5DJ8A

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A01
4YK4C 3S96B 1QLEL 2Z92A 4KKBD 1T0PB 5DR5L 5C07E 1WFTA 4JN2A 5EO0B 1Z9OA 5B21A 2AJZA 4Y19B 2CKBA 3PUCA 4NHCH 3VXME 1ZS8B 2DJ4A 2IPUG 2QR0A 3LKOB 1PW3A 3NOIA 2VZTA 3ARUA 3V6OE 4HS8H 4OIAA 1PEZA 3RY4A 2V7HA 4YX2L 1ERNA 5AYQA 3BN3B 4PJ9D 1HQRB 1JZ2A 4XCCL 4RGNB 4D0DB 2CDEB 4XB7A 4K3JH 1S7WB 2J6EA 4L8BB 3U0WH 1E4XI 4OLWL 3BRFA 3LOWA 1R6VA 5BS0B 1S7XA 2BNUA 1JP5A 1S3KL 1T0MA 5J6GB 7CGTA 4LQ1A 1KEML 3BP6B 4PG2A 4ELKB 4Y5VC 1A4KA 3RVTC 5HYJE 5ESVA 4OD2A 5GJTH 3WFEH 3EFDL 1P5UA 5IMMA 4UIKL 3MUGB 3O6LH 4NBZB 3OB0H 1CQKA 2OJEA 3KR3H 2VLJB 4J23A 2IFGA 3C60D 5DDHB 4NFCA 3C6LD 4GW5B 4OGXH 3DHMA 5JHDB 2Z31B 1BP3B 3DBXB 4LF3B 4LLQB 4KKCD 3BPLB 1EK3A 3D1MC 5ACZB 1ZV5A 5LGHL 5JORA 1DLHB 5IB5B 4YGVB 5I19L 2V5MA 4JE4B 2YD3A 4ODVH 1KJ2L 1ZLVH 3L5WB 3MRQB 4GAYB 3MLRH 3QUKB 5KVEL 2YA1A 3R0NA 3ARGA 3H9HA 5DQ9A 4PRHE 4ZUWB 3ZSTA 5CEZH 4Q58C 1U91A 3CFCH 4WI5A 2XKNA 5EBMB 1QLFA 4I0KA 4JKLA 3F7QA 4XWOD 5GRUH 1ZGLM 4X9GA 4AJ0A 4FQXD 3BWUC 3ARPA 5L2KD 1A6UL 3TN0C 1PG7W 3Q48A 3VI3F 4N0UA 5IK3A 3MRDA 4BUHA 1RURH 1CR9H 4OAWB 4X6FA 4LCCB 2FB4L 2AXGB 5L8KB 1BF2A 5FYJE 5KANG 2JJSA 5HYSB 3FO1B 1YQVL 5JXEA 2GY5A 4O4YH 4E9LA 4LAJH 1U36A 3IXTA 4JREB 1EHLH 1NCNA 3MLYL 3QCUL 3MRNA 3NAAL 3RTQD 2HT4C 1DN0B 2NW2A 4KTDL 1YJDC 2X4OB 5GIRB 1JNHB 4JZJC 4IM8A 3IT8D 3TYGL 4M5ZH 3QJFA 3GBMH 5L2JB 5IMLA 4CNIB 2F54A 4ZS7L 2VXUL 1JCKA 4CVZA 4WFHE 1UA6L 2BXZA 5K59F 5LAXA 1J12A 3DNKA 2YD1A 4BSWA 1I8KB 2AEIT 1MRFL 2W0PA 1A6TA 4JN1H 2KKQA 5FUOL 3VXQB 1A1MB 5E95B 1PG7X 4NFBA 1NBVL 3TJHD 2KZWA 4V1DA 4KZDH 1DSFL 2IPUK 1IGCH 2ZUQC 4I77L 4XWGL 1BIIB 5JQHC 5F9JA 4KRNA 5ISZB 3HAEG 5I1DB 5I2IA 4OLYL 1MREL 1LO2L 1IC5L 3GMLA 2C26A 3LH2H 5LBSH 5C2BH 3SQBA 3QSKB 5EC2B 3H9SD 3HUJA 2UYLA 4TNWF 2OK0L 1IBGH 1ZT4B 3O3BA 5IP4A 5CGYC 1KBGH 4KTEL 4NO5B 4NZUH 1D6VL 5D1XD 3CDYA 3MJ9A 2DYPD 1J0IA 4ZQKB 3PV6B 1I1AA 4QXUL 3HE7A 4TRPH 2B1AH 4WWKD 2BOBA 4HF5H 3DRQA 2P5WA 4F33A 4WTZA 3QIBC 5ETUA 2NY2B 2ZUVA 4NC0B 4JHBA 1OCWH 3QFDB 4GAJL 3VXOB 1K4CA 4Z5RA 2FATH 5DD3H 1A6WL 3VI4E 5KG9A 4K8RC 1RZGA 1XGYH 3RDTD 1HSBA 3KPLA 4KI5E 3SGJC 2PTTA 3VXRD 2W0LA 4Q9QL 4P5TB 4P2OC 4QOKE 2HMIC 5C0BB 3MPCA 4M61B 1KTDA 2JCCF 5LCVH 1I7UA 3LD8C 1KPUA 4FQPA 4CUCA 5EZOL 2UZIL 5DZOA 3DPBA 1MCDA 4X9HA 1R3HB 5GGSB 1CDHA 3GM0A 1W8NA 2BVEA 2FGWL 4RAUB 5KS9E 1IGJB 4LHUD 1U8OB 1C08B 4H26A 2XRAH 1YC8A 4OZFA 5E7FA 2ZJSH 2X4NA 3QIUA 3TO4B 2DWEA 3ZE2F 3WLWC 2CO7B 2IBGA 4MHHI 3W5MA 4ZO7A 4XVJH 2EIEA 4MAYD 2PXYD 4G7YL 1QRND 2H45A 1V7MH 1FAIL 4LSVL 3S5LA 1GOHA 3AMLA 3RAJL 1GGIH 4PJAA 2BK8A 4QHUA 2D4FA 5CIPH 5DC4B 5HPOA 5EPMA 4BZ2H 5DHVB 1E4XL 3L7FA 2AQ2A 1MCSA 1TVBB 4U7SA 3IFOB 2IC2A 2VSDA 1KCVH 3GEWB 3BP5B 3VGGA 5IBTL 3V5DA 2BY0A 3STBA 5I66A 1YYLL 3BPOC 1B88A 3QNYB 2V2TB 1A9EA 1KG0A 4Y16D 4C83A 1LE9B 2AV1B 4NKMA 4JY4B 5IB3A 4JO4H 1I1YA 1JPTH 4X80H 1DLFL 4R7NB 5CJOL 4OFYD 4XP6H 2IQ9L 5EZJA 4IRJD 1UB5A 5GPRA 3MLSH 4JKKA 1VADB 1L0XA 2XYCA 3QJHB 1NANH 3MO1A 5EUOB 5MP6L 3F12B 2E9IA 1S9VA 1PSKL 2R29L 1RU9H 1VFOA 1ADQH 2H32B 1RIUL 1XEDA 5BO1L 4KKAD 4O58L 5LG1A 2QADB 3SDAA 5TE4L 3MOBL 3GMRB 1G7PB 2WK2A 3GSNB 3TYFA 3I50L 5D96B 2FL5A 1GL4B 1UM4L 1NJ9A 2QQKL 2O5XH 2CGRH 1AO7A 3TIDA 1NFDF 3QCTL 3ETBF 4XBEL 4AMKL 4JM2A 3WNOA 4M3JA 4DN4H 5DZNA 4IOFC 5FB8A 2OP4L 4QRPD 4P23A 5IKCB 1S9YB 1KCKA 5HYIA 2D3VA 2W65A 3CXHJ 3ES6B 4JY5H 4PJFB 2LU3A 4MXVF 3QEUA 4OQTL 5C8JB 3ILQD 2L7JA 1N6QH 1PX3A 2J8UB 1P9MC 2FECI 4JLRB 4Y0GA 4PLJD 3HC4H 3WS6C 5AUMA 1WBXB 2I24N 2OL3A 1I1CA 3V8OA 5FHBL 1CGSL 1KJVA 1ZLSH 2DLIA 3W0WB 5KN5A 4P49A 2DLHA 1I3GL 3ZSSA 1JZ3A 3KXFD 1UM6H 3IDXL 4Y1AA 4QXGL 2EH7L 3MLWL 3CPLB 3EYUH 4HGKC 2UWEB 1LP9A 3QXUA 2B7DT 4PJXB 4UT7L 4PG9A 2HWZH 1AE6H 3QAZB 1JPGA 1J0ZA 2ITDA 4XCFH 1MHEA 5GS1B 1C5DB 3UBXI 1D5IL 4P3CH 1QSEE 2YUVA 4L9LB 1D5XB 1EZVY 3IETA 5I73C 1KTLA 2JCCA 5F1SA 1CXEA 1BFTA 4JFPB 3TO2A 2VDNL 4PRBA 1B2WH 1AD0A 5C0FB 1GAFL 5I1KL 3VXNB 1AD9A 5CZKA 2R1XB 4R0LC 3RVTD 4PUBH 4YIQB 4MD5B 1XAUA 2CUIA 4DJMA 3TPKA 3FOMA 4F9PC 4PGEA 4RFNC 3WHE1 1LO3L 1J88A 1XIWB 4GS7B 1ZLWK 5JLZA 5E1AB 4P9MH 3RY6A 3K8KA 3KPRD 4YJZL 4X4YA 3FB5B 5J9PB 2VDKH 4D3CL 3QXAA 3KYOB 5HVHB 3RWDB 3NIGE 2HKFH 2QHLA 5HGDB 1TCRB 3RUGE 3BOVA 4W4OA 2APWA 3MMEA 1KEGL 1F4AA 4XZUB 2YBRA 5CZXC 5GSRB 3LQZB 1JRHL 1BOYA 4P9HC 3RPKA 5I75B 2Q8BL 2GFBA 4M43L 5IHLB 3MXWL 3VXUB 1CFVH 3AXLA 5C0GA 3HLAA 3LEVH 5INCB 1PG7L 5TQ2L 3H7LA 4GG6B 3K74B 1T5XA 4KKLC 5GRJH 4L3CA 2HRPH 3KPSA 4MXQD 2AABL 4S1QH 3GSQA 4NQEA 2VSCA 3BYTA 3LKQB 3TN0D 4HGWB 1E28A 4ONGL 5I1GH 3ZL4H 1Q1JL 1YJDL 4C56E 4V1DE 5MERB 3MZGB 4MYWB 1N0XL 4LAQL 3F7VB 3ULUC 1Y6MR 2BSTB 2I25N 4EI6A 3HZKA 1VFMA 3P4NB 4X5XA 1CFNB 1W72H 4WEUD 3K4AA 1KENH 1FO0B 5IW1B 1P69B 4WHYG 3BT2L 1DL7L 2R1WB 2HVJB 4GKNB 5DJXA 3TIEB 2VZ1A 3MNWB 4URTB 3T77B 1RZKH 4WNQB 5IM7B 4YDIH 3O81A 3TBYA 4MA8L 3VA6A 2XTJB 3IS0X 3D25A 1QSFA 2OSLA 4M6OH 4PJHF 3WFCL 5CILH 4N8CL 4NJAL 2PW2A 3CSPA 1JGUL 3DI2B 5MEPB 3R8BB 3OJDA 3WYRA 4R2GB 1FFQA 4XH2A 3FFCB 3NGBC 4IJ3C 2VLMD 2NY6D 3BZFB 3DXAD 5IMKA 2Q20A 3ARDA 5CBAB 2ADGA 2OI9C 4X6CE 5FGCB 4ZPTA 5JIPA 3WJJA 4EUPA 3O2WH 5E94B 3V4VL 1LEKA 1WFNA 2DQCL 2W60A 1VB9A 4XP9L 2GSGA 2A6JB 1NGPH 8CGTA 3MRHA 4HFWA 1T0NB 5J6HB 4IRSA 4CAGA 5SWQB 3WIIH 3MOAH 5CGYD 5JTWA 4K8RL 1T5WA 1FC2D 4MVBC 4ZYKA 3DURB 4GRMA 4KK5C 1PZ5A 3RKDC 4XC1L 2ATPB 2JB5H 4J7RA 4RQQA 3S3SA 1ZVYA 4ZO6A 4MNGB 2XN9A 4JFQB 1WT5A 3QIBD 3QZWA 2PR4L 4KY1H 1LO0H 1LNUA 4OT1H 3DVGA 4HXAL 5FKPB 5DTFB 3SJVB 1T1WA 4K8RD 5HYSG 4OI8A 5B3JF 1B3JA 2QSVA 3GSRB 2Y06H 4HZLA 2P45B 4B7IA 1G7IA 1MCPL 4MA3A 3I75B 3GMQB 4HH9B 2ZOLA 3TBVB 1A7OH 4KC3B 4P2OD 3ESVF 2HMID 3H0TA 3IKKA 4JFYA 1I1FB 2I26N 4L29B 5MI0C 3EBAA 1KJ3L 3DIFB 1EVUA 3HNVL 3O2DA 1ZA3A 4L8SC 2EECA 5LQBL 3VW3L 1WISA 4LLMA 4WFGD 1ZHBB 1S78C 1EIBA 1LE5A 2PO6B 4OGYH 3WFZA 2YWZA 4X98B 4Z18A 4FQLL 1FLRH 3VI3E 5KSBB 1HHJA 3MZTA 3GGWA 3R8QA 4HFUH 2MPAH 4HEME 1RJLB 5BV7H 4LHQB 3RWCA 3E2HB 4YFLF 5CAYB 1NMAL 2VLRA 3HC0A 3WLWD 3G6JF 4EBQH 2B1HL 3L9RA 1UEMA 4KJWC 4QHLB 5KOVC 3MA9L 4Z7OF 1K85A 3QUYC 1TENA 4DUWA 4HUVA 1BIHA 3IFLH 2HVKB 3F6LA 3PGCB 4JFXA 5ICYB 3VRLF 4N0FA 2ADJB 3MYJA 5I8OL 4N5EC 4XPTH 4J3TA 1R0AL 1SEBB 2VDQL 3ESUF 5DJZB 2FJGB 4H1LB 4XNQB 5CEXA 5K59E 3O0RL 1H3PH 2SEBB 4PJGA 2VXQH 1UJTA 3GNMH 1RHFA 3MRRB 2IFFL 1EHXA 4YBHA 5GGUA 5FDYA 2OZ4H 1MWAA 4K2UL 1RUQL 4R7DA 4OCXH 2GTWA 4NNYA 2YPKA 3U7YL 1U3YA 3IDIA 1YEIH 3O45A 3UC0H 4FQHA 3QDGE 1FL3B 1Q9KB 2ZCHL 1KCRH 1T66C 5HPMB 1YN7A 1HIMH 4PGBA 1NFKA 2BP3A 5E00A 3M8OH 1T7VA 4WTZG 5F70A 3ZYZA 3ARFB 1CGVA 3D18A 4M7KL 1AP2A 4HIIA 4OZGF 4YDLB 3ECBA 1K8DB 5ADPH 2H3NA 2DQJL 4PJ5A 4G8GA 1SMOA 5ESQB 4C4KT 8FABB 4U1SA 3FRPG 1JHTB 3MV7A 4U1NB 4WUKL 3LS4L 3DGGA 1UM5H 2EEDA 3O3EB 4XP4H 3F65A 5EU7E 4Y1AE 5ERWA 5GGTL 4KUCF 1PKQA 3CVIH 3HG1A 3O11B 5T3ZH 2J5LB 5JPMA 4U1JA 1IQDA 4K07A 1YEEL 3B3IB 3GSUA 1TITA 5D7IB 5DC0A 4OM0H 1RUKH 2OMNA 3V5HA 1LDPH 4IOFD 5C0CB 4WGWB 4CMMB 2EO1A 3FHQA 3MRFB 3E6FA 4ZFOA 3C08H 4BQCA 4P2QE 1P2CA 1I3VA 5I71B 2AXFA 1CU4L 2P47B 3VWJA 3FO0L 1CFQB 4OZIA 4KAQL 2B5IB 1FNEB 4LQFH 3S5LG 3SDDD 1R3JB 2AGJL 1KPRB 3AS1A 5SWSA 3ZE2E 3GK8H 3CLEL 5D7LD 2APFA 1HHIB 5IEHB 5D7JC 3Q5YA 5F3HB 3D39A 4WDIA 2I9TB 5B38A 4HLJA 5IW6B 5JW4Q 2EXYC 4O02H 4CU6A 1KLUA 3BMVA 4L3EB 2ED9A 5EU3A 1ZVSB 2V2WB 3L3KA 3BE1H 1NLDL 4WEBL 1CL7H 1MI5D 2QBWA 3O6FC 3OKKB 5MENB 1F3RB 1F3JA 4LPXA 2F74B 1PGRB 2ESVB 1GVIA 2VKXA 3IF1A 3NCMA 3KJ6L 2HN7A 2AJYH 4JRXE 5FYKU 3LPGA 3VXSE 4P4KC 1QBBA 4Z7VA 3VH8A 2AEPL 3MCKB 3PABB 1BAFL 5DMIL 3C2AH 3GIVA 3DVNB 4LNRB 4OIIL 3QUXA 1FSKB 4P9HL 4AENB 2QSCL 1JPST 4HV8A 4HULB 3MV9B 4LVHC 1IGFL 1HYRC 4JR9H 4X7TA 4XCNA 1IC4H 1OF2B 3B9KA 1OAKH 1MAMH 1QBAA 3HRZB 1J0HA 4XPFH 5E4EB 1TJIL 3HI1B 4HAFA 2F19L 3MX0A 2R4SL 1XCTB 2ZUTA 2HJLA 5C07B 3OXRB 3H42L 2EC8A 2E9BA 4L8DA 5D5MF 1U8HB 3W9DA 3QRFM 4OV6F 1MEXH 3GI8L 3VXMB 1Q38A 1RD6A 4J12A 3VMPA 3R06A 1HKLH 3T1FA 4KKLD 2GSIB 1NFDE 3NA4A 5IIEB 5K9OB 2F5AL 1Z5LA 4L5FH 4P3DA 4NQXA 1UXWB 3K81A 4OFIA 1OSZA 5IFJA 5D93C 2DQGL 3UTQA 1T03L 4JRYE 4L3AA 3HE6C 4M7JL 4MJIE 3ZHDA 1CXLA 4B7LA 2R2EA 3CMGA 2DRUA 4MXVE 2ARJA 2YSSA 2HFFA 1ZK9A 2AP2A 3IDUA 3I3EA 1U41A 4FFVC 4OZGA 3MJ8A 4KDTA 4WI7A 3SOBH 3RZCC 5HYJB 4TOYH 4MGXA 4HIHB 4RGOL 32C2A 3BO8B 4JQXC 3P9LA 4FQ1H 1CD9B 5IVNA 1FDLH 1J05B 4HLZH 3BN9C 5C71A 4HIXL 5A2JH 5KW9L 1OTUD 5E99H 4X7CC 3FKUS 1J5OH 5ID0A 4M4PA 4LIQE 4Y2DB 3U0PA 2R15A 3DETC 3KYKH 4YAQB 1FNSH 2NX5A 3GHEH 2R0KH 1T2XA 2FLRT 4Y5YC 5FA3B 3BIKB 4UB0L 1HHHB 5GJTL 5GHWH 2FDBP 3TZVA 4PFEA 2A6IA 3T0BA 1AXTL 3UO1H 2JIXD 1D5ZA 2R2HB 4PRHB 1S9KC 3ME0A 2NZ9C 2P5ED 4FFYH 4GAGH 3VFPA 2XV6B 3I2CL 3L3DB 2A0LC 4XVSL 5HDLA 3REVA 4HPOL 4OCSH 3S8WA 1NANI 1QA9A 4JFDD 1EJOL 4MVBD 2BRQA 2IANE 2I07B 3LKSA 5MEOB 3RKDD 4HKXA 4JFED 3NA9L 3MLRL 4Y4KC 3ZTJH 5ID1B 5C0AA 4PGZA 4J4PA 5IVXF 3VDCA 1JZ5A 1YDPB 4JGUA 2ZNWA 2YA2A 4HWZA 4JKPH 3WN5A 2WIMA 5EU5B 1F6AB 3HI6L 5I17A 5KANI 1QPPA 1U93A 3TCXA 2RHEA 1N5YH 1C5CH 2V5SA 3PIQB 4D0CB 4JO3H 5E6IA 1DEEB 3U4BH 5KSAA 4U4BA 2MWCA 2ZSWA 3MCG1 3LSOA 4P5MB 4RDQF 1KIPB 2NY4B 2NW3A 1EHLL 5DRNA 1S78D 2G60H 1HHKB 2Q7YB 4LBEA 4O51B 5DJDA 4HWBH 2YS4A 5CP7A 4NYLA 7FABH 1KIUA 4ZOAA 3L95B 2BMKB 3AY4C 3TT1H 3S88H 4QRUB 1FFPA 3V52H 5HVFB 4TNWK 2GAZA 1NEZB 5EC1A 1MUJB 5SWZD 1DUYA 3MODH 3QUYD 4PREB 5IFHH 4ZOBA 1L7IH 4JANA 1N0LA 5EIIA 2EH8H 1XT5A 4PJ5E 4AG4H 3STZB 3UTSE 2H6PA 4N5ED 4IDJL 4MQTB 1CDIA 3PL6B 2E6JA 4NJ9H 1A0QH 5CD3B 3VCLB 5D5MA 3KPQB 4PJHE 1J8HD 5EBWA 4HCRA 1DBKH 1PKQE 3HG1E 5SX5K 4JHAH 1I7RA 3QXDA 1T22B 5E2UL 4M62L 3DV4A 4M8QA 3WXVL 2VLKD 1JNLH 4MNHB 4YHLL 4NZUL 4FQCL 1AHWB 5FYKE 3UTTE 1HILA 2BVPB 1HINL 2H1PH 1T20A 4IOIA 4HF5L 4NCDA 1T66D 2JJTC 4PV9A 4UV7H 1RULL 4QOKB 3QNXA 5GJSH 1U8MA 2HT3C 2NYYC 3ABZA 2P49B 3LIZL 5GGRB 4I3RH 4X7EC 3JVGA 4TVPH 2VDRH 2MKLC 2W91A 2X4RB 3QT2A 4PJ8B 3HB3C 3BPNC 4XTRC 4X6DF 5GSVB 5KS9B 5C0NC 3NCJL 4ZAKD 2R4RL 1I85A 1NGXB 2D9CA 4K7FA 4R3SA 4QRRA 4ZUSA 2KBGA 3MNZA 4GT7A 4HC1A 5DVLA 4LMQE 4GXVH 4Y4HB 1MLBB 5GZOD 2FO4A 3T3MF 2OR8A 2DD8H 4HKZB 5J12C 4ODSL 1K2DB 1MCHA 1UFUA 1N7ML 4NQCE 1BD2A 2DI9A 4ONHA 2HLFC 1B0GB 3VWKC 3QG7H 3NCCB 5E8PB 4GLRH 1XGUB 4RMVA 2IJ0C 4HJJH 2WBJC 5D6CB 1CXFA 1DTUA 3JWOH 3ZT6A 2AEWA 5TE7L 4JAMB 4QXTA 3HMXH 5EZLA 1IEHA 1AQDA 1G7HB 1XGPA 3OKOB 4NO0B 2YD9A 5DVOA 5HHQA 4H1LG 4PRAA 3CK0H 1I75A 5EWIH 3V5KA 1VACA 15C8H 4GRLA 4N9GA 5DYOB 4RMUA 3QWQB 4EOWH 4KZEL 1EDQA 3RPIA 4ETQB 1Y18A 2X6MA 3OKNA 1PZUB 4UT9H 3O6KH 1JL8A 5BV7C 1MCLA 3EOTH 2Y25A 3CDGB 4A2MA 3G6JE 2CIKB 3L3OB 1HSAA 4DEPC 2DWDA 4Z7OE 5IVXA 1K5NB 2F58L 5D7JD 3DMMC 2ICWI 3QISA 1NCCH 1XF5A 3QWRA 3VRLE 1JIBA 2EXYD 3QI9B 1S7VA 4Z7QF 3G04B 5ANME 4MQXD 5D72L 1A9BB 1KV3A 4TQEH 4OLZL 4WW2B 3AMKA 4Z0BH 3O41B 1LDSA 5DD1H 3LMJL 3O6FD 4GRWF 3ZE1E 4OSUL 4KMTL 2HFEA 5EU6A 2MJWA 4HHAB 4G7VL 1X4XA 2CKBB 4YQXL 1JTOA 1RK0A 1XFPA 5FOJA 4YHMH 4XPGL 2HJFB 1Z9LA 1VKXA 4P4KD 4LP5A 5ENWB 4XXCA 1RU9L 3T2PA 2X42A 1OGAD 4I18C 4APQA 2OCFD 4LVNB 3U1SL 1Z9SA 1X5GA 1OAZL 1WZ1L 4OGZA 1V7NH 1YEKH 2NXYB 2NXZC 1A64A 2DQHL 2OTUA 3CSYB 3ARBC 4YE4H 3TA3C 1M7DB 1FO0H 1KGCD 2CGRL 3IRPX 1FZKA 4M6MH 2EYRB 4ZSOA 3QHZH 5E08H 2OXHA 3QEGL 2DQDL 3LV3B 1IAKA 5EOCL 1K8IA 5KSUB 1V8HA 3KPPB 1YUHB 4I0PA 3F58H 3WIFA 4DCQA 3TPUB 4PGDA 2AI0H 3ZHKA 3CAFA 3OSKA 1CLYH 1NAMB 4ODHH 4PJDE 4RGNC 3HC4L 1IC7L 4P48A 3ALWA 4X5LA 5DEFA 4NT6B 5JORB 5C1MB 1F4YH 3BUYB 5E24E 1MH5A 4MD4B 3HE6D 1QSEB 3IYLW 2ZG3A 3RVVC 3E6HA 1JN6A 4OJFH 1U91B 3UTPE 2VXTL 3FB7B 2KL6A 4FFVD 3QIWA 3AREB 4PRIA 2CXGA 2J88L 3RZCD 1CICA 3RP1A 1CDUA 5F9AC 5GISL 5B38G 5D8JH 1W0VA 4J3XA 3BN9D 1HDMB 3M17B 2Z31C 4JVUA 5IQ9A 4EI5A 1A6ZA 1QBMH 1PVHA 2DLFH 2J8HA 3WHE0 3IVKB 4P57B 4XPAH 3FQNA 1B2WL 4Z76A 2C7UA 4JZOA 1HI6A 4KVNH 1QEWB 1FNLA 2R39A 4DQOH 1M05B 4KRPB 3BEWB 4P46B 5TH2B 5CKAA 3RUGB 1U0QA 4NM4L 4UUJA 4PJ9A 1FNGA 4FTVE 5IB1B 1KJMA 2NZ9D 1DQMH 2CK0L 3SE4C 2RIKA 4D0BB 2A0LD 1TNNA 4K9EC 3TH4T 4NIKB 1A6TB 4CN6A 1N2RB 1EUUA 5LGKA 4UOW1 1KCSL 2P8MB 1WK0A 1WWAX 3KPMB 4LCCC 2VWEC 2BNRE 4X7SH 4C56B 3SKMA 5JIIA 4V1DB 1MCOH 1C5BL 5C0RH 4Y4KD 3BVNA 3JZ7A 1V3JA 4G9DB 4IMKC 1JGEB 4CMHB 4F7PB 5EOQH 5JR1L 5AZ2H 5CJ5A 3C60A 2A6DA 3MRBA 1H5BA 1JE6A 1BWWA 2YRLA 4JHWL 4Z77B 4NQDE 5T33L 4J1UB 1X7QB 2W9LA 1G6RL 1S7SA 4UILL 2HH0L 2BC4A 4MX7B 3HI5L 5K9JH 2BSSA 1CXKA 3TNNB 1IFHH 1P7HL 4RISL 4LLUB 4TUJB 1W72L 5F93C 3JTTA 2C9AA 2B39A 3MJ7A 1NCWL 5FOBA 1JZ6A 2DAVA 2FR4B 2FEEI 3EDDA 2X1QA 2XWBB 3KPLB 1T2QL 1NSNH 3VMOA 4GFTB 5C92A 2WWKT 5L2KA 2Y9RT 2PTTB 4X6CB 4XNXL 3WEXB 3VFMB 4RSVA 1KJ2A 3SEPA 2X40A 5F7UA 4XGZA 4Z7UA 4WU5A 3RHWK 5E1HB 4NWTH 2CLVA 4BK4A 1T7YA 4GW4B 3X3GL 1QFUH 5H2BB 1INEL 3CZFA 4DUVA 4GMSH 2X44D 1IGYB 4B41A 1KB5B 1MHHB 2NY2C 2JKXA 4NKOA 4XVUD 2D7PA 2FJHA 5IQ7H 4HUNB 1OSPL 4CDGC 1LK2A 3CFIC 1FCCA 3G5VA 1G1YA 2FBJL 2IGFL 3AU1A 4Q2ZA 4TUKH 4HBQA 5EO1B 1JI2A 2OTWA 5FV2A 3PWPD 3MOAL 1MVUB 1ND0B 3BH9B 1MHCA 2CLZB 4P5TC 5F7NC 3QPXH 3HMWL 2GY7B 3CLFL 3WKMH 1W8OA 5I1JL 4HX1A 1EAPA 5D71H 5TF0A 3T3PF 2LQRA 3EYOB 2HT3D 5BW7C 5CEZE 2NYYD 3SDCB 1XGQA 4KVCL 1IZJA 3QFJB 1CE1L 4Y5XA 5GGQH 1ZT7B 3N1FC 4NKIH 3HB3D 4WHTB 2EIDA 2PCPA 2LU4A 3NFSL 2BFVH 2Y06L 3H9SA 1RZ7L 3RKPA 5C0ND 3TO4C 1BQHG 1GC1H 4H5SB 3O4LD 5D1XA 3UZQA 5HHMD 4LCYA 2DYPA 1F58H 5IVXE 1Z3GL 5C09D 5DS8A 3C9NB 5D2NA 4AL8H 4HIEA 3FN3A 1NEZG 2X4SA 3LN5B 2HLFD 4OGYL 3VWKD 1S9WA 3QIUC 1LEIB 5F1NA 3RWIA 3FB6A 2Q87A 1BOGA 2WBJD 5ITFB 3RDTA 3EYVA 2MPAL 1BPVA 1FVEB 3SDAB 4KDVA 2OJZL 5BV7L 2AK1H 5L8JB 1OP3K 5CINL 2ED8A 1SEQL 3VXRA 3MSPA 1E6OH 4JDZB 1Z9MA 1FL5A 1CN4A 3OKMA 4AT6A 1EMTL 1QBLH 3ULVC 3LN4A 5FK9B 4U6YB 1BFVL 1HK6A 1T04A 1UEYA 5IJVB 4ZO8A 5ESAA 3CCHA 4S2SB 4HS3B 1UZ8A 3QDGB 1V3KA 3CUPB 1ORSA 1X6LA 2IPTL 3PWUB 2QQQA 4PRPE 4D94A 4N5UA 5B39A 3MRGA 4ZXBB 3FOLA 3REWA 2ZOKB 1IT9H 2DQIH 2R0ZH 3QEUB 5DRWB 4K94H 2HP4A 2WUCL 3CSGA 1T3FB 3PNWB 5FGSA 3JWNC 1QR4A 4HMCA 3C5SA 4FQ2H 4MAYA 2PXYA 2QADC 1WEJL 3LHPH 1QRNA 1YEDA 1KJVB 4ZNCD 1RFDH 1HOCA 2APTA 1I8MB 3VFGL 5D96C 2EO9A 3RA7L 1HIML 2B2XH 3R1GL 5JO5A 4U6HB 4Y1AB 3M8OL 1WLHA 4KQ4H 3VD7A 1CS6A 2HG5B 3M45A 1QTYT 4RFEB 5J0BA 4M5YL 2AS5M 5I1AA 4PJEF 4TNVF 4OZHA 5JDSB 1KXTB 1VHPA 2ITDB 1KNOA 2ICES 1KFAH 2AXHA 2O61A 4M9OA 5F88A 1YEJH 3PGDB 2VYRE 1X9QA 4JDVB 1UM5L 1YNKH 2PYFB 3ARBD 2VZ3A 3BKYL 1ZT1B 4D8PB 1P5VA 4P2QB 4F57L 3H8NA 4OFYA 4MNQE 3LZFH 4NO3B 5I9QB 5C0IA 4IRJA 1IEBA 4BH8A 3EYQC 4X6DE 3QQ9C 4XBPB 4JZNB 1A5FH 4WGVB 2Z4QB 3DO3A 4YDKH 4OLVL 1I9JL 3D85A 3SY0B 2R2BB 4MQ7A 5T3XL 3T3ME 1EGJL 3C08L 1HNFA 5EU4A 5IHUL 3QAZC 3OAYH 3UROR 4HKJA 2FEEL 5D70L 1YN6B 4L9LC 1SY6A 1K3ZA 2ZSVA 1RIHH 2RGSA 4YHYB 2E8ZA 2YN5A 3JWOC 5BS0D 4HUWB 1A3RL 1B6UA 1R3KA 5T3XD 3RVVD 3MCLH 4R26H 1MFBH 1YY9C 3ALXA 5BJTB 2YC1A 4QRPA 3HLAB 4QRQA 3CVHB 4JRXB 2BY1A 1T5XB 1MFDL 2O5ZH 2C5DC 3VXSB 5BOZG 2Q86A 1F4WH 2VLJD 3G5YA 4H88L 4AEIH 3ROLA 1XIWC 4GS7C 5DRZB 2Z31D 3U4EA 5FYJH 1OAXH 2DS4A 5DJ0B 1R24A 5HVHC 1ZXQA 1ZLWH 4JKMA 4JPIA 1F8TL 2AJ3B 1LHZA 2XFXA 4K9EL 5MHSE 3OKEA 5EIQA 4Z7QE 2BCKA 1CVRA 1HEZA 5CP3H 5I75C 1F4XL 1T80A 1S5IH 4LOUC 1U2HA 4NP4H 1UT9A 4GRWE 1S9XA 4H0IA 2RB8A 2DQFA 2FX9H 3C8KB 1A3LL 1DZBA 1GOGA 3V6ZB 4JFOA 2PF6A 3B5HA 4R4FH 5E7BA 1ZTXH 5FEBA 5J13C 1NFDB 2EIBA 4Z8FL 1MAML 4XP1H 2Y07L 3P4OB 2FX8H 3ARGD 4XPFL 3UXFA 43C9A 5IMKB 3SQOL 1GSMA 5F7DB 4Y5VA 2ADGB 1QFPA 1VCAA 4JRYB 4LLAA 2C3HA 3WNLA 2A9NH 4MJIB 5D1ZB 3F5WA 5DVMA 2XZAL 4GKZB 4NGHH 5ILTL 4EUPB 2VLLB 2DBLH 2WNGA 4O2EA 4LSPH 2L7UA 1DUZB 1HWGB 1MEXL 4YNYB 5KSVA 4XXDB 1SJXA 3WXWL 4PY8J 1AXSB 1KC5H 3B4NA 4J8RB 2HRLA 4U6VH 1KT2B 2XZQL 2Z93A 4H8WC 1QR1B 1TZHA 2ZCKL 4RAVA 3KPRA 3OGCB 5CZVL 5HHXL 5I30L 2XWTA 5D2LF 3DX8B 4M7LL 3OR6A 1AFVL 1YMMA 4X5WA 5LWYH 1YEFH 4ZUVA 1CLZL 1YY8A 4R2GC 1M6OA 2X7LA 1CZ8L 1N64H 5HHPB 1P53A 1NGYB 3OKDA 1LNUB 3VXPA 1U8QA 3MA7B 3NZHL 3SOBL 4G5ZH 2UZXB 2F54D 3FCTA 1IAIM 5BXFA 3GKWH 3Q2CA 4LASH 4R97B 4Y7MA 4OGAC 5B8CB 3P0YL 3W5NA 5ISZD 4FXLA 1VERA 3TN0A 3VFVA 4FFZH 4POYA 4YGAB 1MJ8H 4K71C 3WDIA 4WEMB 3L7EB 4NPYA 2FSEA 3CX2A 5CJXC 1TTFA 4LKCA 2WIIB 3VFSA 3GHEL 3MJ9L 5IEKB 4WRLA 1TFHA 4MJ6A 3N0PB 3H9SE 2IANB 4U1IA 3GGWB 3D9AL 3WFHB 1LO5A 2XPGA 2NY2D 1A7PH 2E7CA 4JCMA 4LLVB 2R56L 3HC0B 4M00A 3O6ML 1RJZA 25C8L 3TVMA 5DJAB 2ZUWA 3X14A 3PHOA 1N8ZB 1CG9A 2WP3O 4X9FA 1VFUA 4P5TD 1UH4A 3QPQC 5C0BD 5IFAH 2D7TH 1M4KA 3DXAA 5BQ7A 1R5VB 1S8DA 2A1WL 1DANT 1IAOB 5E8EB 3GRWH 3SE9L 2R8SL 2PO6C 3L6FA 5LVEA 3O8XB 3I6LE 5DHXB 1ZHNA 4HJGB 4FZ8L 4R7DB 4POUB 3SPVA 3MUY1 2VXSL 3JTSB 5DSCA 3MNVA 3QA3A 2MCPL 3E2HC 4YXLH 3BZDA 5BRZE 2VDML 3TO4D 1WWBX 5F6IB 1R5WA 5DI8A 3WLBA 3TESA 3BDXA 3P0VL 3FMGL 1EUTA 3S36H 1X5YA 3CFEB 1IM9D 3DROB 2GJ6A 4MWFA 4LCWA 4KJYA 3D18B 4LRIA 5L88L 3QIBA 3VD5A 4NQUA 5GRYA 2H3NB 4MLIA 3ULVL 4YXKH 1CGXA 1U2CA 3QIUD 1QRNE 3A6CH 4IOSD 3UTSB 1T1XA 1U3HA 3MBEB 1IGIL 4YZFF 4ISVA 4UQ2B 5I6XB 2KUTA 2CKBH 3S88L 1MPAH 4U1MB 2Y5TA 5K9KB 1F5WA 4PJHB 3SGJA 1RUML 3JSSA 2NLJA 2QLVB 4P2OA 3SBWC 2FX7L 1RY7B 4O5LL 3LN9A 3ULVD 3PP4L 2J6EH 3UTTB 4AG4L 3ZTNH 1NEUA 1LEGB 3QG6A 1EO5A 4ZDHB 4NUGL 2ED7A 5DQJA 1TZGH 3GSNL 1BZ9B 4OF6A 3ARFC 1ZSDA 4LKXA 2XKSA 2ZPKL 3QO0B 4M1DL 4YDLC 3U36A 4F58H 3P4MA 2IALA 1RZ8B 4M1CC 4F9LC 1MJUH 5TPWH 2Q8AH 1MCFA 4NZTL 2QADD 2GJZB 2JF1A 3CC5B 3OKLB 3PP3H 5D2LA 3W81A 1DBBH 4DKEL 5ICZA 2EDNA 3O9WB 3UPAA 3EJZC 1GGCH 5GGVH 4YEFA 2KQMA 2QSTA 4UV7L 1HHGB 3D0LA 3FJTA 2E9WA 5CHNB 3DARA 3HRPA 1NAMH 3FQWB 2J5LC 1UWXH 4E0RB 2Y7QA 3RL1A 3I3DA 2VDRL 3NN8A 4NQCB 1FG2A 4WV1A 4R90L 2I60L 1VPOH 3E8UL 4I3SL 3BKJH 2NY3B 4U1HA 3L3GA 1RK1A 5JDJA 2CDFB 4HIJA 5HYQB 3NCYP 3UBXA 1FYTA 2W38A 2DL9A 5I71C 4GXVL 1AO7D 2DD8L 1KB9J 1JWSA 3IF1B 1LD9B 3UEZA 4KPHL 5F89B 2GHWB 4JM2D 2B5IC 1AH1A 4XNZB 3SO5A 3DUSA 3ILPA 5FM5O 5T1KB 1PYWB 1DBML 1UYWH 3EYQD 4JQIH 4YPGA 3MRKB 3QQ9D 1WAAA 1KN2L 1QLRA 5KAQF 1J1OL 5C0JB 3RI5K 1I4FA 1PBYA 4ENED 1REIA 5E9DA 3G6JB 3B2UC 1QKZL 1HH9A 3EGSB 2XA8H 4KK9C 3CH8A 1K4DA 4K3EL 3KXFE 4P4RA 2C1OA 1UJ3C 5FUCC 2EDWA 3VD4A 4ELMA 5ANMB 5F1OB 5FUZL 3UJIH 5F96L 4ODXA 1IM3B 1FE8L 3BSZH 3FQTB 4DGVL 5IOPB 5B22A 4TSBH 4ZPVB 4UT9L 4CW1B 1DDHB 1KACB 3TBSB 2X4TA 1PX4A 1BM3H 1RZJC 1JF6A 5AD0B 2XWJB 1BHGA 5HI4C 3T08A 3VRJA 2NY1D 3DUHA 1YNLH 3K3QA 3BWAA 5IB4B 5TFSL 3S35X 2BSRA 2DL2A 3QWOB 3SDXF 5GGTA 4P3DB 5KVGL 1P9MA 1FSKC 4DFHA 3V4PH 4Z0BL 3WS6A 1XIWD 3DX7B 4KK8C 4WW1A 4YUEL 1WV7T 2ARJB 2P7TA 4LEXH 1Q9LB 3NCBB 1A3QA 3D69B 1AI1L 3LEYH 4B50A 3O3DA 4JPVL 4YHML 4AEHL 3SKJL 4FXKA 4LRNL 5E4EC 2CLRA 3I6KA 5D7KE 3EZJB 4JO1L 1A7NH 1RUPH 3NIDF 3P77A 4NDMB 3UZEA 1YEGH 3NTCH 5C9KA 4DN3L 3NCYS 4WVRA 3VXUD 5A40E 1MCEA 4XNMB 1MCIA 5HGAA 1FN4B 1NGWB 4G43B 3B9KC 3V6OC 1MI5A 3BGMB 1XF3B 2C1PA 1HKFA 2AEQH 4FZEH 3V6FB 3DECA 3A6OA 4GXUM 4D9RD 4PJEE 2NTSP 4PJDB 2D0FA 3W82A 5T3ZE 4BZ1H 4H8WL 4G8IA 2AK4E 6FABH 4R0LA 2WINA 4X8JA 3ZKSD 4YHPB 1L6ZA 2E7HA 4F9PA 5A16A 2X89D 4Q0XH 3HFMH 3PQYA 5FDWA 1BQLH 2Z8SA 4OB5L 3P73B 4MAUH 1GGUA 2WQRA 3O3AB 1EZVX 3T4AB 4U2YA 3BDYH 4BSVB 3HS0B 4U33A 1QNZH 3GMMA 1F45A 4OZFH 5CMAA 1U8LB 3C5JA 5C2UB 4Y2DC 1ACYH 5H35B 1Z0NA 2OR9H 4R2GD 1QSZA 5I0ZA 1BJ1J 5EFIB 5CFHA 1BVZA 1MFNA 1S7TA 1YPZA 2H2SC 4HAGA 4C58B 1NBZA 2CRYA 1P4LA 4JGMA 1JHKH 1XGRB 1IAIH 3T2NL 1FJ1A 4RWYH 3Q6GL 4Z6AT 3D3VE 2YRPA 4KI1A 2BVYA 4GBXB 3VFUB 5FO7B 4OGAD 5I8EB 3QQ3A 5EBLA 4M48L 4F7TA 4AIZB 4FTVB 3IKCA 2DM3A 3WL9B 1RAMA 5TDOB 3HPJA 3PWNA 1R3LA 3QR2A 3E3QE 5DRNB 3A67H 4C59B 3JWDC 2YPLE 4ORGB 1OAYH 4M7ZB 4LBEB 1UB6B 4HWNA 2BNRB 1FZJB 4UOW0 2ADFH 1VGKB 1HZHH 2FCBA 3PWVA 4K3HA 4QYOB 1F11B 1P84K 2VQ1A 5TE6L 1MY7A 3IDNB 4JB9L 2WWMC 2F5BL 3SJVD 4BH7A 3IU3A 5CCKL 5L8LB 3T4YB 2EYSA 1U8JB 2X2YA 4HKBB 3KPTA 1FORL 4NQDB 3L3JA 3V0AC 3VXTA 4FP8L 4J3UA 5HHNA 3QPQD 1MIMH 1JGLL 4P59H 2BHYA 3QH3A 2WLYA 3K7UA 3EFFB 4ZUTB 5CS7A 1RZFL 2XZCH 1WJ3A 5EOQL 2JIXA 3OWEA 1MIEL 1U95B 2RR3A 2PO6D 4XAWL 5DFWH 3QP3A 4LSSL 3SDXA 2HTLC 3DX6B 1AQKL 5HGBB 1Y0LB 3MGOB 4MZ2A 5E2WL 4YBLB 5E6IC 4Z7WE 4UQ3A 1GGBL 2FJFA 3B9EA 4JFDA 5BZWB 1EERB 1TQBB 4OV5B 2X70A 4ZD3L 1PQZB 4F7EA 2I5YH 4JFEA 2BNQA 1NCBH 5KBNC 1A2YB 3VFOB 1CDBA 2OL3H 1SVZA 4OZ4A 3F7YB 1NCDH 3PL6C 5I18L 4O00A 1CIUA 4OLXH 1QG3A 4UDUB 2FHBA 2VLRD 2GT9A 5D2LE 5IG7A 1AGCB 1H15B 4R3SB 4XMLL 1QVOA 4U2ZA 1OTTD 2BHZA 1OAUH 1VENA 2AJXH 4XX1G 4RRPG 1ORQB 4RZCB 1AHWC 1BGXL 5SX5H 1AKJB 4PJCA 1RJCA 3GBNH 2VO5A 4KI5C 1KXQE 1BEYL 1TLKA 3EOAA 4YDJA 2G75A 3KG5A 1OB1A 4ACPA 3EYSH 3INUH 4L8SA 4NSKA 5FO9A 1WF5A 2D4DA 4LVOB 4OQ1A 3OAZH 3QEQA 3O2VL 3Q6FA 5IROC 3OF6A 1MCWW 3ARFD 5IQ7L 3ZZ1A 3FQXB 1XGPB 4PJ8C 3U9PL 3DSFH 3F7RA 4RFOL 4QT5B 4DKDC 3I84A 2HJKA 1SJEA 3V5KB 4M1CD 4QF1A 5JOFA 5J56B 3G6DH 4I4WB 1G7LB 3QUYA 4YHIA 2ADIB 3L1OL 2XXMB 4Y4HC 4A6YB 3ARQA 3H7BA 1BJ8A 4D9QD 4OFVA 3EJZD 4OFPA 1P7KA 4U1KA 5D71L 3W2DH 5CUSL 2CRMA 4HUUA 2B0SL 5GS2D 3T04D 4PJIA 1KYOJ 5ALBL 3A6BL 5HHVL 2DICA 1WQVT 1EEZB 4W4NA 1J8HA 4HT1L 3WSQH 1F97A 4G6JL 1H9VA 2DTML 1NL0L 1A1NB 5I1CL 4XC3H 2VLKA 3S35L 1B0RA 4NKDB 4ODTH 3THML 2RAMA 3KGRA 2VL5B 2XI9A 2PYEE 1QOKA 1B6DA 3TNMA 1XR8B 4U0RB 3NABL 3OPZL 5D7SL 1NC4A 5DD6A 4OCRL 4TSCL 3PDOB 5DJ6B 5I0DA 4UU9B 2UVFA 1GYAA 4D9LH 1JYVA 4PRPB 4OF7A 5IBUB 1RZJL 1MRCL 2EKJA 3RVXC 12E8H 3RU8H 4KK9D 1IEAA 3NFNB 3LRSB 3QI9C 1WZKA 3H3PH 5D7LE 4HXBH 4PJBA 4WW2C 3S4SA 1QBLL 5JHLH 3MRJB 3DTXA 4X6EA 5SWSD 4OD1H 1DQJA 1J1PH 2DQEH 4UTBH 4YZFE 1JYXA 2YEZA 2IH1B 3BDBA 1HQ4A 4QCIA 3V7AE 1H8SA 3MFGB 1D5BA 4H20L 4QEGA 4PS4H 5HI4D 4I0PB 3OX8A 5L9DL 4GW1B 2DQIL 2VXVL 1U8NA 3G5ZA 3EHBC 1N26A 4N90D 4UBDC 1EAJA 4BFIB 1QQDB 3VRIA 2NXYC 2Z35B 4U1LA 1MQKL 4G3YL 5AYUH 3S37X 4EUPH 3HZVA 1FVDA 4KUZH 5JW3H 4KK8D 3MV9D 3ULSA 3E6HB 4CADA 3I9GL 1TVHB 3NACH 5J1AB 2CDGA 5C7XL 2DOCA 1DANU 4IHOA 4JG1H 3GBLA 4OIBA 4MNQB 2OQJB 1FFOB 3MFFA 2G5BA 3CFBB 1BVKB 1ZEAH 4IMLA 3V4UH 3WD5L 3QUXD 1FH5H 4X6DB 1DQDH 2D31A 1NBYA 4NHUB 2VITB 4YHKH 4NUJA 1YEJL 3VXMD 4MJ5B 3DUUA 4F7CB 2XKUA 4LIQH 1BX2B 3B9KD 1CBVL 5F1KC 4DTGL 3O6FA 4Q9RH 4UV4L 2CUMA 3WDJA 3OHXB 2E7BA 4JPWH 4JZOB 1JMXA 4J6RH 5E2VL 3MYZA 1G9NH 4UDTA 2EKSB 1CLCA 2OR7A 3B5GA 1MLCB 5CIPB 4P4KA 3PV7A 4WU7A 4XP5H 5SX4H 3DRTA 1ZLUK 3WJLC 4CBPA 1OGAA 2GITA 1T1ZB 4S1RL 3GMPA 1SYVB 2C3WA 2ORBH 3AREC 4POZC 3O2DH 1JGDB 1WFUA 5HYJD 5M95B 4R4NC 4UOJA 4OUOA 3KNBB 2H8PB 4PP2A 5IHZA 3VFNB 4KDWA 3VG0H 4OCWL 1UWGH 3IJSB 5C08B 5IR1A 5DD5H 1HCFX 1URLA 2MMXA 1CFSB 4RCAA 4Y2DD 3MCLL 4F37K 2QQNL 2PW1A 4JFHD 1EHAA 5F44A 1XMWA 3PF2A 4KRPC 3FRUB 4P46C 3EYFA 3C6LB 1N6UA 2H2SD 2O5ZL 3ALPA 2XQYK 4F7MB 1W0WB 3N85H 3P9MA 4FA8A 3JWDL 5HDQH 1Y6KR 4MD0A 4FNLH 4YR6B 1BFOB 4WI6A 4GRWB 4NM8H 1P4BL 1ZWIB 3GUTB 1OL0A 5CGTA 2Z8RA 2YD2A 4JQVA 3IDYB 2QTEA 3FT2A 3HE6A 4YC2B 4K7PL 1MWAH 3NVQA 2I9LB 5F7YC 1EBPA 2FYYA 2P5EE 3SDXE 4HK0B 2GI7A 3Q5OA 4DZBA 4PJ7A 3X3FH 1FAKT 5E8DH 1MCWM 5FECB 4FQXB 4HBCH 4CMHC 3RZCA 4R4BA 3FTGA 1OP9A 1E6JL 2AJSH 4EVNB 4JQXA 1WIPA 4G42B 5H37G 3VDAA 2FWOB 3UTZB 4CDHA 4UIMB 1RIVH 4BA8A 5EZIH 1GXEA 3ZDYE 3QDJE 4WCYH 3LAFA 3X13B 1WCBA 3NIDE 5B4MC 4R6UA 3N1QC 1XR9B 1FL6B 1A7QL 4WFHD 3RTQB 1PY9A 2LTQB 4Y5YA 4YWGL 2X4QB 4XCEA 3RNQA 3BH8A 4P3WA 5DT1H 3A0OA 1QFWM 4O9HH 3IDGA 1IQWH 5DMKA 4IS6B 5I1LA 3VGBA 3BP4A 3GSOA 1AGBB 1OTSC 2HTLD 4IDLA 5FYKH 2YRZA 43CAA 5E8OB 3V9FA 1JV5B 4KH2A 5E6ID 1FVCA 3EO0A 5KSAD 2DMKA 4AEFA 2YKLL 3BFOA 3C09B 4JO2H 1EAPB 5EO9A 3T0EE 4G9FE 4GXUN 5LWYL 3UJTL 1RZIB 4N0YH 3L5JA 1CD0A 1NGQH 4CRPA 3MLPA 1TTUA 4Y4KA 5E6ZA 3U6RB 5FCUL 5CSZB 3PGFH 3OJ2C 4Q6IB 3OZ9H 5DQDL 4JJ5B 2P8PA 1UVQA 1V3MA 5SWZE 3PL6D 4NNPL 2UUDK 3QCVL 3H9SB 4HWEL 5TGBA 3MLZL 4ODWA 1NAKH 1ODAA 2ATKB 3STLA 3JV4A 4NRXB 4O2FB 4YO0A 2PETA 5D1XB 3FB8B 4G8FA 1KLGA 4N8VB 3VJ6A 3QRGH 2IH3A 4WWKB 1G7MA 4FABH 3MACL 3S3PA 1CFTA 1QYGL 1UQSB 1AGDA 4G80A 1UENA 5LGJA 4R96B 2C4XA 2MCG1 4KI5D 2BY3A 1QO3B 2K9UA 3MROB 3CD4A 3QNZB 4DW2H 1BOGB 3RGVC 4KXZH 1HXYA 1AGEB 1TMCB 1UKQA 4ONOA 1XF4B 3SDCC 5HY9A 1T89C 1EA9C 2EIZA 2VABA 1EEYA 4PJ8D 5GRZA 4RGMB 2BVOB 3AY4A 3BPCA 1T83C 2NR6C 5IF0B 1ZGLB 3EW3B 1W72A 1HCVA 3HNSH 1WITA 2DQUH 4HC1L 4Y4HD 4X6BB 5E5UB 1Q0YL 5BRZB 4EN3B 2ZCLH 4GG8A 1FPTH 5GGSY 1MFCH 3FT3A 3MRGB 4LHUB 4UINH 1G7QA 3L3IB 5DUBB 2O26U 4N68A 1M7IA 3BGAA 5GRXG 1X5LA 4EIZC 1FFNB 1OHQA 1ZHKA 3VGHA 4BM7A 2ICWA 4IIQB 2AJVL 2A6KA 4WJ5A 3RIAK 3CFJA 4HJ0C 1I9RL 2CQVA 5T1DH 4XVTL 3PWPA 3V79C 1Q72L 4KRMB 4KMLB 1CD1B 5BZDB 4ZFGH 1ZA6B 3FO9B 4MCYB 3FONB 2C3VA 1NGZA 3RWJA 3S36L 1ZANH 1H0DA 2OMBA 3Q1SL 1OP3H 4LU5L 5DJ2B 3KYMB 1DBJH 4FQJH 4BKLB 2JJTA 3QUML 5TQ0L 5KJRH 1FGVL 3IDJA 2DMBA 4XNUH 1CK0L 1B4JH 1IGTA 5HHOE 3K4DA 1KNOB 3A6CL 4ZXBC 2H9GA 4HK3J 4N0CC 2VDOL 3MRIA 5JW4N 4L1HA 3VGEA 1WBZA 1KPVA 4Y16B 5F88B 4GSDL 5IB2B 1MPAL 3TLRA 1WC7B 5EDXA 1R3IH 1NFIB 1A4JB 4L4VE 3JV5A 4AH2A 2FZ3A 4PR5B 3GMOA 1MFEL 1WWCA 2GK0A 5C09A 1CQYA 4JDTH 2HKHL 4AQ1B 3B6SA 3X11B 1ZHLA 5SV3A 4M6NH 3VWKA 3LKNB 5EU7C 4ZFZA 2MQ3A 5E2TL 4MQ7B 2WBJA 2JB6A 4QTHA 3BIBX 3C5ZA 3VGDA 3EHBD 4XMKL 2G9HA 4PV8A 4Y8AA 1UWEH 1A1OB 4KU1A 4UBDD 2HLAA 3LY6A 1PLGL 2NXYD 5DD0H 5ACLA 2NY5H 1CDGA 5EOCJ 3D0VB 2IBZY 1TETH 5INDA 5TDNB 4DGYH 3BEVA 2N7BA 3KHQA 5IJKC 2ZWLT 3GSWB 1OGAE 4R8WH 1VFBA 5JUEL 4Z78A 1DJSA 3RBGA 5BCAA 3OJMB 4LLDB 5I9QC 5DLML 1VEPA 2NQCA 1RJYA 1JF1A 1A14L 1J9CT 3DMMA 4PY7A 2YUWA 3HC3H 1N6VA 5JXAH 4OUUA 3LKRB 1GPOL 3LB6C 3OR7B 3G08B 3F7PC 3FO2A 2NCMA 5DEGA 4MS8C 4YHOH 4X99A 4YK4B 1UCBL 4XMPL 2VDPH 1JFQH 1MCQA 4HQQL 3GMNA 4M9PA 3KXFB 2DM4A 4W81A 1SBBA 1MCJA 2IQAB 4IRZH 4YHYC 5JW5B 4IEFB 3AAZA 2OZ4A 2VR5A 1QSED 5DHYB 5BVJA 4JG0H 3TEUA 2QL1A 3BKCH 3BKMH 2DIBA 1MRDL 2A77H 1JZ7A 1I3RB 3U2SA 4ODUA 1BLNB 5EOTA 1KF9B 3AB0B 2NZIA 3MRCA 5EG6C 3TBWB 2IPKB 4GUPB 1JWUB 1RVFL 3GI9L 4HUXA 4I18A 4E42B 5LXGL 3X12B 3ARED 4M93B 5KZCD 4POZD 3SKOA 1EFXA 1AC0A 5F7EL 4R4ND 3ROOB 2WMPA 3ZYJA 3RWHA 3ARBA 1KOAA 3TA3A 1HXMA 3HR6A 2B4CC 1KIRB 2IADA 2GUOB 3SGKA 2V17L 3CH1A 3SE3C 3U46B 4YFEA 4JFFE 1BZ7B 4Z95H 1J0KA 2R1YA 3OB0K 2W9EH 3EO1A 3FQUB 3S96A 4MZ3A 3K4ZA 1OW0A 3QIWD 1U92B 2QHRL 3RWFB 5EO0A 2CRIA 2V9TA 3BMWA 1NDGB 1CICD 1T4KB 4Y19A 4ZOEA 1ZS8A 4KRPD 3LKOA 4P46D 3NH7L 5DVNA 3HUJF 2X9YA 2A9ML 1FRGL 4RAVB 5BVPL 4GQ9H 4NKQB 3B2VH 1HQRA 4D0DA 2CDEA 4ZS6C 1S7WA 4L8BA 4OCYL 4ZUVB 3X17A 1I3UA 4HCRH 1FGNL 2YD5A 1DVFB 5BS0A 4YDVB 2BRRH 1MJJB 1YYMH 1EGJA 2BDNH 5J6GA 3VXPB 3WUWB 4ELKA 3BP6A 4PJEB 4C56D 2VERN 3C8DA 5A43C 4P99A 5C0DB 5E8NB 5D1ZC 4GKSB 2AK4B 2JELL 4LGPB 3D5OF 3WMSA 3MUGA 1X5JA 2VLJA 4TULL 5DDHA 2X4UA 2YWYA 1DQLH 4OLUL 5J3HC 3KAAA 4GW5A 3QHFH 3N9GH 2R69H 3AS3A 5JHDA 2Z31A 3DBXA 3MOQA 3IFPB 5AG9A 2AEQL 2MQ0A 5FF6B 1NCAH 4LF3A 4LLQA 4LKCB 3T8XB 1F02I 1RV6X 3HHRB 5ACZA 5B4MD 3OAUH 5E70A 1DLHA 2AW2A 4PTTB 2VISB 4LSUH 3MLTB 4YGVA 5IB5A 2W9DL 2YR3A 3L5WA 3MRQA 4GAYA 5CWSB 4Z7NF 4JZJB 1K6QH 3QUKA 3WE6B 4DKAA 4ZUWA 1E4KC 1LGVA 4I5BB 3TWCL 3FN0H 1OGTB 5TF1L 1QFWH 2EDKA 5EBMA 4PB9H 3IFNH 1RJZB 4HPYH 4AM0B 1BQLL 1OTSD 3SE4A 4R97C 5B8CC 4PJAF 1QFOA 3D3VB 2XQBL 1KB5L 2YZ1A 2NY6B 4XRCB 4OAWA 4WUUE 4LCCA 1NUFA 2IG2H 2AXGA 4WHCA 4PIRF 3TV3L 4U3CA 5I76B 4ODBD 5HYSA 1VEMA 3FO1A 4IMKA 4E41D 4L8CB 5EA0L 1EO8L 1Q9WA 1RUAH 1SYSB 3KYAA 1H3TA 1JHKL 2YPLB 4A6YH 1DN0A 4MA7L 4RWYL 2X4OA 5FA4B 2D0HA 1JNHA 5GIRA 2HTKC 5A2FA 5L2JA 1BVLB 4FXGB 4CNIA 1U9KA 4EDXB 2LAAA 3EJJX 5F9OH 4PP1C 2Q7NA 4JEGB 4PB0L 3U9UB 1J86A 1F6FB 1I8KA 2E7LA 4QRSB 3A67L 1A1MA 2QQLL 2GKIA 4AIOA 4WY7H 5KVFH 3LS5L 4FQIH 3SE8H 3RGVD 2BHUA 2V7NB 3SN6N 1GIGH 5EN2B 3TVMC 1U58B 1NLBL 1BIIA 5FHAH 35C8L 1XF2B 2R23B 1XGTB 1Q94B 3QFJD 3O8XC 5ISZA 1X5KA 5I1DA 5IT2L 2NLJB 3M1BA 3K46A 2NR6D 5EC2A 3LD8B 1ZT4A 3WHXB 4JM2F 3MGTB 1EXUB 4NO5A 1NC2B 4Z7WB 4A2LA 2M26A 2GCYB 4XPBH 4KJQD 4ZQKA 1MCNA 1S7QB 3PV6A 3MLVH 4N1CA 3VFTB 3N1PC 1MF2L 2CJUH 3WIHH 2EDLA 3KS0J 4ALAH 3O4LE 3VE0B 3PWLB 1BQSA 3VXOA 3QEHB 4PRNB 2UWEF 4M1GL 2EDBA 3MBEC 3QDHA 4RMQA 1N4XL 4HJ0D 5I6XC 2GK2A 4B5EA 4WTXA 5JMOC 4NFDA 4LRIC 4P5TA 5SX4I 5H8DA 5C0BA 4PTUB 4M61A 5T5NF 5ITBH 4HMEA 4CVXB 4TSAH 1LP9F 3NMEA 3NN8B 1U3HC 5BW7A 2Y5EA 2WZPD 5GGSA 3OXSB 3P30H 3CFDB 3QDGD 3I6GA 3FRPA 2X4PB 5E0QA 1KN4L 4U1HB 2XT1B 4RAUA 1IGJA 2Q6WB 1U8OA 1C08A 3TJEH 2IAMB 5HXMA 1BBDL 3TO4A 5T5FL 5I8CB 3RWEB 4L4JA 1OAUL 5GS0C 2WSKA 5FAAA 3K2UL 4GH7B 3UYRL 1IM9A 2YK1L 3QUZB 2L4OA 2VE6B 4YPGB 3O9WC 4S1DC 1S7UB 3BD3A 3CMOH 2UV3A 3EYSL 4CVUA 2RCSL 5DHVA 2DDQH 5DURD 1JK8B 1TVBA 3LQMA 2UZYB 4ERSH 4N8PA 3IFOA 5DJYB 4JFZH 1I7TB 2ZG1A 1QP1A 3BP5A 3T65B 5MEQB 3BX7C 4GG6F 2J4WH 2NY3C 4QO1A 5ECJE 4WO4B 3QDMD 3QNYA 5DJCB 4P2RE 3G6DL 2V2TA 2DTSA 3ET9F 3V0WL 1LE9A 4XPHH 2AV1A 5CSGA 4JY4A 3V95A 2CKNA 1QLEH 4HWBA 5DR5H 5T1LB 2GQHA 4P2QD 4R7NA 4X4XB 4LSQL 4XNZC 1SBSL 4WV1C 3EOBB 2PYEB 1DQTA 2HFGL 2C3GA 1L7TH 1OAQL 3G6AB 4XAKE 1VADA 3V7MA 2RQ8A 3KYNB 1SMAA 3AM8C 4RNRB 1C16B 1DBAL 3QJHA 4DOHE 2YPVL 5EUOA 2FD6L 3F12A 3BHBB 4YX2H 2H32A 2ENYA 4XCCH 5FXCH 1D6EB 5I16B 1CE6B 5H94B 3OGOE 4U31A 4MS8D 1IGML 4X4MA 3SDDB 3GMRA 1MFAL 1G7PA 5KTEL 3CVHL 3GSNA 4NZDA 3ZDZF 1S3KH 3GDBA 1SY6L 5D7LB 3WS3B 1JPSH 1KEMH 3D85D 3DOSA 3GJFB 5L0QB 4ZNEA 5ICXB 4Y88A 3KLAB 2B4CL 1R5IB 2ERJB 1X44A 4GRWH 3BP7B 3TBTB 3HNTL 5DGRA 4NOFA 1KTRL 2X9WA 3BQUB 1S9YA 1EBAA 4JRXD 3ES6A 3RU8L 1GRWA 3VXSD 5C8JA 5T3XE 1ZGLP 2J8UA 4C57C 4JLRA 4LLYB 2A74B 1YEHL 3TCLA 3H3KA 1T21B 5JHLL 5LGHH 1WBXA 3L5XL 1FNAA 5ADOL 3B43A 2AV7B 1XCQB 5CD5C 5I19H 4ONFH 4QHMB 5F3BB 4XCYB 1KJ2H 4RA3A 3W0WA 4O2CB 5KVEH 4JRWA 4LMQI 2FIKB 4PRDB 4MSWB 5C70A 1F42A 3KPOB 2K3TA 5IGXL 1G9MC 3CPLA 5E03A 2UWEA 1MHPL 4PJXA 4OI7A 2V5YA 1A6UH 3EO9L 2CPCA 2X5PA 3EJYC 1GH7A 2CD0A 5GS1A 4ZS6D 1C5DA 4DZ8B 3G9VA 4L9LA 2FB4H 4X0KB 3IDMB 2DIJA 4JFPA 1YQVH 1JHLH 5C0FA 5DJ8B 2CO6B 3VXNA 2XNAB 3MLYH 3QCUH 3V4UL 3NAAH 4M03A 1FH5L 4H25B 3BXNB 4KTDH 4JRYD 4YIQA 4MD5A 3AGVA 5D1ZD 1U8PB 3TYGH 1U8KB 2CMRL 4ZS7H 5IW3A 2VXUH 5J1SC 4AK1A 3BRDA 1P7QB 2ITCB 4HZAA 4PLOB 1M71B 1UA6H 1XIWA 1E27B 2ZKHL 4ZTPL 4UTAL 3T0WA 4QRTB 1NMCB 5E1AA 1MCRA 4Q9RL 3HPJB 3FB5A 5J9PA 4S0SD 3KYOA 1TQCB 5FUOH 3RWDA 3PJSB 4LCIL 5HGDA 4Y89A 1TCRA 4N0UE 3V0VB 4U0QB 1NBVH 3BJ91 2P8LB 1ES0B 4XZUA 4TUOB 5GSRA 3LQZA 4I77H 2IMMA 5J11B 4XWGH 4DVBB 3HZMB 3MGAA 1JPFB 4YHNB 3VXUA 1TPXB 5DWUH 3IGAB 4OLYH 2VMFA 1MREH 1LO2H 5INCA 5GRVL 4GG6A 3DV6B 2OK0H 2NY7L 4GBXC 3CXDL 1MAJA 1WZMA 5IESH 1CLOH 1YMMD 1NMBL 2BXYA 2MFNA 4KTEH 4QNPF 3LKQA 5C0EB 4HGWA 1D6VH 3MLXL 3VG0L 2F54E 1BBJB 5MERA 4JVWA 3CSBA 4QXUH 5T1MB 3F7VA 1N3NB 2XA3A 4NWUH 2BSTA 3OV6A 4PJGF 3T2QA 2NTFB 3IXAB 3LEXB 5DO2C 4GAJH 3P4NA 2P5EB 3HZYB 3K80A 3SDXB 1A6WH 1FO0A 2IAND 1ZMYA 3N1MC 3ZKMC 5IW1A 2X89A 4TYUA 1Z6JT 2UY7A 2R1WA 3VGAB 2HVJA 2HTKD 4GKNA 3VFRB 5ACMA 2DBJA 3TIEA 1J7VR 3T77A 4WNQA 5IM7A 5DUPL 3IB4A 4Q9QH 2D03L 2R2CA 5GS3A 4PP1D 1AY1L 5EZOH 2UZIH 5MEPA 3HUJE 1H8NA 3QDJB 1UXSB 3L5HA 1TXKA 2HT4D 3FFCA 3HTLX 3GO1L 4DAGL 1I1RA 3GJEB 2FGWH 5D7IF 4HBCL 5CBAA 2LFGA 2BVQB 1H8OA 4K7PY 2AJSL 2FEDC 4MQSB 3TVMD 2EE3A 2P5WE 2P1YA 5E94A 3OG4B 2ENSA 4QHKJ 4DKFL 4OM1L 1YNTB 4LSTL 1AGFB 2A6JA 3BZ4B 2EDTA 5IWLC 4YBLC 5E56A 5J6HA 1T0NA 4G7YH 5JQ6H 2ARWA 4LSVH 5SWQA 5F7WC 3VU2A 3RAJH 1A7RL 5CJXA 3ZMRA 1VESA 1TQBC 3DURA 4RIRB 5FO9B 1E4XH 2ATPA 3Q6FB 4G6ML 3T0EB 3MRPB 3E1F1 4G9FB 1T6VN 4IBLT 1FBIL 4AEEA 1D9KB 4MNGA 3KPNB 4JFQA 1IQWL 4UT6L 4OI9A 5DRXB 5IBTH 2VH5L 5FKPA 1SJEB 2VIRB 5DTFA 4HS6B 3SJVA 3RHWF 3UTSD 4OZIF 3MBED 1IL1B 5SWZB 5E5RB 2Q3ZA 1IARB 2O5YL 4Z7NE 2GJ6D 2ZUYA 1MJ7H 4LCWD 4JVPA 1OM3L 1DLFH 4HH9A 1X5XA 3GMQA 5CJOH 5F6HI 3TBVA 5I1HL 3WBDA 4N0YL 1DP0A 2YUZA 4I48B 1I1FA 1GJIA 4L29A 1B9ZA 1O5DT 2AAVA 3DIFA 2Q76B 5GS0L 1U3HD 3OZ9L 4X7DC 3UTTD 2YA0A 4PJAE 5MP6H 1ZHBA 4LVOC 2PO6A 1PSKH 4X98A 5HD8C 5KSBA 1I9EA 3QULB 5BO1H 4O58H 1F2QA 4I9WE 2F53D 1FLTX 1RJLA 1Y6NR 5TE4H 3MOBH 2FECL 4GMTL 3I50H 3BUTA 1UH2A 3U48A 4QHLA 4GO6B 4NO2B 1CGWA 5GS0D 2QQKH 2MQCA 2HVKA 4WFED 2KQNA 3QCTH 1BREA 5JZ7C 3PGCA 4Z7VF 3O9WD 4XBEH 1KCLA 5CEYB 4AMKH 5ICYA 4S1DD 3C8HA 1NQBA 3UYPA 2ADJA 5C9JB 5IV2B 3G5XB 3DYMA 2OP4H 1SEBA 1J1XL 1AJ7L 5HTSA 2JJWA 5DJZA 2FJGA 1MAKA 4H1LA 4XNQA 4ZAKB 5L6YL 4NQCD 4OQTH 1FZOB 3MRRA 4PD4J 5JPNB 3HPLB 3SCMB 2Z91B 1FZMB 2YXFA 4K3GA 3HNSL 3SBWA 5CJQL 5LJYH 1F90H 4E5XB 1CGSH 3JUYA 4XNYL 1FL3A 1NUGA 3IJHB 4LARL 1Q9KA 2KZ1B 1I3GH 2VQTA 1MFCL 5HPMA 4U0RC 3GSVB 4QHNB 4Y4FB 2CIIB 4HLZG 5T1KD 1U8NB 5DFVC 4ZUUB 3CX5K 2EH7H 3MLWH 3ARFA 1AO7E 5I15L 1IRAY 2BJML 4EEEA 3B5TA 1S5HB 4UT7H 1K8DA 1Q0XL 1FYTD 1KCUL 4JM4L 2WW8A 5HHOB 5ESQA 4F9LA 1TZIB 8FABA 3NFPB 1FYHB 1JHTA 5AAWA 5FYLE 4U1NA 4YHZL 3O3EA 1ZANL 2C4FT 1H3XA 4L4VB 5C3TA 2VDNH 1NKRA 1GAFH 5I1KH 3O11A 4LLWB 5EORH 5E5MB 5D7JB 1D3CA 5E9DD 3B3IA 4NRZB 2D31B 5D7IA 4PGCB 4LK4A 2XXCB 1Q9OB 1U42A 5HSFA 3LKPB 1LO3H 3WFBL 2DQTL 3RY5A 5F1IB 1XZ0B 3DO7B 1LP9E 1OARL 3ZTJG 4OTXL 5HDBF 1G9ML 1CFQA 4FN0A 4D3CH 1ETZB 3JXAA 1VGEL 1FNEA 3BISA 1KEGH 1R3JA 5CD5D 4X4ZA 2F9BT 3LQAH 1KUMA 1A47A 1JRHH 1KPRA 4M43H 1OGAB 2JCCE 3MXWH 2GITB 1P1ZA 3W39B 1AR2A 3MREB 4F80A 1HHIA 5IEHA 1LMKA 1PG7H 4MDJB 5TQ2H 5F3HA 2I9TA 3MUZ1 5D1QB 1OWWA 5HGHB 2AABH 2QKIB 4LGRB 2HAZA 2Q1EA 3D2UD 1Q1JH 1YJDH 1UJ3A 3EJYD 4L3EA 3BZEB 1G0YR 1ZVSA 1J8KA 2AKRB 2V2WA 5KVDH 1TETL 2VC2H 4DGYL 1N0XH 3OKKA 4LAQH 3QXTA 1AXIB 4KUCD 4R8WL 5MENA 5FKAB 2F74A 2ESVA 4XT1C 5FM5M 1GHFL 3T09A 3BT2H 2XICA 4EJ1C 3MCKA 3FQRB 3PABA 1JUFB 3DVNA 4LNRA 1S7RB 4MA8H 3ARTA 2A73B 2IF7A 4AENA 5D93B 3WFCH 3MV9A 4NJAH 4I8DA 1JGUH 3KPSE 1YMHB 2W07A 1OF2A 4NQEE 2YD6A 4DZBB 3HRZA 3P11L 4QY8B 3WO4C 3L3HB 3BKML 3HI1A 4JFFB 1H3WM 3KDMA 1G7JB 1XCTA 4NN6B 4LPCA 5C07A 3PQYD 3OXRA 5C6TL 1YECH 3TT3H 3V4VH 1U8HA 3ZDZE 5IVZB 2DQCH 1A02N 3VXMA 4XP9H 4CGTA 5IIEA 5K9OA 3GHBL 2GSIA 3V6OA 1BJ1H 1WCBB 4LSDA 3VI4F 4KK6C 1UXWA 4LL9A 2MHAB 5CZXD 2XY1A 3QYCA 1CD8A 4FTVD 4Z95L 4I1NB 1T6WA 1INDL 1EO7A 3HAEB 3IDYC 4OD3H 4XC1H 4YC2C 1QSFE 1JBJA 3NPSC 3ULUL 3MRMA 1TJHL 2PR4H 1Z2KA 4MA1B 4XWOC 5DO2D 1II4E 2EDDA 4FQXC 2BNRD 2MOVA 3ZKMD 5BMFL 1QHOA 5HYJA 2N7AA 1KIQB 4HIHA 3BO8A 1DQQB 4BFGA 1J05A 4JQVC 1JYWA 4WFFE 1TCMA 1GZPB 2OX5A 1FIGH 3ULUD 4NNXB 2A83B 4H0GA 4NHCL 1B90A 1YYML 4Y2DA 4EDWH 1D5MA 2IWGA 1KJ3H 3R0MA 4HS8L 3HNVH 4NQDD 5TDPB 4YAQA 5LQBH 3VW3H 2GTZB 2OM5A 3HR5B 3RTQC 2VAAB 2LTQC 4HDIB 3BIKA 1WVZA 1HHHA 2D7QA 4K3JL 1OP5H 3U0WL 5A2LH 2FEDD 5KAQG 4LPYA 2XN9E 2R2HA 3SHSA 4PRHA 2X1WL 1NMAH 2ICEB 2B1HH 4OF5A 4S11A 2R69L 3MA9H 1I7ZB 3EKCA 5JNYB 4NBYB 4RBPH 1L6XA 3TC9A 5JW4R 5FV1L 5ABDE 3S6CA 4HSQA 3WFEL 3C09C 4LEOB 3O6LL 5I8OH 2I07A 1U8IA 3KR3L 5MEOA 3F62A 4NQVB 1R0AH 3AFLA 2VDQH 1G6RB 1K6QL 4WUUB 2E7MA 1PD6A 2NPLX 4X9IA 5ID1A 5F7MC 4OGXL 3DX9B 2ARJQ 4Q6IC 1OT2A 1NUDA 3O0RH 1Q8MA 1GZQB 3I85A 4XBGB 1YDPA 1MQ8A 2IFFH 3DJ9A 1L0YA 4K2UH 1RUQH 2W0FB 5EU5A 3U7YH 4KK5D 1F6AA 4ODVL 2BNQD 2EYTB 2NNAB 3PIQA 2ZCHH 2VLRE 4D0CA 3LRGA 5CEZL 4MCZB 3CFCL 1FCGA 1DEEA 4KKNA 5GRUL 1VFAB 4RAHA 5FM4A 1AKJD 4P5MA 4RMWA 2AJUH 4M7KH 2YHGA 2BZDA 1KIPA 1FV1B 4QNPE 5CBEB 1BQHA 1HHKA 2Q7YA 5DMGC 4A6YL 2DQJH 4O51A 1UGNA 5HD8D 3RIFK 1RURL 4JY6B 1CR9L 3S9DB 5CEZD 1V5JA 4RGMC 3L95A 1XH3B 2BMKA 4QRUA 1ONQB 4PJGE 2BOCB 3HCVB 2G2RB 4O4YL 5JA9A 1NEZA 1WBYB 1MUJA 5GGTH 4PREA 2F8VA 4PYGA 2J8OA 5D6DC 1HH6B 5JZ7D 3QEQD 3QQ4B 3OF6D 1YEEH 4EN3C 1OPGH 5DXWA 3QO1B 5J7CC 4M5ZL 4WY7L 3GBML 3STZA 4G8EB 2EICA 3FL7A 3PL6A 1WBZB 1GIGL 5CD3A 5DK0B 3VCLA 3KPQA 4KJWD 5HGGS 4D9QE 1CGTA 1CT8B 4IIQC 4OKVB 3O4LB 2H26B 1CU4H 3GJFH 4MDIB 4JN1L 3VFWB 3FO0H 4PD4K 1T22A 2M8XA 4KAQH 1AIFB 4G8GE 5D9SB 2K7PA 4BQ9A 1AHWA 1RZKC 2BVPA 4KZDL 3JV6B 3FFDB 1IGCL 3MV7E 2E27H 3OBAA 3E0GA 4QOKA 5DA0B 1IILE 1M1SA 5DFVD 5IROA 3LH2L 5LBSL 5C2BL 5IMOB 4RMRA 3PWJB 1IBGL 3O4OB 2X4RA 3I02B 4PJ8A 5FGRA 1KBGL 2DKMA 4PRPD 4PY8I 4Y16C 4NQSB 5GSVA 5KS9A 4TRPL 3R4DA 2B1AL 1NLDH 4WEBH 1NGXA 3N06B 5FO8B 1NC4D 2R0LH 3C87A 4Y4HA 3SDYH 5AG8A 1MLBA 1OCWL 3EDKA 4HKZA 4DK3A 5DK2B 3KJ6H 2FATL 5DD3L 1IAMA 3GB7B 4OZIE 1XGYL 3UPRB 3KWWB 1B0GA 3ZE0F 5J4MA 5HJ3B 5E8PA 1DE4B 1BAFH 3RUGF 5DMIH 3T1WA 4TTDC 2V5TA 3J7HA 5D6CA 3PXHA 1INQB 5SWSE 1I8IB 1JWMB 2X1PA 5DEGB 4JAMA 5LCVL 1NKOA 1G7HA 1U6AH 3C6SB 4KHTH 3BAEH 1TDQA 3D39E 3OKOA 4NO0A 1IGFH 5B3JE 3GRWA 4U3HA 3RWGB 4P2RB 5DYOA 3MV8D 4ETQA 1RHHB 1TJIH 3Q3GB 2EE2A 2XRAL 2F19H 2B8OT 2R4SH 1FFRA 3C5ZC 2ZJSL 3CDGA 3H42H 5C6PB 2BERA 2CIKA 2O93L 4Z0XB 3L3OA 4XVJL 4JFZL 2YMXH 1K5NA 1V7ML 2V9RA 4LFHG 2DI7A 2F5AH 4PLJC 4DOHB 1GGIL 4Z7VE 3QUMA 4YXHH 4F3FB 3QI9A 4BZ2L 3G04A 1A9BA 4WW2A 2R1YB 2DQGH 3O41A 1T03H 4U6XB 4M7JH 3MR9B 4HHAA 1KCVL 3RI5F 5EUKB 1L7TL 2P42B 4PGJA 2HJFA 5DK3A 3SKNB 3GSXA 5ENWA 3AB0C 2RFXB 4RGOH 2CR3A 4P5KB 1EJ6A 5HVGB 1QACA 2Z92B 4JO4L 1JPTL 4X80L 2XG4A 4HIXH 4M93C 4JN2B 5KW9H 3ZDXF 4CN4A 2AJZB 4X6CF 4WIQA 4XP6L 3CSYA 3ELAT 3MLSL 3TH3T 2D7OA 2QR0B 2Z9TA 1M7DA 4L4TD 1P6AB 1JNJA 1JPSL 2V7HB 5C08D 4U7MA 1JTPA 1ADQL 4UB0H 2EYRA 3RVWC 1KULA 1AXTH 3LV3A 5KSUA 3KPPA 2X4UB 3ORJA 1YUHA 1KELH 1S7XB 4M3KB 5MHSD 3SGKC 2BNUB 3I2CH 3TPUA 5I1EH 4Z7UF 1T0MB 2O5XL 4LPVA 4OZGE 4RX4D 4XHJC 4JFHE 1NAMA 4XVSH 1A4KB 4HPOH 5ESVB 4OD2B 4KK6D 1OW0C 4DN4L 1EJOH 4NT6A 5IMMB 2OJEB 3BUYA 4ONFL 1SM3H 1DVFC 4MD4A 3NA9H 1QSEA 4JY5L 4MB4A 3N50A 1N6QL 3WJLA 2Y72A 3FAXA 3FB7A 5HDBE 2NX5E 3TGXA 2XZZA 3AREA 2P4AB 4MXQC 3RJQB 3HI6H 1ZLSL 3LQAC 1P6FA 2IBBA 3D48R 3ARGB 3H9HB 5DQ9B 1HDMA 3M17A 1UM6L 2XKNB 1QLFB 3NPZB 1BF8A 3EYUL 3KJ4B 3IVKA 2APXA 1RSFA 4P57A 3SGEH 1IC1A 1JHLL 2WUBH 4EXPX 2HWZL 1AE6L 1Q9WB 1QEWA 4BZYA 1M05A 3BEWA 4P46A 5TH2A 4N0UB 5IK3B 3RUGA 4XCFL 3MRDB 3C2SA 4F15B 4P3CL 4X6FB 4BYHA 5C0AE 3BPLC 5IB1A 3PE9A 2C4FU 4D0BA 3DETD 3IXTB 3AS0A 3MRNB 3FAWA 1N2RA 2NW2B 4PUBL 2P8MA 2OXGA 3WFDH 4ZMAT 3AC0A 1C8PA 2NY6C 4LNVA 3KPMA 3U0TA 2HYMA 3QJFB 4C56A 5IMLB 4IDJH 2F54B 4CVZB 4U3XA 4G9DA 5LAXB 1JGEA 4F7PA 4KWUA 3E3QC 5DWUL 4P9ML 4B0MM 5FM8A 4BSWB 2VDKL 3M1BB 2JJVA 2HKFL 5E2UH 4M62H 3WXVH 5IESL 1CLOL 4Z77A 5I1IH 1BJMA 4YHLH 4FQCH 4J1UA 1X7QA 2BY2A 1HINH 2W0KA 5F9JB 1LILA 4MX7A 1CFVL 1A6AA 1RULH 4JREC 5I2IB 4NWUL 3LEVL 3TNNA 3LIZH 3GMLB 5GRJL 2HRPL 3HUJB 4LLUA 2UYLB 4TUJA 4S1QL 3O3BB 3N1GC 4JKWA 1CXHA 2FR4A 4NBXB 5DMGD 5I1GL 3ZL4L 1IJ9A 4F2MA 4QTIH 2XWBA 4FQQA 2DKUA 1I1AB 3HE7B 3NCJH 2R4RH 2BOBB 3DRQB 4X6CA 2P5WB 5D5ME 3WEXA 4F33B 4M8VA 3VFMA 1JRHI 2E7LC 5ETUB 4HG4K 3I6LD 4LVEA 4ODSH 1K4CB 4Z5RB 2QSQA 1KENL 5KG9B 4GW4A 1RQ5A 1LQSR 1N7MH 1RZGB 3BRGC 5H2BA 1HSBB 3NCFB 4S0TD 5BRZD 2VR4A 3I6GB 1DEDA 4OZHF 4EN3D 4E41A 4H0HB 1IGYA 1RZKL 1CGYA 4YDIL 3U79A 4F8QA 2VJXA 1KB5A 1MHHA 4MJ4A 5TE7H 2Y4SA 1KTDB 3UPCA 1I7UB 4M6OL 1KPUB 4Q6YA 5CILL 5DEZA 3OJVC 5DUMH 5JQ6L 1IM9B 1WCQA 5EO1A 4KZEH 1MVUA 1ND0A 3BH9A 1C1EH 2BVUA 1CGUA 2CLZA 4H26B 3ZKXB 1RMFH 4QRRE 4OZFB 3O2WL 1CL7I 2X4NB 3QIUB 2DWEB 2FLBT 4WI3A 4LCUA 5FGBC 3RGVA 3EYOA 4LPTA 3SDCA 2EDJA 1NGPL 2F58H 3MV01 1T89A 1BD2E 3QFJA 4YH6A 3S5LB 1ZT7A 3WIIL 4QHUB 4PJAB 4NCC1 4WHTA 5EPMB 2IAMC 5D72H 1CVSC 1T83A 4OLZH 3L7FB 2JB5L 5F8QC 3LMJH 5GZNC 1MJ7L 4H5SA 3PHQA 4OSUH 4KMTH 2Y1VA 4G7VH 2QV2A 4YQXH 4KY1L 1LO0L 3V5DB 3QUZC 5I66B 4OT1L 4XPGH 3C9NA 4XTRD 1A9EB 4I0CC 1YZZA 3LN5A 1KG0B 4C83B 4NKMB 1TTGA 1LEIA 5IB3B 1KLFA 4TTDD 3U1SH 5HDOA 1I1YB 5ITFA 1OAZH 4NC1C 1WZ1H 3V6BR 2XG5A 1FVEA 3BGFB 2DQHH 1A7OL 1UADC 5EZJB 4BJLA 1UB5B 1F00I 4WO4C 5HYEA 3K8MA 4JDZA 3CDCA 2DLEA 3MO1B 5DGQA 1ITBB 2RJMA 1S9VB 4KFZC 5CJBA 4Z9KB 1FLRL 5FK9A 2APVA 4U6YA 2HA1A 5IJVA 4HFUL 4S2SA 2GYSA 2PUQT 3QEGH 4HS3A 2DQDH 3QDGA 4MB5A 3C5ZD 3TFKC 3CUPA 5EU6E 3PWUA 5EOCH 3MJGX 2WAHA 4ZXBA 4EBQL 3TYFB 2FL5B 2ZOKA 1NJ9B 4ZTOH 5DRWA 2Z0BA 4YPJA 2WP3T 3IFLL 1AO7B 3TIDB 1T3FA 3PNWA 1YA5A 3TCLB 4OLEA 1IC7H 4JM2B 4XPTL 1F90L 5FB8B 1J18A 3SDDC 9CGTA 1HE7A 4P23B 3ARRA 1I8MA 2W65B 1H3PL 4EIGB 4U6HA 2VXQL 3GNML 3DMMD 2VXTH 5L0QC 3OAYK 2OZ4L 2ERJC 2HT2C 2HG5A 4OCXL 5CGMA 5AUMB 2J88H 4RFEA 1NDMA 2OL3B 1YEIL 4ZSOE 3UC0L 3BQUC 5EH1A 5JDSA 3HAEH 5GISH 3QDMA 1PKOA 5KN5B 3SO3B 2OTPA 1KCRL 3PGDA 1QRKA 4JDVA 2PYFA 1SJVA 3AVEA 1ZT1A 5IJKA 4D8PA 4P2QA 1LP9B 2NY1B 4NO3A 4PG9B 5ADPL 5EORL 1JPGB 4NQTA 4HUMB 4XBPA 1MHEB 4NM4H 4JZNA 3RVWD 3EDEA 2Z4QA 3FHAA 1ROWA 1EFXD 2NXZD 3EAKA 3ZT5A 3SY0A 4FOMA 3IETB 1KTLB 2JCCB 1MSPA 4XP4L 2R2BA 3TA3D 2CK0H 3TO2B 4PRBB 1AD0B 5D7KD 3CVIL 4PRIE 1AD9B 4XHJD 5T3ZL 2IBZX 3ZE0E 5CSBA 4HK3N 1KCSH 4OM0L 1MOEA 1YN6A 1RUKL 4KROB 1LDPL 3FOMB 4PGEB 1WIUA 4Y19D 1C5BH 3LQAL 1DVFD 4HUWA 5JLZB 5BJTA 1CYGA 5JR1H 3W11C 4X4YB 5T3ZD 1OLLA 3CVHA 1M7XA 3QXAB 4JRXA 4RGND 2AK4D 1JNNH 5GS1C 3VXSA 4LQFL 2X1XR 5K9QG 4JHWH 1WTLA 5J13B 5T33H 4QKXB 3MMEB 4QLRA 2YBRB 2H41A 1G6RH 4UILH 5KVDL 2VC2L 2GFBB 2HH0H 5DRZA 3GK8L 3SE3A 1NMCC 3HI5H 1HN1A 3ZO0A 3AXLB