5DJ8A

Fc heterodimer design 7.7 d399m/y407a + t366v/k409i
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLMSDGSFFLASKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Computationally Designed Bispecific Antibodies using Negative State Repertoires.
pubmed doi rcsb
total genus 34
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2015-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5dj8A01
1TITA 2WW8A 3D0LA 2ARJQ 3RUGE 2GSIB 1FAIH 4ISVA 4NZJA 1I8LA 2FEDC 4HWEH 4BQCA 4LLQA 3BP6B 4JFEB 4XNXH 4CMHB 1ZHBA 4X80L 1BBJB 4AIXA 1CFVH 1KELL 5DD5H 2NW3A 3RNKA 4RZCA 3VXQB 3QDGA 2JB6A 1M7DA 2DQFA 3A6CH 1RURH 4XPBH 3UTSE 3GBLA 3P0VL 4MNQA 4RMVA 1NJ9A 4KHTH 4OLXH 2X4UA 4HUUA 4KROB 4XWGH 1ERNA 4PRPE 3WUWG 5JUEH 1NFIA 1CXHA 3RWHB 2H41A 35C8H 3JTTB 4KTYA 1AI1L 3VG0L 1C08B 5E70A 3MV11 4PJDE 4MNHB 4YC2C 1IC4L 3IJSB 2IQAB 2W0FB 5FUCE 2JIXA 3Q6FB 1OAQL 3INUH 4KTEH 3O8XB 1E4KA 3GHBL 2NX5D 2YWZA 2Q87A 3F5WA 2VXQL 4OV5B 4BSWA 4R4BB 4LIQH 1L6ZA 3PDOA 4KV5E 5KSBB 2Y07H 5ISZE 1CDYA 4GLRI 3R8BB 4RGNB 3HMXH 3UYRL 2A73A 3C5JB 2C3HA 1UWXH 4QHKJ 2P49B 3ROOB 2DKUA 4ETQB 3HC0B 4L1DA 3MYJB 3PWVB 3Q2CA 3L3OA 3NA9H 3L7FB 4HIXH 2EIBA 3V4UL 4JRXA 2QADB 2ADGA 5B4MD 1TTFA 3GKZA 4U7MA 1J8HD 3N50A 5HXMA 5FYKH 1FNEB 4YHKL 5DQDL 1IEAA 1E6OH 3GMMB 3KWWA 1A7OH 3SDYH 1A5FH 4UIMA 4J8RA 5GPRA 2GJ6A 3TNMA 3OKKB 4YHPA 4CVZA 2VXTL 1J0ZA 3RX7A 3BSZH 3TT1L 3QDME 3QRFM 1V8HA 2EECA 3MRQA 4YXKL 3EYVB 4HH9B 4TPRH 3MODL 3ESVF 2YD7A 2IH1B 1RURL 4XPBL 4JFOB 3P3YA 3BZEB 3QEGH 4LVOC 3DRQA 2OJEA 4NDMA 3BVNB 1RSFA 3P4NA 1CE6B 1ULVA 4G8GB 4OBRA 2AABH 3ZYIA 2V5MA 3BEVA 1U8QB 4JO3H 1XF4B 4FXKA 2EH8L 1A21A 4JFQB 4OCWH 2NXYD 3O3AA 2FIKA 4DGYL 1ZSDB 3KLHD 4IHOB 3FN0H 1V7NH 4WFFE 5D7LA 5KOMC 3QYCA 5JPMB 3X3FH 3O4LE 1BOGA 1JFQH 4PLKD 4U1NA 4UOW1 1HH9A 3E3QC 1QP1A 2GTWA 2LU4A 2NTFA 3GSNH 3B3IB 3D9AH 4EI5D 2DIAA 3VU2A 4BH8B 1SY6L 5TF1L 3ARZA 3G6JB 3O45A 4Y5XA 5CSGA 3UBXA 1VGEH 2ZCKH 4KI5C 3AVEA 5GGRA 3TJEL 1NCWL 4WHDA 3V5DA 4D3CL 4XTRC 2DQTL 2DBJA 3MCLH 3WSQH 2B39A 3BT2L 3GJFB 3EJJX 1RY7B 3NH7L 4RAVB 1GC1H 1FFQA 5GQBA 5JR1H 2Q3ZA 3ELAT 3QHFH 2YWYA 1WZKA 2BVPB 2KL6A 5DFTA 3C5ZB 3MA7B 3SE3A 1J5OL 5D7IA 3CX5K 2CLRA 1DQQB 3QRGH 3ZKSD 5F6IC 1F6FB 2NY2D 2RJMA 3ZE1E 1RIVL 3MODH 3FB6A 4HZLB 2EDNA 3HAEG 3GMNA 1SYSB 1FYTA 1UEMA 1QEWA 3DWTA 4JFYA 1WCBA 2AK4D 1J86A 3QUKA 1XCTB 1OP3K 1UM4L 3HI6H 1Z5LB 5JTWA 4XI5C 5TDOB 4ODUB 3RKPA 1AGEB 4NQEE 3MJ7B 3QO1A 4KK6C 2ATKA 3MRFB 5ICZA 3S96B 5DJ2A 4MSWB 4FQLH 3VFVB 4K8RD 1T80A 1J1XH 3SY0A 3VH8A 4S1QL 1VSCA 3HNTL 4UB0H 1S9YB 2FIRT 4EXPX 4GG6A 2DQUL 5I73B 4UTAH 3VFMA 5ISZD 3TESA 3ULSB 2AI0L 2QKIB 4JB9H 3OQ3B 3RA7L 1E4WL 2C5DC 4DOHE 2VLRB 1BJ8A 1MJJA 4G6FB 4U6VH 1YPZE 4L3CB 3S9DB 2EE2A 5DDHA 1N5YL 4F15C 2MMXA 4JHZA 4F58H 1YMME 4OLVL 4WNQA 3S6CA 1OW0A 1F45A 1PEZA 2NY2C 1A1NA 5DD6B 4G5ZL 1ADQA 4M6OL 5ETUA 2Q3AA 4UTBH 3HUJE 3VRIB 5IVXA 1BEYL 4RGOH 2G5BB 1FLRL 4IM8A 3VA6A 2E7BA 3AS2A 4ZYKA 4H25A 3UYRH 1FZJA 4LQFL 5SWZA 2CO7B 1GAFL 4TNWF 1PSKL 1ES0B 1BIHA 4YXLL 2CSPA 2VXSL 5DJYB 1MH5A 2DQCH 3BXNB 4AY0A 1A6UL 5F7WC 3FOMA 4HMCA 3KPSA 4U1JA 5IB1A 3GMRB 2AXJA 3R0MA 3NIDF 4U1HB 4NQVB 4Q9RL 1T21A 3ARGC 2XPGB 3QDAA 4QXGH 1CE1L 1FFPA 1YA5A 4WW2F 3RGVA 3ZTNH 1UCBL 4WGWB 5E56A 1KJ3L 3VXOB 4ZOAA 1G1CA 4XX1E 5C0BE 2H8PA 5I1IL 4YUEL 1IC5H 4PJCA 3RUGA 4J7RA 5HYSG 5F7HA 2IADA 4J3UA 5C6WH 3TBWB 5JIPA 3D69A 1UB6A 2WNGA 4KJQC 1H0DB 5HHOB 5JOFA 4CKVX 2I27N 1NC4A 1TIUA 2UWEB 4NZUL 5FO8B 5IROC 1MAKA 5DF0A 2H2SC 3ARBD 1F2QA 3BD3A 4R26H 4OZFH 1OGTB 4NN7C 4ZPVB 4RQQA 3DMMA 4D0DB 3O6KH 4NZTL 5JHDE 3IJYB 4KH2A 3GSOB 2D3VA 2RBLA 4K7PL 2ZSWA 1B6DA 3GSXA 4A6YH 2YKLL 1WZMA 3RTQB 4ZD3H 1NMCC 3MCLL 4ZO7A 4IRJA 3CFKA 4X98B 2UZYB 1CK0L 1UFUA 4N0UB 2QQLL 5IVNA 4HUWB 1YZZA 3KPSD 1H3PL 2MKLC 1FL5A 4L29A 1LE9B 2EDFA 3I6GA 5JW4M 3F7VB 2IBGA 3VXPA 2YUZA 3QDGE 3VJ6A 5D5MA 1JK8B 5IW1A 1JGUH 4YDVB 2P5WB 4O02H 5GJSH 1FJ1B 3HE6D 4GMTL 4Y5YB 5H8DA 5FDWB 1TVBB 4EBQH 1KJ2B 2W38A 5IMKB 5EDXA 3CX2A 1CXKA 3V7MA 3SKNA 1OTTC 2CUIA 1NFDF 5CEZE 2ARJA 4BZYA 3CZFA 3NOIA 2D7TH 2FECL 4JDTL 1CLZH 1HXMA 2VDOH 1KJ3H 3ES6A 1OARL 3O6FD 4R97B 2DQDL 5BJTB 4Z0XB 2JIXD 4QXUL 1P7QD 3UP1A 2HVJA 3OAZK 3ILQC 4J23A 5B8CA 4L3EA 2ZUQB 3RUGF 2CMRH 2GT9B 4IMLB 3RVVD 3ARFD 4ZAKD 2LABA 4PGEB 3UYPA 1BQLL 4EQ3A 1U8LB 2WBWB 4DTGH 5CEXB 3G5YA 5JXED 1A1OB 1QNZL 5E8OA 4J3XA 4DQOL 3UYOD 5IB2B 4GKOA 1WBXB 3QP3A 2FRGP 4IRJC 4U1SB 2NW2B 1E4XI 3P9WB 4NBYB 3WNNA 4QHUA 3FHQA 4Z7NE 3ULUF 2ITCA 1C16B 3T77A 4R8WH 4WFFD 1U3HA 3D3VB 5K9OA 2M8XA 2FX8L 3NACL 1ZS8A 5ITBH 5E03A 3MUZ1 1NCCH 4PBWD 4H1LA 4OFYD 4PJAE 2ZZUT 2UY7A 1J1PH 4Y19D 3VXMD 3QAZC 4NJAH 3O6FC 5FHAL 1RZFL 1HWHB 5E4IA 4HWBL 4NQUA 1FH5L 2D0HA 3ARDA 1NBYA 2ZUYA 3ZE1F 4UDTB 3WNLA 4ZAKC 4NOBA 1CE1H 2B1AL 1CGUA 2GUOA 2BCKA 2OTWB 1I1FB 2Z8VC 1MJ7H 3MJ8A 5IGXH 4C56D 4X6CE 5CJOL 4Y0GA 1ZOXA 5C0RH 3FFDB 4GW4B 3BAEL 4YEEA 5F7KC 3BZFA 2AK1L 3C60C 4MQSB 4YHNB 5F7DB 1MQKL 4YHZL 5HVHC 2DTML 2DN7A 3MBED 1KUMA 4JAMB 2EXWD 1K5NA 2NR6C 3PF2A 4X6DA 5KSAB 1GGTA 4ZFZA 3QXAA 4ZAKB 1BZ7A 4CU6A 3VXNA 4PV9A 4JHAL 4PJDB 2IFFH 1CDIA 5D2LA 3VDAA 1NAMB 1LK3L 4XHQA 5I1CL 5EU6B 4R8WL 3FT3A 4XC3L 4XPHH 3VD3A 3WXWL 2IGFL 3OZ9L 4QHLA 1EFQA 4FXGB 4DGIL 1CICC 1JWUA 1ZLWK 7FABH 1OAZL 1S3KH 3R1GH 3B83A 3AC0A 4JZJB 3SOBL 1EUUA 1FNSL 3ARPA 4X4ME 1LO2H 4I1NB 3BMVA 3I84A 5BZDB 3ARWA 2HMIC 4UMGA 2EEBA 2FSEB 4WI4A 4ERSL 4ODTH 4N90E 5C0GA 5E4EC 4JRYE 3CUPA 4JFPB 1K2DA 5L2KD 4E41A 4RAUA 2IJ0C 3QUYB 4MJ6B 4LGSB 3B2UC 3BPOC 3V4VL 3WO3B 5C71A 4GAGH 3UTSA 1G9NH 2G75B 1X5XA 5I16A 4KZDH 2JJWA 2J8UE 1R5WB 5E8EA 3CPLB 2F9BT 4P2RE 1DTUA 5CD5C 2NY5H 4AYFA 3EYFA 4Z95H 4DAGL 4YE4H 1G0YR 4CL7A 1ZKAA 4DKFH 5L2KB 5F9WB 2LQRA 5KS9E 4JZOB 5FF6A 4JQIH 4HS3A 5J6GB 4MXVF 1R3LA 4Z7VB 1DZBA 2P5EE 3D1MC 4OCMC 1WF5A 5I8OL 3BIBX 2DJUA 4QT5A 5JOPE 2D4FA 1SMOA 3O3BB 2VH5L 3VD7A 2DAVA 4IRSC 4PJEB 1MHEA 4GRLD 3PGCB 4HBCH 3RWEA 3OKLA 1J0JA 2HFTA 4G7YL 3WKNA 4JM2B 2I25N 1HZHL 3BT2H 1Z0MA 3QHZH 3VD9A 3LCYA 2VXTH 3P9LA 1OLZA 2W59A 4IBLT 1DUZB 5D7IF 1BM3L 1HSBA 3VGGA 3T4AA 1D5XA 2ZSVB 1BMGA 4MA8L 4GFTB 1MAMH 3VDCA 1ZXQA 1J8KA 4G42B 1OP9A 2R15A 3KPMB 2XRAL 5H37G 4I3GA 3L3DA 4P46D 2YEZA 1D5ZB 1XFPA 3ARED 4BFBD 5HPMB 2ED8A 1X7QB 2CIKA 2DQTH 4HF5H 5DS8B 1H15A 3UCRA 4YHIB 5D2NB 1LO3H 5EOCJ 4QWWC 4PR5A 4QRRA 5JNYA 4NCC1 1LEIA 2QHRH 1VCAA 2XT1B 2C7UA 2H3NA 2B1AH 1NLBL 1VFUA 4PLJD 1AC0A 4ZXBB 4HC1H 1U8KA 2X4NB 4JFHD 1F4HA 1RU9H 4HUXA 5DJDB 5C0AD 5HJ3A 3PXJA 3GHEL 4NO0D 4N0RA 1UYWL 2HVKB 2X1PA 3S3SA 3X3GH 1T89C 1DQLL 3IETB 2ICWI 4JN1H 4N0YL 5EOTA 1JZ2A 4J1UB 3FB8B 1RJLB 5FV2A 5IFAH 1GGUA 3WCYA 4MA3B 4UIKH 4WFEE 1L7TL 1OSPL 1T5XA 4X7SH 4WI9A 2A6DB 5HGDB 3U30C 2Y6SD 5IF0A 3WEXA 4QY8B 3E3QE 4GMTH 1MRFL 4V1DE 4PRIA 5DVOA 5GS1C 3VFSA 4HKJA 4OFKA 1KLGB 2FO4B 2A9MH 4W68A 2CIIA 2R1YB 5F72S 3K74B 2YRLA 1GPOH 3C8KB 2O93L 1EA9C 2HT4C 1SJXA 3OAUH 2AK4B 2CDEA 3VFOB 3DVGB 4XP1H 6FABL 4GRWF 4OKVB 1M71B 1KN4L 3RX8A 2BP3A 3F58H 4YGVA 3B2VH 4L3EE 4OCYL 5DMKB 3TIDA 3ULVH 1J1XL 1MFBH 3ARGA 2CLVA 4YK4B 1UZ8B 5IHLB 1I75A 1I7ZB 1CD1B 1GHFL 3T04D 4AH2A 2Z35B 2YUVA 4J3VA 4D8PB 4PJCF 3RZCA 1PZ5B 2ZKHL 3DSNA 4U6HB 2J2ZA 1MFNA 3ALXA 1PBYA 3O9WA 4ZMAT 7CGTA 4ZFOA 1KTLB 2DLFL 3ARBB 32C2A 4ORZC 3DYPA 1D9KC 3TFKC 3BH8B 2G2RB 3DXAD 3WO4C 4XCEA 3V7AE 5CGMA 5IROA 3KPOA 4LARH 2X40A 5M7QA 4OLUL 1OT2A 4FRWA 3H42H 3X14A 5IEKA 5H2BB 3LY6A 3WFEH 5E4EB 1AHWA 2VLLB 2HT2C 4XCYB 3CU7A 3P4LA 5C07E 3F62A 1JZ3A 4WEBH 1Z0NA 1I3RA 1W8OA 3TPKA 5J11C 2YN5A 5GS1A 4ZDHB 5MP6L 4W4NA 4CMMB 2P44B 1AO7A 4FQ1L 3BKYH 1X4XA 4OD3H 4YQXH 3THML 4ACPA 4OIIH 1KGCD 3IAPA 5HD8C 5F7EL 1PEWA 1GOFA 1P5UA 3DARA 4NUGL 2HH0H 1KEML 1TVHB 1I7RA 2CJUH 3IAGC 3IF1B 3ZKND 1WBYA 1CF8L 1UVQA 1WFUA 5TE7L 5IESL 3ULVL 5C09A 4HX1B 3ARTA 1RZKL 2DD8L 4NRXA 4FTVE 4CUCA 4P23C 3VFRB 4XPFH 3A67H 1KLUB 1EJOL 2VQUA 3RZCC 1FRGH 4OQ1A 4DVBA 5F1NB 3MRLA 4JFFA 4ODXA 2DDQH 4L9LB 3IKKA 3IKCB 4KJPC 3GMPB 4PJGA 3UPRB 2APTA 2VDRL 4AG4L 1G9NC 3MOQA 1EV2E 3P2TA 1UM5H 5HI3C 1PG7X 4KVNL 3TWCH 5I1CH 4UB0L 1U8IB 1X4ZA 2X4SB 1IAMA 4WJ5A 3GSUB 4NQDE 2DIBA 4LOUD 4Q2ZB 3NABL 1BBDL 1W0WB 5SWQB 1F13A 4EDWL 2DTMH 2Z93A 5EU3A 3CC5A 4KRPC 5BV7H 1U6AH 1ACYL 5K9KA 1I8IA 5CJQH 1B88A 4PREA 1K8IA 4UQ3A 1WFTA 3MRMA 3IFLL 4WUKL 5GGVL 3MRPA 1MHPH 5C0CE 5TGBB 3HRZA 5JXAL 1E6JL 4MX7B 4C4KT 1EEQA 2NZ9C 4G5ZH 2V2WA 3L3KB 4JFXB 4HBQA 1HHHB 4Y7MA 4I0PC 1G7JB 5DRZA 4XNQB 4I77L 3RIAF 4L8CB 1EH9A 5F89A 3RWDB 1TJIH 4PRDB 5HHXL 1JRHH 1EGJH 4ZXBC 5KVGH 1PKQA 4Y4HC 2C9AA 4XNXL 5E8PB 4HS8L 3MNVB 3V2AR 2MKWA 3KPLA 1NBVL 1BQHB 4AM0A 1WT5C 1VDGA 4LKCB 4PJIE 2XA8L 1TTUA 5E94A 4NWUL 5GS2H 1OAUH 5D1XD 4JKKA 1JGEB 3NAAL 3NFNA 1A2YB 3L3HB 2B20A 4WFHE 5L8JB 3UTTE 3WLBA 4OT1L 1P4LA 1VFAB 3MCKA 3VD5A 1N26A 2BDNH 5D9SA 3QIUD 3R8QA 4I18B 4MWFB 4JPIB 4TOYH 3PNWB 4M1CD 4XNYH 2WK2A 1IC5L 3MV7D 3HAEA 1ACYH 1BX2B 5EFIA 3IU3A 3RTQC 2Q76A 1X4YA 5EO0B 1A6VL 2YZ1A 3MJ9H 3H9ZA 4PJIF 4NKOA 2W9DH 3IXAA 2Y4SA 2Q8BH 3SDDC 1FNGA 5DURB 2X6MA 5BRZE 3OXRB 4NIKB 2V5SA 1K85A 3KG5A 3STLB 5J3HC 1MJUL 4OCSH 5ITFB 4NO2B 2XWTA 3HN3A 1Q0XL 4G43B 4W4OC 1NCBL 3VI4E 5LGKA 3S97C 4KKBD 5I76A 4FTVB 3SKMA 1OQXA 1H3UA 1TJHL 1XGTA 4LPXA 4IOFC 5FDYA 1CDCA 1FCGA 2C1OA 2DQIH 3OPZH 4D0CA 1YN7A 4IJ3B 1XF3A 3MROB 4Y4KC 1AGDA 1FFOA 4CN1A 4EN3A 5D1QA 2AQ3A 2P5WE 4PJ8A 5LXGH 5EU5B 1IT9H 2P45B 5INDA 1AGCA 1I8LC 3HCVB 1A7NL 1R3KB 4PJ5A 1B0GB 1WUNT 3I50H 5FYJL 3FFCA 1U93A 1T04B 1ZLUK 5DGRA 4QHNA 4L3AA 2FL5B 3EUUA 5JXEC 4GG6F 3UBXG 1KJVA 3G6DL 3WBDA 4ZQKB 3FKUS 1I9EA 1ZHLB 3IDXH 2GJJA 2VQ1A 5C9JB 3B9KA 2PTTB 5FGRA 3RU8H 1N8ZB 3AAZA 1C5CH 4IRSA 4MQ7A 2R4RH 1JNNH 1V7NL 5ID1A 5ADPH 4YPGB 2Z92A 3BQUA 1KC5H 4HIIB 3NA4A 3L6FA 1T5WA 3FB5A 3U4AA 2BNRA 3RWIB 2V7HA 1F11A 3LQAC 4IEFB 3BQUD 4OQTA 5E95B 1NDGA 3NZ8A 2A77H 3CH1A 4OCYH 2A9NH 2PXYB 3KPRA 3O2DH 5IHZB 5CLTA 2OS7A 3ZTJH 2BHZA 2IALB 5GIRA 3HMXL 2AJYL 2I24N 3FCTB 1FQ9C 2BSED 2X4TA 3QWOA 3SE4C 1CFSB 3BDYL 4M1GL 2N1KA 4LLVB 4LIQL 2PCPB 5KVEL 1T0MB 5TDNA 9CGTA 3D18A 5E00A 4QTHB 2F54E 1S9KC 4UZGA 3N1MC 3BWAA 1HEZB 1TQCB 4FZEH 1P6AB 4X6EA 5DZOA 1RZIB 3QO0B 4E41E 1DE4A 4LLAA 5DHVH 4UT9L 5LGHH 1BJ1J 4GXVH 3VFPA 3QQ9D 5CBAA 2R0ZH 1U58A 4PG2C 1K9TA 2PXYD 3QZWA 1OGAE 4M6NL 1PX4A 1BD2B 4D0BA 3LKRB 2HJLA 3VXUD 1HYRC 1ZT1A 1BP3B 5ACMA 3S4SA 1S9VA 4X7CC 3EOAB 5E8NA 4LK4A 1Q8MA 2AJZB 2P5WD 4O51A 3N1GC 1YUHB 1KCLA 1VPOH 4OZFG 5D7IE 1R3IH 5F96H 2RGSA 4F33B 3PL6A 1UWEL 1EXUA 4X6CF 3BQUC 5KN5B 5FO9A 4OB5H 1BVLB 4PJXA 1YNTB 3IFOA 3S36L 5J0BA 1KCVL 2HFFB 4LCWD 1PYWA 1UACH 3OGCB 5H35A 3CFIC 1MNUH 3OR6B 4LVNB 1T22B 1JHTA 4MAUL 3EYUH 1LHZA 1FAIL 4MAYC 5DTFB 3BH9A 5D2NC 4XBGB 3SBWC 1IQDA 1GOHA 3W2DH 1JYVA 4J4PA 1IBGH 2BC4B 5I1AB 1QO3B 4RFOH 5DSCB 4PY7A 5T1DH 3CFCL 3AXLB 3FONA 2FYYB 2RFXA 3BOVA 1EEYB 1S7VB 4OCRH 4JG0L 2MQ0A 4F2MA 2MCPH 3SKUD 3TO2B 3VE0B 2R2EB 4KVNH 2AAVA 3ZO0A 3ME0A 3TH3T 2ENYA 4XVSL 2GJZA 1GGYA 2BVOA 3BP4B 3FFCD 4H88H 3VXMA 2NQCA 4BQBA 5IBLC 5DK2A 1CBVL 1CGWA 4I3RH 2Y07L 1GZPA 3QPQD 3F7YB 3DTXB 2ZUWA 3W0WD 3QFJB 3LKNB 1N7MH 1PQZB 3G04B 1HOCB 4H1LG 3DX6A 4P4KB 2R2HA 1OSZA 4LFHD 3EO9H 2VZUA 4MQXC 2FB4L 1DQML 3DBXA 3TYFB 1OAQH 5KS9B 4Y19B 3D9AL 2WP3T 2YPKB 3OJDA 4JPWL 1K6QH 2WWKO 3CMOL 3PWPB 4MXVE 4P2OA 3ZHLA 3B43A 4F7EB 1J88A 5EWIL 1CQKA 2AVGA 2VLKE 4PRBA 5CJBA 4OZIA 1ROWA 5JW4N 2MFNA 1IARB 5C0EA 5DJZB 1IM3A 2BNUA 5IVOA 4LSSL 1YY8A 4MJ5A 4YHLL 3KPQA 1VFBB 2WUCL 5SX4I 1T20B 2VISB 1JMXA 1KNOB 1KULA 1SEQH 3EYSH 1LEGB 4OZ4A 5I73C 1I3UA 4IIQA 4MMZC 3D39E 1Z2KA 1IJ9A 2VLJD 3QIWC 4RX4A 4YBQC 1DANT 3UTQB 5I2IB 3MLZL 1MI5D 5E08H 4YDKH 1MF2L 3PHQB 3B9EA 1QFUH 3QPQC 4GKZA 4MGXA 3C6SB 2D03L 3TPUB 3L7EA 4DZBB 2IBZY 1YC7A 1LO3L 1ZA3A 2DQDH 4M8QB 5GSRB 2WBKA 4K55A 5HGBA 1MCCA 1MRCL 3K4AA 3O2WH 2R0KH 4Z7WA 5C3TA 3TBYA 2BSTB 3EO9L 5JIIA 5F6IB 2LTQB 3KYMA 4OI7A 2ESVE 3UZQA 5HYQB 2W0LA 4XB8A 4JO4H 3MGOA 4PRPA 3WIHL 3NFPB 1CBVH 5DO2C 3RPKA 2AV1A 4K3DH 2ZPKH 3CLFL 4P4RB 1I85C 2X09A 2JELL 4R7DA 1Z9LA 2X4OB 1NAML 3QPXH 5K9QI 4NQXB 1QSEE 5DRXB 5B3JF 1RHHA 1MOEA 3QXDA 1IGTB 1DLFH 1A1MB 4F58L 4PUBL 3DX9A 4P59H 4AK1A 2EH7L 1Q72H 2F74A 1UCBH 4OCXH 2AV7A 3WDJA 1QYGH 1IM9B 1MWAL 1AQDB 4HGMA 3OX8B 4G7YH 1LK2B 1I1AD 2D4DA 4RNRB 3ZE2E 1WAAF 4WDIB 1KIQB 4U1LB 3IDGA 4PPTA 4WVRA 3B9VA 2OQJA 5C86A 4U49A 1R3IL 2ICWB 5EC2B 4L4VB 1MCEA 1V05A 3GMOA 4O58H 1L4IA 4G7VH 5JDSA 3CDGB 4G8FA 4ZFOL 4ELMF 4OKDA 4LLDA 4PJ8D 3CFBA 1FORH 1RZ8B 5IMMB 1M4KA 1S5IL 2VZOA 4RBPK 3QQNA 5MENA 1BIIB 1I8MA 3FFCE 2H32H 5TH2A 3UAJD 4NO5A 2WBJB 3UO1L 5I8CB 4Z5RB 5EBWA 3MC0A 5HHMB 3WS3B 3ET9F 4HUVB 1NLBH 4P3WA 1K8DA 1S9XA 4NM8L 1ORSB 1NC2D 5F7YC 2B0SL 5FYLL 2VIRA 2AJVL 1V3LA 25C8L 1MPAH 5CEYA 2R23A 5GGSY 3STZA 3HUJA 2YA1A 5JW5B 3ULUC 4XH2B 3KAAA 4U0RC 4UTAL 4U6YB 5D70H 1MVUA 2GEEA 5GRZA 1ZGLA 3MLVL 4X7EC 1UXWA 5I17B 5J1AB 1RIUH 3UJIH 1MHHA 3MNZA 2ZPKL 4HMDA 4X8JB 3SJVD 4NZRH 3P77B 1U3ZA 5EUOE 4GW5A 2W65A 2BOCA 4HIHA 1U3HD 1CLZL 4P5MB 3SHSA 4OTXL 4Y4FB 3O3EA 4NYLA 3GIVA 1A7RL 4PGCA 4OD3L 3C5ZD 5TDPA 2JJUA 2R56H 3LIZL 3EYOB 4KUCD 5L0QB 3QUZC 4WHTA 3ZE2F 3KJ6H 5L9DH 5DHVB 1T2JA 3U0TA 4X7DC 2AERT 4OCSL 4ZPTA 3RWCB 2AJ3B 4Q9RH 1DN0B 2XTJC 3ZHKA 1JYXA 3GSWA 4Q6YA 3X11A 4X5WB 3FQXA 2VDLH 4RFEB 2QR0B 1ED3A 5IFHH 5ESVA 5L7XL 4XCNA 4N0UE 1P7HL 2X4QB 5AZEL 1ZEAL 5ABDE 4PB9H 4DVRH 3T4YB 1OLLA 2CLZA 4RMRA 1Q9OB 4NM8H 4CDGC 1JCKA 3FQTA 1BPVA 4Z95L 4RIRB 5CGYD 5FKAB 5T1KA 4MS8D 1R3HB 1HK6A 3HMWL 1I3GL 4PJIA 3DETD 3CVHB 5JW4Q 2OYPA 4GXVL 1CCZA 3BUYA 5IOPA 4YPJA 4K7PH 3LKPA 4POUB 5ILTH 5FK9B 5DRWA 4PGDA 1PVHA 3HNSL 4F37K 3U0PA 1XR8B 3MV8E 3DI3B 1HHGA 4XMPL 3BP6A 4JFEA 3I75B 4QRTA 4Z9KB 3DV6A 4XZUA 2NW3B 4Y1AA 5HDLA 1MCOL 3QDGB 1P84K 1FO0H 1YPZF 4FQXD 5K59F 4NKIL 2X1OA 3O2DL 5HVHB 5IB5B 3GJEB 1OGAD 1NJ9B 3J8F7 4S10A 4AQ1B 5A2LH 1QTYT 3EZ8A 1JWMB 1JPSH 4FABH 2UUDH 2VZ1A 2X4UB 3BZDA 3MV01 4HUUB 4JE4B 3UJJH 4PTUA 5CP3H 2DJSA 5IBTH 4RA0C 4HSQA 4P4KC 4HLJA 1IKNC 3QH3A 3IYLW 3TT1H 1MY5A 1S78D 4X6DE 3MRJA 3R4DA 1T1YA 1T0NB 4DK6A 1XF1A 5ELIA 3RY4A 2IQAA 3CFJB 4NM4H 4XMLL 1JYNA 4MVBD 3BIAX 3Q6FA 4XWGL 4JHWL 1KCUL 2C3VB 4JDVA 3ZDXE 3S35H 5I1DA 2EKSB 4RMWA 3JWOC 3LN4A 2XY2A 5IK3B 5IB3A 3SDDD 3F5WB 3QCTL 4J3WA 5AWNH 5C0BB 2NNAA 3DIFB 3ZKMC 1LO4L 2KQNA 3DUUB 4MA7L 2EDRA 2A73B 3C5JA 3ROOA 1D3CA 4JRYD 5AEAA 1EGJA 3BYYA 2FZ3B 4FA8A 4ONHB 4ERSH 3BE1H 5KVFL 4ETQA 3DO3A 4OZHA 3MYJA 5ALCL 1OP3H 3L3OB 1R5IB 3CFEA 2CXKA 2RIKA 4HFWB 3WKMH 1QRNA 2DBLL 1T7YA 4CDHA 1XZ0A 4BH7A 4JJHA 4XAKE 1S3KL 5E08L 1JHKL 1TNMA 3K7UA 2QADD 5DUBB 3OKKA 4CVZB 3QCVL 4X4ZA 2R9HD 4ELKA 1BM3H 4OFPA 5IM7B 2PF6A 5AZ2H 1KJ2L 3RVTC 1CDHA 1J0IA 5ICYB 4HPYL 4IRZL 1FFRA 5HPOA 2EEAA 3ZT5A 1BJ1H 1U8JA 5C6TH 3P4NB 2H26A 3K1DA 3BEVB 3SKOB 1XF4A 5KSVB 4FXKB 2OL3H 1IE5A 4JFQA 2P7TA 3OG4B 1I1AA 1IEBA 2J8UB 1ZSDA 2VXUH 4P2OD 5DJ8A 4TSBH 5HSFA 2R56L 3NPSC 2H32A 4FQXB 3LN5A 1BOGB 1DLFL 4U1NB 4KKCC 5C7XH 5GRVL 2VSDA 3U7AA 1MCJA 3B3IA 4X6CA 5L88H 4AT6B 5HYIA 4KHXH 4RDQF 2W0KA 4DUVA 1YYLL 4JLRB 5DQJB 3PIQB 3BPCB 2QADC 1KENH 4OF7A 5MERA 5B38G 1WWWX 4GJTB 3QNXA 1JIBA 1KTDB 1ADQH 3V5DB 1CU4H 4OLVH 3ZYZA 1XGRA 1OGAA 2CO6B 2C4FU 2Q7NA 3GSVB 4B0MM 1N5YH 5LAXB 3X13B 3T1WA 1CFVL 5BV7B 3OSKA 4DJMA 4LHUB 4KY1H 3MLWH 5GISH 4JCMA 4Y1AD 3IDJA 5EUKB 1GGIH 4X5LA 4X6BB 1DQQA 1XGPA 4ONFL 4U4BA 3MUGA 4PJ7F 2OBGA 4RFNC 3VW3H 4TVPH 1SYSA 4K3JL 5C07A 1QEWB 4PBXA 2E6PA 1XCTA 5AG9A 3SO3C 1UXSB 5GS2D 5TDOA 1FVEB 3CSBA 3BUTA 4QNPE 1DBKL 1MSPA 3UTPD 1AGEA 3ARFA 1S5HA 1M7IA 2XQBH 4RCAA 4Y16D 5E8DH 1WJ3A 3QO1B 2PYED 4X83A 2F58L 2DWDB 5HI5C 4PRHE 2K7QA 3H3PL 2WM0A 4NNYA 2VLJA 1P7QA 4Z7VE 4KK5D 3VFVA 4E5XA 3SY0B 2FJGA 3QEHA 4OLXL 2BFVL 2HRLA 4M8VA 3MYZA 2YK1H 1QKZH 4JFDD 4Q7DA 2ZKHH 3ULSA 3QQ3B 4QYOB 2EYRA 1PD6A 5BQ7B 5HYSA 4WI7A 1JPFA 5DUPH 3V5HA 5MHSE 4OFDA 3DXAB 3F12B 2IANE 1MUJA 4I0CC 1FC2D 4M4RA 3S36H 1A1NB 5DD6A 4YO0A 4G9FA 1UWEH 2GK0B 1Q9WB 1DR9A 3JVGC 2GAZA 2PW2A 3JV0A 5EZIL 5DQDH 3VRIA 1T1WB 1PG7W 1QR4A 1T66D 1P5VA 4KK9C 1JHKH 1DBBL 4JKWA 1X5HA 2YBRB 2DQGH 1HH6A 3C6LB 5FHBL 3N85L 4H25B 5DA4A 4ZNEA 1FZJB 3P11H 4WHYG 5D6DA 1U91B 1OW0C 3U36A 4OGYL 4YQXL 4YAQA 2EIDA 3DXAE 5EZJB 3KPNA 5ERWA 5DJYA 3BO8A 5IBLD 1MH5B 4HS8H 1I4FB 3BXNA 1TZIA 2Z31B 3DURA 4XXDB 4QRSB 3WKML 2Y06H 3D48R 3GMRA 1B2WL 4YBLB 1T4KA 2QQNL 1T21B 2XPGA 3RGVB 2HFEB 4HHAB 2BXZA 5I8EA 2CXGA 3VXSA 1UWGL 3FZUC 4LSVH 4GXUM 3OKMA 1MI5E 4NN6B 3ALWA 1F4XL 4KMLB 2VC2L 3RUGB 2QSCH 3RQ3A 2IADB 1NGXB 2CR3A 1W72L 3D39D 3I6KA 3WE6B 3D69B 4OLWH 2BRRH 2JCCB 2VWEE 3BGMB 4YDJB 1NC4B 2BVUA 2UWEA 3G08B 3MJ9L 5FO8A 1MCIA 1KPUB 3CCHB 3T08A 2XWJA 3CXHK 3QUZA 4RQQB 4D0DA 4FNLL 2WANA 4MNGA 2BSSA 2ESVA 4LSSH 3IJYA 3GSOA 5CINH 1ADQL 1RIHL 2ZSWB 2JJSA 4KGJA 5FHBH 3HZMB 4DCQB 4BZ2H 4X98A 2ZOLA 3A6OA 2W92A 2IAMB 5C2BH 5EPMB 1IGFH 5ADOH 1T2QL 4ZUVB 3U83A 4AEHH 4U2ZA 1FL5B 1X5KA 4I4WB 4L29B 3PWLA 2VKWA 1HXYA 4HK0B 3TWCL 3RI5F 3EJZC 5E99L 3I6GB 3VXPB 4MB4A 1BOYA 1RUAL 5DR5H 1YMMD 2N7BA 5D5MB 5F1OB 1QLRB 4OLYH 5I71B 3DI2B 4ZG1A 4FQCL 5D2LE 3MRNB 1TVBA 4V2CB 3IB4A 4KKLC 1W8NA 4DN3L 4F80A 4PJ5D 1IAOA 3NTCL 4PJHF 2Q86A 3CZFB 1AXTL 2Z9TA 4BM7A 2R1WA 3GMQA 4EI6A 5I1HH 4Q6IA 4DKEH 2F54A 4Y89A 5DMIL 1WEJH 3ES6B 1I1YB 2Q8AH 1O7VA 4POZD 4FQLL 3ILPB 2EDWA 4Z0XA 3U2SA 3WXVL 2Y5EA 3T2QA 4TUJA 4MJ4A 3LRHA 4GRWH 3O9WD 4WW2C 1H8SA 4NNPH 4F15B 5F1IB 3MLUH 4L3EB 2VLKA 3BAEH 3MJ9A 2GT9A 4IMLA 1H5BA 1NGYA 4PGEA 2VYRE 3G5YB 4QOKD 2F53A 3FQRB 5E5MA 5E8OB 4CN4A 1A4JA 2BRQA 3TYGH 2J6EL 2ZUXA 3EJZD 3GMLB 4U1SA 4Z7VF 1N59B 5HDOA 5CCKH 4GKSB 5GZNC 4U33A 3UTZB 5JO5A 4TSAH 4S11A 4M3KB 1KJMA 3R06B 1VEOA 4OTXH 4QHUB 5D6DC 2BHYA 4M1DH 1C16A 3QUMB 1LD9A 3R1GL 5J11B 4GT7A 4K2UL 1ITBB 4DGIH 2DOCA 1U8NA 1A5FL 1QQDB 2DI9A 4KTDL 4KROC 2CKBH 4X8XA 4NUJB 4C58B 5F9OH 4YHML 4S0TD 1D6VH 5BVPL 4WW1A 4L4TD 5BOZG 2CPCA 5F7EH 5F3BB 3RX5A 4FQIH 5IMLA 1ZHKA 1QZ1A 1CFBA 2OR9H 1YY9C 5CUSL 1A3LL 2DIJA 3LKOA 2D2OA 4NHUB 3BGAA 4UUJB 4OCLC 4MHHG 5E7FA 4I9WE 4LU5H 4G8EA 5F7DA 4DAGH 4GMSH 1UZ6E 4X6DB 2NY5L 4WGVB 3QXAB 2F15A 2KKQA 2A6JB 1J10A 1A6ZB 1BZ7B 2XKNA 1QLFA 1A6VH 3MXVL 4JPKL 4PJEF 3PL6D 3VXNB 4P2QE 3X12B 4P3CL 1SEBA 4HJ0C 5GGQH 4M43H 2NXZB 1WZ1L 5EU6A 3MV9E 4ODVL 3AMLA 4WENB 1JWUB 2YUWA 4BSVB 3QUMH 5DA0B 1P9MA 5KBNC 4MDJA 3N9GH 3AREA 3NCJL 2BHUA 3DRTA 4APQB 4YR6B 4NBXB 1IZJA 1Q0XH 2OCFD 4Z78B 2XXMB 4Z7UF 4JRXD 3V6FB 1W72B 5FYJE 4L3ED 2R0WH 4EEEA 1RUAH 5DR5L 3WJLA 1Z3GL 1BJMA 4I0PB 2IPKA 1DBJL 2P5EB 4E41B 4G6MH 4APQC 1XGQA 1IGMH 3BHBB 4UNVA 3O11A 4HWUA 1CDBA 4BZ2L 1G7HA 5IFHL 4GRWB 1QFWI 2FGZA 2HJKA 4LVHC 3WV0A 1WZLA 5K93A 3JBG7 3M17B 5D2NE 1RJYA 3F7QA 1UH2A 5ILTL 1I8KB 3QUXC 1VEPA 4KXZH 3FQUA 2QSVA 1CG9A 1HNGA 1NH6A 4IJ3C 3ESUF 1FGVH 2XZCL 3B6SA 3OXSA 4PRNB 4H0IA 4LNVA 4QRPA 4R96B 1FSKB 3TN0D 3G6AB 1QFWH 1L7TH 4EOWH 1IKFL 3MLUL 4BQ8A 1TVDA 2LU3A 4JZOA 3SGKC 3CVIL 2HAZA 1F8TL 4HS3B 4XHJC 1JF5A 3MO1A 2I9TB 1HHJB 4JO3L 1UJ3C 4JDTH 2OL3L 3O3BA 4TRPL 2HFGL 1I1RA 2XTLA 1WTLA 4GMSL 1JNNL 4JGUA 3MREB 4M9PA 5C0AE 2VXVH 2VDMH 4OSUL 4I48A 3PWPD 1FG2B 5DD5L 3LRSA 4RRPG 5C8JB 3S98A 4HJJH 1MCOH 3RY5A 2KUTA 5DWUL 4IS6A 4PLKC 3MZGB 1I7TA 4PG9A 4X5XA 5DK3A 4PJ7A 1S78C 1UH3A 3PHOB 3H9HB 2W60A 4ZS6C 2DL2A 3L3JA 4JY4B 3JV4A 1WFNA 3L3DB 2AJXL 3G5ZA 4W6WB 1HI6B 4HDIB 2D0GA 3V0VA 1X7QA 4WCYH 1U95A 4P2RB 4B7LA 4E0RB 2R0LL 1G1YA 5B8CC 1NCUA 4XT1C 4FS0A 1FAKT 5GRVK 3KDMB 1JHLH 1N64H 4F7PB 4MHHI 1LDPH 4PR5B 1T83A 4QEGA 3T0DA 3F58L 1IGJA 3FN0L 3LEXA 5MEOB 4H26B 1IGML 4WI5A 1FZKA 2R0KL 5D1ZB 3T3ME 2G60H 5F1KC 1HQRB 3CDFA 5DJCA 5HDQL 3B4NA 2VXQH 5F7FA 3SGKA 2EYTA 1IEHA 3D2UA 2HWZL 2XICA 5AWNL 2XKUA 3HZYA 2HVKA 4PJFA 2IG2L 4NO0A 3IETA 4LAQL 3BIKB 4KVCL 1AC6A 2DWEB 3HG1E 4J1UA 2OL3B 2P5ED 2IC2A 5GSVA 3HS0B 1KT2B 4RWHA 1QFPA 2YPLE 4MA3A 5IB4A 1JTPA 4CW1B 3LMJH 2J4WL 2BSRA 3IFLH 3T0EB 1YEIL 4A6YB 5FECA 5I75C 1FZOB 1ZGLM 1N4XH 1A9BA 4OIIL 3I6LD 1J87A 4KMTL 3BPOB 2XI9A 2Z0BA 3BDBA 4GSDL 3MBEC 4XNUL 1NGPH 5EORH 3QDJB 3ECBA 3NIGF 5FYKL 4KZEL 3VFSB 4OCNC 2YD5A 1BD2D 4BK5A 4PY8I 4K3GA 3C08H 4Y2OA 2JB5H 1RJZB 4X9FA 4GQPH 1BLNA 2CDGA 2UVFA 2EDTA 4KRPB 4OUOA 3ZKXC 5IUSA 1JNHB 3HI5L 3VXRA 4WV1B 2CDEB 1HHKB 4WWKB 2DLGA 1NLDL 5B38A 4G9FD 4R2GD 5B3NA 2P8PA 1NGZB 3OG6B 3UTTB 3L5JA 1F58L 2YD1A 4NNXB 3FMGH 4FFZL 5I1EL 3Q5TA 1NSNH 1GPOL 5DJ6A 1RVFL 2YS4A 3PWJB 4OZIE 2CLVB 3KXFA 2B1HH 3N85H 4KKCD 3JV5A 1CD1A 5I15H 4PRAA 5D1ZD 1N6VA 3F7RA 2G5RA 3U0WH 4LEOB 1OAXH 3HR5A 5BXFA 4ZFOB 2VDNH 3I85A 4BKLA 3AMKA 2BY0A 4QRQB 1SJEB 3OB0H 4UIKL 4AMKH 1CGXA 1KCKA 3SDCA 2UWEF 2QSQA 4LLUB 3S35L 3MR9A 5SV3A 4HJGA 4MJIE 5E2JA 4ZUSB 5I9QC 4M6ML 1NGQH 5GGTA 2Y72A 2P46B 1AHWB 4FFVC 1HINL 1LNUA 4YUEH 1U6AL 4M5YH 1IMHC 1A6AA 1HHIA 5GS1B 43C9A 5L2JA 3GKWL 4CMMA 4TSCL 3JWDC 3P30L 1MHCB 4DFIA 1AO7B 2APBA 1GH7A 1IAKB 4A2MA 1K4CA 3QNZA 2Y5TB 5JORA 1AGFA 3VXRD 2Z8WC 4QHKI 2AGJH 5FCUL 3VI4F 4S1RH 5KSAD 1TVHA 1I7RB 5I19L 4TULL 3IF1A 3TBSA 2VUYA 3PJSB 3IDNB 5E1AA 4BA8A 3I02B 4L8SC 5C09B 4H88L 1BWWA 4J3SA 1MCRA 1P1ZA 5I1HL 3LOWA 3VGAC 1INEH 1KLUA 3IFPA 3S7GA 1YQVH 2VDNL 5BRZD 4Y2DD 5DXWA 2LFGA 4ODXB 5CD3B 5F9JB 4YFLF 4L9LA 3O4OC 5M94B 4ZSOB 1NL0L 4LNRB 4O02L 1C5BH 3E6HB 3O2WL 5DQ9B 4PJGB 3FHAA 4OQTH 5GRYA 4NQDB 4OD1H 1E4XH 1FDLL 2ZUQC 2W9EH 1FNAA 1N6QH 4QF1A 4HD9A 4MYWB 1X5JA 3SE9L 1OTTD 3MMEB 4Q2ZA 1X5ZA 5JA9A 1HIMH 3H9YA 1M7XA 4TSBL 2DYPB 5ESQB 2YR3A 4AIZA 5B39A 3PV6A 2W07A 4PB9L 3IGAB 1YDPB 5SX5H 4NSKA 1AIFB 3CC5B 3GJFH 4OD2B 5EBLB 1K8IB 4UQ3B 4N1HB 1EBAA 2AXFB 2L7UA 3MACL 1A7PL 1VADA 5F70A 5F88B 1PLGH 3OPZL 2IFFL 5CSZA 3MRPB 4U3HA 1AKJA 5TGBA 3ZTJG 1RULH 5J8OA 3UPAA 1T0PB 5EORL 1HHHA 1CFQB 1HWGB 5I1KH 2HJFB 3X3GL 3F8UB 3T0XA 1PZUB 4L8CA 2A74B 2PKDA 3LEYH 4J3TA 2BVTA 2FATH 4XNMB 5IHUL 4YDIH 5E8PA 1AJ7L 3MNVA 1F4XH 1EAPA 1ZVYA 3MRGB 3MOAH 2GTZB 1E4JA 3KPLB 2EICA 1BQHA 4UT7L 4AM0B 1D9KB 1U92B 4PV8A 3VW3L 1DBJH 4F7MA 5DUML 2V7NA 3HE7D 4I2XE 2PYEB 4PB0L 1SJVA 4QGTA 2W9EL 4X7TA 3VA2C 1P4LB 3MCKB 3PQYD 4UBDD 4I13B 5BS0A 5T3XH 4OF3A 4CJ1A 4I18A 4MWFA 4JPIA 3ABZA 3KPRD 4M7JH 1QUNA 2CR6A 2O5YH 4MD4A 4D9RD 1BX2A 1YMHB 5EFIB 3B8SA 3IU3B 5DD0L 4CNIB 5I8KH 3HZVA 4R3SB 4HGWA 2HRPH 5EO0A 3WNKA 3H7BA 3D6GA 2NY1D 3WIHA 3T2OA 3LQAH 3W9DB 3TEUA 1DFBL 4IDLA 3IXAB 4GO6B 4WWID 4U1IA 4Z7NF 3ULUE 5C1MB 4YC2B 3S5LA 3HC4L 1ZV5A 2B1HL 4WV1C 2AI0H 4PP2B 4XCCH 4P9HL 1UEYA 1LP9F 2ZG3A 5C70A 3DX8B 2EDBA 3TIEA 3EGSB 1BFVH 1MCQA 3NCYP 3FTGA 5ITFA 3U82B 4J3OC 4Z7UA 3VWKA 4K23H 3BMWA 1NKRA 4MA7H 4KKLD 2VLRE 3DGGA 5I76B 1WTGT 5D1XA 3SKMB 1P4IH 2PYFB 5L7XH 3L1OH 1TNNA 2J6EA 5BVJB 5CIPB 5DMGC 1A0QL 5C0CA 1LE5B 1M05A 1F3JB 1QSFB 4JDZA 3LKQA 5SWSD 5DHYB 5D1QB 3KYOB 4HKBB 3P4OA 5D7LD 1QYGL 5INDB 1AGCB 5E2WH 5L9DL 3HC3L 5CS7A 2E9BA 4OZFA 2IMMA 3ARVA 5KVMC 4K71C 1TETL 1B0GA 2D7TL 2CKBA 5EO1B 3RGHA 3MLTB 3HE7B 3WD5L 4KMQA 3DMMD 2ZCLH 2FL5A 4TTDD 1CL7H 3EOBB 1NBQA 5JW3H 4P2YA 2DICA 5FGBC 4Z7WE 1FNFA 4Y2DA 4Z76A 4XCFL 5CZKA 1ZHLA 4N0CC 3MUJA 5GZND 2FBOJ 4KTEL 1G0XA 4WU7A 5TF1H 4LGRB 4FQQB 2D9CA 3L3GA 4P5TD 3VFUB 2PTTA 4U2YA 3HFMH 5F9AC 1N8ZA 3AAZB 4NGHL 3WL9B 4MQ7B 1J8HE 4RAHA 5IV2A 3QDMB 2HLAA 2VXVL 4YPGA 5EN2A 2IH3B 2NY4C 5CP3A 4N5ED 3D87B 8CGTA 3OHXA 2ERJB 4Q58C 4PS4L 1P4IL 1T5WB 3EHBC 2AEQH 43CAA 3ROLA 2OTUA 3ULVE 4BYHA 3HC4H 4KHXL 5LXGL 4EXKA 2V7HB 2JF1A 4U1KB 3EO0B 3O3DB 4G80A 4NM4L 3NZ8B 3CH1B 2GJ6D 3TZVC 1A6TB 4Q74A 4NWTL 5HHMD 2NX5E 3CU1A 2IALA 4OGZA 1Y6NR 3GRWL 4TNVK 4LLQB 2H2PD 1ZHBB 1BBJA 1QACA 1CFSA 4MA1C 2A83B 1GL4B 1TDQA 5FUOL 5TDNB 3ZE0F 3MLRL 4MD0B 1IAIH 4RZCB 1SYVA 2C26A 4K8RC 5E00B 3VXQA 3SCMA 4QTHA 3HE6A 1M7DB 2XA8H 2E7LA 3U46A 4MNQB 4KDWA 1GGBL 2UYLA 1HEZA 4HW6A 1CGTA 1S7WA 2FJHB 4WUUD 4XCFH 2NYYC 3RIAK 3BE1L 3OAYH 3TVMB 5DI8A 1A7OL 4N0FB 1OTSC 1NFIB 5KVGL 3CVIH 3QZWB 4ZS7H 4ZTOH 4XNYL 4MNHA 5CKAA 2NPLX 1RZJL 3GI8H 3UTSD 1ZT1B 3SDYL 3REWB 3U4BL 1QBAA 3LZFL 2BVYA 4O51B 4MB3A 5IW3A 1MIEH 2JIXB 2HKFH 1ZHNA 4NBZB 3PL6B 3H0TB 4Y4HA 1EFXB 1AXIB 2X05A 1ZE3C 1BVLA 4LSTL 4PJXB 1YNTA 1O0VA 3IFOB 3U30B 2FHFA 3O8XA 1PYWB 1JF6A 4PLJC 3V6OC 1T83C 2Y9RT 4DEPC 4BSWB 1JPGA 4R4BA 1CR9H 3AUVA 4P48A 2WP3O 1WIOA 4OCWL 4H8WL 1FGNH 4ODHH 1T22A 1NCBH 2E5EA 3C09C 2AJYH 1DUYB 5DTFA 3BH9B 5FYLD 3GKWH 1X3DA 5E6IA 3MLPA 3NCFB 4WUUE 2D03H 1JPTH 3PWVA 1OSPH 3RL1B 3QULB 1SVZA 2JJTA 4JRXB 5CEZL 3EFDL 2ZOKA 5DSCA 2IAMC 4JFFD 4KGLA 1DVFA 1G7PB 1D7FA 3GMMA 1S7VA 4OQTL 2FD6L 4ZFGL 1NGPL 4MJ2A 4HV8B 4LDLB 1LQSR 5FYLE 3W11C 5A2FA 2R2EA 4LDEB 3SBWA 1FV1B 4IOFD 1AI1H 1GJIA 3K81A 1SY6H 3FO2B 3VXMB 1S7SA 5E2TL 4JG1H 5TE4L 5DK2B 3EYVA 5H94A 4G8GD 2GYSA 1FIGH 2FCBA 1GZPB 4K3DL 4I8DA 4EIGB 2IH1A 1DQTA 3IFNL 3VG9C 3G04A 3X3FL 1FG9C 4NDMB 5FA3B 3JV6A 4FG6D 1ZANH 5TF0A 3D3VE 4OD1L 1U8QA 3L95B 3BN9D 3N0PB 4NP4H 4P2OB 1MPAL 2O5XL 4LMQI 5DEFA 4NKQB 2SEBB 5DZLA 3U1SL 1BF8A 4FQ2L 3A6BL 1IM3B 2BNUB 5D7LB 3FO1A 5JPMA 1CU4L 5JHLH 5KZCD 5DGQA 2A9ML 1VFBA 3VWJC 1HH9B 4TQEH 4HXAH 3C08L 1F3DH 2NTFB 3GBMH 4J4PC 4PJXE 2Y36L 1IGFL 1LEGA 5E6IC 1Z9OA 3QI9B 3L9RA 5D93C 4RFOL 3P73A 1NC2B 4M6MH 3WLWD 3HKFA 2M1KA 4Y5XB 3QUML 3WJJA 2A77L 1A7QH 1BQUA 1J05B 2A1WH 4L5FH 3KGRA 4JG0H 3UTQA 5I2IA 3UROR 1HINH 1RZ7L 5B4MC 1Q9KA 2R4RL 2ED7A 1YYMH 1SBSH 4JKPH 12E8L 2ILLA 3ZSSA 3MRHA 4GKZB 4KXZI 5EIVA 4RAVA 3C6SA 2AXGA 4LCWB 4V2BA 3BKMH 1CXEA 4PS4H 5I15L 3DOSA 3MA7A 3V79C 5E8DL 1RK1A 1ZA3B 2IPUK 1JV5B 2L4OA 4M8QA 2V9TA 4M61B 1OF2A 3FB6B 4HZLA 3TBYB 1ZA6A 4Z7WB 2BSTA 1FYTB 4FXLA 1OWRM 5HD8D 1N2RB 4DUWA 3KYMB 4HXBH 1UWXK 3CZJA 3PWNB 1YEJH 4NFCA 1BREA 4LCUA 4ODUA 3UMTA 4BZ1L 4LAJH 3WFCL 4OGYH 1T7VA 3BEWB 5BZWA 3MJ7A 4RBPH 4GRWE 5F3HB 2FGWL 1KFAH 4G8IA 1INEL 2V5RA 4TUOB 4MSWA 1D5MA 4XWOC 1OD9A 5TQ0L 4Z7QF 2ADJB 4NRZB 1RHHB 1S9YA 1IGTA 2VQTA 4LSUL 4EIZC 2FB4H 4TQEL 5GS0D 2A6IA 3FB7A 4LLYB 3UDWA 3THMH 4FNLH 2QKIA 4FQJL 4K2UH 3U1SH 4EI5C 4IOIA 4F7CA 3OX8A 4XNUH 4Y19E 4QXGL 1NCWH 4WDIA 4U1LA 3QIBA 1ZVSB 3RKDD 4P46A 3TN0B 2FNBA 2ICWA 5KVDL 1I9RL 3SE3C 4FHBD 8FABA 3OAYK 2BJMH 1EMTL 1YQ2A 2YPLA 3TO4B 5GGTH 4TTGA 1A3LH 1NEUA 3O6LL 1PG7H 5JHDA 5I1JL 2GFBB 4ODSL 5C08A 3LSOB 4HCRL 5C0ND 2Q7YB 5MENB 3ULUL 5SWZB 1I8MB 3HI6L 3RP1A 3SE8L 1OQOA 4MXWH 5TH2B 5BS0E 3RU8L 4NQDD 2EYSA 5I8CA 4ELME 3KLAB 3EFDH 3FOMB 4C57C 5LGJB 4AMKL 4LPCA 2HRPL 1D5BA 1AQKH 2ADFL 3B2VL 3QZWG 3CK0H 4RA3A 3TZVB 1H3PH 1U8OA 5TQ0H 5E2UL 4M62H 4AEIH 3I3DA 1D5IL 3HUJB 4KJYB 5JW5A 4XH2A 3TF7C 1E4WH 3WNOA 3GBNL 2H8PB 3KPRE 2XQYK 5SWZD 3U7WL 2B5IB 1EIBA 3U7YL 3NPZB 1B90A 1DQJB 4ODWB 3TBWA 1XEDA 2ZUUA 5CEZD 2NX5A 3QJHA 5KSAC 2DRUA 4M1CC 3FO9A 1H0DA 5JOFB 4G3YH 5FGSA 3B5HA 1DEEB 2XTJE 4NYLB 4F3FB 1Q1JH 4R2GB 4HCRA 3DMMB 4U3CA 4HPOL 1TENA 4PBVC 4Y2DC 3GSXB 4OM1L 4WHTB 1UZ6F 2IPUG 3BP7A 4ZPTB 3CFKB 4B7IA 5I30L 4TULH 5FYKU 5L6YL 3ARGD 4PJ5E 4X5WA 5CD5D 3ULUH 1V7ML 4RFEA 1ED3B 2X89A 5KVDH 3F7VA 5LG1A 4KKBC 1TCRB 5KVEH 2X4QA 1TZGH 1JK8A 5IW1B 4YDVA 2VAAB 1KACB 2CLZB 4Y5YA 3IRZA 3AS1A 1TCMA 3HPLB 2DB8A 3VMOA 3V0WL 5IMKA 2DDQL 4OF8A 3V5KA 5I71C 1F5WA 1GOGA 4KJQD 5T1KB 4UINH 5F21B 3RGVC 1S7RB 1RUMH 5HI4C 1KCVH 4AJ0A 4AIOA 1FVCA 4YNYA 3LPWA 2Z91A 4IRSD 2G9HA 1FNLA 5FHAH 1DEDA 5GGUA 4Q0XH 2MSPA 2JELH 5C09E 2YD9A 5SX4H 3FT2B 4NZRL 3C09B 1XR8A 4Q9CA 2DM2A 4PP1C 5CKGA 3LZFH 4EI5A 1P2CA 2HVJB 3KPPA 3O6ML 2VOTA 4ODVH 4U1GB 3OAZH 1AR1C 4X4XA 2NY0D 3KYNA 5GJSL 1U8LA 3C2SA 4PRIE 3D25A 1ZGLP 4YHZH 2IEPA 2C4FT 3U4EA 4FQ1H 4M7ZB 1KB9J 4I5BB 4PTUB 2X1WL 4LCWE 1VEMA 3MLRH 2VABA 3QH3B 3A0OA 2J7LA 1E6JH 4KFZC 4TVPD 4OM0H 2IGFH 3OZ9H 3K1KC 3W9EA 3Q6GH 1AFVH 5BO1L 2RQ8A 1ORQB 1K4DA 4LKXB 2YSSB 4LVEA 2R69H 1A22B 4Y5VB 5A16A 4W6YB 5I1DB 5IFJA 2EKSA 3LN4B 3WJLC 3PP3H 3UXFA 3MXWH 5F8RC 5C0BA 1Y18A 4KI5E 2YHGA 1KN2L 5HGAB 3RBGA 2QEJA 4UDTA 3DUUA 4NHCH 4CGTA 1HKLH 4IMKA 6CGTA 4RGNE 3QG7L 3FQNA 2IPTH 4DFHA 1S7TA 2BCKB 4WI6A 1I1FA 2C1PA 3MJ8B 3L5WA 3O6FA 3CFEB 4N9GB 2F8XC 3MLVH 2PO6B 1BFVL 2FX7H 5KSBF 3TJEH 1QRNB 3DSFL 4LCCB 5EU4A 4DQOH 5EZLB 2N56A 3WSQL 5B22A 4L8BA 2FH8A 4ZAKA 1B9ZA 3RVXD 2YA0A 1EX0A 3K2UH 4ODBD 5ISZB 1Y6MR 4PJDA 1J8HA 5D2LB 2WAHA 4LF3B 1NAMA 3HAEH 1HILB 4CBPA 1OPGH 2XA3A 3SDAD 3LRGA 2BZDA 2EC9T 2NXZC 5FM5O 3RBSA 4JZJA 5T1LA 4XVTL 1IT9L 4JHWH 2EXYD 3QA3A 1U8JB 1F6LL 2VDKH 3O8XC 4Z0BL 5B21A 4WUUB 5C0GB 1ZVHA 3B9KC 1Q1JL 2Z31D 1DL7H 3KR3L 1K2DB 2NY7H 4AEEA 3H9SA 4G9DB 5DUPL 5HYFA 3DLQR 4TVSa 5T3ZH 5KANI 3QB7C 4CVWA 1B4JH 2XTJD 4R6UA 1QBBA 1HKLL 5D6CA 2GY7B 1Q72L 5CUSH 2HT2D 3UTSB 4S1QH 4N5EC 1C12A 4MCYB 4X6CB 4AT6A 5I16B 5KTEL 3PIQA 4LCIH 4H0HB 5DMYA 1E6OL 1MI5B 3IDIB 1H5BC 2C3XA 5IR1A 1JF1B 4WI8A 1YEFH 4X6FA 1UH4A 3Q5OA 4BQ6A 3DROA 1MY7A 4EUPA 5ADPL 5LAXA 3LKSB 2ARWA 1T2XA 3X13A 1DDHA 5L2KA 3QT2A 4LHUA 1FNHA 5EU7C 5FF6B 1R3LB 4Z7VA 4F9LA 1AGBB 3CDCA 4QT5B 3S88L 4P99A 2ICCA 4X6BA 4GS7C 5CBEA 3MUGB 4G6ML 3ZDXF 2X70A 1MAML 1MHEB 3E2HB 4JN2A 3RWEB 3KHQA 5C07B 2YC1A 2DLEA 3U9UA 1J0HA 4JM2A 1CICD 4YHYC 3V6ZA 2NYYD 2EDOA 4H0GA 4M1GH 1NPUA 1OTSD 3GRWA 3ARFB 1S5HB 4NO3A 4FMKA 1D5XB 2ZSVA 2DWDA 1XH3A 5SWSA 1IGIH 4NNYB 3KPMA 4MNQE 4WFGE 1ZLUH 1A7NH 2YEZB 4E5XB 5IEHA 4OFVA 2CJUL 4OLEA 4I2XA 2FEEI 5DJ0A 1CQYA 1QR1B 4QTIH 3DUHA 2OZ4H 3MV7B 3UZEA 4GSDH 4JY5H 3EOTL 1G9MC 3QQ3A 3VG0H 4D2NA 4MDIA 4CU7A 5EO9A 3QIUB 4DGYH 5HYSB 3PWUB 3MA9L 1VFOA 1IQWL 5DC9B 4CMHC 3K8KA 1NFKA 1MEXH 3DXAA 4K94C 1MUJB 1U8HA 4H5SA 4P2QD 1MCPH 2X4NA 1CDUA 4KPHH 1D6EA 2XZQH 5EZOH 4G9FB 1A3RH 2DQJH 5CJXA 1FBIH 1HDMB 1FLTX 2GAZB 2PW2B 1JUFA 4M00A 5IQ9A 3KNBA 4HUKB 4NKDB 5EOTB 3DVFA 4GG8B 5DT1L 2LAAA 5ESAA 3REVB 2YBRA 4V1DB 3CX5J 5A2JH 3DV4B 1RJLA 4X4MA 2CD0A 2NY3C 4HAFA 5ITBL 3OKOA 2LV4A 4YDIL 1T5XB 2A6DA 1EHXA 3U79A 5EZJA 4MA8H 1JBJA 4R26L 4JY6A 3SDAA 4GBXA 2XG5A 4PJHB 4O2CB 3SCMD 1MCBA 2Z31A 3DURB 4QRSA 1TLKA 1P4BH 4PRIB 4O5LL 1KEMH 1RZGB 3CFCH 3HLAA 4NCC2 4UT6H 3FQWB 3ZKXB 2CIIB 5JMOC 2DM4A 3P0YL 5GZOC 3WIIL 2Q1EA 1UKSA 2HFEA 4HHAA 2W91A 5I8EB 3VXSB 2YD2A 1J0KA 1II4E 2XN9B 2AK4A 3OKMB 3VFOA 2AKRB 3GK8H 3T3PF 5I6XB 2VXUL 4LPYA 5E24E 4K7PY 4OKVA 4N0YH 1F6AB 1YN6A 1QFWM 1MQKH 1MEXL 1QLEL 2B4CH 2VL5B 2WWMD 1BWMA 3GI9H 5KW9L 4PJ8C 2JK5B 1QSFE 3S37L 4NQCD 2FEDD 1XCQA 2A6KA 5EZOL 2VZVA 1UZ8A 1YEGL 3LS5H 4YDLB 4HC1L 2YK1L 3CCHA 2B8OT 2XNAB 3JVGA 5E6ID 4ZNCD 5F97E 5BV7C 4YX2L 3RZCB 3DO7A 3H3KA 1LILA 4KHTL 1KBGL 1RZ7H 5JPNA 3TA3A 4L8DB 3HZMA 1CIDA 3ARBA 1VPOL 32C2B 5F96L 3ARUA 3MACH 3C6LC 5JUEL 4PIRF 3MLSL 4Y4KD 2JLLA 3ZDYF 4KY1L 4NQCA 1NDMB 4QHMA 3UBXI 3KPOB 1YJDH 3WHXA 4EUPH 4CVXB 3X14B 1RFDH 3AU1A 5H2BA 4M7KH 2VLLA 5DVKA 3EDDA 2EE3A 3LEVL 3EDKA 4XVUD 3HHRB 4N8CL 5D7JD 3MRNA 4AG4H 3U7WH 2QQLH 1HE7A 3VGHA 1SJHA 5FGCE 2P24B 3JZ7A 2FO1A 1OAKH 4LHQB 2R1WB 1OB1A 4HEME 4XPFL 4JR9H 2F54B 1XIWC 4N68A 5T1KD 2PYEE 3V8OA 1EJ6A 4WW2A 1FL3A 2HTLC 3U2SB 1QHPA 5HHNB 1FO0B 1T7ZA 4TUJB 1CTNA 5F1IA 4DKFL 5KANG 3LDBC 3B9AA 1Q0YH 3MFFB 2VO5A 1CGYA 2WQRA 5E2TH 5MEQB 3GUTB 4GH7B 2PN5A 4BZ1H 4HWZA 3SE4A 1KBGH 1XIWB 3F6IA 3OMZA 3GGWB 4DVBB 3MRLB 2F53B 3FQRA 4MLSA 5E5MB 3CFDB 4HAGA 1NMCB 4HGKC 5E9DB 1Q94B 5MP6H 4CJ0A 3MXVH 2OX5A 3EYQC 3GMLA 3P30H 4YHYB 1N59A 1UQSA 4NQEB 5ICXB 5HY9B 3LPGA 3LVEA 5D5ME 3R06A 1G6RL 3SDCD 1U8IA 1CZ8L 2X4SA 5CZXD 5C08E 1EK3A 1QBLL 3KS0H 3W0WB 3H42L 5GRXG 4LLMA 3BESR 3DETC 1DANU 5SWQA 3FO0H 4Z18A 1KCRL 2Z93B 2BMKB 1CFNA 1I8IB 1IC7L 1X5IA 3JTSB 5DYOB 2UY6A 5DD1H 3MRMB 4KRNA 4HMEA 1RMFL 2NLJA 3EDJA 3RIFF 2HTLD 2IMNA 5EULV 5A3ID 3SPVB 1AR2A 5INCA 1F90L 2KZ1B 3RPIB 1T6WA 5DJXB 1P4BL 4R97C 1YEKH 3G9VA 4PJGE 5F3BA 2K7PA 3KLHC 5I18H 2JCCE 5IMLB 1ZHKB 5EC1A 3DYOA 2X1XR 4NWUH 1ZT7B 4ZOCA 2FLRT 4UT9H 5LGHL 1BFTA 3AM8A 4HCRH 3WUWB 4P23A 5DK0A 4JREC 5FO7B 4O58L 4MXWL 4YZFF 3P40A 1CICB 3MRBB 2VMFA 4BFEA 4LEXL 4X9HA 4P4KD 4H20H 4LKCA 5D7SH 5F7NC 4Z7WF 3JUZA 1B6UA 1NMAL 5E94B 2BERA 4KRPD 1G0DA 4XTRD 1XF5A 2NY3B 3WLBB 3O2VL 1SEBB 1MLBB 1CXFA 2CMRL 5D9SB 3S3PA 4JZJC 3H7LA 3PNWA 4ZTPL 2NZ9D 2X7LB 5BOPA 5ID0B 3KYAA 4BSVA 5BW7C 4MDJB 2HN7A 1P69B 4E42A 4KWUA 1UM4H 4C59B 4EDWH 4G6AC 4Z78A 1FYHB 3VD4A 3ZL4H 4ZUUA 2OR7A 5AG8A 3UJJL 1T1ZA 4JQXC 4Y4HD 3V6FA 3V4UH 4XP5H 3CXHJ 3IDXL 5T3XE 4XPTH 2O5ZH 1JZ5A 3RDTD 1QRNE 1R0AL 2IBBA 1WAAA 3GSQB 1XGQB 5GHWH 3EO1B 1V3KA 3EKCA 1G7HB 1G84A 5JOPD 3T0AA 4F8TA 1HZHH 4FTVA 5IHBA 1CFTA 5T33H 2FHCA 2R4SH 1YEEH 3TCLA 2NY5C 3FT4B 2GSGB 1RJYB 1CLCA 3T65A 3MROA 1RZFH 2ZCHH 4ZXBD 1AGDB 3QIUC 5D7LE 3I6LE 3J7HA 2VLMD 4TUKH 4ZO6A 4XBEL 3FQUB 4M7KL 4PJ8B 3B6SB 5TPWL 3OXSB 2Q20A 5A43C 1EO8L 1WQVT 3OBAA 3S36X 4JJ5B 2DLTA 2IAND 2Y7QA 3SQOL 3G6AA 3QG7H 1R3KA 4LSDA 3TM6A 3H9SD 3QCUH 4NN7B 1G6RB 5C0IA 4R90H 3SE8H 3IAQA 4KMTH 2XWBA 3JWDH 2I9TA 1U93B 1HHJA 2CK0L 4JY5L 1XGUB 4G6AD 1JJUA 5FUZH 2X10A 1IGCL 5CIPH 1DQLH 4JN1L 2I26N 4MB5A 2WUCH 1QRND 5EG6C 3FL7A 1IKFH 4TSAL 4XRCA 2JJSC 4PJDF 1FZMB 3CGTA 2XZQL 1EHLL 5I8OH 1I7TB 4PG9B 5GS3A 5C9JA 1AP2A 5DC0A 4JPVH 4PJ7B 3JUYA 3MV9A 1RIVH 3H9HA 4HPYH 4IRZH 3L3JB 5F71A 4TVPL 1WC7B 3DX7B 1RJCA 2ICEA 4P5TA 1MJ8L 3BQUB 2OK0H 3C60A 4P2RA 4E0RA 2J5LB 3HZKB 4UAOC 3FB5B 1S7UA 3KDMA 3MV8A 4MXQC 4BJLA 4NN6C 1CL7L 3A67L 2ERJC 4X4YB 4DEPB 3WYRA 1QBMH 4NPYB 4XBEH 2XFXA 2VDQH 5MEOA 5IHZA 2MCPL 1RQ5A 3QCUL 1FZKB 5D1ZA 1WISA 3C9NA 4FFZH 5I1EH 3ARSA 1BZQK 4UAOB 2EYTB 2L0DA 3V52L 3I3EA 3RVWD 1MREH 1T0MA 4WY7L 4JB9L 1ZEAH 3D18B 1IBGL 5FOBB 2ZCHL 3HG1A 4NO0B 3BIKA 2OL3A 4Y16C 1H3XA 1KT2A 4UQ2B 5E6ZA 4X6EB 4GW1B 1RZIA 2HYMA 1DE4B 5AYUL 2IPTL 3LS5L 5CEZH 4OCXL 4JKLA 1E27A 1F8TH 4QCIA 3C5SA 4D0BB 3LKRA 4LU5L 5DRNA 3VXUE 2EDXA 1S9VB 2GW5A 3EOAA 5E8NB 1Q9LB 2UUDK 3DPBA 1MCHA 3ZL4L 1JWSB 1MFDH 4F33A 1JTOA 2FR4B 4F9PA 1M1SA 1BHGA 2CDGB 1RV6X 3CIQA 1P84J 2H6PB 3NIFF 1URLA 5B38B 3D39B 3OR6A 1ZLVH 3MJGX 2Z31C 2P8PB 2OTPA 1NGZA 3IJHA 5T3ZL 1MWAH 1EMTH 3RJQB 2DMBA 1JHTB 4FQ2H 4DOHB 1DQMH 2E7CA 1B0WA 2ORBL 1VKXB 5HYJE 3QFDB 2Y1VA 1BZ9A 3GJFK 2XQYG 3RL2A 4Z0BH 3RVVC 2WLYA 1OAKL 3A6BH 3SGDI 2W1NA 4JFDB 3UX9B 1TQBC 4I3RL 4ELMB 3NZHH 3HR5B 5B3JE 1T7XA 4LHUD 3RWGB 1NMBH 1FRGL 2RFXB 4M7LT 2VR9A 1R5VA 4QRQA 3F6LA 2JCCF 1NEZA 3ULUD 5I74C 3CK0L 4LRIC 2GJZB 3MR9B 4KKAC 4E9LA 3MRDB 1S7XA 4ZUSA 2CRZA 4GRMA 5JMRA 3DUSA 3MXWL 1Y0LA 1MRFH 3QG6A 1IGCH 2I9LB 2BNQB 3QQ9C 1A7BA 3FZUD 1U3HC 4MD5B 4M7LL 5CZVH 1HHIB 43C9B 2PW1B 5DLML 1HOCA 2P8MB 1GZQB 5IFAL 1OSZB 4WRLA 1MFAH 5MI0C 1MHCA 1JPTL 1YMMA 5KS9A 1YPZB 3QNZB 3PWPA 4F7EA 2Y5TA 2AP2A 4YEFA 5JORB 3QUYC 4PRBB 3WN5B 4WWKC 1I9JH 3S4SG 4GUPA 3SGEH 4ZFFA 2GI7A 4WEBL 1MNUL 3C2AL 4OF5A 1A6WH 3QRGL 4JKMA 5K9JL 1OY3B 2B2XL 1YY8B 4MJ5B 2OR9L 5E2VL 1X5AA 2MTPA 4P9HC 1KPVB 4DKAA 1EZVY 3GSNB 3RVUD 4DZ8A 1KNOA 5JQ6H 1T89A 1QSEA 4HT1L 4K8RH 3U6RA 2EH7H 1G9ML 4NQCE 3H3PH 2O61A 4QRPD 4HIXL 4J6RH 5T3XD 1KIRA 5CGYC 5IIEB 5F9JA 5CD3A 1IVLA 4LNRA 2EXWC 4Y4KA 5BRZA 5I18L 4LSUH 4NQDA 3VI3F 1AD0B 4KI5F 3ZKQD 3MBEB 4XVSH 1ND0B 2O5XH 4QF1B 5IT2H 5I9QB 1BD2E 1UKTA 3VXUB 3MMEA 1EO5A 3MOBH 2AEPL 5LQBH 5ESQA 1NBVH 3S37X 4ORGA 4NSKB 1AIFA 4PFEA 4ENEC 2EC9U 3GSNL 4M62L 4POYA 2YPLD 3VH8G 5CSZB 4JQVC 1AKJB 2QV2A 2DL9A 1LK3H 1A6WL 3NFPA 3WFEL 5EIIB 1FORL 3MV7E 3RVUC 5HYJA 4U0RB 2AV1B 4B50A 2X4OA 4CVUA 2E9IA 4JCLA 4V1DD 1IGYA 2A74A 2ZUTA 1R24B 4LQFH 1KG0A 3QXDB 1A1MA 3PV7A 3L5HA 5ANME 3O4LB 5D96B 1IAIM 4PJAF 2VITA 3BKYL 1TJHH 1EAPB 4ZUTB 1HQ4B 1F42A 3E6FB 4XAWL 5GGVY 4UTBL 3KHOA 3ALPA 1D9KA 1U92A 4PV8B 4OZGB 4K94L 2K1MA 3P0VH 3E0GA 4KAQL 1MFBL 3QIWD 3QEQB 2ZUSA 3IDGB 2ZJSH 2OQJB 4PY8J 3W5NA 3MZTA 4L4VA 3GMOB 2F5AH 3CDGA 3NMEA 4G8FB 4NJAL 4YXLH 4HS6A 4UT7H 4ENED 4HWBA 3CLFH 3EIFA 1YMHA 2DLFH 1YNLH 3MNWA 4R3SA 2EKJA 2VDML 4OSUH 1A8JH 2D31B 3BFOA 2IWGA 1BIIA 4XI5D 3QFJD 4LCYA 3P9MB 1RZKC 4R4NC 4PP2A 3NCYS 5JOEA 3PUCA 4KK6D 3GSRB 3M1BA 4LP5A 4Q0XL 2VUOA 5EBWB 4P5KA 3TIEB 2FGWH 3WS3A 4WHYH 5D7JC 4NQSB 4Z7UB 5F6HI 3VWKB 1K8DB 5BV7L 3NBNA 1ZT4A 5JIKA 1YEHL 1TJGH 3DGGB 3VGEA 2VIRB 4KV5F 4UOJA 2R23B 5BVJA 1KC5L 5C0CB 5FUOH 4R4FL 4HJJL 4U6YA 4QNPF 4S1DD 1EHLH 1MVUB 1WIUA 1TZHA 1QSFA 4JDZB 3A6CL 5E2VH 4HKBA 5E6YA 5I17A 5C6TL 4GOSA 4FTVD 1L0QA 3P77A 1UC6A 5GRJL 3HNVL 4HIHB 2VR4A 3QIBC 3LDBB 3I2CH 5IVZB 4P5MA 1IRAY 3OJVC 3O3EB 5MEND 3HE7A 1C7SA 2XZZA 3O6MH 4PD4J 2OSLA 3OV6A 3D3VD 3PDDA 3PE9A 3V4VH 1FGVL 2XZCH 2VJXA 5DHVA 1QBML 1ETZB 1UJ3B 4EBQL 1VHPA 4HIEA 5MHSD 4Y2DB 4Z76B 2FWOA 3NAAH 3AB0B 5ALBH 5H37H 3GSWB 1G7QA 4M7ZC 3FQXB 4WU7B 1QHOA 3SDCC 1A14H 5KSUA 3TBVA 1IFHH 1P9MC 4XCNB 2APVA 1G9EA 4KK8C 3L3GB 3VFUA 4NKIH 2DF3A 4NKMA 1G9MH 1KF9B 1YEFL 4YLQT 4U6TA 3T4YA 3WL9A 1KCRH 1Q9OA 5IV2B 5FGBA 4HWNA 3FQTB 4NJ9H 4AQOA 2IH3A 2DQIL 3E1F1 2HG5B 1CN4A 5IBUB 4PJIB 1MIML 4GKNB 3CVHA 2V2XA 1V5JA 4HQQH 2HT4D 2OTUB 2WBJD 3PP4H 3B5TA 1KB9K 3BUYB 5IOPB 1BQLH 1ONQA 1A3QA 4P57A 3O3DA 4LPUA 4G80B 4PGDB 3K80A 4U6XA 2FJFB 1DCLA 5J12C 4HK3N 2GCYA 4JM2D 2X2YA 1KN2H 3LEYL 3I75A 4QRTB 3SDXA 3CSGA 1A7PH 3DV6B 3M07A 4XZUB 2OXHA 1A0QH 3OTTA 4IOSD 4Y1AB 1D6VL 1BQSA 3NN8B 3SCMB 3HE6B 4P2RD 3GJEA 1U42A 2UYLB 1BVKA 1S7WB 2FJHA 3IDUA 1VACB 3TVMA 5DI8B 2AJUH 5IGXL 1RVFH 3RZWA 2DI7A 1QA9A 2YN3A 1NEZG 1INQA 1P7KA 4WY7H 1DL7L 4UU9B 3OKNA 3QWRA 5DMJB 3MRJB 4U1MB 1T0NA 1T1YB 3CAFA 1N7ML 4PD4K 1GGBH 2C3WA 3REWA 2NY1B 3CFJA 3W39B 1AKJD 2GHWB 2UWEE 4KPHL 2C3VA 3H0TA 5ALBL 4JDVB 5HHOE 4XP5L 4RMUA 4OT1H 1WK0A 1YYLH 5IK3A 5IB3B 1R0AH 1JPGB 4XPHL 3WXWH 4RDQG 3AS0A 4XGZA 2NNAB 3DIFA 3KJ4C 4C4KO 3VRJA 4FQXC 2GQHA 4U6VL 2MHAA 3ULVD 1T1XA 5CJ8A 1QPXA 2A2QT 5C08D 2FBJL 4ONHA 1YNKL 5E5UB 4ODTL 4L8SB 2EEDA 3OAUL 4OZHB 4EVNA 4OZGF 3ETBF 3QULA 1JZ4A 1I9RH 3QUXA 4W81A 2R0WL 4HFWA 2ZOKB 1XZ0B 1G7PA 4BH7B 3BYTA 4Y16A 1PW3A 5GGTL 2Z8RA 4XPAH 1MF2H 4HV8A 4IRJD 3TBTA 1KCUH 1G7MA 3TVMC 1FV1A 5F93C 1Z9MA 1GIGL 3H8NA 4ELKB 5FEBA 1GC1C 1KLFA 5C0AA 4HWBH 5H94B 2EIZA 1LO5A 1J0YA 4N8VA 5ICYA 5DFVD 3GIZH 5FOJA 3ZKMD 4OM0L 1AHWC 2I5YH 5J9PA 1JYWA 5FA3A 4F7TB 2K3TA 2H26B 5C0RL 1UM5L 5HVFB 4S1SH 3SKOA 2BVQA 5KSVA 2R0ZL 1XT5A 4TNWK 1I1AB 1IEBB 2J8UA 4NGHH 2EDYA 3NGBC 5DJ8B 4Y8DC 2D7PA 2X41A 1M6OA 3NZHL 4PGBB 4FQXA 4D3CH 3HUJF 3LN5B 5FYJU 2YZ8A 4Y8AA 1OM3H 5FFLA 5I66B 1HCVA 1OOAA 3V9FA 3QI9A 4LSTH 5SWSE 2OI9B 3OB8A 5BCAA 4JLRA 4OLUH 1QVOA 4G6JL 1WAAE 3K8LA 7FABL 1J05A 3QNXB 2EDHA 1KTDA 1NGWA 1F02I 1XGRB 1OGAB 2OK0L 4PG2A 1ZMYA 3GSVA 3VWJA 5DLMH 4D9QE 4QO1A 3MRHB 4JZNB 2PR4L 3WIFB 3EHBD 2OZ4A 2AXGB 1GIGH 3B8YA 3P4MB 4LCWA 3CSYB 5EOCH 3K0WA 1RK1B 4PJHE 1JV5A 4L4JA 4M61A 4PTTB 4P49A 4M48L 1IGIL 1JI2A 1IZKA 5C2UB 4PJ9B 1QPPA 4ONOA 3LN9A 3PWNA 3RWJA 4C54A 4F37F 1U8PA 4LCUB 1UXSA 3IS1X 3KYKL 1J11A 1V3JA 5J56B 5EZIH 4WTZA 4HIJA 4LAQH 1M7IB 5J57B 1HIML 2GJ6E 3MLYL 2LAGB 3U7YH 2EZ0C 1NCDL 1D5MB 2VLJB 1MFCH 1P7QB 3VXTB 3NIDE 2JJVA 3MGTA 2FECI 2X4PB 3EJYC 1BVZA 1SEQL 2ADJA 3EYSL 4JREB 4NRZA 3WFBH 4OZHE 1W0VB 2EO1A 2J3SA 2A6IB 3MUY1 3SJVB 3RFZC 2R8SL 3QJFB 1VA9A 3HB3C 3VXSE 1KFAL 4QYOA 1T7WA 5CINL 1U8MB 4U31A 5BQ7A 3SGEI 4F7CB 3BGFB 4JVPA 1A9EB 1IC7H 3MFGB 4BELD 2YOCA 1PKQE 2XXCB 3GFUA 4MAYA 3QIBB 1AO7E 4OI9A 5L8KB 1IAII 3D5OF 4PJAA 1BFOA 3RAJH 1UKQA 3TN0A 1NLDH 4XNZB 1YEGH 2OR8A 4PRHA 5EBMA 3HI5H 4R7NB 3TO4A 4GRLC 3VRLF 5HI5D 3WFHB 2NZIA 4OIBA 4PYGA 4HKZA 1EERB 3C6LA 3KJ6L 2Q7YA 3LSOA 4KU1A 1KPRB 1SBSL 5HHPA 1A4KA 5SX5K 3BSZL 5LBSL 2P8LA 4QKXB 2PO6D 4KDTA 4YAQB 3VCLB 5HDBF 4TPRL 5ERWB 1S8DA 3BO8B 5ANMA 1X9QA 4GAYB 1X5FA 1I4FA 4XXDA 3LIZH 4EQ2A 2QQKL 1Z6JT 4Y1AE 3DHMA 2XRAH 2COQA 4OUUA 2YA2A 4XP9L 1U8OB 3VFNA 3MRCB 1RU9L 4HQQL 4L4TB 1Q0YL 2F8OA 2R8SH 1CT8A 1KIPB 1L0YA 2HWZH 4Y4FC 3TNNA 1GHFH 1TFHA 2MWCA 4QWWD 2AEIT 3SGJA 3FRUA 5T3XL 5KSBE 4RISL 5KAQG 5CWSB 2F8VA 3HFML 3M45A 2ZG1A 1MLCA 2GITA 4ODWA 3VXRE 3I6KB 3WE6A 4YDLC 1LEKB 3QJHB 1NMAH 5D96C 3IXTA 3FO9B 1XF2A 2ATPB 5T1LD 3BGMA 4YDJA 4PJBF 4Z77B 3G08A 4XPGH 1DEEA 2CRYA 4JANA 3FRPA 4U7KA 3Q3GB 3QUZB 1AXSB 1RFDL 2DM7A 3D85D 4JRYA 4LBEB 2BSSB 2HH0L 1VGEL 2ZCKL 5GGSB 1FN4A 3PP3K 4GG6E 1RK0B 4RMTA 3P0GB 3B5GA 3Q48A 1FLRH 3L3IB 4DCQA 3UEZA 2D7OA 2ZOLB 2IAMA 5DD1L 5JLZA 3T2PA 4MJID 35C8L 4ZUVA 3SN6N 4O9HH 2DLHA 3PABB 3PQYB 1JZ6A 5EB9A 3N1PC 4PGZA 2E8ZA 3Q1SL 4WU5A 4GBXC 5DMIH 5F1SA 5CMAA 1QBLH 4WO4D 4RFNB 3DVNA 5IG7A 1NUFA 3HPLA 1XR9A 4L5FL 4M03A 1JGVL 4NQED 1JRHI 1S7RA 3ZMRA 4YDKL 3QBTB 1YEDB 4LSVL 5F6HJ 1R3JB 2Q86B 3S8WA 2GIYA 4Q97A 1G9NL 1ZAGA 3ARYA 4J2XA 2G9HB 3GZKA 3GMQB 4EI6B 3VGAB 4KJWD 3KXFD 2CDFA 2AEPH 5D7SL 5LQBL 3ILPA 4Y5YC 4YFEA 3LB6C 3D0LB 2GSIA 1EPFA 3D85A 4EI5B 1P2CB 4XPGL 2QBWA 4YHMH 2X4RA 3T3PE 3KPPB 2H1PL 3O6KL 2C4XA 4XC3H 3RNKB 5FAAA 4X4XB 1MCKA 3KYNB 1C5CL 4XVJL 5AAWA 2JB6B 1F4WL 1QFHA 5BS0D 3D25B 2DQFB 3SOBH 3ZDYE 1Z9SA 1O7SA 2UZIL 2D7NA 5IVXF 3TFKD 3U4EB 4JO2L 5HYJD 4PJ9D 2VZSA 4GKSA 5GS0C 3H9SE 5JO5B 3UTZA 5L8LB 1DN2A 1NANH 3RWHA 1F4YH 4LHJB 5BMFH 2DMCA 2MQ3A 1C08A 4F8QA 1CD9B 4X9GA 4OLZL 1LD9B 5KJRH 2LTQC 3U9PH 3VGBA 1O5DT 3V4PH 2W0FA 3N9GL 1K4DB 1QQDA 2ZJSL 4LKXA 1AD9B 4LSPL 3RKDC 3SEPA 4S1SL 5ENWB 1RZJC 4NUJA 3KPTA 4KQ3H 3LB6D 3WDIA 4HH8A 1N3NA 3MRRB 5DC4B 1MREL 3O3UN 2H2PC 3NCJH 2N4IA 3PDOB 1IC4H 3WXVH 3T1FB 1Y18B 5AZ2L 5IJVB 2B4CC 3T2NH 5JW4R 4YE4L