1YEHL

Structure of igg2a fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
219
structure length
219
Chain Sequence
DIVMTQSPLTLSVTIGQPASISCKSSQSLLYSNGKTYLNWLLQRPGQSPKRLIHLVSKLDSGVPDRITGSGSGTDFTLKISRVEAADLGVYYCVQGTHFPYTFGGGTKLEILRGDAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Catalytic antibody
molecule keywords FAB FRAGMENT
publication title X-ray structures of a hydrolytic antibody and of complexes elucidate catalytic pathway from substrate binding and transition state stabilization through water attack and product release.
pubmed doi rcsb
total genus 50
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 1997-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1yehL01
3TIEB 4XCFH 1FNSL 4TN9A 3A6BL 5ISZA 3BN9D 4D9LH 4YHKH 5GRUL 5ISZB 1W8NA 4KI5F 3IFLL 5JOPD 5JNYA 2EH8L 2BFVH 2E7HA 2ADFL 5ID0B 5JNYB 4WTWA 3V4VL 5F7FA 2Y36H 1IGMH 1D6EA 1OCWH 4OD1L 1UM6H 1D6EB 2YD8A 1CLOL 1NCAL 4K3JH 4NQXA 4POUB 3TVMD 3RWDA 2QQKH 4NQXB 1ZV5A 4UOW1 4C4KT 1ED3A 3RWDB 3MR9A 4L9LC 1ED3B 1Z0MA 3MR9B 3QCVL 1QFWL 5EOCJ 2H41A 1CXIA 3MOQA 3O45A 3L6FA 1ZK9A 1X9QA 3O45B 1NFDE 1JTPA 3ZMRA 5LCVH 2AJSH 1P53A 4R0LA 4XWGL 5FYKU 4OZIE 3FN3A 3L3IA 4R0LB 1UC6A 2FEEI 2A38A 4M8VA 3L3IB 3MMEA 4NKDB 3T1FA 1FFNA 3MMEB 3T1FB 2JELH 1FFNB 1KUMA 4U7MA 1X4YA 3HB3D 5JUEH 3FQXB 3GUTB 3RWCA 3HI5H 4MNQD 1OP5K 3RWCB 4P4KA 5F3BA 1H3VA 4FFZL 3SJVA 3QIWD 4P4KB 4X7DC 5F3BB 1MHPL 4WW2C 4YDJB 5HDBE 3SJVB 5EBMA 3WL9A 4KTEL 4ONHA 5EBMB 3IDNB 1J12A 2HLFC 3WL9B 4ONHB 1FSKC 5E4EB 4NC0B 1AJ7L 5I1CL 5HPMA 2E7MA 2HT2C 2APXA 4ZUSA 2XV6B 2VDLL 4LSQH 1B4JH 5HPMB 4O4YH 4ZUSB 1QP1A 4ESKA 4RMWA 4YBLB 1G7QA 3WKML 3CMGA 3NPSB 1MCDA 1SYVA 2NYYC 3U36A 2DLTA 3BEVA 2LFGA 2IQ9L 3LQZA 4JFFD 5DC4B 3U36B 1CF8H 3BEVB 3TYGL 3LQZB 2GHWB 3UYPA 3PL6C 4OKDA 4GBXA 2DI8A 5SWZA 5KS9F 5LBSH 4GBXB 2R2HA 5SWZB 2FH6A 2R2HB 3D39D 1NCWH 5F6HJ 1UM5L 3BQUA 5HHXL 3ZDZF 2ZCKL 2A6JA 1CD0A 3BQUB 1J0IA 3DJ9A 4WFED 3QUKA 4M4RA 3QUKB 4TTDD 1MPAH 2VXTL 1AI1L 2GJ6D 1HOCA 2GIYA 3HKFA 4K3EH 1HOCB 4JG0H 3MUHL 4MYWB 4L3EE 1HSAA 2NY4C 3PHSA 1F6LL 1HSAB 1QEWA 2IAMA 1QEWB 2VSCA 5IGXL 2VLRE 2IAMB 5CBAA 5CBAB 4PB9L 4WY7L 3OHXA 3RU8L 4M62L 3OHXB 4NBYB 4ELMA 4Q0XL 3CSPA 4ELMB 2CIIA 4WU7A 1I8LC 3OSKA 4OFKA 3HE6C 2CIIB 2Z93A 5I74B 3JV4B 4TYUA 4LPVA 2Z93B 3U1SL 1QO3B 3ULSB 3LEVH 5ALCL 2A0LD 5HGBA 3B9AA 1A6UH 1S7TA 1KJ2A 5HGBB 1T7ZA 3MJ9A 4LHJB 5CZXC 4FG6C 1S7TB 1KJ2B 5D7KD 3PQYD 4JQVA 1IGTB 1FG2A 5IESH 5A2JH 5DEFA 1FG2B 4A6YL 3DV4A 2ADIB 5DEFB 3K4ZA 4LLWA 2PXYA 3DV4B 4FQIL 2I25N 5E8DL 2JIXD 2IQAA 2PXYB 3O3AA 1P4BH 1LNUA 3EYUH 4PGDA 3O3AB 3DMMD 3KPTA 1LNUB 2QQLH 2KZ1B 2DQGL 4GAYA 3LN4A 1I1RA 2J8OA 1RUAL 3LN4B 4GAYB 2DF3A 5LVEA 1S9YA 1WISA 4MVBD 1S9YB 5I9QC 3NIGE 2FIKA 3A6CL 1NMAH 3O8XD 2FIKB 3VFRA 4P2OD 1MUJA 4NQTA 1YNKL 4P5TC 3VFRB 1PVHA 1VA9A 1MUJB 5JQ6H 2FRGP 4OLZL 4XHJC 3S97C 5IJKC 2HTLC 1NGZA 4MXVE 3H9ZA 2EKJA 2ESVE 1NGZB 5CHNB 3CGTA 4K71B 5GS1C 1MIML 1N6VA 1T21B 4KDWA 2DLFH 1JHLL 2F5BH 1BQHA 5DVKA 1KCRH 3QO0A 3ZT6A 1PZ5A 3REWA 2NXYB 3FN0H 1BQHB 4NJAL 3QO0B 2X70A 1PZ5B 3REWB 3R06A 3WJJA 5IROC 3BKMH 5I19H 3R06B 2VXQH 4J6RL 3ZKXB 2XWBA 1TIUA 2XWBB 3INUL 3NPZB 4ZTOH 4PJFF 3KPQB 3IS1X 1TZHA 1U8MA 5JIKA 1TZHB 1Q94A 5GRVK 4EN3D 1MHCA 1U8MB 4M9PA 5BO1L 1MHCB 2BVQB 3WNMA 3THMH 4C57C 3REVA 1NDGA 3REVB 5FUZL 1NGWB 2QJDA 4OUOA 1NDGB 1A5FL 3U9UA 4M48H 1TETL 3FO9A 4ODTH 3U9UB 1BIHA 3GBLA 1JF5A 5E8PA 2GTZA 3GO1L 2ZPKL 4RGND 5E8PB 3RP1A 4K3DL 1N0XH 2NCMA 4X7EC 3ZKND 5DMIH 1PLGH 3S5LA 5IG7A 3RUGA 5J57B 1MCWM 3S5LB 5IG7B 3RUGB 4F37F 2V5SA 3P0VL 5KTEL 5FGBC 4OD2A 1JI2A 1T89A 5ACLA 1EEQA 3KS0H 1A7OL 3S37H 1RZKC 4OD2B 4HWBH 5INCB 3DSNA 5DO2C 2FO4A 5IB5A 1ZGLM 1YEIH 3ZHLA 2FO4B 5IB5B 4HBCH 2GITA 3MFGB 4K94C 2AEPH 3SKJH 4MD0A 4Y4FA 4M6ML 2RCSH 2XXMB 4MD0B 5T1KD 4MWFA 3GSNA 4PRHA 5C0CD 1WQVT 4MWFB 3GSNB 4PRHB 1DQML 4WFHD 6FABL 1N7MH 1NFIA 1OTUC 4Y16D 1FYTB 4OZHA 4I3SH 5B38A 1NFIB 5EG6C 2J5LC 4OZHB 3KJ4B 3BRGC 2VERN 3VWKA 2IH3B 1FL6A 3VWKB 2W38A 4DK3A 2QQNL 5CKGA 1FL6B 4K8RH 1NFDF 3FT3A 2EXYD 2AJVL 3ZKQD 3GJFH 3FT3B 3FT4B 5CEXA 1YMMD 2Y1VA 3N1MC 5CEXB 5MP6L 4OZIF 3BW9A 4KC3B 1KXQE 3G9VA 4ZMAT 3BW9B 4NQEE 5LWYH 3MLUL 4D0DA 1K6QL 2E7CA 4D0DB 4L3CA 2HRLA 4IMKC 4L3CB 4EXKA 5IQ7L 2VRAA 5K33A 5IBUB 5GGQL 2F74A 5HDBF 1E4XL 4JB9L 3Q5OA 4AQ1B 2I26N 2F74B 2BNQA 1KOAA 3TJHD 2BNQB 4JRYA 4XPAL 1DE4A 1NJ9A 1DE4B 1XF5B 3ZL4L 3G9AB 2Z8RA 3B2VH 4YFDB 1PW3A 4QHMA 1IGYA 4OV5A 1T2XA 3RTQC 1YEGL 1IM9A 4QHMB 4OV5B 1JRHH 1IM9B 4WVRA 5IJVA 4HPOL 2FB4H 5A3ID 3QDJA 3QDJB 5BV7L 2GK0A 2ZSVA 2IPTL 1M1SA 5IFJB 1KCSH 3ULVL 2ZSVB 1U3HD 5IFHL 5IK3A 2NY2C 2P5WB 5IK3B 2VL4A 3HC0A 1WBZA 3L5WB 1B0RA 5DDHA 3ULUE 3HC0B 2BY1A 1WBZB 4FP8H 1B0RB 5DDHB 3T2PA 2ADGA 5FEBA 3MPCA 5I18L 2ADGB 1TCRB 4WFGD 1KIUA 5EZOH 5KW9H 1EA9C 3R0NA 4LP4A 1NMBL 4S1RH 1MCSA 1UA6L 2PTUA 2VZTA 4ZXBA 5JHDB 1A7PH 1I3VA 4NN6B 4ZXBB 5IMKA 5DT1L 5AD0A 1UACH 4XC3L 5IMKB 5AD0B 4FQLH 1YYLH 5D7SL 2YUWA 5CKAA 1NBVH 2J2ZA 3LPFA 3WHXA 1EZVY 3WD5H 3HNTH 3WHXB 3D9AL 4DN3L 3SOBL 1JL8A 4ORZC 1X6NA 1U8JA 4NOBA 5CBEA 4UOW0 1U8JB 1YEJH 1MVFA 5CBEB 3O4LD 3QQ3A 1XF2A 1DQLH 4RGOH 4GAJH 1XF2B 3H7BA 4P4RA 1KFAL 3H7BB 4P4RB 1J0HA 4NM4H 3ZE2E 1QG3A 1NFDB 4QYOA 3T1WA 1AGCA 4LDLB 1UB5A 2Y4SA 4QYOB 1U6AL 1OAYL 1VGKA 3WN5C 1UB5B 1D5MA 4PGJA 1K4DB 3CSYA 1F4WL 1VGKB 1CT8A 1D5MB 4KMQA 3WIHL 1HKLH 1NCCH 4P3CL 1PQZA 1BQHG 1VFBA 1JIBA 2NX5A 2NX5B 5ADPL 2DQJL 3STLA 4GSDH 2B0SL 4HK0A 3GMQA 3STLB 3LKRA 1S7SA 3GMQB 3LKRB 1S7SB 1EO8H 1KC5H 4XAWL 3ZTNH 1YA5A 3NIGF 1T5WA 3BSZL 3D87B 4JRXD 2EECA 1T5WB 4O5LH 3KGRA 2A9ML 4U3HA 1IARB 4BA8A 1ONQA 3CLFL 1ONQB 1RULL 3QIBA 4I13B 2DMBA 4MXVF 4CN4A 2AEQL 3QIBB 3UTPE 3MUGA 4KK6C 3HPJA 5CUSH 2HT2D 4IDJL 2VDRL 1K3ZA 5BS0D 3U7YH 2VYRE 3WXWL 1BEYH 3F65A 4HFUH 4KK9C 3S5LG 2NYYD 3PWPA 2F9BT 3C5ZC 4U6YA 1QFWI 1YJDH 4KXZI 4U6YB 3PL6D 2BHYA 4PJ8C 3ULUH 1HILB 4X83A 3CFBA 2A83A 2YBRA 3CFBB 2A83B 1Q9WA 4FFWC 2YBRB 4HIXH 1Q9WB 3UPCA 3M8OL 2CO7B 5C08A 2PW2B 3MLRL 5T3ZE 5C09D 1S8DA 3BP5A 3W5MA 4XMLL 1S8DB 1I9RH 3BP5B 1X5LA 2FJGB 3MZTA 3LEYH 4YFLF 1CGUA 4G7YH 1R6VA 4X6FA 2CKBH 4HDIA 3MUZ1 4X6FB 3NIDE 4HDIB 1QRND 1BPVA 1AFVL 3A67H 2DL9A 5B38G 2XN9E 3LRGA 3MGOA 2JJSA 2G60H 1ND0A 4K7PL 2NY4D 1NH6A 1ND0B 1X5JA 4PJIA 3CLEL 2X5PA 4OIBA 4PJIB 3JTSA 2OLDA 1L7IH 3JTSB 1H8OA 4YGAB 4JO2L 5GIRA 5E4IA 2X1QA 3O6LL 2JTDA 1HHJA 5GIRB 1CN4A 4IJ3B 1RU9L 3CX2A 1HHJB 3MLZL 2Y72A 4MQTB 2ZJSH 3LCYA 4HMCA 4AY0A 4GAGL 5F9WB 3HE6D 5CJXC 5IBUG 5DUMH 3VFOA 3UPRB 3VFOB 1MREH 5CSZB 4Z95H 1T2QH 3H9SE 5J0BA 3IU3A 2BNRE 5CZXD 4FG6D 3VFNA 4HGMA 5KBNC 3VFNB 5E56A 3NFPA 1NUDA 2VAAA 5EIIA 1HK6A 4YC2B 5C0DA 3MV8D 4M1GH 3V4PH 4HH8A 3NFPB 2VAAB 5EIIB 5C0DB 5HDOA 4LEXL 5JR1L 4GS7C 4Q9RL 2Z92A 4XCCL 1L4IA 3QQ9C 3KNBA 2Z92B 4XI5C 1B2WL 3KNBB 5AZ2L 5BOPA 1C1EH 1OTSC 3L3HA 1AXSA 3ARBC 5DD1L 3L3HB 1AXSB 1FIGH 5DMYA 4L29A 1RSFA 1AGDA 5EO0A 1KJMA 4OKVB 2DL2A 4C56D 4GXVH 4PRDA 4L29B 3SDCA 3U0TB 1AGDB 1F3RB 1T2JA 1KJMB 2ESVA 5EO0B 3RDTA 2XRAL 4PRDB 3SDCB 1RUKH 2ESVB 3ALWA 4PV9A 1MFCL 3RDTB 5D93C 4JVUA 2R29L 3Q6GL 3QB7C 4PV9B 1NFKA 1HHHB 2WWKO 1FORH 1JWSA 4P5TD 2CDEA 4H20L 1RUPH 1FRGL 5AG8A 3S37X 3DO3A 2HTLD 1VFUA 1IC7H 1AC0A 2NY3C 4ONFL 4L1DA 2UV3A 2F58H 3MREA 5AAWA 3VXRE 2E5EA 3MREB 5C0AD 3CJJA 2Y06H 1YNLH 3DXAE 1NGPL 2YMXL 1EERB 1RJYA 3P11H 1KXVC 3DPBA 4HS3A 4ODSH 4AJ0A 3KYMA 3IF1B 4HS3B 4KPHH 3RNQA 3KYMB 4U1NA 1RIVL 3TT3H 4YHZL 5D1ZC 5DYOB 1G9NL 3E8UH 4U1NB 1I7TA 4PJDA 3RNQB 4PJDB 2CLRA 4FXGA 4PG9A 1ZS8A 4HS8H 2VUYA 5C07D 2CLRB 4FXGB 4PG9B 1ZS8B 3T09A 3VGBA 3GM0A 1KTDA 5CZKA 4G42A 1SYSA 4TNVK 4UDTA 1KTDB 3I6LD 3RZWA 4G42B 1SYSB 3ULUF 4UDTB 3MRPA 2WP3O 5F89A 8FABA 3MRPB 3MLVL 3IRZA 1A1OA 1HNFA 4NUJA 5F89B 25C8L 4EQ3A 4NUJB 4HPYL 2YPVH 4OD3H 1BQSA 4AIOA 5E24E 4LLMA 3E6HA 1XGUA 2ZZUT 4LLMB 3E6HB 1XGUB 4P59L 3PUCA 5EIQA 3MRDA 4XVJH 3MRDB 3U7WH 4M6NL 2LQRA 4ZOBA 2F54E 3O6ML 3C6LC 1HSBB 4RA0C 3U82B 2WAHA 1BGXL 1SY6L 4ACPA 2Q3AA 2AJYH 3FO0H 2H6PA 3Q1SH 5DO2D 2BY0A 1XGYH 2H6PB 5BOZG 1UJTA 2IG2L 3SQOL 3T65A 4QHLA 1SQ2N 1A7QL 3T65B 4JFYA 4QHLB 4EUPG 1CIDA 4XP4H 4Q2ZA 1KN2H 4PJXE 5AYUL 5E2VL 4TQEL 1F42A 2AABL 4OZ4A 3NA9H 5HHMB 2UZIL 3ZE2F 4OZ4B 5FYLE 2R0KL 4W4OC 1OTUD 1MVUA 1CGYA 1A21A 1MJUL 3S7GA 4ELKA 4LU5H 2VDMH 1MVUB 4N0YH 2V2WA 4ELKB 2EE9A 1NPUA 3V0WH 5KVEH 2OTWA 2V2WB 4NQEB 3V7MA 1NCBH 1KCKA 4LCYA 3UROR 3Q3GA 3RKDC 4M7KH 4GG8A 5TQ0H 3Q3GB 4GG8B 2EDBA 1OWRM 2XIDA 5EOCH 2XTJC 4NZJA 5SWSD 2FYYA 4WJ5A 2FYYB 4Q7DA 4JDVA 4WJ5B 4CMHC 4I4WA 1G6VK 4J3UA 2VOTA 1LDSA 4JDVB 2V2XB 3TWCL 4I4WB 2NY7H 3SBWA 5DD0L 4RMTA 4HKZA 4OGXL 4U0RC 4KKNA 1E4JA 4QGYA 1GXEA 4R9HA 2ZG3A 1BJ1J 1DQQA 1DQQB 4K23L 4D9RD 3NCJH 3WO3B 3UTSE 2FIRT 4Y19D 2ZP0T 1FQ9C 3BYTA 1Q1JH 3QHFH 4MAYC 3N06B 4LHQB 1D5IH 1RMFH 4R3SA 1JNNL 3RTQD 4ODHH 4R3SB 2BVPA 5I30L 2BVPB 3VXTB 1CICC 5SV3A 4B5EA 5DQDH 4F80A 1N6UA 3N1PC 2DS4A 5EO1A 3WS6A 2YK1L 4RDQG 2IANA 2NY2D 2JB5H 2X1PA 2VDNH 2IANB 4G8FA 1QSEA 5L2JA 4G8FB 1AO7D 1QSEB 3O4OB 1GC1L 5C71A 3SKOA 1RZ8A 5HXMA 3L5JA 5DSCA 5TFSL 3SKOB 1G7IA 1LDPH 3ARSA 5DSCB 3RY6A 4R4FH 3NIDF 1G7IB 4X4XB 3RAJH 1E4KA 1P9MC 2V5TA 3Q6FA 5E70A 5EH1A 3WFEL 4M1DH 3MOAL 1F3DJ 3Q6FB 2YXMA 4DKEL 4UUJA 2HWZL 3NFNA 4K9EC 1OM3H 1NAMB 3IXAB 4UT6L 3IAQA 5F7NC 3NFNB 1N6QH 1FPTH 2IWGA 4UV4H 1QUNA 4HLZH 1NLDH 1D5BA 4JZJC 4BSWA 1XCQA 5TQ2H 3ZYJA 15C8H 2R0WH 5E5MA 5FYLH 1U93A 5KJRL 5D6CB 2DBLL 5E5MB 5MENA 4RISH 1U93B 4ZO8A 3D39E 5MENB 3ZLQC 2D31A 2WNGA 3IXTA 4AEEA 4JO3L 2D31B 4KVCH 3X12A 4ONGL 1L7TL 4L8SC 3RGVC 3GSOA 3F12A 4WFEE 3SEPA 2JKXA 3F12B 4D0BA 3MBEA 1C16A 4HK3N 4D0BB 3MBEB 1C16B 2V7NB 3GMNA 1N5AA 2ARJA 3IDGA 5KVDL 3WFHA 1KBGL 3DVNA 1N5AB 2ARJB 2D4DA 3SDXA 4LVEA 3DVNB 4M00A 4N90D 1UT9A 1NGQH 5J12B 3O3DA 4G6ML 1BMGA 4U6VH 5HJ3B 3O3DB 3HS0B 3WYRA 5K9QG 4C55A 5GGUA 4RZCB 1OGAA 1FO0L 3HZVA 1U3YA 1JV5B 2JJWA 5F1IB 3HZVB 1WEJH 1DN2A 4NHCH 3IDYB 3QRGH 4N9GA 4PRIA 4Y1AD 4MA8L 5D7LE 2LTQC 4N9GB 4PRIB 3SGDI 4BZYA 4J4PC 5LGHL 1K2DA 3S3JA 1IKNC 1K2DB 4TPRH 2QQQA 3FAXA 3P30H 3WSQL 4XPFL 4NSKA 3U4BL 4XPBH 4KK6D 2OK0H 4G5ZL 3O6FC 1IEHA 3ARGA 3FO2A 2AEIT 5EOQL 3ARGB 3DUHA 3FO2B 3FCTA 3B9KB 2G75A 3FCTB 3HZMA 2JF1A 3PP4H 2G75B 3HZMB 2B7DT 3IKKA 1CQKA 3C5ZD 4XNZC 3BGFC 4OF8A 3OMZA 3VD7A 3N9GL 4PJ8D 4PLJD 3LRHA 3I9GH 3VDBA 3H3KA 3KAAA 3Q0HA 3BOVA 5E6ZA 4M7LH 1S7WA 2F19H 1R3JA 4FFWD 1AC6A 1R3JB 5EPMA 3V7AG 3AROA 5EPMB 1F3JA 1U95A 3CX5J 2WBJC 1F3JB 1U95B 4QNPE 4DAGH 4FMFA 4HUKB 3SGJC 2IPUG 4YHMH 4GQPH 1DANT 5IT2L 1A0QL 4ZQKB 1ZLSH 2IMNA 2R1WA 3OKKA 2R1WB 3OKKB 2JJTC 4Q6IC 1U9KA 4MDJA 4F58L 3ROOA 3KXFA 4EBQL 4NQSA 1EO7A 3KXFB 4NQSB 4LVOC 1BD2E 4NQVA 1KB9J 1W8OA 4NQVB 2GSGA 3D2UB 3EKCA 4LSVH 5CINL 2GSGB 1ZWIA 4L5FL 1ZWIB 5K9KA 4YDKL 4I8DA 4F9LC 3VXMA 4L1HA 3QEQA 1XZ0B 1HHIA 4ORGA 3VXMB 3QEQB 3B6SA 4PJXF 5EWIH 1HHIB 4EDXB 4ORGB 1JNLL 5E7FA 5FM4A 2Q20A 3OKEA 3CDFA 2ZKHH 3LIZL 2VAJA 3RVTC 3OKEB 3HI1A 1BAFH 5GXBB 4H8WH 5AAMA 2XQBL 3L1OH 1WIUA 1VESA 2HH0H 2YPKB 3DX8A 5BVJA 4I1NB 5DJAA 5DRZA 1G9EA 2BOBA 3DX8B 4WV1A 5DJAB 5DRZB 5IUSA 2Q8BL 3BP6A 1RZGA 4WV1B 4AENA 2AK4D 3FMGH 5DC0A 1RZGB 4AENB 1NCUA 3QQ9D 4HWEL 4XI5D 1MF2L 4X5WA 3NZHL 3SO5A 1KELL 1P4IL 4X5WB 1KF9B 5HYJD 1T03H 3ARBD 4RX4A 2B5IC 1J1OH 3AB0C 1WZMA 3KPPB 2BHUA 3QUYD 3KYAA 2D7NA 4ZODA 3K1KC 4QKXB 1RIUL 1A8JH 1CIUA 4HMEA 3VXRB 3L7EA 3S35H 1RAMA 4Z8FH 3DXAB 3V95A 4HCRL 1A6ZA 3OJDA 2NY3D 5BQ7A 4CN6A 1A6ZB 3OJDB 5DD5L 4UAOC 5BJTA 5IB1A 5BQ7B 2OZ4A 4FMKA 3C87A 2AQ3A 1CFNA 5BJTB 1SMAA 5BZWA 5IB1B 4LQ1A 4KZDH 1OW0A 1CFNB 2DB8A 2VITA 5BZWB 1T1WA 3L3OA 5TPWL 4WHDA 4YHPA 4POYA 5F44A 2VITB 1T1WB 1L9NA 1WWBX 3L3OB 4YHPB 3NBNA 2HVKB 1MRCL 1D7FA 5FXCH 5F7EL 4BQBA 1S3KL 1KEGL 3TV3L 3CH1A 4IHOB 4J7RA 1DSFH 4TUKH 3CH1B 4GW5A 2FLBT 2ZNWA 5GGTH 4GW5B 1F90H 2AJUH 2Q1EA 4B7LA 2P47B 4A2MA 3D85A 5HDQH 4P23A 4UQ3A 1S7XA 4NGHH 1LO4L 3SDDC 1M7XA 4UQ3B 3L5IA 2W65A 1TZGH 4JM2A 2W65B 4LDOB 5DMGC 2AQ2A 4JM2B 1MWAA 3DLQR 4XNUL 3RZCA 4DOHE 2QADC 1FC1A 1EX0A 3ZSTA 1MWAB 3RZCB 2OL3H 3CFIC 1WFUA 3H42H 1DANU 4UDUA 2UZXB 4UDUB 3C6LD 4PJ5D 3EDFA 3IJSA 5HTSA 2AGJH 3I84A 4DKDC 4FABL 1Z5LA 3IJSB 1J5OL 1Z5LB 2HA1A 2DWDA 1F2QA 1YYML 4JFEA 3RRQA 2DWDB 3G6AA 3JV0A 3MRMB 4I3GA 5DR5H 5L0QB 5I1HL 1YPZA 5BVPH 1V5JA 4FOMA 3VXUE 3F5WB 5I6XC 4UILL 1PKQA 3ZE1E 2EYRB 1P4LA 1PKQB 3AUVA 5HYIA 4MGXA 1CDCA 5F9OH 4GLRI 4Z7UE 4NT6A 4XP5L 1BJMA 3OB0K 5D5MA 2XA8L 4QRRE 2P7TA 5D5MB 5FYKE 3VRJA 2P7TB 4XNYH 1C12A 1ADQH 3RKDD 3VRJB 4QT5A 3MLSL 5DHVH 4ZNEA 1C12B 4JJ5B 1P7HL 3HE7C 4QT5B 2UYLA 3SE9H 2XTJD 5ESAA 5HYFA 4P49A 1IQDB 2UYLB 5ESAB 4QY8A 2VIRA 3RVUD 4OSUH 2VTFA 4QY8B 1UCBL 3HNVL 2Z0BA 4U1HA 2MQ3A 2CGRL 4GMSL 4LCWE 5JW5A 2XZZA 1JZ8A 4XMKH 2FCBA 4PYGA 1HYSD 1QYGH 3TVMA 5DHYA 3TVMB 1KLGA 4G6KL 4P3DA 1KLGB 4IRZL 3H3PH 3SKNA 4P3DB 3ARUA 1FNSH 4GQ9L 4R4NC 3UJIL 3MRJA 3MYZA 5AWNH 2F15A 4OBRA 4V1DE 1H3PL 5GRUH 5CCKH 4HC1A 5T33H 1SVCP 4MAYD 2OR8A 4WTXA 3BN3B 5H37G 3LH2L 4N1EA 2W07A 5B4MC 1CLOH 1CICD 4F7TA 1AR1C 2HJLA 4F7TB 4WCYH 4MNQA 3ZT7A 3K46A 4MNQB 1KTKE 1QNZH 2BSSA 3NGBC 4JZNB 2DQEL 4QXTA 3QIWB 1QBML 1NUFA 4QXTB 3X3FH 3V8CA 3IS0X 4PY7A 5HY9A 3UEZA 2HTKC 2VR5A 4PY7B 4XWGH 4X6CA 3QUZD 4UT9H 4P2QD 5EU7C 3QG7L 5K9QI 3WJJC 4HUWA 4PJBE 5K9JL 3EO9L 3HI6H 2CRZA 4MJ6B 5IF0B 4DFHA 1KIQA 4X9HA 3MCKA 5CILL 5J13C 3BZEA 1KIQB 4JFFA 5AYQA 3MCKB 3BZEB 4FFZH 4JFFB 1MH5B 3BH9A 4LVHB 5ALBH 1KCVL 5B3JE 1KIPA 3RHWF 4DWHA 4NUGL 1BECA 5ANMA 1E27A 1KIPB 1L0YA 3D39B 1QFWM 1FL5A 3MA9L 5ANMB 1EEYB 5SWQA 1FL5B 4PGZA 3DUUA 2OR7A 2MKWA 3GMOB 3DUUB 5ETUB 1JYVA 2O93L 4OGZA 1TZIA 1TZIB 3WKMH 4R7DA 2C4XA 2GJ6A 3E0GA 1ZANH 1ACYL 4OLUH 4FFYL 4R7DB 2GJ6B 1AE6H 1I7ZA 1I1AC 5BV7C 4JREB 1CVRA 5FYKH 1WFTA 4AH2A 4XBPA 1IT9H 4AH2B 1UM5H 4YO0A 4XBPB 3E1F1 1G9MH 2X1OA 4YO0B 1T7XA 5FV2A 3GDBA 3T0XA 1BLNB 2DTMH 2IALA 1MRDH 3HAEA 2E27H 2DYPD 3A6OA 1JYWA 2R39A 2YD5A 2FD6H 3HAEB 1CBVL 1P69B 4YQXH 2FGWL 4Y4FC 4RAUA 4KMTH 1LHZA 1UCTA 4QRPE 4POZC 4RAUB 4WI5A 1J05A 3D48R 5GSVB 2XXCB 1J05B 4OCYL 4J8RA 1J1PH 4RCAA 4BSJA 4J8RB 3C08L 5IWLC 3GKWL 2FZ3A 1EHAA 3I50L 5FUOH 2FZ3B 2AK1L 3NCCB 4ZOAA 1VHPA 4U1GC 1UEYA 3PQYA 3BHBA 4Y4HB 4CNIA 5BMFL 3WNOA 3PQYB 3BHBB 4CNIB 3RWFA 2BJML 5GRVL 4MDIA 3RWFB 4PB9H 4MDIB 2AEWA 3VGDA 2JIXA 1IEBA 3O6FD 4KQ4L 1OAXL 2JIXB 4Q0XH 5TDPA 1VFAA 1IEBB 3DMMA 5D1XB 1HCFX 4EI6A 3DMMB 2Q8AL 5JW3H 4EI6B 1MY7A 2H26A 1MJ8L 2H26B 3CFDA 4P3WA 4XRCA 32C2A 4BKLB 3O8XA 4PBXA 1JZ4A 3O8XB 4P2OA 4PJ7E 4XPGL 4A6YH 2PTVA 5TE7L 4MJID 3V5HA 1DLFH 1MIEH 5E8DH 4PUBL 3D25A 1HH9A 5BW7A 3MV9E 3V5HB 5L2KE 1HH9B 4HXAL 2WBJD 1GHFL 1MFEL 2B1AH 3IFPA 3VXSD 1RZFL 2ENSA 3WUWA 3G04B 1OB1A 3WUWB 1RUAH 4AQOA 4Z7NE 1OB1B 2DDQH 5T3XL 3N1GC 1A4JA 5GS0H 3VWJC 2AQ1A 1FFPA 1A4JB 3WKNA 1FFPB 1BD2B 2X10A 1RV6X 2VWEC 3T04D 4TSBH 2EIDA 4IRJC 3RWIA 2VH5L 4ODUB 3RWIB 3LDBB 2EDOA 3MRQA 3S35X 4GRWE 3C2AL 3MRQB 4XX1E 4XCFL 3RGHA 5MEPA 4GG6E 3ARVA 4EN3A 1GAFL 3PWUA 5MEPB 3NVQA 4EN3B 5TE6H 1K8DA 1MIMH 4D9LL 4YHKL 4BH7A 1K8DB 3I3EA 1JHLH 3FRUA 5DVMA 4ENEC 4BH7B 2OCFD 3FRUB 4NJAH 5LKNA 3UTQA 1XGTA 3RY5A 5CS7A 3UTQB 5EU6E 1XGTB 1IGML 2GT9A 5EORL 3VI4E 5C0IA 2G2RA 4Z9KB 2G2RB 2QQKL 5E1HB 3RVTD 3MV7D 4LAJH 2DAVA 4RGNB 3ZE1F 1OSPH 2GSIA 1MAKA 1D9KB 2GSIB 1E0OB 4PJHA 4MS8C 3L3GA 4PJHB 1CL7H 3L3GB 5BO1H 4Z7UF 2P43B 2Z31C 3HG1D 5LCVL 4WGVB 3A0OA 5HHPA 2ZCLL 5FUZH 3MRCA 3WDHA 1JHTB 4MHHI 3ZHKA 3MRCB 3SGKC 3T77A 1JWMA 3T77B 1C8PA 3TIDA 4QXWA 3SGEH 1JWMB 2JELL 3TIDB 4RGMB 5KAQG 2ZPKH 4K3DH 5T1KA 5C0CA 2QKIB 3HI5L 3DVGA 5T1KB 2VE6A 2PCPA 5C0CB 5FAAA 3DVGB 4XVTH 4YNYA 1F8TL 2PCPB 4DW2H 2P4AB 4LMQE 2I27N 2ERJB 1KV3A 4M7JH 4Y16A 4Y16B 5KTEH 2DQCH 1VGEH 3GSQA 3TLRA 2HFGL 4H26A 2H32B 1A7OH 3GSQB 4H26B 3MXVH 3MTRA 2FX9H 2XPGA 8CGTA 2XPGB 4LSQL 1BJ1H 3GIVA 4O4YL 1YMMA 4YUEL 1YEHH 2BSRA 3GIVB 1YMMB 3L5XL 2BSRB 1T1YA 4JHAH 1X5AA 4QXGL 4NIKB 3BKJH 3KG5A 1ZLVK 5JO5A 3E3QE 5LBSL 5E99H 5JO5B 4KFZC 1T6VN 2APBA 5DJDB 1A3RL 2OXGA 4UMGA 2AJVH 4Z76A 3MRRA 1KJVA 2KPNA 5MP6H 3MRRB 1MPAL 4DOHB 2A1WH 3STZA 4LSRL 2CH8A 1CE1H 1NBQA 3STZB 4PJBF 3SDDD 2JB6A 4K3EL 1K6QH 4WW2F 1VADB 4JG0L 2NZIA 2JB6B 4YK4B 4WW1A 3T0EC 3K2UH 4D9RE 4WW1B 1UKSA 5DMGD 3HUJA 2QADD 3HUJB 3FQUA 5B3JF 1E4XH 4LASH 1ZLUH 3HAEG 3FQUB 1U3HA 3AS3A 4N0RA 1U3HB 1ZGLA 5DK2A 1RIHH 1JZ2A 1WWCA 2L7JA 1ZGLB 4KHTH 5DK2B 4Y4KD 5JPNA 4D3CL 5GHWH 1UEMA 3WDIA 5JPNB 4U1LA 2BSED 5I66A 2NY6C 3P77A 5I66B 2YXFA 3BYYA 1MQKH 2JJSC 3P77B 4HPOH 5ERWA 1YN6B 3LEVL 1G9NC 2EDXA 5ERWB 1JUFA 1A6UL 1UKTA 1JUFB 2DRUA 3CU1A 1VENA 2IPTH 3ULVH 4YDLB 3FFCE 2ITCA 2DKUA 3MCLL 1TQBB 4EI5A 5D72L 5IFHH 5IESL 5I1EL 5C0FA 1CFTB 5FOJA 5KSBE 4NNXA 5C0FB 1HQ4A 1ZTXH 4NNXB 3TH3T 1P4BL 1HQ4B 1NKOA 3EYUL 3VFMA 2X1XR 2XZCH 5F7KC 3VFMB 2QQLL 3HE7D 1DUYA 3O4LA 5HI5C 1AIFA 1HH6A 3O4LB 4NQUA 1AIFB 1HH6B 4WI3A 4QRUA 3BDXA 2AERT 3G5ZA 2BVTA 4QRUB 1DEEA 5CP7A 3G5ZB 3OAZK 4G8GE 4NO0B 4UIMA 5D7SH 1DEEB 5CP7B 1AXIB 4BQ8A 1IEAA 1PJ9A 4UIMB 3T2NL 1IEAB 2R9HC 3D9AH 1U2CA 4L9LA 4DN3H 5JQ6L 1ZA6A 2BVUA 4L9LB 4R4ND 3WUWG 2DLFL 2F5BL 3DX9A 2A77H 4Y5YC 1KCRL 1OWWA 3DX9B 1MCWW 3KYNA 3EYVB 5IOPB 4XZUA 3BKML 1KFAH 5I19L 3LKSA 1K9TA 2VLKE 2VXQL 5B4MD 4HUMB 2NY0D 3LKSB 4ZTOL 1U6AH 2LVCA 3MO1A 4JRXA 3RIFF 4LNRB 3JV6A 4NFDA 3MO1B 4JRXB 4PJ7F 2HRPL 1ZHNA 1S9WB 1UZ6E 1ZHNB 4WW2B 1I85A 5FHAH 3THML 2HTKD 3UZEA 2HT3D 1MCBA 1FSKB 1TENA 1UB6B 4Z7NF 4M48L 5BS0A 1Q9OA 4ODTL 3EW3B 3QDMD 4XAWH 5BS0B 1Q9OB 5MEOA 1LK2A 4U4BA 3BUTA 1CDYA 5MEOB 1LK2B 3ECBA 1N0XL 5H94A 3ECBB 2E8YA 4E41E 1PLGL 5I1IH 5H94B 3PL6A 1A6TA 3H3BC 4NN7C 4YHOL 3PL6B 1A6TB 4GRWF 3CLFH 4LSSH 1QHOA 4GG6F 1FLTX 3S37L 3VW3L 1CR9L 4HWBL 3DV6A 4HAGA 2AEQH 3ETBF 3DV6B 1YEIL 4XGZA 3KPLA 5C09A 4HBCL 4XGZB 1FZJA 3KPLB 5C09B 2AEPL 3WFDL 1EV2E 1FZJB 4LLDA 1A6PA 2PTTA 3WXWH 1A6VH 4LLDB 5I0DA 2RCSL 2PTTB 4PD4J 5HI4C 5M94B 2OTPA 1QRNA 4ZPVA 1OT1A 1TCMA 3VI4F 1I1AD 4TVSa 1QRNB 4ZPVB 1QACA 5C70A 3H0TA 4I3SL 3H0TB 4WEBH 1LO5A 5IMOA 4Z5RA 2NY4B 1BOGA 3H9HA 4NO5B 5IMOB 4Z5RB 1BOGB 3H9HB 4JZOA 4PRPE 3QUMH 1GC1C 4JZOB 4XMLH 3G5VA 1NKRA 4NN5C 3EAKA 3WCYA 2I5YL 2J7LA 1VCAA 5LWYL 1MCFA 1WC7B 3RWGB 2XT1B 2MKLC 5IVXE 3HE6A 3GKZA 3HE6B 2X4UA 4HKXA 2J6EA 2X4UB 4H1LH 5J9PA 1JWUA 4PJCE 3MQIA 5J9PB 3SN6N 1DJSA 3UTTD 3MV8A 2ICWI 3C6SA 1C5DA 5A2IH 5JW4Q 1M6OA 3C6SB 1C5DB 1AGFA 3QHZL 1M6OB 1TJGH 1UXSA 4MXWH 1AGFB 1UXSB 1UH2A 4X6BA 4WHYG 1PX3A 4HUUA 1QLEH 4X6BB 1INEH 3WUZA 4UV7H 4HUUB 3V52L 1JRHL 3SBWC 1V3LA 2FB4L 43C9B 5FM8A 4C56A 2DMKA 1CDUA 4C56B 2BERA 4HJGA 3P73B 5I9QB 3MGTA 3CDCA 4HJGB 1Y6KR 3R1GH 3ES6A 3KLHC 4P5TA 5B21A 5JR1H 4FZEH 1JPSH 3ES6B 3CCHA 3BPCB 4P5TB 4Q9RH 1CVSC 5MHSE 5E00A 5GS1A 5E00B 4O2EB 3D5OF 3CFJA 1EJOL 5GS1B 5KW9L 3NCEB 5EZOL 5GRZA 5C0AA 4BK5A 3CFJB 3WHE0 3CXHK 1XCTA 5C0AB 4S1RL 5DD1H 2DQFA 5JQHC 1XCTB 4GRWB 3VWJD 2DQFB 1A7PL 4FTVE 3STBA 4ONOA 1OAZH 1UACL 2NTFA 1R5WA 2PO6C 4IRJD 1QVOB 1YYLL 1JHKH 4BSVA 1R5WB 1LO0H 2P46B 3W0WA 4BSVB 1KB5H 3WD5L 1EGJH 1MI5D 3DVFA 5C07A 2GAZA 5C07B 2D7QA 3P2TA 3OAUH 4ENED 3B43A 1YEJL 3RY6C 1DQDL 3GRWA 3QNXA 4P2RD 1DQLL 3QNXB 4NQDA 5IEHB 2XA3A 3UC0H 3IU4L 1NGPH 1ETZA 3TA3A 1HYRC 4ZUTA 3IDJA 4NM4L 4ZUTB 3IDJB 1PKOA 1IL1A 2DIAA 2VDOH 2DKSA 1ZEAH 4KRPC 3MNVA 2UWEE 4LSPL 4MS8D 3MNVB 1NCCL 1XIWC 3UP1A 5CSBA 5KSBF 5FGBA 2Z31D 2K1MA 4KKBC 3ROLA 1F6AB 3ROLB 3MLVH 4GSDL 2GYSA 1OOAA 4JM4H 5T1DL 1S5HA 1EO8L 1KC5L 1S5HB 4JANA 5IP4A 2KUTA 4JANB 1LK3H 4J12A 1R24A 5KSAD 1GGCH 4O5LL 1R24B 1YUHA 5TJWK 1FNFA 3O6MH 2CUIA 1B6DA 2BXZA 3MLYH 5EC2A 4PB0L 2DQDH 5EC2B 3QXTA 5DJYA 5CUSL 5DJYB 2FJFA 5DRXA 3QT2A 4P48A 3U7YL 1JF1A 2FJFB 5DRXB 1BEYL 1A7QH 2E3VA 2FJHA 5SWSA 1JF1B 4HFUL 5SWSB 2WUCH 2FJHB 3QFDB 5E2VH 3RWHA 5BRZD 3RWHB 2R0KH 4IMKA 1NUGA 1EVUA 3ULUL 3BH8B 2GY5A 2XTJE 1K4CA 3L3JB 4HIXL 5LXGH 2VZOA 1BVKA 1CGWA 1K4CB 2IFFH 1UZ6F 3D3VE 1V7ML 1BP3B 4HIHA 5GS2H 1I9RL 4HIHB 1JK8A 4Y19A 4PJAE 3IETA 2A6IA 1JK8B 1QBAA 4Y19B 4G7YL 2FX7H 3KPSE 2B20A 2CKBL 3IETB 2A6IB 1PDKA 4Z78A 3PWPD 2MNUA 2WSKA 4BH8A 1JBJA 1FDLH 2HG5A 4Z78B 3RTQA 3T0ED 4OCSH 4BH8B 4BK4A 2HG5B 1QSFA 3VXPA 3PGFH 1UENA 3RTQB 3VXPB 2WIMA 2CD0A 4OUUA 2G60L 4OUUB 3K74B 5HGDB 1B3JA 5C08D 1L7IL 1NAML 3BEWA 1DBJL 4YX2H 5FB8A 3BEWB 2YN5A 5FB8B 1U8QA 2NY2B 3QWQB 1BX2B 1AO7A 3BZFA 3VXOA 1AO7B 1JNNH 2ATPA 3VXOB 2ZJSL 4I5BA 5F7YC 3QFJE 2NY6D 3NCMA 3MNZA 1YDPB 5D2LA 3FOLA 5I1DA 3MNZB 3FOLB 5I1DB 4Z95L 4R90H 1G7JA 1T2QL 1NMCB 1G7JB 4IS6A 4G9FE 3TF7C 5FIEA 1M71A 1CZ8H 4M1GL 4LNVA 2BSTB 3V4PL 1M71B 2IBBA 3O2WH 2DJUA 5K59E 3BRFA 4KQ3L 1KT2A 4OIAA 2D7TH 1KT2B 5JTWA 5SX4H 2YPLD 3MCG1 1HEZA 4TULH 2CJUH 1W2KT 4EIGB 4WFFD 1C1EL 1HEZB 1NC2D 3BPNC 5HI5D 4GRMA 1FIGL 3RX8A 4GRMB 3QZWB 5IVXF 4AT6A 1J0KA 4YJZL 3AMLA 1RUKL 4Z7VE 3BP7A 3ARDC 5CD5C 2B8OT 3BP7B 4DKEH 4OF7A 4UTAL 1FORL 4PJCF 5KVGH 2HWZH 2GTWB 2R9HD 1RUPL 3WN5A 3H2WA 3UXFA 3WN5B 2V9TA 3OJ2C 1IC7L 2C3XA 1M05A 4MX7A 3BD5A 1M05B 2DBLH 4MX7B 4FQHA 2H1PL 4FQHB 1KULA 5FKAA 1JYXA 1Y0LA 4JO3H 4DEPC 1RJCA 2EDFA 3P11L 5FKAB 1Y0LB 1L7TH 5I16A 2MMXA 4KPHL 2Z9TA 4Y1AA 3TT3L 3TNNA 5I16B 4J2XA 3E8UL 4O2CA 4RWHA 5T3ZL 3TNNB 4O2CB 4QHKJ 5FK9A 4HS8L 4OGYH 5KVDH 4I3RH 4X7TB 5E1AA 4BZ1H 1U8OA 4LL9A 5E1AB 3PGCA 5GS2D 1U8OB 3PGCB 1E6OH 4J3WA 1QLRA 2BVEA 4YHYC 3C5SA 4G8IA 1EFXD 1TVBB 1QLRB 1JN6B 3C5SB 4G8IB 1AY1L 1N3NA 1DBAH 2YPVL 1N3NB 2VXUL 4OD3L 1KCUH 3IFOA 5C6PB 3IFOB 4GOSA 5KN5A 4XVJL 5KN5B 3C5ZA 3R8QA 1DCLA 5DJCA 3U7WL 3C5ZB 5GGRY 5LGHH 1G6RH 4IRSD 5DJCB 4PJ8A 4PJ8B 4XHQA 5I8OH 2I9LA 3IDMA 1CTNA 4YBQC 2AJYL 3FO0L 1J8HD 3Q1SL 3DWTA 3WSQH 2PN5A 1MCCA 4NKIL 4P23C 2FECL 4M43H 3OKMA 4G5ZH 3OKMB 1IBGH 3ZKMD 4M61A 4MQSB 3ARZA 1U58A 3MJGX 2YRLA 4QHNA 4XAKE 2DLGA 4XP4L 1D6VL 1U58B 5HI4D 1HINH 4QHNB 3ILQD 3L9RA 3NA9L 1F58L 3L9RB 3F58L 1U3JA 5I75C 5MI0C 4PRPB 4X9GA 4GW1A 1MLCA 4LGSB 4BFBD 2BVOA 1MLCB 4GW1B 2A2QT 4LU5L 2VDML 1JF6A 2UWEF 4N0YL 1ERNA 5AEAA 4OZGE 5FGCB 4ZFFA 4JDTL 4ZFFB 3HC4H 1FHGA 2R4SH 3RBSA 5IVXB 3HMXH 5TQ0L 4Y5XC 5EOCL 4UTBH 1FL3B 4JG1L 1L6ZA 4LCIH 3VFWA 5D2NA 1H8NA 2KBGA 4RMVA 3VFWB 5D2NB 1VEOA 1WZKA 4ZUWB 2NY7L 5CJXA 4R26H 3UO1L 5BCAA 4YPGA 1LD9A 2EDWA 1W0WB 4MMZC 4YPGB 4KI5C 1LD9B 1NGXA 1T20A 2ZNXA 3OWEA 4NNYB 1T20B 4IM8A 1H5BC 1A7NL 4RMQA 3OKLA 4X4MA 5EB9A 3WJLC 3GSWA 2ADJA 1Q1JL 1J8KA 3QHFL 3GSWB 1MFDH 2ADJB 2AK4A 2VO5A 5LGJA 1R5IA 5C0RL 4GS7B 2AK4B 3SDAD 1D5IL 1RMFL 4Z7WA 1R5IB 3B8SA 4ODHL 4Z7WB 4WUKH 5EZLA 3SCMC 3D0LA 1NL0H 5EZLB 3RIAF 5HYJA 3ARBA 1JNLH 1X5HA 4YWGH 5ISZE 5HYJB 3ARBB 4OQTA 2DTSA 2HJFA 1RVFH 2DICA 3VI3E 4OZFB 2Z8SA 3QUYA 3S3PA 1UKQA 4JFXA 3EFDL 3TGXA 2QSCH 1LO2H 4JFXB 5LGKA 2JB5L 3CC5A 3KLHD 2VDNL 3CC5B 1GJIA 5J6HA 3MRGA 3UAJC 5J6HB 3MRGB 3QR2A 1P1ZB 1JGEA 4PJAF 1MF2H 5GPRA 2YUXA 2NY3B 3NZHH 1KELH 3QSKB 4U3CA 1UYWL 4I9WD 1LDPL 3KJ6H 4NZRL 2EDLA 1RHHA 3MLWH 1JGDB 2CRYA 1K3IA 1RHHB 1C5CL 4XCEA 4XCEB 5HHVH 5F96H 4M1DL 2YA2A 3ZYIA 4WTZA 1ZT4A 3BP4A 2PO6D 1RIUH 2V2TA 2EIEA 2V2TB 2D0GA 2P42B 1OM3L 4KUZL 1U91A 1N6QL 1U91B 3VD9A 4HCRH 3QG6A 4UV4L 1CE6A 1NLDL 1JRHI 4QTHA 3SJVE 1CE6B 5TQ2L 4PTUA 15C8L 4QTHB 2R0WL 4KI1A 3VFSA 5FYLL 2Z35A 4PTUB 3VFSB 4RISL 2Z35B 5EFIA 5TPWH 2E7LC 3G6JA 5EFIB 3OG4B 5E03A 3G6JB 4TSCH 4RFEA 5DFVC 1UWXH 4YFLI 4RFEB 5IFAL 1MRCH 3V6OC 1TLKA 3IDUA 5DJ8A 4KRPD 4YHIA 1S3KH 1KEGH 5DJ8B 3TV3H 3SE4A 3CVHB 1GPOH 4ISVA 4YHIB 5L8JB 2XZQH 4ISVB 2Y5EA 1XIWD 3BX7C 2QEJA 3C6LA 1QRKA 4PJ5A 5K59F 5GGRA 5DD6A 3C6LB 5SWZE 4KKBD 5FHBH 5GGRB 4U6VL 5DD6B 1DUZB 5IVOA 1D5ZA 3BJ91 1LO4H 1D5ZB 1IM3A 3EJZC 2W9DH 1IM3B 3MNWA 1WEJL 4K3HA 4HMDA 3JWOC 3MNWB 2R8SH 4WUUD 4YGVA 1YNTA 3CU7A 4YGVB 1AD0A 1MHEB 1QBLH 4Z7VF 1YNTB 4XH2A 2BY2A 1AD0B 4XH2B 4W4OA 4LPTA 4TPRL 3ARPA 1KXTB 2VDPL 4FABH 4XPBL 1T80A 3QH3A 3SO3C 1AQKH 1MJJA 3QH3B 4JY6A 2E6JA 1OGAD 1MJJB 4JY6B 4X7CC 3LAFA 4QCIB 4MNGA 2XTJB 2XQYK 4MNGB 3PP4L 4ZFOA 1O5DT 3R4DA 2Q86A 1HDMA 3V6ZA 4ZFOB 4UILH 5FYJD 4CMHB 4ELME 1BZQK 4OGAC 4WGWB 2YUVA 4HKBB 3CAFA 3ZO0A 4M7LL 2F19L 4U0RB 4NQCD 2XA8H 4GKNA 3G6DL 4LVNC 1G1YA 4UIKH 1HHGA 2O5YH 1HHGB 3BESR 4DAGL 5FGRA 2X9WA 4MAYA 4OB5L 1FVCA 3NACL 3B5GA 4MAYB 1Q0YH 4YHML 1FVCB 3K1DA 4MVBC 3GFUA 2APWA 1ZLSL 3QIUC 4KRMB 5CJ8A 3FQNA 4GMSH 2P8MB 3FQNB 5DA0B 3BPOC 1CICB 1RZ7L 4P2OC 2YD2A 3V6BR 1NCDH 1IKFH 3RA7H 3L5HA 5KANI 2X4RA 3PWNB 2X4RB 3PDGA 4DGVH 5GGTA 1CD1A 3S3SA 4LSVL 5DXWA 1EMTH 3T0DA 5EUOA 1CFBA 3QUZA 4P2QA 4KDTA 3LH2H 5EUOB 2CLZA 4P2QB 1IC5H 5AG9A 1CCZA 2QR0A 2CLZB 4AEIH 5EWIL 5J56B 2QR0B 2EEDA 5KVMC 1FZOA 4APQC 4DVRH 4MD5B 2ZKHL 1FZOB 4BFEA 3CXDH 3Q5TA 3HR6A 1P9MA 4H8WL 2OL3A 3JZ7A 4HS6A 1AD9A 1V7NH 5EU7E 5C0JA 4EN3C 4HS6B 1AD9B 2DQEH 4QOKD 5C0JB 4XXCC 2FHCA 1DEDA 5KOVC 4OZGF 4XWOC 1JGVL 4WI6A 4LEOA 3I6GA 1T04A 4TRPH 3FMGL 3QPXH 4LEOB 3I6GB 1T04B 4X98B 1ORSA 4YEEA 3DYPA 1ORSB 3TYFA 4JZJA 2J88H 3T0AA 3TYFB 4NJ9H 4JZJB 3BD3A 1NCNA 1M7IA 2XFXA 3LY6A 5DZLA 1M7IB 3ZKNC 3O2DA 4AL8L 5K93A 3ARDD 4L8SA 1BQLH 5CD5D 3VDAA 1KCVH 4L8SB 3RGVB 3S35L 1GZPA 1B9ZA 4NUGH 2WWMD 3GSUA 1GZPB 1QR1A 5E8NA 5EU5A 4JDZB 1B0GA 3GSUB 3OJMB 1QR1B 5E8NB 1B0GB 4QTIH 3AM8C 3MRNB 3UBXI 3RUGE 3WS3A 2DYPB 3WS3B 5KG9B 1X4XA 1W72A 4KZDL 1INDH 5DJZA 4FFYH 1W72B 5DJZB 4WTZG 5DVLA 1WWAX 5D7JC 3I85A 1UH3A 1EAPB 2ERJC 2EDRA 4P2CG 2J8UA 4X7FC 3X11A 1KJ2H 2J8UB 3VI3F 3KR3L 2FSEA 2LTQB 3DURA 2FSEB 2XKNA 2F53D 3DURB 1KN4H 4HKJA 2XKNB 4N68A 1IKNA 4PRHE 4TUKL 5CSGA 4HKJB 2EXYC 5F9JA 1HHKA 2J1KA 1F90L 2GCYA 5F9JB 1CBVH 2BZDA 1HHKB 1MFNA 2P45B 4OZHE 3RQ3A 5T5NG 5F3HA 5HDQL 1BBDL 4N0CC 2WUBL 4X8XA 3GI9H 4NGHL 1RJLA 3O6FB 4P99A 1RJLB 4FXLA 1TZGL 2EO9A 4MLIA 1CYGA 4Y8DC 3W39A 4HEME 5FO9A 1I7UA 3I50H 4R2GC 1FAKT 2M2DA 4ZOEA 5C0BA 3W39B 5IIEB 4XNZB 1GYAA 3BGFB 5FO9B 1KYOK 1OQOA 4L4TA 3N85H 4E9LA 1C08A 2AGJL 3PJSA 4YBQD 1C08B 3C8KA 1HZHH 2H2SC 4MJIA 4TUOA 3C8KB 3ORJA 4TUOB 3LD8B 2VZ1A 2WBJA 2L7UA 3OB8A 2WBJB 3VXSA 3WFCH 2BNQE 4Q97A 3LQMA 2Q8AH 3VXSB 3NIFE 3PHQA 4JRYE 3SGJA 5BVPL 2K7QA 2PW1A 4BQCA 5DD3L 1CFSB 1W0VA 1IAOA 2W0PA 1T4KA 1W0VB 2JJTA 3TEUA 3LPGA 4Q6IA 3GJEB 4Y2DC 4XPGH 3PF2A 4Q6IB 1IAIH 4IIQC 5IEKB 2C26A 2AXGA 3S9DB 2AXGB 3QDJE 4EOWL 2BP3A 3G5YA 5M95B 3C9NA 2MFNA 1ADQL 2V17L 3G5YB 4LVOB 4NKQB 2I60H 1VDGA 2BCKB 1H0DA 3FQRA 4YHNB 1UWXK 1BOYA 1H0DB 4OSUL 5C0GA 3T4YA 3AFLA 1AR2A 4F9LA 5IB4A 1OVZA 1DFBH 5E2TH 3EJJX 5IB4B 2J8HA 3CFKB 4EI5C 2VH5H 4XMKL 4NO3A 1QYGL 1OF2A 1V8HA 4KI5D 4LKCA 5EUKA 3MV7A 4NO3B 4LKCB 1OF2B 5EUKB 4G6AD 3MV7B 2FECI 3VG9C 2CLVA 3H3PL 3P0YL 2NY5L 1GAFH 2CLVB 1CDIA 4YE4H 5AWNL 2IPKA 3ABZA 5CCKL 3HG1A 5CFHA 2IPKB 5T33L 3K80A 3HG1B 1J0JA 2PETA 2Q3ZA 3KDMA 3AREC 1MLBA 1MAJA 3KDMB 1TJHH 3SCMD 2QSTA 1MLBB 4YBHA 2FATH 5EORH 4DN4H 3GSNH 4JPVH 2RAMA 2IMMA 1U3ZA 2WLZA 2DQIH 5HHQA 4WCYL 4ELMF 2B5IB 5HHQB 3AB0B 3QDGA 1QNZL 5DK3A 4X6DA 3IGAA 4X6DB 4K8RC 2WWKT 1NAKH 3IGAB 3L6FB 3X3FL 1ACZA 5CJOH 5HYSA 3UAJD 1OGTA 5HYSB 2ZCLH 4UT9L 4MMXC 1OGTB 3PWLA 4HZLA 4JKMA 5SX5K 3PWLB 3CFEA 4D8PA 4UAOB 3HI6L 3CFEB 4D8PB 3MJ8A 3VMNA 2NX5E 3MJ8B 5F6IC 4X5LA 2MTPA 5I2IA 1Q72H 1F8TH 3IRPX 5ALBL 1DQJA 5L88H 1DQJB 1I85C 3ESUF 2HFGH 4UNTA 4A6YA 5BXFA 1OTTD 1CGSH 4FRWA 1MFBH 1HQRA 2FO1A 1A64A 1HQRB 5C6WH 5DQ9A 1C7SA 5DQ9B 4YUEH 2UUDH 3L5XH 1ZANL 3VU2A 3BIAX 4OLUL 1G7QB 3QCTH 1AE6L 3SDDA 1SYVB 5DFVD 1WITA 3SDDB 4QXGH 5I1JH 5FYKL 3QISA 1U8KA 3JWDH 4JFHD 4AYFA 5JXEA 1U8KB 3V6FA 1IT9L 2QADB 2QV2A 3V6FB 1G9ML 4YDIH 3PWPE 3DX7A 1A3RH 2A6JB 5F6HI 3DX7B 2CO6B 2DTML 1MRDL 2E27L 3OKNA 3ARFC 2FD6L 4OCRH 4YQXL 4Y4KA 1IZKA 4HBQA 1XAUA 4LSRH 4KMTL 5T3XD 1S7VA 3EJZD 5I0ZA 1S7VB 3KPRD 3RL1A 5C08E 4WI2A 1J1PL 3RL1B 1R0AL 2AXHA 2BRRH 3T0BA 3DO7A 5FUOL 3IVKA 4OFVA 4J23A 2JK5A 5IBTH 5I6XB 3CDGA 2JK5B 5E2UL 5FM5O 3CDGB 3GHBH 3TFKD 3GMRA 5HVHC 2VZSA 3O9WC 3PDDA 4D3CH 1JZ5A 1XF1A 2OM5A 2AV7A 2NR6C 3RUGF 4PJIE 5J1SC 2AV7B 4KROC 3HE7A 2MCPH 5JIPA 3D6GA 3V4UH 3HE7B 4WU7B 5JW3L 3TJEH 4UNUA 1H3TA 3RNKA 1FYTD 1AXTH 3HNSH 1MRFL 2F8VA 4OGAD 3MCLH 3QWRD 5D72H 2J12B 2R2EA 5I1EH 1H8SA 4RQQA 2YEZA 3BFOA 4RQQB 4O51A 2YEZB 1DLFL 1MIEL 4LLWB 4YHLH 2ATKA 2IQAB 3GBNH 5H8DA 2ATKB 4OZHF 1PYWA 4PGDB 2B1AL 2NPLX 2DWEA 2BC4A 1PYWB 2GK2A 3RVWC 2DWEB 5FO8A 2BC4B 2DDQL 3VRIA 5FO8B 4CDGC 5GS0L 3VRIB 2EDHA 3QIUD 3VCLA 5J1AA 3VCLB 5EZIH 5J1AB 4TSBL 4MQXC 2NY0B 5KSUA 4WWKC 3DETD 3T2NH 5F7UA 2QL1A 3FB8A 4DZ8A 4D9QE 3FB8B 4DZ8B 5C2BH 1A6WH 4JY5L 3NGBB 5TE6L 4OM0H 5K9OA 1PBYA 3TBVA 5K9OB 3TBVB 1WBYA 1WBYB 4PV8A 2X70B 5F1NA 1Q0XH 1U8NA 1FIEA 4PV8B 4M6AA 3NIFF 5F1NB 3F7PC 1U8NB 3B5HA 1Z3GH 1YJDC 2K9UA 5C7XH 4ZS6C 3QDMA 4KRNA 3ULUC 2E8ZA 4APQD 3QDMB 35C8L 3AMKA 1OSPL 1S5IL 4PRNA 5E9DD 4PGBA 5J13B 4PRNB 3FRPA 1CGVA 2HRPH 1CL7L 1Q94B 4N0UA 4XWOD 1G7MA 2XYCA 5F1KC 3T3ME 4W70A 3FHAA 1G7MB 4J3VA 4PJDE 2EDKA 3PP3H 1XT5A 4DQOL 3OKOA 3P4OA 3P4LA 1ITBB 1NBZA 3TA3C 3OKOB 3I02A 4K7PY 1NBZB 2E9JA 5I15H 3I02B 2FLRT 4C58B 4X9FA 3FO9B 4MB4A 2Y25A 2GTZB 4P9HH 1ZE3C 1I1AA 5HVWA 4D0CA 3F62A 1B0WA 4XVTL 5JA9A 1I1AB 4GAFB 5BV7B 4DW2L 4D0CB 1JE6A 3EZJB 4M7JL 4YHOH 5HYSG 5DUPH 2RFXA 2DQCL 1VGEL 2CQVA 3EJYC 4OI9A 2RFXB 3TBSA 1IRAY 3VW3H 1CR9H 1QFOA 3MXVL 3TBSB 3BWAA 5ICXA 2FX9L 4JEGB 3BWAB 4DK6A 5ICXB 4TNWF 2X4SA 2GITB 3WFDH 1YEHL 5CEZE 2X4SB 1A3LH 4YZFE 2PYEA 2YN3A 4F2MA 5B3NA 4Y4FB 2D9QB 4JHAL 3BMWA 4FNLH 5D7JD 3J7HA 3FO1A 3MC0A 3Q2CA 4OF0A 1WCQA 3FO1B 3BKJL 4M5ZH 3V7AE 5E99L 5IWLA 4ODXA 3BD4A 3C5JA 5B38B 5FCUH 4HULB 4ODXB 1GL4B 1GGBL 3C5JB 2Z8VC 5DRNA 5HHME 4MA3A 2H3NA 5DRNB 3UTTA 2EEAA 2H3NB 1GGIL 4U1GB 5MERA 3UTTB 1LE9A 3C60C 4L8DA 5MERB 1SBSH 5ACZA 2ZUSA 4F7EA 2A1WL 5ACZB 4N0CD 2I5YH 4DGIH 1CE1L 5L8KB 4I0CC 3K2UL 3P3YA 4DKFL 4NC2B 3DI3B 4HK3J 5F9AC 5GZNC 1F11A 4JO4H 1R3HA 1F11B 4N8VA 5CGMA 4R2GD 2MCG1 5HYEA 1UJ3C 2ZWLT 4HHAA 4LASL 1T0NA 4HHAB 1MCOH 3WIHA 3WV0A 4NP4H 1GOHA 1RIHL 2NNAA 4JRYB 4KHTL 3NZ8A 3QHZH 2NNAB 2VC2L 2H2SD 1NJ9B 5DFTA 5GHWL 3NZ8B 5DJ6A 5DGRA 5DJ6B 1IGFL 2DM2A 4CRPA 2EDDA 3NAAH 4F57H 3V52H 2VNCA 1IGYB 1B6UA 1X4ZA 1Z9LA 1QQDA 3O3UN 1MQKL 2X4TA 1QQDB 5IJVB 3VWJA 4LLYA 1M7DA 4KTDH 4WEMB 5JIHA 3VWJB 1M7DB 4HJJH 2GK0B 1VFOA 4IRJA 1QPPA 4Y2DD 1FLRH 4IRJB 4I18A 4LLAA 4I18B 3KYOA 1MI5A 1ZTXL 3KYOB 1MI5B 1JPST 4L3ED 2UUDK 2OYPA 2XZCL 5EA0L 4MCYA 4NM8L 1LVEA 1EJOH 2X1WL 3O81A 4MCYB 5A43C 4XPTH 4P2RA 2IANE 1NMCC 2VLRD 2X41A 4P2RB 4PJ9C 3OF6D 1CXKA 2DLHA 3V5DA 1QSEE 1WBXA 1QZ1A 1AHWA 5GRJH 3V5DB 1WBXB 4BQ9A 1AHWB 4O02H 4EI5D 2EE6A 4G6JH 3PXJA 1JGUL 3HRPA 1FZMA 1FZMB 2R0ZL 3RI5F 1DDHA 5D70H 1DDHB 5DQJA 2Z31A 2A77L 5DQJB 1DQDH 2Z31B 4G7VH 4PJIF 4F37K 2OP4L 4K3GA 3ZT5A 3IU4H 3ARED 3QQ3B 3SGKA 4PJGA 1OLLA 2KL6A 4J3TA 4RDQF 4NKOA 4QRQA 2Y07H 3VDCA 1AGCB 5MENE 4NCC2 5KSAA 4LSPH 4FHBD 5EBWA 4NCDA 3GI8H 3CSYB 2CUHA 3UMTA 1CT8B 4QXUL 5GJTL 4K8RD 1DLHA 1PQZB 5FHAL 1VFBB 1DLHB 3LS5L 5C8JA 2XTLA 2ICES 3ARQA 5C8JB 2Y9RT 1CLZH 5ID1A 4O9HL 3D0VA 5FA4A 4HK0B 5T1DH 5ID1B 3D0VB 1LGVA 5DURD 1HKFA 3TH4T 4HEPG 3L95A 3SDXE 4HT1H 3OL2A 3CSGA 3TCLA 2VXVH 3L95B 3TCLB 3FRPG 1OSZA 3EDEA 4EUPA 5BRZA 4LFHD 5I1IL 4GRLC 1OSZB 4EUPB 4Z77A 2ZUUA 5BRZB 4Z77B 1WFNA 1OGAE 1F13A 1UXWA 4LSSL 1F97A 4LK4A 1UXWB 4PRIE 4U1IA 4PB0H 2E6PA 3AC0A 4ETYA 3MUGB 3HPJB 5FYJE 2UVEA 4TOYH 1H3WM 1X6LA 5EO9A 1A6VL 2KQMA 2XY1A 1VSCA 5EO9B 1AQDA 2PNDA 4NQCE 1AQDB 3PWPB 3HHRB 3T0EA 4QLRA 5E5UB 1JPFA 3T0EB 4PLJC 1JPFB 2EC9T 1UFUA 4WEBL 2ILLA 4ALAH 1P5UA 4K7PX 4HG4K 2JJUA 1ZSDA 1ZSDB 5B8CC 1V7MH 3T3MF 3QUML 1KLUA 5C08B 4PJDF 3ARFD 1KLUB 4FQXC 2P44B 1RQ5A 2C7UA 1JMXA 3PDOA 1A7RL 2C7UB 5A16A 2NY1C 2FEDC 5I8KH 1HI6A 3PDOB 1KG0A 5HGAA 4HF5L 3GB7A 1KG0B 3AY4C 5HGAB 4C83A 1R3LA 2NY6B 4JQXC 3OAYH 4C83B 5ICYA 4JJHA 3MGOB 5ICYB 3KWWA 3M17A 5F1OB 5I73B 3M17B 1CG9A 4J3SA 4LPWA 4LIQE 1UADC 1NAMH 4FQJH 5E6IC 5FA3A 1YEFH 1DBJH 5CIPA 5FA3B 3PP3K 1EUTA 5I71C 5CIPB 3O9WD 2GQHA 3BPLC 1TJGL 2XG4A 4MXWL 5A2FA 2NR6D 3LEXA 4LCCA 3KXFE 4LCCB 2YPLA 5D2NC 4KROD 1QLEL 4OLXH 1INEL 4YZFF 3K0WA 4UV7L 4DGYH 2YPLB 5TF1H 1NC2A 3NCYS 2WQ8A 4N8VG 4WWID 1NC2B 4Y0GA 5IW1A 3MGAA 5IW1B 1DBMH 4S11A 3B3IA 3IU3B 2RJMA 1ZHBA 5HHOD 1VACA 3B3IB 3VXME 3R1GL 2RB8A 3QEQE 4NQED 3EYFA 2EZ0C 4RBPH 3EYFB 4FZEL 1JPSL 1ZVSA 1SY6A 1ZVSB 4KQ3H 3IJHA 3LHPL 1R3KA 3IJHB 4XXDA 1R3KB 4XXDB 4Y5YA 3IDXH 3RVWD 5JHLL 4Y5YB 3S34H 5TGBA 4IMLA 5TGBB 1RK0A 4PJEA 2CRIA 4IMLB 1OAZL 3QUYC 1RK0B 4PJEB 4MQXD 1JHKL 4UTAH 3MOBL 1LO0L 4WWKD 3GMMA 4R7NA 2IGFH 1KB5L 2CXKA 2OTUA 3OPZH 1JYNA 4OI8A 1JWSB 2OTUB 2CDEB 1EGJL 5JZ7C 3GJFK 3OZ9H 5DMJB 1KTLA 3OAUL 4OLYH 3T08A 1KTLB 1CWVA 2CXGA 1EFXA 3MACH 2H1PH 3Q5YA 1EFXB 3UC0L 4Y5VC 3KHQA 4KY1L 4PYHA 1XF4A 1RJYB 2FBJH 1XF4B 1YECH 4ZS6D 4TSAH 3MLPA 1WK0A 3ULUD 3W0WD 5T3ZH 2VDOL 1I9IH 4XCYA 5FECA 1ZEAL 1I7TB 4N8PA 4XCYB 5FECB 4F33A 3BE1H 4IRSA 3PXHA 3S36X 1OAKH 4F33B 4KWUA 2FGZA 1E6JH 4NN7B 1EHXA 1SJXA 2I07A 4HD9A 1J8HA 2I07B 5JLZA 1YEDA 1J8HB 8FABB 4NQDD 1AY1H 1EZVX 1YEDB 1A1OB 1H9VA 2B4CH 2NXZC 1OHQA 4JM4L 3TA3D 3VFGL 2VXUH 4XNQA 2HKFH 4LIQH 2ZUXA 2QLVB 1LK3L 4CW1A 1LP9A 3SE4C 1GGCL 1ZVHA 1LP9B 2YS4A 4S1QH 2X9YA 3WO4C 4EKXA 3EJYD 1JFQH 3MLYL 1RK1A 4NKIH 2DQDL 1DBBH 3U83A 1OP3H 5L8LB 3SQBA 1ITCA 5CEYA 4LGRB 1D6VH 2WUCL 3QPQC 4NN5B 4JFYB 5CEYB 1J88A 4Q2ZB 4WO4D 1F58H 3EHBC 3F58H 4H8WC 1CL7I 3U0WL 4JFEE 1OAUH 1MOEA 4X9IA 4HFWA 3MODH 3TH2T 3W11D 4HFWB 1DTUA 5LXGL 2IFFL 1YPZE 2OTWB 4UZGA 4JDTH 4LCYB 3HFMH 4BM7A 4IEFB 3C60D 3SGEI 1PKQE 2M1KA 2Q87A 4YIQA 4XP9H 1DN0A 2FX7L 4JG1H 4YIQB 3RVUC 1DN0B 4TVPE 3SDAA 5D5ME 1FDLL 1CLYH 3ARTA 4OCSL 3SDXF 2IPUK 1TVDA 3PGFL 2AJ3A 3UO1H 5GZND 2AJ3B 4ZNEE 2CK0H 3UTPD 5GISH 2WBWB 1HYSC 1F2XK 4HKZB 4UBDC 1WAAA 5JOPE 1A7NH 1T7VA 4FA8A 4NO2A 1IC4L 4YX2L 4C54A 3TN0C 3C8DA 5FUCE 1DL7L 2ICEA 3ZE0E 4L8BA 4YDVA 4KTYA 3HRZA 2ICEB 4NHUA 3ESVF 1D5XA 4UNVA 4L8BB 4YDVB 5C0RH 4X5XA 1UWGH 3HRZB 4NHUB 1D5XB 4X5XB 1L6XA 3HZYA 1QSFD 1FO0A 3HZYB 4X7SH 2C1OA 4N8CH 1FO0B 1ROWA 3N1QC 4R90L 1WTLA 5T3ZD 2KQNA 3CFCH 2ZOLA 3F7YA 5EO1B 4LHUG 2PO6A 3EFDH 2NMSA 2ZOLB 3CVHL 3RL2A 1CZ8L 5DVOA 4BYHA 2PO6B 3CNKA 1F4AA 1V3JA 3RL2B 3O2WL 5TF0A 5IBLC 3ZTJG 2XN9D 5L2JB 3QUZC 2D7TL 4MNQE 4KDTC 4EXPX 4LLVA 2HFFA 2P5EA 3CPLA 1FNHA 2Q7YA 2CJUL 4TULL 4AIZA 4LLVB 1FE8H 2HFFB 1UYWH 3D1MC 1RZ8B 3CPLB 4AIZB 4NZRH 3EFFA 4HW6A 3ZYOA 1N0LA 4MA7L 3EFFB 2YKLH 3EYSL 4PJ9D 1C5CH 4P5MA 1E4XI 1NLBH 1SHMA 3F6LA 4P5MB 4X6CE 1R5VA 1MWAH 4OIIL 4AMKH 1R5VB 4O2FA 2Y5TA 4O2FB 5KVGL 3VD3A 2Y5TB 1F4HA 4UUJB 4R6UA 1TJIL 4KUZH 4KRPB 4O58L 1A9EA 2NLJA 4P5KA 1RPQA 1XIWA 1A9EB 3CMOH 4JFFE 1BFSA 4P5KB 5GRWA 1XIWB 1D5BB 4BSWB 5J4MA 2J3SA 3H9SD 1XCQB 2BNRD 3IDIA 4LDEB 5ELIA 3ZDYE 2YWZA 3IDIB 5ANME 3OAYK 1KEMH 3IXTB 3DUSA 5DEZA 5IFAH 3X12B 1N2RA 3DUSB 4A2LA 3GSOB 4U2YA 4WUUA 4OQ1A 2H2PD 4WUUB 4P57A 2GJ6E 4OGYL 3L3DA 4P57B 4I3RL 1XGRA 3GMNB 4BZ1L 3L3DB 3IDGB 4TVPH 1TDQA 1FAIH 3DTXA 3WFHB 1CDBA 2Z4QA 3SDXB 1E6OL 4LMQI 2Z4QB 4GXUM 3JUYA 1TQCC 5KOMC 2EC8A 5A1AA 3D18A 3O11A 1DBAL 2JCCA 3D18B 2JCCB 1KCUL 1NANH 5GGUB 1OGAB 2DLEA 1U8HA 5H35A 1U8HB 3FOMA 1T1XA 5H35B 1FNEA 4GRLD 3U4EA 5FF6A 3FOMB 1T1XB 3VXRD 1G6RL 5I1LA 5FF6B 5ENWA 3LS4L 5I1LB 3DXAD 2ITDA 5ENWB 1FNGA 4CBPA 5I8OL 2VDPH 1FNGB 3FB5A 4I2XA 3QHTC 4NQCA 3FB5B 1DVFD 1MCRA 3KLSA 4NQCB 2IADA 4M43L 1RZIA 2CKNA 4NSKB 2P49B 4UB0H 2IADB 1RZIB 2P24A 2ZG1A 1IBGL 3I3DA 4HC1H 4OCXL 5DJXA 5IHUH 2P24B 5DJXB 5D7KE 3PQYE 3DHJA 3QDHA 2H9GA 5JMOC 2AJXL 1HINL 4JO1H 2H9GB 3S98A 4ZFGL 3BKCH 1BVLA 2HKHL 3FFDA 4NRZA 1BVLB 4NC1E 3FFDB 2E9BA 2RHEA 1CXFA 2VLJA 5I1GL 3ARWA 1PZUB 2BRQA 4CUCA 4WEUD 3I75A 1S7WB 3LD8C 3I75B 3G6DH 4AG4L 1IGCH 3HC4L 2R4SL 4FZ8H 4HCRA 2KKQA 3HMXL 3MBXL 4FQXD 1ZHLA 2MWCA 3TPUA 3CK0H 1CD8A 1X5FA 4UTBL 1ZHLB 4OB5H 5E95B 3TPUB 3NACH 2XG5A 1MEXH 4M5YH 1UWEL 2F54D 2NY1D 2FEDD 2XQYG 5DI8A 4LCIL 2YRPA 5DI8B 5LAXA 4MJ5A 1DQTA 4HWUA 4JN1L 3OX8A 4R26L 5LAXB 3ALXA 3OX8B 5D7IA 5JA8B 1RZ7H 1RZJH 2CR3A 5D8JH 1P84K 5D7IB 2OJEA 4MDJB 4RAHA 3DROA 4N0FA 5IB2A 1FVEA 1Z6JT 2OJEB 5J3HC 3DROB 4N0FB 4JRWA 3ROOB 1AKJD 1FVEB 4H88L 3WLBA 5IB2B 1ODAA 5E6ID 1BVZA 4QOKA 4JM2F 4KGJA 3WLBB 4QOKB 1GIGL 3RVXC 1KPVA 3H7LA 3IAPA 1KPVB 1UQSA 2VKXA 4WDIA 1MFDL 5FYLD 3MJ7A 3FTGA 3O3BA 4WDIB 2O61A 3MJ7B 2N56A 3FTGB 3O3BB 5GZOC 4J1UA 1C5BH 1OAQH 5K9KB 4WUKL 1J7VR 1MCJA 3K4DA 1PAMA 1NL0L 4YWGL 2R2CA 4LSTH 3B6SB 3BPNB 2YC1A 1RVFL 1BQUA 2YC1B 1OT2A 1IE5A 5DRWA 4H0GA 3HI1B 1HXYA 4XB8A 7FABL 3WIIH 3WIFA 2YOCA 5DRWB 1HXYB 1G9MC 3ARDA 3WIFB 5CJQL 5JIIA 2QSCL 2RR3A 3ARDB 1LO2L 2I9TA 1ZT7A 5BVJB 2VQ1A 1J0ZA 1YPZF 2EZ0D 2I9TB 2BOBB 1KENH 3P9WB 1JGVH 1ZT7B 4MQ7A 4OM1H 2VQ1B 5L7XL 1OP3K 4MQ7B 4RGNE 3BP6B 3HAEH 2VMFA 1U8LA 3W2DL 3BJLA 3NFSH 4PJHE 5HVFB 3MRLA 1U8LB 2A6DA 4M3JA 3KJ6L 3MRLB 1FBIH 5F7WC 5ID0A 2A6DB 5D5MF 3MLWL 2CUMA 2DQHH 3BGAA 1JPTH 3MRBA 3UTSD 3DRQA 4M7ZC 3MRBB 5HHVL 5F96L 3DRQB 4AL8H 2RGSA 3DYOA 4DEPB 1LQSR 3MLXH 4CKVX 2EH7H 3HTLX 4ZS7H 4Z0BH 1MCHA 1QFUL 4NWTH 3L7EB 2F53A 5JZ7D 1P7QD 2O5XH 1KJ3L 2F53B 5ESVA 5C0CE 3KLDA 4Q6YA 2DN7A 1EK3A 3DECA 5ESVB 3ZE0F 3TP4A 4WI8A 3OQ3B 4U3XA 3MRKA 4WFHE 3S8WA 4V2BA 2FWOA 2C3VA 3NOIA 4QRTA 1YN7A 3MRKB 2FWOB 1BFVH 2C3VB 4QRTB 4YHYB 1YN7B 4NKDA 1BIIA 4TSCL 1WF5A 3MZGB 1BIIB 5TE4H 5CAYB 3FQXA 3GUTA 5LJYH 1VPOH 1LEGA 1YMME 3KR3H 1LEGB 1ZGLP 3KPNA 4YDJA 1GPOL 3KPNB 1GGUA 2XZQL 4M6OH 4U6TA 3IDNA 5L9DH 3M1BA 4KJPC 1MCPH 3M1BB 5FHBL 2G9HA 5KAQF 4OCLC 4ZYKA 4PRBA 5JW4N 4K2UH 2G9HB 1L9MA 1BBDH 5F88A 4ZYKB 4PRBB 3T2OA 2WUBH 3D85B 2AXJA 4P23B 2NXZD 5F88B 4MHHG 2BXYA 5GS0C 1S7XB 1CQYA 2W9DL 3OGCA 3OGCB 2X4OA 4G3YH 2R8SL 2X4OB 1YEEH 5JXEC 4X6CF 1QBLL 1W0YT 2IBZY 2JLLA 1GCFA 4JHZA 1YY8A 5I75B 5MI0B 5AZEL 1YY8B 3EYOA 3RX5A 3EYOB 4AEHH 5EZJA 3HUJE 4Y4KC 5EZJB 3G08A 1AQKL 3G08B 1EBPA 4JFEB 1BM3L 3G6AB 4IOSD 2R15A 3ZDYF 3RPIA 4Y5XA 2EXWC 5EBLA 3RPIB 4Y5XB 3QPQD 1J11A 2X89D 4U1MA 5EBLB 3GIZH 2A73A 2ICCA 1YPZB 4U1MB 2A73B 2D3VA 3EHBD 5DD3H 3SE3C 3UX9B 4YEFA 1P4LB 4WFGE 2DJ4A 1IC1A 3CZFA 3N0PB 1H5BA 4EOWH 4NT6B 2VR4A 3CZFB 1H5BB 4UIKL 2O5YL 5D7LD 2V17H 3WJLA 3UYOD 2W92A 2ICWA 4OLVL 1PG7X 2R4RL 2ICWB 1Q0YL 4XBEL 2LV4A 2VIRB 3EO0A 2YD6A 3JV4A 3EO0B 1FYHB 5CGYC 3SCMA 1QO3A 4U1HB 3ULSA 2DJSA 3SCMB 5JW5B 1B88A 3LQAH 1NCDL 4UBDD 1IKFL 1T0MA 3MJ6A 3O4LE 3BDYH 4Y4HD 3RA7L 2NQCA 5DHYB 3TCXA 5IW3A 1T0MB 1I3RA 1IGTA 1PG7W 5DZNA 2B2XL 2H32H 3P0YH 2NY5H 1I3RB 3P9LA 3SKNB 2ADIA 1CU4L 4W6XB 1D3CA 3TN0D 3P9LB 1EEUA 4DGVL 4TUJA 3MRJB 1FC2D 1OP9A 4TUJB 1EMTL 1ZAGA 5IM7A 5EU4A 4X4ZA 5D1XD 1TTUA 2LU7A 4LRIA 5IM7B 5EU4B 3DHMA 1IC5L 2R1YA 2ZUVA 3WMSA 2R1YB 4AEIL 2NY0C 3O2VH 2D03H 4DVRL 4B41A 2HJLB 3CXDL 1GRWA 1GZQA 1GOFA 3NH7L 5FKPA 1GZQB 1V7NL 1MFAL 5FKPB 1AGBA 4R97C 2BSSB 1PX4A 1KPUA 3TM6A 1AGBB 1KPUB 5IBLD 4TRPL 3QPXL 5CHNA 5HY9B 5IVNA 2HT3C 4QNPF 1T21A 5F7DA 4X6CB 4JRXE 1MNUL 3U4AA 3EZ8A 5F7DB 5KS9A 2J88L 4NJ9L 4HUWB 5KS9B 3GK8H 1WGOA 4MNHA 5EC1A 3IFNH 5DS8A 3F6IA 1UM4H 4MNHB 5EC1B 2E7LA 1IAKA 5DS8B 3UYRH 1BD2D 4WHYH 1IAKB 3AVEA 2CK2A 3EIFA 1N59A 1BQLL 2XWTA 5F8RC 3V6OA 3QEGL 3KPQA 1WVZA 1N59B 3BH9B 2XWTB 3DOSA 5BS0E 4HXBH 4XMPL 3OTTA 4YH6A 1E27B 3VMOA 2BVQA 3VFPA 3K4AA 2QHRH 4QTIL 3VFPB 5SWQB 1TPXC 5F21B 3BO8A 3VGAC 1NGWA 3BO8B 4FQ1L 4OCWL 2OS7A 5IV2A 4PG2C 3RWJA 1INDL 4ZUUA 5B22A 5IV2B 1SM3H 3LKQA 3RWJB 4ZUUB 3LKQB 1I7ZB 2EDNA 2AXFA 3KPRA 3NN8A 3ULVC 5C09E 1T6WA 2AXFB 2Z8WC 3KPRB 4F9PA 3NN8B 1M4KA 1KJ2L 1D9KD 3Q48A 3MJ9L 5E08L 3X17A 2ED8A 1KN4L 4LAQL 3ZHDA 5SX4I 1EXUA 1QRNE 1F4XH 1YMHA 1EXUB 3QQNA 4LCUA 1T66C 2C3WA 5GS3A 5INCA 1YMHB 4LCUB 3VFUA 2IALB 1TTFA 1BF2A 2WK2A 3RBGA 3VFUB 4JQIH 4GUPA 3WNKA 4RNRA 4JN2A 4GUPB 4PJHF 3GI9L 4RNRB 4JN2B 2GW5A 2N1KA 3SO3B 3AXLA 5D9SA 3AXLB 1EHNA 2OR9H 5D9SB 4NRYA 1R0AH 5B39A 4FQ2H 3QCUH 4NRYB 2OI9C 4OLEA 5B39B 3N1FC 4Y89A 1NQBA 1FYTA 5E2UH 3QWRA 3N85L 4ZD3H 2IH3A 1CGXA 4M1CC 5IMMA 1X5GA 1U8PA 3EYQC 3TNMA 1HZHL 1KTRL 5IMMB 1U8PB 4YXKH 2HMID 3TNMB 3FT4A 4JHWH 4DUVA 3E3QC 4LVNB 1OPGH 4S1DC 1EHLH 5TDPB 1VFAB 1FG9C 3TZVC 5HHOE 3WFCL 4F3FA 3MV8E 2AKRA 3AAZA 4KK8C 4F3FB 2AKRB 3AAZB 3HC3L 3SPVA 5F1SA 5C0BD 3QIUA 3X13A 3SPVB 3GBMH 3VMPA 1MRFH 2N4IA 3CFDB 3QIUB 3EO1A 4LLQA 3X13B 4XRCB 32C2B 3EO1B 4L4TD 4LLQB 3BPOB 1IAIL 4HSQA 4ZUVA 4P2OB 4FFVC 4ZUVB 2DQTH 2YA1A 3UCRA 3EOTL 1QKZL 1R3IH 4BZ2H 4C56E 2M26A 2GUOA 3D25B 1SVZA 1XF5A 2I60L 2GUOB 2W9EH 2IBZX 3VJ6A 4XP1H 4ZSOA 3UDWA 1S9XA 1EFQA 2V7HA 2R2BA 1JGLH 3VJ6B 4ZSOB 3IFPB 1S9XB 4PJFA 2V7HB 2R2BB 3BGMA 4RFOL 4PJFB 4P9MH 3BGMB 5C6TL 2IH1A 5BZDA 2CMRH 1DFBL 5E2TL 2IH1B 3QXUA 5BZDB 5ITBH 4MCZA 3UZQA 4MCZB 4NFCA 4APQA 1MJ7H 5IFJA 1WUNT 5C0AE 4I18C 4APQB 5E9DA 4M93C 5J3HD 1BFTA 5E9DB 5DLML 4LSUL 2P5WA 4JY5H 3RVXD 3PWUB 4XXCA 3L5WA 3HUJF 4YE4L 3VXUD 4HX1A 3VG0H 1N4XL 3W0WE 4HX1B 1Z9OA 1TCRA 3VD5A 1N5YL 5GZOD 3RHWK 1AHWC 3BIKA 5C07E 1TJHL 4L3AA 4C59B 3QUXC 4E42A 4KGLA 5J7CC 3BIKB 5JHDA 2FATL 2GT9B 4QRRD 1A2YA 4DN4L 4E42B 3GSNL 4JPVL 5FYKD 3T4AA 4B53A 2NZ9C 3I6LE 1A2YB 5C0IB 35C8H 3B9DA 4EVNA 2DQIL 1CK0L 3T4AB 1S5IH 4EVNB 4YXLH 1Y18A 3BWUC 4NQDE 1Y18B 4NYLA 3QI9C 4OF6A 4KMLB 4PGEA 1NAKL 1S78C 4NYLB 2YD1A 4PGEB 2COQA 5CJOL 4JGMA 3CVIH 4LCWD 5HHPB 3AM8A 4DQOH 1A4KA 1A9BA 1A4KB 1A9BB 1I8IA 2VQTA 1I8IB 5D7JA 4NO0D 2BNUA 5KSAC 1Q72L 1RURH 4V1DD 1NFDA 3EOAA 3QDGD 5D7JB 2BNUB 4ZAKC 2VE6B 2J6EH 3EOAB 5DJ0A 4YNYB 5L88L 5DJ0B 1FP5A 4OZIA 1K4DA 4OZIB 3HMWL 1CGSL 1MFBL 3E2HC 3B8YA 1P6AB 2Q76A 4P46C 2PF6A 3F7QA 2HAZA 2Q76B 2R56H 2EYTA 5CD3A 2EYTB 5CD3B