5DJ8A

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 34
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A01
1S7RB 4L5FL 3PF2A 4JRXA 3FQUB 4P2OD 1T5XB 4YHZL 1O0VA 3K8LA 3HR5A 5CBAB 4NRYA 2E7BA 4FQPA 3TNNB 3WJJA 3OZ9L 4PP1D 1MLCB 4WRLA 1K8IB 2A77H 5EOTB 1AE6L 2BHUA 1CD0A 1KJMB 1OSPH 1WT5C 1BEYL 3CZJA 4TN9A 2VKXA 5TQ2H 5JPMA 4U05A 2BY2A 5E99H 1ZWIA 1N7ML 4JGUA 2DM4A 2DMCA 3QG6A 5J1AA 3ARFD 2DD8L 2IF7A 1KB9J 4JM2D 1GZQA 3R0MA 1I3UA 4FP8L 5CUSH 5E6ID 2AJSL 1SM3H 1V7MH 4PJHE 3VFUA 5JPNA 4M1DL 4R4BB 1H3TA 5IESH 2PO6A 3FB8B 4EUPB 2XKUA 1INDL 1IFHL 2WUCL 2X4UA 2XN9B 4K3EL 1LNUA 3IDNA 2AEPH 4YE4H 1J0ZA 2D4DA 4JM4H 3KPRA 1YDPB 3QQ4B 2JLLA 4HK0B 3UBXB 3CPLB 4GRWB 4M7ZC 3KJ4B 2D0HA 1EO7A 4NO0D 3MCLH 4D0BA 4YAQA 2WIIA 3B9VA 4QTIL 5HGHB 2FO4B 5SV4A 4KJPC 4OB5L 1BBJB 1I1AA 2IBGA 1EFXA 4FXLA 5FM8A 3A0OA 4E0RB 2R69H 2C1PB 5C2BL 1DL7L 1T3FA 4LMQE 3WS6A 4G6AC 3QDMB 4YXHL 2J4WL 5GGUA 4LGRB 2BDNL 3Q1SL 4NHUB 1NL0H 3L9RA 5H94A 5HGDB 5GIRB 5A16B 4BFIA 4JR9H 2EYSA 3AY4C 1KT2B 3QEGH 3FO9B 4OFPA 1HH6B 5D7JB 3RY5A 5FO9A 5HY9A 3S36H 3HLAB 5FYLH 3GSWB 3G6AA 4MNGA 4ZUUB 3QUXC 1YEGH 2BOBB 1SYSB 2YXFA 3QPQC 5JUEL 3SCMB 1EXUA 5JXEA 4L9DA 4RA3A 5DK3A 1BD2A 3DRTB 4BQCA 1XH3A 2E7MA 4WY7H 4QTHA 1KELH 4XPHL 4IJ3C 3RWCB 1FORH 5C0GA 2NCMA 3VMPA 1MRCL 3KJ6H 5L8KB 5GS0D 3QB7C 3QEQE 1AHWC 1I7ZB 1VKXB 4IIQC 5BV7C 5FDWA 4PJ9A 3NA9L 3HZYA 5BRZA 4QRPE 3BT2H 5D7LE 1P9MA 4MSWA 5GJTH 3NIFF 3VGBA 4L4TB 2L4OA 3ARGC 2X4NA 2VISA 4C56A 1DLHA 5D8JH 3RX8A 3UEZA 1S3KL 5F8QC 4LLWB 4ODXA 4X7EC 1BZ7B 3A6BL 3QHFL 2ITCA 2FHFA 4D0CA 1XCQB 4JN2B 1YEIL 4PD4J 5JO5B 1I3RB 1JMZA 5I1LB 3IDUA 2P5EA 3DUSA 3AFLA 4OZIB 4FZ8H 5I8CA 5DJXB 1KCRH 1A3LH 1M7IA 4YBHA 2X9YA 3RIAF 3K2MC 3QEQD 1J0HA 4ONGH 4LPCA 3OB0H 4D8PA 2JB6A 2DI8A 3BISA 4KKNA 5GSVA 1WVZA 4ALAL 1BZ9A 4NQVA 2XWTA 5CZKA 1RAMA 4QRPD 5D7LD 3QBTB 5J8OA 1OP5K 4OCRL 2X2YA 3FN9A 5IB1A 2LVCA 2XZQH 3MV7E 5T1KB 2XA3A 1T2QH 1JYWA 1FNAA 1KIPA 1B6UA 5IW6A 5F9JA 1JNLL 4EVNA 5F1SA 4YIQA 2ADGA 1B90A 4X4XB 1UM6L 3MXWH 3DYMA 4LAQL 4M00A 4CVZA 4PJCF 3LQAC 2NTFA 1OD7A 4NKOB 4G7YH 15C8H 3DECA 4Q9QH 1U8IB 2P7TB 4Y89A 2AXGB 4HS3B 4TPRH 2A6IA 5I6XC 4PIRF 3I75A 3BQUB 4Y16A 2ARJB 1IC7H 1ONQB 5C3TA 3RWDA 1NCAL 4V1DE 1JTTA 3PGDA 2DM3A 5DD5L 4RWHA 2DKMA 3G6JB 2CRYA 5ELIA 3MV7D 5E9DB 3SDCC 4I3RL 5B8CA 3IJHB 4JN1H 3VWJC 2W0KA 2NY0D 3LRGA 4KROB 1IAKB 7FABH 1XMWA 3VXQA 3PWNA 4ONHA 1Q94A 2OXGA 5E1AB 3G5VA 3ZTJH 5I71B 2KBGA 1JJUA 1CF8H 2R9HC 2FATL 3ELAT 3PWJB 3UTTE 5ISZB 5IOPA 1IQWL 1HYRC 3T65B 4X4ZA 3L3KB 3RUGE 1CR9H 2EH8H 4B5EA 1YEJH 4X4YB 4V1DD 4QHLB 1MCNA 4N1EA 2Z31B 2DTSA 4LGPB 5IVXB 4WU5A 2NY1B 2DRUA 2P47B 1ROWA 1JL8A 1MY7A 1D5ZB 2VRAA 3GSVB 2ZNXA 2YR3A 5DUBA 1M7DB 1TVDA 3TPUB 4HUUB 2FIRT 5M7QA 4XH2A 4HIJB 4BSVB 2MCG1 5HDQH 3GBNH 3HAEB 4Y4HD 2CO6B 3K81A 4NQSA 1G7IB 3WDJA 3HPJB 1RI8A 3DSNA 3ZE1F 4L8SB 3OKDA 5F1NA 4N0YL 2A74B 1T7XA 5EC1B 3UTTD 5KZCB 1F8TH 2ADIA 1LD9A 3RVWC 2I9TA 3CXHJ 3STLA 3BKCH 4ZFFA 3L95A 5BOPA 3SDDC 3QDJA 1DBBL 4JO1L 1E4XL 3I50L 1XGRA 5EPMA 4ZNEE 4XX1E 2CH8A 1FC1A 1XZ0B 2NXYC 4GLRI 2X1OA 1IM3B 1GAFH 3TO4B 5HHME 3V4PH 3U46A 2H9GA 3QEUA 3F12B 4PJGE 5CEZH 5HYQA 5J6GA 1OPGL 3P4MB 3VFPB 5B38A 5I19H 2Q3ZA 3L5XL 4PRPB 1QKZH 5JHDB 5A3ID 5D6DA 3ZKMD 3BMVA 4PRAB 4TSCH 4FMFA 3ULSB 4L4VB 3NPZB 4JY6B 2UY6A 5CEXB 1CVSC 1X5LA 2YBRB 3BWAB 1DANT 1OY3B 3ROLA 3P9WB 1FN4B 2AV1B 1B2WL 2H3NB 4EDXB 1JK8B 4KTYA 3R06B 4FABH 2XQBH 5GGQL 3MLXL 4HF5H 2NY7H 1A9EB 4HT1L 3C2SA 1RJZB 4H5SB 4MHHI 4RNRA 4WUKH 1OGTA 2CMRL 5DJ6B 3V5DA 3MA9L 4G80A 5HHMD 2OR9L 4ZUTA 1TJIL 4KUZH 3NFNA 3OPZH 1D5BB 3FQTB 5E2WL 2CIKB 2GT9A 3D39B 3FB7A 3SE3C 3A6CH 3IS1X 4AH2A 1CFNA 3QFDB 4LSPL 3K2UH 5ERWB 4HGWB 2YS4A 1KLGA 3LN5B 5EU4B 1TVBA 1VFAA 4I2XE 1CQYA 1MCQA 1PKQA 3RWEB 2IAMC 2VDKH 1NSNL 3V5KB 3VD9A 4E42A 1FIEA 3GMRB 2B1AL 3EFFB 4KJPD 1CLZH 4AG4L 4BSJA 2QQKH 5FKPA 5E08H 3MJ7A 3AREC 5ENWA 4UTBL 3F6IA 1NKOA 3WFEH 1ZT1B 3BP6A 3QCUL 4G6AD 1CIDA 4R0LC 2J6EH 4OIIH 4Y4KC 5INCA 1FH5H 1C1EH 1NGZB 1HQ4A 4KH2A 4OBRA 1VEOA 4GH7B 4XXCC 1YZZA 3R1GH 3D69A 3T0WA 1NGPH 1ZGLM 1FFOB 4YEFA 5SWQA 4L3EE 1J0IA 5FO7B 3QUXD 3T09A 4OM0L 1I1YA 3DX6B 2AJ3A 3QPQD 1YEDA 1CN4A 2F5AH 4KJWC 4WU7A 4YO0B 4X98B 5EZJA 3LV3B 2IPKA 2MKLC 1EEZA 2DDQL 4XB7A 2EDEA 3OKNA 5GISH 4P2RE 4LKCB 1N3NA 4X9GA 5B39B 3STZB 4PJFE 2E7LC 2GYSA 2PKDA 4GLRH 2I9LA 1T1XA 1EJOL 4GQPH 3ZTJG 3BKYH 3PGCB 4JVUA 5LG1A 4N0CC 4GSDH 1PW3A 1T21A 3MOAH 1MVUA 4L3ED 3WE6A 5K9QG 1NLBL 3ARGD 5KN5A 3BZEA 4P48A 4PJXB 4Z7OE 2EDHA 1A7QH 4I77H 1U8OA 2D4FA 1WBYA 5EIIB 5J13C 4YHNA 1H0DA 1HWHB 3ULVC 2GFBB 4YGVB 3B8SA 4P2RD 3QUML 4KZEH 4LQFL 3O2VH 4EQ2A 4PRHA 4TQEL 4JFEE 3OGCB 3MGOA 2EDRA 4NN6B 4ZFZB 2BY3A 4LVEA 4YXKH 4CN6A 1QP1A 2EDFA 3PL6B 2A83A 1JPTL 3MXVL 5C92A 4HPOL 5FM5M 3KWWB 4O9HL 5CKGA 4GG6A 3C08L 4LRNH 3O4LA 2WQ8A 1OQOA 1SJHB 3MROA 3QCVL 4U6HB 2M8XA 3VXUA 1J8KA 1RK0A 2X41A 3O0RL 3E6HB 1RJCA 2VE6A 5I9QB 3VXPA 1BQHG 1M05A 1K3IA 3SGJC 3OHXA 5E7BA 4LPTA 3MRFA 4ZS7H 1WBZB 5EBMA 3UTSE 1CDIA 2B5IB 4F3FB 1EK3A 4KGJA 5EUKA 3VWKA 3FFCA 1KTDB 4H26A 2Q7YB 4JFED 3JV6A 3OJVC 2R0LH 2ITDA 5TQ2L 4OKVB 4NKMA 1BREA 3P9MA 5KS9B 5E99L 5EBLA 1N6UA 1TCRA 4RZCB 4OLXH 5CCKH 4GMSH 1OLZA 5I1EH 4JHZA 3I3DA 3DV6B 4JPWH 4MNQB 2HA1A 3SDCD 4MJ5B 4BUGA 1SM3L 1V7ML 4P3WA 3VWJD 4Z78B 5IESL 1IQDA 4KDTA 1BVLB 2EIZB 5FDYA 4J3OC 2AEPL 4YE4L 1L4IA 4CL7A 4X6CF 4JM4L 4ODWB 1KPRA 2E6QA 4Y7MA 3OXSB 3UTSD 2FH6A 4D2NA 2R9HD 5EUOF 4XWOC 5HBBA 4HFUH 3MCLL 5FGCE 4U4BA 1JE6A 4PG2C 4TUJA 4A2MA 1XF4A 3QDGE 3EIFA 5B3JF 5SX4I 2V17H 1J0KA 4I1NB 1RHHA 4EI5C 2R69L 4LCUA 1AD0B 3L6FA 1ITBB 1A6TA 3IDGA 3ZKSD 5FEBA 4CMMB 4Y19A 1NC4D 1I7RA 3CVIH 1XR9A 4JR9L 3D1MC 3C6LA 1EBAA 2FJHB 4WW2C 3QEGL 4FQXB 2P4AB 3C60A 4X9BA 4I3GA 1BQSA 1SJEA 4UOJA 1T1ZA 2X4QB 4P9ML 1B88A 4FQ1H 3RVWD 1S9WA 1EMTL 1YEGL 3QDGD 1F11A 2HVJA 5HHNB 3SDDD 2EC9U 5KSUB 2H6PA 5IMMB 1GGTA 4P5TC 3QAZC 5E0QA 1TENA 2H32H 1UG9A 4WY7L 5EIQA 1F4WH 5C07A 1NEZA 5I1KH 1RZ8B 1KELL 5L2KA 3BJ91 1FORL 3DARA 3KJ6L 5ICXB 1NQBA 1YEEH 2NXYD 3RQ3A 5D2NE 1JN6A 4LSRH 4NQCA 3FQNA 1CFTA 1ZHKB 1UA6H 3W0WB 4PGBB 3TBYA 3L7FA 5MERB 1NANI 2X4RB 3IU3A 3BT2L 4WV1A 3O2WH 2Y07H 3KNBA 5GJTL 4MJ6A 2W65B 2F74A 1UWXK 2YKLH 3BGMB 5D8JL 5IWLA 1A2YA 4G9FB 3KYKH 1K5NA 1BQLH 1OT1A 1A1OB 1CFQB 3MLYH 4U1JA 3RA7H 4HEPG 1PJ9A 5FO8A 5DSCA 3P9LB 3L3GA 2E9IA 1NDGB 4JFXA 5A2IH 1RIUH 1TIUA 3DROA 3Q3GA 1KCRL 5C08A 1A3LL 5C09A 3DX7A 4XNMA 1UVQA 5JR1H 1HIML 4ONGL 4GW4A 4WWKC 1T4KB 1PDKA 2AW2A 1PSKH 4Q9BA 3W2DH 1AXIB 1FZOB 1CL7H 2HTLC 3ZMRA 5K59F 4P3CL 5JXAH 5E8PA 1NCNA 2Z92A 4JRXB 5EFIA 5J06A 1JF1A 2XZQL 1JPFA 4HJGA 4GBXC 4PRIE 3HR5B 2JCCF 4NRYB 2CR3A 3MRQA 3MXWL 3BP7A 2WK2A 4B7LA 3U30C 1O5DT 1KIRA 15C8L 4G7YL 3Q2CA 2P8LA 3ZDXE 2IAMD 3NH7L 3VG9B 1W8OA 1KENL 5JOEA 5JPMB 4DKAA 1ZWIB 3QJFB 1KXQE 3MGAA 2FEDC 3I6GA 4TPRL 1A14H 4K2UH 1F90H 3QG6B 5J1AB 1IC7L 4LCWA 3ARED 1GZQB 2P46B 5JW4Q 3SE4C 1MCIA 5JPNB 3DXAE 3VFUB 4LVHC 4LMQI 3MO1A 2PO6B 4AJ0A 4H8WH 2X4PA 4Y4KD 2X4UB 3ROOA 5D70H 1LNUB 1IGCH 4HXBH 4NCC1 4PRID 3GM0A 3KPRB 4JN1L 2VQTA 1WWBX 4L1DA 2DBJA 7FABL 4WWID 4D0BB 4YAQB 5J6HA 4X7CC 3ZTNH 2WIIB 1MFNA 5E8EA 4FG6C 1MCPH 1E4KA 2PTTB 2VUOA 2KZ1B 4Q74A 4KJWD 4NM4H 4OZGF 1DVFB 5E6ZA 4KRNA 1I1AB 1EFXB 3ULVE 1CR9L 3MNZA 2EH8L 5F93C 1YEJL 1H3PH 3DO3A 3O3BA 3IVKA 3BIAX 3DXAD 1T3FB 3EZ8A 5KVEH 2NXZB 3EKCA 4YHIA 5T1MA 4RMQA 5GGUB 1QFPA 4MAYC 3MUJA 5F6HJ 3L9RB 5H94B 4BFIB 3FO0H 4N0CD 2EYSB 3B9DA 2J6EA 1CE1L 4Q6IB 5HY9B 5HDQL 3GBNL 3OKLA 3TBWA 3QUZA 3BDYL 3G6AB 4LPUA 1OTTC 5L2JA 3MRRB 4LHUD 5EA0H 1DZBA 4EOWH 2EIDA 4RDQF 4A6YH 1F8TL 1RIHH 3MNVA 5I30H 5J3HC 1EXUB 3QXWA 3ULVD 5EZIH 5HPMA 5HYFA 3QIUA 1Q1JL 4W4NA 4QTHB 1U9KA 4E41A 3A6OA 1I9EA 5C0GB 2ZG2A 2H8PA 3N1GC 4DN4L 2EEBA 3QR2A 2FH8A 1B0GB 4Z7VA 3U0PA 4MLSA 5FDWB 4PJ9B 3HZYB 5BRZB 3VFWA 3V4PL 1GAFL 5GS1A 3NBNA 4MSWB 5DQJB 1XGPA 1AGBA 3TZVA 3AC0A 4C56B 2X4NB 2VISB 5CEZL 1DLHB 4Z7WA 2YD4A 5I19L 3O81A 1QKZL 4QXUH 4JQXA 4ODXB 1VHPA 4TSCL 3BJLA 1FV1A 1SY6H 2ITCB 4D0CB 2DICA 3MPCA 2QSVA 1FQ9C 1DBMH 3EBAA 1ZT4A 3LRHA 3DUSB 5E2UL 5I8CB 5D1ZA 3V8CA 4Y8DC 4FABL 2XQBL 2BVYA 1K4DA 4Z5RB 4D8PB 4HF5L 2JB6B 2NY7L 5HI5D 2X1PA 3M8OH 4TTDC 4ZO9A 3Q6GH 4NQVB 2XWTB 2W59A 1F3DJ 2VZTA 3HPLA 3IGAA 1GL4B 3GSNH 3MRHA 4X99A 1C08A 3SO3C 4KUZL 5IB1B 1A3QA 4NGHH 4OI8A 1W2KT 5IW6B 3OPZL 5F9JB 4EVNB 4YIQB 3OR7A 2ADGB 2E6JA 4OCXH 3MLSH 3S4SG 2NR6C 3UZQA 4CVZB 5FF6A 3A6CL 2NTFB 4PY8J 4QHKI 3K2UL 4OCMC 4PJAF 2G5RA 3CXDH 4XWOD 3S88L 4RISH 3NACH 1UH4A 4PJ7A 4PJDA 2A6IB 5HI3C 3I75B 4RFOH 4Y16B 2VDKL 3K8KA 2WUBH 3RWDB 3OJDA 3PGDB 5T33H 1CLZL 3KYAA 2QQKL 4EI5D 5E08L 4DCQA 1JGEA 5IW1A 3QWQB 1UACH 1P7KA 1KSRA 1KCKA 5DMKA 1A6ZA 4TNWK 3WFEL 2IBBA 4ELMF 5BS0E 3G5XA 4GAGH 2ZWLT 1FH5L 1C1EL 3PWNB 3VXQB 5F3HB 4ONHB 3VXSA 1Q94B 3ARTA 3G5VB 1I1FA 3MV9A 1ZS8B 4M7LT 3RPIA 1XF3A 5BXFA 1U3ZA 3R1GL 2JTDA 1NGPL 2NW3A 3MLZH 4Y5VC 3WJLA 2FBJH 3PQYE 3BDBA 3CFCL 1JI1A 3O3UN 2F5AL 4UDUB 2EDDA 4L9LC 1UM5L 5D71H 4K7PH 4P23D 3WXVL 3QNYA 4P5TD 4WU5B 2NY6B 5IHUL 1XCTA 5DUBB 4U7SA 3ALXA 3L5HA 3NTCH 5BS0D 1G6VK 4XH2B 2XXMB 3BHBA 3BKYL 2I27N 3SO5A 2XRAH 4NQSB 4GSDL 2VLRE 3VRJA 1QO3A 1NDMA 3OKDB 4RFEA 5F1NB 3MOAL 3ZKQD 1NGQH 1UWGH 2BNRA 1LD9B 3PQYD 2I9TB 4JQVC 3STLB 4ZFFB 1CFSA 4XT1C 3DHMA 1A7QL 2CDEB 3L95B 3QDJB 3D25B 3MLPA 1XGRB 2ILLA 4KZEL 3O2VL 4PTTA 2R0WL 1KYOK 2H32A 1WAAF 4WWKD 1NCUA 4PJAE 5DJZA 5J4MA 3U46B 3J7HA 2H9GB 2P1YA 3QEUB 2HTLD 4YXKL 1J1XH 1EEUA 2BJML 3B5TA 3I3EA 3QQNA 5HYQB 2VLRD 5B38B 1KFAH 1MCWM 1T7VA 4ZO6A 4NRXA 5FM4A 4CJ1A 1FL5A 3QIBA 1GRWA 1WIOA 2UZXB 1UCBH 4ISVA 3UC0H 4ZUWA 3RAJH 3RNQB 3THMH 1KLFA 4GBXD 2VXTH 1B9ZA 4KC3B 2PXYC 3ROLB 4K23H 1QLFA 3RTQC 1X6NA 5KANI 2EDQA 2VH5H 5D5MA 2HFEA 5D7IA 4ELME 4IRSC 3QUMB 2C9AA 4RNRB 1OGTB 4HGMA 1HWGB 2FEDD 3S4SA 3NCCB 3NPSC 3LEXB 4ORZC 3V5DB 4G80B 2R0LL 5C0AE 4PGEA 4ZUTB 3CFBA 5JLZA 3UTOA 43C9A 4HWBH 2Q76A 5KG9A 5MHSE 3NFNB 4BSWA 3MR9A 1NBZA 4MA3B 4OLXL 2CDFA 1CDBA 4GMSL 1EDQA 3HE6C 1TQBB 4ZAKA 2GT9B 4JPWL 5GGSA 1J10A 1IC1A 3FB7B 4AH2B 3LHPL 1CFNB 2IQ9L 3OB0K 1D9KC 1U36A 3FTGA 1ZANH 3HI6H 3GNMH 1KLGB 3D5OF 3U9UA 1TVBB 1AD9A 1IARB 4YWGH 3ZYIA 4U1SA 4FG6D 4LLVA 4EEEA 1B4RA 1PKQB 2ESVE 1JF5A 4GS7B 4E42B 4HFUL 2O26U 1IGFH 3SKJH 5C0EA 5H37G 1LGVA 4ETQA 4ODTL 2FHCA 5C0AD 3UAJC 4Z7QF 3MJ7B 1J11A 3RRQA 3ZHLA 2YPLE 5LJYH 5MHSD 4XPAH 2HT3C 3U6RA 2QADB 2X4SA 5ECJE 1DE4B 3BP6B 1T2JA 4MAYD 2HG5A 5IR1A 4XMKH 4KV5F 1HQ4B 1FPTH 3WXWH 2OXHA 1T83C 4NN7B 1IJ9A 1G84A 4LVOB 3CVIL 4KZDH 3D69B 3MOBH 2BZDA 5SWQB 3U7YH 3OMZA 1OTTD 4F7CA 1I1YB 2ESVD 4KI5C 1YC7A 3DBXA 3WN5C 2YMXH 4OFYD 2AJ3B 1YEDB 1NFDE 5J3HD 4P5KA 4WU7B 4FQ1L 5D7KE 5B21A 3ZZ1A 3HE7A 2VDQL 5EZJB 2V9RA 2IPKB 4O2FA 1EEZB 2A9NH 2YPLD 1RV6X 3OKNB 4NN5C 2FX7L 1N3NB 2WNGA 5FKAB 3WLWC 2Q6WA 5TJWK 1F4WL 2I9LB 1T1XB 2GEEA 5I1KL 2YN5A 4YK4B 3MRMA 1KACB 4U7MA 4BUHA 2APXA 1VENA 5INDA 4LSRL 4OFKA 4OCWH 3MOQA 4JPVH 1UA6L 1MVUB 3WE6B 4KTEH 5KN5B 3BZEB 1UH2A 2DIJA 4ZG1A 1EAJA 2I26N 3O2WL 2Y07L 3H7BB 3BKMH 1U8OB 1WBYB 3QRFM 2D03H 2YKLL 4PJIF 1NJ9A 1R3JA 3OV6A 5FA3B 4YHNB 1H0DB 3O8XA 3KYKL 4QY8A 2LFGA 3GSXA 3M1BA 1BQLL 4A6YA 4LARL 3MLYL 5LCVH 1YY9C 4PRHB 3U4EA 5JORB 1GJIA 3EOBA 3FN0H 3MGOB 4BFBD 2D7PA 4PTUA 5JW5A 4TTDD 5JR1L 2B20A 2ICWJ 2FIKA 4GRLA 3BRDA 4DAGH 2A83B 2CDGA 4HS8H 3X11A 1X5HA 1I7TA 1PSKL 3W2DL 4DOHB 4GG6B 3O4LB 1MQ8A 1HDMA 4JFFA 3BO8A 3MROB 4N8PA 3IYLW 3VXUB 4KKBC 4PJHA 5JXAL 5I66A 1RK0B 5IK3A 4ZS6C 2VE6B 3BH8A 1ZGLA 2V9TA 3VXPB 2NR6D 1M05B 3KAAA 3OHXB 1XIWC 2VXUL 3VD4A 1BIHA 4O2CA 1YNTA 5DHXB 4I4WA 1UCTA 2AJUH 3MRFB 5IG7A 5L6YH 1CLCA 5F44A 3WFHA 5EUKB 2DTMH 3VWKB 1SY6A 4XXDA 3FFCB 4H26B 3MBEC 3OJ2C 4LKXA 1CS6A 1T7ZA 3JV6B 3EOAA 5HI3D 2ITDB 3BX7C 2B4CC 4NKMB 1CDGA 1DBKH 3P9MB 1SVCP 1I8MA 4F57H 5EBLB 1TCRB 5IVOA 1A14L 4K2UL 1F90L 2E7HA 1YPZF 4NFDA 2OR8A 2BSSA 1AGEA 3GSNA 3DX8A 5JOFA 1IQDB 4H8WL 3PG2A 1MUJA 4HXBL 5CEYB 1JFQL 1KPRB 1UT9A 5JW3L 1WFTA 4F8TA 3LKRA 4IRJA 4NP4H 1GOGA 3WNOA 3ZTNL 2ZNWA 1LP9E 1I9IH 3RKDD 1MCPL 4NYLA 2HP4A 4TUJB 1NUFA 4FXKA 1XF4B 3OKYA 4IOFC 4LBEA 4D3CH 1NMCC 3JTTA 3BD3A 1Q38A 5HDBF 5KTEH 4NM4L 5F6HI 1BF2A 2VSDA 4W4OA 1RHHB 1QQDA 5ANMA 1P7QD 4LCUB 4Y8AA 2O61A 3L6FB 3P0VH 3PWPA 2BX5A 1A6TB 3IDGB 5KVEL 4Y19B 4U1KA 1I7RB 4X7FC 4LFHD 4OT1H 2BY1A 1XR9B 3FO0L 3C6LB 3BP5A 3MBXH 1S7WA 2QQNH 2EO9A 3C60B 2XWBA 2EDJA 2EDTA 1T1ZB 1D6EA 1S9WB 5EA0L 2LV4A 3O4OB 4EOWL 2XWJA 5GGSY 4Y2DC 1F11B 1ZV5A 2HVJB 4XX1G 1RIHL 5I30L 2A6JA 1CXIA 3DYOA 4JG0H 3KPSA 4N90E 1FGVH 4Z6AT 4J3UA 2H6PB 5EZIL 1LMKA 3GKZA 4UNTA 5C07B 4BQBA 3ULUC 1X9QA 2FYYA 3C5SA 5L2KB 4I5BA 1T1YB 2R8SH 1JUFA 1JN6B 4C4KT 1VFOA 4NQCB 5D1QC 3FQNB 1J7VR 5ID1A 4XVUC 1OCWH 3L7FB 3IU3B 4WV1B 4CU6A 3KNBB 4NFBA 2WAHA 2F74B 3NVQA 2P5WA 4OGAC 1A2YB 4M6MH 4KJYA 3S3SA 1K5NB 4QXUL 1YQVL 4D0DA 2PXYD 1C5BH 4N90D 4QOKA 3OB8A 4U1JB 2HJFA 5FO8B 3RTQD 3VFNA 3L3GB 5CLTA 4JFXB 5IEKA 4WEBH 3NCMA 5DGQA 4KU1A 4NZUH 2MCPH 3DROB 4IRSD 5C0IA 5C08B 3RY6A 4YBLC 5C09B 3DX7B 4XNMB 1UVQB 3LEVH 4YEEA 2XPGA 1JHKL 5MENE 2ZPKH 1IEBA 4IDLA 4GQ9L 2X9WA 3Q6GL 4DUVA 1WZMA 2DQFA 3DO7A 1KLUA 4PY8I 3GSNL 4ERSH 4F15C 5E8PB 3HE6D 2A0LC 1OWRM 5DDHA 3EYFA 2Z92B 1D5MA 5EFIB 1JF1B 4NGHL 4APQC 3CIQA 1JPFB 4HJGB 5KANG 3JUYA 5HDBE 3NCYS 1D9KD 2BVPA 4OCXL 3MRQB 3MLSL 3ETBF 4YHMH 1ZT7A 3GI9H 1W0WA 3H3PH 3BP7B 1KIRB 2OM5A 4KHXH 2P8LB 5C9JA 1UM4H 4KI5E 3R8BB 3T0EA 3CXDL 4GG8A 2BY0A 2CQVA 4RISL 3ORJA 3I6GB 3NACL 2EE3A 5MEND 4UAOC 4OCLC 3UAJD 1J86A 4RFOL 3LPWA 2G60H 3ALWA 4WI8A 2WUBL 4LCWB 1FSKC 3MRJA 1VB9A 3S8WA 3CDCA 2HT3D 1FYTE 4NKDB 5T33L 2D31A 2KQMA 3ARDC 3MO1B 3RGVC 1I1CA 3P3YA 2B1HH 1UACL 2X4PB 3ROOB 3LS5H 4L8DA 3MLRH 4WHYH 4RMUA 5IFHH 1HHIA 1JF6A 1CGWA 2R4SH 2BNQE 2NY2B 3QUYC 1RURH 5J6HB 5TH2A 1X5ZA 3CSYA 5E8EB 1E4WH 4KI5D 5JIIA 3UP1A 5EH1A 5FUOH 3X3FL 4CU8A 2ZOLA 4Y4FA 4WI9A 3MLZL 3SGEI 2FBJL 1AQDA 5T3ZE 1MJ8H 4Y5XA 3MNZB 4OSUH 4TSBH 1G9NL 3X14A 1IEAB 3O3BB 3T1FA 1FYTD 3IVKB 4K7PL 3WLWD 2DI9A 4YHIB 4QXWA 4Y5YA 1PAMA 5C8JA 5FGBA 3QISA 3OXRA 1DJSA 3NTCL 2DJSA 5I1HH 3FOMB 4PJCA 4N1HB 2BNQD 4OLVH 5HD8C 3TESA 3OKLB 3TBWB 5I74B 2XRAL 3QUZB 2MFNA 5L2JB 4LPVA 2J3SA 4YHKL 2J8OA 3SDXE 1PG7W 4M61A 3S3PA 1NGQL 1QSEB 1UWGL 3MNVB 3HG1E 5C2UB 5T3ZD 5HPMB 3QIUB 3DV4A 1F3DH 5FIEA 3P4OB 4U0RB 4AZ8A 5HYJE 3UPRA 4E41B 2AV7A 3UPAA 1YY9D 1ZXQA 1WWCA 4H0GA 4HCRA 2OZ4H 2H8PB 1UEMA 3WEXB 4Z7VB 3U0PB 1KC5H 3HNVH 5TDNA 4GKSA 1CXFA 1NUDA 1WICA 3VFWB 3ESUF 2QHLA 1NC2A 5D9SA 1AGBB 4G8GE 3TZVB 5AYUH 1J1XL 3CCHA 1WF5A 1WIUA 4Z7WB 5AAWA 1KFAL 1Z9OA 2C3VA 3IFNH 4KKBD 3D2UD 2VL5A 3HG1D 4ZS6D 4RAHA 3T3PE 3L5WA 3T0DA 2X70A 1FV1B 4F80A 1XIWD 2VXTL 3VXNA 3CDFA 1S9KC 3RI5K 1ZT4B 5F7NC 1NCTA 3FB6A 2V2WA 5HYJD 3GSUA 4K23L 3IKCA 5ILTH 3BYTA 5DMIH 3MBED 5D1ZB 5I73C 4GAJH 1K4DB 2VH5L 4YHYC 3ULVH 3OKMA 2X1QA 2EO1A 2Z8RA 3PHQA 5FYJH 4F8QA 3OQ3B 4CMHC 4LLDA 1CGXA 4OFVA 3HPLB 3IGAB 3MRHB 4X99B 5A40E 2HRLA 3BUTA 1C08B 4G8GD 4HWBL 1KB9K 4GUPA 3VGEA 5F7HA 3DJ9A 1FCCA 1ZOXA 4G8EA 3OR7B 3QG7H 1HSAA 4OI7A 1CICC 1TTGA 4EBQL 4XC3H 1QR1B 3P30H 3DIFA 1TQCB 1X7QA 4K7PY 4OLUH 5FF6B 5GXBB 1KEGH 2FO1A 5J1SC 3OKEA 1GGUA 1ZANL 3HI6L 2MTPA 3QXAA 4KTDH 3RDTA 1X5JA 1S9VA 4YWGL 1RIVH 5LVEA 2X44D 3C5ZA 1QFWM 4L3EA 4PJ7B 2OQJA 4F7MA 5FGSA 4IOFD 5K9KA 1IGFL 3SKJL 3OJDB 3HUJE 3SKMA 4DCQB 1JGEB 4NT6A 5IW1B 3HMWH 1LEGA 4DKEH 1WCBA 1P7KB 3E6FA 4XPAL 3ULUE 2YA1A 3SE9H 4PGJA 2F19H 1A6ZB 5CILH 3IU4L 3LKOB 1HXMA 1QVOA 4HK3J 2DLGA 2ZJSH 4KRPB 1YQ2A 4FTVA 2D7OA 4XMKL 1KEMH 3WXWL 3VD7A 3VXSB 1ZK9A 4OF6A 5DFVD 1X5YA 4NZRH 3L3OA 1I1FB 3MV9B 4TVPE 5GGVH 3RPIB 2OMBA 1XF3B 2EDYA 3UZVB 4IOIA 4F9PC 3MOBL 2NW3B 4UT9L 1NBYB 3U7YL 5SWSA 4Q9CA 2YMXL 4Y2DD 1S78C 5LAXA 3MNWA 5E2TH 5I18H 4FQIH 3T4AA 3N9GL 3Q0HA 3QNYB 4MJIE 1EIBA 2A9NL 4QHMA 1XCTB 3ULUD 5DD6B 3V4UH 3VG0H 1HKFA 2NPLX 4JB9H 3BHBB 1KNOA 2D7TL 5T1LD 5LGJA 1D3CA 4FOMA 1GGBL 4XVUD 4ONOA 1SMOA 2ICES 4TVPD 1EVUA 3VRJB 1QO3B 1NDMB 4RFEB 2R2HA 3MODH 3GBMH 2GKIA 4JPVL 5DJAA 4OGAD 5JMRA 4QXGH 2ADJB 5A2JH 1CFSB 5I15L 3BIKA 4U6VL 3BKML 2CK2A 3BPNC 3ARRA 3JSSA 1MPAH 2Y7QA 1EEQA 3OR6A 1KN2L 1U8JA 3DX9A 3FB5A 4MJID 1R3IH 2CIIB 4PD4K 3IB4A 5LCVL 3C8KB 3RPKA 2KDGA 4PTTB 4AK1A 2VKWA 5IMKB 5KSBF 1TCMA 1T0PB 3RHWF 4ZODA 2H32B 5DJCA 4Q7DA 5DJZB 1RUMH 1A6AA 1RZ7L 2X4OA 1EHXA 4DAGL 1RU9H 1OAKH 4PBVC 3O11A 1C5DA 4NRXB 4HS8L 1JRHI 2I07A 2A0LD 1FL5B 1HCFX 1T04A 3QIBB 4ISVB 3LPGA 4ZUWB 4FQJH 5TE4H 4APQD 4HAGA 3ZKNC 1KTKE 4JPKH 1V3MA 2XY1A 4G8IA 5DYOA 5IB2B 5D7JC 1V3JA 1SHMA 2FL5A 1C12A 5CGMA 3AXLA 4GAYB 3JV4A 1OW0C 1QLFB 1H8NA 1TTFA 4M03A 4HUXA 5ETUA 2AJUL 5L6YL 4U2YA 5D5MB 1WC7A 3X13A 9CGTA 3MRCA 1MQKH 2HFEB 5D7IB 3SCMC 2DTML 4FHBD 1MJJA 1F3JA 4PJBE 3S4SB 4HJ0C 1J8HA 2YUZA 4PGEB 5JLZB 3CFBB 4MDJA 2IH3A 43C9B 1JCKA 3BH9A 1QPXA 1DBKL 2UYLA 1IZJA 2Q76B 4F57L 3MJ9H 5KG9B 3NA4A 4BSWB 2BMKA 3MR9B 5EOQL 1FFRA 5FK9A 2CDFB 1P5UA 3ARDD 3QULA 2DOCA 4X83A 3RGVD 2PNDA 4ZAKB 3AS2A 5GGSB 2VDOH 3BD5A 4LHUG 3WIIH 4G6FB 1IGTA 3FTGB 3U9UB 4GKNA 1Y18A 3H6JA 1AD9B 3QUYD 4JRYA 2AEQH 3VJ6A 5IF0A 5L8LB 5J9PA 4U1SB 3GFUA 4NOFA 3CH8A 4NP4L 5C0EB 3CC5A 4Q2ZA 4ETQB 1I9IL 3GGWA 3QPXH 5E8DH 1CXKA 3EJYC 3T2QA 4D3CL 4JY5H 4HIIA 5KTEL 4MA8H 3U6RB 2KQNA 2X4SB 1S9YA 4DGYH 1IM9A 2AK4A 3WS3A 2HG5B 3D3VE 3KLDA 3P0VL 1SJVA 1X5FA 5IP4A 3C9NA 4JLRA 1BVKA 4ODUA 3EOTL 4CKVX 3D48R 1OAXH 3LKSA 4NNXA 5D2NA 2X1XR 5K9JH 5HD8D 4OT1L 1I8LC 3BEWA 4WFEE 3F7QA 1VFMA 2DLTA 5DGRA 4F7CB 3MBXL 4Y1AA 1YJDC 5JNYA 3DBXB 1CGYA 3WIFB 2CUIA 4TNWF 5IV2A 5DVKA 1CD9B 3NN8B 4P5KB 5A1AA 3HE7B 4D94A 2CLZA 2CK0L 1TDQA 2APTA 1C7SA 3CXHK 4O2FB 4PRDA 1U8PB 1SQ2N 1HHKA 4PY7A 4XNZC 4JG0L 3FAXA 5KVGH 1FGVL 5CGTA 2WP3O 3BQUC 2YRLA 2Q6WB 1KCSH 3ZDZF 3D3VD 4JZOA 2KL6A 3MRMB 3BEVA 2R8SL 5E2JA 5INDB 2VMFA 3H8NA 4X6CA 4C57C 3SBWA 1JRHH 1XFPA 3VRLE 4GW1A 4WFED 3ZO0A 2VIRB 3HCVA 5DLMH 2J7LA 1HXYA 1OCWL 4W6XB 5EUOA 4YLQT 2DBLH 5E6IB 4KROC 3TV3H 5CBEA 4N0FA 1R3JB 1BMGA 5I71C 3KG5A 3O8XB 4QY8B 4RX4D 4FQLH 5HHQA 1FL3A 3AM8A 4MQ7A 3GSXB 3M1BB 1C5BL 4A6YB 1YC8A 5DRWA 1ZEAH 3BE1H 3PHOA 3GB7A 3U4EB 3EOBB 3HRZA 32C2A 3EW3B 4WEBL 2J8UF 2ZSVA 2MCPL 2CUHA 4PTUB 5F9DC 5JW5B 2Z31C 4M7LL 2DQDH 4JCLA 1Y0LA 4HC1H 2OZ4A 2NY1C 4GRLB 2FIKB 1A21A 1JNHA 3LEVL 2CDGB 3H9SE 2ZPKL 4X7SH 3X11B 1I7TB 1I8KB 4CU7A 2VR5A 1WISA 4R7NA 5K9OA 5C7XH 3MLUH 1HDMB 4JFFB 3BO8B 4ERSL 2Y5EA 4PJHB 3DXAA 1CICD 3BH8B 3EDFA 1ZGLB 5BJTA 4XPBL 4O2CB 1YNTB 1QSFE 2FCBA 4K94H 4L8SC 5IG7B 1EO5A 1RUKH 1HNGA 4YHML 3GI9L 4Z76A 3WFHB 3H3PL 2AXJA 4XXDB 4NJ9H 3OJMB 4UBDC 4LKXB 4KHXL 4M6NH 4R9HA 3GMPA 1KTRL 4KK6D 4RDQG 3V0AC 1MWAH 4HG4J 4N1CA 3H9SD 4RQQA 4AL8H 2G60L 3QZWA 5DA0B 4OLWH 1WZKA 4QEGA 3BP4A 1MCCA 3FZUC 3ABZA 4ESKA 5MP6L 5DVOA 1PG7X 2BSSB 3TO4C 1AGEB 3GSNB 1AJ7H 3DX8B 5JOFB 4LSUH 2B1HL 1J05A 1BHGA 1MUJB 3MQIA 3GMMA 1F42A 4EN3A 3LS5L 1IAIM 1QSFD 3MLRL 3B5HA 1C8PA 5IFAL 1BOYA 4TUKH 2R4SL 2CKBL 2XN9E 5KOMC 2VSCA 3HB3C 1LO4H 4IRJB 3IAQA 5TDPA 3ZDZE 4JKMA 3S7GA 5JQHC 1E4WL 4NYLB 4FXKB 3IDYB 5FUOL 4LBEB 1S78D 1RULH 3JTTB 3UO1H 2E9WA 4GRWE 4X6FB 2V5MA 3VMOA 1AXSA 4N9GA 3SPVA 5ANMB 4OSUL 4RMSA 1FVDA 2O61B 4TSBL 1N2RA 4X9IA 3VFMA 4JGJA 3PWPB 2FDBP 2FR4A 5F88A 4QRSA 5DC9B 5DUML 2VQ1A 1CK0H 1F45A 1KG0A 2JCCA 1RZJC 3GJFK 2OTPA 5EIVA 2B39A 5I1HL 2R1WA 3BP5B 3QDME 2C3XA 2K7PA 1S7WB 2XN9D 5TPWH 3C5JA 1LO5A 1QFWH 3WNLA 3NGBB 1D6EB 1EHAA 3OG6B 2XWJB 4GOSA 2JK5A 4EI6A 2A6JB 3KPSB 4EXPX 1CI5A 3REVA 1EVTC 2VXVH 1ZLSH 4UINH 5TDOA 3W81A 3B8YA 4FXGA 1T5XA 2A9ML 2FYYB 3C5SB 4Z8FH 2GSIA 4G6ML 3K4AA 4F9LC 3QCTH 5CBAA 3T3MF 2OZ4L 4I5BB 4NQEE 5EU6A 1JUFB 3B43A 1MLCA 1X5AA 1X5XA 4PG2A 5EOTA 3WSQH 1GC1H 3FRPG 5ID1B 1KC5L 3HNVL 4YQXL 3QDMD 2EC9T 3ARQA 4OLYH 3WNPA 3FQWA 1XAUA 2GJ6E 4YC2C 2PCPA 5AYUL 3VDAA 3ZKND 3TH4T 3IFNL 5D7JD 3RWJB 1G7PA 4OZGA 4D0DB 1ZLUK 3RL2B 4L4TE 4QOKB 2WWMC 3FO2A 1C5CH 2HJFB 1KCLA 5DS8A 3VFNB 3K0WA 2CLRA 1Y6KR 3P73A 5IEKB 2FHBA 3SCMD 3CDYA 4WIQA 5C0IB 5ILTL 2FGWH 2RCSH 3EDKA 4NQED 5DMIL 1A7PH 1BECA 4HJ0D 4GAJL 2XPGB 3IDIA 3QWOA 5DQ9B 3ULVL 1VPOH 4MXVF 4OZIE 2HFTA 5DD3H 1IEBB 1WITA 5IBLC 2DQFB 2L0DA 3DO7B 3E0GA 4JFZH 3UTZA 1QR4A 4P23A 5DDHB 2GJ6D 1D5MB 2VZOA 4ZMAT 4PJEF 4Q9RH 3QG7L 2BVPB 4XC3L 2ZCLH 4L4TD 1ZT7B 4OLUL 2QKIA 4O2EA 1KEGL 4Y4HB 5C9JB 4NHUA 1MRFH 2CRMA 5HGDA 3P11H 3QIWA 1FLRH 3T0EB 4XCCH 4GG8B 3JBG7 3UTTB 3FO9A 2FBOJ 3L5IA 3VCLA 4AIZB 2P44B 3EJYD 3RUGB 4OAWA 3G5ZA 3MRJB 5CJ5A 3AGVA 5FYKE 3QXTA 3ARBA 5F3BA 2ZOKA 2D31B 4NN6C 4BQ9A 5FOBA 3HMWL 4DKEL 4JO3H 2AEWA 3MJ9A 3GEWB 3PL6C 3SE9L 2F19L 3CGTA 5CILL 4L8DB 4LL9A 3WL9A 3GM8A 2YOCA 1IT9H 1T89C 1HHIB 2ZJSL 4KDWA 1WTLA 2ICEA 2ED9A 2Z93A 5T1KD 5E9DE 5F9AC 1KEML 5I17A 2AP2A 8FABA 1S8DA 4MD5A 4NZRL 5TH2B 3CSYB 5GGVL 5C70A 3JV0A 5IW3A 5I9QC 1JHLL 4PJ8A 1MCJA 2ZOLB 4Y4FB 3W5MA 4F7EA 1AQDB 1BJ1J 4TNVF 2R0ZH 2B5IC 2C3HA 2ARWA 3AAZA 3X14B 5FYKD 2Z0BA 3T1FB 2F54A 5E2TL 5I18L 2RBLA 3HN3A 5ITFA 2G9HA 2V5TA 2XZAH 3BQUD 2SEBA 2A38A 4Y5YB 5DXWA 5LXGH 3EYSH 1S7QA 5C8JB 4NQTA 3V4UL 3VG0L 5JO5A 3OXRB 1I3RA 5IVXE 5DT1H 3O3DA 2EE6A 4JB9L 5E9DD 2DLHA 5AG8A 1KYOJ 4HMEA 5GRJH 5TGBB 4XC1H 2AJZA 4HW6A 4KROD 4M61B 3MODL 3GBML 1DCLA 5TE6L 4NC0B 1QTYT 4XZUA 5E8NA 2FWOA 3O2DH 4WI3A 4Z95H 4TRPL 3DV4B 2Q7NA 5SWZA 2WBKA 3UPRB 1MPAL 3SGKC 2AV7B 4BZYA 1MHHA 1R3IL 4BH8A 1F2QA 2D9CA 2ICWA 1H3VA 3CX5J 3EJZC 1DBJH 2Z31D 5CMAA 2NY1D 5TDNB 1ODAA 4GKSB 5BVJA 2VLKA 3F65A 5D9SB 2XXCB 1N7MH 5FOJA 3DI3B 4MA1B 3CCHB 1OAKL 2ARJA 1RHFA 1QPPA 2C3VB 1JYVA 2J88H 4PB0H 5KVMC 1VCAA 2VL5B 4FP8H 1F6AA 3L5WB 5TE4L 2KZWA 2X70B 4FQXC 3VXNB 3HHRB 4PRPE 5JHDE 3L3IA 3FB6B 2V2WB 5KZCD 1S5HB 3GSUB 5HHOE 2WM0A 3IKCB 4L4VE 3B83A 4J3VA 1MCEA 3QXUA 4UBDD 3TCLA 1DQLH 1IAKA 4X6DF 1MQKL 4MQXC 2EKJA 3UDWC 3JVGA 3PHQB 4LLDB 5GGVY 2AQ2A 4HH8A 4URTB 2MPAH 1NAMH 4MLIA 4OD2A 5C6PB 1BM3H 4J3WA 4GUPB 3MJ9L 5E1HB 3FZUD 4HC1A 3S5LA 5TF0A 4CN1A 5FAAA 1EAPA 4G8EB 4IJ3B 3TO4D 4P3DA 1HSAB 4X4YA 5C2BH 2J8HA 3IDXH 4U1LA 3PV7A 3DIFB 1X7QB 1EGJH 3KXFA 4XCFL 4RGNB 4UB0L 4PRPD 4IIQB 3WIIL 3OKEB 4BQ6A 4Z7NE 5JHDD 5JIKA 1C16B 2BDNH 3QXAB 5HHOD 3CMOH 3D39E 4HUUA 4QT5A 3RDTB 1S9VB 3HB3D 4L4VD 1MF2H 2AEQL 3C5ZB 5EWIH 2LQRA 4L3EB 4UIMA 3OKOB 2J2ZA 2MQ3A 1K85A 5DEGA 2XTJC 5K9KB 1FNGA 5JDSA 3HPJA 1WAAA 4H1LH 3S34H 3ZT7A 1N64L 4ZQKA 1W0VA 3SKMB 3QPXL 3KYNA 4NT6B 1LEGB 4JY5L 1WCBB 3E6FB 4R97B 1MWAA 4OBSA 3MV8A 4PRNA 1YMHA 1HXMB 1QVOB 1W72H 4NCC2 2QQQA 4ODSH 4DGYL 4XPHH 3INUH 4HMDA 1N0LA 4FTVB 5SX5H 4E9LA 4HBCH 3VW3H 3L3OB 4JDZA 3C6SA 3D39D 3ARUA 1OAXL 2EE9A 1JBJA 5K9JL 2OMNA 2VLJA 2WINA 2JELL 2XKNA 4IOIB 3NA9H 1OGAA 4QRRE 5SWSB 4MVBC 3WJJC 3MNWB 5J57B 1RZFH 3OTTA 1S3KH 3T4AB 3WUZA 5JIHA 1IGYA 3VG9C 3SOBH 4PRAA 3A6BH 4HIEA 4QHMB 4ZTOH 5KVGL 3ZDYF 2PF6A 4PP2A 4OGXH 2YBRA 2HT4C 5F1IA 3NFSH 4C83A 1KNOB 2VYRE 4FA8A 1IAIH 2PO6C 1A9EA 3NAAL 1A1NA 4ALAH 1JRHL 2Y72A 5ADOH 2R2HB 4X6DE 5DJAB 5DLML 4QRRD 2ZZUT 1MCDA 1YNLL 2DBLL 3TV3L 2M1KA 3BIKB 5JTWA 5D2LF 2Y7QB 5DF0A 1XF2A 3OR6B 1U8JB 25C8H 3DX9B 3FB5B 1LDPL 4FQLL 1TPXB 4PJXE 4HV8A 4LAQH 3WFZA 1A7RL 5I2IA 1ZEAL 1I1AC 3BE1L 4QRUA 4Y5VA 1VGKA 4K3HA 5DJCB 4LDOB 1A6AB 3GIZH 4K3DH 2DQDL 2X4OB 2P43B 3LS4L 1AGFA 3VMNA 3WS6C 2NXZC 2IJ0C 5IBLD 4WEMB 1ZHNA 4FQCL 3O11B 1C5DB 4BK4A 2I07B 1T04B 1G6RH 5CAYB 2R23A 4GMTH 5C7XL 1QFUL 3MLUL 3T04D 4G8IB 5DYOB 1YEFL 2VAJA 4IM8A 1U6AH 2DJUA 2FZ3B 2FL5B 1C12B 5E94A 3AXLB 1R6VA 4M9PA 3JV4B 5CHNA 5DMYA 4HUXB 4K94L 5ETUB 3B9EA 1RUKL 5LKNA 1WC7B 3X13B 3MRCB 3WO4B 5ALBH 5F7FA 3REWA 5JXEC 1R5WA 4OGZA 1MJJB 4JO4L 1J8HB 5JW4N 2IH3B 3BH9B 3QDGB 4POZC 2UYLB 5CJXC 5FO7A 3U1SH 3BESR 3GJEA 2BMKB 1MWAL 3SDDB 5FK9B 2OJZH 5HDOA 4AL8L 1JGLH 3QULB 3CSGA 4OLWL 1JPGA 5KS9E 2FSEA 3RZWA 5I1DA 1AJ7L 3ES6A 1P84J 1P9MC 4G5ZH 2DS4A 4LSUL 4PJIA 1G7QA 2NXYB 3O6FA 3PXHA 1BJ8A 4GKNB 1Y18B 1A6PA 1UWXH 2F58H 4JRYB 2XNAA 1M71A 5J9PB 5GS2D 5MEQA 2RJMA 4LSTH 2YD1A 1LO4L 5I8OH 3CC5B 1WCQA 4Q2ZB 4CADA 1A4JA 3GGWB 2HJLA 1K8DA 1RULL 1OL0A 4HIIB 1MAJA 5HJ3A 1KTLA 1S9YB 3STBA 3ME0A 3S97C 4ZOAA 1IM9B 4M3KB 3WS3B 1FBIH 4OZHF 4YFDB 4FN0A 3C9NB 3VI4E 2M2DA 4JLRB 1BVKB 4ODUB 1D6VH 4P0DA 4JKWA 4NNXB 1AKJA 3LKSB 3MA7A 4HXAL 5D2NB 4MNQD 2BSRA 5BVPL 4NJAH 5FV1L 3I84A 5I1CL 5EORL 43CAA 3AB0B 4Y1AB 5JNYB 5TPWL 2MHAA 4YDJA 3ZE0E 1JIBA 5IV2B 4U6YA 1QFWL 3PV6A 1OPGH 1FRGH 5EZLA 2CLZB 4N9OB 1QLEH 4PRDB 3H9ZA 3W9DA 1HHKB 4PY7B 1N59B 3LDBB 1YPZA 2QTEA 4MX7A 3KLSA 1DQTA 4Y16C 1ZLSL 4UINL 3EJZD 4G6JH 4Z8FL 4ZSOA 4JZOB 3U2SA 4NRZA 1TFHA 3IXAA 4AY0A 2Q8BH 4YXLH 4X6CB 1N5YH 1EPFA 2Q7YA 2CMRH 4GW1B 3WSQL 5B8CC 1GC1L 3JWDC 3HCVB 3NCJH 3ZT5A 1KJ2H 1HXYB 4P9HH 2CO7B 4OLYL 4RIRA 2R4RL 4DEPB 5CBEB 1G7LA 3DWTA 1SEQH 4L3CA 2LE9A 3O6LL 4JKKA 3VI3F 1Q9LA 4FQXD 2H26A 2R29H 2IPUG 5E2WH 1TVHA 5HHQB 3DGGA 3MRPA 1FL3B 1EEYA 2AERT 4U1GB 4CN4A 5DRWB 5GGTL 3W39A 3O2DA 2V5RA 3GB7B 4G9FE 3LPFA 3HRZB 3K74B 2ZSVB 4PPTA 4MQXD 1P7HL 3AS1A 3QEHA 3I6KA 2RCSL 2XTJE 1X4YA 1Y0LB 3OXSA 2GUOB 4DZBA 1A7PL 4G3YL 2NY6C 4JM2F 2V2XA 1VPOL 12E8H 4IOSD 5DD3L 1H15A 1BGXH 1I8IB 4R7NB 4PYGA 4AG4H 5K9OB 3VGAB 2F8VA 4JFZL 3DXAB 5F6IB 1FHGA 1CXLA 4UTBH 2FECI 4KVCH 2LAGB 2Q8AH 5F8RC 3M17A 3VGHA 5BJTB 4PLOB 2FNBA 4XNXL 4XVTH 1QRNA 4Q9RL 1B3JA 3WNKA 1X5KA 1URLA 1RZGB 4LSSH 3DSFH 2ZCLL 4Z77A 4ZOEA 4JRXE 3CFIC 4M48H 2WSKA 5EBWA 2HH0L 2EXWC 1MREH 3IETA 4CMMA 4G9FD 5IHBA 1KPVA 4WTXA 1MRFL 4HLZH 3GMPB 3UBXI 1B4JL 2XTJD 4HKXA 4XCCL 4LOUC 5J89A 1F6LL 2W07A 4RQQB 4MDIA 3QZWB 3VGDA 2VZ3A 5DHVH 3BP4B 1LWRA 3CH1A 3A67H 2C3WA 5GRUH 1HYSD 1NAMA 1IE5A 3E1F1 2F53A 1L7TH 3MRGA 3SY0A 2Z9TA 4JO3L 1J05B 2YPKA 4R6UA 4XP6H 5D6DC 3BAEH 3DRQA 4JRXD 1R0AL 4OLZH 3BPOB 1U0QA 4BH7A 4NIKB 5TDPB 2X6MA 3KPRE 5CLWA 3RNKA 1MCWW 2PYEA 5E95B 4MVBD 5HDLA 4LEOA 3LEYH 5BZWA 4MCZA 4J3XA 4PGBA 4PB9H 1ZMYA 1OTSC 5MERA 1YECL 2MJWA 1AXSB 2NX5A 1NLDH 1EX0A 4N9GB 5J11B 1RZKC 2R0ZL 1L0YA 2DYPA 3SPVB 1FVDB 4HBQA 1N2RB 1CGTA 3VFMB 1U8HA 4H1LA 1N0XH 2FR4B 4QRSB 1A1OA 2HT4D 1J1PH 1KG0B 1YEKH 5LXGL 3P9LA 3EYSL 2JCCB 2ZP0T 4TQEH 2PO6D 2R1WB 5DT1L 1OAQL 1TQBC 3IFOA 3VXRA 3EGSB 3C5JB 2FEEL 5GRJL 6FABH 3ARYA 3RJQB 3KPRD 1ZSDA 2IFFL 4MWFA 5HYSG 4KKLC 3CUPA 3RWIA 2JK5B 5L0QB 4EI6B 2CXKA 3QCVH 3KGRA 3O2DL 5EN2A 3VFOA 3REVB 4MNGE 5EBGA 2OSLA 5BW7A 4Z95L 1L6ZA 4GS7C 5TDOB 3MFFB 4PBWD 4FXGB 2GSIB 1G7JA 3E2HC 3BPLB 1I1AD 4ZFOL 1EFXD 1BD2E 2IBZX 4M1GL 5EU6B 1RUQH 4DZ8A 2I25N 1DBJL 2PTUA 1ORQA 2C3GA 2QADC 2NXZD 1A64A 5AZEL 1BFTA 3QJFA 3FQWB 2PCPB 1I4FA 4M02A 4NN7C 2Q1EA 4LVOC 2J88L 4PB0L 1UYWH 1G7PB 4OZGB 1OLLA 1ZHLA 2Z8VC 1M6OA 4OV6F 3FO2B 5DJ8A 4C56E 3CX2A 5DS8B 1QLRA 2CLRB 1WTGT 4NWTL 3P73B 1CXEA 3TIEA 4QGYA 4WW2B 2COQA 4WI7A 5JXED 2X42A 3MYZA 2QHRH 1BD2D 4ZPTA 1DQLL 4CRPA 1QACA 5LGKA 2RIKA 3IDIB 3QWOB 2P5EE 1UB5A 4P4KA 4POZD 3IXTA 2PTTA 3FFDB 3L3HA 2QV2A 2MPAL 1NAML 3UTZB 3UMTA 5I76A 4JZJC 4P23B 4YK4C 1BM3L 1WWAX 1DVFA 2P24B 3QAZB 3D18A 4J3TA 4MS8C 3LMJL 2VDNL 1BJ1H 2YWZA 3IDXL 1G6RA 4UNUA 4C56D 4X5WA 1EGJL 2QKIB 4JKPH 4JANA 4LCIH 2ENSA 4O2EB 4XCYA 3TBVA 3UCRA 5HTSA 1I85A 3CMOL 2HLFC 4WUUA 3QIWB 3QYCA 1MF2L 5EWIL 3N1MC 4WVRA 5CINL 3VCLB 4Q6IA 2P5ED 4YBQC 2Y23A 2IMMA 4OAWB 3G5ZB 4P9MH 3MRRA 3S34L 1EMTH 1JZ7A 3ARBB 5F3BB 2EH7H 2ZOKB 4PREB 1KBGH 5E03A 5FOBB 4P5MA 1ORSA 1PBYA 2DQEL 1AFVL 2B4CL 3GZKA 3WL9B 1FNSH 1W72L 2BSTB 4ODSL 4YDKL 4QNPE 3INUL 2ICEB 4YHPA 2Z93B 2NW2A 1D7FA 2OI9B 5D1XA 5C0CA 5I17B 3HZVA 4HLZG 4HBCL 8FABB 1S8DB 4MD5B 3VW3L 4H88L 1B0GA 4O02H 4OFDA 4PJ8B 3RUGF 4F7EB 3JWOH 3T0VA 5AZ2H 1DR9A 5DQJA 5CWSB 1L9MA 3WIHL 2NY5C 3AAZB 3VWKC 1RZFL 4Y0GA 4PG9A 4PS4L 1UADC 2F54B 4JHAH 5IJVA 5ITFB 2G9HB 4Y16D 1IEHA 1ZKAA 3SOBL 2SEBB 1CFBA 4ZTOL 5HYSA 2DM7A 1S7QB 2CRZA 4L29A 4OGXL 2VC2L 4IRZH 4AT6A 3O3DB 3NFSL 2EDKA 4PJAB 3JUZA 1IAIL 1HIMH 2AJZB 4Z5RA 2VDRH 4KDTC 2OCFD 4BYHA 4EQ3A 3MYJA 5ADOL 4R4FH 3ARSA 3L3JA 1ADQL 4P3CH 4XZUB 5E8NB 2FWOB 2N7AA 1A6WL 4OCYH 1J0JA 1MAMH 3JXAA 3B5GA 5SWZB 1BJMA 4ZYKA 1ERNA 4O4YH 3VFVA 4IMLA 2AEIT 25C8L 5D6CA 1MHHB 4BH8B 5C0FA 2ICWB 3SE8H 5GPRA 3HC0A 3QDJE 4ELMB 1Z3GH 5CMAB 3RY4A 2OJEA 2NY6D 3NH7H 1AIFB 5BVJB 4PJGF 1KENH 1U3HC 4NKQB 2VLKB 3GIZL 2XKSA 4I9WE 4K3DL 1CU4H 5L7XH 2ORBH 5F9OL 5EDXA 3QFJE 1BQUA 1G6RL 4G7VH 4GJTB 1F6AB 4GMTL 3ZLQC 1WIPA 3C6LC 2LU3A 1KJ2A 2UUDH 2E7CA 3HC3H 3C60C 1QFHA 1U6AL 3L3IB 1SBBA 4TVPL 3N06B 2EXWD 5J0BA 1FP5A 4NBZB 3O4OC 4CBPA 2X89A 5E5MB 3TCLB 3TIDA 2LVEA 4XPFH 4IMKA 2G5BA 3QDJD 5ALBL 2APVA 5DRNA 5F3HA 2HLAA 1ZS8A 4LOUD 3DVGB 4F58H 1F97A 3KPQB 2HJKA 2MWCA 3AMLA 2HRPL 2RR3A 4I9WD 4OD2B 1OB1A 3MRLA 1PZ5A 2E6PA 3U1SL 1OT2A 5JHLH 1PKOA 1KIQA 3MUY1 3S5LB 2OJZL 3QFJD 1EAPB 1G0XA 1JGLL 4P3DB 2LAAA 4K71B 4UDUA 1F4HA 4U1LB 3CD4A 3KXFB 1PG7H 5B22A 4YFEA 4XCNA 4WV1C 3HA0A 4G5ZL 3UBXG 1Q72H 1QBAA 4QT5B 1Z9MA 2F58L 4G9DA 4P59L 1CE1H 5D72H 4UIMB 2YA0A 4LSTL 5KSBA 5A2LH 3NZ8A 5DEGB 3BDYH 1FNGB 5I8OL 5JDSB 2CUMA 1OTSD 4ZQKB 1W0VB 3P40A 3KYNB 1PKQE 1BX2A 1RMFL 2RQ8A 2VUYA 5AWNH 1BVZA 4OD1H 5D96B 1MWAB 4Z0XA 1Q1JH 2R1YA 3MV8B 4PRNB 1A9BA 2CDEA 1YMHB 2P8MA 3WFBH 3GMQA 3V2AR 4M1CC 2JB5H 3D25A 1FBIL 2QJDA 1G0DA 1TZHA 2GQHA 4DN4H 5E4EC 1R3LA 1D6VL 1Q9OA 4JDZB 3C6SB 3WFDH 2MMXA 2VLJB 2WINB 2XKNB 2PUQT 2BCKA 5IROA 4NJAL 1OGAB 2J12B 4HIHA 5EO1A 4KKLD 2ZUWA 3VXOA 4J4PA 4KQ3L 4XI5C 1FRGL 1AO7A 1QLEL 1IGYB 1E6JH 2ENYA 3RNQA 4PJFF 3RZCA 2JJSA 2VDML 1H3UA 4HIEB 2ADFH 4PP2B 1UH3A 3UJJH 3TVMA 3K3QA 1T80A 2IPTH 5F1IB 5E2UH 4C83B 4X0KA 3RVUC 4DUXA 4G6JL 1G9MH 2QADD 3U48A 1U93A 2Q8BL 1MY5A 1MHEA 3E8UH 3QUMA 4YXLL 1A1NB 1N5YL 3EYUH 4NC2B 4Z7OF 3LEXA 3NCJL 1KJ2L 3TFKC 4P9HL 5DTFA 3CLFH 5BOZG 1A4KA 2NY2C 4EZMA 4MA3A 3AMKA 2EXYC 1SEQL 2G75A 1XF2B 3UTPE 4WTZG 5HXMA 4PV8A 5KSAA 2R29L 1RSFA 2IANA 5DVNA 1E4KC 2V2TA 4HV8B 1M7XA 2BVEA 5FYLE 2EYRA 3U0TB 3TWCH 4X8XA 5I2IB 5A43C 3BN3B 4QRUB 4Y5VB 1VGKB 3DMMA 5FXCH 3T0XA 3S88H 4PR5A 2MSPA 1YEHH 4PRHE 1AGFB 4MJ4A 4OGYH 1ZHNB 4LIQE 12E8L 4QHKJ 2R56H 2G2RA 4DVRL 1WFUA 1BGXL 2AK1L 2R23B 4MS8D 2XZZA 2A6DB 1OAUL 4DOHE 4GG6E 4KVCL 4ZOCA 5E94B 5I74C 3O4LE 2Q8AL 3QUZC 2JJTA 3UTPD 5CHNB 4XVTL 5DEFA 1DE4A 1KUMA 1J0YA 3VXUE 2WBWB 4LSSL 2OS7A 3DSFL 3IRPX 4LGSB 5FYLD 5FHAH 4M48L 2HLFD 4X4ME 1MREL 3REWB 1R5WB 3LN4A 3QIUC 4KK8C 4CVUA 4YJZL 4YBQD 3NZHH 1GOFA 3FL7A 5J12B 4PRHD 3FFCE 3GJEB 3CFCH 2IG2L 1MAKA 1KJVA 4M62H 1JPGB 1J18A 1UM5H 2PYFA 3WXVH 3T0BA 5TF1L 3A67L 5GRUL 2FSEB 5GS1C 5IHUH 5I1DB 3F58L 3ES6B 4PJIB 1L7TL 1G7QB 3O6FB 1HNFA 3O4LD 3TZVC 5JIPA 5FKAA 4JCMA 3P2TA 3MRKA 4XHQA 1ACZA 1VDGA 3VXUD 2XNAB 1LQSR 1M71B 4XP6L 5MEQB 1UFUA 2I60H 4JQXC 1H8SA 3BAEL 4OLZL 1MLBA 2J8UA 4NO5A 3PUCA 2GY7B 1YYML 2FX8H 1V5JA 2YRPA 2BRQA 1A4JB 4CADB 2HJLB 1K8DB 5M95B 3LEYL 3VWKD 3PE9A 4PB9L 3FFCD 4OJFH 5HJ3B 3NMEA 1NLDL 1INQA 1KTLB 4KK5C 1CTNA 3H7BA 5DC4B 4FFYH 3EYQC 4XPTH 5FA3A 4LLQA 1X3DA 2HVKA 1N0XL 2Z8WC 4RGMB 2C5DC 1FFQA 1J1PL 5AUMA 1LO0H 1BFOA 1AKJB 3MA7B 3BFOA 3NPSB 3SDAA 3RFZC 1YEKL 4NZJA 2BSRB 2R0WH 4NQXA 5JORA 2B0SH 2Y9RT 3GKWH 4Y19E 3VDCA 43CAB 4YFLI 2MHAB 4YDJB 3LKPA 1TQCC 4U6YB 1U8QA 2BJMH 3HE6B 1L7IH 6FABL 2EDXA 3PV6B 3SKUD 2GJ6A 5EZLB 2XZCH 4M4RA 5TFSH 3W82A 3W9DB 5SX5K 5GS2H 1D9KB 1Z0NA 1MI5A 3DNKA 1YPZB 2PN5A 4MX7B 3CZFA 3T08A 5DEZA 1G1YA 1U8NB 3U9PH 1OF2A 4HUNB 1CFVH 1P4LA 2BC4A 4QXTA 4ZSOB 4OKDA 4IDJL 3U2SB 4NRZB 2B2XL 1JPST 2EZ0C 2WIMA 4KUCF 4P49A 5MI0B 3IXAB 4XP5L 2ATKA 1RUQL 3KS0J 3Q48A 1U3HD 5C07E 1CE6A 1WFNA 3GUTA 4BJLA 1CD1A 4HUMB 4OQTH 2E3VA 1S7XA 2JIXD 4Y19D 1BOGA 4BKLA 4NQCE 4RIRB 3BN9C 3PDGA 5ACZA 1G7LB 3PNWA 4L3CB 1IMHC 3C6LD 2Y4SA 1GGYA 1Q9LB 2H26B 3QHZL 1BWMA 1TVHB 1UYWL 3C60D 3DGGB 1NKRA 1TLKA 3MRPB 2YK1H 1EEYB 4FQQA 35C8H 3LHPH 3W39B 2IQ9H 1JWUA 4EKXA 2AJVL 1Q9KA 5CEYA 3QEHB 2QHRL 3I6KB 3RVVC 4MNHB 2XG5A 1G7MA 1T20A 4ZFOB 4DZBB 2BOCA 5C07D 2V2XB 2HKFH 5IQ9A 2WWKO 3LVEA 3HKFA 1H15B 4ODTH 5C08E 3JTSA 4QLRA 5C09E 4NQCD 1NGWA 3M17B 4AEIH 2VZVA 1QRNB 4OM1H 5IBTH 2Y36H 3GMNA 2YXMA 4Z77B 5EBWB 4JKPL 4LCIL 2VN7A 5C6WH 2Y06H 3IETB 3BOVA 5CEZE 3ZDXF 3NIDE 1KPVB 1MCLA 1V7NH 4JFDE 4X9FA 2IGFH 3IT8D 3SQBA 3U36B 5SV3A 4HKXB 4P2QA 4EJ1C 1JZ4A 5EULV 4MDIB 5IB4A 5C08D 4EXKA 2VDQH 5C09D 3CH1B 2PW1A 2EH7L 5C86A 1KBGL 1NAMB 2F53B 2FX7H 4M1CD 4LCWE 3MRGB 3SY0B 1QNZH 2HKHH 3ZE2E 2EICA 2YPKB 4KJQC 4FNLH 4LDLB 1RPQA 1FNSL 1IILE 3QIBC 3DRQB 4N5EC 3BPCA 5F1KC 1EHLH 1JWMA 1T1YA 5E2VL 4BH7B 5CEZD 4JFDD 1CLYH 4RBPH 3RNKB 2PYEB 4YR6A 3IFPA 4KKCC 5J7CC 4LEOB 1W0YT 4O02L 5BZWB 4MCZB 3ULVF 1CCZA 3JWOL 4YNYA 4XI5D 2NX5B 5AZ2L 2P42B 4HJJH 5JW4R 2DYPB 2C4XA 4JFHE 5I16A 3VE0B 1A7OH 3TA3A 5B39G 1U8HB 4H1LB 4JHAL 3RIFF 4HX1A 1A0QH 4XBPA 4LCYA 4LARH 1JNNH 2IC2A 1MIEH 1MRDL 1S9XB 3DVFA 1XGTA 3G6DH 4LCWD 4PJEA 2ZUTA 3RVUD 4OIAA 3T4YA 4IRZL 5CZVH 1W72B 4X7DC 4ZAKC 3IFOB 4BFEA 3ALPA 1VFUA 3VXRB 4P57A 4ODBD 1BQHA 2C4FT 4PJDF 3QXDA 2VDRL 4K8RH 3V0VA 3TFKD 1ZSDB 4KUCD 4MWFB 4CGTA 2HWZH 4XVSH 3VXTA 3CUPB 3RWIB 4R4FL 2NY2D 4G42A 2EXYD 2WLZA 5EN2B 3VFOB 2LTQB 4OCYL 5EC2A 5IVNA 5LQBH 2OSLB 1MAML 4JFHD 2VABA 1NCWH 4M7KL 1P6AB 4O4YL 2VXUH 3CK0H 1G7JB 3I6LE 5CJ8A 4MHHG 3N1QC 3HZMA 3SE8L 4DZ8B 4E41E 4JZNA 3AS3A 1ORQB 1KIUA 1B6DA 1Z3GL 5FYKL 1FFNA 3M45A 4IEFB 3VFGH 5LGHH 2M26A 1YMMA 2BRRH 4I18A 1YYLH 2VZ1A 1CU4L 4Z7VE 5SX4H 5L7XL 1I4FB 2ORBL 4O00A 2VZUA 4H8WC 2W1NA 2AJYL 2VNCA 4G7VL 4NKDA 1ZHLB 2Z8SA 1M6OB 1SBSH 3QUZD 4HQQH 5DJ8B 5GZNC 1GPOH 4Z7WE 1QLRB 3HC3L 1IC5H 1J87A 7CGTA 2J5LB 3TIEB 3AUVA 1JFQH 3I6LD 3HE7C 5JW3H 1R3HA 2DIBA 1XEDA 4ZPTB 5MEOA 4PGDA 4WGWB 3QIUD 4KK8D 4XPFL 4E41D 1UB5B 4P4KB 1IKNA 3QNZB 2ZUQB 3S35X 3IXTB 4F58L 4UT6H 2AI0H 3L3HB 4HG4K 3QJHA 4WDIA 5I76B 1OHQA 3VD5A 1MIMH 3D18B 4HUKB 5JHLL 4UQ2A 5M94B 1W8NA 2WQRA 4F9LA 1IEAA 5T5FH 1G6RB 4ZUSA 3TZVD 2YEZA 4X5WB 4WW2F 4JANB 4XCYB 3TBVB 1PG7L 4UIKH 4NO3A 4WFFE 4HLJA 4U6XA 5DK2A 1Q72L 4KDVA 3V79C 1P53A 4WUUB 4WO4A 4HULB 1OD9A 3FOMA 3O8XC 5EO9B 3OKKB 1NANH 3S98A 3H3BC 1A1MA 5D72L 3U4AA 3LQZA 2VXSL 2WBJA 4KXZI 1OVZA 1MFAH 4KK5D 4PJ7E 4PJDE 1QSEA 3HNSH 4P5MB 3RHWK 1ORSB 3EYQD 4LLAA 5AWNL 4GRLC 4OD1L 1I9RL 2JJWA 3P4OA 3I3BA 3WFBL 4YHPB 1JZ2A 2IH1A 2JB5L 2NW2B 5C0CB 5D1XB 4NQDA 3WEXA 3HZVB 4WFFD 1E0OB 1OAZL 4LHQB 3WFDL 2KH2B 4X6DA 1EZVX 3VXSE 3ARZA 4QF1B 3MV9E 2LU7A 3P0YL 1I9JH 4PG9B 1T7WA 4UZGA 3WDHA 4RMTA 3CFKA 1TXKA 5IJVB 1YQVH 1E6JL 5F21B 3PIQA 2BHYA 1LE5A 1H5BA 2ADFL 3T8XA 5HYSB 2ERJB 3UJJL 4L29B 2EZ0D 2IPTL 4AT6B 2GW5A 1ZLVH 1G9ML 1FL6A 3KHOA 4OZ4A 1JHKH 3E8UL 3V6OA 4YDVA 3MYJB 3EYUL 4GQ9H 3BN9D 5IJKA 3OF6A 4LCCA 3EUUA 3L3JB 5TE7H 3RGVB 3VXSD 1LEIA 1HHGA 3MV9D 5H37H 3HFMH 4HWZA 2DMKA 1RZJL 5GS0H 3CLFL 3EFDH 4IRJC 5H2BB 2BNRE 1NMAL 4ZYKB 2APWA 4N0UE 3VFVB 1MFBH 5C1MB 1FE8H 4IMLB 4OF0A 5D6CB 5GRXG 3V5HA 3IDYC 1CLOH 5C0FB 1QR1A 3HC0B 3TWCL 4K07A 4DWHA 3RVVD 4W4OC 1UC6A 4XRCA 2OJEB 4JPIA 3LSOA 2GHWB 1YEHL 4WJ5A 4OGYL 3G5YA 4GAFB 1ULVA 2R56L 2GI7A 3TN0A 4QHUA 4OQTA 2VL4A 4I48A 1MH5A 1FAKT 1CZ8H 1KJ2B 3PDDA 1R5VA 4RGOH 3PWLA 2BNRD 2WLYA 1DQDH 3NGBC 1EFQA 1ETZA 3KPTA 3QI9A 1U95A 3LKOA 5HHPA 3T2NH 5D7SH 3RX7A 4C54A 1VADA 5E4IA 3TIDB 5FHAL 4Q97A 2G5BB 5DRNB 2HLAB 4I0KA 5C9KA 1DEEA 3RWFA 2HJKB 4L8BB 4XHJC 1TJHL 3X3FH 1NMBH 4PJ5A 2VZSA 5IHZA 3NZHL 1HOCA 1NBYA 1OB1B 3MRLB 1PZ5B 4XCEA 5L88H 4YPJA 1KIQB 3HRPA 2BVTA 4MD4A 3BXNB 5DUPH 1CGUA 1MFEH 1G9NH 4M62L 3ISWA 1RY7B 5EG6C 2NY3C 4XNUH 3NFPA 4KJQD 5D2LA 1TNMA 4XCNB 3QIBD 1JVKA 5DD6A 4N5ED 1JPSH 1CDYA 4MXWH 4CNIA 4JFQB 4G9DB 4MXQC 2I60L 1RJLB 1F58H 4JG1H 5KSBB 4KQ4H 3NZ8B 4D9LL 4YHKH 4LNVA 3QQ3A 2FX8L 3MGTA 3T2PA 1UZ8A 5DVMA 1BX2B 4ZTPH 4HKZA 2NNAB 1U3JA 3RY6C 4F33A 4OJFL 5JA8B 2ADJA 4Z0XB 3O9WA 1U41A 2R1YB 1T2XA 1A9BB 1MEXH 2P8MB 3GMQB 4FFYL 4XPTL 4MGXA 5DHVB 3B9KA 3VD3A 1TZHB 4LP5A 2CIIA 3UDWA 1R3LB 3WO3B 3LD8B 1Q9OB 1LO0L 3C8KA 4ZAKD 3UJTH 5HSFA 1TMCB 2ZKHH 5IMKA 1BIIA 2BCKB 1BZQK 5ALCH 2B0SL 4HIHB 3GKWL 5EO1B 3OGOE 4YGAB 1NFDF 4MZ3A 2Y25A 4QGTA 1XGQB 4Z7UF 1L7IL 2X7LA 3VXOB 4TYUA 2FD6L 3SJVA 4ZXBA 4K9EH 2XZCL 1AO7B 1VEMA 5TFSL 1HI6A 3RZCB 3T0EC 5EU3B 1CYGA 1VSCA 4G6KH 5IB2A 4WI4A 3H42H 5E8OA 3TVMB 3U9PL 4LVNC 1CFVL 3CX5K 4GAYA 4X0KB 1LO2L 1RZKH 4I0PA 5IBUG 3H3KA 4R90H 4TTGA 3AROA 3VFTA 1U93B 4UILH 5F71A 4J3SA 3WCYA 1MHEB 1MJUH 3J8F7 2Z4QA 4AEHL 3H9SB 5J56B 4OQTL 4R96A 3W5NA 1XGUA 1CTOA 3NABH 1TJGL 2ZUXA 1I3VA 5DTFB 1A4KB 5F7YC 5FYKU 1BBDL 4CDHA 4HDIB 3CLEH 2G75B 5GZND 1GSMA 4PV8B 5KSAB 1PYWA 2IANB 4LP4A 4ZPVA 4EBQH 2V2TB 2YK1L 4Y4FC 35C8L 2EYRB 4LLYA 4M43H 3U0WH 3HE7D 1J5OH 3GMLA 2VXQH 2VLLA 4Y5XC 2F8OA 5DZOA 2UV3A 4OZHA 2IALA 3DMMB 3MLVH 5FUZH 4PR5B 2ZUUA 1UJ3A 1QA9A 1JGUH 4Y5YC 1A7BA 2HKFL 1JHTA 5C0BA 1MELA 4OCSL 2ZUYA 2DQCL 2G2RB 5FGBC 3GJFH 4U1NA 4L4JA 5CKAA 4Y2OA 1FG2A 5DD1L 5ITBH 5TQ0H 2AQ1A 4AEIL 3IU4H 5DEFB 4JFFE 4OM1L 5IBTL 2Y36L 3CNKA 1S7VA 4NM8H 1P2CA 4BA8A 2Y06L 2H2PC 3R4DA 2HFFB 3O8XD 1OP3H 2EKSA 3SGDI 1V7NL 3LN4B 2AS5M 2IGFL 5F89A 4P46A 4UT9H 1IAOA 4H0HB 2UUDK 3V52H 5BQ7A 3UYRH 4ZD3H 3GSQB 2CD0A 3BPNB 1U8LA 3CFEA 3CSPA 3WIFA 5GRZA 5E00B 2ZUSA 2IQAA 1KJVB 3NN8A 2X1WL 4HUWA 3D87B 5J1TC 1DN2A 2PYFB 3N9GH 4GRLD 4P2OA 4Z7UE 5DJDB 3IFLH 2VN4A 1U8PA 3MX0A 1AGDA 1EV2E 5BMFL 1MCBA 4MA1C 2CR6A 1QNZL 3MRKB 3GK8H 2HKHL 4JFFD 4FNLL 3CVHH 4HWUA 5DZLA 2VJXA 2D7TH 1LP9F 1EHLL 1ZLUH 1K3ZA 1FZJB 1GGBH 1MLBB 2J8UB 4NO5B 5F7EH 4AIOA 3U7WH 1CLYL 2XACC 4N8CH 3OAUH 3RL1B 1L6XA 2VIRA 3ARFA 5GHWH 3KS0H 4JM2A 1FZKA 3CMGA 5E6IA 1INQB 1UZ6E 4DFHA 5I15H 4HJJL 1GZPB 3LKQA 4U6VH 1A7OL 4LLQB 1KN2H 2HVKB 2BP3A 4NDMA 2BXYA 5HGBA 1A0QL 3FRUA 4NQEB 1JNNL 5AUMB 5ANME 1BFOB 1MIEL 4S1DC 3ZYJA 5K9QI 3G6DL 4LIQH 3SDAB 5KJRH 3PWPE 1CDHA 3PP3H 4NO0A 4NQXB 4F37F 4DK6A 1CG9A 3UXFA 3QWRD 5CJXA 5CZVL 2O93L 1RZ7H 4OF7A 4U6TA 3IRZA 3LKPB 1F4YL 4JJHA 1U8QB 4RGNC 2GJ6B 4K8RL 3QUKA 1I8KA 5E5UB 2HWZL 4XVSL 3RDTC 4IRJD 3C5ZC 1MI5B 4NHCH 1JWSA 5BV7H 3CZFB 2XT1B 5LQBL 1NCWL 2HTKC 1FVCA 1OF2B 4HH9A 3MREA 1P4LB 1PGRB 2BC4B 4QXTB 3KPSE 2NY5H 3CK0L 1QG3A 4XTRC 2ATKB 3V6BR 1CE6B 3GUTB 1CD1B 1RK1A 3PWPD 4R97C 5IVZA 3HI1A 1S7XB 5B38G 3BRFA 2I24N 1BOGB 5DRZA 4BKLB 4HMCA 3VFGL 5LGHL 2BRRL 3BZFA 1CBVH 1ND0A 1YYLL 1DTUA 5ACZB 1KF9B 1OSZA 5EOQH 3PNWB 3UPCA 5ESQA 3VXME 4XVJH 4GO6B 4W6WB 1T03H 1LK2A 4FQQB 2FLRT 4XAWH 1YUHA 1SBSL 2P5WE 4HQQL 1JWUB 4OZFH 4QYOA 1GPOL 1T6WA 4AEEA 3SGDH 1IC5L 4TNVK 1PEWA 5IMLA 1VFBA 4KGLA 4DW2H 1Q9KB 3KPSD 1AI1H 4QOKE 1QBLH 1G7MB 1T20B 2DLEA 2BOCB 4XHJD 3VU2A 1Z9LA 5I0DA 5IQ9B 1PX4A 1UENA 1MCFA 5ID0A 4NQUA 1DQJA 3JTSB 4XNZB 3LQAH 4UT6L 1U92A 2AI0L 1XF1A 3LH2H 4W6YB 3QRGL 4HEME 4N8VG 1PD6A 4X6FA 1MIML 2V5YA 1UGNA 2NY3D 1NGWB 3VXMD 3GMNB 3WKNA 1P84K 5T5FL 2P5WD 3BRGC 3KR3L 3LOWA 1KCVH 4KI5F 4UIKL 3EOTH 4MXQD 2A6KA 3QEQA 2WANA 3D85D 4QOKD 2X10A 1WLHA 4G8FB 1RD6A 4P2QB 1NFIA 3FT3A 1EUUA 1TPXC 5A2FA 4U1MA 2W38A 4QRPA 5D7LA 2VERN 1PVHA 3T77A 5IB4B 2W9EL 4JREB 3T0EE 5CD3A 5IEHA 3L5JA 1MFAL 2CK0H 4WFGE 2PW1B 2AABH 3TBTA 3HNSL 5DMGC 4U7KA 5F96H 2AXHA 3AU1A 3NIFE 3FQRA 1TTUA 1IKFH 2P8PA 3BPCB 1JWMB 1JGDA 4KWUA 4H25A 4YR6B 3IFPB 3ARXA 5DRXA 4YNYB 5DR5H 4LSQH 4TULH 3BDXA 3WO4C 4WI2A 5I16B 3T0ED 5I1JH 1YN6A 3MV7A 4DVBA 1I9JL 4IS6A 3TA3B 4KPHH 4WFGD 2QLVB 2ZG3A 2IFGA 2L7JA 3ESVF 3RWJA 4S0TD 2GTWA 4HX1B 1MJ7H 1QOKA 1RZIA 2DKUA 4LCYB 3CJJA 3C8HA 4XBPB 3RL2A 4AMKH 4M6AA 1XGTB 2APFA 4PJEB 1F13A 3H9HA 5CZXC 4U33A 2XIDA 3T4YB 2VDLL 3TNMA 2VAAA 4M7LH 4P57B 3SDXF 1BQHB 4XPGH 3QXDB 5DQ9A 3W9EA 3V0VB 1AH1A 4PJCE 4KVNH 1NBVH 3QFJA 3VXTB 1PY9A 4OIBA 1E27A 5TE7L 4G42B 4V1DA 3GBLA 2X5PA 4N5UA 3HFML 3MZGB 5EC2B 5GS0L 5DJ2A 2VABB 4WHCA 3EFDL 4AM0A 4O51A 4PFEA 1UEYA 4XPBH 4Y4FD 2ZCKH 4CUCA 2APBA 1MFBL 5HHOB 1FE8L 4U3HA 3FMGH 4MCYA 3EZJB 1CLOL 3ARPA 3HZMB 5C6TH 3OAYK 2V6HA 5KOVC 3BW9A 2V7HB 4JZNB 3S96A 4Y4HA 2Q86A 4UT7H 1FFNB 3LQMA 1YMMB 2WP3T 3UTTA 4I18B 4X6BA 2OL3H 5D93B 4AIZA 3T3PF 1X6LA 5D2NC 3RUGA 2EDBA 4WENB 5IMOB 4W68A 3HR6A 4LRIA 1HHHA 5MP6H 4RMWA 4UV4H 1CZ8L 3AB0C 1XT5A 3JWDL 4LDEB 4HWBA 4RGOL 1AR2A 1DQDL 4N8VA 4B0MM 1R3HB 2H2PD 3T2NL 5D7SL 2XQYG 5IFAH 5MEOB 4PGDB 4PGCA 1DSFH 3LRSA 2CKBH 4JFOA 3LDBC 3QP3A 5I1AB 3O3AA 3ZKXB 3QJHB 5ESVA 1NMBL 4WDIB 1FGNH 3I2CH 3KPMA 1CDUA 1GYAA 3IDJA 5L88L 4UQ2B 3SQOH 5DUPL 1MFEL 3SBWC 2YD3A 5FECB 1CXHA 4N0RA 1NC2D 4OZFG 3DETC 4ZUSB 4XNUL 3GJFA 2YEZB 2OBGA 3ZE1E 5DUMH 5IB3A 4NO3B 3S37X 3KPPB 1JI2A 4U6XB 5DK2B 4ZNEA 4DEPC 1DBAH 1P6FA 1WT5A 1JPSL 4MXWL 4WO4B 4AIXA 2KPNA 4RGNE 5DJ0B 4WFHE 1MFDH 3AM8C 3DURA 4YC2B 1A1MB 2HFGH 2YD8A 3LQZB 5FFLA 3CFJA 1F58L 4QRRB 4U1GC 3HUJF 4JG1L 1HH9A 4KQ4L 5TGBA 5BO1L 2WBJB 4PJGA 1MOEA 1P4BH 1FO0H 4RFNB 3ULUF 3F5WA 2F9BT 4ZTPL 4PV9A 4YHLH 5DURB 4JY4A 4S11A 1CDCA 2LU4A 1MEXL 2QSQA 2A9MH 4S1DD 4G6MH 2IH1B 2EDNA 1P5VA 3C87A 3VGAC 3FT4B 4NQDB 4QKXB