1YEHL

Structure of igg2a fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRGDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
molecule tags Catalytic antibody
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehL01
4PJ8B 2WIMA 4XNYL 1EPFA 2ARJB 4ZPVB 5C6TL 2RFXB 2HFFA 4M7LT 2OL3A 1INEL 1EFXA 2FSEA 1HHIA 3LEYH 3P9WB 2AXJA 1KB9J 3C2AH 4OCWL 3PGCB 4IM8A 5AD0B 3DURA 2PXYD 4HZAA 1YMMD 5I17A 1MLBA 4ZTOH 2VDQL 3WD5H 4P59L 1X7QB 4XCYB 3BWAA 2DKSA 5J3HC 3FQTB 5GJTH 1CK0L 3ZT7A 1J10A 3G6JF 4PRPE 2R4SH 1WISA 5KG9B 3TIEA 3MCKA 5AZEH 2A9ML 3T1WA 1C5CH 4KMQA 3C5JA 4BFEA 2XNAA 3WS6C 4OI8A 2QHRH 5DJDA 1HKFA 43CAB 3QA3B 4P9HC 1BQLH 3SQBA 1W2KT 3UJTH 2JJSA 4WY7L 5D7SL 2F53A 1MEXL 4IIQA 1UJ3C 3GSVA 3O3DA 4MNHA 3OKNB 2AEIT 1CR9L 4HKXA 1S7VA 1YDPB 4ETQB 4NJAH 4L4VD 5FGRA 5C09D 1KLUB 1MFEL 4L8DA 3PUCA 5TE4L 4ZPTA 5BVPL 5LXGL 2VWEE 3VXSA 4JY6A 4PY7B 1ED3B 3OXSA 1AJ7L 4HPOH 1H3VA 1AC0A 4D8PA 1AI1L 1OAYL 2NY4C 2HLAA 3HMXH 4F7TB 3DVIA 4ODVL 2DM2A 3RIFF 3HG1A 3QEQA 1ORSB 3B4NA 4JFPA 5EOQH 4JKMA 2K9UA 4ONFL 2CRIA 4PYGA 1WWAX 4YXKH 4LSDA 4PJIA 3FFDB 3AMKA 3QHFL 5D93C 5I16A 4XHJD 3WIHL 2OXHA 4N9GB 1GL4B 4UT9H 3SOBL 4S2SB 4TTDD 4W4NA 4PRPD 3QZWA 1K4CA 4UV7L 2LU4A 3ARED 3ROOB 3DGCR 3S5LB 1DBJL 5KSBA 2OQJB 4Z7VF 4OFKA 1EA9C 3MMEA 5B38G 1EO8H 3KYOB 3CDCA 1T4KA 3GBML 1AD9A 5DEFA 2KZWA 2D7MA 3OX8A 2NY1B 1QSFB 5IHBA 4ODXB 1UEYA 4LPCA 2DYPD 2QJDA 3UDWA 4FQXD 1RZIA 3BIAX 1NBYA 2FGWL 4X6DF 5E2UH 1P69B 3ARBA 1G7JA 4HUXB 3ARGB 3UP1A 5MP6H 2VTFA 3ZTNL 1AR1D 2AJ3B 4JO3L 2GT9A 4U1IB 5A16B 4PJXA 2I24N 5HSFA 1UB5A 1I9RL 3FT4A 2XZAH 2ATKA 3VD7A 1IC5L 3KPPB 3MBXH 5BS0E 2EC8A 4ZTPH 2ICCA 4MQXD 4GMTH 4KXZI 1YEKH 1IEAA 3O2VH 4PGEA 4F57L 4YHOH 1FNGB 4DKEL 4PJGB 2MJWA 3QFDA 3KVQA 1YJDH 3SKNA 3LKNB 1NCBH 2BNRD 2HTLD 2BC4B 2IPUG 4OD3L 2FJFB 4WV1B 4QEGA 3S96B 4F3FA 1UZ6E 2B2XH 2DIBA 2PETA 4FMFA 1AKJB 2G2RA 1KEGL 4ELKB 4R97C 4Q9RH 1ND0A 1MF2H 1OAQL 4NKOB 1G7MA 3MREB 1UKSA 5J1SC 3PABB 2B39A 3A6CL 3RWJA 5GS0C 3Q3GB 2VZUA 5CIPB 4M7JH 3V4VH 1YN6B 3WCYA 4Y4KD 2H32H 5GRJL 4PJ7B 2P5WE 2IQAA 4XC3H 2VOTA 4J3XA 3MOQA 3OBAA 2B20A 3GMNB 4J4PD 1FNSL 3GBNL 2NY5H 4XNUH 4KC3B 4DGVL 1NGQH 1IC4H 1YEEH 4KH2A 3OKMB 5E8EA 5I19L 1LK3H 2NY2C 5CAYB 1LEKA 7FABH 1A3LH 4IOFD 3MRFB 5FHBL 4X7SL 2X9YA 2ZOKB 5FF6B 3QXDA 1FAIL 4LSRH 3S37L 1FSKB 1T03H 4AY0A 1UVQA 4GRWF 5INDA 4Z7WB 1PKQB 3BQUD 1TZIB 2W38A 1QSED 3T3PF 1CFVL 4G6JL 3ZDYE 5EORH 5BS0D 4X83A 1T04A 3L3GA 1PFCA 1NMCC 2AABH 5HI3D 4HQQL 4ZFFB 5CWSA 1KIUA 2R4RH 3MLVH 4TTGA 4YHNA 1X5XA 1ITCA 4PRIA 3U36A 1KJVA 4MHHI 5FK9B 2OK0L 5DWUL 4EI5D 4FQQA 5HDOA 4KJPC 4Y16A 1I8MB 4NP4H 3LRSB 3F7VB 1QO3A 1VERA 4MD0B 4HIXL 3G6DH 2FR4A 1AH1A 3BZDA 1A3RH 1P6AB 3L5WA 4JFFE 5C1MB 3BT2L 5D7IA 4ONHB 1EDQA 5FB8B 3QH3B 2J2ZA 3JV6A 5MEQA 1FL3A 1VB9A 2IWGA 3E3QC 1TPXC 5L6YH 4NRXA 5ALBH 2P5WD 3BGAA 3MLSH 3QB7C 4G5ZL 4HHAB 1KN4H 5DFVD 4F7MA 1X6LA 3PWJB 4TSBH 3EYUH 4K71B 2BVQB 5B22A 4F2MB 3O9WC 5C0EB 4X6CB 1IGYA 4RFNC 1U91B 4ZNCD 3UTOA 3C8KA 3I6GA 1P9MC 3M8OH 3Q1SH 1XF5A 2QQLL 3HZKA 4FQ1H 4RCAA 4W6XB 1CT8A 1KIQA 3GEWB 1KIRA 2JJTA 4LOUC 2DQIL 1CXIA 2EIZB 1CFTB 5HDLA 1RAMA 4GRLC 3W9DA 2FH6A 12E8H 1QFPA 3E8UH 2ZUSA 2XQYK 43C9A 5E08H 5DUBA 2AK4B 1BZ7A 3VRLE 5KW9L 3HB3D 3QUYD 3RUGB 3RU8H 3SDDC 5KVFH 5CGYD 4AK1A 3M1BA 4M93B 4X8JA 4LCCB 5CEXA 3AMLA 4L8SB 5LG1A 2CR6A 5DLMH 1JHLL 1NSNH 3EDFA 4BQ9A 5EU4A 3CDFA 2P43B 4JFFD 1B2WL 3KPQA 3DRTA 3IJHA 4HXBL 2DQFB 4FFZH 3OKLB 1ONQA 4WO4A 5MEOB 1HSAB 1HXMA 3S34L 1X44A 1P84K 1DDHA 4ZUUB 1GGTA 5KVMC 3EOBA 3HE6C 1CFNA 1MRFL 4X4YB 2BNQE 1WBYA 3F7PC 3FMGH 1Y6MR 1YQ2A 1RUMH 2P5EB 3UJJH 1UG9A 3S8WA 1Y6NR 4ODWB 1T22A 5T3XH 4EDWH 3EUUA 3H3PH 5IESH 5MERA 3W0WB 2H45A 3L5JA 4OFVA 5AAWA 5EFIB 5EZJB 4RDQF 4P4KD 1AO7E 3VDAA 1IM9D 3JBG7 3MRGB 1INQB 1OW0C 3L95A 2XG4A 4H5SA 4R4FH 5L88H 3ULVC 3VXMB 5DQ9B 3QFJB 2G9HB 1G6RL 2WBKA 3ZDXF 2CLZB 5HHMB 4QYOB 2DKUA 1TVDA 3W39B 5JDJA 5I75B 3MRKA 4HFUL 1P4IL 3FONB 3RIAF 3QIUA 1A7NL 3SE3A 4NDMB 3VXTB 3RI5K 1XF3B 4OZGB 5J7CC 3WHE1 5IQ7H 5EIVA 1QACA 4WCYL 1HHKB 2GSGA 4UINL 3KLHD 5GS1B 5C0JB 4MNQE 1LO0L 5L8JB 4M5ZL 5E7FA 4FP8H 3ISWA 4HKBA 4F9LC 3WEXB 1AQDA 1BQHB 2I60H 3HMXA 3MLUL 5EZLB 1E0OB 1JGUL 5B21A 3LH2L 3DLQR 3QDAA 5I1LA 4AEEA 5L2KB 3FO1B 2BNQD 4XP5L 3P11H 1XCQB 4M6OL 5FO8B 3QUZC 4LPTA 2Y07H 3EYOA 4OFYA 2YK1L 2GJ6A 2VLLB 5LCVL 3SDXE 2WNGA 4OZHB 5KVGH 5EG6C 1BHGA 1A6AA 5JTWA 1HEZB 5LBSL 4YBLB 5E5RB 4LDOB 4LP4A 4JFYA 5C0GA 1AO7D 1LP9B 1KF9B 3TWCH 1YNKH 1R3IH 2NTFA 3FQRA 4YC2B 2F19L 3BFOA 3PGDA 1FE8H 1AP2B 2PXYB 3N1QC 1YMMB 1HILA 4WWKC 4ODHL 2WP3O 3GMMA 3QUML 4LF3B 5CINL 5B3NA 3UXFA 1YQVH 3S4SA 3ZKSD 1YEDA 3OR7A 5EU6A 4Y2DB 1R3LB 1GCFA 3HPLB 1CDGA 4N1HB 1KJMB 2B1HL 2PCPA 4IRJA 3AS3A 5DD5L 5MEPB 1IILE 1DVFB 1UZ8A 3FQXA 5BV7H 4LQFL 3MV9E 2HT2D 3BZFB 1HXYA 1JWSB 4WU7A 5E6IA 2BVEA 1A2YA 5EUOF 4MNQD 3TPUA 4JM2D 4M03A 2R1XA 2MHAB 3WN5C 1FVCA 2CGRH 3ZTJH 4FTVA 2DJ4A 5CCKH 4DZ8B 3FRPG 2AXGA 4WUKL 1NFKA 5KZCD 3OB8A 1A1MA 4LLWA 1NFDA 4PJ9A 5C09B 4PJ8C 3UZVB 3WXWH 2JJWA 5FO9A 5TPWH 5T3ZE 5FA3B 4RAUB 5KN5A 2VO5A 3VH8G 5HVGB 1R3KB 3SDYL 3QIBA 1CCZA 1KULA 5DRWB 3OSKA 5FYJH 5DJXA 2DF3A 4CGTA 2GTWB 4EN3C 2AJYH 3FB8A 4DKFL 1F6AA 4ALAL 3D3VA 2H32A 3M45A 4KROB 3REWA 3B9KA 3MRNA 3GMLB 4MZ2A 4XWGL 1VFBB 1JRHI 3D0LA 3QDJA 4HS3B 4UMGA 3UTTA 1U8NB 3ALWA 3VFMA 3NFNB 4HLZG 5FXCH 4J6RH 3CDGA 2BHUA 2ORBH 5CSZA 4Y4HB 5ICXB 3NBNA 3AREB 4HDIB 4P9HL 1P4LA 1MQ8A 5JNYB 2VRAA 3VFPB 3QSKB 4QCIB 3NTCH 4S1QL 4WW2F 3DX6B 4BK5A 5E5MB 5IWLC 1MVUA 2IPUK 4EUPB 5HVHB 3GNML 1GGIH 2KH2B 2QHLA 3G08A 4UTBL 4RGOH 4TSCH 3GSOB 3O2DH 1RUKL 5DFTA 2YD4A 5DJZA 1OD9A 4D3CL 1CU4L 5EULV 5GRUL 5EU3A 1BLNA 2BERA 4WI8A 2VC2H 3NCMA 5DSCB 5T3ZD 2BRRL 1NLBH 1UWXK 4YUEH 3JZ7A 3PWNA 4L9LB 5C0BE 5T5FL 5I66B 1UACH 2C5DC 1IZKA 3LKPA 4E42A 2GW5A 1JFQL 4Z7OE 2HWZL 1T7VA 4LBEB 1I1FB 1LEIA 3FHAA 4NOFA 2DLFH 3BH8A 5C92A 3V8OA 3HN3A 1NDMB 4WUUE 5CILH 4XBPB 3DI3B 2Y72A 1NJ9A 3TBSB 3GJEB 3KPOB 2X4NB 4JN1H 3KDMB 5TFSH 5DRXA 4OCXH 5E9DE 1AGBB 4U31A 4K3HA 1YEIL 3MRLB 5IVZB 2AK1H 2QR0A 3BYTA 4JO2L 2GY5A 2Y25A 3CU1A 2JCCE 1MY7A 1U8OB 1RJYA 2NY1C 2VLKA 5FUZL 3CVIL 2E6QA 4KJYB 5EBWB 2VDLH 3MRPB 4Y4KB 1UC6A 4DVRH 3MLTA 1NAMH 1TJGL 5F1KC 3EYFA 5I2IA 1GOGA 5GGRA 3C9NB 4OJFL 3DXAE 2EKSB 3ARGC 1KCKA 4K7FA 1HZHL 1X4ZA 3KXFB 2HJFB 3TBTA 5ANMA 3WFHA 4Q7DA 2DQEH 3S98A 2RHEA 3TIDA 1SYSA 2EH8L 5EOCL 3VD5A 1T2XA 3PWLA 5M7QA 5C0BD 1KC5L 3QUXD 3HZVB 1ES0A 4O4YL 3ZDZF 1I8LA 3WL9A 3BQUB 1BFSA 5EWIL 1Z9SA 5CJ8A 1KEMH 5IB1A 1G7PB 5BS0B 1U8LB 1JI2A 5CS7A 3NA4A 2CIIB 2UZIL 4M8QA 1MFAH 3MRDA 1NGPH 1S9WA 2DQDH 4HGKC 3VXRA 4WV1C 4WUUD 1CGVA 3X11B 3LPFA 4ZQKB 2O5XL 1KTDA 3U7AA 5ERWB 5GPRA 1MAKA 3BJLA 1UT9A 2JK5A 3SQOL 5DYOA 3NFPB 2BSTB 4KJWC 4OAWB 5E9DD 4BZ2H 1FFOB 5FKAA 5D5MA 3LQMA 3CAFA 1VHPA 5GS0L 1VEMA 3OTTA 1CVRA 2B1AL 1CL7H 3CFJA 2WZPD 3UC0H 4E9LA 4KUCF 5BQ7B 4XP9L 3WLWC 1M6OB 3SGDH 4RMWA 4S1RH 1OP9A 1QYGL 4KK6C 4NYLB 3TJHD 4FQCL 2P5WB 4YDKL 4U1NB 1XGQB 4JFZH 2Q8AH 4DJMA 4PBVC 2A77H 4KWUA 4UT6L 1KLGB 3DXAD 5GGVH 3QZWG 1OTUC 5D4QA 3QCVH 5DA0B 5HD8D 4GBXA 2WSKA 5FCUL 3LS5L 4F7PB 1MJUL 3LV3A 1FSKC 2G60H 4HS6A 4AEIL 1XF2B 4X7CC 3MCLH 1MSPA 3FO9B 2A6IA 4P4RB 5E7BA 4QRPB 3WNPA 4X6FB 3IJSB 4U6TA 4QRRA 3KJ6L 1MI5B 5EPMB 3MYJB 4IOIB 1QLFA 4XVTH 4WTXA 4KDVA 4PRBB 2GY7B 4HIHA 1RV6X 1CLZH 2XTJE 2YPKB 5IMLA 1KGCE 3QCTL 5ISZE 1N64L 2VNCA 3CUPA 1U8JB 4RA0C 4CMMB 1T2JA 3X17A 5D2NE 4FRWA 3SJVA 2FHCA 3T09A 3VGBA 1GGCH 1S9KC 3BJ91 3H7BB 3CPLA 1BM3L 3VCLA 1H0DA 2HJLB 3F6IA 3O41B 3P4MA 2EH7L 1FL6A 1V3JA 1F4WH 3GMOA 3HC4H 5HYSG 4JFFB 1ODAA 1E4JA 3MA9L 1NBVL 3HHRB 5DUML 4EI6A 3TCLA 3JWNC 4K71C 2WLYA 4JJ5B 1IBGH 4D9QE 4LKCA 3TO4D 3O6ML 2AI0L 5ADPH 3W11C 3C5ZD 2D03L 3F8UB 2XA8L 4Y5YA 3P4LA 1W72B 5IGXL 4LKXA 3DV6B 3BSZH 3VFNA 2BVUA 3E1F1 1BBDH 3WUWG 3SGJA 2VITA 4N8CL 1FH5H 3JWDH 2RGSA 1IM9B 1BFVL 4LLUA 1FGVL 3FN0H 5SV3A 4ODTL 4JANA 2DQJL 1KPVB 4UQ3B 4DFHA 1FFQA 3RVTC 2EEBA 2FX9L 1K4DA 5IMOB 4QY8B 2OI9C 4AZ8A 3V5KB 2XTJD 4OV5A 2CLVB 1BECA 2UWEA 1KGCD 5CBAA 5ISZD 4M93C 4YDLC 3TO2A 4LCCC 4XPHH 5LQBL 2ENYA 3BP4B 2EZ0C 3LSOA 4Y2OA 5E8DL 2GUOA 3KWWB 4PTUB 4FNLH 1C12B 1AHWA 5I1EH 5F6HI 2VZ3A 2AGJL 2WUCH 1CTOA 5CZVH 4G7YL 3SEPA 4JFEE 4CRPA 3LS4H 3CGTA 3UBXA 4WI5A 2FO4B 2BSSB 3WDJA 3RZCD 2ADJB 4ELME 1MNUH 3FO2B 4MQ7B 5FYKL 4CMHB 3O2WH 4PB0L 2YPLD 1ZLSL 4OCYL 4B41A 2BNQB 4JQVC 2V2WA 1HYSD 2NYYC 2Q20A 3WFEH 3QXAA 5DVKA 2VZ1A 4WFHD 1XAUA 1SY6H 4FQJH 2YRLA 5LGJB 1ZS8B 4Z7UA 4X9IA 3ULVL 5IOPB 5FV1L 4RMQA 3MJ8A 3P0YL 3L3KA 1MCDA 1M7DA 4IRZH 2DQHL 5IJVA 3QNZA 3RJQB 3IDGB 4POYA 2ZUVA 5FDWA 2PW2A 1GHFL 5I75C 5I8CB 2BY3A 5DTFA 3ZL4L 1QVOB 1UQSA 1JZ2A 2GAZB 3O2DA 3EO1A 4ZO9A 1JNLL 4MJ5A 2D0FA 2EDJA 3KPSA 5CD5D 3RVUD 4NWUL 5I1CL 4JHBA 4OZIA 5B39B 5BRZE 1NMAH 3TA3D 3MUZ1 4XH2A 2DRUA 5GS1C 4U3HA 1KENH 2E6PA 3F7YB 3QDMA 1FO0H 1JVKA 3LMJH 4NQDA 4YWGH 1JPGA 1M05A 4NT6A 5GZND 2LU7A 4H1LG 1ZVHA 1BGXL 4MNQB 4CN1A 2B4CH 5CFHA 4JM2B 4HUMB 4JFED 2E7LC 1E28B 5L9DL 3K4AA 1J1OL 4CVXA 5AYQA 5FO7B 3FCTA 1WUNT 3PWPE 4PJHE 1U8MB 1ZT7A 2WWMD 4Y19E 2CR3A 1C5DA 5ESQA 2CO7B 4EZMA 3D25B 4LRNH 4CVZA 4PJAA 2IPTH 4XNYH 3RX5A 3NAAL 2O5YH 1D5XA 1U2HA 3HNVH 1JN6A 4YBLC 2F5BL 1INEH 4K8RC 5D2LE 5D70L 3SDXB 3CH1A 3D69A 3QXWA 3U0TB 4NRYA 4R4ND 2R0LH 3GHBH 1I3RA 2JE8A 1EZVY 4JFXB 4YC2C 2P44B 3CFIC 3CFBA 2PXYC 2Y36L 4YZFE 4P59H 3TF7C 2H8PB 4G9FE 5HI4D 5CLWA 2RR3A 1RULL 1G0YR 3MV8E 1OGAA 1JV5A 1NAMA 1BIIB 3VMOA 4PRHA 1N59A 4JY5L 2JB6A 4YDVB 3T2PA 2ZUXA 4PBWD 4B0MM 1DVFC 5I15H 2NX5E 3Q0HA 3EYSL 3FQUA 5BRZD 2OSLB 4X7EC 4NKDB 2R8SL 3MV9B 5F89A 4PJDA 1GJIA 2BVYA 5CJXC 5IV2A 5C0NC 3ECBB 5HYQA 3LCYA 3ZKMD 4NQEA 1LE9B 1CG9B 2VIRA 3VI3F 3E6FB 1CR9H 3V6FB 1V8HA 4OFIA 3HPJB 5JW4Q 3SPVA 1IKNA 1R5VB 3PWPD 2I26N 3DRQB 3EJJX 3KHQA 9CGTA 1BEYH 3B9DA 4GRWH 3KPRA 3C60A 3P9MB 5IEKB 4NQCA 4ODSL 1RPQA 4C59B 3L5XH 5TQ0H 4GFTB 3EO9H 2GSIA 5B38B 4N0RA 1B6DA 4U7SA 1OAYH 2VXQH 4ODVH 1DBMH 1S9XA 2C1OB 4JZOB 3VA6A 1D6VH 4R26H 3RNKA 3FB6A 3TBYA 4KROC 2O61A 3ZYZA 3HTLX 4O2FB 4ZFOB 4WI6A 2A74B 4BH8A 4K9EH 2H9GA 5EZOH 1AIFA 4M6NH 3DUSA 1R24B 2IPKB 1AQKH 1RFDH 4RX4D 1OQOA 5J6HA 3OJDB 2V7NA 5FUCE 4G80B 4DN3H 5D6DC 5E99L 2CK0L 4LNRB 4TTDC 2HKFL 1A6UL 3GRWL 2XZCH 4Y4HC 1YN7A 4I2XA 3MLXH 3AREC 1A14H 2NX5D 1F90H 1NGWB 2D31A 1PAMA 4MDJA 3RAJL 3MLYH 1F2QA 3LN5B 2F53E 2R9HD 2VXUH 1LQSR 5D1XB 4OLWH 1FZKB 5DJ8A 4P5TB 1MCOH 5HVHC 4LEXL 2X5PA 3PV6B 4WGWB 1KIPB 1G9MC 3QO1B 1WGOA 3S4SG 1TTUA 3OKOA 1HH9B 2GHWB 4ZFZB 4XNZB 5F1NA 3VXSE 2A9NL 1SJXA 1DQDL 4Z95L 5EIQA 1J8HA 3BW9B 2V17H 1IAKA 2Z8SA 5T1KD 2F8OA 4L9LC 2VWEC 3ILPA 4JDVA 2XXMB 3A6BL 4OTXH 3C08H 3RGVA 3HG1E 3QEQE 1HSBB 4KHXH 4HKJB 4WI7A 3QUXB 5BZDA 1ZHBB 4PJIE 1OWWA 1UWGH 4MQXC 1IAMA 3SBWA 4JFQA 5T5NF 5E03A 5C7XL 1RZJC 5KSBE 4NM8L 3L3HA 1A6ZB 4WUUB 5GSRA 4DCQA 4JHAH 4HJGB 3U4EB 2UY6A 5C3LD 1E4XL 1IGML 4C4KT 4OLXL 3EO0A 4K23L 1C7SA 1J86A 2F53D 3RP1A 2R23B 4M6ML 4BSWB 1JPSH 3VXQA 4Y4KC 2JCCB 1S7RA 1DQQA 5JMRA 3QWOA 1BZQK 2M26A 4P5MA 1FRGL 2GCYA 3QHZL 4DZBA 4J4PC 3QIWA 4WU5B 2YR3A 2GQHA 3DX9A 1ZEAL 4MX7B 3WJJA 5AG9A 5AWNH 1EHNA 3L3DB 3VXSD 1JGVL 5K9KA 3DXAB 4PV8B 2FBJH 5FYKU 3HR6A 4X7SH 2FATH 4PJXE 4IOFC 1JPFA 1X3DA 1N2RA 5KSAA 5C9JA 1DQTA 1JWUB 1U8IA 5F9JA 1N7MH 2R2HB 2WUBL 3IDIB 2R56L 1CFVH 3BQUC 3DYMA 1TNNA 2AQ3A 4Z6AT 2E9WA 3S88L 3IFOB 4NKIL 1J8KA 5I1DA 2FJGB 1VGEL 3ARSA 1MCPL 1K2DA 3WFCH 1U8PA 3FT3A 2R39A 1MRCL 4ERSH 1LO2H 3CX2A 3DIFB 3MR9B 1YNTA 4G7VH 1CBVH 3RKDC 3LQAC 5JLZA 3FT2A 2W91A 4DGIL 1JYWA 3WNMA 2DOCA 3V7MA 3UPCA 3NZ8B 1OLZA 3O4OB 3VXNB 4NO5A 4CJ0A 3G04A 1SY6A 5K9OB 2NY7L 4DOHB 1YECL 2HFEB 4R0LB 5SWSA 3TBWB 1NC4D 1A47A 2XWBA 4XVSH 4Z76B 2DICA 3V7AE 2VQ1B 5DRZA 4FFVC 4NUGL 3HRZB 5DFVC 3RTQA 3ARBD 4HKZA 4FHBD 4Z7VA 3U6RB 4ZG1A 4L1DA 3TO4B 5LKNA 2VDOL 4JZJB 3A67H 1UH4A 5GGSB 5GRXG 4P9MH 4AJ0A 4YGVB 1SJEA 3RPIA 4C57C 1FO0A 2HFGH 1B0RB 3G5VA 4QXTB 3QO0A 3CFDA 4TYUA 1CGSL 4XPBL 2QKIA 1T83C 3NIFE 4K7PX 5F9WB 4APQA 2NY0B 2X44D 3RWGA 4XXCC 2UVEA 2ZWLT 3B3IA 1ZA3B 3NIGF 3HRPA 4U1SB 3X3FL 4X6DA 4KUZL 5TF0A 1F8TH 4JFOB 2EDWA 3B2VH 4BH7A 2A73B 1OSPL 2X70A 3GZKA 4I0PA 4MJ2A 4MLIA 5C08A 1MCIA 1TVBA 5TDPA 5J12B 5KW9H 4NZTH 3CSPA 3JV4B 1AFVH 3HB3C 2XTJB 3QUYC 5DD6A 1FG2A 5CGYC 3EAKA 1V7ML 5ISZB 3GMQA 3MNZA 5D7IE 5DHVB 1XEDA 4X6EA 1IGJB 1JZ8A 1MOEA 5E94B 4LAQL 5D2NB 4LCYA 4Y5XB 3VFGL 1ZLWH 3OAZH 4MXWH 3SKOA 1R6VA 1XR8B 2J6EH 1II4E 3R8QA 1PQZA 3UO1L 3VW3H 5IQ9B 4P3CL 1OAUL 1JMXA 3W5NA 3BRFA 3I3DA 2ADIA 2VZTA 2ICWA 4FABH 2AJXH 5DZOA 1FBIL 3LIZL 4OM1H 1T5WB 1YEHL 4AIZA 3KYMB 4KTEH 3EDKA 4M62H 3D2UB 1VFOA 3HFMH 2PYEA 2Y5TB 1AXIB 2FL5B 3JTSA 3NFSH 3X13B 4Y7MA 1IAIH 1U36A 3TH2T 4Q9QL 2FD6L 2IMMA 4FXKB 4X98B 3SCMA 1G6RH 3OJMB 1WT5A 1FFNA 1KJ2A 4P2CG 4JVWA 4PRID 2BOBA 2ZNWA 4OBSA 1BMGA 2MFNA 1I7ZB 4MA8H 4Y16D 1A7NH 3IRPX 4DVBB 1ZSDB 3MROA 3VXOB 3T1FA 4FA8A 3K80A 2NZ9D 2X7LA 3H0TB 3SY0A 4OF8A 4FZ8H 1CICA 3A0OA 3GMPA 1MHCB 2ADGA 3KLHC 3V5DB 1RIUH 4TNVK 1I7RB 2ZCLH 4HJ0D 5KJRL 2HVJB 3O6FA 3S36X 1LE5B 1FZMA 1BQUA 3ULSB 5DD3L 1NCDL 3QRGL 3ZE1E 4NFCA 4JFEB 5FCSH 5I1KL 4CMHC 2KKQA 4PJ7F 4HUKB 1NDGB 1KNOB 4XP5H 4ELMB 3U0PA 2PW1A 4A6YB 4LSSL 1MIEL 2BY1A 3C8HA 2DTML 2X42A 3TN0D 3GSNH 5IVNA 4EXPX 3SE8H 3VRJB 2P24A 4UDTA 4HMDA 3L5HA 4M4RA 4D0CB 5F70A 3PNWB 5GJSL 4ZUTB 1A1NA 4MAYA 3H9SB 4PGBB 3IVKA 2ITCB 1QBLH 5DQJB 4UB0L 3H3KA 4MXVE 4BFGA 5CKGA 4AEHL 2F19H 2QLVB 4C83B 4Z7WF 4WFGE 5FM5M 1KUMA 3IFPA 1T20A 1TCRA 3GK8H 1DLHA 2IH3B 4NCC2 5J06A 1I1AA 1M71A 4LVHB 1QLRA 1CDYA 4HD9A 2X4PB 4POUB 1X5ZA 3TV3H 3THMH 5GHWL 1E6JH 3QJHA 3LPWA 3AU1B 1VFAA 3R0MA 3N06B 1M7IA 1FFRA 3NMEA 1B4RA 3ZO0A 4M4PA 1G7HA 1RURH 3OAUL 4HULB 4WO4D 2J7LA 1J12A 3R06A 4JM2C 4G9DA 3S35H 3BXNB 2EDHA 4HIJA 1OL0A 5JR1L 3OKKA 2E3VA 4JDTL 5DMIL 3ZTJG 3O11A 3F7RA 4PS4H 5JQ6H 5DDHA 2VDPL 4IDJH 4N0CD 3N85L 4I9WE 4V1DB 1EMTL 3PWPB 4PJHB 1NGXB 3RX8A 4Y19B 1ZT1B 1S7WB 3UYOD 5TGBB 4RNRB 4K8RL 2EE2A 4PUBH 1TQCC 1HKLL 1F3JB 4TPRL 4DW2L 1A7OH 2YZ1A 3D39A 4OIIL 1EEYA 3O8XA 3QULB 1NEZA 1KB5H 3MRBA 3ZZ1A 4HUUB 5EOTB 1JGDB 3BEVB 2FYYA 4F15C 3ZE0F 4YDIH 3T4YB 3UBXG 2BSRA 2J8HA 1FJ1B 4HK3J 2IEPA 4WFGD 4AT6A 5EU6E 3HNTL 5TDNA 1MWAH 3U2SA 3QIUD 1I7TA 3IKCA 4LIQH 2R0KL 1D5MA 4G9FB 4OQTL 1DBBH 1WBXA 3MV8B 4FFWD 4I18B 5CP7B 3MFFA 4H26A 5HGDA 3LN4B 3S3JA 4MJ4A 2W0FA 3KYKL 3NCFB 1KBGL 2PN5A 2WLZA 4M9OA 1CYGA 2VN7A 2H26B 4QT5B 3FOLA 5IIEA 3V5HB 4U1JA 1JHTB 4FTVE 2CK2A 3MJ9H 1OM3L 4XX1E 2HTKD 1NFDE 1FGNH 4NNXB 1D5IH 3S9DB 1KCVL 4URTB 2CLRB 4OFYD 2GJ6D 4I9WD 2LQRA 5GRUH 3INUH 4OLEA 4QRSA 3HI1B 3HMWL 2BJML 4K3EL 2EDEA 2HFFB 2MCPL 4F9PA 2OL3B 4LSUH 1EFXB 4BELD 1TQBB 1HHIB 3SGKC 5JW3H 2ILLA 4LGPB 3CK0L 2PR4H 3L6FA 3K0WA 3WHE0 3D3VE 4XBGA 3S3PA 1H3GA 5T1DL 4R7DB 4WTZG 1NFIB 4XPTH 1RHHB 2M1KA 5I17B 3HI6H 2FBOJ 5EC2A 3QDJE 3BWAB 3QPXL 3UTTE 5EU6D 1X4YA 4X5LA 4OGAD 2DBLH 4NM4H 4IRJD 2X4UA 4XNXH 4XP6H 1C1EL 4F33B 1T7XA 3MCKB 4LLVA 5IK3A 3RY6C 1MELA 2J8UE 4GXVH 1MPAH 5E6ID 5GRWA 4DGYH 4X6BA 4HPYL 5F6HJ 5DJDB 2OZ4L 3K74B 4JO2H 1DUYA 4XTRD 4RQQA 4DQOL 5D1XC 5E00A 3CLFL 2JKXA 1Z5LA 4FTVD 2F53B 2YWZA 4ZFGH 1G9ML 4X80H 1AXTH 3O3DB 3JUZA 4IIQB 4MNHB 1S8DA 3LHPL 3VMPA 4GSDH 3U1SL 1AGCA 1MQKH 4XNZC 4OJFH 4PJ9D 5E2TL 3F5WB 4N0FB 4L8DB 5D7LA 3GDBA 5IG7A 1AE6L 1D5ZA 3P3YA 1DFBL 3ZKND 5DGRA 2V2XA 3DI2B 4KI5E 1RD6A 4MWFA 4ZPTB 4I4WA 2LV4A 1SJHA 1HHJA 2GK0B 4PD4K 5EUOA 5E2JA 3QIBD 4JY6B 5D71L 3VXSB 5I1JH 1Z0NA 3WHXA 3T0EE 1MFBL 2R1YA 1ZANH 1QEWB 3OXSB 4MD4A 2BY0A 4D8PB 1FIGL 3BKCL 4O4YH 4KK9C 2HLAB 3F58H 1DN0A 3QUXC 4OCMC 3B9AA 3D3VD 2E7MA 3FJTA 1LP9F 2J6EA 3B9KD 3HG1B 3QEQB 1B4JL 1NC2D 2Z31A 1A7QL 4N5EC 3N9GH 4LU5H 1IAOB 4O58H 3QDJD 3UTTD 1EBAA 3HC3L 4S0SD 3MLWH 4TVPD 1RZJL 2NMSA 3Q6FA 1IM3A 5F9DC 5JHLL 1KCRL 1NCCL 2JJVA 2AERT 4KTDL 3VD9A 4ZAKB 1DSFH 5J1AA 5ACZA 4G3YL 1S9VA 1CE1H 3MMEB 2ERJC 4UOW1 3TZVA 3EOYG 4QRUA 5JIPA 2VLKE 5IT2H 4PJBA 4FZEL 3RWHA 2EDLA 3EOTH 4JR9H 1BJ1J 2Q7YA 1AD9B 5DEFB 5CBEB 4JN2B 4RZCA 5T1LA 1OY3B 2XWJA 5BVJA 1YC7A 2XY1A 5IEHB 1G6RA 4FQCH 4OSUH 3STZB 4UBDD 2XZZA 3SE9H 1RZIB 5ANME 4ZO6A 5FAAA 1DEEA 3QWRA 1IQWH 1QFWH 3U4BH 5HHPA 1N3NB 5HD8C 4KI5D 1AGDA 5HGAA 1C7TA 5A43C 2DQTL 4WW2A 3LRHA 3UPAA 4C56A 2XICA 2GT9B 2XXCB 4PJXB 2YN5A 1UB5B 3TVMA 2OYPA 3MLRH 2ATKB 3DOSA 2DM3A 2C26A 4NN6B 1ZT4B 3DGGB 3VXRE 5BZWB 5ITBH 2RCSL 4P46B 1B88A 1RUQH 1P7QA 3JSSA 4MD5A 2J12B 5F72S 5DJ6A 3SKNB 1OAKH 3LQAL 4NBZB 5EO1B 3QCTH 5T3XE 1CIDA 1QTYT 4F3FB 2EYRB 2ZSVA 2VXSL 2NW2A 25C8L 3HLAA 1WZMA 2G2RB 3GSNA 5D5ME 3O4OC 2FB4L 1ND0B 4J1UA 1G7MB 1LILA 1IEBA 4R0LC 2VLKD 5DJ0A 4OLYH 4FN0A 4LMQI 1F6FB 4DTGH 2LAGB 1KN2L 4DK3A 2IQAB 1EO7A 1NBVH 1FPTL 4JPWL 3AY4A 4HLJA 2EDKA 1J5OL 5FUOL 1DUZB 1UB6A 2ZPKL 2AI0H 2NR6C 3MUGA 3TO4C 1LEKB 1S7UA 1HI6B 5ID1B 1UJTA 1I9JH 2O26U 3C5ZC 15C8L 4JZJC 3OKDA 2H1PL 1MJ8H 5HJ3A 3QXDB 4QRRE 4PREA 4RA3A 4S1DD 1ZXQA 1DBAH 3TT3H 1KYOK 1MFCL 5F9WC 4R90H 2NY0C 5EU7E 4G8FA 2GK2A 2F5AH 2OTUB 5CUSL 3MRRA 3WSQH 2EIEA 4HIIA 3PHSA 1WEJH 3MRHA 4JPKH 3ARDD 5F8RC 2O93L 4HCRL 3VXRD 1OTTD 2ZJSH 5CWSB 5J12C 1IGIH 3ZKXB 4PGJA 4IBLT 4RFOH 1EH9A 2AXFA 2DQUH 4UILH 5C07A 1KJVB 2XTJC 1H3PL 3U36B 4LLDA 3SJVE 5T3XD 5DJAB 3KLAA 4Y16B 5ACMA 5JA9A 5M95B 4GMSL 4PTTA 1GGYA 4H88L 1TJHH 3VFSB 2Q3ZA 4KAQL 2FR4B 3GSWA 4YBQC 4FQXA 5D2NC 4Y5XC 3L5WB 1F97A 2W60A 5JUEL 3WXVH 2R15A 3JV6B 1KB5A 1WWBX 5MEQB 1BD2A 1YY8A 4G6FB 3QNXB 1F42A 5AYUH 4EVNB 3UTSB 4F7MB 1BFOA 1MWAA 1EXUB 1MCSA 5DC4B 1HHGA 4PB0H 2HVKA 2V5RA 4NQVA 3OAYK 4CAGA 3LKQB 5EUKB 1W72L 5F88A 1CD0A 1IGYB 5H35A 4X8XA 3C8KB 3I6GB 1HYSC 1UCBH 2RQ8A 5CEZH 5HDQL 4RISL 1XF5B 3HZKB 3FO0L 1CT8B 1KIQB 2BNRA 2SEBB 4BKLA 1A0QH 4JDZA 1IT9L 3W9DB 3MJ9A 1QRKA 1P5UA 3OHXA 4JO4H 3O3AA 1GHFH 5T33L 5DUBB 1TIUA 4YHZL 1UM4H 5HHXH 2AEQL 1JZ7A 4O2CA 5SWZA 3SJVD 4O2EB 4N8VG 5CD5C 3K1KC 3M1BB 3RVUC 2Q86B 5CEXB 3BDXA 4S0TD 4NUJA 4GAJL 4OM0H 5FYJE 4KPHL 2O5ZL 1F45A 1L7TH 3BD3A 3EFDL 3MRQA 4OLUH 3T04D 3KPQB 1OF2B 4OT1L 5GZNC 3DRTB 1BGXH 1HCVA 5ICZB 1PY9A 3BMVA 1ONQB 4WO4B 5AUMA 3ET9F 1HXMB 2AJZA 2YMXL 4UQ2B 2VE6B 5CP3H 2CMRL 3QDGA 1DDHB 5L9DH 1MCQA 3HZYA 4YO0B 3VMNA 2HMIC 4L5FH 4HWEH 1LD9A 1CFNB 4LDEB 1QBAA 5I1IL 3TJEH 1MHHB 5B8CA 4OI7A 3WLBA 2WWMC 1TFHA 2ITDA 2X2YA 4CADB 2BVTA 1T22B 4UT7L 4GKNB 4Z7UE 5MERB 2VXTL 3T08A 4UV4L 5I76A 1N8ZA 5E2WH 3MGOA 1FORH 5FKPA 3FN3A 1FAKT 2E6JA 1C5BL 1MIMH 4R4NC 2AKRA 1FZJA 4H5SB 4Z77A 2Y36H 3MBEB 5IKCA 8FABB 4KDTA 3T0XA 1MFNA 1DBKH 4HGWA 4LVHC 3KG5A 4XC1H 4U1KA 3BUYA 2R0WH 5HI4C 5E24E 3KPSE 3IU4L 4JY5H 5GS2H 3MRKB 4Z9KB 5F3HA 4I3GA 1QNZL 1S7QA 3ZDYF 4OZIE 3QIUB 4JFDA 3EOAA 2Q8BL 4U1HA 3QCUH 4NQDE 2GSGB 5GRZA 5FYJD 1NCTA 3P73A 4U3XA 4ENED 3EIFA 1LO3H 4TSAL 2W9EH 4BZ1H 2OR9L 4HKBB 2I07A 4U6VL 2W9DL 5IJKC 5ADOL 3BI9X 1U8KA 1CGTA 3ZT6A 5IF0B 3ZKMC 5I1LB 5GRVL 4G8GA 3AAZA 1PSKH 5JMOC 1K8DA 4PJAE 1EVTC 1PZ5A 5DVMA 2R2EA 4I0KA 5TQ2H 3EYOB 1U9KA 3E2HB 5I9QB 1U6AL 4ODSH 3ARZA 1N6UA 3MV11 2VLRA 1A9BA 2E9IA 4PLJC 4TNVF 3GI8H 3GJFB 1S7XA 1MUJA 4JFYB 4GG6F 2COQA 1W0WA 2BDNL 2XKNB 3FQRB 5D7JD 3PGDB 1OGAE 2ZCHH 1HILB 5I30H 3GMMB 4RAHA 4L4TA 3GI9H 4D94A 3H42L 3S4SB 5C0CD 3ARXA 1OAZH 3OR7B 1UWXH 3KPSD 4I18C 2ZSWA 5LVEA 4GRMA 2YEZA 4R96A 5H94B 3BWUC 1UZ8B 5EN2B 3FQXB 3Q5OA 2IBBA 3LKSA 3QDMD 4PJDE 2NPLX 1RVFL 4NQDD 1Q8MA 3DV4A 5E6IB 1B0GA 4YXLL 1A2YB 2HT4D 3OGCA 2VH5L 4B7IA 5EO0A 1ZLUK 4N68A 3BESR 1CD1A 2IH1A 4NQEE 1T89C 3IU3A 5BMFL 3MOBL 4X7DC 2R9HC 1REIA 2FWOA 2AEWA 1FVCB 4RMVA 3W82A 1C08A 4FTVB 1JNNL 1F4YL 1UXWA 4M9PA 2M2DA 4OF7A 4WGVB 1UA6H 2CKNA 3QI9B 1H8SA 4WFFE 3JXAA 3KPRE 1NFDB 4YLQT 1XGUA 4NQCE 4RMRA 4PJ9B 3IFNH 4Z95H 3D6GA 3K2UL 5FO9B 32C2A 4Y1AB 3W9EA 1UGNA 5T3ZL 5J6GA 5KN5B 2P4AB 4YH6A 2A83A 5EBMB 2W9LA 1N6QL 5DJXB 3RNQA 3MYZA 3SKJL 3ULUE 5CZKA 3VXUA 1QRNA 1QG3A 4AMKL 3FB8B 4MA7L 4ZFOL 1F6AB 4K94H 2H32B 1OGAD 3REWB 3B9KB 3MRNB 4PRHD 4XP1L 4U2YA 4FQIL 3BN9D 1N5AB 3I9GH 3D0LB 3QDJB 1XF1A 3UTTB 1X5IA 1T7YA 5E8OA 4LLMA 3MRJA 4LPXA 2EECA 4XXDA 5I0ZA 4CDGC 1HIML 5FUCC 1VACA 3CDGB 1NAKH 3HI5L 3BH9A 1P9MA 3OKYA 5KTEH 3BIKA 4LGSB 2J8UB 3ETBF 1P4LB 5ETUB 1NEZG 4CNIA 4BFBD 1X5AA 1AXSA 2NY3D 3O0RH 2ZNXA 1GGBL 2JJSC 4QXUL 3T4AA 4NQED 2XRAL 3PIQB 4IIQC 4L9DA 4MS8D 4JKPL 3MJGX 5H2BA 1WIPA 2A1WL 1SBSL 1FFPB 1CDHA 1CDUA 2R69H 4IDLA 4K3GA 2GITA 1P5VA 3D48R 3SKMB 1J8HE 5DJZB 2CRMA 4WFFD 4NQXA 3KPRD 1TETL 3C60D 4J8RA 5JPMA 4NQCD 4RDQG 5I6XC 2GYSA 4HF5L 5JOFB 1A1OA 4OLZL 3PWNB 3TH4T 4N0YH 1QUNA 3T0EB 1FL5A 5DURD 1YYLL 4E42B 4PG2A 3V6ZA 3S88H 3OGOE 1XF4A 5I8KH 1MCPH 1RZFH 3HE6A 2EIDA 3MSPA 3BH8B 3WKMH 4FQLL 4PP2B 4YE4H 4ZAKC 1TJIH 5IFHL 3VFUA 2ZUQB 4NO3B 4TRPL 1JJUA 5DRXB 1FV1A 1FLTX 1DQLL 2X41A 1A22B 1S5HA 4YHMH 2QR0B 2VERN 4KKCD 2Y23A 5CIPH 2NTSP 3TYGH 1LO4H 4YIQA 2VDKL 3WNLA 2OM5A 4UIMA 1BZ9B 4PRNA 4E41D 4CVUA 1RJYB 3BDYL 3U7WL 1EUUA 3HNSH 3RDTA 4KKBD 5HI5D 4DN4L 1OT1A 3MLTB 4MAUL 3F12B 3UDWC 5I2IB 3DTXA 4UU9A 5GGRB 2JB5L 3TGXA 1J8HD 5LGHH 4K7FB 3TBTB 5ANMB 3WFHB 2OP4H 3R0NA 4KZEH 1YEJH 3OR6A 4NJ9H 3RHWK 3TIDB 4ZDHA 1SYSB 3RGVD 1RZGB 2GFBA 3PWLB 3ZYIA 5EIIA 4KJQD 1SVZA 4LGRB 1ZGLM 1Q9OA 5C6PB 3RVVC 5JO5A 1LHZA 3QG6A 1RJLA 3BE1H 5FYLL 4CU8A 5CP3A 2CO6B 4LCWA 4P57A 3PHOA 4WNQA 4P46C 1OSPH 4BQCA 4M8QB 3MRDB 1S9WB 4XNQB 3VXRB 1XT5A 3RIFK 1TTFA 1QBBA 2AJSH 4EKXA 4Z0BH 3NCEB 2C3VB 3RWEA 1KTDB 4NZUL 4L4JA 1RIVH 4XRCA 2JLLA 1J1PL 1JL8A 4HSQA 5DYOB 3O6KL 1ZHNA 3U0WH 2DBJA 5SWSE 1FNHA 5D5MB 1IEHA 3IDMA 1F11A 3ZLQC 4JB9L 4HW6A 2ZUUA 1GPOH 4OZFG 1KPUB 2DD8L 1T1XA 3TT1H 2ATPA 5EZIL 3PWVA 5JORA 2NY6D 3HS0A 3QIWD 5KAQF 3IT8D 4S1SH 4Z7VE 1EEZB 5DZNA 4H0HB 1WICA 4X99B 2ZUYA 5GGTH 2CKBH 1WITA 2H2PC 4GBXB 1MHEA 1O7SA 4HZLA 1UXSA 2C1PB 4LSVL 5KSAD 4EBQL 2YD2A 3LV3B 4QTHA 4ZS7H 3MFGB 4HS6B 3PGFH 2ZOLA 1Z3GH 2A6IB 4NC0B 2VDRL 5E5UB 3N1FC 2PTUA 5E1AA 4EIGB 1T6VN 4QRRB 1OD7A 5T1MA 4X6DE 1MREH 1QLFB 4WRLA 4YHLL 3FL7A 5FHAL 4M7KH 1RUAH 1IGCL 2X4TA 4HIHB 5C08E 1QQDA 2HG5A 2EEDA 1ETZA 1JTOA 5JXAL 1AGEA 3ZKXC 3ES6A 2KL6A 1VKXA 3MV7A 3STLB 2MCG1 4G42A 1V3LA 4QTIH 4PJ8A 4Y16C 5A3ID 4KQ4L 2ARJA 4ZPVA 2EXYD 4KK5D 2C3GA 1HQRA 2NZ9C 3FTGB 2ICEA 3VG0L 2IBZY 1H0DB 5SWSD 2VDNL 3PGCA 5FIEA 4LLAA 4XCCL 1FL6B 4X5WA 1U2CA 3GMOB 1FVDA 2MNUA 4HJ0C 5DA4A 3IETA 1CLOL 1X7QA 4HWBL 3RTQD 3FQTA 2OTWA 2JCCF 3V52H 1I9IH 4KV5F 4HEPG 5HVFB 1LDPH 4LKCB 5KG9A 2GEEA 2N1KA 1TZGH 5L2JA 4K3JL 2E5EA 1CTNA 1AY1H 5IBLD 1QFWI 2NW3A 3NCCB 3TNMB 4LKXB 1MHPH 3VFNB 4G6ML 5BV7B 5C0DA 1EGJH 1MJJA 2JJTC 4APQD 3V0VA 1J0ZA 2VITB 4O02L 1TVHA 3L7EB 4LLUB 1Q1JL 3AGVA 3ARRA 3MLZL 5I8EA 5CSBA 5DFWH 4I0PD 4XPGH 3WIFB 5HHVL 5C08D 4R7NB 4ETQA 1K4DB 1TTGA 3B8YA 3MXVL 3DPBA 4F37F 2ID5A 3X12A 1KTRL 2YHGA 4GRWE 5CBAB 3SDAA 6CGTA 3TO2B 3RL2A 1OTSC 3T3PE 2FEEL 3LSOB 3U82B 1J05A 4NZRL 5GSVA 4U33A 4OGYL 1EIBA 4TN9A 4P2OA 2QQKH 1AHWB 2E9JA 1GAFL 1IJ9A 4F7TA 4L3CA 1HINL 3Q6GL 4J7RA 4ISVA 4WO4C 1WLHA 1CDIA 2BCKA 1KOAA 3UBXB 5DMIH 3FFDA 1XGYH 2MKLC 4A6YL 4N9GA 3DSFH 4HBCL 1QLEL 2PO6A 4N0CC 4XCFL 4MVBD 5FV2A 5MHSE 2PYED 5E2VL 2DLEA 1D5BA 5IVXF 3ROOA 3MRIB 4PP1D 3HUJE 3QXAB 4K8RH 4YX2L 4L3AA 1BX2A 4Z7UB 1HNFA 3GSQB 3QUKB 3AVEA 2H6PA 1FYHB 3MBEC 3SCMD 4M61A 3SE4A 6FABL 3MJ8B 3GM0A 4G8EA 1M7DB 5IJVB 4J3WA 3QNZB 4CL7A 4LPVA 4B5EA 3P9LB 2PW2B 5FDWB 5EA0H 1OP3H 1ZTXL 1YEGH 1VGKA 5DTFB 5IHUL 1UQSB 3QIUC 3EO1B 4K07A 4MJ5B 3KPSB 1CICD 4OZIB 1L7IH 4AG4L 3DUUA 3RVXD 3L1OH 2IG2H 1CWVA 2N7BA 1JPGB 1M05B 4NT6B 3O6FD 1ZK9A 1XMWA 3WIIL 3VWJA 3T77B 3KPPA 1H9VA 2EXWD 3PG2A 4ETYA 1HDMB 1QP1A 1LGVA 1U3JA 4PG9A 5D7KE 1ORQA 5IW3A 4CVXB 5DQDL 2HTKC 5JXEA 5DK0B 1ZT7B 2DWEB 1S9YB 2BC4A 2XN9B 1I3GH 2FJFA 4WV1A 5HGHA 1JZ3A 5MENA 2W65A 5ESQB 3L5IA 3JWOL 5I9QC 1RZ7H 4PJAB 1F02I 1T1WA 3D39E 3KS0J 4FFYH 3KLSA 1D5XB 4MAYD 3MRCB 4NSKA 3D69B 3B5GA 4NRYB 1SYVB 2HRPL 3Q3GA 4MCYB 3OXRA 5CIPA 2D9QB 3OF6A 1YN6A 2X4OA 1JHKL 3BKJL 1HYRC 1MCKA 3CFBB 4PJ7A 1I1AD 5L8LB 5GXBB 1RMFL 1OGAB 2VKXA 1JV5B 1NAMB 3WJLC 3PP3H 1WZ1H 4OGAC 2JB6B 1Q9LA 2EE6A 1C1EH 4IRJC 4OLVL 1CFBA 4JO1H 1W8OA 2F58H 3KR3L 2C3WA 3RZCA 4AL8L 2Y06L 2Q6WA 2ZOKA 5ALCH 1OCWL 3CFCL 3V4UL 5E6IC 1KXVC 3CXHJ 1BQSA 3RIAK 2YPLA 3I2CH 1EHLH 1RI8A 2ZKHL 5F89B 5I73B 4WI2A 4EUPH 2NY3B 3CLFH 1LDSA 5HYQB 3WFBH 4NQEB 1Z9LA 1NCWH 3OMZA 4JQIL 3UJIL 3LHPH 1U41A 2VIRB 4ZFFA 2AV7A 4KHTL 3U1SH 5B4MD 5I6XB 1IKFL 2DQGL 3SPVB 2NXYD 4PJ9C 1DFBH 4PJFB 2CPCA 3ZKNC 3KPRB 4YXHH 3C60B 1P6FA 2OL3L 1BVKB 4NQCB 3U7YH 3D39D 4MD0A 2GSIB 2JELL 1H15A 4HIEA 4OB5L 5DT1H 2FECI 5ILTL 3TNNA 5K9JL 3V0AC 1CZ8H 4QNPF 1FIGH 1R3JB 5HDBE 2MTPA 3NZHL 4Z7QF 5DJ2B 5CEYB 2Y9RT 5FOBA 1S9XB 1BAFH 5DURB 5DRNB 4JY4B 4YHIB 3RNKB 3FB6B 3TBYB 3B9KC 4BH8B 5IHZB 2H9GB 1JK8A 3PWJA 1AIFB 2NY5C 2VR4A 3DUSB 4YGAB 4F2MA 4K7PL 5C0EA 1QFUL 4KKLD 2NNAA 1KCRH 5DD0L 3C09C 5GGTA 3QQ3B 2CKBA 3CSYA 4I3RL 1F4AA 2H3NB 1SJVA 4PYHA 1XGTA 3WE6B 4RWYH 3MACH 2D31B 4J3OC 3NABL 1IC7L 4YFLI 2VXVL 4FZEH 5D72L 2YKLH 4ONOA 3G5ZB 2EIZA 3W2DH 1MCHA 4ONGH 2VLJD 1FYTA 4JKWA 1UH3A 2F54A 1EAPA 3P0VH 2CJUH 4HWNA 4ZO8A 5D7LE 1R0AL 4QXGH 3OKOB 2IC2A 3D87B 5EUOE 5F1NB 2BP3A 4XI5C 5BXFA 1NL0H 3TBVB 4B7LA 2AJUH 1J8HB 4Q58C 1ZLWK 3OAZK 1JRHH 1IAKB 1MH5B 3FRPA 4L8SA 4MB3A 5BO1H 1SBBA 3O3EA 1V7NL 4KI5C 3P30L 4PJHF 3GIZL 1P4BH 2R0ZH 2LTQB 4JDVB 3T0EC 4JVUA 1URLA 5DR5L 4PLNC 5BZDB 3VH8A 4ZUUA 4LSPH 1F4XH 2XIDA 5TH2A 1JUFA 3T8XB 3VXPA 2Q3AA 1A7PH 3BD5A 3D9AH 4IOSD 4X4YA 1V5JA 1NEUA 3I50H 4JFQB 1RZKH 2F15A 4ODWA 4WHYH 5JW4M 1QPXA 4JQVA 5BJTB 2ZUQC 5JDSB 4Q6IA 1UM5H 4X7TA 5I8OL 5DGQA 4PJBE 4H25B 4EOWH 2FZ3B 5EFIA 3BPLB 2V5SA 1INQA 5C2BH 1EGJA 5DXWA 1ZOXA 5IB4A 2WMPA 4PLKC 3VXMA 3VXQB 5TE7H 2Z93A 2G9HA 5F9OL 2CLZA 4OCSH 2ZZUT 4QYOA 4P5MB 4BZYA 4DZBB 5D7LD 5TE6H 4K2UL 5AAMA 5FUOH 3T2NL 3NN8B 3DX9B 3GO1H 4NDMA 3VXTA 3S36L 1K6QH 1MFDL 2J88L 4WDIB 5K9KB 1KELH 1T66D 4C56E 3CCHB 3AS1A 5IBTH 1JPFB 1IRAY 1N2RB 2AEPH 4OCLC 5DD1H 2AJVH 1MFCH 2MPAH 3DETC 3UPRA 1U8IB 3TYFB 1KB9K 1I8LC 3B5HA 4BSVA 3WEXA 1BQHA 1N26A 3RQ3A 2WM0A 3K1DA 1CLYL 3M07A 1A4KA 4HC1H 4XVJL 3TLRA 5I1DB 2E7LA 3R1GH 1PG7H 1GGUA 4M3JA 3NCJL 4O9HL 4H1LH 1K2DB 4HT1L 3FO1A 4GKSA 5E8NA 3FT3B 4DUXA 1XCQA 3MZGB 2FX8H 3WN5B 3NCBB 3MNWA 4IHOA 1KACB 5JLZB 3FT2B 1D6EA 1IFHL 3TZVD 1T6WA 1KCUL 2BFVL 5GISH 4LARL 1T7ZA 5F96L 5F6IB 4RRPA 4NO5B 3O4LA 3U79A 3G04B 4EDXA 1LP9A 4XAKD 1E4XI 1KG0A 3OWEA 4FMKA 5F7KC 5SWSB 5T1LD 4I0CC 4YQXL 3BP7A 1UH2A 2XWBB 2N7AA 4GW5A 4HH9B 1NMBL 3WFDL 5T1KA 5DRZB 4LF3A 2EDRA 3ARVA 5CZXD 1U8QA 2Y5EA 3RTQB 4EN3B 4HKZB 1R3LA 2DN7A 4Y2DA 3HPLA 3QWRD 4Z7VB 4GBXC 1MLCB 4LASL 1W72H 1DVFA 3JVGA 1CD8A 3U48A 3BZFA 4C56D 5DMKA 1PX4A 4M5YH 3VGGA 3TVMD 3FO0H 4XMKH 3OG4B 3RPIB 2B7DT 3QEGL 3G5VB 3QO0B 4KMTL 4OGXH 2QKIB 4APQB 3LQZA 3RWGB 3B3IB 5CJOH 2ESVA 3PDGA 5EU7C 1NLDL 3ALXA 4X6DB 3TCXA 1P7QD 4IMKA 1DJSA 4K3DL 5C07E 4HJJL 3LEVL 3IGAA 2CDGA 4I0PB 4LPWA 3GHEL 4RGNE 1TVBB 4CU7A 4YHZH 5CJ5A 2FJHB 2XPGB 4HV8A 5KVEH 1FG2B 4S11A 3RHWF 4JM4L 1FLRL 4LRIC 2AS5M 1EZVX 2AV1B 4X6EB 1NKOA 2HRLA 3QT2A 3C2SA 1Q0YL 1BD2E 5IBUG 4LCYB 1T7WA 5D9SA 2DI7A 4XMLH 3SKOB 2W59A 1I9EA 1RY7B 3WUZA 5GGUB 2CMRH 2IFFL 3GMLA 4LIQE 2ADIB 4QHNA 2ICWB 3BP6B 4WEBH 4HS3A 3I6KA 1Z0MA 3MLPA 1FNEA 2DI8A 2I9TA 5DO2D 4Z8FL 5GGQL 1INDH 4GAGH 4Y5YC 5E4IA 4ZUWA 1MVFA 2IANB 3T0AA 4Y4HA 4Z7NF 2BNRE 5BV7C 4HDIA 3JTSB 2ADFH 4WI4A 1SQ2N 2VMFA 3SGJC 4Y4FB 2IQ9L 5F71A 1D3CA 2I9LB 1A4JA 4IRSA 1J1XH 3TESA 4PJXF 4ZXBA 4F58H 5T5NG 1Y18A 4EUPA 3SCMB 3N1PC 1FFNB 1KJ2B 2DWDA 5C6WH 2BOBB 4U2ZA 2HN7A 4R3SA 4HEME 4OZ4B 5C07D 1UYWL 5SWZE 2BHZA 4RGND 1ITBB 3VE0A 1NC4A 2A0LD 2A6DB 3QQ4A 3FFCA 3MXWH 2DMCA 3MROB 2CRYA 2X7LB 2WV3A 4GRWB 5KVDH 5H8DA 5KS9B 1PVHA 1KJ3H 3MRMA 1CICB 5I66A 3LEYL 1AHWC 4FQ2L 3GMPB 5A2FA 4ENEC 1BD2D 3QDGE 2MQ0A 2W9DH 3O6FB 4LBEA 4KGJA 4QXWA 1FZMB 1ZMYA 4ZTOL 3WD5L 5J3HD 3LKRA 3WFZA 2Z92B 3CLEH 4JHZA 1NGYA 1QSEE 5GJTL 2H2SC 4H0GA 5SV4A 2AQ2A 3U9PH 4TQEH 4NQUA 1NDMA 1I4FA 5GGSY 5HYSA 1UADC 3Q2CA 2DI9A 4CN4A 5AZEL 2X4NA 3TC9A 1FP5A 1XIWA 2C9AA 1AGBA 3K81A 5EU5B 2P24B 4ORZC 4UDTB 2QHRL 4KUCD 1MAJA 2HJKA 4DAGH 3FB5B 3MODH 3WO4B 3HUJB 3OB0K 3EHBC 1A1NB 1BQLL 4MAYB 3EGSB 1BOGA 3FKUS 3VFVB 4JG0H 3UJTL 1XCTB 3QEUB 4XP4L 5BCAA 4YHKH 5EBWA 4MLSA 1DR9A 2BRQA 3MRPA 1YA5A 1T20B 4UZGA 1TCRB 1DLHB 3WUWA 1I1AB 4JFDE 4NJAL 1QLRB 1GIGL 2V2TB 3OQ3B 3CFEB 1YYMH 1R5IA 1RSFA 2EDTA 1FNLA 5SWZD 4NRZA 3KXFA 4FXGB 4OF5A 3QJHB 1W0VB 1DCLA 3QQ9C 4Q9BA 4KZDH 3F7QA 3AM8C 2P47B 2X9WA 4TVPH 2BOCB 2A6JA 2P45B 4LSQH 4HPOL 2NY4D 4N90E 2YRPA 1G7HB 1G9NH 5A2KH 5FGCE 3PP4H 3HMXL 3R06B 4G9DB 4JRWA 3QDGD 4HIJB 4G8GE 2AXHA 4XZUA 4NQSA 1U8LA 3VWKA 2X89A 1CXLA 3O11B 3ARFA 5DDHB 1CQKA 2Y6SD 4UT9L 1XR9A 5CHNA 3H9HA 3K4ZA 1RZ8B 2VSDA 3K2UH 2VLRE 3S35X 1PLGL 5EOCJ 3NACH 4PJCF 2XT1B 1EO8L 1FFOA 1F5WA 1EEYB 3O8XB 4NWTH 3MRBB 1N0LA 4JLRB 3RBSA 2QEJA 3IAQA 4L4TE 2FYYB 1T0NA 3PL6A 4NYLA 2BSRB 4AT6B 3QXVA 4UNUA 1XGQA 3U2SB 5AZ2H 2YD1A 4GUPA 4JFDD 3IKCB 5E2UL 1KLGA 3BN9C 4JRXA 3RL1B 1J88A 1WBXB 4POZD 3MFFB 1TXKA 2XFXB 4H26B 4P99A 1VADB 2EYTA 2W0FB 3SHSA 5MP6L 1HIMH 4Q97A 1A6PA 4KVCH 1PY4A 2MSPA 1JPTH 3FZUD 3I84A 4JG1H 4M1GL 4ZUVB 2FLBT 1T1YA 3GB7A 4QRPA 5I73C 4X6FA 1MI5A 4N90D 1MCRA 2XZAL 3MYJA 1UWEH 2NY3C 3KYNA 4XCEA 3TN0A 5IIEB 3MBXL 4QXUH 4U1JB 4ZTPL 4GMTL 4PRBA 1YEKL 3O2VL 4G8GD 4HC1A 2DQCH 4MS8C 4H1LA 1IKNC 2NZIA 2YPKA 4YEFA 1X5KA 1NCBL 3CMOH 4LVOB 2KQMA 1TETH 3QISA 4ZS6C 2VAAB 2B2XL 5DK3A 4FOMA 3C60C 3T3ME 2VLRD 4QRSB 3UTZA 4HG4J 2OI9B 2R29H 1MAMH 4Q9RL 1C16A 1MF2L 1R5WA 4OCRH 4OLZH 5EBLB 1E4WH 2KZ1B 1QRNE 4JVPA 5C70A 3L6FB 2Q76B 4YDLB 4M7JL 3V4VL 3BZ4A 4XBGB 1CE6A 4R8WH 3ULUC 4E0RB 3DNKA 1EV2E 4L4TD 5I1AA 2NY5L 4XNUL 3S97C 1NGQL 4M7ZB 1P1ZA 1IC4L 1YEEL 4FQPA 2HLFD 3RFZC 1LK3L 2OJZH 2X4UB 1CD9B 1I1YA 7FABL 1A3LL 1CF8H 1DTUA 35C8L 5IK3B 1W72A 2P49B 4HUVA 4GG6A 4XPFH 3IXAA 4LSRL 5FM8A 1T03L 3CNKA 4JAMB 1MRDH 4RQQB 2OTPA 3ZHLA 5E8PA 5IW1A 5E00B 1OAXH 1Z5LB 1K3ZA 1W0YT 5EORL 4W4OA 1WAAF 3IF1A 4NO2A 1VFMA 2AABL 4U0RB 1JGLL 4KKBC 1S8DB 4MAUH 5IMOA 3MLVL 2R4RL 5F44A 3V5KA 4NN7B 5FEBA 5D7LB 5IG7B 1D5ZB 2XKSA 2V2XB 4YFDB 4NP4L 3BP4A 4MWFB 3V95A 4I4WB 5EUOB 2OCFD 3WHXB 3KWWA 3G6DL 2LTQC 2R1YB 1A3RL 4MA1B 4OFDA 4YHPB 3RGVC 3EDEA 3L3JA 3VXUD 1QRND 3H7LA 4KJQC 1AD0B 1DN0B 1PX3A 3BGMA 4WVRA 4GQPH 4I48B 5L6YL 5ALBL 4WI3A 2Z31B 2BSSA 3CSGA 3MLSL 5FYLH 3FO2A 3CXDH 2LABA 4TSBL 3EYUL 4M00A 2C4FU 3D18A 4Y8AA 4F7EA 3I75A 1IM3B 3U46A 2CSPA 5D1QB 4YHYB 5CEZE 4HWUA 5L7XH 3N0PB 5ACZB 5IB2A 3Q1SL 2QL1A 4OBRA 1BPVA 3BPLC 4FQ1L 2IAMA 5LGJA 3TZVB 4QRUB 4A2LA 4L8BA 1SEBA 4IS6A 1F58H 4PJBB 3RWHB 3QNYB 2LU3A 3JWDC 4PB9L 2E8ZA 2Q7YB 2GTZA 3FRUA 3I3EA 5KSUA 4LK4A 1JYXA 4RZCB 1H3TA 12E8L 1DL7H 2XWJB 3E8UL 4ESKA 5BVJB 5CD3A 4PR5B 3EW3B 5E08L 4JKKA 5HTSA 1QVOA 3B6SA 1PJ9A 3SDDD 4CUCA 4Y5VA 1JYVA 1L9NA 3WJJC 3RU8L 2HH0H 3PHQB 5HHPB 1NFDF 5B39A 4U6HA 1J11A 1YZZA 5DLML 3GKWH 3ZE2F 4C56B 3VGHA 1DZBA 1NSNL 5D8JL 3BZEA 3IYLW 3TVMB 4EIZC 1N5YH 4ORGB 2HKHH 4FFZL 4LCWE 4ZOAA 2QQNH 3AXLB 3HE6D 3OAYH 4C54A 3VJ6A 2EYSA 3DYOA 1U93A 4KQ3H 5JXAH 4OCNC 1EVUA 3FMGL 2ZUTA 1RUML 3UJJL 2I5YH 3DVFA 4QGYA 5DJYB 1KFAH 4J3UA 5T3XL 4LNVA 4EDWL 4NHCL 2NW2B 1YEFH 3IAPA 1WF5A 2Q7NA 4AIXA 3H3PL 5CEZD 4NNPH 5F6IC 4PBXA 4KK5C 1EEUA 4J1UB 1SM3L 3LOWA 2VISA 4L4VB 2G5BA 3IDYB 1VCAA 5CJQL 5DJ0B 2DDQH 2Y7QB 2J8UF 4JFXA 5F97E 4HWZA 3RDTD 4R4FL 3PV7A 1S5IH 3CVHH 5IMMA 3RTQC 1PEZA 3BAEH 2CXGA 4X5XB 1UB6B 4JE4B 3VG9B 5C0FA 4KRPD 1ADQH 3MUJA 2VDMH 3MUGB 3QHTC 1NC2A 5IQ7L 1S7UB 2D0HA 2YUXA 2OR7A 3OKDB 2VL5A 5C71A 1EHXA 2OSLA 5HJ3B 4MHHG 1Z2KA 4PREB 4FP8L 4I77L 2Y4SA 1PGRB 2R2BA 4APQC 1JZ5A 4PRPB 3BKYH 3QRFM 4G8FB 2I60L 1Q1JH 2C7UA 2B4CC 5IFJB 4LCWD 3MRRB 1JIBA 3IJYA 1YY9D 3MRHB 3UAJC 3MV7E 4I0PC 4FQHA 5I1HH 3P11L 1YPZF 3AUVA 3DRQA 4PGDB 2X9XA 5KVGL 4M43H 5DMYA 1CI5A 2Z91A 1KXTB 3P4NB 3UZQA 5DS8A 2DYPB 2B0SH 3GSWB 4FQXB 4L8CB 2W60B 1Q72H 2YA2A 3TWCL 1R3IL 1BQHG 4Q9CA 3FN9A 3Q6GH 3RBGA 1KB5B 4WWKD 1BD2B 1YY8B 1FE8L 4LLQA 4O2FA 3NIDF 4QRQB 3UYRH 1FZOA 1YQVL 1BFOB 1MWAB 5GS2D 1HHGB 3NVQA 4Z0XB 4A6YH 1I85C 1P2CA 2DJUA 3NOIA 2VABB 5H35B 5BV7L 3UYPA 1CGWA 4GW4A 4PP1C 5TDOB 5F7WC 4RRPG 1NGWA 5DF0A 4Y4FC 3LAFA 3I02A 3RA7H 2BNRB 1ZGLB 5D1XA 3V9FA 1H5BA 4BKLB 4N0UA 1QKZH 4P5TA 5JOPE 3JV0A 1E27A 2JIXA 4X4XB 3SCMC 5DI8B 4NNYA 2CGRL 2BNUB 2JF1A 4I5BB 3OHXB 5CCKL 1A6VH 4F7CB 3O3AB 5I18H 3MV7D 4ZFZA 5IHUH 4PJ8D 1QR1A 1RK1A 1VPOL 1YNLH 2P8PA 5CJBA 3WXWL 2A2QT 4O51A 4O2CB 5SWZB 5TPWL 4RIRA 3IDXH 1EJOL 5HHOA 4D0BA 1CICC 3NIGE 4NUJB 2AVGA 3RVXC 1A7RL 5FYJL 2OMBA 4BYHA 3NH7H 4GAYB 5D6CB 4HKJA 2AJYL 3GSUA 3QEHB 3O6FC 5D5MF 4YJZL 4E5XA 5JA8B 3L7FA 4XVUC 2EXWC 2YRZA 2AJZB 3QDGB 2H41A 1LD9B 1WIOA 4P3WA 5ACLA 4UTAH 1CGUA 1QSEB 3WLBB 3DMMA 2ITDB 2Z35B 1ZLUH 4J6RL 4TULH 1K9TA 2ORBL 1KT2A 1OGTA 3ARDA 3QG7H 4KKNA 3WO4C 5J4MA 1N4XH 5IW6B 1N8ZB 4MAYC 2CDFB 3MGOB 2ICWJ 5FKPB 3MA7B 1RU9H 3NTCL 3V4PH 2AKRB 4EI5B 2R23A 2V9RA 2WP3T 4Z77B 2KPNA 5JOPD 4Q0XH 1ZKAA 1GGIL 5DMGC 4HK0A 2PF6A 1I1AC 2YPVH 4HGWB 4RGOL 4TSCL 4U1KB 4LCIH 4I3SL 4WU5A 3OJ2C 4MX7A 5IFAL 5F3HB 3SDAD 4LSTH 1DQMH 4BFIA 3TFKC 1KV3A 2FX7H 1CN4A 3EOAB 2F8VA 4P3DA 2VC2L 3X3GH 3KPNB 1HE7A 1NLBL 4P2OD 4YUEL 1UM6H 4Y89A 3EBAA 4J3SA 1JWUA 4MJ6A 2D7PA 1I1CA 4TUJB 2ZKHH 1J0KA 4NGHH 3NA9H 2I07B 2QSCH 3STBA 2VLME 3V0WL 5IMKB 4EUPG 2FJGA 5FGCB 1V3KA 3E6HA 1JGEB 1U8KB 3W81A 3DBXA 3C5SA 2X1WL 2DLFL 4G8GB 2PO6D 4NBYB 2KQNA 5MENE 1IKFH 3MOAH 2HFTA 3DIFA 3MR9A 5CILL 5B4MC 1ACYH 1K8DB 1PKOA 4M3KB 4JN1L 5TFSL 3GFUA 1N0XH 4MJIA 3WMSA 4OCXL 4UNVA 4X0KA 4WJ5A 2AK1L 2CQVA 2VLRB 2RJMA 2VR5A 4JFHE 3O8XC 3ZKQD 5K9OA 3QUYB 1S7XB 4PJ7E 4QRTB 2NY1D 1MUJB 1NCAH 2V7HB 4R0LA 3GSRA 3GIVA 1SHMA 1W0WB 1T0MA 2X1OA 4HS8H 4Z76A 1DEDA 4TUKH 2VDLL 1T2QH 4XCNA 2VQ1A 4QWWC 2CDEA 4DVRL 1NAML 2X4SA 5J13B 4PGZA 5DJCA 5IVXA 3RWCB 3G5XA 8CGTA 2ZSWB 4KRMB 4KKLC 4CN6A 4Z78A 2YEZB 3FAWA 2APTA 2DQEL 2YPLE 3LKSB 1A6WH 3A6OA 4W81A 4D2NA 4YGVA 5FECB 1B0GB 3OGCB 2BXZA 4Q74A 3VWJD 1I3VA 5ESAB 4G6KH 2IH1B 4WFHE 4HK3N 3IU3B 2J8OA 1ZA3A 5K33A 2VLMD 2Z0BA 3MO1A 3H3BC 1KEML 4EEEA 3VGAB 1BBJB 5JXED 1CFQB 2A73A 1UXWB 4P4KB 1V3MA 1MFAL 1NGPL 2DQDL 5MEND 4R9HA 3JV4A 4LVOC 4UIKH 5MI0B 1F3DJ 2UV3A 3KPLA 32C2B 3W9EB 1QFHA 2YC1B 1A5FH 5J6GB 4F9PC 4BZ2L 1IGJA 4K55A 2A83B 3GIZH 4JFHD 3OF6D 4Y5XA 1VDGA 2ZUWA 2BSED 1CL7L 3RNQB 1X5LA 3UC0L 3ULUL 4HH8A 1T1ZB 4ZOEA 3AB0B 4KK6D 3ZYOA 1A9EA 2IMNA 4S1RL 2IF7A 2J4WH 3CVHA 2Q8AL 4M7ZC 3DVGB 2IFGA 4TOYH 2P7TB 5GGVL 5EC1B 3QCVL 5E8OB 4LLMB 4WHYG 1ADQA 4XXDB 3D2UA 2PKDA 2WIIA 1Y0LB 2Y5TA 3T2OA 2FEDD 3ZE0E 2G60L 3BIKB 4QHUA 3MCLL 4OZIF 3MNVA 2E27L 3X14B 1FYTE 4U4BA 1AXSB 4XAWL 1JTPA 1JWMA 1D9KA 4JHWH 2F54E 2EEAA 3U83A 3TM6A 4U0RC 1FDLH 5INCA 2HYMA 4U1LA 5H2BB 4UDUB 1CLZL 4NN7C 1VENA 4L29B 4JPVH 1I7ZA 1AO7B 2GITB 3RPKA 3LZFH 5A40E 4V2CB 4DVBA 4NQXB 5D7JA 1MFDH 4J8RB 1MJ7H 3EDJA 3HZMA 3O45A 5JPMB 3BHBA 4G8IB 5ICYA 5I1GL 2MOVA 4LEOB 1T66C 1NANI 1GGCL 4ZD3H 4MMXC 5C0CA 1HK6A 3WV0A 4MA1C 4NPYB 3V5DA 4XPAH 5FA4A 2L7UA 1JCKA 1I7RA 2HVJA 3V6ZB 3G9AB 5BW7C 2Z31C 5DVLA 3NCJH 1KNOA 2PNDA 4U1MB 5C86A 4M1DH 1IBGL 1LEGA 4WTZA 1U58A 5D1QC 4YHYC 2XKUA 3D0VB 4IJ3B 3O81A 3VFUB 2YSSA 4JCMA 1FV1B 4D0CA 3C6LA 3BSZL 4H8WH 4OUOA 3TZVC 1S5HB 1QBMH 5KZCB 1BBDL 3H9SA 4PGBA 2ITCA 3VXME 3JWDL 5FGSA 1FYTD 5HGGS 5C6TH 5HHME 3VFOB 3VRIB 2F54D 4C83A 1TQCB 3RDTB 5FYJU 2DMKA 4OCWH 4X4ZA 4RMSA 3DTXB 1S7TB 4PLOB 5CZXC 3SO3B 3BO8A 1LNUA 2IJ0C 2VDQH 4F15B 3W5MA 2P48B 1VEPA 2EZ0D 4XPHL 4GG8B 1YC8A 4KRPB 1CK0H 2X40A 3BVNB 3KPTA 4PJFF 1OWRM 4WW2C 4ZDHB 1HHHA 4X9BA 4HFWB 5I1EL 2GFBB 2A9MH 2WUCL 4KI1A 5EIIB 3TVMC 5BOPA 5CZVL 5F7NC 2CRZA 5IBUB 1WBZA 5JHDA 4OFPA 1Z9MA 4M8VA 4PRAB 1Q9OB 3LS4L 4PJEF 3QG6B 1RJLB 3SDCA 1MNUL 1F13A 2WW8A 4P57B 1U95A 3PHOB 3ULUF 3O2WL 3RY4A 1Q94A 3LKOA 4WY7H 1OSZA 5D7SH 3HA0A 1MEXH 2GJJA 1U92A 4V1DA 3RWEB 1T21A 4LHUA 2E7BA 1I7UA 1ZT1A 4L3EA 3O4LE 3WFEL 1UCTA 1LP9E 1MFEH 1ZHNB 1SY6L 2A38A 3IDYC 4FQJL 2ARJQ 5TE4H 3IDMB 1F11B 5BVPH 5LXGH 3VXMD 3K2MC 3GGWA 2OX5A 4HUUA 1OP3K 1A7BA 1T1XB 1JGDA 5HHMD 2ATPB 3T4YA 4YNYA 1AJ7H 1GRWA 3PWVB 4P49A 4IRZL 5JORB 1G1CA 5EO9B 3HS0B 1AI1H 2YBRA 5JOEA 1ZGLP 3AY4C 3OPZL 3LDBC 2X09A 3VG9C 4JZNA 1R3HB 1QPPA 2M8XA 5CP7A 1E6OL 3LN4A 4ONFH 3CU7A 3RRQA 1MHEB 3ULVF 1CFSB 3QHFH 4HZLB 1UXSB 1NMAL 2D9CA 3WIHH 3SOBH 1MY5A 4B53A 1LVEA 1AC6A 1KENL 4XHJC 2ZOLB 2H26A 4YWGL 3DX7B 4QT5A 4UV7H 5E1AB 2ESVE 2XZQL 1DBJH 2CUHA 2B4CL 3BIBX 3QAZB 4ZOBA 4OGZA 5L2KD 4JPIA 1SMAA 1QQDB 2HG5B 1ETZB 3GBMH 1WCQA 1YMHA 4E41A 3ES6B 3WNOA 3MUHL 2HT3D 3MV7B 1VKXB 2D7NA 4G42B 4RGNC 4LRNL 2A0LC 4F8QA 2IPTL 5B39G 2IADB 5I71B 3HI1A 5ESVA 2O5YL 4K8RD 1PBYA 1HQRB 2FGWH 3HNVL 3O4LD 4U0QB 2ICEB 2D3VA 4FQXC 4DKAA 4FQ2H 2R0LL 3GHBL 2XWTB 2WINB 5GGRY 3PP3K 4R7DA 3K4DA 3KS0H 3ZTNH 1NFIA 4X5WB 1RHHA 1BOYA 1FVDB 4JO3H 1QA9A 5F7DA 1AR1C 3IETB 2HA1A 4IMLB 3EKCA 4KMLB 3CD4A 2PTTA 1I9RH 4Y2DD 2OTWB 5C0BB 1IC5H 4WEMB 1FC2D 1DVFD 4JRYA 3GSXA 4F33A 5CGTA 3EDDA 5L2JB 2MKWA 3VGFA 4F57H 1XGPA 3IXTA 5I15L 2NW3B 3T0DA 4DKEH 3GUTA 5FM4A 2C3XA 4GH7B 4OD3H 5C0DB 4U49A 1MJJB 2HTLC 3V0VB 2APWA 5C0ND 1KEGH 2RB8A 1TVHB 2ESVD 5KANI 3TP4A 3MC0A 1OAQH 4XP4H 3D85A 1KJ2L 2ERJB 5I8EB 2PYFA 1H3UA 5JIHA 5E9DB 2UYLB 3A6CH 2BVOA 2LVCA 1GIGH 3FFCE 3F5WA 4N0FA 5GRJH 3X12B 4YFLF 3VFRA 1ZA6A 1ZE3C 1BEYL 3PQYA 4HMEA 3SDAB 3G6JA 1FNSH 3GBNH 2GK0A 3RL2B 3IDUA 1RQ5A 4DGVH 4XB7A 3L5XL 4U05A 1UKTA 1J05B 3EO9L 5GSVB 5TQ0L 3IDNA 1QEWA 2YN3A 5I19H 2UUDK 4P2OB 1CXKA 4LAJH 2VXQL 2VJXA 5B3JF 4L3CB 5FHBH 1DBML 1WK0A 4ISVB 4KROD 1D6VL 1FAIH 4R26L 1A02N 3S37H 3DECA 5KBNC 2BCKB 1IAOA 1U0QA 4K9EL 5EZOL 4M6NL 1WFTA 4G6JH 1AQKL 1RFDL 5B8CC 2PO6B 2Y6SC 4DN3L 5KOVC 4ZAKA 4HQQH 4Y4HD 1D5BB 4XMPL 5HI3C 2XZCL 4EJ1C 5IUSA 4MDIB 1PLGH 3MLXL 1A14L 3GJFH 1F90L 3P77B 4MA3A 2QSVA 2OK0H 5DWUH 1IQDA 4IRSD 1FN4A 3MLYL 1BX2B 4ZXBD 4EI5C 2VXUL 3CX5K 4OLWL 5CBEA 2H6PB 4JN2A 4M61B 1MCOL 4HIXH 1K5NA 4KDTC 4G8EB 5IEHA 3BT2H 3STZA 3KXFE 2L4OA 1VGKB 3FFCD 3T0WA 5HYJA 4LP5A 4ODUA 4G5ZH 4KFZC 4POZC 1N3NA 3FOMA 2V17L 3WBDA 3DUUB 2FEEI 4QHLA 4M1GH 1S7SA 4QHMA 4X9FA 4U3CA 3FZUC 4C58B 4OTXL 3C08L 2APVA 4MNGA 4KHXL 1JNHA 4N8VA 3C5ZB 4J12A 3VWJB 5KAQG 2QQLH 1ZT4A 4PG9B 3CH8A 3ESUF 3K8MA 1ORQB 1UWGL 3DGGA 1NGZB 5BZWA 5HY9B 3QQNA 2DQIH 3CX5J 4P46A 3JTTB 4I13B 5EO1A 5HGHB 5MENB 2W65B 4TNWK 1XIWD 2EYRA 4PRIE 4UAOB 4JHAL 1T1WB 1WVZA 4PGCB 4NSKB 4G6AD 3PJSB 1DP0A 3OXRB 3F62A 5A2IH 2X4OB 4YK4C 1JPSL 1VSCA 1BJMA 1JHLH 5GIRB 3B2UD 4JRXE 5J13C 4OZFH 1B2WH 2WBJA 2DL2A 2MWCA 4W70A 5F7EL 4HXBH 3KXFD 1DUZA 2EKJA 1Q9LB 3S34H 5K59F 3MGTA 5AWNL 2HLFC 4OUUB 3FQNB 5KOMC 5HPMA 1HI6A 1MRFH 2FBJL 35C8H 5F93C 5ID1A 5J9PA 1E4KA 2FATL 3RZCB 4QRPE 2Q6WB 5LAXA 1LMKA 1MI5E 1Q9WA 4NC1E 1EO5A 2YPLB 5KS9F 3NPZB 1N7ML 3BP5A 4YDJA 1WTGT 2OTUA 3VWKD 2X89D 3BPNB 3VGAC 4ZYKA 5HVWA 2DJSA 1JGLH 3CMGA 3WFCL 3ARFD 4P4KC 2AV7B 4XGZB 1I8IA 4ERSL 2DIJA 3RKDD 1LO2L 2C4XA 4G7VL 1CBVL 5MI0C 2NLJB 5DEZA 1L9MA 2GJZB 5DJAA 3VFSA 2CIKB 1TZHA 4HFUH 1F2XK 1P4IH 1H15B 3HC0A 4HIEB 3TNNB 3UEZA 4PJGF 3VFTA 4Z5RB 4WCYH 3HUJF 3BN3B 3CJJA 3PL6D 3AB0C 4UINH 2VUOA 5FOBB 4XVSL 1JF1B 4FFVD 1B6UA 3QNXA 5JPNB 1LO0H 3TA3B 4EVNA 3UTSA 4M5ZH 1WTLA 5C8JB 3FHQA 1EXUA 1JK8B 3C6SA 4JRXD 3RWDA 3DVNA 4CU6A 1Z9OA 3MLUH 4U7KA 2NNAB 3LKQA 1JGUH 3LPGA 4N1EA 5EUKA 3LH2H 4GG6E 4PJCA 2CKBB 3CSYB 1ZWIA 1RK0A 5D1ZA 3A67L 4QRPD 1XGTB 4M6OH 3Q48A 1A64A 1MI5D 4P9ML 3WIHA 3BEWA 2SEBA 2YK1H 2HFGL 5LCVH 5IB5A 1HOCA 1U8HA 4PB9H 1KTLB 1FYTB 5LBSH 3WYRA 1WZLA 1FCGA 2F54B 4RBPH 1EAPB 1G7QA 2BX5A 1F8TL 4ZSOA 3B2VL 5GZOD 1XZ0B 4NZTL 1AFVL 3EFFA 4ODHH 3ROLA 5BXFB 3QUMH 4O2EA 2IBZX 5CINH 2Q86A 2HP4A 1CXHA 4R4BA 3O3EB 3VI4F 2BMKA 1NBZA 2B1HH 5DD5H 5D8JH 1Q9KA 4PG2C 1OF2A 4O00A 5KANG 2DM4A 4MXWL 3G6AA 5DK2A 2J6EL 4ODBD 4LQFH 5ICZA 1BF8A 4LHJB 4UQ2A 2HT2C 2VE6A 3VH8B 3VW3L 4YO0A 5BRZB 5TH2B 1JUFB 3UX9B 3VXPB 3LEXA 4RFEB 1PW3A 4FABL 1MHHA 4PPTA 2AJXL 2F74A 2OLDA 4OM1L 4CBPA 4KTEL 4AEFA 4IJ3C 4M62L 4CADA 4Q6IB 4NHCH 4GKNA 3HFML 4WUKH 4X7TB 5K9QI 4W68A 2GJ6E 2YD6A 1SM3H 3NFSL 4O5LL 1DANU 1IAIL 3SGEI 5CJQH 4WW1B 4AH2A 4X6CF 5IB4B 1OHQA 1RUPL 3MBEA 3RDTC 8FABA 3L3OB 3SDYH 2Z93B 4WHCA 5D2LB 5F3BA 3SO3C 4JGUA 4S10A 4DKFH 4MA8L 4U6YB 1P84J 4ALAH 4DEPB 4KRPC 2GKIA 2CH8A 1CGXA 2P8MA 5SWQA 4XWGH 1AGFA 4FZ8L 2R2CA 3DROA 2BVPA 1RIUL 4I77H 3UPRB 1WAAA 4JQXC 3RUGF 5GRVK 3SN6N 2ZCLL 4BSVB 4AENA 4D0DA 3T0VA 4OIAA 3RWFA 3J7HA 4P9HH 1A4KB 4PY8J 2NX5B 4HUWB 5IF0A 5GGVY 3ME0A 1YY9C 4NC2B 4S1QH 3L9RA 4GKSB 5E8NB 4R6UA 5HDBF 3TEUA 2VQUA 3GNMH 3MNWB 2VLJA 4IHOB 2VYRE 4GKOA 5C0IB 3GSNL 1T3FA 2IALA 4UTBH 5J89A 1D6EB 1EUTA 3PWUA 3SE8L 2IAMD 1RUKH 1PG7X 3DHMA 2WK2A 4H0IA 4D3CH 3MV01 3O4LB 2DWDB 3GJFA 1V05A 3H9YA 1CU4H 3VFWA 4EDXB 1QBLL 2EDOA 1KG0B 4AQ1B 3ARWA 2XKNA