1IGYA

Structure of immunoglobulin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
213
Chain Sequence
KCAHTVSKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1 INTACT ANTIBODY MAB61.1.3
publication title Crystallographic structure of an intact IgG1 monoclonal antibody.
pubmed doi rcsb
molecule tags Immunoglobulin
total genus 28
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyA01
2R69H 4WI6A 4FQ1H 5CP3A 5A3IC 5C7XL 5GGSY 3MXWL 4S0TD 3W0WE 1H15A 3KPNA 4M5YL 4MDJB 5CKAA 2EE9A 5D93C 5DUMH 3FAXA 5JORB 2JCCB 4LARL 1D5MA 4I2XB 3D18B 4UAOC 4P5TD 3NABH 1JTTA 1V7ML 5J3HC 4H25A 3GMQA 3WLBB 3GJEA 4NUJA 1ES0B 4KPHL 1MAJA 4HIIB 3HNSL 5IHUL 5FUCE 1NEZB 4ORZC 4N0UA 5E56A 2NMSA 2EE3A 1HQ4A 1KBGH 3TIEB 1CIDA 3ZKQD 4OLVH 1Q94B 4OCSL 1CDBA 1BZ9A 4PS4H 4U49A 3VFTA 1GGIL 1JRHI 4O2CB 4LHUA 4X6DE 3VXUA 2DJ4A 3IETB 3SBWA 1CDHA 5CCKL 2UZXB 4X7TB 5C0GB 3T1FB 1VDGA 4PGBB 3BHBA 4TSCH 4XVJH 4LL9A 5IVOA 4KWUA 2BNQE 3MPCA 2YD4A 2VN7A 4OZFG 1MRCL 1XF4B 5DMJB 3FO0H 3C60C 4OCXL 3O4LB 3RVVD 3UJJL 4CVXA 1VFAB 3B83A 2HYMA 4ALAL 1QEWB 1MCLA 3JWDH 3GSOB 5TE4L 1NL0H 5C2BL 4OV5A 5DURD 4KUCD 3U9UB 1A7NH 5GZOD 4ZS6D 3REVA 1OVZA 3UCRA 1F8TH 1UWXK 3PXJA 4U2YA 1QRND 1R5VB 4QRSA 3RVXD 3TWCH 1I9EA 3EO1B 1AY1H 2HT3C 3GO1H 1GH7A 3MGTA 1SM3L 3B6SA 4NUGH 4ORGA 1I7RB 3S3JA 4AH2B 1K8IB 4LPWA 2VDMH 3ECBA 3V6OC 4JFYA 1UM5L 5IB2A 4GMSL 2AV7A 1FVCB 1MQKH 1FH5H 1CQKA 2FGWL 5D2LF 4Z7VE 5CZXC 2VDKH 1IC1A 1KJMA 4FFWD 2CKBA 1AKJD 1NUFA 2P44B 4XPAH 3CFDA 4M1GH 4APQB 4U1SA 2A9ML 4HMCA 1A7OH 1OLLA 1ZA6A 4JFHE 1IC4H 1J05B 4D0DA 2V7HA 1J0YA 1QG3A 3HE6B 5J6GB 4QWWC 1QNZL 4MA8H 2X4RA 4FXKB 4PG2C 5F70A 4XPBH 3ARED 3F7YB 1FZOA 5J1AA 4LQFH 5IVXE 1N0XL 3ARBA 2D3VA 1HIMH 1UH4A 3GK8H 5CSZA 3ULUH 3FQWA 2DIBA 3LQAL 2G9HA 4XVTH 5SWSB 3PP3K 3SDYH 3O2DA 2QKIB 5C0CB 3P2TA 1RZKC 3EHBC 3MZTA 3K74B 3SEPA 1BQLH 1OCWH 2I5YL 3DMMB 4YEEA 3EFDH 5A2FA 4DVRL 2YSSA 4HZAA 4KZDH 3RP1A 1IGYB 2V5TA 3IJYB 2AEQL 2YD2A 1KXVC 5C7XH 3DXAE 3LQMA 2V2TB 1L7IL 3L7FB 4M5YH 3C09B 5IVZB 1MLBA 3OR6B 4P5TA 3L3JA 1O5DT 5HYSG 4LARH 4CMHB 3V4UH 4GRLC 5JUEL 1XR9A 2VXTH 1MIEL 4MNGB 3RL1B 5ID0B 5CGTA 4N0CD 4I3SH 4PJFF 4KPHH 3HNSH 5IHUH 3ZE0F 4LPXA 3S37X 3MRKB 5D7JB 2VDQH 4PJIB 2O61B 1Q9LA 1LEIB 1GGIH 4EUPA 4J1UB 3HAEG 4NQEB 5C09E 2A74A 1MHPH 2CRZA 4R97C 3OR7B 1KOAA 1F3RB 2IH1A 4FQQB 4Y88A 4HKBB 4PB9H 4U1LB 1DEEB 1MRCH 5CIPB 5IBUB 1NFDF 1BM3H 5B38A 1GJIA 2HMID 1OAZH 1CVRA 3UJJH 5IESL 3MRMA 5CJBA 1JTOA 1UJ3B 1XZ0B 4XPTH 4ALAH 1WBXB 3OJ2C 5TE4H 2HFFB 2Z93A 5DMIL 3HE7C 1QRNA 4PV9B 3G5YA 2IMMA 1FV1A 1A0QL 2FRGP 4GRMA 1PVHA 4NKOB 1JZ8A 3PABB 2V5YA 5EORH 3B9DA 5E8DL 4Y1AD 1NCUA 4ISVB 4IRZL 1A7RL 1SM3H 3UPCA 3HMXA 4AM0A 4O9HL 3BH8A 3S6CA 3TBTA 2FWOB 2IAMC 2UVEA 3QNXB 5DMYA 4HBCL 4GW4B 1UM5H 3P40A 3PGDB 4GMSH 1ORSB 2BX5A 2DYPB 2VL4A 2W0KA 3MRBB 1S7TA 4MHHI 1AKJA 5C0AE 2AGJL 4Y19E 4G9DB 2XNAA 4JFED 1U3HC 4I5BA 1E6JL 5D1ZC 1MHEA 1C5CL 3SDAD 5ADPL 4MLIA 3E2HB 5DHVH 5IVXF 3QPXH 5DMGD 5CGYD 4PGCB 1QNZH 2B7DT 3AREA 4RAVA 3WIFA 1Q9KB 1XIWD 5F1KC 3VXRD 4L8CB 1F02I 4PY8I 2F8OA 3G08A 5KAQF 4N5EC 5C8JA 2YC1B 2EDWA 5EIIA 1AR2A 1EEYB 1FL5A 1N0XH 3DURB 4P2OC 4B41A 4HJJH 4F7PA 4OF0A 4P46C 3U9PL 4EIGB 4R7DB 4EI5C 1IILE 7FABL 3LQAH 3QQ3B 3K8MA 4ZG1A 3MLXL 1U3JA 2DQHL 5DTFB 4QRRE 5H94B 3MGOA 3FCTB 5DUBA 1MCPL 2RQ8A 1G1YA 43CAB 2I5YH 1ZHBB 2HJKA 2JJTA 3M8OH 5DJ2B 1KLUB 5K33A 2OQJA 5T5FL 4IOFD 4G6AD 1FE8L 4YHYC 1UH2A 4IOIB 2AEQH 4UT9H 3BO8B 2XN9B 1L7IH 3SE3C 3UTSD 1RIHL 2O5ZL 2EKSB 3BRFA 1N59A 4EDXB 3RAJL 4CN4A 3STBA 1MFCL 35C8L 1NAML 1NEUA 3TM6A 3P73B 1MIEH 5BS0D 1DVFB 1IL1B 1LK2B 1YEIL 4U6YB 1NH6A 4PJ7E 5J06A 4F15B 1LO4L 3THML 3VMNA 5HTSA 3DROA 4G6FD 5DXWA 4NN6B 3BVNA 3PV6B 3BEWB 5E5UB 2VDRL 5JQ6H 2MTPA 4HXBH 4D2NA 1I1AB 3VXSB 3GJFK 4MAYD 4P2QD 4JG0L 5L2KB 2GKIA 3QIWC 4YR6A 3W82A 1AHWB 1QPPA 3T0BA 1UEYA 5TQ0L 5F72S 3MOBH 5IESH 2X4UA 3NFPB 2J5LC 3BZFB 4JDZA 4JDVA 5E0QA 5FA3B 5T1MA 3ELAT 5DMIH 1QSEB 1L0XA 4Y1AA 1A0QH 5BCAA 1CL7I 4ELKA 5E8DH 3WN5C 4XI5C 3BP5B 5TFSL 4O9HH 4XMLL 4X6FA 4A2LA 1IBGL 4N8VA 3TN0B 3OG4B 5F71A 4M93C 3WJLA 2R2EA 4M7JL 4X6CE 3CH1A 3FRPA 5F9JA 4JFEA 3EOTL 3WUWB 1T20B 4L4JA 3TJHC 3S97C 4KUZH 1K2DA 3RGVB 5HHMD 2VDNH 4PRBB 3SDAA 3DO7B 4MNQB 3TCLB 3U2SA 3MBEB 4JKWA 1E6JH 2UY7A 1C5CH 4UT6H 4M6OH 1XIWA 2WK2A 2YXMA 3VXRA 4OZHA 4NBYB 4Q97A 4Y4HB 1QA9A 4KI5D 4HCRH 5EOCL 3CFCL 5DWUL 3MRIB 4OCNC 3JTSB 3HZYA 3WHXA 2BOCA 3H0TA 3T0WA 4CMMB 4JHAL 1B0GB 2QEJA 4CVUA 3QCVL 3U9PH 7FABH 3NCYP 4HGMA 3MLXH 2DQHH 1I7UB 1XCTB 2DTMH 1UXWA 5ACLA 1G1CA 5KW9H 1MCPH 3OWEA 4I0PC 4IMLA 1ODAA 3V52L 4XTRD 3NH7L 4D0BB 3S34L 3TVMB 1MCBA 4IRJB 4UILL 1FE8H 3UTSA 3CJJA 5E00B 1Z0NA 3TPUA 1INDL 1A2YA 4D8PA 3ET9F 1M1SA 4OM1L 5J6HA 4KC3B 1S9XA 2O5ZH 2HRPL 3D25B 3BPNC 3RAJH 3IFOB 3SDCB 1JGUH 3G04A 5INCA 4PJ7F 4U6XB 1MFCH 1VB9A 1NAMH 3U7AA 5J13B 5BS0A 4UB0L 5I8EA 4KDTA 4WW2B 3QUXC 4I77L 1R3JB 3C6SB 1ITBB 1YEIH 1FNGB 4TVPL 1FVDA 1TZHA 3BISA 3A6CL 3OKDB 3MROA 1LO4H 4JREB 3U30C 2X1QA 2X40A 1F6AA 4MA7L 3RIAF 4UNTA 3GI8L 1NC2B 5EO9B 3QCUL 4X7EC 4CVWA 1RIUL 5EO0A 2VDRH 1QO3B 4WWKC 3F58L 3IDMA 3TNNB 4TUOB 1U8KB 4I4WA 4NZUL 4MAYA 4P2QA 1QHPA 3MFFB 1RJCA 5C70A 2DD8L 4ZQKA 4JG0H 4HEME 1AJ7L 4OIBA 1A1OA 4BQ8A 1IC7L 1AO7D 2F5AH 4LVHB 5KSAB 5TQ0H 3DTXB 4XNMB 3JVGC 5ESAB 4PJGF 4PRPB 5ISZE 1INQB 4QOKE 4MQ7B 5D7LE 1NLDH 4L4VD 3VFNB 2NXZC 3W9EB 4JE4B 1S78D 1QFHA 3TBWB 5CHNB 3JBG7 2B1HH 3ZTNL 3BXNB 3WS6C 5TFSH 1OOAA 4ZPTB 4KTDH 4JZOA 3F7QA 5DI8A 4JQXA 2D31B 4PREA 3V6FA 1A7BA 4UDTA 1AXTL 2X4TA 1IBGH 3SKJL 1YY9D 4XP5L 4X6CF 3CZFB 4R9HA 4MXQC 3DIFA 3RUGE 3HC0B 5EN2B 5SX4H 5EPMB 2Q87A 3HB3C 1J0KA 3KPLB 1G9MC 3FQTB 2WBJB 4M7JH 2UWEE 4HFUH 3T77B 1SVCP 2H8PA 1XF3A 2Z31B 3EOTH 5EBLA 1ACZA 3VFOB 1NCDH 5ITBL 4HIJA 1NCNA 3VMOA 3LKOA 1G7PB 5T3ZL 5E70A 3L1OL 3MLTA 3X11B 1GC1C 5K9OB 4QRPE 2GCYA 5JNYA 3FJTA 1AFVL 5ADOL 3VI4E 5F7WC 3SOBH 3NIDE 5D72H 3CFCH 5EOCH 5GPRA 2ATKA 2ZG3A 1RD6A 4K55A 5DJCA 1G9NL 1KCVL 5DWUH 4AY0A 2C1OB 3MV7B 4QHKI 1HNFA 3QUMA 4LCIL 1T83C 4JEGB 4F8TA 4QXGH 4IRSC 3LKSB 1B4RA 1IMHC 5I66A 3CFJA 3QCVH 2FO4B 4DGVH 2OI9C 2N56A 5E6IC 1MPAH 2R15A 3K4ZA 4AENB 4KY1H 4CGTA 3EYUH 3FO2B 3KJ4C 4U1MA 5GRXG 1S7XB 5IQ9A 1WWAX 4QEGA 5DEFA 3V52H 4F7MA 2FBOJ 3NH7H 5GIRB 2PR4L 3S34H 4M6ML 4UILH 1KN2H 1IQWL 2JJWA 5DK2B 3AAZA 5IMKA 4O51A 1INDH 4P0DA 3QXDA 2FSEB 4CN6A 4K23L 2HRPH 1Z9LA 1S9KC 1EK3A 4PJDE 1ED3A 4LQ1A 5HJ3B 3B2VH 2K1MA 4UB0H 2B5IB 4KKNA 1BZ7B 1IGTB 1D5ZB 4I77H 2X4QB 3HI6L 1L0QA 3OV6A 4TVPH 4JRXD 2BNRE 4PJHB 4FQPA 2HKHL 1SJHB 3QQ9D 3GMPA 3CFEB 5DYOA 4MA7H 3RBGA 4Q9QH 3DI2B 4OF6A 3KPOB 3EGSB 1RIUH 2B20A 2X70B 3MNVA 1FZKB 1CFQB 1G84A 3M1BA 3F7PC 3T2OA 3L3DA 4NZUH 4NKDA 2N1KA 1AO7A 1DQDH 3H42H 4HIHB 4OQTA 1U8LB 3QWRD 2DD8H 1A6PA 2H32H 1MCFA 4TQEL 1IC7H 1NDGB 3HRZA 3DX7A 5F3BA 5ALBH 1FNHA 4OBSA 1K4DA 2EDJA 3PNWA 1R3KB 4L4VA 2XRAL 1JZ3A 1W2KT 5ICYB 3MV9B 4EOWL 1T03L 1KJ2H 5LGHH 5BZWA 4LKCB 3VJ6B 3C9NA 3A6OA 3D2UD 3FFCD 4PP2A 3N1GC 3RUGF 3ZTNH 1G7IB 1KB9J 1TJHL 3EBAA 2DKMA 2D7PA 1AXTH 2WWMC 4Z76A 2R1WB 2UWEF 1WBYB 1VFBA 5IBTH 4LDLB 3E6HB 3PL6D 4LPCA 1NAMB 1D9KD 5JHLH 1BJ1J 1UM6L 4JVPA 5TE6L 5F7EL 1RZFL 3L95A 3U0PB 1RUPH 1NCBH 5MI0C 4JM2C 5F9AC 1NCAH 4OCMC 3D3VD 3O6FD 4YUEL 5ITBH 2E9IA 4M61A 1KT2A 4QHMB 3VFGL 3S4SA 3NIDF 3L1OH 5AWNL 4RMVA 4YQXH 5D6CA 5KJRL 2X1XR 1BFSA 5FUOH 1OARH 3H3BC 1AFVH 3SDDB 1BVKB 5ADOH 2KH2B 3MJ7B 4PGDB 4M7ZB 4KKAD 4DEPB 4MA3B 3ARFC 1DLFL 4XP1L 4OCYL 1M71A 2GAZA 4JCLA 4MAUL 1G9NH 4LLYB 2W9EL 5CP7A 2P46B 5IMLA 5ICZA 3WNMA 2DLIA 4LCIH 3GRWA 4JPKL 3OX8A 2Z9TA 4U6TA 3D0LB 4JB9L 1T1YA 3DX8A 2OK0L 4FTVD 4Y2DC 4Y5XC 5EFIA 4DN4L 3VXTA 2EYSB 1JPGA 1VKXA 1EUUA 2RB8A 3U0TB 2X2YA 2W65A 1T1ZA 3OQ3B 5E95B 5FGBC 5DRWB 3CPLB 3I75A 1BWMA 2PR4H 4HEPG 2CXKA 4X6BB 5MEQB 4M6MH 5C0FA 2AXGA 2AEPH 3DNKA 3LZFL 3QO0B 2B4CC 4K23H 5D96C 3HCVB 3IFPB 4HGKC 4NZTL 1UWEL 4Y5YA 3V6ZB 1FNSH 4G42B 3CUPA 3RVVC 4HKZA 1MF2H 4JRXA 3GBNL 4YBQD 1FCGA 3DARA 3SGEI 3I84A 4F9PC 1DZBA 2Q86A 2EDRA 4RGNB 4BQ6A 1E4JA 1FFOB 4ZS6C 5LBSL 5C0DB 1RZGA 5GZOC 2NW3B 1F5WA 2NTSP 4F7EB 1K85A 1R3LB 5DK0A 4HT1L 5AZEH 3RVXC 4LKXB 1TPXC 1X6LA 2A0LD 4NRXB 4YDJA 3GHEH 5F6IC 5CEYB 1N8ZA 1A6VL 1LP9B 2XWTB 4ZNCD 3ZDYE 2C1PA 4L3ED 1NUDA 2XWJB 1E0OB 3K1KC 1FL3B 1XFPA 1YYML 4TQEH 1ZEAL 4ODWA 1OW0A 5EUOA 1YA5A 3IKCB 3WFHB 3PQYE 5KS9A 4D3CL 3O3AA 4C4KO 4EXPX 5IJKA 2JB6A 2DQUL 4OZFH 5D2NB 3MV8B 3IXAA 1FRGL 3L6FB 2BVOB 4LGSB 1ZTXL 2EDTA 3GMOB 1T03H 3D2UA 2CLZA 1VGKB 3FFCA 3T4AA 3V0VA 5ANME 2DQTL 1URLA 2CRYA 1MAML 1MFAL 3G5ZA 2QSVA 1TJHH 3OAYH 1FPTL 5T1DL 5FEBA 1T89A 1QFUL 2Y6SC 3PL6A 4R96A 5E4EC 3AREC 1D9KA 3MX0A 4KAQL 4YDVA 3PGFH 2X5PA 3W11C 4MX7B 2ESVD 2NXYB 3EFFB 3GI9L 2H45A 1GYAA 1UM6H 5L8JB 5TE6H 4QY8B 5F7EH 3D3VA 1GCFA 3O6FA 2DQFB 3DSNA 1AP2B 1B0RA 3QFJD 1FFQA 1PEWA 3K4AA 1CXHA 5E99H 3VFGH 5L7XH 1XF1A 1BBJB 3QHZL 5F89B 1DR9A 5AWNH 4HHAA 2R4RL 5KJRH 3BP4A 4F7TB 2W92A 3KLHC 4ONGL 3EDEA 5HGBB 3QRFM 2YS4A 2BC4B 3S7GA 1S3KL 4XP1H 1FYTB 4NRYA 1PD6A 1BWWA 2YEZA 2Z91B 5D1XB 1I85C 2H32B 3KS0H 4MAUH 5GGTH 5IW6A 2W9EH 4OD2A 2BMKB 1CF8L 1I3UA 3QIUD 4FTVA 4JPKH 5GRVK 4GAJL 1DQMH 4OLYH 2YPLD 4S1SL 5LCVL 4JB9H 2AQ3A 2OK0H 4EN3C 1S5HA 1X3DA 4RCAA 4NOBA 1I9RL 2AJXL 3DMMD 4PJCB 5TDNB 2BVPA 3TO4B 4ZUVA 2Y5TB 2KZ1B 4YZFE 1MNUL 1UYWL 3OKOB 4MDJA 5EZOH 3HZVA 3INUH 3QPQD 4GKSB 1EMTH 5F7UA 4MD0B 3MCKB 3QI9A 2DLGA 4QRUA 4ZFFB 3DUUB 3RVWC 3DVFA 1DN0B 1ES0A 2BOBB 3P4OB 3ILPA 4Z7WE 1UWEH 2HMIC 1T22B 1NMCB 3TIEA 1IQDA 1C08A 4GQPH 3U4EB 4P3WA 4Z7UE 3GBNH 3ULVH 2XXMB 3SJVD 1PEZA 32C2B 5LBSH 5C0GA 1JZ5A 4BFIA 5CEZL 3CC5A 4HXAH 3F7RA 3ZDYF 2J8UA 1WTGT 4HT1H 4G9FD 3C5SA 4LNRB 3E0GA 3SHSA 1QSFD 4EVNA 2BJMH 4L3EA 1RK1B 4U1IB 1MWAA 5FK9B 4B7LA 4M7LL 1A6VH 4U6VL 3G6DH 3B5GA 4LDOB 5B4MD 3PGCA 2GITB 4YO0B 4M7KL 1FAIL 5IT2H 3HAEH 4KKBC 2W59A 5F7FA 5FXCH 1ZEAH 1BD2D 2P24B 3WJLC 2DQUH 4HLJA 1OGAE 5I1AB 4ODHL 1ZTXH 3DVGA 1T21A 2HH0L 3I3EA 2ORBL 1L0YA 2AJVL 4L4TB 4Z78A 4P3DA 3I6LD 3S98A 1MCOL 1HNGA 1U58B 5E2WL 1M7DA 5IEKB 4R2GC 4Z77A 5KSUB 1XIWC 5J11C 2ZUQB 1FPTH 1U8JB 5T1DH 1BF8A 1OSPH 2ESVA 2CGRH 3C2SA 4KAQH 3KPRB 2DAVA 2AABL 3VFSB 1MCJA 2F8VA 3GI9H 2Y25A 3GNML 3QFJA 2BHZA 4K94C 1Q9OB 4OIAA 4P5MB 1J05A 2FJFB 5LXGL 1RUQL 4XCFL 3RVTD 1TZGL 3VXUE 1T3FB 1VCAA 4FXKA 1G0YR 3QHZH 3DV4B 4J3TA 4ZXBB 2DIAA 4LU5L 4R4FL 2IF7A 1AXSA 3F7YA 3P4NA 4ONGH 1H3TA 4HAGA 3LS4L 4CNIB 1CLOH 5ETUA 4NZDA 3ROLA 3ZE2E 3BAEH 3QIUA 4LLUB 4DUXA 3O9WB 3WV0A 1A6TB 2YPLA 2VLJB 2QKIA 3NZHL 1OAYH 3KPPB 3MLPA 4S1SH 2YRZA 4NCC1 5LCVH 3DMMA 3S36X 5AD0B 5J9PB 1E27A 2R8SL 1IGYA 1ND0A 4BSWB 1I9RH 3TFKD 3UZQA 1I1FA 4GS7C 4JVUA 1MNUH 2COQA 3X17A 4NYLB 3VRIB 2IADB 3QAZC 5IB3B 4ZSOB 4Z7WF 1MREL 2A6DB 3AVEA 4NM8L 4P23C 5DQ9B 4ZPVB 3ARVA 3VCLB 3DV6A 4NQCB 1MUJA 4U1HA 1TVBA 1QBAA 3WFEL 3BUTA 5DDHB 2VDOL 5FAAA 4C56B 5AG9A 3WFBL 1DE4B 1WTLA 1JWUA 2HTLD 3SJVA 2P5ED 5BOPA 4UTAL 2QLVB 4PJIA 1S7SB 5DRXB 4J1UA 3X12A 3PHQA 4G9FA 2D7QA 2M2DA 4X5WA 1GZPB 2IQAB 1QSFA 4PFEA 4XPHH 5D7KD 5L0QB 2I9LA 2NY1D 4C4KT 1EFXB 1HYSD 3BZEB 2HKFL 3VD3A 3HI5H 3QJFB 2C3XA 4U6VH 2W0LA 2G75A 5HHOE 4LCUB 4JQXC 1BD2A 1UJ3A 4M7KH 1MI5D 1TQCC 3V8CA 3IDJB 3H9SD 4X4YB 3ZT5A 2ED8A 4UT7L 3CFKB 1K3IA 3ZL4L 1IAKB 1QSED 4HV8B 3L3OB 1L7TL 2NY4B 3NIGE 2D7NA 4ODHH 2J88L 4JFPB 5E7FA 2FLRT 2HH0H 2LU3A 2NQCA 4GUPA 2ORBH 2AJVH 5JDSB 4HWBL 3SPVB 5D5MA 1MCOH 5CJOL 5E2WH 3GZKA 2Q8BL 2HG5B 5GRUL 3VFWB 3EYFA 1XT5A 3BWAA 3P11L 4K2UH 4KI5C 4BFBD 5HDBF 3UYPA 2RGSA 5GJSH 3TESA 4WFHD 2NY3B 2AABH 5C08D 2ID5A 3GNMH 1Q0YL 3KXFD 4DTGL 2YPKB 1CZ8L 5ABDE 1NSNL 4R90H 3ZKXB 3ZYOA 4JM4H 5HYSB 3SDXA 2EDYA 4GXVL 1AGFA 4ZO6A 5LXGH 1RUQH 1HHJB 4H8WL 4XCFH 1TZGH 4QXTA 3UPRA 2Y4SA 5DMKB 5EU3B 4BKLB 4L8CA 4XTRC 1WT5A 2P5WD 5FB8A 3DJ9A 3QG6A 2GT9B 3FO9B 4R4FH 4FZ8L 1XCQB 4NC1C 1MFDL 1QBMH 1NGZB 4D0CA 4O4YL 3NCJL 2VERN 5ESVB 1KIPA 1CE6A 3MRDA 1U93A 2JKXA 3H9YA 1AIFA 4R7DA 3B9KD 3HAEB 1JPTL 2DKUA 2OR9L 5DTFA 4HJ0C 4LEOA 3WD5L 1FC2D 2ICWJ 3NZHH 1I1RA 4GSDL 2EC9U 1QBLH 1QRNE 1VA9A 1I9IH 3BH9B 1PG7X 2AKRA 3MLVH 2BCKB 2E3VA 3RX5A 1BOGA 1A1MA 4HDIB 3BO8A 2ZSWA 1NFIB 5I1DB 2ZJSH 3OJVC 4DFHA 2MKWA 3EOBB 1CI5A 2CQVA 4KRMB 2PCPA 4FFZH 3KG5A 1EJOL 1MREH 4NM8H 4UQ3A 3GSRB 3SKMB 3TYFB 3P73A 2ATPB 2GUOB 2WQRA 1CLZL 1FZJA 1R24A 2PTVA 4NO3B 4NQSA 4HBQA 5MEOA 3O6ML 2IEPA 4XNQB 1MH5B 2P5EA 3IU3B 3WFBH 2E9BA 5FM5M 1CU4L 4RISL 4J7RA 1REIA 4UUJB 3VFRB 1BP3B 3VXQA 2DL9A 4XNUL 3C6LD 4GG8A 1E4XI 2EYRB 3OL2A 2NY6B 3RWFA 4HGWB 1YEJL 5I75B 2VXUL 2VKWA 4QTHB 1DQLL 2ZOLA 4LCWE 3BKCL 5TDPB 2BVEA 1DL7H 4DK6A 1KN4L 4X7SH 3MUY1 2HKFH 2PXYC 3U82B 2DBJA 3LEXA 1MI5A 3MRPA 1FGNL 3K4DA 3BPOC 1XF2A 3H9SA 1FJ1B 2R29L 3NIGF 4O58L 2APFA 4WHDA 1HCVA 3IDNA 3UDWA 1T1WA 5E94A 1QSEA 1AGCA 3EYVA 4HUWB 1WZ1H 1X44A 4YBLB 3ZL4H 3QEUA 4X4ZA 3NCFB 1U3ZA 2J88H 1M05B 4OSUL 2NX5B 2QQKH 4HWBH 3C8KA 1I8MB 1BFOB 4XAKD 5F1SA 3O41A 2XQYG 1TTFA 2VQTA 4R8WL 3FT4B 5CJOH 3FB6A 4KTYA 2Q8BH 3ZHKA 2B0SL 2V9QA 3K46A 4JY5L 3QXAB 3P11H 3FT2A 3QO1B 4PJXA 3FMGL 5IG7B 4WHTA 5C08A 1G7MA 3KXFA 1JYNA 4LVOC 2PUQT 3KNBA 4OKVB 5IW1B 3M45A 2Z31D 5ID1A 1Q0YH 4DTGH 5I15H 1TNMA 4PRBA 2JK5B 4H20L 3NMEA 1JUFA 3DO7A 5DC9B 2PN5A 3I3DA 1AGBB 1HXYB 2VLLB 2X05A 4H8WH 2P5WA 3QEQB 3KR3L 3L3IA 5CILL 2ZP0T 1A6ZA 4JJ5A 2L4OA 4FZ8H 4NNYA 4K7FA 3JTSA 4F37K 1NJ9A 5B8CA 4KUCF 2OTWA 4O4YH 5F88B 3UTZA 4JKMA 3NCJH 2WUCH 4CMMA 4F57L 3B9KA 4QKXB 3UP1A 3G6JB 1MCEA 4K71C 1XH3A 1RJZA 2HT2D 1JGEB 1JPTH 4LCYA 2OR9H 1M7IA 4OLXH 4Y5VC 5B39B 1CICD 1BIIB 4X0KA 5HHQB 2ZG1A 3MLZH 2AW2A 2YD8A 3JWOL 1J8KA 4X9GA 3QQ9C 1FL6B 4CADB 1P84K 4GFTB 1Z6JT 4BJLA 3WHE0 5FYJL 4OZIB 1QVOB 4OLEA 1NBVL 3D48R 3GIZH 3EJZC 3IFOA 4S11A 5A43C 4OCWH 1EJOH 3L5IA 2EE6A 5IHZA 4CRPA 4NN5C 4XWOC 3WDIA 3L5JA 5T3XL 2G60L 4WW2A 2P43B 4FXGA 1CLZH 5J1TC 1R3JA 3VWKC 3O6MH 5SWZB 1UEMA 1VFMA 5IJVB 1SJEB 2R2CA 4D9QD 5CEXB 1MLCA 1NBZA 2GFBB 1KPRA 4CL7A 3R0MA 2EXYD 3BZ4A 5C71A 3C6LA 5FKPB 5IJKC 1G9ML 2VAAA 2YKLL 5FF6B 4YK4B 2FR4B 4WI3A 3VG9C 5DHVA 5ITFA 3TNNA 4D94A 4HJGB 5E2VH 2VXUH 3WIHL 5J12B 3VXRE 2FD6L 5FDWB 1AI1L 3MFFA 4C59B 1KN4H 1RULL 4ETQA 2IPTL 1WV7T 2IQ9L 1E4KA 1MJ7L 4RAUB 2CLVB 3RWGA 4UINL 3JV4B 1TTUA 4HWEL 4KRPC 4O58H 5ESAA 5M94B 3PL6C 1BEYL 1D9KC 4TSAH 1I7ZB 4JY6B 3N0PB 4IDJL 1I7TB 4CVZB 2G5BA 4L8DB 4P9HC 4QHUA 4X4XB 5KZCB 1X4YA 3W39A 1J1OL 2GEEA 2OCFD 1X7QA 4Q9BA 3WDJA 5LAXA 1CXKA 1LEGA 5JOPD 3EYSL 1T04B 2Z35B 3MO1A 3UTSE 1CFNB 5JOFB 3B5TA 3ZTJG 3CZFA 4R8WH 4HIEB 3CSPA 4JY5H 4KKAC 3NCYS 5K9JL 3Q6GL 3CVIH 4JPIB 3FMGH 4JQVC 2Z31A 2FIRT 1E28A 1P4IL 4K8RL 4ONHB 3ZSSA 4AK1A 4P59H 4NKIL 4GW5B 4YWGH 2C26A 3MLRL 4HFWA 4NQDB 4PY7A 2V2XB 4OKDA 3ZYIA 2YD5A 3GMMB 4H20H 3X11A 1BVLB 4X99B 2H26B 1VERA 5D1QB 3UTQA 1YNLH 4NRZA 3QH3B 4RQQA 5B3JF 3O3BA 3O3EA 5ENWB 1ZLUK 5HDQH 3UJIH 3NIFE 1P7QB 5CILH 4P2QE 2VB5A 3UXFA 3AM8A 2DLTA 4LSPH 5EC2B 3MREA 4X6EA 4U31A 1U8PB 3ARSA 3LKSA 5A1AA 4F57H 1L6XA 2VSDA 2FO4A 4FFYL 1OSZB 4NZRL 4Z5RB 4BSVB 1CICA 1EZVX 5F7YC 1J10A 1QFWI 2QHLA 1S7XA 2R0LL 2CDFB 1A7QL 3HUJA 3FB7A 3D39E 1S7WB 2A6KA 3JWOH 3T4YB 4YHKL 5GGSB 5HI5D 4GRWH 5KVMC 1A3LL 1UVQB 3IYLW 1DLHB 2CIIA 2E6QA 5DJ0A 3IJHB 4PRIB 4G8GD 5E5MA 5FYJH 5EBMB 4MJ6A 3MUHL 4WU7A 4WTXA 4E9LA 2VLKB 1OD9A 5D7SL 1Z2KA 2YN3A 1Y6KR 4LCCA 4RGOH 5E8PB 2BSTA 4NWTL 3RVUC 4GAFB 2NY0B 5T3XH 4AL8L 1D5ZA 4YNYA 3MR9A 3STLB 3QXTA 4F2MB 5GS0C 4IIQA 5FM8A 4QHLA 5E8NA 4LIQH 4YHNA 3X13B 1SJHA 4RNRA 5HHME 1U8IA 4G80B 2WP3O 3MLYH 4OZHF 1QTYT 4M8QA 2Y07L 4JAMA 3EW3B 1G9MH 4LASH 4PJBB 1HSAA 4XZUA 1A22B 1T5WB 3TT1L 2WSKA 4JRYD 5CBAA 3GIVB 5L88L 3MNWA 4KI5E 2FD6H 3VRLF 4HCRA 4LPYA 2YUVA 1AI1H 2OLDA 3L9RA 1BOYA 1CWVA 3RWIB 1A14H 3HRPA 2MQ0A 1FQ9C 1MY5A 2IPTH 4J4PD 5DFTA 2IQ9H 3IFLH 1T0NB 3K8KA 4BK4A 1L9MA 2NZ9D 1IKFL 2Z92B 4XP6L 4HWEH 3IT8D 1BEYH 3ARGD 2ZZUT 3MV8D 5F7DA 1B4JH 4G5ZL 2X7LB 2HA1A 1YEHL 5F1OB 2IH3A 1MHHA 5DLMH 5KG9A 2DQCL 4N90D 3UBXI 3MA9L 4KK5D 1AR1D 1J1OH 4HIXL 4HS6B 2MHAA 4WFEE 1JCKA 1NLBL 4NC1E 4MNHB 3HE6C 5TH2A 2X10A 4Z0XA 3EYSH 2PYEE 2K7PA 1MRDH 2R1WA 1BFTA 2DI7A 4RDQG 4HW6A 3OZ9L 3ZT6A 1OTTC 3EOAB 1KTDB 2AS5M 4AYFA 4XCCH 3RI5K 4PTUB 1XGQB 3DI3B 3U36B 4PGEB 4JFFD 3Q6GH 2ZUSA 2C5DC 1IAOB 1IGFH 1UKQA 2B4CL 4KJQC 4U6HB 1P4IH 4K8RH 4XPGL 1E4WH 3QIUC 3RNKB 3X14B 3GSUB 3MLRH 4TVPD 2GJ6E 4NO5A 4N9GA 1WFOA 5FGCB 2YZ8A 5DVLA 1SYVB 2R1YB 3DMMC 5IQ7L 2F54B 5BZDB 3QWOA 1KFAH 4PGDA 3RZCD 1OLZA 3RU8L 1OPGH 1F90L 2WWKT 3C5ZD 5BVJA 2VKXA 4MJ5B 5DS8B 4QTIL 1N0LA 1AO7E 2XZZA 3C09C 4XBEH 3FRUB 1L6ZA 4CMHC 3IXTB 5D1XD 4LSQL 5C0RL 3ESUF 1WWBX 4NSKA 5FHBL 4GXUN 4NZRH 4WI4A 4RSVA 2LAAA 4LF3B 1P5UA 2HN7B 3CLEL 1KNOB 1FIEA 2AJYL 3S35L 4UV7L 5D7JC 4YHKH 4G8GA 1YC7A 3GSWB 1D7FA 2A2QT 4X6BA 5HPMA 2BSSB 1K4CB 1INEL 1FO0H 1ACYL 3Q6FB 3KPMB 3VFUA 3GMNA 1EUTA 1PYWA 4KQ4L 4GG6A 1RMFH 3IFPA 3V6ZA 2XOTA 4XGZA 3H9ZA 4PLNC 3LKPB 4JFHD 4TTDD 4AL8H 4ELMF 3TNMB 3RWEB 25C8L 1QSVA 2XWBB 2JTDA 4YGVA 3RTQB 3BN9C 2WIIA 4K9EC 5DK3A 5JPMB 3GM8A 1UJ3C 4X80H 4C83A 2Y9RT 1QOKA 2BRRL 4KI5F 4OZ4B 1IM3B 4JFQA 1G7HB 2Y07H 1F6FB 4JRYA 3QQNA 3F12B 4U4BA 5C6PB 1S9VB 2V2WA 1RUML 3HLAA 3TCXA 1X5GA 1J1XH 3DSFL 4E41E 1OAUL 2WBWB 4XMPH 4J4PA 4JZJB 3WXWH 1YDPA 1OF2B 4F58H 1QFWM 5IK3B 3B9VA 2A83A 4JJHA 2YN5A 3UEZA 5L2JA 2ED9A 4JFOA 1EO5A 4WO4D 4P2RB 1IKFH 3ARGA 4Z6AT 1NEZG 3MV8A 2D4DA 5K9QG 1MCQA 4ODUA 3EYOA 3CSYB 3CZJA 1BGXL 1A4JA 4PJ5E 4YFDB 3U4AA 4F3FB 2FYYB 4X8JA 1IGJA 1YEHH 2DQCH 3CX2A 4X9FA 2C3VB 3UO1H 4ODSL 4XHJC 3VG0L 3MRCB 3RKDD 5HYJB 5HXMA 3NPZB 1G7JB 3E2HC 3FO1A 5IFJA 5CD3B 4EIZC 1PAMA 4YHLL 1ONQB 4C57C 2VE6B 4JFFA 4MX7A 4X6DA 4X5XB 1CD0A 2YZ1A 5GRYA 1GIGL 4QGTA 5C09D 4V2CB 1E4XL 3G5VA 2B4CH 4JRXE 3DYPA 4NN7B 4XPGH 1JYXA 1KTLB 2P8PB 4DZ8A 1BBJA 4W4OA 3G5XB 3KPSD 1RJYA 4H26A 4R7NB 3VMPA 3RZCA 2DWEB 3TFKC 3MFGB 3V5DB 3QNZB 5HGBA 3C5ZA 1XGRB 1YMHB 2CLRA 2VN4A 4ZOBA 3RU8H 1DTUA 2FEDD 5F1IB 1F90H 3TZVD 1RQ5A 2DQIL 2QADD 5D1XA 4MWFB 2H32A 4Y16B 4N0RA 2BMKA 1TNNA 3ABZA 4FQXD 3O9WD 3P4LA 5EU5B 2VLRB 5EUOE 1TTGA 2VLJD 5KS9E 1BREA 3W2DL 2Y36L 1DVFC 3EKCA 1A6AA 5TDNA 1D6VH 1KJ2A 2GTZB 3P77A 1S9YB 2N7AA 2Y5TA 4XBGA 3WE6A 3P0VL 3CLEH 5AUMB 2AJYH 4F15C 4JDTL 3S35H 4UV7H 1AE6L 3FFCE 2LQRA 3U1SL 1R3IL 4Z7VA 1WLHA 4G7VL 3FHQA 4MMXC 4FQ2L 5C0AD 3VXNA 5IMOB 1INEH 3BUYB 2JIXB 1ACYH 3FB8A 1N5YH 4OD1H 2BHYA 1ORQB 1F97A 2BOBA 3T8XA 1UCBL 3MYJB 4WI7A 3P9MA 2W60B 4Q6IB 5EUKB 3LDBB 2DDQL 4PTTB 4YPGB 1FIGH 3TH4T 4F9LC 5D2LB 3I02A 3HG1B 3HHRB 4RMUA 5AYQA 3FKUS 2P8LB 1RU9L 1NUNB 3EDKA 5GS1A 3D3VE 4QNPE 3ULUC 3WLWD 4PJ9B 5E7BA 1HINL 2BRRH 3PJSB 4LMQE 1Y18B 3G6AA 1HILA 4X5LA 3NFSH 3NPSB 3VFPA 4G8EB 3MUGA 1JYVA 1JP5A 5ESQB 1IFHL 3VH8B 3DSFH 2J6EA 1EFXD 3LIZL 4ZO9A 43C9B 2ICES 5DZNA 2N7BA 4JO4H 3TN0C 3O2WL 4WO4A 3CGTA 1MFBH 4X98B 3NCMA 3VXME 1KG0B 3TF7C 3ULSB 4DJMA 2H2SD 1CD8A 4KU1A 3BDBA 5D70L 4ZUUB 3RPIA 4LFHG 1YNTA 4PJAA 5DRNB 5DFVC 1BGXH 4J3WA 4O2FB 3LB6D 4ODVL 1CXEA 3W0WB 1JBJA 5FKAA 4FN0A 5DJ8B 4M7LT 3RGVC 3O8XD 3P4MB 3SKOA 3PWJA 3PWPB 4A6YL 1LO5A 2QR0B 1KIQB 2AVGA 3JTTB 5H37G 3MBEC 1B9ZA 4ODSH 1ZE3C 3SGKA 3VG0H 5DD3H 3HR5B 4W6YB 5JIHA 4I2XE 5E6YA 4Y4HC 5IBUG 4UOJA 4YHLH 5TJWK 4MVBD 5DEZA 3KDMB 2Q6WA 4ZAKB 2EDFA 3VFSA 3FQRA 3OKNA 4W70A 5C09A 1QLRA 4HKXA 4ZUWA 1ZVHA 4PJFB 1GIGH 5JO5A 4I13B 4PR5B 4Q2ZB 4FMFA 3TA3D 4YAQA 1YN6B 1K5NB 3ULVD 3KPSA 1II4E 2YUZA 1KV3A 3S8WA 2BNQB 2VNCA 3IDIB 5F8RC 2H3NA 2V9RA 3DV4A 4N68A 1JGLL 2Y7QB 5MP6L 1A9BB 2WZPD 3TVMC 3TZVA 4IRJC 5EUOF 5BVPL 5KS9F 1V05A 2DQIH 1NFDB 2QHRH 4FQXA 2KBGA 4FZEL 3O9WA 5E8OA 4H1LA 2VLJA 3HNTL 3D69A 3MRRB 3O45B 2W0PA 3ZE1E 1LE9B 3KPTA 2NZIA 3OGCA 1QPXA 4OZFA 4WW2C 5IV2A 1CVSC 1DUYA 4FQJH 2Y36H 4JKPH 3CSBA 3NFNB 3OKKB 3QUKA 3DOSA 3SCMD 5I8CA 1RY7B 5IB4A 1KTKE 3P0VH 4JREC 2KDGA 4JDTH 1AE6H 2PW1B 4GBXD 3U1SH 5C0AA 4ZTOL 4FQCL 3K7UA 2P1YA 4G7VH 2NTFA 4PUBL 3V8OA 4CW1A 1RK0A 4FQ2H 2MCPH 2PF6A 4XRCA 5K93A 1L4IA 1HHKA 2HVKB 4EI6B 3RWHA 4Y8DC 1TCRA 4MMZC 2ESVE 4Y89A 1UCBH 2XQBH 4TNVF 2BP3A 3FQUA 3FOMB 1HYRC 3C8DA 1FDLL 1S7SA 4LVHC 5FYLL 3L5HA 5KSAC 5KANG 3QFJE 2VAJA 2NPLX 1XGUB 3SQBA 1RZ8A 3BMWA 4LSUL 1BMGA 3LQAC 2OTUB 1MSPA 3BPCB 1KCUH 4V1DD 1FFPA 1DN2A 2I24N 4TUJA 1JWMB 4LLDA 1G6VK 1CT8A 2A6IA 5FO8A 1EFXA 1SY6L 1IFHH 1P4BH 2XZCH 2XZAL 4MYWB 1OGTB 5J1SC 4AIZB 1KB5L 5FUZL 5GGTA 5IB5A 2BDNL 3W9DA 3R06A 5DHYB 2KZWA 1HK6A 3DGGA 2FJHA 5DRZB 4I48B 5SWSE 5D70H 4A2MA 1IKNA 5B3NA 1I3GL 1R5WB 3L3GA 2Z31C 3O8XA 3O11A 4ODVH 5C86A 3DXAB 4RMRA 5H2BA 1JZ4A 2EEBA 1YEGL 4MDIB 3VFWA 1FN4A 3N1MC 4H0HB 4BFEA 3D85B 1DQJB 5JMRA 2BNUB 2AEWA 2HT3D 1IEAB 1WZKA 1GVIA 5M7QA 4MNGE 4Z8FL 2RCSL 4X7FC 1CQYA 5T5NF 3J8F7 3MJ8A 4JPWL 3TA3A 3WFCL 2HT2C 3ZMRA 4XXDA 2J8UF 3N1PC 4PJIE 5T1LB 1CICC 4QHNB 4HUMB 2DWDA 1U8MA 4NQEE 5EU3A 1K6QL 1OAKL 2V6HA 2AXFB 1JGLH 1SBSH 4XB7A 2HJLB 5MP6H 3DVNB 4JO2H 3W5MA 5D8JH 4RFEB 1PG7W 3E1F1 3PIQB 4PJEB 1QFOA 3Q5YA 3SGJC 3ZE1F 3BN3B 5ISZD 5BVPH 3PDDA 1JGVL 2BSED 3HAEA 4QWWD 5D7LD 5LQBL 1BD2E 2FECL 2WBKA 2XTLA 3QEHA 1JNNL 2WAHA 3ARDB 3RI5F 2B5IC 5DJXB 2ADGA 3SCMA 3FQNB 3LPGA 5D6DA 1TJIL 4GBXA 1CFSB 3I6LE 4JFZL 3IF1A 1QLFB 3U7YL 3LOWA 4JFDD 1VACB 1MCRA 2ZSVB 4ZTOH 3T0VA 4PUBH 5GGUA 1DUZB 1JI2A 2E6JA 3TYFA 1FG2B 1X5AA 4Y19B 2D7OA 3LV3B 3AS0A 1XEDA 2YUXA 2AXHA 4PP1C 1I8KB 3ARYA 2DM3A 5SWZD 4Z95L 3QDJD 4QRPD 3WS3B 5FYLH 1VEOA 2OM5A 3OMZA 4V1DA 1MEXL 2FZ3A 3OXSA 1UKTA 4LSUH 3SDXE 1I8IB 5DSCB 4M1DL 5F6HJ 1N2RA 3NOIA 1P4LB 3F6LA 5F7HA 1JV5B 1SY6H 4FG6D 4P5KA 1EAJA 1HEZA 4AJ0A 3HPJB 4DUVA 2XZAH 4HZLB 1I1YA 3T0AA 1S7RA 1PFCA 5FUZH 3FQXB 1ZANH 4ZUTB 4L9LB 1TLKA 4HUWA 3GHBL 4OFPA 5DC0A 1EEZB 3EOYG 1DBJH 1D3CA 1W72H 5BW7C 2MPAH 3BT2H 1I3GH 2GSGB 3BWUC 1WF5A 2Q76A 1X6NA 2CRMA 1F2QA 3HE7D 2XN9E 1YEGH 4ZDHA 2GJZB 5IFAL 3EDJA 4NO0D 2NLJB 2Z8RA 1F3DJ 3QHFH 3SDDC 2BNRD 3GGWA 3DETD 1X5LA 4M7ZC 5DR5L 4LBEB 4PJ7B 4DEPC 1JWSB 4PJIF 3V6OA 3TBVA 3VDBA 4IHOB 5SX5K 4NQXA 2F58L 4V2BA 2X4NB 2IAMD 2P5EE 4PLJC 4K3HA 5CSGA 4BH8B 4JPWH 5C1MB 1DBAL 2JK5A 1EGJH 2HWZL 3AB0C 1T2QL 4X83A 4OGAC 5HGGS 1AGBA 4P57A 1F00I 4C58B 1ZHNA 2CR3A 4G8IB 5TGBB 4JO1H 1I9JH 4CU6A 5D7KE 5HI5C 3H9HB 2Y72A 1WZLA 3VXSE 5GSRA 5ISZA 1IVLA 5L2KE 1JE6A 5D7LA 3IS1X 4I18B 4NQVB 4Z7NE 1MI5E 4N8VG 1NANH 3NZ8A 1JGEA 3H9SE 5LQBH 5C0JA 3S37L 3ULUE 1Y0LA 1GGCL 1G6RL 4ZFZA 1QSEE 2AJUH 4PJGB 4N5ED 1JN6A 1A5FH 4Z7QE 5D5MF 3Q48A 4P2OD 3S5LB 3LSOA 1TJIH 4RGNC 4P46D 3GBLA 4JFDA 4EI5D 1H3XA 5BO1L 4JFZH 5DD1L 3U7YH 4F33B 5ERWB 1HN1A 3MNZB 4A6YB 1F42A 3RL2B 1B88A 2VLKD 4X6CB 2NYYC 2F74A 3BKJL 4J4PC 4LLQA 5SWZA 1S8DB 4PJXE 3QDJA 4POUB 1SJEA 4QRPA 4D9RE 2R0KL 4G3YL 5C08E 3DGCR 5DJZB 3ZYZA 5GISL 3SDXF 3B8YA 2JJUA 2NZ9C 5IKCA 3KXFE 4Z95H 4GRLA 5EZIL 4HK0A 5IEHA 1XGTA 3RY6A 1J5OL 3FONB 3PWUB 3U7WL 1MEXH 4NPYB 3IU4L 5D2NC 5I1KH 1DSFH 4KTEL 1J1PH 3SE4A 3V0WL 4HJGA 2CDEA 1A6UH 3MRHB 4M1DH 2P5WE 1KCSL 1BFVL 3KYNB 4K3EL 4OGXL 4XCEB 1TVHA 2W0FB 4ODBD 1LK3L 4NJAL 3HZKA 3VFMB 2FX9L 2XKSA 1Z5LA 5F3HB 1HSBB 1QD0A 4LSVL 4YDLB 2FDBP 2EXWD 5D71L 1CDGA 3GHBH 1P84J 5E08L 2NXYC 2OL3L 1BX2B 1K8DB 3QIWD 4NDMA 4PJ8B 1RPQA 1VADA 3R0NA 4LHJB 4PJDA 5GRJL 1JNHA 4RMQA 3WKMH 3FTGA 3HE7A 4E0RA 4KH2A 5I1GL 3SE9L 4YE4L 1I3RA 4NO0A 3MA7A 2BNRA 5IFAH 4MCZB 3BQUB 4OF5A 1IARB 1ZLWH 4P4KB 3PDOA 2UYLB 3LN4A 5DR5H 5HGHB 1UM4H 1VESA 1YY8A 2IAMA 2K3TA 4OV6F 3H3PL 3KWWB 4ONHA 3V5HA 4U7SA 1T7XA 5D1XC 3CFBA 1T4KA 3QUYB 1YEDA 2V2XA 1R3HB 2HWZH 3F8UB 1T2QH 5CBEA 4GLRI 4CU7A 4X99A 1OAXL 1PQZA 4HUUB 5F44A 1A3RH 1XF5A 2OYPA 5A2LH 2EH8L 3TO4C 4Z7NF 2FGZA 2EDNA 3TJHD 3WFDL 2E5EA 4PRDA 5D1ZA 4FQHB 3MODL 3E3QC 1K3ZA 3U6RB 2AV1B 1KB5B 4OBRA 4H88L 4YHOH 1ZXQA 3TIDA 1D5XB 3T0EB 4R4ND 1UFUA 5KVDL 4QOKB 3UYOD 4M48L 3ZDXE 4HC1H 4LSRL 4PRPE 2CDFA 1GGCH 1G6RH 3LH2L 1NMCC 4P2OA 1T7ZA 1N6QL 3LQZA 4P46A 4RAHA 4EI5A 1ZT7B 2A77L 2QSQA 4EJ1C 2OZ4L 1W0YT 1ZHKB 4XAKE 4OLWL 5BO1H 3OB0K 3RUGB 4PJXF 4JVWA 4QRTB 5C0IB 1PZ5B 2VLKA 5T33L 2H1PL 4I0PD 2UWEB 4ODXB 3BD4A 5KN5B 2ADFH 4GAYA 4GKZB 3BKJH 4WGWB 8FABA 4F2MA 3L3HA 3SE3A 1JZ7A 4IM8A 3U46A 4OF7A 5GISH 1ETZB 1G9NC 2OR7A 4WO4C 2O5YL 3L5XL 3RNQA 5I76B 3WNKA 1EZVY 4S1DC 5EZIH 2X4OB 1F3JB 1U2HA 3A6BL 3CD4A 4NO2A 4Y7MA 5JLZB 3WIIL 1B6DA 3U7WH 3IU4H 3C08L 4KTEH 1RIVL 1PKQB 3V0WH 3QFDB 1AGEB 3TP4A 4K7PL 1YQ2A 1KCSH 1YQVL 3Q1SH 3OPZL 4K3EH 5C9JB 4PV8A 3ILQD 2DF3A 1NGYA 4DK3A 1QLEL 1LK3H 3MBXL 4NJAH 3MV7E 1IC5L 2B8OT 1P2CB 4R4BB 2ZUQC 4Y4KD 4DWHA 1HHHA 4WWKD 2OP4L 4N0YL 1IEBB 1XR8B 4HH8A 1WWCA 4WUUB 1MJJB 1W0VB 3QIWA 4MJIB 4HWZA 1FVEA 1GHFH 5D71H 5C0EB 3UBXB 2C7UB 3NTCL 1ZSDB 4Q7DA 3VI3F 3HUJE 2ADIA 3QB7C 4R0LA 3DRTB 3BP6B 4MD4B 5IWLC 2GK2A 5FIEA 3QZWB 1GAFL 3UPAA 2FATL 4EBQL 1HHIA 5GRJH 3DBXB 1JF1B 5I1GH 2NW2A 3SE9H 4YE4H 4WW2F 4J8RA 4DUWA 4ZXBC 5FYJD 3QG7L 2M26A 2R2BA 4ODTL 2Q3AA 2JF1A 3BW9A 2Z4QB 2NXZD 4HPOL 1CG9A 1CGTA 2FEDC 3FOLB 4RGMB 2YR3A 5T3XD 3CCHA 3E8UL 3DX6A 1YN7A 2QQQA 5BJTB 3O9WC 5KSVB 4JN2B 1WWWX 1CLYL 4WV1B 2VH5L 4JHZA 5TE7L 2E9JA 3C5JB 1OAXH 3EO0A 3HB3D 5F96L 5A16B 5GS0H 2R2HB 1LD9A 1S7VA 5MEPA 3GSVB 2EH8H 1IAIL 1UB5B 1VFUA 1XGYH 3IB4A 2ZUTA 1JZ6A 1CGUA 2NR6D 3WFDH 1J7VR 2F5BH 5FO7A 5JPNB 1FFNA 4NNXA 4QXUL 1BPVA 1UKSA 3ZDXF 2LU4A 3IXTA 1SEBA 5ANMA 4HKJA 1UT9A 4H88H 1S5IH 1NBYB 1WICA 4IEFB 4M48H 3Q3GB 3SKNA 2A9NH 4L29A 4LSRH 2IAND 1O7VA 3LPWA 1MFEH 3OHXB 4NBXB 2HN7A 2EDLA 3LH2H 1BAFL 3PP4H 5JHDB 1N6QH 1AC6A 4IRSD 3TC9A 3AXLB 4YDIH 1MCDA 2A77H 2BSSA 5JDJA 1C5BL 3CFIC 5JOPE 2OZ4H 4U7MA 3GKZA 5E6ID 4OLWH 5EU6D 5C6TL 3S4SG 5D9SA 4I0PA 1SYSB 2CR6A 4PB0L 1GGBL 5T33H 4LEXL 1ZKAA 2H1PH 1OP9A 4QGYA 2XZQL 3LKPA 3VD7A 3TNMA 1MCKA 1FCCA 2FEEI 4N0FB 1J0ZA 5A2KH 1JHLL 4JZNA 3GJFB 2H6PA 5C0NC 1UWGH 4M62L 2O5YH 3L5XH 4K8RD 1IM3A 5H35B 3U83A 4DKEL 4OFYD 2I26N 1IKNC 3L5WB 3WIIH 2YBRB 1WFTA 3LB6C 2NY4C 2E7BA 3C08H 4RMWA 3KPQA 1YECL 3STZA 1RIVH 2B39A 2DI9A 1T1XB 4K7PH 4Y4FD 2KL6A 1IGIL 2Q7YA 3OPZH 1G7LA 3HC4L 1GGYA 5IK3A 1LWRA 1S7QA 3S96A 4Y4KA 3LKRA 4WWKA 3O2DL 4ETYA 1W8OA 3MBXH 2EIDA 2OS7A 3ES6B 4QF1A 1IC5H 1KULA 3HUJF 2Q8AL 3SQOL 4FQLL 4Z18A 3O81A 4N0YH 4RA3A 5BQ7B 1A9EA 3RDTB 3VRJB 1IEHA 2NY3C 3IJSB 1GL4B 4M02A 3NTCH 5HI3C 3F7VB 4QYOB 5TDOB 3O4OC 1GAFH 2FATH 4EBQH 3IGAB 1G7JA 1X5IA 4G8GE 4RWYH 2VUYA 1H0DB 4WW1A 1Z3GH 1WFNA 3N9GL 2J5LB 2W91A 4Z7UA 1FG9C 2OSLA 1U8OA 1JPFB 4EQ3A 4TTGA 2VR5A 3QG7H 4NGHL 4ODTH 1AH1A 4GG6E 3WS6A 4GW1A 5KVEL 2QQLL 3BDYL 4PPTA 4KQ3L 3LKNA 5H37H 5LWYL 1HHGB 3MCLL 5EOTB 5HGDB 4WVRA 3GBMH 1FYHB 2WWMD 2ERJB 4RGNE 4JR9H 1WZMA 1N7ML 5CIPH 4S1QL 1CLYH 4EXKA 3S3SA 5E1AB 2VH5H 5K9KA 3QUZB 5HY9A 4RWHA 3CDGB 2OBGA 5F96H 1J0IA 4M93B 4F7CA 3ZKMD 4JRYE 1F11A 5IHLB 3S88L 3V5DA 4JHWL 4K9EH 5HHOD 2NY2B 1A3QA 4JM2D 3TYGL 2E7LA 3AS1A 5T1KB 4GBXC 4BH7B 1IAIH 3SGDI 4ONOA 3TBYB 3GMRA 1ZVSA 3PWLA 3LN5B 3PQYB 4QXUH 4WI5A 3ROOB 1EIBA 1N4XL 3V4VL 2W9LA 2CIKB 1S7UB 3WJJC 1J11A 3DRQB 4UU9A 5HHPB 1KLFA 1IAMA 2IANA 4M3KB 4P3CL 2R0ZL 3KYMA 5D2NE 3MV8E 3ARFD 3HMXL 1YEKH 1T83A 2OL3B 3RX7A 4IRSA 4WTWA 4LSSL 1CGYA 4N90E 5C0BB 5GGRA 3P9LA 5E6IA 5EU6A 4OZGA 4Y2OA 2AJ3A 2HT4D 5IMOA 2NY6C 4Y2DD 3DUSB 3EJYC 3MRFB 5C6TH 3WNNA 5I75C 1F58L 3B8SA 2KKQA 4PB0H 1ZGLB 5EZLB 1GGBH 3MYJA 1MVUA 2FCBA 1H5BB 4KXZI 4LEXH 4M6NL 3HTLX 4IS6B 2XZQH 1MHCB 4JFFE 4YLQT 1CYGA 4S2SB 3QJHA 1JHLH 2R0WL 5HVHB 3F5WB 5F1NB 1OTSC 1OL0A 3BYTA 4PG9B 4IMKC 3IAGC 4TVPE 4OFYA 4M62H 4L8BA 1KYOK 2WUBL 3OJDB 1LMKA 7CGTA 3VE0B 4PRHD 4YBLC 5GRVL 2C3HA 4DKEH 4NHUB 1WVZA 4G8EA 5EBWA 1XAUA 4Y4FA 3OKEA 3QUXB 1Q72L 4Q9CA 1A7PL 2C3GA 1IGIH 4P49A 3VXPB 4XPFL 5J57B 3HC4H 4OGYH 3GMLB 1KJVB 1FYTE 1R0AL 3OAZK 1NGXA 1JGDA 3O2DH 4LSTL 4M8VA 4TRPL 3SO3C 2EH7L 2BVQA 3SQOH 1HQRB 4H5SA 2VIRA 5DRNA 3FB5B 2XG4A 5I19L 4HK3N 3U0WL 4S10A 5DT1L 2G2RA 4KVNH 4BZ1L 4KJYA 1QKZH 2DKSA 2YK1L 4J12A 1K9TA 1KIQA 5DJAB 4Y8AA 3M17A 4GG6F 3E3QE 1FO0A 5ACZA 2I9TA 3BEVA 1F45A 4HG4K 2ICEB 4HQQL 4MZ2A 5GXBB 3CSGA 4Z7WB 1U91A 2HLAA 3BP7B 2VR4A 5I8OH 5JW4M 5DQJB 5IBLD 3QDGD 5KVEH 4PJFA 2MKLC 4HX1B 1ZOXA 4KQ3H 4Q2ZA 3MCLH 2ZKHL 5AAMA 1YN6A 4LCWD 1K5NA 2Y6SD 2ADJA 1U8QA 1Q1JL 1WFUA 2ARJQ 5T1LD 4L3CB 2IFFH 3W11D 5HHOA 5GRZA 4WNQB 5KVGL 2NY7L 4YHIB 4JM2A 1H8NA 5LGJA 5EU7C 4MCYA 3FAWA 5DGRA 4XAWL 3WL9B 4XP4H 4G6ML 5JQHC 2FX7H 4KGLA 2FB4L 1NFDA 4MHHG 1CGWA 2V7NB 1CFTA 2SEBA 4WCYH 3O6LH 3V4VH 3L7EA 3CDFA 5HGAA 1W0WB 2J3SA 3KLHD 3ARFA 1JJUA 3MXWH 2R0ZH 4P3CH 4HMDA 1IZJA 1F4WL 4PJAE 2Z0BA 5D7IA 5DEGA 5GQBA 4Z9KB 1H15B 3KPNB 5ECJE 3RY6C 1V7MH 4Y2DA 4Y5XA 3MUZ1 5E8EB 1T0MA 2OXHA 5GGVL 4P99A 1HH9A 4X6DF 4YDKL 4EN3D 3SE4C 4HK3J 1WK0A 5MENB 1WEJL 4O2EA 5J12C 4H25B 3GMQB 4EI6A 4NUJB 5FGBA 4FG6C 1JK8A 5HHXL 4OCSH 1HOCB 1JMXA 4N0UB 5MERA 1HQ4B 4Q0XL 5FA4A 4L5FL 5CCKH 2AJSL 2R0WH 3AMLA 5JW4R 3VFTB 3VXUB 4NWUL 4JPVL 4PRHA 3RVWD 4L8SB 4NFBA 2WUBH 2RHEA 1EA9C 3MRJA 3OAUL 3BHBB 2CUIA 3KPSE 4OCXH 2BK8A 4P2CG 1VFOA 2HVJA 3JV6A 4KK6C 4F9PA 4QHKJ 1QQDA 1FGVL 5FHAL 2P7TA 4AIZA 1Q72H 1A7PH 4N8PA 4J23A 5C2BH 4CVXB 1AXIB 1SBBA 5A2IH 3OKLA 4GH7B 1OP3H 2FL5A 4XH2B 4OV5B 4I48A 1HCFX 4TRPH 3REVB 3DETC 2VLJE 2EH7H 5JW4Q 1RZIA 1EAPA 4QRSB 4XX1G 4H0IA 3B6SB 4I3RL 4JO3L 3U0WH 4Z7VF 2YA0A 5EULV 4HUXA 4LLMA 1WCBA 4KKBD 4R3SA 3ECBB 4BZ1H 4MXVE 2X4PA 4JFYB 5IB2B 5D1QC 2FGWH 2NNAA 1WAAE 2AV7B 5I18L 1Z9OA 2XFXA 3I6GB 1ZA3A 4OD3L 2BNUA 4HQQH 4NQCE 3QDGA 2A9MH 1LO2L 1KJMB 2FLBT 4C56E 2KUTA 2AK1L 5J7CC 4HF5L 4R2GD 4HS8L 2VISA 4LCWA 4U1SB 3RY5A 1ZA6B 2PTTA 4LP4A 4D0DB 2V7HB 3EJJX 2YUWA 1Q8MA 4WDIB 2GK0A 3H7BA 4M3JA 2X4RB 5KVGH 3MMEA 2NY7H 4UQ2A 4UTBL 5I71B 1FZOB 4AT6A 5J1AB 4RRPA 1CLCA 4RIRA 4AEFA 2C4XA 4PJEA 1GSMA 4XAWH 3ARBB 2WQ8A 5DVNA 3NVQA 2HRLA 2MJWA 3UYRL 1F6LL 4PJAF 4ZYKA 4DVRH 4XB8A 1C5DA 1YUHA 2NY0C 2YD3A 5DJXA 5DJ6A 3WBDA 3R4DA 2YSSB 1I85A 1FORL 1F4WH 2AQ1A 4P4RA 1FNFA 3DO3A 2IBGA 4JKKA 3OXRA 5JUEH 2PYFA 3MLWL 1MLBB 1QR1A 4P5TB 3L3JB 4EN3A 2DMKA 1HDMA 4TNWK 5GGVH 4YDKH 3QT2A 3WXVL 4H8WC 1XR9B 3ZHDA 3QIBD 2A6JA 1FSKC 1WEJH 4W6XB 1BIHA 5HHXH 2EC9T 1I8KA 4OTXL 5DZLA 1HI6A 4Q0XH 1TQBC 4P23D 1Q9LB 5B39G 1IM9B 4OAWA 3V7AG 4EUPB 2KQMA 2CO6B 2EXWC 3ULVE 4NWUH 5CWSA 4QT5B 4ZO7A 2A74B 5DSCA 4PD4J 4EDWL 4TVSa 3D5OF 1DQQA 2IH1B 1JV5A 4R0LC 4XWGL 5F9WC 4DKFL 3GSXA 4XCYA 1FGVH 4NQTA 3NACL 4LSDA 1MOEA 3MRMB 3X3FL 1CDIA 5DURB 3MCG1 1P7KA 3D39D 2JELL 1QRNB 3G5YB 4IRZH 1JHTB 1A7RH 2XV6B 4PRAA 4GRMB 4RFNB 2EYTA 5IVNA 5F6IB 2QSCL 1U95A 4I3RH 4JO3H 4AM0B 4HBCH 3BH8B 4PJ8D 1G9EA 1WBZA 2WINA 3TBTB 2J2ZA 1I4FA 2GY7B 4GAGL 2AGJH 5I18H 2NLJA 4OD3H 3I6KA 1P6AB 1S7TB 1LE5A 2HJFA 1AKJB 1LO2H 3RA7L 2D4FA 2YMXL 2VXSL 2XNAB 1Q9WA 4LHQB 5ADPH 4HF5H 3LRGA 3S36L 4HS8H 1EDQA 4R4NC 1RHFA 3QUYD 2LU7A 4I5BB 3V5KA 1MHEB 5FYLD 4V1DE 3DX9A 5E4EB 4G43A 3AREB 3WIFB 1DANU 4U7KA 3DUHA 2GTWB 1HWGB 4OQTL 5HYFA 4UTBH 3G08B 3VFVA 5C8JB 5EIIB 1QFPA 5FV1L 1FL5B 4F7PB 4FFVD 5I16A 3ARWA 4KRNA 5I2IA 4HULB 3UYRH 2FO1A 3GSQA 3MGOB 4IDLA 5T5FH 5DJYA 4WFED 15C8L 1TJGL 3VWJB 1G7QA 2HJKB 2PYED 2AK4D 2OQJB 3RWCA 1FORH 1RIHH 35C8H 2JJSA 2NX5E 5AAWA 5GJTL 4HJ0D 4CDHA 2ITDA 3MLWH 1FZMA 1N59B 2XPGA 3QIBA 4DGIL 1AQDA 2AJZA 1NGWA 3WXVH 3THMH 3IRPX 3ILQC 1FNEA 4JZJC 1WUNT 1M6OA 2GJ6D 5FGRA 3ULVF 5IOPA 5DJZA 2FBJL 3V6OE 4OTXH 3DROB 4P23A 4U33A 4Y4KC 4U1NA 1NGPL 1FP5A 2DIJA 3BVNB 2HAZA 4UIMA 5CD5D 5GS3A 3CH8A 3MZGB 3JWNC 4FXLA 3MRHA 4FMKA 4EDWH 4G7YL 3PWNA 3GB7A 4BUHA 2P8MA 4DN3L 5CEZE 5FYKL 3MUJA 5K59E 4KKCD 2XKNA 3JWOC 4XWGH 1TVDA 3HS0A 5E9DB 5C07D 5BV7L 4YR6B 5ILTL 3GRWL 5EU4A 1AGDA 3D39A 4LLVA 3X3FH 3G9AB 5GGQL 2Y1VA 3C8HA 4JDVB 2E27L 5T1MB 4JANA 1EEUA 2JELH 4Y1AB 2ARJA 1NAKL 2P48B 4MJID 3V7AE 3WEXA 4XMLH 4ELKB 2PXYD 3QDMD 1ROWA 3UJTL 3BPLC 5EU7E 5GHWL 2QSCH 1LHZA 4NN7C 1P9MC 1F3DH 4X6FB 4KHXL 4N8VB 4JFDE 1KLGA 2QJDA 3KLAA 4N1CA 4M5ZL 5DD0L 1JRHL 4E5XA 1N5AA 5I1LA 4DZBA 2R2EB 2DQEL 4BK5A 2MNUA 2H9GA 2ZNXA 1CXFA 1GZQA 2NR6C 1UXSA 2E7LC 3I9GL 3EO9L 3CH1B 5AYUL 5F9JB 2IG2L 4I8DA 3KWWA 4JFEB 1UACL 5SWZE 3RA7H 4Y16C 3QDJE 2VXSH 3QUYA 1K2DB 2EIZA 1D6EA 1CD1A 2R1XB 4WI8A 3SDAB 4UOW1 3U2SB 4E41D 4HUUA 3VXRB 4OZHB 1EBPA 4L1HA 1QA9B 2VZVA 4OQTH 2J8OA 5DJDA 4JHAH 1I8LA 1CTOA 1SY6A 1KCLA 3HZYB 3WHXB 5FO9A 4XNZB 2BOCB 4ZOEA 3L3KA 4DQOL 3U6RA 3FFDA 1EXUB 5F97E 3AU1B 2UV3A 4PJ5D 5CJ5A 3PHOA 5KSBA 3PWVA 1YPZA 3JXAA 1UXWB 2VQ1A 4Q6IC 3O3DA 3LDBC 2PYEA 2AK4A 1W72A 4IMLB 1UZ8A 3P0YL 15C8H 1TJGH 4OM1H 5IR1B 4K8RC 2VABA 4PJ9C 1A2YB 4D8PB 4HPYL 5J6HB 1S9XB 1PZ5A 3NPSC 2OJEB 3G04B 4KJPC 5INCB 1HH6A 2FHBA 4DGIH 4OUOA 4Y4FC 5BS0B 3RZWA 5DA4A 3ZLQC 3A6CH 2GJ6A 5I8EB 4MS8D 3JZ7A 4GKZA 1WISA 2DN7A 4G6FB 1TZHB 1KIRA 3GI8H 4KDVA 3QCUH 3QBTB 2D2OA 1F6AB 3OKMA 3OGOE 5IF0A 3EJZD 4YHPA 1EGJA 5I1CL 3F58H 2X4SA 3AS2A 1U92A 3S35X 5K59F 5EO0B 4XWOD 1KCRL 5I9QB 4HS3A 3OF6D 3IDMB 2ZOKA 2FJGB 3O0RL 2XTJD 3VWKD 1AJ7H 3BDXA 4I4WB 4MAYB 3K81A 4P2QB 1MCCA 5C07A 4DN3H 5FYKH 4ERSL 1OB1A 2VC2L 5JTWA 1AD9A 4ZQKB 3MSPA 1A1OB 1JFQL 3FZUC 5BV7H 1CN4A 5ILTH 2ICWA 1U8NA 2AI0L 4ZFOL 3QNYA 1KJ3L 1UQSB 4PYHA 1XGPA 5SWQA 1W0VA 4MJIA 4GKNA 2PXYA 4ZAKC 3QDMA 2PO6D 1ZVYA 1KACB 1PLGL 4GXUM 2QTEA 5I73B 2J1KA 3DPBA 2GSIA 4KGJA 3UJTH 3SKJH 4XP5H 4DAGL 5GHWH 4KRPD 2BY3A 4JZOB 4LRIA 4PREB 4UDTB 3OTTA 2VZOA 4PRIE 3ZKMC 3G9VA 1L9NA 1SVZA 1TQCB 5JW3L 1UB6A 1JRHH 4YIQA 3DIFB 1P6FA 4P9ML 2VLKE 1DQTA 2RFXA 3I9GH 3VI4F 5AYUH 1CDYA 2IG2H 5T3ZH 5EBLB 2NY5L 2C4FU 3MOAL 1PSKL 3RKPA 4ELMB 1A6WL 1UJTA 4HIJB 4E41A 1CGXA 1OT1A 3LKOB 3GEWB 3MLTB 5I0DA 3VGDA 2R39A 2GCYB 1QBBA 3D0VA 5JNYB 1KCVH 3GSVA 5EO1A 2I07A 2R9HC 5LKNA 1YMMB 5E4IA 3VXMD 2ATKB 3P3YA 4NT6A 3LRSA 2HT4C 1KPVA 2OXGA 3QUMB 4PJ5A 3Q5TA 1QUNA 2CUHA 4OF3A 5I66B 3CFJB 5I8KL 3SY0B 2D0GA 1OWRM 3LN9A 3QDHA 4U1MB 2VMFA 5IQ9B 4PJDF 1IQWH 5DEFB 4F7MB 4OUUA 1BLNB 1LVEA 5BRZB 1NDMA 2IALA 3AAZB 4Y5VA 4O51B 4XBPA 3QXDB 1ZS8A 1SYSA 1J18A 4WJ5A 2DLFL 4TULL 1MFNA 3HI6H 1ED3B 1V3JA 1GOFA 1ZLUH 2HKHH 4LVNB 3LMJL 2BXYA 4WIQA 3LKQA 3CVHA 4JGUA 4ZUSA 3GMPB 2P4AB 5DYOB 3OF6A 3RVUD 3QWRA 1LDPL 2D0FA 5FGCE 5I0ZA 3VWKA 3MNVB 4OJFL 5A2JH 3M1BB 3O4LD 3O0RH 5GS0D 3L3DB 2F54E 4NKDB 1DDHA 4LPTA 4I9WD 1AO7B 4ERSH 2VC2H 4WEMB 1BF2A 4FQIL 1JFQH 3EDFA 1RJLA 3HRZB 1EVTC 3DX7B 2XRAH 1A4KB 5IMMA 3BGAA 5IM7A 5JXAL 4EOWH 1K4DB 3REWA 2AI0H 4TNWF 3H2WA 1KJ3H 3HZMA 4UI2A 3PNWB 4GMTL 4L4VB 2PO6A 5IBLC 2BSRA 4HC1A 3AY4A 1G6RA 4XCNA 1UADC 1PLGH 3BIKA 2GYSA 3C9NB 3MRLA 2LVEA 3DWTA 4PP2B 4DAGH 5HYQA 2XA3A 3QQ4B 4ZS7L 5EZJA 1NMBL 2VOTA 4Z76B 5JW3H 3VH8G 1FLTX 1RZFH 1VFBB 1KEGL 4MXWL 4JLRA 5FOBA 1R6VA 4P9MH 4FP8L 2EEDA 5ALCL 4APQD 4YUEH 1ZWIA 3L95B 1N64L 3BGMA 4N9OB 3HE6D 5I6XB 5EB9A 4YJZL 3TPKA 4GO6B 1V3KA 2UUDH 3UZVB 1KENL 1BQHA 1PSKH 3MOAH 1A6WH 4M61B 1KT2B 1OTTD 3TBSA 3ARDC 4CDGC 3S4SB 1U8HA 2A73A 3TO2A 3KYOA 2C9AA 5D6CB 3U79A 2VJXA 1DLFH 4JQVA 4PBVC 4OCYH 4TOYL 3CXHK 3VXMA 3PDGA 4KJQD 3N1FC 4FS0A 1CL7L 1UZ6E 3I50L 1EHXA 4CJ0A 1M71B 2GAZB 3PUCA 5SWSD 3UTPE 4BELD 3GUTA 3RHWF 5CP7B 5BV7B 5IMLB 5ICZB 5C0CD 1Z9SA 2VITB 4DN4H 1S7UA 6FABL 3OX8B 5JA9A 1LO0L 1T1YB 5I8KH 4P2RE 5EFIB 3KS0J 3VXTB 1JPGB 1VKXB 4TYUA 4FQ1L 2W65B 5JORA 2JCCA 4I2XA 3D18A 4X7CC 3LZFH 3QRGL 3SO5A 3WLBA 5CINL 5C0FB 2AXGB 5F7KC 4GRWE 4HIIA 1EV2E 2CJUL 4NZTH 1NEZA 2EDHA 2AXJA 4OGZA 3DHJA 5FYJE 2DLFH 5MEND 1Q94A 4LFHD 2JE8A 4TULH 4Y5YB 1LDSA 4O2CA 5D7JD 3CUPB 1UENA 2A38A 4HKZB 5SX4I 3IETA 4JRXB 2WANA 4X7TA 3T1FA 3BRDA 5T3XE 4PS4L 2VL5B 4PGBA 5IB1B 4NQED 2Q86B 4XC3L 5HD8C 1RZGB 4LIQE 1XF4A 4TSCL 5DK0B 2XICA 2DLHA 1LDPH 3O4LA 1CDJA 4YDJB 1VFAA 5EWIL 1QEWA 1N8ZB 2YPVL 1YYMH 3GSOA 3BN9D 4KJWC 2C1PB 3U9UA 4D3CH 1BQSA 3JWDL 4FQIH 1R5VA 1NL0L 3QXWA 1FRGH 4ODWB 5HI4C 5EUOB 4D9LL 3EO1A 5KS9B 3O3AB 2JB6B 1I7RA 3VG9B 3IXAB 4AH2A 2VLRE 1K8IA 2DQTH 2VDPL 4GMTH 4IBLT 3TWCL 3GO1L 3RIFK 4NUGL 4HUNB 2IANE 1MAMH 3WNOA 3D2UB 2CLZB 3MJ6A 3JUYA 3FFCB 3T4AB 3V0VB 2GW5A 1MFAH 2VDML 1FVCA 1PDKA 1QFUH 4J3VA 2DYPD 1MCNA 3G5ZB 2OZ4A 5EU6E 4OZGE 1MQKL 1EVUA 4ZS7H 4R96B 4UZGA 1D9KB 4YDVB 5C3LD 4APQA 1KEGH 4RZCB 4MXWH 3ARQA 5KAQG 4FP8H 5C3TA 3WO3B 4DCQB 3HE6A 5J6GA 1KYOJ 5DVMA 1FAKT 4HWUA 1N64H 3O6FB 4XHJD 5D2LE 1JPST 4I18C 3TH2T 4WUKL 2CRIA 4MJ2A 2R4RH 1UZ6F 4L3CA 4HHAB 3BP4B 4LQFL 1S3KH 4TOYH 2X1OA 4JHBA 3UZEA 5SWSA 3GK8L 4RBPH 1CL7H 3I50H 1CF8H 5C0CA 4NRYB 2JJSC 4GAJH 2YEZB 3BGFB 4YZFF 5IW6B 4OD2B 3QIBC 4FTVB 6FABH 4KVCL 5J4MA 2AJXH 3IJYA 4ZFOB 3EFDL 2V2TA 3L7FA 1UYWH 4KZDL 2BVTA 2R56L 5IVZA 3OR6A 4GRWF 2BVPB 4DKDC 4ZUVB 2XN9D 2X9XA 3B4NA 5DA0B 4HG4J 3QRGH 4MNGA 3RL1A 3D1MC 3HZVB 5ID0A 1U41A 4Z7UF 2E9WA 5E8EA 3V4UL 3PWPE 5CINH 3QI9B 1QP1A 4QRUB 2CJUH 5MENA 2VXTL 1DVFD 4AG4L 1EO7A 3KVQA 4I3SL 3MRKA 4CUCA 5D7JA 2O61A 1HOCA 3ILPB 2XA8L 1LEIA 2KPNA 2FH6A 4NQEA 2VDQL 1IQDB 1C08B 5CEZH 4PJFE 3OR7A 4AEEA 4XC3H 3ZE0E 4FQQA 4H1LG 4L8SA 4HKBA 4U1LA 1IM9D 1DEEA 1MHPL 4YDLC 5CIPA 4BFIB 1RURL 3CC5B 1I1AD 3VXSD 2J8UB 5L2KD 4M7LH 3C5SB 4PB9L 1MCWW 1KSRA 1JNJA 4EVNB 1H8SA 4L3EB 1FAIH 1XZ0A 4PJ8C 3BIAX 4LNVA 1WBXA 5EWIH 2XQYK 1MWAB 2YPVH 1BM3L 1J8HB 2HFFA 1OAZL 4PV9A 4YHML 3PGCB 3ULUD 3RX8A 4XPTL 4KV5E 4NKOA 3PABA 1NFDE 4XH2A 4ISVA 4D9LH 3BQUC 5EORL 2DTSA 4G6JL 4P4KC 2VDPH 2D03L 2FWOA 3DVGB 1V8HA 3QNXA 2F53B 5FOJA 1T21B 4GW4A 4OZGF 3PGDA 4Z78B 1ORSA 3TN0D 3QUYC 2DBLL 4P3DB 1RUAL 2DYPA 5D7IE 4WU5B 1M7DB 3MRBA 4N8CL 4Z77B 5KVFL 4NC2B 3I6GA 4G9DA 4D9RD 2ESVB 5DFVD 3O3UN 1I3VA 3QDAA 1I8LC 3OSKA 3RGVD 1KTRL 2ITCB 4FFVC 3QFJB 4MNQD 3TJEL 3MBED 1NGQL 4PGCA 1ZT1B 1Q9KA 4J3OC 4WUKH 3T0EC 3ZE2F 3QPXL 4LU5H 4WDIA 4Y4HD 4YX2L 3B2UD 2W38A 4PRHE 2YC1A 1UGNA 1PX4A 5LG1A 4JKLA 3LS4H 1EEYA 4YHZL 2D7MA 3DURA 3K2MC 1AQKL 1AXSB 1QZ1A 4X9BA 3P4NB 4AIOA 3VGFA 3QQ3A 4WFGD 4PLKC 5ETUB 1EBAA 1OQXA 4HJJL 5F93C 1DEDA 5H94A 3ROLB 3FCTA 2VUOA 3QIUB 2MCG1 43CAA 1FNLA 1ZHBA 2YPLB 5DJ2A 1KLUA 1PJ9A 4KVCH 2R8SH 4WHYG 4IOIA 3TVMD 4IRJD 3M8OL 2XN9A 4LLWB 1E27B 4UIKL 2EKSA 1ND0B 2R56H 3VWJD 4EDXA 1I1FB 2AP2A 4UT9L 4WFFD 4HUVB 5CD5C 4IOSD 5L6YL 3SDCD 3SN6N 1P7HL 1X5FA 3ISWA 1WIOA 1DVFA 1IL1A 1LK2A 4U6YA 3WFEH 2VDOH 1OD7A 4WEUD 2RJMA 3DV6B 4AG4H 1MUJB 4KKCC 1OP5K 4U1HB 2RR3A 1TVBB 4UTAH 5DF0A 8CGTA 2XA8H 3PV6A 4FRWA 3BEWA 3H8NA 3QDGE 1PZUB 1TIUA 4ZNEA 1JWUB 3SJVB 1NC2D 1H3GA 4X7DC 5B22A 1IM9A 3LD8C 4OIIL 3X12B 4KKLC 1I1AA 3VXSA 4JN1L 1N6VA 3PHQB 4JM2F 4QT5A 5JQ6L 4G9FB 5L2KA 4HXBL 1BVZA 1RURH 4X5WB 4F9LA 1AHWA 1QSFB 3S5LG 4HSQA 2E8YA 2WW8A 2I9LB 4KV5F 3B3IB 3NFPA 5KSAD 3IDGB 2WLYA 3BZFA 5FA3A 5E9DD 3MOBL 2G75B 4PJEE 4YHMH 3AGVA 4UT7H 4LRIC 1BD2B 4PRPD 2X1PA 2DOCA 2EDQA 1L7TH 1SHMA 2PW2B 1JHTA 2RAMA 2X09A 3BP5A 4POYA 5D7IF 4G6JH 4RGMC 2D03H 2Y23A 1EJ6A 2EZ0D 3TN0A 2P49B 4W68A 3HN3A 3CLFL 4GUPB 4YBHA 3VGBA 5TF1L 1VGEL 3V9FA 5GRUH 2DBLH 5D5MB 1RUAH 4WV1C 3AS3A 4N8CH 5L9DL 2UZIL 3EYFB 4Q9RL 5KVFH 2ZUXA 3BWAB 1TFHA 3N85L 3WUWA 1T20A 2WBJD 5CKGA 1ZT4B 3RGVA 1N6UA 4M00A 2F8XC 1CZ8H 5MHSD 4MNQA 3TCLA 1NSNH 3MBEA 3J7HA 4KUZL 3MLSL 2VDNL 4GXVH 3TJEH 1NGQH 3GDBA 4Y4HA 3SDXB 2DM4A 4UT6L 3N50A 3QHTC 2L0DA 4M6OL 1AGFB 2CXGA 3MRIA 4YX2H 4QXTB 1MFDH 3UPRB 2WLZA 3UTOA 2GTWA 4HCRL 5FB8B 4YXKL 4YHZH 3DYMA 1KXTB 3QG6B 1B0GA 1AQKH 3MV7D 3Q5OA 4D0CB 1X9QA 4YC2C 2BXZA 1KIPB 1CE6B 1T66C 1I7UA 1O0VA 3MRDB 1XCTA 1U93B 2WWKO 5HHNB 3WD5H 1J0JA 1AIFB 4GSDH 4P48A 1HXMB 1H9VA 2DTML 5CZKA 4LEOB 4D0BA 5KW9L 4MS8C 3TVMA 4IRJA 3EIFA 5JMOC 1CE1L 2JJVA 5E00A 1ZHLB 3VDAA 1DCLA 2APXA 3VWJA 2AKRB 4UIKH 1BOGB 1A1MB 3D25A 4L3AA 3SDCA 5GGRY 4U6XA 2EDKA 2ZSWB 1OTUC 5L6YH 1TZIB 2QL1A 2PCPB 1JGUL 3C6SA 2XTJC 1FNGA 4UQ3B 3WUZA 3OKDA 4NQSB 1FZJB 1R24B 1ZK9A 3U4BL 1CU4H 4RISH 5MEOB 1X5ZA 2E7MA 2P5EB 1MRFL 1NC2A 2FNBA 5EO9A 1QSZA 2XT1B 4XNUH 4NFDA 1RFDL 1QO3A 1YEJH 3GSNL 1KELL 1U8KA 4TUOA 5KTEL 2ED7A 3VXQB 1DQLH 3LPFA 4OIIH 3BKCH 4GG8B 4MQTB 4JN1H 1P5VA 2HLFD 2PO6C 3RWFB 2GY5A 3RDTC 1ZLWK 2NY1B 3NCCB 3AY4C 4BQ9A 2MWCA 2ZOLB 4PJEF 1NFKA 4PP1D 4JGMA 5KSAA 3DTXA 1FGNH 4XNMA 1T2XA 5E9DA 2R29H 2YOCA 1A21A 3LEXB 4PRPA 5IIEB 2F5AL 1INQA 1MI5B 3MRPB 1XF2B 3H9SB 4MQ7A 3UTTB 3VFNA 3IDNB 3MV9D 3W9EA 1T1WB 5E94B 1AGCB 3EYVB 3TBWA 5CHNA 1CXLA 1NLDL 3UAJC 4ENED 1NC4B 3BXNA 4ZPTA 4OSUH 1JI1A 3I85A 3CNKA 3MGAA 3QEUB 4DOHE 2D31A 4PJGE 2F9BT 4NHCL 2B1HL 5JIPA 3CLFH 4KTDL 2B0SH 1VGEH 2O5XL 5TF1H 3C8KB 2ERJC 3HC0A 5EN2A 2M8XA 5EPMA 3O41B 4K7PX 1V5JA 5LGKA 3SGEH 3KPLA 2R23B 3QUZC 3FB6B 3FQTA 2WBJA 4KROB 5L9DH 3T77A 2UZIH 1Y6NR 4Q9RH 3FT2B 3N85H 2NY2C 3VFOA 2OJZL 4PJXB 4WHTB 4HFUL 5C08B 1G7PA 1G7MB 3RWDB 3KXFB 4LAJH 5K9OA 1NCDL 3KNBB 4BSJA 1FBIL 2MMXA 3MLSH 5ID1B 2R1XA 1NMAL 1JUFB 3QR2A 4TNVK 3KR3H 3UBXG 3SDDD 2VXVL 2P5WB 4ZO8A 1CBVL 1GOGA 4Q6YA 2C1OA 2W9DL 3MV7A 3QZWG 5J56B 5LJYH 3RIFF 3SOBL 3L3IB 5D72L 4YXKH 1A6ZB 4JJ5B 4NNYB 4PLJD 1IJ9A 1YMMD 4K7FB 1NJ9B 5B8CB 2OTWB 3UTZB 3VXOB 4O02L 3HI1B 4OGAD 4QXGL 4AENA 4XP9L 3B9KB 3FO2A 1YJDL 1EXUA 3AU1A 3MQIA 4KMTL 4DGVL 5FECB 1XH3B 4E42B 1RJZB 1MPAL 1CCZA 2BRQA 4KY1L 4LCYB 3EYUL 1M7IB 5GIRA 5E5RB 1H5BC 4X0KB 5DK2A 1CE1H 3SGJA 1CGSL 3MTRA 3HNVL 2FSEA 5HVHC 5FYJU 1KN2L 1NBVH 5IR1A 2YRLA 2ENSA 5SX5H 1GGTA 2V5MA 5DD6B 4XXCC