 1MF2L 3K1DA 4KHXH 1RQ5A 3FMGH 4N0UB 5IBUB 1T04B 3TLRA 1K2DA 4JFEA 2M26A 3PDOA 4D2NA 3OR7B 5C0BD 5B39A 4XP1L 1NCWH 4CAGA 5D7IA 1N3NA 4NQXA 4XCYA 4QGTA 5IR1A 5GGQL 5C6WH 4U1KB 3HRPA 5JQ6H 1BBDH 1ZKAA 5HGBA 1LMKA 4PJ5D 5TE4L 3PL6C 3VFSB 2VUOA 1TJGL 4XXCC 4XPGH 2ZUYA 1WQVT 4O2FB 3HNTH 4U1SB 4BQBA 1P1ZB 3KPMA 3WEXA 3V0VB 3CFIC 5I1GH 3B5GA 3VD7A 1A5FL 2EKSA 3CCHA 4PG2A 5J0BA 2FH6A 4Q9RL 4QRRA 3CFEA 2DQGH 3IETB 4LARH 4ZO7A 3EO0A 1WSST 3GUTB 2QTEA 1IKFL 1BWMA 2PUQT 1R3IH 4GLRH 3U9UB 3WHXA 1UCBH 2EDFA 2NX5E 3RVTD 2Q6WA 5D6CA 5EO1A 1JPTL 1OT2A 1U95A 2AEIT 3SOBH 5IVXF 3OKOB 3JUZA 5DD3H 1G6RB 4Y4KC 4X6FA 4PJFF 4H26A 4P4KC 4UDUB 4N1CA 4QGYA 3E6FB 5DTFA 4J3XA 5FIEA 3VFNA 5F1SA 4TUKL 4X8JA 4TOYL 1HQRB 4MJIE 5F3HA 1WBYB 3CMOH 3MLPA 2DRUA 2X4SB 1QG3A 3F7VB 3U4BH 3DX9B 2W9DL 1WBZB 4KMTH 1H3PH 5DVOA 1DUZB 1E4XL 3GO1L 3F7PC 5F7NC 3U36A 3WSQL 3X12A 4C55A 4EUPA 5L2JB 4NN6B 1D6EA 3LKSA 5GS2D 4ACPA 2E7LC 4NO0B 1S9VB 2VMFA 4WUKL 3PG2A 4AH2A 5D7LA 3VRJB 1MCSA 2H32H 3HKFA 2F53D 1VDGA 1ZA6B 3KJ6H 3EDFA 4N0YL 3P40A 4P23C 3BZ4B 1JK8B 3SO5A 4LF3B 3QNZA 3SE8H 3G9VA 3VWJC 4TYUA 2R9HC 1BQSA 1YEKL 4JFFB 3T0BA 2ICWB 3MV9A 4KI5C 3CX5K 2NY1B 2MHAA 3WCYA 4ONHA 2R4SH 3OF6A 2R2HA 1I3RB 4RMUA 1JGUL 4QXGL 4MAUH 4X4MA 1RJYB 5IHBA 4OGXL 2ARJB 2IH1B 1HH6B 3ESUF 3KGRA 3RL1A 5KSUB 1CFTB 3E3QE 4GSDH 3T0WA 3HG1D 4OZFG 5I19L 4HUKB 3JVGA 4GW5B 1TQCB 1NGPL 4JM2D 4APQB 4Q9QH 5ID0B 3D0LA 4WEBH 4MJ2A 1PKQA 4H1LA 1P6AB 4GG8A 3CDFA 5DSCB 1V7MH 2V5RA 4IIQB 3TVMC 3BSZL 3L95B 5SWQB 5FFLA 2ZOKB 5D71H 3BZFA 3G08A 1JPFB 3QI9A 4S10A 3BZEB 3VFUA 4L29B 1UB5A 5GGUB 2X4UB 4X9IA 5CJXA 1AGCA 2FECL 5HHPB 1DL7H 2DJSA 3O6MH 5FOBA 2Q8AL 4H25B 1JPGB 2YEZA 3NFPB 4XVSL 3X14A 4R4BB 4QHMA 1QSEE 4OTXL 3VG9C 4YHOH 1HH9B 4ZUTA 2ICEB 3UJTH 1SEQL 3ARXA 3OXRB 1B4JH 3UBXB 4HT1H 5DJYA 3PXJA 5J13B 5GRVL 2X05A 3CFKA 1TVHB 1UACH 1YPZE 4EKXA 1KN4H 2NXZD 5E2WH 3RA7H 3LPWA 5F7FA 1VPOL 1VEMA 4XMPL 3L3JB 5DEFB 1HHHB 3QSKB 1EUUA 5JW4R 1H3XA 3PGCB 5EUKB 1OPGL 3QDMA 4G3YL 3N1MC 4YK4C 4PJGA 5L6YL 5BOPA 2CRZA 2ZKHL 3RDTD 1ZGLB 3HNSL 5F7UA 5TE6L 1P6FA 3MV11 3QFDB 2IFFL 5IB4B 1K4DA 1S7TB 3LHPH 1KLUB 1TETL 2Y06H 4IMLB 2ITDB 3F7YA 4M6NL 4PLKC 4HXAL 3VA2C 5MERA 1DE4A 3IFPA 1WJ3A 5GRJL 3B9EA 4J3UA 2VDQL 5D1ZB 1SYVA 4JFDE 2GTZB 2GSGB 2VDLL 3MRGA 5E24E 4WUUB 4JG1H 3KS0J 3QDMD 4IJ3B 3TBWA 4GS7C 3PL6A 5E2VH 2YC1A 1RZKC 1KENH 3HUJB 3BPLB 2UY6A 3MNWB 1F13A 1OD7A 2DI9A 3QEHB 4B5EA 5DRNA 5BVJB 1MQ8A 5HI5C 2F74A 3F6IA 2DQUL 1I1AC 3UJIH 2VDRL 3RI5F 3FB5B 2NY6D 2BOCB 4GRWB 3FB8B 1HEZB 4JDVA 4NKDA 5DZNA 3OKDA 3HE6B 3B9DA 1J5OH 1S78C 3PDGA 5MHSD 4HKJA 1DQML 1D6VH 2VE6A 4XCCH 2BCKA 1FQ9C 4S1RL 5E99H 1EGJH 4OB5H 1OARL 1P7QB 3TJEL 1Q9OB 5JW4N 2ZSVA 3PIQB 4R4NC 1NANH 5MENB 2BVPA 4Y4KA 1SBBA 1K4CA 4LSUL 4AL8H 5JPNB 5DVMA 4MQXD 1E6JH 2X4RB 3R0MA 1M7IB 5EN2B 4S0SD 4ZS7L 4EN3D 1MJ7H 4W4OC 3L6FB 1Q9WA 3L7EB 1ZMYA 2XXCB 5GRUL 2W59A 1KEMH 5CJQH 5JA9A 1KTLA 4G80B 5GHWH 5C0EB 2VXQH 3BZDA 5LBSL 1NEZA 1CGUA 1U91B 4OKVA 3QDJD 3DTXA 4HWZB 3C60B 4JZJB 4OD3H 5KVFH 1I9IH 1MHCB 2H9GB 1ORQB 4RNRA 5EU7E 1ORSA 1RZGB 5EOCL 1JL8A 2E7LA 2EE6A 5D2LB 3MRHB 2WUCL 1YEFL 1CTOA 1UWGL 2F54E 1ZHNB 4N8VA 1NUDA 3MRLA 1VB9A 3H9SB 1SY6H 1RHHB 5J6HA 3WO4B 1FL3B 4L8SC 2NMSA 4LLYA 4PTUA 2QHRH 4XNXL 2F19L 3QUZD 5K9KA 4P23A 4PRPE 1IC1A 1MOEA 3FQWA 4P3DB 3JZ7A 5L2KB 4I2XA 3D2UA 5AZ2L 4JM2F 2GAZB 3KHOA 4ZXBB 4Z6AT 3VWJA 5TQ0L 1TCRB 2ICWI 1BQHB 1QBAA 5AYUL 5IVXB 3KYNA 4LNRB 2VLJA 3ULUL 3NCBB 2A0LC 4YXLH 5KANG 4J1UA 3ALXA 4KU1A 4LSTL 5T1MA 3T1WA 1TIUA 2IC2A 3M8OH 1ONQA 4LU5L 4KKCD 4XPFL 3VXTA 2QQNL 3HLAA 3MRJB 3P0VH 5EIIB 1F3DH 5SWSE 5AWNH 1JRHH 4F3FB 5SX5H 4JDTL 3ROOA 5ALBL 1CXKA 2VLJD 2AJUL 3VXMB 5F1IB 4N1HB 3MV7D 1J8HB 3E8UH 1J1PH 5IJVB 4YX2H 1N64H 3LEYL 4HGWB 1DQQA 4XVUD 5SX4H 5EH1A 3T1FB 3IGAB 2XQYK 5A16B 5I1IH 3TH3T 1IQDA 3U6RA 1OAKH 3KYOA 3S34L 5MEQB 2ZCKL 3UTQA 4GRLD 5HHNB 2VL4A 2VSCA 4MLIA 2IADA 4R90H 5GSRA 5IW3A 3PWPE 1LNUA 5CUSL 2AEPL 3UAJD 4I3SH 2NY0D 1FL5A 3WUZA 2ZCLH 1L9MA 1OGAB 2FJFA 3MRFB 3LN5A 2DWDA 1CE6A 1BZ7B 2P7TB 5C0AA 3UBXI 3RX7A 1TMCB 3TNMB 1A1MB 4A6YB 2F5BH 3ZE1E 2BZDA 4KRPB 4PJCA 4OCWL 3FT4B 2OSLB 4IRJD 2NY3D 4OLWH 1UXWB 3E3QC 4P9ML 2VLRD 2YRZA 5I71C 1N6VA 3BP4A 1RZJH 4OJFH 4BZ2L 4X80H 1O7SA 1MCOL 3S36H 4U1JA 3DHMA 4S2SB 2YPVH 5FYJE 1N4XL 2NY5H 3ISWA 2O26U 1BOGB 1KTDA 4RGOL 5DMGD 1FJ1B 5TDNA 2ZCHL 3NCYS 3BISA 4NUJA 4J8RA 2X1OA 3L7FA 1AH1A 5JHLL 4YPGA 1GZQA 4RISL 2VAAA 1TQBC 2OP4H 2COQA 1QRNB 4NO5B 3F58H 4NWUL 1GAFH 4X6CA 1A6TB 1WC7A 3BH9B 5BXFA 2VSDA 5B3JE 3RTQB 4MNGA 1YJDL 3ILQC 1VERA 4QWWD 3LN4A 4G8EB 4JY5H 1NGWB 2HH0H 1CU4H 1HSBB 2HKFH 1FIEA 3PGFH 2QADD 4KY1L 3OSKA 4PJ9A 3ZTNL 3D3VB 4DUWA 3MROA 5GSVA 2R1WB 3ORJA 3WXVL 2AS5M 1FC2D 3HC3H 5DI8A 4L9LA 4Z7VE 3QT2A 1RZ7L 4HJ0D 2KKQA 3ARBD 3CSGA 1OAQL 4ODXA 1EDQA 3K80A 3EDKA 4HK0A 3REWB 1YMHB 1UZ8B 4P2QD 1EEYA 4NNYA 4GO6B 3UTZA 1PFCA 2E9WA 5F7EH 3P9LB 1IAOA 4Q2ZA 5IQ9B 5IJKC 2X4OB 1MELA 2PTTB 4PJ9D 5EBWB 1N8ZB 1RIHH 2V5TA 1FNEB 4QRSB 2G75B 5EO0B 4R0LA 2NNAB 4NQCB 2CO7B 4WI2A 4ISVA 1WTGT 3QUXD 2R2BB 4LMQE 1NFDF 4JFHD 3C6LA 4NUGL 3O3BA 4IOSD 1CXLA 2X89A 1VACB 5DJ0A 3UXFA 4WENB 1J1XL 1ZVYA 2PXYA 2CR3A 2CMRL 2D7NA 3G6AA 4RAUA 4DN4H 4WO4B 3L9RB 1NUFA 5T1DL 5AZEL 3DIFA 4MXWL 3MCKB 1Q0YL 2X7LA 4QTHA 4NKIH 3QULB 4RBPH 1K6QH 3BVNA 4L8SA 2PYEB 4L8DA 3WDIA 1YEEL 2FIKB 4HCRL 5D5MF 2EDDA 4GXUN 2IGFH 2CKNA 3WJLA 4KJQD 2NX5A 1C16B 3LEVH 1NC4D 1N5AA 1JWSA 1UB6B 3QIBC 1Q1JL 2PXYD 3FO0H 3EYQC 2GCYB 4EXKA 2ADGA 3BMWA 2CJUH 1QSFE 4X99B 5F3BA 2VXSH 4FQJH 1KCRH 2DQDH 5IMOA 5C0GA 4LLVB 4PGCA 1QP1A 3HRZB 4M7ZB 3G6JE 2GJZB 3BDYH 1HINH 1YEIH 4ZNCD 4L3EE 3CVHL 4R8WH 5B8CC 1E6OH 3MBXL 5J6GA 1ZTXH 3JV6A 1EH9A 3ARYA 3U0WL 4XHJD 1EA9C 3PNWB 4U1NA 2XWBB 1BPVA 5EU7C 1RUKL 4Y4FA 4LCIL 3MQIA 2XWJB 5HYIA 5C0NC 4IRSB 1NDGA 5F71A 3S96A 5E8PA 5I1EL 1NLBH 1IM3A 4LSRL 4K2UL 3TESA 4WHDA 4JQIL 3WFDH 1SJXA 4NOFA 1C5BL 4PJBE 1A1OA 2ADFL 2KQNA 1G7PB 1N2RA 4YXKH 1G9MH 1YY8B 1EJOH 1YEGH 2VQTA 1WGOA 4LASH 2XZQH 2C4FU 3S35X 2IPUK 5HI4D 2OJEB 1VFOA 2G60L 5I1HH 4LEXL 2NTFB 3F65A 1CS6A 1PJ9A 3O8XA 4XRCB 3ELAT 5KG9A 1BD2B 2VNCA 2EICA 3GK8L 4OBSA 4HS8L 5E5UB 3D69B 4JLRB 3RL2A 4K55A 5EA0L 1QR4A 4LHJB 2C7UB 5DR5H 1AQKL 3VRLE 4RX4A 5F7LB 5KN5A 2BHUA 2E8YA 3MO1B 1YNLH 4D9LL 1SJHA 1A47A 1XFPA 1HIML 2V9TA 1D5IH 3UPCA 3KG5A 2DQCL 1XCQB 4PV8B 1NAMB 3DX7B 4HF5L 4AIZA 2FB4H 5DUBB 3O8XD 4HS6A 1P84K 3NCEB 5E95B 2V6HA 1CF8H 1UQSB 2MMXA 1MCCA 2DJ4A 3VXSB 1CGTA 1JGEA 1X5YA 4LKXA 5DJ2A 3ULVD 3SDXE 3GMOB 5EBMB 4JJ5B 4Z5RA 5I15L 4XP6H 3HA0A 4HLJA 1BJMA 1MI5B 4UIKL 1S7UB 4NPYA 4ODUB 3OJDB 4LCWD 5I73C 2I24N 4DGIL 2XG5A 3LN9A 3RDTB 5FKPA 4CADA 2DLFL 4EQ3A 5D7JB 5ALCH 2C3HA 3EFFB 2C3XA 4NGHL 4I0PD 4HUXB 1PW3A 3L5WB 1I7UB 4QF1A 4AEFA 5FCUL 5FO7B 4CVZB 2P8LB 3FHQA 4YHKH 5IWLC 4KK9C 1LP9B 3MJ9L 4BKLB 3IJSA 1K3IA 4OKDA 3WHE0 3VXRB 4DUXA 4DVBB 4ELME 1FVEA 4QHUB 4D9QE 4YBQC 3VW3H 4YGAB 1NGYB 1HXYA 3CH1B 3O4LB 5IOPA 2AJXH 4F9LC 3QO1A 5ACZA 3RZCD 1SHMA 1DP0A 4YE4H 2YS4A 2E7HA 3O3EA 4LVOB 3ZYIA 1ZLUK 4Q7DA 3MRBA 1FAIL 5DDHA 3SCMB 4OD1H 3QISA 2EXYD 1EUTA 4GMTH 3PWUB 4ZNEA 4FQXA 4E9LA 2NY6B 3S35H 3IJYB 1A14L 5F9JA 3T3PF 4JFDA 4K8RL 1MCQA 3WMSA 4OV5B 3BX7C 5JOPD 1QACA 3U30C 1FC1A 1A7QH 4O51B 5LGJA 1MHHA 3RUGA 5F9WC 5HD8D 4L4JA 4TSBH 1GIGH 4CVXB 3V4PL 1BZ9B 1AD0B 4OI8A 4QCIB 3M1BA 2E6QA 1KJVB 4G7VL 4U1LB 4AT6A 5D1QB 1DCLA 3G5YB 4U0QB 1BREA 5H2BA 1XR9A 2JIXD 4RQQB 1HOCB 5D1XD 4AQ1B 1Z9LA 2BVQA 3EYFB 2R1YB 1WWBX 2I27N 4FQXD 3LQAC 3C5SA 4P46D 1LEGB 5FUZL 1S9KC 5SWZA 5TJWK 3I6KB 5FA3B 2F8OA 1DQJB 4EXPX 3SDYH 3BPOC 1CDHA 4XMKL 4NQVB 1FZMB 3AB0C 1HXMB 4LSPH 4XPTH 1OAYH 3ZTJH 4GKSA 2BNQA 2SEBB 4MQ7A 1BF2A 3ES6B 4PJ8A 5B38A 3EJZC 4MDIA 1WZKA 4YDLC 1KIQA 4HIEB 4QT5A 5ADOH 4LLQB 4H8WC 4ODSH 5TDPB 1VGKA 5AD0B 3LV3A 2DIAA 3NABL 3FOLB 3KPPA 3ULSB 1G7JA 1H0DA 5B8CA 1NFDB 7FABL 3MTRA 2YD6A 5ENWB 4XPBL 4JRYD 1LO4L 3OKLB 2WWMD 3T8XB 3D5OF 3BOVA 3V2AR 5CSZB 4BH8A 5AG9A 1BX2A 5DJXB 1PEZA 1PVHA 4QYOA 4NZJA 4JANB 4MJ5B 4RIRB 4NKMB 2DQEH 5HGGS 2QR0B 3RNQB 4YHZH 3TJHD 5JHDD 5KVGL 4G8GA 1U8KB 4ZOAA 3TO2B 2CXGA 4XBEL 1EAPA 4ZO9A 1CK0L 1KLGB 4PRPA 3RGVD 5TH2A 2VLLB 1GOGA 1L7IL 4WWKC 3KPQB 3BP7B 5GS1C 5C07D 3P4NA 3MV7B 4RAHA 1I8IB 3MLTA 4AM0B 3CXDH 2YHGA 2BXYA 4R2GB 3VU2A 5EU6D 1HILB 5JPMA 2QQKH 1Q9LA 4G8GD 1NLDH 2WINB 4M1DL 2GTWB 4GRLB 1BJ1H 1IBGL 2UYLB 1Q0XH 1MLBB 1U36A 3ZYJA 1IAIH 3KYAA 3S97C 4M5ZL 1B2WH 1S7XB 5GJSH 5DD6B 1DVFC 1R3KA 4IOFC 4XP9H 4G6JL 2X4QB 4FXGB 4Z7QE 5IT2L 4F57L 1HZHL 1VADA 1G7QB 5ISZA 2ZJSH 4H20L 1WWAX 3K2MC 3TF7C 4PJEA 1YMMD 3SDDB 3GMRA 3QH3B 3QWRD 5JIIA 3QZWB 5LCVL 2X40A 2CO6B 3Q6GH 2J8UF 43C9A 2ITCA 3EOAB 4FXKB 4KH2A 1KJMB 2PW1A 4JB9H 2JB6A 4MD0B 4QHNB 3G5ZB 3V6ZB 2QQLL 4R3SA 3OBAA 2IAMA 4FQHB 3QUKA 3QNXA 3G5VA 4UINL 3EO9H 2ICWJ 3KS0H 2AQ1A 1G7MA 2QBWA 2X6MA 1PG7L 1W0VA 1D5MB 1S7RA 4HLZH 4MA8H 1QLFB 3QQ3B 3G6DL 4WUUE 3FRPG 4BSVA 5IWLA 4HBCH 4FG6D 4AENB 4HIIA 2FX8L 2P5WA 3L3KA 2AJ3A 2H32A 4WJ5A 3FFDA 1ZE3C 5DJ6A 3TYGL 2YRLA 5DFVD 3HUJE 2EIDA 4QRQB 5JXAH 2XACC 3V7AE 3B3IA 4FTVB 2ZUQC 2AXFB 3P4MA 2NR6D 4PS4L 1CXHA 2D2OA 3VFMA 1PY4A 4NYLB 4GRWE 4XP5H 1N6QL 2PW2B 1A6PA 4Y5VA 3NH7H 3HMXL 1KCVL 2OL3A 5IF0A 2GT9A 1Q8MA 1QLEL 1S3KL 4JQXC 4MXVF 2HVKA 1G9NL 3GSQB 4GKZB 3S88L 3RU8H 4LPYA 2HVJA 3B2UD 3MRCB 4CDGC 4OFYD 3WXWH 2IQ9H 4GW4B 4LLWA 3FZUD 4LVEA 4LLMA 2AGJH 1A7RL 3INUH 2D3VA 2QLVB 2Y9RT 3SHSA 4DKEL 4KZEL 3I6GA 4QY8B 4KVCL 5HHOE 1FDLH 5E00A 1REIA 4LDLB 3Q5OA 1MRFH 4TSAH 1YYLL 3S4SB 2Q7YA 2IG2L 4CVWA 4QRUB 5BMFH 3C2AL 3F7RA 3MPCA 1NGXA 2C4FT 3EJYC 5FGSA 5J12C 5GS0H 1T0MA 4OSUL 1DBAH 2AABH 4R96B 1N59B 3KPOA 4KJYB 4WCYH 3VFVB 2A6KA 4ZYKB 3HB3D 2OJZL 3IAQA 4Y4HB 3MBEB 5D2LE 1U3HB 2MWCA 4OCYH 2D0HA 3FN9A 3TBSA 5A2KH 3H9SE 2NW2B 3VFRA 3X3FH 1DBML 4F2MA 4EQ2A 4GT7A 3T65A 5AG8A 1JN6B 4PLOB 2DDQH 3LKQB 4ZPVB 5BJTB 1L6XA 1EFXB 4U0RB 2BSTA 1CXEA 4S0TD 4P5TC 2R56H 1QNZL 1FVDA 3SE4A 2VR9A 2J88H 5KS9F 2DLGA 2YN5A 1ZT7A 4JG0L 3HC4H 2AJYH 5IHZA 4PGDA 3O3AA 3KPSA 4GW1A 4DZ8A 1F3JA 1X5ZA 3JWDL 1CE1L 1IC7L 4O58H 4XWOD 4MX7A 2QKIB 3N1QC 1UA6H 3AROA 5E5RB 1IFHL 1UJTA 1U92A 1RIUL 1UVQB 3LVEA 5DA0B 1IGTA 2D7QA 3ROLA 5TE4H 3FQRB 3D0VB 1FFOA 4LPVA 5TPWL 4NQUA 4S1SH 3MGTA 3BYTA 1J8HE 1ADQH 3C08H 4DQOH 4X5WB 1AE6H 1QSFA 4CN6A 2BMKB 5GGSA 3J7HA 3QIUA 3LY6A 3QIWD 1BBJA 3SQOL 2NY2D 5ICXA 5CZVL 3UPRB 2CDGA 1VENA 3FQNB 3OAZK 5F89A 1ZAGA 1INDL 3Q3GB 4YC2B 4L3EA 4ZD3H 1T66D 4N1EA 5ECJE 4YXHL 4WV1B 1OSPL 4XI5C 1Y6MR 3VXQB 2X1QA 4KFZC 1FNFA 2OCFD 4JFXB 2OS7A 1EIBA 2CIIB 4LGRB 3OHXA 2ZOLA 3GSVA 1MCKA 5C08B 2FWOB 2YPKA 2V9RA 4HUUA 4OCXL 1A7PL 5JDSB 3ZKXB 1OD9A 2L0DA 4M8QA 1JFQH 2IPTL 5L9DH 1JHLL 4XMLL 5ESAB 4P5KA 1NJ9B 4TUKH 2WBJD 2MTPA 2LU3A 4HBQA 4YHML 3U48A 3Q48A 2VABA 4QHLB 1HN1A 3V4UL 2YN3A 2HA1A 4C83B 4LCYA 1DEEB 1AXSA 5E6IB 2HG5A 1WCBA 1TQCC 4PV9B 4APQC 3L3GA 3OR6A 3MXVL 4OZFA 1CQYA 4YFDB 1HI6A 2YSSB 3MUGA 2VN4A 2WANA 5IMKB 2BK8A 3KXFE 2ESVB 4PJDB 1OOAA 4I5BB 3G5XA 1AD9A 3VA6A 1B9ZA 5LQBH 3MXWH 3EAKA 5FK9A 4X98A 4X7TA 4IHOA 2FEEI 1QRNE 4OIIH 3RWCA 3H7BB 2Q3ZA 1JBJA 3KYMB 5HTSA 4PP2A 3GMQA 2CK0L 4C56D 5I1CH 2QL1A 1SY6A 4AMKH 4JGMA 1IVLA 3R1GL 5KVDH 5CIPB 3BH8B 1MUJB 1A2YB 1J0JA 3PV6A 1NCAL 1GSMA 4IDJL 2FZ3A 2CXKA 3OXSB 4UV4L 1S9XA 2EZ0D 1II4E 1X9QA 2OXHA 4QXTA 2YUZA 2FR4A 3ARDB 3GKWH 5DRWA 1ZSDA 3D3VE 1T2QH 3H9HB 2IFGA 1AXTL 2BSSA 5EO9A 1BIHA 3VH8B 4K71B 4LLAA 4ZSOA 1SJEB 4KC3B 5IGXL 1T2XA 5J11C 2X41A 3EGSB 4GFTB 2Q76B 4JPKH 3IDXH 5BQ7B 1AO7E 2WLZA 2R69L 4YHYB 4N8CH 1I8MA 3BSZH 3V95A 4JAMB 1IC5H 2C5DC 2BY3A 3BUYA 4WTZG 3SKOB 3WUWB 2A73A 4HUWA 4NQCE 5I0DA 4K9EC 3GJEB 3EZ8A 4WTXA 2Z8WC 4EDWH 5K59F 5DMKB 2W0KA 5IMLB 4IJ3C 1H5BB 3BT2L 1MIML 3I6LE 4NRYB 3AREB 4HC1L 4ELMA 1TVBB 4N8PA 3KPLA 4KK6D 3ARFC 1RZIA 1N5YL 3IXTA 1KPVB 1RV6X 2A6IB 3U2SB 1TNNA 4JO1H 5D2NE 4ONGL 1HSAA 3K4DA 5J06A 5KSBF 3QXDB 3VWKB 4Y5XC 4YZFE 4LLDB 4N0FA 4HDIA 4XNQA 1MPAH 1ZT4A 1VPOH 4PRIE 5E56A 4FZ8L 2CIKB 3VGAC 5I1DA 5EORL 5C0DB 5DK2A 5FF6A 4H0IA 3CU7A 2EEDA 2FL5A 3DBXA 4EI5A 1O0VA 1EHLH 5E2JA 5C6TH 5FYLE 2AK4A 4TNWK 3FB7B 1JNHA 1MFAH 5C86A 3MJ7A 3QHZH 4HXAH 2VDPL 1DN2A 1A6VH 4FQCL 2FLRT 3PP3H 3U1SH 1AI1L 4JKKA 4LIQL 1LO3L 1CICD 4P2RA 4BZ1L 2VITA 1VGEL 4EVNA 3QCTL 3P11L 5FKAB 3QYCA 1T5XB 2JJSC 4XHQA 1I3GL 4JRXD 5ANMB 3R4DA 3DETD 5J89A 4PRNA 3GBNL 3PWVA 5FHAL 4JFYB 5HDQH 3SDCB 4WW2F 4E41B 2CD0A 2DQUH 1SVCP 3IYLW 3LMJL 4G6AD 2HRPH 5A40E 4Y2DA 4FOMA 5CJOL 5DJDB 1C7TA 5JXED 2WW8A 4RAVA 4P2RD 5JOFA 3HZVA 1SM3H 3CZFB 1EEUA 5ESVB 4ZOBA 2X44D 1O5DT 3SGJA 4S1RH 4NCC1 5D4QA 4ZXBC 4BUHA 1AY1L 3TIEB 4DW2H 2Z93A 1UH4A 3SO3B 3EBAA 4P3WA 3WIHA 5KS9B 1KB5A 1G7IA 3PHSA 4CN1A 2FIRT 1NCUA 3RY4A 1VFBA 5EZOL 4L5FL 2OXGA 5I16A 4ZS7H 2IANB 1KJ3L 3MLXL 3IVKB 4MA1C 2IALA 1BD2E 1LEIA 2YD9A 2AEWA 2JK5B 4PIRF 5GRUH 1CFSB 5I9QB 1KEGH 2A9ML 3FQTB 1ZLSL 3WV0A 4NQDA 5GRVK 1A0QL 4JFQA 1KFAH 4JKPL 3C8HA 1UC6A 1MCPL 1SVZA 5BCAA 3REVA 1PEWA 4PGEB 3Q1SH 5I8CA 1GGIL 3D9AL 4HAGA 3W11C 5BVPL 3VXUA 4NOBA 1SBSL 1FRGH 1YEFH 4FZEH 2FEEL 2EKJA 3DXAA 5F1OB 5F93C 1MRCH 5DT1H 1NFKA 2VLKE 5DJZB 4ZS6C 4KROD 3MOQA 3UTPE 1Q72L 4ZO6A 4ODHL 5BS0B 3MJGX 5C0CB 1FNAA 3FO2A 4TQEL 2FO4A 4P9HL 1QPXA 4KRNA 4OV6F 5DZLA 1MI5E 4W81A 4M6OH 3TA3C 4YHNB 1CLYL 2PNDA 3CFBA 2LV4A 4ZUVA 4OM0H 5TQ0H 1BVKA 1FIGH 4OFIA 3ULUH 4X7EC 1S8DA 1FP5A 4LSTH 4MJ4A 3DXAD 4WDIB 1FH5H 1U6AL 2XNAA 3RPKA 1AQDA 4PJAE 1Z3GL 4XPFH 3TZVC 3X13A 4QOKA 1HHGA 1A3QA 3GSRA 4Z7UA 1UWXK 1LP9E 4QRPD 4I1NB 1HHJA 1TZHA 1EO7A 1R5IA 1XF1A 4LCCB 4DTGH 1A6AB 3O4LE 5DMIH 2EXWC 4ZFZA 4P4KD 5L88L 3LEYH 1FO0L 1F8TH 2XN9D 2QV2A 3O3UN 3IU4H 5FHBH 5BW7C 2DIJA 5F8RC 1KJ2B 1ZHKA 4GQ9H 1ROWA 4QOKD 3QEQD 5GGVL 5CAYB 3DUUB 2HLFD 4HKZA 3LAFA 1RUPH 3AAZA 3W0WE 4U1IB 1CFNB 3IDMB 5HHMB 1FNGA 4G9DB 4V1DB 2WBWB 4WI8A 4MNQB 4NSKB 1OCWH 3D25A 1W72A 1RURL 2OQJA 4R97B 1R5WA 1U8JB 3S5LG 5E9DB 5H35A 5FGBC 2V7HB 1S5IL 1ZK9A 3HZKB 4XAKE 1U8PB 3IU3B 3ZMRA 5EU4A 2HYMA 5BV7C 1QBLH 2QJDA 4G9FD 4OCWH 4Y5XA 2BVUA 1OP9A 4NM8L 1DFBL 2FCBA 1OB1A 3JTTB 4G6FD 4MS8C 4X7SH 4XVTL 1QFHA 3BRGC 3B9KD 4NQEE 4XAWL 1F4YL 1QQDB 1N4XH 1JGDA 1UJ3C 4YO0A 2W38A 1RHFA 3JSSA 1CXFA 2CDFA 3SY0A 4GRMB 3CK0H 2A38A 5HHOA 3DX6B 2CGRL 3QUYC 3MRKA 4HEPG 4M7JL 4J2XA 4QLRA 4JY6B 2EO9A 5IVZA 2YPLE 4KDWA 4P57A 2FHFA 3D39B 3RVUD 4L4VB 3VFTA 5DQJB 1NFDE 1PYWB 2JB5L 4U6HA 4CDHA 1GPOL 1WFUA 4HH8A 5BO1L 1FL6A 3RIFK 3VRIA 1C5CL 5K9OB 2JJSA 3TVMD 1YJDH 2Z0BA 4FQ1H 2O5YH 2KDGA 1DUYA 2RAMA 5HYQB 4WO4C 2ZNWA 5C0FA 5D2NC 4HX1A 4G8FA 3RY6C 4F58L 5J8OA 3NZ8B 3WE6B 2D31B 4HIJB 3ZKSD 4ZTPL 5HHQB 4POZC 1NC2A 4Z7OF 2WNGA 3DRTB 5EZJB 3GSOA 4NZRL 2AV1B 1L0XA 1G6RH 5CGYC 4Y8DC 1LD9B 2XRAH 1P4IL 4KTDL 4RWHA 1K8DA 4ZPTA 2Z35A 4GAYB 1WZLA 2P5EA 4U1HB 2GJ6A 3QBTB 3KLHD 1RU9L 5HYJA 1RZFL 4KMLB 4JVWA 5KAQF 3RWJB 2ADIA 1G9EA 5DJ8B 1CFQB 3BKYH 3U9PL 3CJJA 3QIWB 1CXIA 2FBOJ 4GBXC 4F37K 4UOW1 1TITA 5LWYH 4GUPB 2WQRA 3UTSB 1X5JA 3RWDB 5EZLB 4HHAA 2WUBH 4I18B 4WFHE 5F7MC 2UWEA 4ELKB 3RVVC 3GKZA 4HFWA 1R24B 1XEDA 2X4PA 1EMTL 2D0GA 3C8KA 4ZG1A 3ZSSA 1PZ5A 3IFLH 4Y1AE 4LBEA 5GJTL 2B1AL 5FO8A 1OTUC 5I76A 1XGUA 4PLKD 1S5HB 3ULVL 2X4TA 2GHWB 1WAAE 2PO6D 4JZOB 3GRWH 3IDIA 5IW1B 3BGMB 3LKOA 4KK8C 4AG4L 2LU4A 2FSEA 4ETQA 1YEEH 3TNNA 5DRXB 8CGTA 3MNZA 3OJVC 3FFCD 4ODWA 4TRPL 1AGDA 3IS0X 4RFEA 3TA3A 3EHBD 2VISA 1K2DB 1XF5B 1EEZA 1I9JL 1TTUA 1C5DB 4MAYD 1ZVHA 1Q1JH 3PDOB 3MRIA 2MQ0A 4G6ML 1B4RA 3BE1L 4F7MA 3DVGA 2YK1H 2D9CA 1JUFA 5D7IB 1N3NB 4NQXB 4XCYB 3T2PA 1CFVL 4G5ZH 5IR1B 3WNKA 3EO1B 5TE7H 4BUGA 4YIQA 3TZVA 4BSWA 5F7YC 4HIHA 1IARB 2ADJA 3NCYP 4J23A 4M48H 4Y5YB 3MBXH 2JE8A 3LS4H 4R4ND 1FG9C 3KPMB 3ARSA 3AUVA 4D9RD 3V6FA 4FTVE 5TFSL 2HT3C 2EKSB 3CCHB 2X5PA 4GAGL 3CU1A 3MUHL 4LCIH 1XMWA 5BW7A 3IFOA 3CFEB 4QRRB 5GISL 3I02A 2R1XA 3UTTE 3EO0B 2KQMA 4NRXA 4CVUA 1D3CA 4X4XA 3WHXB 4O2EA 5FUCE 2Q6WB 1BQHG 3OAYK 5D6CB 3MLUH 2VC2L 1WZMA 2E7CA 1U95B 4L4TB 4OCSL 2EIZA 2W9EH 3IF1A 1F2QA 1KC5H 4KVNH 2DTMH 4X6FB 5CINL 5D7JC 4KI5F 4H26B 5HGAA 1YYML 5DTFB 3OKMA 2W0PA 3VFNB 4RMSA 4X8JB 5FYKL 5F3HB 4F7PA 1E28A 2B5IC 1TZIA 1QFUL 4W70A 1ZLVK 4GAJH 2RCSH 1GGCL 4OGYL 4U33A 3WKNA 4EUPB 3X12B 4PRHB 1JI1A 1D6EB 3LKSB 2V2TA 1UJ3A 4Q97A 4LVOC 3V4VH 3QUYA 3ARUA 4YUEL 2F5AH 4AH2B 5D7LB 4GG6A 4ERSH 1I3UA 4YBLC 3RWIA 1SEBA 2CUMA 1ETZA 3LRGA 1BFOA 1X7QA 3QNZB 3VI4F 5J1AA 1TZGL 3E1F1 3C8DA 4UIMA 2CKBA 1G7LB 3MV9B 4DVRH 2DLFH 3DGCR 5C09E 1T20A 3KPRD 1RUML 4G6KL 3TV3L 2R2HB 2VQUA 5D2NA 5IB1A 3RKDC 4KUCD 4M7LL 2YXMA 3RL1B 5IROA 1I1RA 4X4YA 4KHXL 2LQRA 3FMGL 3QQNA 5JNYB 3D0LB 1PKQB 4H1LB 2H3NB 3EDDA 2Q87A 4GG8B 4PUBL 4NM4H 3H3KA 2HN7A 5F7DB 1XF2A 1NCWL 3NPSB 3BZFB 3BP5A 3G08B 1NCBH 3QHTC 1FGVH 3QI9B 4UU9B 2V5YA 3VFUB 4W6WB 4XC1H 3I75B 1UB5B 4GBXA 1BBDL 5DHXB 5E8DH 1ZEAH 1WFOA 2XKUA 1KELL 4HGKC 5FOBB 4X6CF 1WWWX 4U7MA 3L3IA 3IAPA 4HH9A 4XPGL 5IK3A 1UT9A 5T1KA 4QHMB 4DK3A 1CBVH 1KXTB 4G7VH 3HNTL 3WNOA 1NMCB 1HHKA 5C08E 3E6HA 5I1GL 4MSWA 4U3HA 5DJYB 3SBWA 1PG7W 4EIZC 3CFKB 2DQGL 5JTWA 3H0TA 1E4WH 4HPYH 4LARL 2Q20A 1T22A 5JR1H 4JHWH 4MA3A 5JUEH 1OTTC 2GFBA 1BEYH 1FG2A 1UCBL 4ENEC 1A9BA 5EU5A 5B39G 4PJGB 3O6FA 5DQ9A 1OP5K 5DD3L 1XGQA 5LAXA 3ZDZE 3WS6C 1JGVH 1K4DB 3MLSH 1J1OH 3M17A 4Y7MA 1NANI 1KF9B 3TH4T 4PJDE 3F7YB 1AR2A 2DYPB 4WFED 5MERB 2BRQA 1DE4B 1KB9J 3IFPB 4LCUA 4NFBA 5HYSG 2NYYD 3DX8A 1SYVB 3ZL4H 3CMOL 2MJWA 4WHYG 3MRGB 3U4BL 1OP3H 3NABH 1XIWC 1H3PL 3TBWB 3O6FD 3PL6B 4LAQH 4PYHA 4XC3H 5GS0D 1PG7X 1AGFA 2VXTH 2ICES 5HY9B 4U7KA 3BQUA 5DRNB 3AGVA 3QWQB 2W91A 2F74B 1U2HA 4PTTA 1GJIA 4OQTH 5T5NG 3GBMH 1Z6JT 2P43B 4NO3A 5DK0A 4JDVB 4NKDB 3OKDB 4HUMB 2C3WA 3SDDC 2I9TB 3KJ6L 4HKJB 2VLKA 2VE6B 2BCKB 1CK0H 1RI8A 3SE8L 1PAMA 1F5WA 2ZSVB 4DCQA 4A6YH 1CDIA 3GI9H 1RUQH 3NIDE 2BVPB 4Y4KB 3W9DA 1K4CB 3RWFA 1RULH 5EWIL 4QRTA 3EYVB 2R4SL 4OZGA 3ECBA 1FSKC 1FE8H 4NC1E 4Y19A 4XNUL 3QUMH 5J1SC 4MAUL 4BZYA 4P2OC 2B20A 4PJAA 1KTLB 5GPRA 4GSDL 3VGHA 4OF8A 5I74C 1NEZB 4RGMB 1I85A 1YC8A 3DTXB 2I07A 3QIBD 3FRPA 4WEBL 3PQYA 4RGNE 4BFIA 1JNJA 1KBGL 1ORSB 2YKLH 1V7ML 3OMZA 3H3PH 5DUMH 3P0YH 1YDPA 5D71L 4Y19D 3QFJE 5IT2H 4G42A 4F57H 1HZHH 5FV1L 4N8VB 3V79C 3MRLB 5T3XH 5J6HB 4F15B 1RIVH 3V52L 1XZ0A 4XX1E 1OHQA 3W0WA 3O6ML 4Z0BH 5K9KB 1DBBH 4P23B 5FUCC 5CBEA 3FQWB 2BXZA 1LDPH 1S7VA 4I2XB 3D2UB 3T4AA 3VWJB 6CGTA 2BDNH 3KYNB 3UJTL 2QQLH 4E42A 4UBDC 3KPTA 1B4JL 4MQSB 4J1UB 4H5SA 5KSVA 5T1MB 2KL6A 4HT1L 2VWEE 3JXAA 2EDKA 2F54D 5C0ND 1ONQB 4EDXA 2ERJB 4X9FA 2BNRA 1D5ZB 1KN4L 3CFJA 3D1MC 3S3SA 3VXTB 4ZTOH 5E2WL 3C9NA 3RA7L 3ZDYE 3G6DH 2YBRA 3BUTA 1FAKT 4BFGA 1ZV5A 3BN9C 3DECA 3ROOB 3ZSTA 4NQEA 2FX7H 3T4YA 2QHLA 4G7YH 1GRWA 5ANME 1EO8H 1OT1A 4C57C 4WGWB 1DQQB 4Y4HC 3LHPL 2Y06L 3DVIA 2C3VA 1IQDB 3MJ8A 5GGTH 5C2BH 5EB9A 2J5LC 2NY4D 2XZCH 3KYOB 3HMXH 3UTQB 2B4CC 2IADB 5SWSD 2EE3A 2R29H 2W65A 5GSRB 3IAGC 1LNUB 4NCC2 4U0RC 3C5ZA 5E2VL 1FL5B 4FP8H 5J7CC 1KENL 2FJFB 4NHUA 1QVOA 1NBVH 3VG9B 5J1TC 3LN5B 2DWDB 3RWHB 1CE6B 1OGTB 4N9GA 1A6UH 4JR9H 2EYTA 5C0AB 5LVEA 3JV4A 1MCWM 4KZEH 4OI7A 3UJIL 4FFWC 2LAAA 5C2UB 2IANE 2APBA 4PJCB 1LO5A 1YPZF 3HFMH 3HHRB 1J5OL 2VDNH 1D6VL 4XCCL 4HKXA 3PWPD 1EGJL 4OB5L 3BP4B 4YK4B 3H3BC 4U1JB 4U3XA 4DKDC 3H9ZA 3WS6A 5TDNB 1E6JL 3A6OA 4NUJB 4J8RB 3DV6A 4KKAD 3ARGC 3L7FB 1MJ7L 3D6GA 3T08A 2VR4A 2JF1A 1CD1A 4YPGB 1GZQB 2VAAB 5CJQL 1KEML 6FABL 3CD4A 2N56A 4YC2C 1V5JA 1U42A 4KK9D 5GHWL 2VXQL 4MQTB 5BS0E 5C0CE 1XIWA 1NBZA 4X6CB 2DQJH 1RVFL 3OB8A 1PLGH 1XF4A 1WC7B 4OD3L 4RZCA 5KVFL 3IDNA 1I9IL 4RFOH 5BXFB 5BRZE 1AHWA 5FYJD 5CGTA 3BEVA 4Y1AA 3N0PB 2P42B 2JJUA 3LN4B 4NN7C 1WITA 4KDVA 4JFPA 1I1AB 2X9YA 3QJHA 1SY6L 1QR1A 3BEWA 4O2CA 3MROB 5GSVB 4D0DB 5ERWA 2QHRL 5DI8B 3TO4C 1KOAA 2VQ1A 2H2SC 3R8QA 1EZVY 3MREA 4LRIA 5E6IC 1ACZA 3VDAA 1X3DA 4ODXB 4HK0B 3WFEH 4K3JH 1EEYB 4NNYB 4YXLL 4P2CG 5DA4A 1LWRA 1IAOB 2X09A 4HMEA 1IRAY 2YD5A 4U49A 1A8JH 2LTQC 3M8OL 3HZYA 4P2OA 1UKSA 1WBXA 1RK0A 4R0LB 5INDA 2IPKA 4ISVB 5CWSA 4V1DE 3C6LB 3O3BB 4MNQE 2ARWA 4PJXA 5BZWA 4X6DA 3X3GL 1LEKA 1NAMH 4HMCA 4OZIA 4O4YH 2Z31C 2WQ8A 3EJZD 5DJ0B 3W39B 3PJSA 3E8UL 1J1PL 1JF5A 3QDGE 4IBLT 4U6VH 5E9DE 1N64L 4RAUB 3O9WD 3G6AB 4QXUH 4Y88A 3GBLA 2A74A 4U1MA 5ETUB 3DIFB 3SPVB 2OTPA 4K7PY 5M95B 5I1IL 3D85A 1MFBH 2X7LB 3BPNC 1BQUA 2WWKO 4NQSB 3SJVE 4PREA 1OAKL 2RFXA 4DEPB 3UTTA 3BVNB 1VA9A 4L8SB 2VTFA 3QEGH 2R0WH 3NCFB 5T33H 3LH2L 4YAQA 1PSKH 1KPUB 4K71C 4I3SL 1KYOJ 1M71A 2NX5B 4IMKA 4KXZI 4ODTH 2ZCLL 5F88A 5C0RH 2IQAA 1JWSB 2EDRA 4Z95H 2ADGB 3U79A 4D0CA 2W60A 4GXVH 4YHYC 5F3BB 3HPLA 5I2IA 4MMZC 4RSVA 5IMOB 4PGCB 2APTA 4MJIB 2ENYA 3GMPA 4NN5B 4WTZA 4HWUA 3HAEG 4OLWL 3QO0A 1CL7H 2FJHB 1H5BC 1P4BH 3K8LA 5J6GB 1RZJL 4X80L 3JV6B 4WWKD 1NEUA 3S36L 5GZNC 4ZAKC 2YPVL 4U1NB 4RGNC 4CW1B 2NY5L 3O6LH 1B90A 4KQ3H 1JYNA 2R0ZH 5FYKU 4LGPB 5I8EA 4Y4FB 2XG4A 4P48A 3MMEA 4IDJH 3U4AA 1LHZA 1TJIH 2N1KA 4UV4H 1NDGB 2JCCE 3S96B 5IFHH 4PJEF 5E8PB 2OP4L 3BDXA 1JPSH 1IM3B 1AC6A 3F58L 1GAFL 5EULV 3DMMC 2ICCA 5AEAA 3SDAD 1A1OB 4NFCA 1N2RB 1DVFD 1ES0A 2Y36H 4FHBD 4IOFD 4L8CA 4K3GA 1NBYA 5GRZA 3L5XH 2OTUA 5LGHH 3W81A 4JY5L 5C09A 2HH0L 1CU4L 2VWEC 2HKFL 3PGFL 3ZE1F 1C08A 3V0WH 1MEXL 5CLTA 3NPZB 5D6DA 5KG9B 5DZOA 4QO1A 1GHFH 5CD3B 3HC3L 3RL2B 1ZHLA 3GHBH 2VDOH 3THML 3IKCA 4PRBA 5HDOA 5KN5B 3FAWA 2NW3A 1R5VA 1SJHB 3TBVB 4NRZA 3KWWA 4WI9A 5CHNA 2OK0H 4YEEA 2I9LA 5F7EL 4GJTB 1E4KA 3N9GH 4AIZB 3QXAA 4M1CC 1UADC 3OG4B 1J18A 1RIHL 5L7XL 1ZHBB 4I77H 1IEHA 5E4EB 1TQBB 1JGEB 3MRDB 4LKXB 3K46A 5DJ2B 1I75A 2CK2A 4Z5RB 5EORH 1U8QA 1F02I 4OZHE 4NPYB 2MSPA 2QQQA 1KG0A 1QSEB 5B3JF 4JFEE 5DQDH 1T03H 1D9KC 3RHWK 5FKPB 5DLMH 4CADB 2IH3A 4DN4L 2H2PD 5FGRA 5D7IE 2CUIA 2DQFA 4PLJC 4NKIL 4QF1B 3BAEH 3BXNA 3GGWA 1K6QL 2JELH 5F1KC 5H37G 5IBTH 5MEOB 2Y72A 1ND0A 1AI1H 4Z7VF 3TO4A 4DN3H 2IGFL 2UUDH 1VEPA 3IJSB 3CUPB 3KLDA 3LEVL 4Y0GA 4S1DC 3AXLA 3P11H 3QHFH 4GXUM 2UVEA 3FO0L 1HXYB 3K2UH 1T3FA 3MLRH 3QO1B 5ACZB 2CJUL 3PGDB 3V0VA 3VE0A 3O3EB 2VXSL 4FQJL 3MRBB 4XBGA 2DQDL 5DDHB 4QRRE 3VGDA 4IRZH 1UZ6E 4NHCH 1UG9A 5F9JB 1HINL 5DJCA 1YEIL 4JFDB 3FCTB 3HAEH 1U41A 4R8WL 2DI8A 2ED8A 5EUOE 5LGJB 1AP2A 1MHHB 3RUGB 1E6OL 4Z78A 4BK5A 5J3HD 3S37X 4PJ7A 1ZTXL 4GMSH 4AT6B 4MVBD 4M6ML 2NLJA 1YEHH 4XP4H 3TT1H 4HXBH 5H2BB 1XR9B 3LDBB 4GQPH 1G6RA 1MRDL 2BVQB 2NZIA 3W9EA 5GGRA 3C2SA 3C5SB 2Q8BH 5SWZB 1NLBL 4NIKB 4Q6IC 4KKLC 3WFDL 2F53E 1MH5A 2OZ4H 3WLWC 4YXKL 4GKSB 4KKBC 1YEGL 2BNQB 3RKPA 4K8RC 4PJ8B 1RUAH 5B38B 3LB6C 4J3VA 5T3ZH 1T6VN 4LASL 4MDIB 1IMHC 1KIQB 3NTCH 4QT5B 4ZFOL 3BRFA 5I1HL 4ONOA 1KIPA 1QFWI 4M1GH 1UWXH 5D7LE 5C71A 5F9OH 4R7DB 1VGKB 3G6JF 3LV3B 3L3OA 1G7JB 1H0DB 5B8CB 4TQEH 3P9WB 5EOTA 2VZVA 1JWMA 1YNLL 2YMXH 1D5IL 4Y16C 4KHTH 1AKJA 3HE7A 4HCRA 3MV9E 1XF3A 4JFFA 3PHQA 4NO0D 1BX2B 2ICWA 1M05A 2FB4L 5I66A 3P4LA 4QYOB 3BKMH 3SKMA 3TBYA 2HLAA 5CKAA 2M1KA 3S5LA 4X4ME 1CF8L 2Y6SD 4M62H 5EU3B 1BAFH 4XI5D 2J1KA 4Y8AA 1EAPB 3DMMA 4XP6L 4EI6B 4PRPB 3CFDA 2RJMA 4PJBF 1JNLH 5TH2B 3LEXA 1R3LB 4NZUH 5DMYA 4YDJA 1PKQE 3CVHA 1CT8A 4JFFD 5IFAH 3P4NB 3PABA 3S37H 2NY1D 2Z92A 4IIQA 3MLTB 1IZKA 1BIIB 3CLEH 3RWEB 3GMLB 5HPOA 1C12A 3BPCA 4FMFA 5JPMB 1Q9LB 3OWEA 1IM9A 4KJPC 1ODAA 2X4UA 4YHKL 2GITB 4D0BA 2IMMA 1IEAB 3VRLF 2DIBA 4APQD 3VW3L 4NT6A 4R4BA 1R3KB 2AJXL 1OW0C 3ARQA 1AR1C 1F97A 2DM3A 2HKHH 2VZSA 4YE4L 4ODVH 5ID1A 3RX8A 5IP4A 1VADB 2AJVH 3U7AA 3UBXA 4OD1L 2B4CH 5ISZB 4GMTL 4J4PD 3S35L 3O45A 4UAOC 4DZBA 4PJEB 2AV7A 1ZT1A 3GMRB 2DN7A 1RJZA 1F11A 4PRAA 2OR9H 1ZVSB 1A7QL 3SDXF 3JV0A 43C9B 2ITCB 3U7WH 32C2A 4NM8H 1GIGL 4TSBL 3L3JA 2PW1B 2JB6B 3QDME 4PJGE 1KULA 2DF3A 3OJ2C 3U46A 5IVNA 5TF1L 1T7VA 3P9MA 4HULB 4R3SB 5I73B 3QEUA 3QUKB 1GGTA 2J12B 3OKEA 3TN0C 1IC4H 3QFDA 1DTUA 3RVWC 3CDGA 5DFTA 4TSCH 1S7TA 1W0VB 2CGRH 3NCCB 1S7RB 4M7JH 3AM8C 3MRNB 5E5MB 2O5XH 3SDYL 3SKJH 3JV5A 4LSPL 2AXGA 4HIIB 2WMPA 4XPTL 1OAYL 3L3KB 2JB5H 2H32B 2R2EA 3GJFH 4WJ5B 4ELMF 5DJ6B 4KJWC 3E2HC 3B3IB 3ARPA 3B43A 3P4MB 5ADOL 4X9GA 3MSPA 4CMMA 3VFMB 2K7PA 1DQLH 3ZKMC 1FZOB 5D1ZD 3EYOA 4Y5VB 5HVWA 2OL3B 3FB8A 3P3YA 2FEDC 3HE6A 4WUUD 2FLBT 1CLZH 4K94C 4I4WA 1ERNA 3U30B 4CN4A 3FAXA 4M4RA 4NZRH 5DC4B 5F9WB 1JE6A 2HVKB 2HVJB 3C6SA 5JORA 4KTDH 1Q9OA 3Q0HA 4LLMB 1A9EB 2FGWH 3CSPA 1GGBH 3JWOC 5KW9H 5MENA 3I6GB 4KK5C 1P9MC 3I84A 3MJ9A 5JPNA 1IGJB 3MR9A 4LGSB 3F8UB 1RSFA 1T1XA 3V5KA 5E00B 4TVPH 1A21A 2ZUTA 2CH8A 2DQEL 4OCNC 5EC2A 3HE6D 2HT2D 4X9HA 1L0YA 1AC0A 1EV2E 4X7DC 3O2DL 4Q6IA 3MV8A 3OAUH 3BPOB 3AB0B 1NGXB 4TNVK 1P7QD 1T0MB 3TC9A 4P2YA 5IG7A 3RVTC 1D5BA 4HWZA 4JZJA 3KPOB 3S98A 5MEND 3ARTA 2H9GA 2A6KB 1IILE 1FYTA 5F9AC 1QFWL 1VEOA 4YDKH 1LO0H 1RK1A 1G9NC 3CXDL 1KV3A 1AIFA 3DHJA 2QQKL 3MRQA 3F62A 1NLDL 1ZHNA 3VFRB 4F2MB 5K33A 3T65B 4FS0A 2K3TA 1Q0XL 4HQQH 4JPIA 3LD8B 5CIPH 2BSTB 3C60D 1B2WL 2H45A 4I2XE 1FVDB 5GJSL 3P73A 5L2KA 5FCSH 1F90L 4JJHA 4LIQE 4XP9L 1NAKH 2VLJE 1TCRA 4TUJA 1BQHA 5DK3A 5IVXA 3QDGA 5HDBE 1ZT7B 4KI5E 1WTLA 4YHPA 5IHZB 1GZPA 4PGDB 3O3AB 3KPSB 4GW1B 4PJFA 1J0KA 1F3JB 2ZJSL 4DZ8B 3DUSB 3H9SD 3UDWA 1CFVH 2V7NA 4MX7B 3R0NA 1C1EH 1P5VA 4LEOA 1Q38A 3H8NA 1U92B 4OD2A 2D7TH 3Q6GL 1IGTB 5AAWA 3OG6B 4JB9L 5L2KD 3MRRA 5T5FL 1MAJA 1FFOB 4ZXBD 2YUXA 3BYYA 4YDIL 3MOAH 4MB5A 2M2DA 3HNVH 2F58H 2VO5A 3T0EA 2HJFA 3EO9L 2GUOA 5TFSH 4MCZA 1QSFB 5GGSB 1A4JA 3QIUB 1BBJB 4HGMA 5ICXB 5IVOA 1ZLVH 2CDGB 4MA8L 3G6JB 5F89B 1TVDA 4L3EB 4MA7H 1F4WH 3JWDC 4OQTA 3I2CH 5KSAA 3ME0A 2V2WB 5MEPB 2MCG1 5TGBA 3OHXB 3VXMD 2ZOLB 1OGAA 1J8HD 4MJ6A 1BHGA 3GSVB 5JXAL 2YPKB 5CINH 4HUUB 3V5DA 3W11D 4M8QB 3I9GH 2FDBP 2VZ3A 3BMVA 2B0SL 4XP5L 4P5KB 4PJCE 3HI6L 1QA9B 1G1YA 1TFHA 4KUZH 1L4IA 5EDXA 5FUOH 2VABB 4Z7UF 2J6EH 3QUMA 1AXSB 4FFVC 2HG5B 3RU8L 1WCBB 4X83A 1OGAD 1EBPA 2IQ9L 4JGUA 3L3GB 1JCKA 4OGYH 4BM7A 3OR6B 4JHAH 2AGJL 4OZFB 1HI6B 3INUL 3MUGB 3TN0A 1BP3B 3OGCA 1QLRA 1FDLL 1U8MA 2W0FA 3C09C 4NP4H 4KRPD 1MRFL 3G5XB 4TSAL 1AD9B 1AGEA 1J0ZA 3AM8A 1A3LH 5IIEA 4WFGE 4W6YB 2H6PA 4X98B 4IHOB 3RWCB 4KRLB 1YN7A 1PY9A 4X6CE 4PP2B 5GS0L 3GMQB 1DBAL 2AABL 1WIUA 5DS8A 3ZZ1A 1HCVA 4HFUH 4WCYL 3DURA 2EXWD 4MNGE 2DL2A 2ZUQB 3PV6B 4OLYH 4OCYL 1CLOH 5C0BA 4G8EA 2FZ3B 3NMEA 1S9XB 4G6KH 1NGWA 4QXTB 4GRWF 2FR4B 2N7BA 3X3FL 5DRWB 5IEKA 1T7XA 4CU8A 3TYFB 1QRND 3OKKB 5T3XD 2DDQL 3SDXB 2BSSB 5EO9B 2P47B 2GK2A 4OZHA 4RRPG 2R56L 1MHEA 4PJ5A 3KLSA 1I7ZB 3RTQD 4ZUWA 2J88L 3MZGB 3REWA 1U9KA 1J8KA 1GC1C 3NACH 4PUBH 2APFA 3HC4L 1P9MA 2AJYL 4XCEA 5IQ9A 3BUYB 4O58L 2PTTA 3RPIA 2A73B 3WYRA 3D3VD 4HUWB 1UA6L 4OT1L 3MV01 5HYSA 5EOQL 4XPHL 1KELH 3LS5H 5DYOA 5J12B 2M8XA 3DYOA 1M7DA 5GGTA 3HMXA 4N5EC 4ELMB 2HTLD 4S1SL 3KPLB 1RZIB 1ADQL 5CP7A 1LDSA 3C08L 4DQOL 1AE6L 4CNIA 5D2LF 1B0RA 2X4NA 3DSFH 4MQXC 2V17H 1HSAB 2AKRA 3DGGA 3W5NA 4NQCD 5FB8A 2V2XA 4HDIB 3QULA 2W0LA 3BKJL 4ZD3L 4XNQB 1F6LL 4LMQI 1ZT4B 2PYEA 1BJ8A 5I1DB 5EUOA 3QDHA 5DK2B 5FF6B 5I6XB 3I6LD 4JCMA 5ESQB 2C1PA 4P5TB 2XA8L 2FL5B 1C16A 3HC0A 2A6JB 3DBXB 3UX9B 1CYGA 3GSNL 4F33A 5H94A 4WO4D 2AK4B 1JFQL 1NFIA 1JNHB 1P53A 1T89A 4NWTH 4X99A 5L9DL 3MJ7B 2GSIA 2P44B 1DR9A 5L0QB 2KBGA 4POZD 1JZ3A 4HWEL 2PYED 3HRZA 2A77H 2G9HB 1JHTA 1OAUH 2VITB 2VDMH 2E7MA 2F53A 5CGYD 4RGMC 3QUZC 1I1YA 4EVNB 4UQ3A 1DSFH 2GW5A 1TPXB 1B6UA 3CVIH 4PRNB 5FYLD 4XPAH 1XGTA 4JRWA 1U8IB 1R3JB 5EBGA 4Y2DB 5LQBL 3MXWL 4F15C 4KKCC 3QRGH 4RAVB 2EDOA 4WU5A 4Y89A 5JOFB 4OIIL 2LABA 3HZVB 1FFPA 2HRLA 1YECH 1MWAH 5I1CL 3EOYG 5D9SA 4AMKL 3QQ4B 3HG1A 3VDBA 4WNQB 5KVDL 4JM2A 5DWUH 4L8BA 1VKXA 1KB5B 1INQB 5EWIH 2E6PA 3X11B 1VFBB 1KTRL 2OJEA 4IRSD 2ERJC 4XVUC 3OV6A 3RWGA 4XNUH 2IALB 3GKWL 1T7ZA 5C6PB 3B2VH 1LEIB 1CIDA 5C0IA 1T2QL 4KK8D 4X6BA 3BD5A 4WFFD 2WP3O 4NJAL 3WNPA 3ULVE 1P4LA 4KTEH 4M7KH 5JW5A 4JFQB 5C70A 5ICYA 2ED7A 2H1PH 4JPKL 2NY0C 3MLYH 3IDXL 3REVB 1U8NA 1KBGH 3OPZH 1J05A 5J56B 1MIEH 5I8CB 4N8CL 1XCQA 1IC5L 1HYRC 3VXUB 2Q7NA 5KJRH 4OM1H 2P4AB 3FHAA 3EZJB 1BD2D 3K0WA 1GOFA 1UH3A 3V52H 1UQSA 4EDWL 5FYJL 3HZMA 3FO2B 1G6VK 5INCA 3GMOA 2FO4B 2NY3C 1MHPL 5DJAA 5IQ7H 2K9UA 5HVHB 1U8HA 3ILPA 3CFBB 4ODUA 1WCQA 1BVKB 3ARZA 2HT3D 4DUVA 3RDTA 1Y18A 1S8DB 2DKUA 4JO1L 5CP3A 4NNXA 4LAJH 5DMGC 5ITFA 2DICA 2I5YH 1AQDB 3L5WA 4PJHA 1T1YA 2PR4H 3X13B 3VXSD 2UZXB 5JDJA 1A3RH 1HHGB 3UTPD 1MPAL 3GSRB 4Z7UB 1PBYA 3F5WA 2EH7H 1HHJB 4OQ1A 1MI5D 1TZHB 5JMOC 3BN3B 5J11B 4LVHC 4QHUA 3LQMA 3PWNA 5D7JD 1NGYA 4ZFZB 1EHLL 4BELD 5C6TL 3ZE0E 4QWWC 1QKZH 1QSZA 1MFAL 1WUNT 1X6NA 2V9QA 3QHZL 4ZNEE 1ZHKB 1A6VL 4IOIA 3ZYOA 1MCFA 4HKZB 3T3ME 3QXTA 5I30L 4DKFH 2QADC 1KT2B 3AAZB 3U1SL 4WHCA 3WFBH 1FNGB 3LIZH 3RUGE 3LPFA 4JFOB 1IL1A 4O51A 5MI0B 3VXRD 4P0DA 5FYKE 4HJ0C 3D25B 1W72B 1BZ9A 3ARBC 2OQJB 3O4LD 4U1LA 1R5WB 3UTOA 2CR6A 3T2QA 3ARFB 5C7XH 3BJ91 5H35B 2FATH 5HDQL 4RQQA 3SCMD 5EU4B 4K94H 3WN5A 2HRPL 2HP4A 1QSVA 5SWZE 2DQTL 1LEGA 4PJ9C 4EN3A 5IBLD 2EE2A 4Y5XB 4YZFF 1EAJA 1ZGLP 4CGTA 1SM3L 4L9LC 3VGAB 1BFVH 4L3CA 3QUXC 3FN3A 2MCPH 5EIVA 2BNQE 5D1QD 3CIQA 3N1FC 3QDJA 4DW2L 2SEBA 2L7JA 3HPJA 3SE3A 1JGDB 4YO0B 3WKML 4E0RA 4K23H 2CDFB 3SY0B 1A4KA 5KOMC 2RB8A 1JNNH 2DMKA 5HHOB 4HC1A 3MRKB 3RKDD 4BYHA 2YR3A 3QJFB 3EYSH 1WLHA 4R0LC 5GRYA 6FABH 5IVZB 3MODH 4P57B 5DF0A 1KEGL 3GHEH 4FQIH 5AD0A 1JF6A 4PRDA 3VFTB 5JHDE 3FOLA 4DWHA 4U6HB 3C6LC 1KFAL 5T1LD 4AEHH 3QUZA 1RVFH 5I18H 1PGRB 3VRIB 1U58A 2HFTA 3T8XA 1R3HA 4QNPE 4PBVC 3Q1SL 2PXYC 1DUYB 3EKCA 3O11A 2A9NH 5C0FB 1FRGL 4HX1B 3OJMB 4FZEL 1YA5A 3PHOA 3RBSA 4J6RH 4G8FB