3WIHA

Crystal structure of the third fibronectin domain (fn3) of human robo1 in complex with the fab fragment of murine monoclonal antibody b2212a.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
96
structure length
88
Chain Sequence
APPQGVTVSKNDGNGTAILVSWQPPPEMVQEYKVWCLGNETRYHINKTVDGSTFSVVIPFLVPGIRYSVEVAASGSGVKSEPQFIQLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Roundabout homolog 1
publication title Structural features of interfacial tyrosine residue in ROBO1 fibronectin domain-antibody complex: Crystallographic, thermodynamic, and molecular dynamic analyses
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 88
sequence length 96
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3wihA00
1YYMH 3SDYL 4LOUC 3IJSA 1FAIL 3FFCA 4N0FB 2DAVA 5C8JA 2D0HA 3V6ZA 2ATKA 1H3UA 3JV6B 2JJWA 4G3YH 3LQZA 5F7HA 3U4EB 4LDLB 2EH7L 4LSVH 4QO1A 4AMKL 1DJSA 2CMRL 3O4LB 3QEQA 1GOHA 1RZJH 5D7IE 2XA8L 3FB7A 2O5XL 4HXBL 4K7PY 4KVCL 4P57A 2UWEB 3IJHA 3VXMD 1YEDB 3L7FB 4JRXE 3MLWL 1RVFH 3QIWD 3FONB 1AGFB 1U92A 2VN4A 4OLZH 1UYWH 2G2RA 1H5BB 4U7KA 1SEBA 4XNXL 1WIPA 5HHOA 3QB7C 2WM0A 2J6EH 4OFIA 3PWNA 1J12A 5JXEA 5BRZB 1N26A 2F54B 2JIXD 3FHAA 3VRLF 4ZO6A 1DLHB 3MRGB 4AIZA 4G6MH 1F4AA 1TJHL 2JJSA 3QZWA 4NM4L 5E8PB 1IGJA 3UCRA 5CGMA 4DEPC 5D71H 2Z4QB 1HYRC 4KDTC 2BC4B 3O2DL 2CRZA 2IPKB 5HI3D 1X5YA 4KZDL 1B4JH 1NUFA 3C5SA 3HAEH 1QLEH 2BNQE 4PGBB 5BZDB 5IGXL 3WS6A 1NGYB 3W11D 2FHBA 1QKZL 4G8FA 4L4VB 1T80A 5F9DC 3TA3B 4AEIL 4ONFH 4KZEL 2IANB 5T5FH 3L5XH 4N1HB 3RKDD 4K7PH 2PCPB 3IJYA 4U3CA 1MNUH 4LMQE 5I76A 4XXCC 1S5IH 1NDGB 1TNNA 2ZUUA 4LNRB 4L8CB 3L1OL 3QUMB 1HXMA 2H45A 4NKQB 5CHNB 2D4FA 3S4SG 4OT1H 3ULVD 1JUFB 2E3VA 2C1PB 2X4RA 4TQEL 2FBOJ 3V4UL 3S5LG 4MA8H 3T77B 4FNLL 3PHOB 3QEUB 1QSFD 3VFOA 3EHBC 4JO1L 5T1KA 1EV2E 4OLVH 2OYPA 1AE6H 2DICA 4ELMF 5DJ2A 1JGEA 3DVGA 4DOHB 5J3HC 3T1FA 3CK0L 1IC5L 4PJ9A 5HHOD 2EIZA 5EORL 1AXTH 4CUCA 4ZOEA 4NT6A 1VENA 3OHXA 1IAOA 1OAZL 4RGOH 3D3VB 3U48A 3JXAA 3R8BB 3WL9A 2FYYA 4XVUD 5E8EA 5LAXB 1BJ1J 1OARH 4PJXF 5D7JB 3W2DH 5SX4I 4M1CD 3ARGC 2R4RH 1CU4L 1HQ4B 5CGYD 4JHAL 2Y72A 3QUKA 5KTEL 4I5BB 1FBIL 3PQYE 1F4HA 1SMOA 4HPYH 4DFIA 5D1ZC 4OZIF 1TVDA 2A83B 3TYFA 1KJ2B 1NFDF 1KCSH 3PV6A 3SJVE 1GPOH 4XZUA 4WFHD 5TDNB 4RMWA 3D2UA 4KI5F 3LSOA 3VCLA 4Z8FL 2DL9A 4RMVA 3CGTA 5DS8B 1F4XH 5I1KL 1Q0XL 3FZUC 4HS8L 1X7QA 2H32H 3CX5K 4MDIB 3QDJA 4GRLD 3FFCE 3F5WA 3WKML 4M4PA 1FL6A 1ZANH 5J6GA 1CK0H 5CLTA 4ODUA 4PJ9D 1HHJA 3GJFH 2OP4L 3CC5B 3D39B 3DLQR 2WWMC 4LVOB 4P46B 2XG5A 5CD3A 4DUXA 3QEQE 4NRXB 3BZ4B 2OJEB 4XNYL 4UU9B 4G9DA 4WI7A 4EIGB 3DX9B 5IF0A 3LS4H 4GKNA 2YZ8A 5SX4H 5KVFH 3QI9D 3DSNA 2GJ6E 5F1NA 2AXJA 1XMWA 4U1HB 4LP4A 1YEHL 2DQGH 2WZPD 3O3UN 3MRFA 1ZSDB 4OJFL 3T4YA 2Z93A 4UQ3B 4K3JH 4PGCB 5F7EH 4Z0BH 1ZLVK 5ILTH 5C08E 3G5YB 3RU8H 5HXMA 3G9AB 1PJ9A 3J8F7 4YDKL 4LAJH 2H1PH 1FNEA 3KYAA 3RVWD 1CE6B 4K3EH 5J12C 1CDGA 5DJXB 4MQTB 2F9BT 3O6KL 4FQCL 3P9LA 3LMJL 1WFTA 3OJDB 4G5ZH 3BFOA 1QLRB 3FQXA 4JRYB 3WS3B 2H3NB 5TGBA 4YQXH 1NGXB 3BISA 4HG4J 4WEUD 3RWIA 1U91B 4JO2L 1NMAL 3CDFA 1M05A 4Y4HA 1WIUA 5B39A 2CD0A 3K8MA 3MNWB 1MCDA 3QDJD 1BQHG 1UKSA 2FIRT 1U8IA 3GSRB 4GXVH 2NW3A 5GRVK 2IMMA 1QD0A 3I6KB 4N8PA 4KJQC 5IMOB 1LILA 2GJZA 2ZSVB 3U36A 1J1OH 1UVQB 3OV6A 2F5BL 4OCWH 2AJSH 3UJTH 1LHZA 4D0BA 3DSFL 1AGEB 4ORZC 5E08L 1MFCH 3FT4A 3GI8L 4WFGD 3HZMB 2MCG1 4HMDA 2BSED 3LKQA 4OF5A 4P3CL 4Y5XC 3ZKQD 1U8HB 4HIHB 3L3OA 4K8RL 1I7UA 1L4IA 1V05A 1TMCB 3VH8B 2NY6D 3LN9A 3EOTL 3ARED 3I3BA 5ESQB 1MFAH 1AI1L 5INDB 3AB0C 4HS6B 3QULA 4IRZL 3LN4A 2R69L 5EO0A 3I9GH 2P43B 3KPSE 1RMFH 3E8UL 3HKFA 4MSWA 1CL7H 2KPNA 4LLUB 3P4MA 3MRPB 1KLGA 3MGOA 1D9KB 3VRIA 2H6PB 4A6YL 3QG7L 5CSZB 3SKMA 4MCZB 4JFFD 4R96B 5HDQL 4QXUH 3GUTA 4O4YH 5TPWH 1NEZG 4LCYB 3ZKSD 4LSSH 1V7MH 1CXKA 2V2XA 4JDZB 3ULUE 4OFYA 4LSPH 4FFWC 4F7MB 1IEHA 4Y4HD 2H26B 4Y5VB 3B9KA 4AM0A 3MJ8B 3ZKMC 3V5KB 1F8TH 1JV5B 3JTSB 2VERN 2FB4L 2ZG1A 5DQDL 3BQUC 2BZDA 3BPLB 1T04B 3EZ8A 4JAMB 3ULVF 5GRVL 2J7LA 1YZZA 1YNLH 5I71C 4YX2H 4MS8C 3T0EC 5JW4Q 1HZHL 3TBSA 1A3RL 3HE7B 1CLCA 4X8JB 4AH2B 4MVBC 3PDGA 3VXOB 1FL5B 2WWKT 5E56A 5FUZL 3JZ7A 5C09A 3FCTA 2MJWA 2X42A 3AS2A 3FQUA 3H9SE 1JCKA 4KJWC 1KJ2L 2IQ9L 3BIKA 5HHXL 3ARDD 5D8JL 1MIEL 2HJLB 4NNXA 1MCBA 4XP5H 4YHZH 5BOPA 4Q0XH 4CDGC 1HKLH 2F19H 2P7TA 3HNSH 4GRWH 4Y88A 1M6OB 4I0KA 3WDJA 4BFBD 4OZFG 1MLCB 5LJYH 5I75B 1T7VA 1T0MB 2QR0B 5CP3A 2A1WL 3EFDH 1U2CA 4HWUA 4I9WD 4ZFOA 1VHPA 3D0LB 3FFDB 4OFYD 4I3GA 4G6JL 5T1MB 1BWMA 2XY2A 1ADQA 5KANG 3SDXA 2CKBH 4MJIB 4LVHC 4E5XB 5ACZA 3BHBA 3UTTA 4Q9RH 4QRRD 4Q2ZB 1DUYA 5EU6A 2VZOA 3P30L 3IDYB 1J0YA 1MOEA 4UILH 2IC2A 4GAJH 2X4OB 2IBBA 4LCCB 5IBTL 3VJ6A 2Z31C 3HC4H 4R4ND 3O6ML 4LLMA 3W0WA 1FH5H 1NC4A 2I24N 2IQAA 3G9VA 2AQ1A 4HZLA 2BXYA 2VQTA 2Q8BL 1R24B 2BVYA 1KACB 5I8KH 4X9FA 2UUDH 2XWBB 2DD8H 3BGFB 1RUAL 3KLDA 1OAQH 4WEBH 4LKXB 1DBBH 1EPFA 1WBYB 3KNBB 5GRZA 3HN3A 3HTLX 2HAZA 3VE0A 4X6CA 4D9RD 2V5SA 2VZTA 3UTPE 3U9PH 2B5IB 2VL4A 5INCB 5ID0A 1GOFA 4LQFH 3MTRA 4RQQA 3E0GA 4TPRL 4HWEH 3FOMB 3S6CA 4WO4C 5KSUB 3WN5C 4FG6D 5DC4B 2MCPL 2AEPH 4O02L 4OCSH 4JFXB 1G9MC 5E8NB 5JQ6L 3CFKB 4NQED 1JE6A 4F9LC 4B7IA 3F8UB 2IAMB 5DC0A 1J1PH 1W0VB 2HT2D 2C3VB 3B43A 4P4RA 4LCIH 4IEFB 3UTTD 2OBGA 5K9QI 4YNYA 1T7ZA 4OZGB 2VOTA 4UI2A 3AY4A 2CR3A 4ZUTA 3TBTA 5IW1A 3WFHB 1UCBL 2VLJE 2AXFA 1KN4H 4GG8B 1N7MH 2VAAA 5C0CB 3SQBA 3MOAL 4L3CA 5BO1L 2F15A 1CICB 2FBJH 1DZBA 2FX8L 2IPUK 2D3VA 2J88L 1NGPH 2AABL 3U9UB 4F3FA 1GZQB 1KTLA 1A9EB 2NX5B 1UM6H 4ODWA 3KJ4B 3EJYC 3UTQA 1G9MH 1U8LA 2E9IA 4FTVD 4YAQA 2C4XA 2XQYG 1MFBH 3I6LD 3AM8C 4I13B 3MXVH 4Q9CA 1M7IA 1IBGH 2A9NH 3RDTD 2HLFD 5C7XH 3L3DA 1HINL 1JGLH 1WQVT 5FDWB 3S36L 3R06A 4OV5B 4XCFL 4LIQH 2HG5A 4OLUH 1UWEH 3GBNL 1FIGH 4FABH 3TO4B 1Y18B 1S7WB 1XGPB 3F7VB 3GO1L 4JGMA 1I1FB 4N0UA 2X1QA 5C09E 4H88L 5CD5C 4AT6B 1IGMH 5DDHA 2BRQA 3TVMB 4S1DC 4HFWA 5EZLB 3HG1D 3BIAX 3ARBB 2MMXA 3TNMA 2BNUA 1U8JA 4OAWA 1L7IL 1P4LA 3QIBB 4F7TA 4P2RB 1IARB 4JM2D 4KQ3H 2LU3A 4XAKD 5FOJA 1J5OH 1RK0B 2DQIL 3VXSE 1KEMH 4MCYA 2NY5L 3S34H 2X44D 1RY7B 4KH2A 5CJOH 1YEFH 4XXDB 5C07E 1S7SB 3E6HB 4GG6B 5M95B 2H2SD 4L1HA 4TNWF 3IFLL 1HHIA 2RHEA 4WHTB 1G7JB 2YHGA 3SDXE 1S9XB 4UT7L 2NLJB 5H2BA 3DVFA 1OWRM 4EN3C 3LRSB 3VFSB 3MCKA 4HDIA 5EU6E 1GXEA 4HIJA 3MYJB 3SKJL 3UJIH 4DQOL 2FX7L 2FIKB 5JXAL 3PL6C 1MAKA 3GHBL 3VI4E 1U8KB 1ZA6B 4HULB 5I74B 3FO2B 3BP6B 1A1NB 1JPTL 2ZCKH 1KB5H 1RZKL 2YSSA 3G5ZA 3NIGE 3MJ9A 2W0KA 1CN4A 4NZDA 5J1AA 5IM7A 4UV4H 1DQML 5CINL 1DQDL 4OCXH 3X14B 4HKJA 4MJ2A 2YR3A 4UTBH 5E5RB 3D69A 1DL7L 4JQXC 3RVTC 3GSUA 5DC9B 3UTSB 4AEEA 4NO2A 1NAMH 1CGUA 2ZKHL 4M43L 2YEZB 4Z76B 1G7HA 1XCTB 4QOKE 5C0FB 5F6IB 1RUML 4QHNB 3QUXD 4GAYA 1AD0B 4OF7A 3MYZA 4MA1C 4XH2A 1NCWH 4ODVH 3SQOH 1QBLH 2O5YH 4XC3L 1UA6L 3I02A 4GMSL 1NC2A 4HAFA 4ODTH 4U7MA 3HMWL 5CEYB 3S96A 3UP1A 1JBJA 1EGJH 4LSUL 4B5EA 1IAKA 3HC3H 4G43B 4PJCF 2GITA 3E3QE 4PJIA 1T5WB 5F9JB 3P73A 3DETD 3VD7A 2OSLA 5IMMA 1ITBB 5MI0C 4XCYB 2MOVA 5FKAB 2XTJD 3QIWC 4R4BB 1I8MA 3QQ3A 3VGAC 1B6UA 4X8XA 5CBEB 3RY6C 4UQ2B 4LEOA 3F12A 5FYJH 5ALCH 5IB4A 3PGFL 4V1DE 3RWFB 5D7LB 3X17A 5K33A 2XFXB 2GTZA 3WCYA 1YMHA 1JIBA 1LO5A 2Z9TA 12E8H 4MQXD 3MBEA 1T2JA 1RJLA 4MXVE 5SWQB 3RWGB 4S11A 5K59F 1W72H 4IOIA 4N0UE 4ERSH 1TETL 2PTVA 5F3BA 4P2CG 4CAGA 1OCWL 4XGZA 3D18A 5HI3C 5H37G 1SJEB 1HHHA 3ZL4L 4G8GA 4XBPB 5BS0E 3W11C 3L5HA 1MRCH 5GISL 2QHRH 5CEZL 1MSPA 4YR6B 2YBRA 4NCDA 5DMIL 3MODH 3W5MA 5HHMD 3OXRB 3IXTA 1E27A 4NRZB 3M07A 2AXHA 3X3GL 1N6VA 4RMUA 4UB0H 5JR1H 4UV7L 5ETUB 3VXUB 3IFPB 4A6YA 4G8IA 3WEXA 4PJHB 2C1OA 4M7LH 3MBXH 2K7QA 2CDFA 3QDMB 2AJ3B 3OKLA 3H7BA 4UAOB 1DQLH 1WC7A 2R56L 3PGDB 5I9QC 2DQHH 5IEKA 3O9WD 4Q9QL 2YRLA 4H20H 3WSQL 2VQ1A 4Y5YC 5ICYA 3IRZA 1CLYL 1HHKB 4HKXB 3MV8A 2DIJA 1IE5A 1QRNE 1HNGA 3QZWG 5IB5A 1TTUA 1CDHA 5EA0H 2QSCL 1BX2A 1GHFH 4JCLA 5JOFB 4X6CF 5C0DA 5D2NC 4MNQE 3TBVB 2DQFA 2D7OA 2X4TA 1L6ZA 4LRNH 3MUZ1 2GQHA 5IMLA 2WUCH 4YHIB 4XVUC 4U1IA 4GSDL 3GB7A 4XVJH 2EYSB 4BKLA 1FGNH 1LDPH 4QRTA 4K8RD 4ODHL 4AG4H 4Z95H 3T0VA 5I2IA 4FQ1H 5GGVY 1NBVL 1P9MA 5DI8A 1LVEA 4M1CC 1JN6A 3QUYA 4LHUG 5DJAA 3PWJB 5CGYC 3RUGB 3SKNA 2H8PA 1MHHB 3T2NH 3WO4C 1N3NA 4OCMC 4NUJB 4QRPB 2CQVA 3TGXA 4U6XA 5MENE 1FCGA 2V7HA 5F88A 4NWUH 5EBWA 1R5IB 2E5EA 2Q20A 3IT8D 4YDLB 4DGYH 4XVTL 3CH1A 4PLNC 4RMQA 5DTFA 4JDTL 1C12B 5HDLA 5SWZD 1UG9A 4FQJH 1MCJA 4GRLC 3QR2A 3LKPA 4OV6F 1U8NB 3P77B 1KJMA 5C0JB 4XNQA 2PXYD 5IBLC 1MFNA 4I3SH 2HN7A 1OF2B 4RA0C 5CZVH 1CD1A 1A7RH 3MMEA 4OGAD 4G7VL 2ITDA 4X80H 1OOAA 2ILLA 3PJSB 4L4TB 4HEPG 5HVFB 3PUCA 1FRGH 1U42A 5GGVH 5FA4B 5JORA 4PB9H 3QI9C 4PGDA 4PYGA 2DF3A 3MRRB 4GW4A 4KXZH 5J8OA 1AQDB 3VI3E 1AIFA 4HH8A 1UCTA 4HUWB 4K3HA 3KPQA 2ESVA 3CLEL 3C09B 1EEYB 1MHCA 1SVZA 3ZYZA 1BZ7A 3QUYD 3EO0B 2VXQL 4K3GA 3RZCC 3TJEH 1VGKA 2VDML 1RIUH 2EDRA 4ZTPH 1K85A 2MHAB 4QHLA 3I2CH 2D03H 1JHLL 4JPWH 3NH7L 1UXSB 1QLFB 2PYEA 2DS4A 2NR6D 4QTIL 4BZ1L 5IT2H 4J2XA 1H15B 3FT2A 3MRJB 3HS0B 1X5AA 3MZGB 4FZEH 3VWKA 3VWJB 4ZNEA 1S7RB 4K3DH 1BJ1H 1T3FB 5I1DB 4NQDB 4W81A 3MRCB 2UY7A 1U6AL 5CEXB 2NY0B 4KK8D 1G9NL 5EULV 4I18C 1PX4A 3QDGE 5IVNA 4A2LA 1LNUA 2W1NA 1EZVY 5I0DA 4OF0A 4NNPH 2K7PA 1T0NB 1P69B 3LHPH 2OTWA 4NO0D 1DBKL 2QKIB 1KPUA 2NY6C 1NFIB 3OAUL 3SE9L 2Y06H 3VDBA 3AREC 2ATPA 4YXLL 4ZFFB 5J6HA 1URLA 1T7XA 1VERA 4KROD 1IEAA 3UMTA 2GCYA 5KZCD 2X4NA 4NNYA 3RWJA 2I9TA 1PG7H 3RVVD 3T0WA 3M17B 2EDXA 4JEGB 2BK8A 2HRPL 1ZT1A 3TYGH 4X9HA 2WINB 4PJGE 5EFIA 5B39G 2WBKA 2AGJL 3QJFB 1QNZH 1HH6A 1A0QL 1XGYL 3U7WL 1XF5B 5HPMA 1EH9A 3W39B 4PPTA 2I26N 4F37K 4NOFA 3WJJC 3RGVD 5CIPA 2HFGH 4E41B 2J4WL 1KNOA 1A2YA 3QH3A 4ZUUA 1KTRL 3IB4A 2NY3B 3BZFA 5J11C 4GLRH 4WU5B 3VRJB 1Q38A 4CVUA 1R3IL 4V2BA 2XN9D 1T0PB 3DVNA 1L9NA 4EBQH 4DN3H 4NRYB 5BJTB 4DCQA 2JELL 5AZ2L 4I2XE 3M1BA 1ZWIA 4PJIF 5JPMB 4IRSB 2K1MA 2N4IA 1D5BB 3TPUB 1WF5A 1UGNA 1OD9A 3TV3L 2G60L 3OZ9L 4XP1L 3BD5A 4HXAH 35C8L 4L3EA 3TT1L 1ONQA 4Z7OE 2YUWA 4GAGH 1DQJA 3LEXB 1EUTA 2V7NA 5A2LH 5HYQA 5EB9A 3ARDC 5IB3A 2JE8A 4U0RC 5C0BB 2WUBL 5GJSL 1W2KT 3D5OF 4G42B 3RNKB 5H8DA 3OKEA 3DPBA 4LIQE 5HYEA 3BX7C 4E9LA 3ISWA 5KJRL 5L7XH 1CE1H 4Z7QF 4R26L 3KVQA 5HY9A 1FV1A 1HWGB 3SEPA 4NOBA 4POUB 4WCYH 5EIIB 4XP4H 4K23H 4RAUB 4M03A 5L2KB 2OI9C 4LLDA 4U2ZA 3LKOA 4NKMB 1FNAA 4ZAKB 4PJAA 2GAZB 1SJXA 2A0LD 2WQRA 4CU6A 2YC1A 3DV6A 4K2UH 1TNMA 3WDIA 2AJUL 4XNUH 3QJHB 4U1JB 2F5AH 3MGAA 2E7CA 4N90D 2VDQL 4X7SH 5DEFB 5MP6L 5D5ME 2DLFH 3UBXB 4R7NB 1WBZB 5AAWA 1DEDA 1S9WB 4RZCB 1MI5E 4YZFF 1H0DA 2X70B 1T83C 2ZUYA 4JGUA 3UYOD 5B38A 1IQWH 1S7VA 4R4NC 1SBBA 2WW8A 2ADIA 4IS6B 3SPVA 5J9PB 4LDOB 3L3GA 1A1OA 2FJGB 4ZNEE 4FZ8L 4JREB 1QQDB 4P5MB 1S7UB 4HIXH 4HJJH 1MRDL 3V4PL 3FB8A 4JFZH 3STZA 5D72L 4OKVB 2CLVA 4ORGB 1FVCB 2R2BA 1T2XA 4BK5A 4PJ7A 2DWDB 5CJQL 2KQNA 1NCNA 4DN4L 4HCRA 4JFYB 2W9DH 3GNML 3C6LA 3WLWD 5ERWB 1CR9H 3KR3L 2E9JA 3L5IA 2O61A 1QSED 1EERB 2BDNH 1JHTB 4ZUWA 1XAUA 1D5XB 5F7DA 1NUDA 3MRHB 3ARFA 3WUWB 4FG6C 1RK1B 3WFDL 3BDYL 1KGCD 3NFSL 4HHAA 3TBWB 2EDBA 1BVLB 4WENB 3BKJL 3K4ZA 4TUKL 3KPLA 4U1LA 3ZDZE 3IGAA 2PR4H 2P8LA 3QFDA 2EKJA 1TQBB 3QXAB 3VD9A 2P5WB 3O6FA 1AGCB 2HT2C 5FCSH 5JMOC 1PY9A 1KC5L 3LKRB 1C7SA 3I75B 3N9GL 5DK2B 4GBXC 1KTKE 1MCEA 3VG9B 2AEQL 4H26B 1CXEA 2EDFA 3VXRD 4XMLL 3SCMA 4C54A 5EO9B 5KG9B 1DBJL 5A43C 5IMKB 4QRUA 1KJ3L 4QXTA 5CMAA 4M5ZH 1UT9A 5BVJA 4QHKJ 2BSRB 1NSNH 3B2VL 5K9OB 5BW7A 1TITA 5I8OH 1ED3A 4PRPE 5MHSD 3HR5A 1N5AA 3RDTC 2HLFC 2HMID 2FSEB 3IDGB 4CJ1A 1G6RL 4PB0L 5E2JA 2VDOH 5I1HH 3IFOA 4BK4A 1G84A 2C4FT 4RFNC 4PP2A 1CG9A 3WHXB 4EI6B 3OKDA 1HE7A 1UWGL 3QHZL 3TCLA 1NUGA 3MX0A 5DVNA 4EVNA 2HJFA 4WFED 1YNTB 2EC9T 3VFNB 3ARFD 1MELA 4HWZA 3NAAL 3DWTA 4L3EE 3V7AG 4DW2L 4M48L 1TPXC 3AROA 1HSBB 2B0SL 2IAMD 2X9YA 5JHDB 5I1JL 4LSTL 1HOCB 1I4FA 2BVOB 2IPTH 1VEOA 5CILH 5T1DL 4IIQC 5F7MC 2JCCE 1A5FL 3SDDD 3SDYH 3RTQB 1C16A 3BGMB 4PRAB 5CWSA 5C0AE 1FAIH 1BGXL 4OKDA 1MHEA 3HE6A 4OI8A 2IBZY 4JM2C 3NACL 3OR6B 3HZVA 1UXWA 4XNMB 2AKRA 3VD3A 5I8CA 3QUZD 4NIKB 3N1PC 3VFUB 1TJGL 4AMKH 5E8OA 5IR1A 2CMRH 3VGHA 3VXME 4L8SC 4PJAE 5DD1L 1BLNB 2XA8H 3MA9L 2O5XH 4HXBH 2H2SC 2R1XB 2VN7A 3VA2C 2NX5D 2R0KL 4JB9H 3T3MF 5C70A 2ICWI 3MLWH 2BVQA 5CEZD 2Y36L 4Z5RB 1MAML 1BF2A 2GSIA 3O8XA 5I66A 1I9EA 4I0PB 5E4EC 3UXFA 4XNXH 3MJ6A 4PGEB 1X6LA 4DVRL 4F15C 4YHNB 3KYNA 2ADGB 3LDBB 4X99A 4F7CA 1OTTD 1F6AB 1IAIL 3U2SB 4QXGL 4U6YB 3GGWA 4HJGB 1TJHH 4NM4H 1IAMA 2CLRB 4N0RA 5EBMB 4KPHL 3QNYB 3PP4L 3Q2CA 4LLWA 4WFFD 5IFJB 5J13C 3X12B 3BYTA 3O2DH 1U3YA 1R5VA 3SE4C 5A2KH 3BESR 4NN7C 4KZDH 1H8OA 5AWNL 5IGXH 3MRKA 3EYOA 4LDEB 5L8KB 2LAGB 1QKZH 4AEIH 4KZEH 4MXQD 5EOTA 5JW4M 1OHQA 4MD0A 3H3KA 1XIWB 5KVEL 3RA7L 3SHSA 1XGRB 3HHRB 4YIQA 3CVHB 1JHKH 3MRMB 1AFVL 3L95A 4Z0XB 1FNGA 4ISVB 3IDIA 4XPTL 1BD2B 3L1OH 3QUXC 1CZ8H 3BZEA 1GSMA 2FJHA 1BZ9B 3HUJB 4TQEH 3V4UH 1JMXA 4RGNE 1L7TL 2VR4A 3L3JB 3IETA 3QQ4B 4FNLH 1WZKA 4OSUL 4CDHA 4ENED 3QNZB 5F7NC 3DUHA 4JO1H 1PZUB 3TCXA 1HEZA 2CXKA 4OFVA 1A4JA 2WWKO 4R6UA 4WTWA 4TUOB 3CLFL 3O8XD 4NYLB 4ZXBB 1IC5H 3T8XB 3W5NA 3HZYB 2LV4A 5EORH 3A6BL 3DETC 1SYSA 1II4E 5JDJA 3TN0B 2A6DA 1ZA3B 1OAZH 5FYKU 4PLOB 3WLBB 3NPSC 3BPOB 2XTJC 5I15L 1WLHA 3RL2A 1LP9A 4PRHA 5DJDA 2XKNB 1DVFC 1J8HD 4X5WB 4YHPB 3PWLA 4NGHL 4BFIB 1MJ7L 5CJ8A 1A7BA 3UTSD 1I3RB 3QDAA 4RGMC 3O3BB 1JK8A 4M7ZB 4Y0GA 1YY8A 5FGCE 3SY0A 3ARPA 4JHAH 2ZP0T 1YEJL 5DURB 4MQXC 4PV8A 4U1SA 3ORJA 4WFHE 3OJMB 4HGWA 5FK9B 2V2WA 1KCRL 4OQTA 5HHNB 2RFXB 2A6KB 2OL3A 4UDTA 1HSAB 1NMCC 3BKML 4Z8FH 2ARJA 3QIUB 5C2BL 5I1KH 4HS8H 5FF6B 4MA7L 4HK0B 1XF3B 2GHWB 3HCVA 1YN7A 5ICXB 2QHLA 2GYSA 2C3XA 1FNSL 4AL8L 1RUPH 1JPFA 1KBGL 4MX7B 3MRDB 5GSVA 1YMMA 2OP4H 3SDAB 2N56A 1VFBB 4BYHA 4U4BA 3BPCB 4ZDHA 2D7TL 1ZHNA 4D9QD 3NIFF 1NKRA 3O9WC 2FCBA 1FG2B 3KPNA 2IH3B 4FXGB 4J6RH 5KSBB 1ORSA 4PRHD 4G6FB 5D7LD 4ZSOE 5MEQB 4Z7VA 5FECA 1YEHH 2DKMA 1CFSB 4ONGL 4OJFH 3GMOA 5CUSL 3KYMA 4PJ7F 2J8UA 5E24E 4WUUA 3E2HC 3JVGC 4YDKH 2ZG2A 3RWCB 3QCTL 3VMOA 4MHHI 1NANI 1F2XK 3RWEA 3HAEB 3CFEA 1LEGB 1KSRA 4K8RC 3O6KH 1KB9K 4LSQL 4DVBA 3LMJH 3OKKB 2VUOA 4PJDE 1ZVSA 3J7HA 2D7NA 4PJ5B 4JO2H 1NMAH 3CZFB 1FORL 3TPKA 3VXUD 3B83A 3K3QA 5HVHC 1YQ2A 2CH8A 1UH3A 2F5BH 2GT9B 3DSFH 1EXUB 5E08H 3LRHA 4N8VA 3GI8H 2YD2A 1SYVA 3NN8B 4WDIB 3JTTB 4GXUM 4P3CH 2P5EA 2FEDD 2VLRD 2HLAA 4K8RH 2PXYC 5D93C 2VDPH 4QF1A 5BZWB 1FYTA 3EBAA 4OGAC 1EAPB 4GKZA 4UTAL 5T1LB 5FO7B 4RDQF 2X4UA 4L9LA 3OWEA 3NZHL 5BXFB 4RAHA 5F9OL 2W0FA 3GMQA 3MRIB 4YO0A 5IVZA 3D0VB 1H8NA 4IRZH 2R69H 1S7TA 3FQRA 4WUUD 3CPLB 3GRWH 3EYFB 1DBML 3VXTB 5MERA 3V5DA 4FP8L 1HI6B 3L9RA 5DRXA 1B9ZA 5EU3B 4ZOCA 2VLMD 2NY1B 4JFFE 5F1OB 5IFHL 3FOLA 3I85A 5ENWB 1QA9B 4A6YH 4XI5D 4LCWB 3QG7H 1HNFA 3DRTB 4JFDA 1IQDB 4YFLF 3S4SB 5HDQH 3ULSB 5FM5M 4Y1AE 4QWWD 1OB1A 2AK1L 4S1RL 4X6BB 3QYCA 3QG6A 2YN3A 4KJYA 1AC6A 4X0KB 5E2UL 3NCCB 1F97A 4HEME 1TZIA 4KUCF 1NUNB 2B4CL 1WSST 5GJTL 2FB4H 4WI8A 4GJTB 3L3IA 4R8WL 5DQDH 1BOGA 4DUWA 2CIKB 2DQCL 3MCG1 3HI1A 3G6DH 3AAZA 1KIUA 2W07A 4XMKL 5JOPE 3DROA 5GZND 3WNMA 2WAHA 1HZHH 1A3RH 4KK6D 4KK5D 5E6IB 3DUSB 2VDLL 3TNNB 4LVOC 1IM9A 4R7DB 5FUZH 1YEGH 4KK8C 1UWXK 4YPGA 5H35B 1F3JB 3WNNA 2F74A 3N1QC 1SBSL 1K2DA 4KKCD 5HHVL 3X13A 1KJ2H 2IQ9H 3KXFB 2CJUL 5D8JH 5HHXH 4DZ8B 15C8L 1MIEH 3OJVC 1RJZB 5BCAA 5EUOA 2V6HA 5IOPA 4HW6A 2HVJA 5JW4R 1NCDL 3IDJA 2G9HB 4Y4FA 9CGTA 4FQXA 4WW2B 1U93A 2ZOKA 4HWBA 3QWQB 4D9LL 1X6NA 3H6JA 1UKQA 3RVVC 2A1WH 3WFCL 4Z6AT 4NZTL 2APWA 1BAFL 4EUPA 4TUJA 1ZMYA 2L7UA 2YMXL 3LH2L 4G6JH 1G7PB 3V0VB 4QRRE 1YC7A 2R0LL 1LD9A 3H0TA 2P44B 1YJDL 4U05A 4JFEA 4JFOB 5JW5B 4P5TA 3AC0A 4OCRL 2BOBB 2J12B 3P30H 4X6FB 1BVKB 3T3PE 2CGRL 3MNVA 3VWJD 3PHQA 2OK0L 5IBTH 3F6IA 3DBXA 1K4DB 3O6MH 3DYOA 4NQDD 4Q74A 2J5LC 1INEL 1F02I 4AIOA 4H1LA 3RGVC 4NDMA 4NC2B 1WBXA 4JQVC 4MMXC 2NY0D 2WIIA 3T04D 4OI7A 1EFXA 2Q8BH 1LEIA 1FN4A 1KIPB 1RUAH 2GK0A 4M1GL 5J12B 1E6JL 4NZUL 1HIML 2NW2B 4I8DA 4EXPX 3GHEL 4HKBB 5LGJB 5EH1A 4NFCA 3P9MB 3BP7A 3BD3A 2CPCA 3C2AL 1ULVA 1WAAA 3HMXA 3K2UL 4C56A 1EDQA 3EAKA 2QADB 3B6SA 5TH2B 2MWCA 1VEMA 4TPRH 2VAJA 1LP9F 2Y25A 2PO6D 4XPGL 2IGFL 3BUYB 5E7BA 1FYTE 4ZQKB 1Q9KA 2KZWA 2MCPH 5B3JF 4O02H 4XVSL 5DJ8B 4B7LA 1F45A 5JQ6H 2IADB 1QPXA 5F7WC 5TDPB 1U8PA 1FPTL 1D9KC 5E1AB 3QBTB 2YPKA 4WWKA 1BQHB 4CMHC 1WT5C 3GEWB 2GUOB 1U8QA 2EDWA 3REWA 1CDJA 1ND0B 1TVHA 3MRQB 1UCBH 3G6JA 3UTOA 3EJZD 1HH9B 2A0LC 3JSSA 4Y16D 4J3UA 3EOAB 1BIIA 3MOAH 4MB5A 2PW1B 1OLZA 4PJEA 2JK5B 3RRQA 5BO1H 5JPNB 3ZMRA 2FX8H 2C9AA 2ORBL 1G6VK 2RCSH 2J88H 1KPRA 2AABH 2NY3D 4QRQB 1INQB 3GSNB 3BPLC 4FTVE 2FO4A 2R4SL 3FQTA 1ROWA 1VACB 3U30C 4NBXB 3DX6A 4IRJA 3NBNA 3EGSA 4RIRB 3HE7C 4NP4L 3ZYOA 3IKCB 5FO8B 3DMMB 1KENL 2NY5C 1FSKB 4G9FE 1HINH 3DXAB 4OD3L 3S36H 2ADJA 2IPUG 4GT7A 4XCFH 5L2JA 1MH5B 5TFSL 4G8EB 3BH8B 4CMMA 3GBNH 1WISA 4ELKB 2Q87A 1FFOB 4R3SB 1CFNB 3GO1H 2XA3A 5FYKE 2JJTA 4H88H 4Z7VF 5JA9A 3TBYB 4LHQB 3D25B 4NPYA 4F7EA 4N5ED 3JV6A 3MLUL 3B4NA 4ZO7A 4GRWB 4YXKL 2Y5EA 3WLWC 3WNLA 2J8UF 4RFEB 1JNHB 3O4LA 1NCCL 4BSWB 2VKWA 1L7IH 1U58B 1HXYA 5L2KD 5IVXE 4HIIA 3S37L 4HV8A 5I75C 1YEDA 3CSBA 3T0EB 4NBYB 3JV4B 1RZKC 1S9YB 1JPGB 2DQIH 4JM4L 3FONA 4QXWA 2NY5H 3CSYA 4JY5L 2E7LA 3I84A 4NWTL 2HP4A 4KVNL 4PJFE 4MLSA 3V6FA 5B38G 1ZXQA 2Q86B 3IFLH 4NJ9L 3FN0L 5BRZA 1U8OA 4PLKD 2F54A 4UT7H 4LCCC 4OZHB 1DLHA 4OUUB 1XCQB 5C0RL 4LF3B 1FO0A 5J89A 2E9BA 1QOKA 3BEVB 4JVWA 1SVCP 2YS4A 4DQOH 1ORQB 1AGBB 2FX7H 5JXAH 4S2SB 2IALB 3GHBH 1PBYA 4OI9A 2BERA 3A6CL 2VIRA 2IPKA 3BGFC 4PR5B 4NKOB 4M61B 3WIFA 1JMZA 3G08B 4PGBA 1AR1D 4P2OB 1JPTH 3QA3B 4JO4L 1H3PL 4URTB 2IANA 1LE9B 4C58B 1FG9C 2P42B 1IFHH 5F3HB 5C0GB 4LVHB 2P8PA 2LE9A 2PCPA 5CINH 2HMIC 1DQDH 5KN5A 2Q76B 3CUPB 5DO2D 5FUCC 1IKFL 5CHNA 1SY6L 3DI3B 1J1XL 1MQKH 1OWWA 5BVPL 1DL7H 2AK4A 2Z31B 1ZS8A 2ZKHH 4M43H 2MSPA 4J8RB 4LLVA 2PTTB 3KPRE 1JVKA 1MCPL 2ZOLA 5CS7A 5D1QB 1RUMH 2IAMC 2XZCL 2YA0A 1HK6A 3TJHD 2DLIA 2YKLL 1X4ZA 1K6QL 1T7YA 4E0RA 1Z9MA 4NQTA 1JNLL 4XC3H 1UA6H 3SDDC 1F58L 4GMSH 1ZGLP 4L8BA 2EYRA 5T3ZD 4Z77B 3HMWH 3HR6A 4NQXB 1U95A 1B3JA 3MFGB 4PD4K 4LSUH 4PJBF 4PTUA 1NGWA 3QUZC 1CICC 3LD8B 1E4XI 3MV9D 2R8SL 4KTDH 2WBWB 5JQHC 5LAXA 1VKXB 4YHLL 4WO4B 1F3RB 2C7UB 3WN5B 43C9A 3AGVA 3U0PB 4WV1A 2VITB 3HI6L 1OGAE 2VSDA 4KGLA 5D7JA 3KJ4C 2NCMA 2AEWA 1HQ4A 1HHGA 4FS0A 5DQJA 4LLAA 4I5BA 2DYPA 5E5MB 5DJZA 1A1MA 3MV11 5I73C 4JN1L 3PGFH 2Y6SD 5GS1C 2A83A 4L4JA 1OTTC 3QQ9D 3TO4C 6FABL 4UNVA 3BDBA 4G80B 2AK4D 1M71A 5EUOF 5DS8A 2A6JB 1DEEA 3UTZB 3FB5B 4JZJA 4MDIA 3QO1B 4ELMB 2EYTB 4YHKL 4EXKA 5JLZA 3GSNL 4EDXB 1OCWH 4Z7UF 3AS3A 3MJ7B 4LAQH 4OIIL 4NO3B 5DRWA 5GISH 3QPQD 4MXQC 1E4XH 5CEZH 1MRFL 5DMIH 1QP1A 3D39A 4P46A 3HPJB 3O4LE 5JIIA 4NRXA 2NYYD 2OJEA 5ID1B 2D0GA 3QWOB 3MGTB 3U7AA 2OM5A 1K5NA 2UWEE 3X3GH 2CUHA 2HFEA 2NY4B 4KFZC 1LK2A 4UV7H 3U46A 1AJ7L 1FP5A 1N8ZB 3CFIC 4U1HA 1NCBL 1P7KA 1G7LB 1ZSDA 2VH5L 1D5MA 5ISZB 4PJXB 4UQ3A 1D5IL 4R0LA 4ENEC 1K3IA 4AZ8A 4Q9QH 3ECBA 5BRZE 2E27L 2F54E 3MRLB 3WSQH 3LKNA 1S8DB 1CLYH 3OGOE 1XZ0B 2YRPA 3SDCA 1YDPB 1DN2A 3O8XC 3P0GB 2DYPD 1QFUL 3DYMA 3B3IA 4JFQB 4OZIB 1CGSL 1NFDB 4CN4A 3QFJA 2QSCH 1PG7X 4JRYA 1QLRA 2AERT 3ARXA 3WS3A 3ZTNL 1G1CA 3U0WL 1FZJA 2Z92B 1WAAF 5IEHA 5FIEA 4CRPA 4GSDH 4L4VE 1E28A 2O93L 4C55A 3Q5YA 2ZJSL 4KJPD 5DJCB 4ODHH 2IANE 4QY8A 3DYPA 2V5YA 2QQKL 1NBVH 3GSRA 3JUZA 3I6KA 4Y4KB 2ZSVA 1OAUL 3HNVL 4UIMB 3RY4A 2XWTB 5F6IC 1QFWM 5HYJD 5GS2D 4YPJA 1BD2D 1JRHL 1WICA 4PRBB 4Y2DA 1MCHA 4KKAD 5KSAB 4XVTH 4MQ7B 1NBYA 2FATL 1B2WL 2DM2A 2Z8VC 1PQZA 3G6JF 3L6FA 1MVFA 1RULL 3BP4B 4JDTH 1OP5K 4ZPTA 2DOCA 5H94A 1I3UA 3O2VL 4PJEF 4HS6A 2KBGA 3X11B 3Q3GA 2HVKA 3PABB 4JPIA 4DKFL 3OB0H 5AD0A 2X09A 3SDCD 3D3VE 1XGQB 1KYOK 1H8SA 1J11A 4G7VH 5I16A 1TZGL 2H6PA 1IGCL 5D6DC 4W68A 3EO9L 4RA3A 2EE6A 3BT2L 3WDHA 1QTYT 2FJFB 4GW1B 4N0CD 1XT5A 5EU4B 1NJ9B 2YPLA 3FQNB 4MA1B 1KEGL 1UEYA 4JDZA 1T1YA 1OSZB 1D5ZA 4Y5VA 3MJ8A 3MXWL 2BOCB 2C3WA 3JTSA 5BQ7B 3CLEH 2XQYK 5I1AA 1RJYB 4LHJB 4HIEB 1G9NC 2GIYA 5CJXC 2PYFB 2VXQH 4KKLC 2APFA 1N2RA 2VDMH 3ZE0E 3N1GC 4M7KH 3NCYS 3GI9L 1WGOA 5MI0B 3NH7H 3QDHA 2NY2B 4YJZL 5CCKL 3DV4A 4Y2DD 3FRUA 4QTIH 4BZ1H 3QIWB 5KS9A 3O4OB 3H8NA 4GRMB 4L3AA 1XF4B 1SM3L 4YHOL 4N1EA 2F8XC 5GGSY 1A7PH 1T89C 1C5BH 3O81A 3CSGA 5I0ZA 3D39E 2JIXB 4GQPH 2R2EB 5HHPA 2HJLA 4NQCB 4IJ3B 2AV1A 1U6AH 3PIQB 3ROOA 5FOBB 4MNHB 1ZLWH 4NZRL 1HYSD 4HJ0D 1G9NH 3RL1B 4RNRA 2KZ1B 3RVUD 1I7ZB 1ZKAA 2IF7A 1R3JB 2PF6A 1OAKL 1QYGL 3HC0B 3ZO0A 2FEDC 1HKFA 1P1ZB 2YPLD 5DK3A 3GIVB 5JO5A 4O58L 3D0LA 1K8IB 2QJDA 1DBKH 3NIDF 1CYGA 3OAUH 3SKOA 3SE9H 1KV3A 3IJSB 5EZJB 1IJ9A 4YXLH 4PRDA 1U0QA 2ATKB 5DUPH 2X4OA 4JRYE 1VFAA 4LVEA 5HDBF 1KFAL 4N9GA 3ZSSA 3FB7B 2HRPH 3AXLB 3OPZL 4P57B 3IJHB 2EXWD 3BO8A 4XI5C 3REVA 1QSFB 5I9QB 4WI2A 5IB2A 2AGJH 1UC6A 2IFFL 1A0QH 1XGYH 4XX1E 4QWWC 1U92B 5F89A 1W0WB 2XWBA 3U7WH 4FQ2L 2G2RB 4LKXA 5HHOB 2QQQA 3PWNB 2VR9A 2ADFL 2WBJD 1T20A 32C2A 4KMTL 2OX5A 3ZDYE 4YDLC 1IT9L 1CGYA 2W9LA 3JV5A 3O6LL 1JGVL 4N8VG 5D2NB 2J4WH 1KIRA 1JF1A 4AIZB 3WNPA 1UJ3A 1B0RA 2BXZA 3UDWA 3QZWB 2DQUL 1IGJB 4OFKA 5DWUL 1R3IH 1DN0B 1CXFA 1VFUA 5I1IL 2WV3A 4XPFL 1NCAL 2JELH 5AZ2H 1KN2L 5E8NA 5EDXA 4DJMA 5B8CC 3C5SB 4KK6C 3B5TA 5T1LD 4G8FB 1EVUA 4NKIL 3TV3H 2G60H 3OZ9H 35C8H 2ZWLT 2C3VA 3TT1H 1LO2L 4KKCC 1Q94B 2WK2A 3IJYB 5I76B 4O9HL 4FMKA 5FO9A 4OZGA 1IC4L 3NTCL 1J9CT 2UY6A 1HXMB 2WUBH 2NY1D 2R9HD 5GJSH 1A6ZA 3MR9A 1FNHA 1EBPA 4IOFD 4LCWD 2X4RB 3SGKA 5KJRH 4RBPK 4R26H 2DJSA 1KLUB 4R9HA 4TVPL 5FB8B 5T1KB 2VDKH 5J56B 5DJ2B 3EIFA 3DUUA 1JGEB 1SJHA 1WWAX 2DKUA 2PUQT 1GGCL 3NPZB 1REIA 3WIHL 2Q3ZA 4PJ9B 2AJUH 3BOVA 3C08L 2EIZB 2BNRD 3H9HA 3CX2A 4NT6B 2VDQH 4P49A 5MP6H 3PWPD 5FDWA 3OHXB 4OV5A 1IAOB 1JF5A 4PRNA 3GZKA 3QI9B 3WL9B 2FYYB 2IFGA 4PLJC 3VWJC 1IGFL 8FABB 5LQBL 1OP3H 5IWLC 5E8EB 2BSSA 3EDKA 4MD5A 1MWAA 2F8OA 1JFQL 4Y19A 4JY4B 2KL6A 1JTOA 5F71A 3TVMA 4FZ8H 1YEIL 2NY0C 4V2CB 5IJKA 5GGRA 3ARBA 4XHQA 4X4ME 1CBVL 3Q6FB 4P9ML 1MRDH 3V4PH 3QUKB 5D72H 2AAVA 1D6VL 3KXFD 4P2RA 4CN6A 1MCKA 2IBZX 2M8XA 3TYFB 4ZFGL 5CJQH 3CMOL 1RK0A 1RIHL 2ITCA 3EOBA 4XZUB 3GNMH 3MV7A 4CW1A 1OP9A 1W8OA 3VCLB 1VFMA 2CDGB 4BUHA 3KR3H 4XXDA 4PJDB 4QNPF 2ARWA 1X7QB 2PO6C 4EUPG 2R1WA 3GKZA 1G7JA 3S97C 3WFDH 3QDJB 2MTPA 3H2WA 3BDYH 1QPPA 2NLJA 3SOBL 4MJIE 3LRSA 3NFSH 3VFSA 1PDKA 1AD9A 3F5WB 1FL6B 1C1EL 4XAWH 3BKJH 1SHMA 4TUKH 3MYJA 1ZVHA 2FR4B 2B39A 4ODUB 1HHJB 1JZ3A 3EO1A 1RUKL 4R4FL 4LKCA 5CD3B 5GRXG 4O2CA 1KC5H 1U8KA 4D0DA 5C92A 4G9DB 1ZA6A 4P2QA 5IF0B 3DRQA 4H1LG 3N9GH 4GKNB 4X4XA 1A1NA 2AEQH 1U9KA 2Q7YA 3Q5OA 5D1XA 3EJZC 3RX8A 4Y16C 2NY6B 4MB4A 5EUKA 5T3XL 1JYVA 4XMLH 4C57C 1AHWC 3AREB 1T6VN 4G7YH 4W4NA 4Y19D 4J4PA 4KDWA 5E9DA 1DBJH 2NY3C 1MJUH 2ERJB 4POYA 3INUL 1KJ3H 4F2MA 3ULVL 5MHSE 5IBUG 5C71A 3B2VH 4RRPA 5DD0L 1FFPA 1RV6X 3K1DA 2ZUSA 5FUCE 4Z76A 5C0FA 3P9LB 4W4OA 4JFFB 1G6RH 1A22B 2QADD 4PB0H 3ZHKA 5TGBB 1AD0A 3MV7D 4OLXL 5AUMA 1UWGH 3RWIB 3QHZH 1NEZA 4P4KD 2OMBA 4F8TA 3TEUA 3ZLQC 4Y4HB 2Y5TA 5B39B 5CEYA 3BD4A 3NAAH 4DW2H 4M48H 2B0SH 4N5EC 3BJLA 2NW3B 3CNKA 4Z7WF 2ZUQB 5I1JH 4LSTH 4C83B 2A9ML 1PG7W 2OCFD 4L8DA 3U36B 2GJZB 3QWRD 5T1DH 4OZGE 1A5FH 1CWVA 3KDMA 4PBWD 4PG2C 1BGXH 5C0CE 3WFBL 3FT4B 1MEXH 2I60L 3UBXI 4P2QD 5HI5D 3S35L 3OKOA 2XACC 1BF8A 4MMZC 5CBEA 2VDNL 2BCKB 1I7UB 5D1XD 1TJGH 1F11A 1F4YL 5KS9F 2D9CA 1BFOA 2NX5E 5DD1H 3MA9H 4DKDC 1P84K 4PJ8A 1QEWA 3WBDA 2ZCHL 5BV7L 4MWFA 3V52L 3H3PL 4YE4L 4PFEA 3RWFA 1AXSA 4HUMB 5E9DD 1J05B 4PLKC 2GFBA 3KLAA 2OR7A 3QULB 4KMLB 4U0RB 5EO0B 3PWVA 2Y36H 4XWOC 3MO1A 5B4MD 2B7DT 1MAMH 1MVUA 4GOSA 1FVDA 2ZCLL 3P4MB 4DVRH 2HFTA 1KLGB 1RZ8A 3MGOB 3MACL 5SWQA 3VRIB 4JY6B 1C7TA 4JREC 5TQ0L 1JZ8A 3SKMB 3D9AL 5DEGA 2MPAL 1OW0A 2OI9B 3GUTB 1IAIH 4WI6A 4QXGH 1AR1C 4XBPA 3PGCA 2V2XB 4KK9D 5I8EA 1A7OL 4YR6A 4KPHH 2VLKA 3OXRA 1N0XL 3GMNB 4AM0B 5C86A 4ZUSA 3N85H 1LQSR 3CJJA 3DOSA 4NRZA 4P2RE 1MUJA 2X89A 3OXSA 1KPVB 4XHJD 4RAVA 1IGTA 5DO2C 5AWNH 1ZHLA 4PJCB 5ETUA 1TIUA 4OBSA 1T2QL 1NQBA 4PJHA 3RPIA 3UYRL 1J10A 5KVEH 3L3HA 3QDMA 3RA7H 3VXNB 4Z7NE 5EO1A 4X6DF 4HF5L 4GG6E 1U3JA 3MNZA 2W91A 4XPTH 3TO2A 3ULUL 1TQBC 4MYWB 3TJHC 1XGUB 3SN6N 3FCTB 5SWSA 4WI5A 5ACMA 3FQUB 1L7TH 4OSUH 3BIKB 1T1ZA 1ZHBB 3T0BA 4NNXB 4TNWK 5L9DL 4PRID 3TESA 4M3JA 3CLFH 2P7TB 2VC2L 4HPOL 2EYSA 5EBLA 3A6BH 4P2OD 3QNXB 3AVEA 3O41B 5D2LA 2DKSA 4NQEB 3GSXA 1AO7A 3MUY1 5I15H 4ZFOB 1C5DA 3RUGA 2CLZB 1MHHA 3B9EA 3EJJX 4J3XA 3UTSE 2WLYA 4LPCA 2OZ4A 4NGHH 4M62L 1GVIA 1MJ7H 3BHBB 3UTTB 5ACZB 1DUYB 2X89D 2JB5H 4UOJA 3QQ9C 1R5IA 4PG9A 4IDJL 5T5NG 1X44A 4F9PC 3VJ6B 1UKTA 3DX8A 1WWWX 1YEJH 1X5HA 3CDGB 3ESVF 4LLMB 3W0WB 5D1QD 1NC4B 4OLEA 1MY7A 2IQAB 1Q9WB 2EDHA 1KYOJ 3DURB 4HZLB 1R0AH 4QT5A 3TFKD 1KCRH 4HUXA 1U8NA 3P77A 3QP3A 3BKMH 4WI4A 2RAMA 4MA7H 3U0TB 2F53A 1FJ1A 1CIDA 3RDTB 3VE0B 2NYYC 4X6CB 4APQA 1I3VA 2X1XR 4PP1D 4P23A 1FNSH 4AL8H 1JYWA 5JOEA 1F4WH 1KBGH 1I1CA 3KWWA 5ID0B 4GAFB 2FWOA 4RQQB 2X4SA 1AQDA 5GIRA 1K9TA 1KXQE 1QFWI 2D7TH 3VFVA 1CGTA 1TPXB 1YPZF 1FE8H 1JNJA 5DZOA 5D7LE 3HG1B 4P3WA 4DKAA 3EO0A 4HC1A 1L0XA 4MNGB 2J1KA 1QUNA 1J0JA 1KOAA 5DUBA 4DZBB 2MHAA 5ALBL 5HVWA 1FLRL 4ONGH 4P4RB 1UXSA 5CUSH 1DE4A 1QLFA 4ZOBA 3IF1A 4YNYB 4JRXA 3NGBB 2VAAB 3QCTH 5AAMA 3CFDA 4L3CB 1NLDL 1H3TA 4JZJC 4KJPC 1AKJA 2YA1A 4LSQH 5DVMA 2HWZL 1FAKT 1EHAA 1KTLB 4HH9B 1CF8L 4ODWB 3UTQB 2M2DA 1EAJA 1U8LB 5E4EB 2XPGA 4YAQB 3FAXA 1ZV5A 3VXUE 3LQMA 1FORH 4EDWL 2F53D 1M7IB 5ITFA 3OGCB 4PJHE 5JUEL 3L3DB 1HDMA 3DNKA 2NY4D 3QDME 4TSBL 3T0XA 4M93C 2VZUA 3BGAA 1DQQA 3UZVB 5LKNA 4KKAC 5DGQA 2FZ3B 2QKIA 3B9VA 3NOIA 3U79A 3D85A 5DFTA 1IKNA 5FA3B 4X4YA 4ZS6D 5DDHB 1I9IL 4LLQA 4OTXL 5ANMB 4L5FL 1RZIA 4X98B 4HFWB 1HILA 2YZ1A 1PSKL 4CADB 5CBAA 3TNMB 2BNUB 1U8JB 2HT4D 1YUHB 2P1YA 4OAWB 3SDCC 3BMVA 2B4CC 1P4LB 4F7PB 4F7TB 4UTAH 1F6FB 4KI5D 2WINA 3NZHH 5F9OH 1LO0L 3BPOC 4M7JL 3MSPA 4N0CC 4XX1G 3OAZK 3EDEA 5EWIL 3QUXB 5DSCB 4UOW0 1CTNA 1IILE 4JRXD 4WU7B 3W39A 5GXBB 1DBMH 4FP8H 3EDFA 4CVXA 1R3KB 1V5JA 5IFHH 1QO3A 3MOBL 3RUGE 4YDVB 1HHIB 5D7KE 1AKJD 5IV2A 3AMLA 1R3LB 2W59A 4QRPE 4E41A 5H2BB 1JF6A 1Q9LA 5HYSB 4RX4D 5FGBA 2AK1H 3MCKB 4HDIB 4S1RH 2BSTA 4WU5A 2XICA 4AENA 3VXQA 5TF0A 2HTLD 3LCYA 1J87A 3VH8G 3P0VL 2X05A 4IRSA 2B4CH 3B2UD 5KSAD 5GJTH 4U49A 2X40A 3NPSB 4Y2DC 4U2YA 2XTJB 4ZPVB 3TPUA 4R8WH 4ZFOL 1YY9D 2YSSB 2DQCH 3OL2A 3TT3L 4TVPD 2BNQD 4OF3A 4WUKL 1ADQL 5DF0A 4NJAL 1VGEL 2ZG3A 4Y89A 4XMKH 3S36X 2FLRT 3PQYA 2DJ4A 4HKJB 4RGMB 4G42A 4L4TE 3U82B 4OT1L 3V8OA 2VDLH 2G75A 4IOSD 1YJDC 3GSUB 1HYSC 1A6WL 4HJ0C 2Z91A 5MEPB 1VPOL 2Q8AL 3O0RL 1SBSH 3RVUC 4IMKA 3TZVA 5EIIA 5HHVH 3AS1A 4RAUA 3SE3C 4NN6C 2CJUH 3F65A 4LPVA 3NVQA 2V9RA 1ZEAL 4GQ9L 15C8H 4ZAKA 3GJFK 3W81A 4GAYB 2DQTL 1NMCB 3GKWL 2IMNA 3MFFB 3BEWB 1NCDH 3I02B 3SGDI 5HHMB 3S96B 1R6VA 3V8CA 5HJ3A 4M5YL 1WTGT 2VABA 2LU7A 4R7NA 1WBZA 2P47B 3O11A 4D9LH 3ZHLA 1S9WA 3WFCH 2X7LB 5IK3B 2X70A 4NZTH 5HI4D 1BAFH 1SJVA 2YMXH 2NY2D 1CT8B 5GSRA 2GITB 2NNAA 1G7IA 4EIZC 4PJIB 4IS6A 2GJ6A 3P73B 5DLML 4G6KL 4AQOA 4XCNB 1E0OB 2B2XL 25C8H 2EXWC 3ABZA 5AG8A 4OCRH 3O9WB 3FO0L 3HLAB 4NQDE 4P5MA 4Q6YA 1I8MB 2CGRH 2R4RL 3LAFA 5DQ9A 1BJ8A 2OK0H 4P0DA 3RP1A 5BOZG 2RB8A 5C08A 1WVZA 3F12B 4LEOB 4OKVA 5IB4B 1V3JA 1INEH 4YBQD 4NQCD 4UUJB 1A6TB 2DWDA 2WBJC 1NH6A 5A16B 2OTUA 3ZT6A 2GTZB 5GGTA 1YMHB 3E2HB 5ERWA 4KRLB 1A7QL 1LO5B 3SJVD 1ACZA 1R3HA 3MBEB 4M1GH 1E6JH 5F1KC 4NZUH 2VQUA 4UDUB 1HIMH 3GHEH 3SGDH 2EC8A 3TZVD 4IOIB 2L0DA 2F58L 1HCVA 4RMTA 5F3BB 2UVFA 3TBWA 3D18B 4POZD 3C2AH 2ZZUT 5T3XD 1K8DB 3K2UH 1HHHB 3OKMA 3FFCD 4G8GB 1DTUA 5D2LF 5FYLE 2XTLA 1Z9SA 1UZ8B 1EO5A 2XZZA 1T1XA 4XPGH 2IGFH 4LHUA 3N1FC 1KELL 3IXTB 1A9BB 1U41A 3LKRA 4KDVA 1KUMA 2AJZA 5DRNA 4XVSH 3QHFL 4LRIC 3P4OA 1MAJA 3QEQD 3N50A 1FPTH 2JB6A 5D4QA 2NY1C 2BHZA 4PY8J 3NZ8A 4G8IB 3LN5B 4A6YB 5HVHB 4BELD 3JWNC 4IOFC 3G5XB 3V6OA 1GC1C 3ALXA 5SX5K 4B50A 3V7MA 2CDFB 3DVIA 4HKZA 2XKSA 4U6TA 5SWZB 3OKLB 1EHLL 1WC7B 5F7EL 5IMKA 5IEKB 4F80A 1ZE3C 3IDXL 4R97B 2PXYB 2VQ1B 5D93B 2UZIL 5ICYB 5HGAB 4E41E 3I50L 1XR8A 3MV8B 5JXED 3KPSA 5IB5B 5I19L 2ORBH 3QRFM 3IDGA 1RI8A 3C60A 1BX2B 1SEQL 1V7NL 2R4SH 2DQFB 2X4TB 4EI6A 4HLZG 4FQQA 5IMLB 1JI2A 4U1IB 1YNTA 3KHQA 4BKLB 4LGPB 4QRTB 1S7QA 4NP4H 5GRJL 2I07A 1KENH 4OD3H 5E6IC 1GC1H 5I2IB 4LBEA 4CJ0A 5JHDA 5DI8B 5TFSH 5ACLA 2YOCA 4PTTB 4TTGA 3QUYB 4K7FA 1CXHA 5DJAB 2QLVB 5E99L 4X5XA 3F7YA 5C0BE 1DFBL 5I18L 3BGMA 4ZS7L 3MV01 4LHUD 5LGHL 3KPMB 3MLTA 4XCEA 3OR6A 2R29L 2FD6H 3IDNB 2V7HB 4XNMA 3MLUH 5F88B 5D7IF 5EBWB 3GSWA 4D0CA 3ARZA 4YXKH 5L2KE 4R90L 3OJ2C 4XPAL 1JGDB 4MJ6B 1JTPA 1NCCH 4WW2C 1BLNA 5GRWA 2DMKA 5T33L 3MJ9L 1XH3A 1T6WA 5FCUL 5T1KD 2WLZA 3IFNL 1CFVL 1MFEL 5IIEB 3S37H 1Z5LA 1EHNA 4P5KB 1YN6B 4NHUA 3H9SA 3LKPB 1RMFL 4JM4H 5A40E 5DMGD 2FDBP 1BEYL 5IROC 3A0OA 1MLBB 1MJJB 4JY5H 4JKKA 4OLYH 4NWTH 1CD1B 4I0PA 3QISA 4PGEA 5C2UB 2R23A 4QYOA 2ADGA 2ITDB 4KVNH 1FZOB 3VGFA 1P7QA 1OSPL 3ESUF 3FN0H 4NJ9H 4UIKL 3C60D 2ED7A 1UFUA 3GSQA 5JORB 5C0RH 4DUVA 5EPMB 2Y7QA 4GFTB 4LSSL 4HJGA 1Q1JH 4PGDB 4L9DA 4NO0B 1GGUA 2MKLC 1I7TA 1AIFB 4HFUL 1FFRA 1FLTX 3ULUD 2LU4A 3NCJL 3KPQB 2ESVB 3X12A 2W60A 3A6CH 4KROB 5GHWL 2QEJA 5KZCB 1MHCB 2EDOA 5CZKA 5J7CC 4QTHA 1MQ8A 5KVGL 4JO4H 1VGKB 2EE3A 1H3PH 4BH7A 4UT9L 5IQ7L 4QHLB 3CVHA 1CL7I 2UUDK 4Z0XA 3T65A 3D2UD 4O5LH 3OG4B 2PYEB 2QADC 5JHLL 1IKFH 1SY6H 3B8SA 1J1XH 5BVPH 5ICZB 3JUYA 1BZ9A 3VWKB 1WWCA 2J5LB 4MAUL 4I4WB 4P4KC 3DX7B 3BXNB 5F6HI 3RGVB 3ARRA 2P5WE 2XXCB 4ZYKB 3QNZA 1MCPH 5GGQL 2BVTA 1KTDA 3H9SD 4UNTA 2XZCH 4P59L 2Q3AA 2YKLH 1K6QH 4NYLA 1PYWB 4ZXBA 3T8XA 1JNLH 2XN9B 3HZYA 1F58H 5F72S 3UYPA 3VGGA 3V6OE 1BREA 3TN0A 1ES0A 1ZA3A 3ZE2E 5HI5C 1TCMA 4I3RL 4F57L 1WZMA 2FO1A 2OTWB 1BFVL 2R8SH 1KPUB 4AK1A 2XKNA 4YHLH 4X4ZA 3H7LA 4FN0A 4TRPL 3B9DA 3JWDL 4RRPG 3HI6H 5J6HB 4PY7A 1Z9LA 1QG3A 4JG0L 2GCYB 1I3RA 4AQ1B 1A4KA 2X4NB 4NNYB 3RWJB 2I9TB 4MAYA 1ZT4A 2VL5A 1MHPL 2W38A 5B4MC 1ITCA 1C5CL 1B0WA 3DMMC 3K81A 1FSKC 3ARTA 2VLJA 1ZT1B 4CMHB 3F7PC 2Z8RA 4JN1H 5E00A 5M7QA 3SBWC 3GSVA 1HH6B 2NXYD 3BW9A 2EH8H 4JKLA 5JHDE 5HPMB 4K9EC 3QIUA 4CVWA 4RWHA 4HK0A 3DTXA 1WFUA 1I1AA 4OGZA 5CIPB 3AS0A 4U7SA 5ICXA 4YHKH 3GSNH 3KJ6L 3MJGX 1KNOB 4XHJC 2DQDL 3QH3B 4ZUUB 3U30B 1J0ZA 4OIIH 4FFVD 3UTPD 1OPGL 4F8QA 3MRDA 2E6JA 4BQ8A 3SDAA 1MRFH 3DVNB 1EO7A 3BPCA 4DCQB 2DI9A 3MRBA 1ZWIB 3M1BB 4KKBD 1LK3L 5JIPA 2EDTA 1KG0A 1UQSA 3P4NA 4YFDB 2ENYA 3NCFB 2LQRA 2VRAA 2J6EA 5KSBA 1AJ7H 5MEQA 1KJVA 2A74A 1NCBH 3RWHA 4K9EH 1DQJB 1D5IH 5HYQB 1IC7L 4PGJA 1TQCC 1TDQA 4J1UA 4MAYD 1EVTC 2E27H 3QEHA 3SGJC 1PX3A 5DRZB 4XCCL 3RWCA 3VXSA 1QSEB 5JZ7D 1C08A 1D6EA 2VLJD 5EU7C 1QFUH 1ZLSL 2FBJL 2AEIT 3HAEA 5HY9B 2A77L 3FQWB 1FV1B 5IHLB 2DB8A 5C07A 3RY5A 2RGSA 4P2OC 3DJ9A 3OKKA 8CGTA 4JN2B 3ZTNH 3LKOB 1CXIA 5KANI 1ZLUK 1CQKA 3B9KD 1NBZA 2YC1B 3DV6B 1MCOL 4WGWB 3DGGA 3FHQA 2ZJSH 3KLHD 3MLSL 2QQKH 4XBGA 2AP2A 2DRUA 2QV2A 5TE4L 4ZD3L 1OAUH 1GGBL 3HNVH 4O51B 1BD2E 1S7VB 3VXRB 3S98A 3MCLH 5D1QC 1PKQB 3SPVB 4RSVA 3HUJE 5DHVH 1JRHH 1IEBB 3NN8A 1P5UA 3L3GB 1A1OB 2X5PA 4NCC1 5C09D 3TFKC 3BP5A 4W70A 1A14H 3BI9X 4MJ5A 5BZWA 3FB8B 3STZB 2GKIA 2FATH 1B2WH 2DLEA 1RULH 4OZFH 2W65A 4M6AA 2CRMA 3BKYL 1E6OL 1NDMA 4PJ7B 5F7KC 4XXCA 1RHFA 4TOYL 5F1IA 3LD8C 5D9SA 4DKFH 4PP1C 3DO7B 4QOKA 4P3DA 1I8IB 1YEFL 1OGTA 2O61B 5D7SL 3OMZA 3VFPA 4BZ2L 5F7DB 3RJQB 4D94A 1IGCH 5ENWA 3ARFB 3EO9H 4FQIH 3BT2H 5D96B 1FZMA 3ULUF 5M94B 4QHMA 3ULSA 5DHXB 4HHAB 2V2TB 3I3DA 3VU2A 4IMLA 4X6BA 3RGHA 2AXGA 4I48B 3KPLB 1KEGH 4LVNC 3IGAB 3CFCL 3SDDB 5EU6D 2AI0L 3Q1SL 4ODXA 3MXWH 1I8KA 2DL2A 1E4KC 4M00A 5HGGS 3W0WD 2H32A 4JKPL 2APXA 3QUZB 3BYYA 1NC4D 5DMKA 3MC0A 2BRRL 2CIKA 1MREL 4OGXL 1U8MB 3P9WB 1Z2KA 3GIZL 3GI9H 1J88A 5ESAB 5CCKH 4QRUB 2WSKA 3ZKXB 3K7UA 3ARGA 3GJFA 4U1KB 4V1DA 2UV3A 1MCRA 4R7DA 5BVJB 3VFTA 3CVIL 4EJ1C 1S5HA 4BFGA 1S78D 4WHYG 1K4CB 1M7XA 5I73B 1ED3B 2VXVL 3NFPB 3HR5B 1SM3H 1BM3L 4YHOH 5D1ZA 1N5AB 5GS1B 1IZKA 1IL1B 4OF6A 5C6TH 2NY4C 2YXMA 1OP5H 5ADOL 1RHHA 1RJZA 3IFOB 4QOKD 5ITBL 4PP2B 1CG9B 5IJVA 3OKDB 3TCLB 5EC1A 1QFHA 4EVNB 2G9HA 5KSBE 2HJFB 1S3KL 5BS0A 4HWZB 4ZS6C 1VADA 3GMPB 1OAKH 1QYGH 1YECL 1DSFL 3UAJD 1I4FB 2ZSWA 2HT4C 1C16B 4KI5C 4AEFA 1RZ7L 1ERNA 4X7DC 4JFOA 4JJHA 3HZVB 2AKRB 4X6FA 3ZE1E 5I8CB 1X5JA 1AP2B 5E8OB 4WY7L 5IR1B 1K4DA 3V6BR 1KFAH 4HUNB 4QRSA 4PJ5E 1I85C 4Q6IC 3OPZH 5LG1A 3MPCA 4NM8L 1QRNA 4JRWA 4Y4KC 4JJ5B 4CL7A 2IFFH 2BVQB 4V1DD 3UPRB 2GSIB 4FQHB 3O8XB 4KV5E 5I66B 4MNQA 4D8PA 2HTLC 1Z9OA 3MLZH 4HKBA 4ODSL 4X99B 2DBJA 4KMTH 5HBBA 1EEZB 1X5GA 3B2UC 1IT9H 5KSAC 1QBBA 3TIDA 3A67L 3U1SL 3GGWB 2ICES 1YY9C 2DQUH 5TH2A 5DWUH 1XR9A 3MODL 3ZDXE 2VXUH 5EOCL 3IU3A 3BUYA 4S1QL 1J8HB 3CXHK 1KT2B 4XPFH 5I1IH 4ZQKA 1NCAH 1BPVA 3NFNB 1KN2H 5DJ8A 2IADA 5TDPA 3MRKB 5MENA 3EYOB 5EZIL 4OLWL 5MEOB 1RFDL 4NKIH 5EOTB 4MD0B 2CRIA 1YNKL 4JANA 3LS5L 3R0MA 1LO2H 4YIQB 2DQHL 1O7SA 2C3GA 4O9HH 1OAXL 1G7QB 3ILPA 3AFLA 3IDIB 4LCWE 4Y5XA 5FKPA 1FVEA 1IC4H 1ND0A 3NTCH 5ESVA 4HT1H 3PDOB 4HUKB 1HH9A 3BZEB 4JG1H 2FJHB 3C5JA 2ED8A 2ICEA 2PW1A 1M4KA 4M9OA 1MPAL 4WVRA 2XWJA 4N0YL 4IHOB 4TVPH 2AJXL 1INQA 1EEQA 4HCRL 1BQSA 4DTGL 1HEZB 3BVNA 1I7RA 1GGCH 3WIHH 4KI1A 5HI4C 4E42B 4MNQD 2MQCA 3BKCL 2NY2C 3C08H 4RIRA 5FO8A 3IKCA 1SYSB 2W0LA 2A6DB 3RNQB 3O4OC 4BUGA 3BH8A 3WFZA 4ELKA 5LQBH 3RL2B 1LP9B 4PRHB 4R3SA 2BVPB 3HFML 4Z18A 2IG2H 4GW5A 4GS7B 1PKOA 3P4LA 4NHCL 5SV3A 3CX5J 4YBQC 1JFQH 4IJ3C 3PWLB 3U4BL 3GJEA 1U3HA 2R1YB 1YEIH 1NAKL 1JK8B 3BQUA 5IQ9A 3KXFE 1YY8B 4NSKA 3SY0B 3KPPA 1CBVH 4P9MH 1JNHA 1U58A 1D6VH 5KSVA 4FQJL 3T0EA 4ZFGH 3BAEH 3GBML 3O3EB 1V3MA 1S9YA 1RIHH 4ZG1A 4TN9A 4POZC 2YUXA 4UDTB 1NC2D 2CKBA 4YGAB 3BWUC 2IH1A 3RKDC 3SDXF 3MLXL 1ZHKA 4XPBL 4LL9A 3HCVB 3QDGA 4NQSA 3ULVC 1NBQA 4RBPH 4OZHA 3SOBH 5C6WH 1EJ6A 1XCQA 3QT2A 3M8OL 1EJOL 1C1EH 1JPFB 4NFBA 3VI4F 3MOQA 1ORQA 1NFKA 4S2SA 5GGSB 2DM7A 1BQLL 1YMMB 5J4MA 4BM7A 1RUKH 1T1WB 4R4FH 1ZHNB 3ZTJG 3LV3A 1BZQK 1RUQL 1WIOA 3LQAL 1PGRB 3QPXL 3NIGF 3KPNB 3G08A 3CFBB 2VLRB 1ORSB 3TLRA 5JXEC 1LE9A 5C0IA 5T3XH 4Z7VB 5FECB 2HA1A 5F3HA 4XBEL 5FYJU 1CFQA 2JJUA 3FO1A 4FFYL 3KYMB 1U3HD 2Q76A 3ETBF 5H37H 1ZT7A 2JJSC 2AV7A 3BWAA 4N8CL 5TE7L 4U3XA 1LEKA 2J8UB 1A6VL 1Q0YL 2R0ZL 3MBED 4PJGA 3K0WA 4WUUB 3BQUD 5I30L 3ULVH 2Z31A 5DYOA 3FMGL 1ZAGA 1T22A 5DD0H 3HZKB 3RWEB 1GAFL 5K9KA 3CFEB 3MZTA 1AR2A 3EYVB 4KXZI 4DVBB 4G8GD 3WS6C 2GSGA 1ZVSB 4PY8I 4DAGH 4RFOL 5BV7C 4OLXH 3UROR 3T09A 5KAQG 2PW2B 2DIAA 4YXHL 3RAJL 4OZ4A 4KJWD 2WP3T 4YGVA 5GGUB 1Y6KR 4YWGL 4I2XA 2A9MH 1I9JL 2A73A 5EC2A 2BMKA 3VA6A 4OD2A 2NXZB 4WO4A 2C7UA 3WN5A 3WFBH 1NCUA 2I60H 3U6RB 3IXAB 2YD8A 3MV8D 5B8CB 5E2WL 2P5EB 1YC8A 3S35H 4F9LA 4PJ9C 2HLAB 5DMGC 2VDNH 1F4YH 3ARSA 5E5MA 1EX0A 4GKZB 5I1CH 1XFPA 3RIFK 4C4KT 2ZCHH 5BV7H 3V52H 3STLB 5E94A 2W0FB 3H3PH 4PREA 4YE4H 3K46A 4YO0B 4LPWA 1P53A 3C60C 1P4IL 4MXVF 3DXAE 1S7TB 3FQRB 3WMSA 4G80A 3EYSL 3Q6GL 1CIUA 3V5DB 2YWZA 3L9RB 2A6JA 2ZCLH 3FB5A 1T5XB 3MACH 3FOLB 4XMPL 3UO1L 3G6AB 3ULUC 5TQ0H 3QO1A 4LLYA 4JFDB 4N1CA 3D9AH 4EDXA 2DLGA 3RVWC 1PLGL 1OB1B 5D5MA 4KJYB 4GRWE 1A7OH 1GGYA 2AJYL 1MI5A 3AM8A 4U6VL 1N0XH 4GUPA 1TZIB 2GY5A 2YUZA 1FDLL 5ID1A 1DUZA 4PJBB 5DK0B 4XB8A 3C9NA 1EBAA 2EO1A 3T0AA 3T0EE 3L3IB 4H8WL 1QBAA 1WCBB 5ELIA 3WYRA 1T2QH 3UYRH 2FECI 5C9JA 3AAZB 4JCMA 5ISZA 4PJXA 4HF5H 3DROB 4CNIA 3ULUH 2P48B 3CMGA 4OZHE 4OGYL 1S8DA 1YDPA 1TVBB 4YPGB 1A6AA 3EFFB 2F74B 4CU7A 5DJYA 1HCFX 1K2DB 1KB5A 1L0YA 1NPUA 4GLRI 1X5LA 3X13B 3L7EA 1F6LL 1JGUL 1MF2L 4OQTL 4S1SL 2GTWB 2BY2A 5IG7A 2Z92A 2OL3L 5EUOB 5L9DH 1M7DA 4OCNC 1YEKL 5IOPB 2HVJB 2ESVD 2Q6WA 2VC2H 4HPOH 2PO6B 3IDJB 3U7YL 1AC0A 2ERJC 4MA3A 4Y4FB 2OR9L 2MKWA 3FL7A 3WXWL 2XKUA 4Z7UB 3MRNB 1U93B 1YEEL 2ZOKB 3WV0A 4EN3A 1NAMA 2NQCA 4FMFA 4TUJB 3PL6A 4C59B 3RJDA 1MI5D 1G6RB 1LD9B 4HUVA 1ODAA 2PYED 4JFEB 4M62H 3FTGB 2XXMB 3VWKD 4ALAL 4IDJH 2OS7A 4Y4HC 3DBXB 4Y16B 1OT1A 1LO3L 2YPVL 1EGJA 5CD5D 1AHWB 3KPOA 4TSAL 2ZUQC 4H1LB 4JZNA 5DJ6A 5IESL 1OQOA 5KOVC 3X11A 1WBXB 4TTDD 2WIIB 4PRPA 3VRLE 4PUBH 1EFXB 2EDLA 1FN4B 4JQXA 4ONHA 2COQA 4FFVC 3BN9D 3EDDA 2GK0B 1J7VR 4Z78A 4MQSB 1QR1A 4GKSA 4O2EA 4JZOB 5C1MB 1R5WA 4KKBC 4ESKA 1N59A 4NQUA 3BP7B 5EU4A 3VI3F 2AW2A 1TTGA 5IBUB 5JIKA 4JFPB 2CSPA 4C56B 2E9WA 4LARL 2LVCA 3HB3D 3QO0A 3B6SB 4QCIA 1RZFL 4OM0L 2JCCA 4PGZA 1Q9KB 1RJYA 5C0AA 2YXFA 4G6AD 1Z0NA 3IDMB 4MAYC 1U8PB 2PYFA 4R2GD 3W9DB 1W72A 2P8MA 5DHYA 1JYNA 1PZ5A 5ALBH 5JZ7C 2I25N 1FLRH 3VXMA 5JIHA 1U8QB 5LXGL 3REWB 5F1SA 5L6YL 2GY7B 2IBGA 3QIWA 2RBLA 1TVHB 4ELME 1T7WA 1I1RA 3RY6A 3G6JB 1NSNL 3ZYJA 3B9KC 1DQTA 4GRMA 1BIIB 1W8NA 3FO9B 3GMMB 4PJEB 3PV7A 5EOCJ 1NLDH 3I6GA 3KLHC 4JKWA 4OD1L 5JW4N 2HWZH 2N7BA 3PIQA 3NA4A 3FQTB 4CU8A 3P2TA 1CDUA 1CF8H 5FOBA 4MNHA 3VFMA 2Y07L 2P45B 4UZGA 3DX6B 4IRJB 3RL1A 3EGSB 4M6OL 5CJBA 5I1LB 4EDWH 3ARYA 4I77L 3ZT5A 3BSZH 4DKEL 5JUEH 4TSBH 5FHAL 3KYOB 1R3JA 2ADJB 5ISZE 4PJXE 3W9EA 5L2JB 2EE9A 4NQVA 5FEBA 4L3ED 1P1ZA 2EDKA 2IPTL 1T4KB 2EDNA 1K8IA 5ADPL 3P40A 3PWUA 3GMLB 1ZOXA 5EZJA 3O45B 3TIEA 5EN2A 3DECA 3ZHDA 2X4PA 3QXDB 4OZIE 4NPYB 1I9IH 4WJ5B 4OTXH 5C0AD 3HAEG 4L5FH 1AGDB 4F7EB 4DGVL 1NFDE 3T1WA 3T4AA 1PSKH 2V17L 4KI5E 4PJGF 1RU9L 2XG4A 1KIQA 3VDAA 1HXYB 3AXLA 4HIIB 4HV8B 4MZ3A 4JB9L 1IGYA 1LO0H 1QSFA 3P0YL 4M7JH 2OQJA 4NKDA 4GKOA 1WUNT 4H25A 4Y5YA 5EWIH 1W0WA 3CSYB 5FYKL 4K55A 1A7NL 1N5YL 3OB8A 3AU1A 3MOBH 3V6FB 1TZHB 1U8OB 2DTSA 5CP7B 1G7MA 3CFJA 5D2NA 3CXHJ 5EOQL 1FO0B 4ZMAT 4ZTOL 1P6FA 3MV9B 1DN0A 4ZUVA 3X3FL 1E4JA 2HTKD 3WE6B 2IJ0C 3P0VH 2JKXA 2BJML 1WFOA 2VIRB 4HWBL 3WIFB 2YA2A 4TVPE 4Z7OF 5CP3H 4FFZL 1PFCA 5LWYL 3CCHA 3TT3H 4WUKH 5IB1B 1S78C 2NTFA 5I17B 3OF6A 4ZNCD 1ADQH 3UZEA 4NJAH 1JHKL 1VGEH 2P8PB 3LEVL 3C6LD 1Q94A 4LFHG 5KN5B 1F5WA 3RX5A 1CZ8L 2X2YA 5D6CB 4HX1A 5FYJE 2AK4B 1BBDL 1ZS8B 1A6WH 1VPOH 2Q8AH 3NABL 3O0RH 3BPNB 1KLUA 4LLVB 4WWID 4GRLA 2ZOLB 5E95B 5TDOA 4DWHA 5FB8A 2EDEA 3MA7A 4RGND 1ZEAH 4GQ9H 2DQTH 3GKWH 3O6FD 2QQNL 5F8RC 3UAJC 4U31A 1PVHA 4E0RB 5D5MF 3OAZH 3D87B 3S37X 4L8BB 1XF2A 2EYRB 3HPLA 3AY4C 3JWOL 1U95B 1FQ9C 2EH7H 4M5YH 3E3QC 3VXPA 4AIXA 3NGBC 4H0GA 3QI9A 2VMFA 3HMXL 3C8KA 4PTUB 8FABA 1NGWB 3SCMD 1BQUA 4KVCH 3FB6B 4XP9L 1H3VA 3QCVL 5DVLA 43C9B 5DLMH 4U1NA 4JY4A 2XNAB 3Q0HA 2NY7L 4G6KH 4WV1B 1I8LA 2B2XH 2EO9A 4ZSOA 2CIIA 2MQ0A 3FO0H 4XPHL 1GZPA 3RZCA 1HHGB 3Q6FA 4NQCE 1AQKL 4PV9A 1LO4L 5DVKA 5DQJB 4M6ML 2DYPB 2OMNA 5DJZB 1A1MB 3OF6D 1JWMA 1KCKA 5HGDB 2XV6B 1LDSA 3P11L 5DD6B 1CFBA 2CDGA 1A7QH 4PJDA 5F21B 1EA9C 1M71B 1MY5A 1DEEB 4GXUN 5L88L 4LP5A 1UB6A 1JZ5A 4JZJB 1P6AB 5T3XE 1TCRA 4FQLL 3ZDZF 1XGTA 2F58H 5JLZB 5IBLD 1RUPL 4KUCD 1DDHA 3OG6B 2BY3A 5DRWB 2FR4A 3HE6D 5C3TA 4I18A 1Y0LB 2VLLA 4NZJA 3ULVE 1G0DA 5HYJB 1JWSA 3HNTL 43CAA 5EZOL 1KELH 3G5VA 1QHPA 3L5JA 3QHFH 4M93B 3MLRL 1K5NB 1BWWA 5D70L 1NLBL 5CFHA 1QSFE 4J6RL 2HFEB 2NPLX 1LK2B 3U46B 4TVSa 3IAPA 1S7XA 1P7KB 3AREA 1CDCA 1D5MB 5HHOE 3BH9B 1EHLH 4R0LB 1UACL 3CK0H 3ECBB 3IDXH 1WZ1L 2UZIH 3LKNB 3RZCD 3I50H 5D2NE 3SDCB 3CD4A 3CH8A 3MLVL 5B3NA 3ELAT 2LTQC 3VFGL 5IHZB 3B3IB 3CDYA 3O3DA 5I19H 4J3TA 3ES6A 4H5SB 4UINL 3QFJB 4JFFA 4YDIL 1SEQH 1V7NH 4P2YA 5JNYA 1W0YT 1FZJB 4OB5L 3MLPA 4CVZB 2FHCA 2FHFA 4Y1AA 5IEHB 5HTSA 2YK1L 5KVMC 3S88L 3IVKA 1SQ2N 5HD8D 1E28B 2EECA 3WJJA 5T3ZL 5GRJH 4QY8B 4EOWL 3R0NA 1CU4H 4QLRA 1CFTA 1Q9OB 2JCCF 2DI8A 4U1MB 2EEDA 5KTEH 4C83A 1RIVL 1FO0L 2VE6B 1FBIH 1AY1L 3I3EA 5E99H 2D4DA 2FEEL 2FL5A 1DFBH 3GMRA 5I18H 2C5DC 4ZS7H 4OUOA 3MROA 5LGHH 4XNZC 4WW1A 2R29H 3UX9B 4JKMA 1BMGA 4PJAF 4Y2DB 4NN5B 1N64L 1Q0XH 5AEAA 2VDPL 5IW6A 2BCKA 4R90H 7FABL 4XPAH 1NBYB 2CDEB 1PQZB 5FDYA 5T33H 3L6FB 3MJ9H 5AZEL 5FCUH 3RWDB 1FZKA 3IFNH 1CFVH 1MFEH 4X5LA 4ZPTB 5H94B 3WKMH 5DT1L 1J05A 5SX5H 5HYFA 1JZ7A 1KCUL 3Q3GB 3ARDA 2O5ZL 2HVKB 4JPIB 5HHQA 1N6QL 4MD4A 3QUML 5AD0B 5FUOL 1BEYH 3GRWL 1UB5A 2X1OA 3UJJL 1TENA 4XNYH 1GRWA 4YEFA 2XZQL 3B9AA 5I16B 4JY6A 4O2FB 2V5RA 1OSPH 2DTML 4UIKH 4NN6B 3V5HA 5LBSL 4TULL 1X4XA 2W92A 2HKFL 3CDCA 2YPLB 2CO6B 4RWYL 1T1YB 5HGBB 4Y1AD 1JI1A 1D5ZB 4F33B 1KCVL 3GMNA 4HFUH 2BHUA 5SV4A 3LEYL 3NCJH 3SO5A 4QRRA 4PS4L 4Z7WB 1U3HC 5I1AB 5GHWH 1KPVA 2HJKA 3MBEC 4PJCA 1T83A 1YYLL 5KVGH 1N2RB 4YUEL 1QBML 4FQCH 3VXNA 3BN3B 1QSZA 3EYQD 4JHBA 4UT9H 5IQ7H 3G6DL 3V0AC 5EU5B 3DV4B 2ZUTA 3FRUB 5JHLH 2YRZA 3QDJE 4KKNA 5JOPD 5KS9B 1B0GA 1JZ2A 2VUYA 1HQRA 1XGUA 1YEGL 4MXWL 3JWDC 2VJXA 4MAUH 2WBJB 4NC0B 5GGQH 5HHPB 1ZHBA 4WFGE 1X5IA 2AV1B 4HUUA 4P59H 1YMMD 2B20A 2EICA 2QQLL 3ROOB 3PNWA 1CLOL 5F8QC 1IVLA 4K71B 2OR8A 2B1HL 1XEDA 4Q9BA 4EI5A 4RNRB 1RURL 3VFWA 4X6EA 4R97C 3QNXA 1GJIA 1OD7A 3O41A 1UADC 3HI5L 4X9BA 4NQEA 4I3RH 4F57H 3C5ZA 5JO5B 3EOTH 3KS0J 1BFVH 2CLZA 3KLSA 1F42A 1AI1H 3UZQA 3SKOB 1PAMA 4TRPH 3JWDH 2L4OA 3E8UH 3OX8A 4PRDB 4JG0H 2NZ9D 3HRZB 1ZLVH 2C3HA 1EO8L 3DIFA 4GBXA 3FT3A 1MHPH 5FGSA 1VFAB 1C5CH 3CDGA 4X6DB 4N9GB 5DEZA 5IHBA 1ZTXL 1Q9WA 1P9MC 2AQ3A 2X4QA 3BO8B 1MIML 3DURA 3QUYC 3REVB 3BUTA 3S5LB 5IB2B 5DA0B 1O7VA 4JO3L 4BA8A 4U1GB 5F89B 2XOTA 5B21A 1QSVA 5K9JL 4MDJB 2Y1VA 4FTVA 3BDXA 2DQJL 3O3AB 3U0TA 3RBSA 2BNRB 4QHUB 2DBLL 3RDTA 2NR6C 1IM3B 5DR5L 1T20B 32C2B 2FGZA 4P99A 3PWPB 1FFNA 3KJ6H 3G04A 1KIRB 1JF1B 2BFVL 1UJ3B 1B0RB 2DQDH 2NXZD 4G9FA 5KBNC 1OPGH