1IGYA

Structure of immunoglobulin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
213
structure length
213
Chain Sequence
KCAHTVSKSMSMSVGERVTLTCKASENVVTYVSWYQQKPEQSPKLLIYGASNRYTGVPDRFTGSGSATDFTLTISSVQAEDLADYHCGQGYSYPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG1 INTACT ANTIBODY MAB61.1.3
publication title Crystallographic structure of an intact IgG1 monoclonal antibody.
pubmed doi rcsb
total genus 28
structure length 213
sequence length 213
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1igyA01
3VWJC 4M61B 1R3HA 4OLYH 4ZOEA 5TH2B 4QYOB 1ACYL 1HOCB 1AGEB 4JPVH 2A6DB 4Y5XA 4G6ML 3NN8A 4FQIL 3NFSL 3VXPA 3EJYD 3V4PL 4F37K 3ARBC 3VFSA 4AYFA 3W0WA 4PV8B 2HRPH 3QRGH 4MA3A 5EIIB 3LEYH 5SX5H 3UC0H 1U3HA 1RZGB 3TT3H 3RQ3A 2VB5A 4HKZA 4P9HH 2DL2A 4J12A 4Y89A 1HHKB 3SHSA 1LEGA 4H26B 3GM0A 3W5MA 1T89C 4HWUA 3U4BH 3TO4C 5E8OB 2AJZB 1EFXA 5ANMA 4RMSA 3SDDA 2OZ4L 2ZNXA 3K0WA 3QNYA 2DBJA 2ZOKA 3QDJA 5IF0B 3D87B 1F3RB 2F8VA 5TJWK 4NQSB 2B5IB 2VXSL 3QXUA 4LF3B 1E4KA 4LFHG 4PJAA 4FS0A 4LDLB 2R0LH 3AAZA 1Q9OA 3U48A 5GRXG 2A83B 4HIHB 4UQ3B 1DL7L 2KZWA 4U1JA 5TDOB 4LEXL 1Z9OA 4R0LA 2BNQE 3UJIL 1CQKA 1GAFH 3RUGE 4XCCL 4OKVA 2C4FU 4RA3A 3MFFA 3Q5YA 1OAQH 1II4E 4XCYB 4RBPH 3OPZL 1B4JL 3S4SB 2W65A 2AQ1A 1ITBB 1XGQA 1P1ZB 3NIGE 3GSXA 1JL8A 2W38A 4C4KO 3ELAT 1J0ZA 2EDNA 2HN7A 3OKDA 4WI8A 5IB5A 2XKUA 3ECBB 5A2LH 3WNKA 2VABA 1R5WB 4GRWH 3IFPA 4IRZL 4MNGB 1MIML 2YPKB 1I4FA 3ARFB 2XKNA 4PB9L 3QDGA 2DS4A 4KQ4H 1K2DB 3ES6B 3CZJA 4UZGA 1FGNH 2JJTA 4XRCA 1WZ1L 4G42B 4LGRB 3WFDH 1ED3B 2CKBB 5BMFH 4Y4KB 4HWEL 1Z3GH 3QFJB 3WNLA 5FA4A 5FB8B 3K2MC 1PDKA 1TJGH 3UMTA 3P4OA 4PIRF 3BISA 2DL9A 4OGAD 4Q0XL 4LU5L 3ESVF 1SEBB 3QBTB 4PJ8C 3D39D 2AAVA 3L9RA 4MD0B 3QUKB 5EBLA 5SWZA 3VFMB 3UYRH 3NIDE 3GMQA 4QNPF 5A2IH 1NQBA 3MRJB 3BEWB 5C08E 4H0GA 1X5LA 3OKEB 1HXYB 3MUHL 2VSCA 3GMMA 3MX0A 4WO4C 5JO5B 4OI8A 2V7NB 1A6ZB 5HYJA 2HH0L 2XG5A 4YWGL 2I07A 2HWZH 5HHOE 4ZO8A 1CIUA 4GMSL 4KAQL 5GGSY 2Z93A 1LO0L 5ITFB 3NCYP 5BVPH 1WEJH 1TZIB 2YBRA 3WEXA 5EU7C 4Y1AE 3W39A 3RZWA 1X4YA 5EZJA 4PUBH 4WW2B 3F8UB 1KULA 1VPOH 1NCNA 5D71L 3TVMB 1IZJA 2LU7A 1BJ1J 3RWFA 1MAML 4Y19E 5E56A 2FBJL 2AK1H 3ARRA 3U9UA 1BEYH 4KKAC 4L8SA 4O2EB 4L4VD 2G9HA 3CFKB 2K3TA 2XFXA 5EU5B 4HIJA 4HEME 3QCVH 1FNFA 1L0YA 2E7LC 5DRZA 4V1DE 1X5IA 1B3JA 1BVLB 4ZAKC 4O4YH 2Y5EA 3FHAA 4JFFB 4NO5B 3RL1A 1OOAA 4CVUA 3G5ZB 4N8PA 4DAGL 1AI1H 4QHMB 4BK5A 5GGRA 3C5ZB 5KSBF 4PJHE 3X12B 3FCTB 3TT3L 4Q97A 2I9LB 4X4ZA 5KAQG 2DQDH 1GC1H 1KF9B 2L7UA 4P9HL 2K7PA 2I60H 5C0JB 4KKNA 2IAMA 4PRDA 3IRPX 3WE6A 1I8KB 1CU4L 3VCLB 1XR8A 3NZHH 2V9RA 1PGRB 4KUZL 1YYMH 4NKMA 3GEWB 5C0CA 3VFPA 1KLGA 3MJ6A 4NJ9H 4ZUVA 3GMPB 2R0LL 4YDJB 5HVWA 4J1UA 2DLGA 4NO2B 1G7MA 4GKNB 3I6LD 1WTLA 1SQ2N 2VAAB 2NYYC 5FCUH 3VFNA 3DO7A 1H15B 1CTNA 2BSED 5LGKA 3Q6FB 3IAGC 4H25B 1IAIM 4YJZL 2EZ0D 4PJIA 2GJZB 2BNRE 5KSUA 5J1TC 1ES0A 4MXWH 1HH9A 5IR1B 5C0DB 5FO8A 1RK1B 3GMRB 3QUYA 4PRIB 3CPLA 4XNQB 4Z7OF 4LSUH 2V5TA 1ADQA 1U93A 4JE4B 1WF5A 5EORH 4IIQC 5JW4Q 1KJVA 3PHQB 1JPFA 3U0TA 3RPIB 1GHFH 4NOFA 2AXGB 5E70A 5EC2A 4KQ4L 3CDFA 1FGNL 3ZO0A 3JV4B 3ARFD 5E7FA 3WFDL 5DMKB 5BMFL 1MAKA 4F7CB 3MA7B 3IDNA 3LH2H 5D7IB 2AXHA 5HDQL 4Y4KD 5DJCA 1U3YA 3PGCB 1TJGL 3QFJD 2PN5A 4IOFD 2J6EA 4FQJH 4OCSH 2HTLD 4JM2C 1YECL 3KPOB 4WFFD 3DXAA 3O9WC 5T1DL 4PY8J 3UYRL 4FQ1H 1RJLA 1VEMA 3LKSA 3I3EA 3CNKA 4Y2DC 5IESH 3OKMB 4GT7A 3UTTE 3UXFA 2OSLB 4M3JA 3BXNA 2FHFA 4H88H 4NHUB 1I1YB 1MRFH 2HWZL 5C0NC 2AJSH 1S78D 3TFKD 4IBLT 3CFCH 4JDZB 1YMHA 1KPUA 2WW8A 4MAUH 1FJ1B 3DVFA 4KKLD 5BVPL 5GS3A 1WEJL 3WFHA 3WMSA 4L9LB 4LSDA 1PYWB 2HT4D 4C83A 2CUHA 1DVFC 1J88A 4PUBL 2J5LC 3H7LA 3X3FH 2JB5L 1I1RA 3OKYA 1RZFH 4EUPB 1VPOL 2R2BA 4RNRA 2VAJA 1U8KA 1AFVH 1MREH 3MOBL 2R15A 4AEHH 1I7UA 3SGKA 1VA9A 2Z8SA 1D9KA 1F4HA 4PG9A 3TVMD 5AZEH 2BSTA 5JHLL 2AK1L 1C08B 3MREA 2LAAA 2VDQH 3EOYG 2CPCA 1KJ2A 4QRPE 3QCVL 1Z6JT 3DX7A 1FHGA 1A1OB 2F5BH 4OZGF 3DSFH 4WI6A 4X98B 3VRIB 4O4YL 3BWAA 4ZOAA 1XEDA 4F9LA 1M6OA 1A9BA 1EHNA 5J3HC 1EUUA 5HYEA 1AI1L 2FECL 4JFFD 5D6CB 1KB9K 2AKRB 1A6VL 4ODUB 1DBKH 1W0WB 4NM8L 1AJ7H 2DQDL 1GC1L 5DJYA 2I60L 5E7BA 3V0VB 3O6FC 2GK2A 3H6JA 2DBLH 4RMWA 1QFWM 4K3GA 5K9KB 4LNRB 3NZHL 1JZ8A 2Z8RA 1CDCA 1L6ZA 3GNMH 2D7OA 1YYML 4PJCE 3MRLB 3VG0H 3DRQB 3ZDYF 5HI4D 1CDYA 1NJ9B 5IVXA 4NJ9L 2E27H 1TVHA 2SEBA 4L4JA 3VFOA 2OQJB 2APBA 5CGYD 4WWKA 1F02I 3L7EA 1LO5B 1QSFD 1VHPA 5FGSA 4QXGH 5E2VH 4P48A 1A3QA 3MMEA 5CD3A 1QLFA 5FCUL 1NGPH 2ESVB 3CDGB 3ME0A 1KT2B 4KVCH 3M17A 4XBPB 3HUJE 1MRDH 3R8BB 3VFRB 3JXAA 3MLRL 4CW1A 4P9HC 4H0HB 4PJFA 3MUJA 3CX2A 3EDDA 4MXWL 4OCRH 3B2VH 3O2VL 3TYGH 4PLJD 1DBBH 5BZDB 2XNAA 5SWQB 2NX5A 2UY6A 4PJGE 1RJYB 3L3HB 1E4XH 4L5FH 2ED7A 5HVHB 4HUUB 5EORL 4G9FE 4HIIA 2ZUYA 1OCWH 1BQHA 1G0YR 4PRID 1DUZB 4U1MA 4L8CA 5F7EL 2Y6SD 2R29H 3PABB 3BIKA 4OT1L 4FFWD 1H0DA 4JFEE 3U79A 3V52H 1VGEH 1ZVYA 4UINH 5D7JA 3B4NA 4JZJB 2P5WE 4Z7UA 3P9LA 1S7RA 3PGDA 1UKTA 2FL5A 3MUGB 1DLFL 4ODBD 4P59H 3UTQB 1FL3A 3O41B 3HE7B 4JRXE 2NY1C 4BJLA 2FJFB 2OBGA 5CBAB 5I9QC 1FVCB 3OWEA 3LH2L 2DLEA 4YGAB 1EHLL 1ERNA 1XF3B 1S7WA 2NZ9D 3V5HB 5DUPH 4I4WB 1DQDH 4LK4A 3QXTA 5C0AB 3UO1H 4OCSL 3SO3B 2Z8VC 1ZE3C 1IGCH 1DQTA 2EIEA 4HF5H 1JRHH 1U8HB 4F7MA 4M6OH 1P7QA 2X4PA 3HPJA 3QHTC 3DROB 3BZEB 5GXBB 5E6IC 3I75A 1IAIL 3FQWA 2NY4B 1FLTX 5C71A 1FL6B 5CSBA 1D5XA 4H88L 3RKDD 4MNQB 2XQYK 1MRFL 2AJSL 5IB1A 2YD8A 3CFCL 4TYUA 3BD3A 2BVOB 1PEZA 1DQLH 4OFPA 1YPZE 4MAUL 4Z76A 4X5WB 3SJVE 1A7QH 4AQ1B 1BJMA 2E7HA 4MA1C 3X3FL 3QEUB 3LS4H 4LLWB 1VFBB 1RZFL 2R56H 5KTEH 1H8SA 2EDWA 35C8L 4LVHC 3QI9A 4NO3A 1MREL 5EUOA 1DFBH 1UCBH 3DI2B 4AEHL 4K3JL 5CJOL 3VXOB 1FFQA 4GUPA 4LHUA 1IKNC 5AZEL 4MQSB 3BMWA 1XF5B 1ZMYA 3VD5A 1XGPB 4NBYB 4LCCA 3ZKSD 5KVGH 2UZXB 1MH5B 4N0FB 1G1YA 3SQOH 1NFDF 3Q6GH 2F5BL 4XXCA 1U58A 3FONA 4KHXH 3DSFL 4QTIH 3C6SB 5HYSG 4KI5D 3BPLB 1ZLWH 3T0XA 1KN4H 4WHDA 5B4MC 4G6KL 2IPUG 2OR8A 4OQ1A 3RWDB 3TC9A 2F53B 3V6FB 3WUWG 5CGTA 1RUPH 3BUYA 2O5YH 4BSVB 4FXGA 1S7VA 1KXQE 3MLWH 2GK0B 1FNGA 1NGWB 1DBKL 4H1LA 1A2YB 5LCVH 3R1GL 1AJ7L 4P2OC 3IDGB 5CIPB 2ORBH 4R8WL 4XCFH 3QPQD 3QEHB 5EOTA 4JKPH 1IEAA 4LPYA 3DMMC 1QBAA 5I6XC 1NC4A 1SBBA 4I5BA 3SDCC 1FNEA 2E3VA 4P5MB 3VG0L 4XNUH 5CJ8A 1JPTL 5D5ME 3QPXL 1U8PA 2E27L 1T5WB 3MPCA 3VFGH 3GMNA 5DQ9B 4QXGL 5E2VL 2IADB 4Z0XA 5GSVB 1NEZA 1TPXC 3PG2A 4WDIA 4XCEB 4OBSA 2NW3A 3REWB 4WFGD 1NGPL 3T0EC 5DVNA 4ZSOB 2BZDA 4KVCL 4RMTA 5DRWB 1MRDL 3WS3B 15C8L 3C8KA 1ZGLB 2ESVD 2Y7QA 3LKRB 3CH1A 1JI2A 1GC1C 1CYGA 2XYCA 5DJ0A 2R1YB 1EA9C 4OCRL 4M43H 2R8SH 3TYGL 3QO0B 3TH2T 1DBBL 4KJQD 3SDYH 2WNGA 2HT2D 3VXTA 3KYMA 3G5YA 3TNNB 1E4XL 2DLFH 4L5FL 5DLML 3RNKA 5DMIL 2CDFA 1OCWL 3M45A 4UTAH 3BE1H 1RV6X 4Y16A 4HSQA 1N2RA 3RGVA 4GFTB 2R29L 4U05A 3V52L 5BOPA 1VGEL 4UINL 2PUQT 2F58H 4UI2A 4P59L 1IBGL 4YZFE 4TUOB 2DKSA 2YWZA 1BP3B 5ANME 1TQCB 3WFCH 4N1EA 4Q7DA 2PW2A 3QDJE 5H35B 5A43C 3HE7D 1H3XA 5F9JB 3TBVA 1ZVSB 2Q6WB 1BIIA 5DUPL 1DQDL 1A6PA 3E3QE 4NN7B 2G5RA 5DUBB 3UO1L 4F7EA 3BJLA 3VWKB 2EDLA 3VXSE 3QIBB 2DQGH 1ROWA 5C0AD 4BK4A 1HYSD 3WHE0 5E5MB 5AUMB 4HC1A 5F3HA 3HNSH 4UOJA 4GBXC 5B8CC 4PRAA 1HK6A 5DJ8A 2R4RH 4OFVA 3N9GL 2VLRA 2EYRB 1R24A 2VQ1A 4NT6A 3DV4A 3I3BA 1I1FB 4XZUB 2RAMA 2NY4D 1Y0LA 1RZIA 2YZ8A 4LEOB 4H5SA 2CDEA 1NAMB 1DQLL 5A2JH 2PXYC 2ADIA 4MNQD 2V5YA 4X6DF 3QR2A 1OP5H 1U42A 3MGOA 2VDKL 3G6AB 2X4UB 3ARGC 2WWMC 1NPUA 4LPVA 1OQOA 1CK0H 2VITA 2ID5A 2FH6A 3KDMA 4G3YH 4NRZA 4DQOH 4M8VA 3QDGE 5EFIB 3BJ91 5DJDB 2VDNH 2R56L 5KTEL 5HTSA 4ETQA 1UB5A 1RIUH 4WHCA 2IH3A 3FOLA 2UVEA 3MLUH 4U7KA 3DV6A 1J9CT 1UCBL 4JM2F 2ZNWA 3QEQE 3PXHA 3IGAA 3REVB 4YHIB 2FNBA 5ADPH 3NCJL 1WFUA 4PD4J 5KVGL 2C4XA 4Y4FA 4NQDE 5F9AC 1HDMB 1ZHBB 3T8XA 4JFQA 1UQSB 3V6OA 2KKQA 3Q6GL 4HAFA 4B5EA 4KHXL 1B0WA 1E28A 5SWZE 2J2ZA 4OLWH 3H9YA 5IQ9B 2Z4QB 5C2UB 4XAKE 3VRJB 4TVPH 3MLWL 3GBLA 5HYJE 2F53D 2QQKL 4C56A 2GAZB 3PDOB 5LCVL 5AAWA 5D7KE 3BP7B 3LS5L 4HK3N 4JHWL 4NYLA 4WNQB 3BGFB 4Q6IB 4HULB 1SM3H 3CVHL 3QDMB 1RIHH 4ZUWB 2ORBL 4XCFL 4JKPL 1ZHLA 3FFDB 1H9VA 1I7TA 3FRPA 4K7PY 5D7SH 2Y9RT 2EDDA 5IHZA 1S9KC 4XNUL 4PJ9A 5DJ2A 4GJTB 3VFGL 4WW1B 4X6FA 3DURA 4S1DD 1LE5A 5F93C 2E9BA 4ZTPH 2IMNA 2VISB 4QRSA 5MERB 3QXAA 3MJ9A 4UNTA 2GFBB 5D2NE 3PV6B 3RU8L 2BXZA 1U95B 4HHAB 1BX2A 1VADA 3MBEB 4Z95H 1GL4B 1X5JA 2OJEB 5H2BA 1IGIH 2AW2A 3I02A 3H0TB 1EERB 1F3JB 3QAZB 1GZQA 2GKIA 5FAAA 2VZ3A 5F1IB 1FZMB 3HMWH 3BE1L 3HC3H 4OZHF 1UXSA 1NCTA 1EMTH 3KS0H 4Y5VB 5GGTA 1L9MA 4J3SA 5E5UB 4YC2C 3DNKA 1CBVH 2F58L 3TYFA 1S5HB 1NCDH 5AEAA 4BA8A 3AGVA 3WFCL 3RWHB 3IDYB 2ZCLH 1HSBA 4QT5B 3FO1B 2FR4B 2JJSC 5CZXD 2R4SH 3MCKA 4ONGL 1J0JA 4FQHA 5C0CE 3T04D 3BH9B 3U36A 3INUL 5A1AA 4AH2A 2FDBP 1YNKH 3WLBA 4EVNB 2DQGL 4WEBL 1HH6A 1U8IA 4Z77A 3B3IB 3VWKD 3KPLB 4PJDF 1YNLH 3HNSL 1AQDA 3QIBD 1BD2A 1QFHA 3W11C 1CZ8H 2R4RL 3RX8A 2DRUA 4PYHA 3BP6A 1MHPH 3QQ3A 3CSYA 5MEPB 2ZCKH 2FWOA 4PJIE 3E6HA 2FO4B 3MRMB 1T21B 4CRPA 4ZPTB 4WUKH 3Q5TA 2GY7B 3IVKA 3I85A 4X8JB 2XWBA 1EJOH 1MCEA 3ARDC 3JZ7A 4Z5RA 4ZFOL 1HEZA 4UDTA 3FB8B 1U8JA 2F74B 2YRPA 5JW4R 4XP6H 1QO3B 3O6MH 4G3YL 4DQOL 3RL2A 1D5MA 1N5YL 4E5XB 3C5JA 1RIUL 2H32A 3MLUL 4LCUB 4OLEA 3CSBA 3ILQD 4WGVB 4XVUD 2E7MA 4P49A 5FIEA 4JFDA 5FFLA 4NKIH 1LE9B 1BPVA 2E6QA 5JHDA 2I25N 3RZCA 4UAOB 2FEDC 2XWJA 2GUOB 1NCAL 1DLHB 3WFZA 2QR0A 1CE1L 4W6YB 4HT1L 2C3GA 1GJIA 5IBUG 3AREA 3RIAF 3KLAA 5BQ7B 1U8MA 3NGBC 2VDLH 2UUDH 4OLWL 4XB8A 2NTFA 3LKQA 5HGBA 1JBJA 4X0KA 4P23C 3D0VB 4ZS7H 4HWBA 5C0EA 6CGTA 3GGWA 1DBMH 4HLJA 1AY1H 4JPIA 5I76B 2C3XA 1W8NA 5ESVB 3SGDI 4NFDA 4GW1A 4EZMA 3WNMA 1SM3L 1RIHL 1WIOA 4X4MA 4NO0A 4JQVA 3WLWD 1ZLUH 3VWJA 3QDMD 5IW6A 1IRAY 4JZOB 5D7SL 1TETH 1M7XA 1XGTB 3ZMRA 5I15H 4TULL 5ILTL 4YNYB 3T2NH 3ARBA 3G5VB 3R0MA 3C2SA 4DGIL 1EEZA 4NFBA 1W0VA 4Y1AB 1ORSA 2FX7H 1NGZA 4WI2A 1CFTB 5IG7B 5F96H 4PJEA 1BFOB 3N1GC 1JNHA 1HYRC 4ZTPL 4I18B 3VG9C 5JZ7D 3WUZA 5C1MB 2DQHH 5L0QC 2JCCA 1Y18A 4Y19B 4R90H 3EYVA 1T89A 3T2QA 3TO4A 3MRNB 2CGRH 4Z95L 3BQUA 1OWWA 3DTXB 5MEQA 5KS9B 2X4OA 3V6ZB 1HHHA 2NPLX 2VLKA 3MBED 5DK2B 4V1DB 4M03A 3EDEA 3HMWL 3HC3L 5IVOA 4AM0A 4PJ7A 4FZEH 5GGVY 1EMTL 2ZUQB 4KJYB 4X9HA 3NCMA 1T1YA 5DK3A 5SV3A 5IB3B 3F5WB 3L3OB 4MAYB 5ID0A 1CBVL 2C9AA 4RWHA 3MGTB 5J13C 1S9YA 1I3GL 2ZCLL 4M1GH 3FQNA 2WANA 2EICA 4I2XA 4MWFA 1IAKB 3S88H 2R4SL 4L3EA 4DTGH 3KPPB 3N1MC 1YEJH 1QHOA 3DLQR 4NIKB 4JFHE 1YNKL 4BZYA 3QULB 2X4RB 4QGTA 3TCLB 4P5KA 5IMMB 4JJ5B 3C6LC 4UU9B 1CZ8L 3VXRB 2GY5A 1F3DH 1MHPL 1G7IA 1JGDA 3TA3B 3O8XC 3QIWB 4I9WE 2F5AH 2W59A 4JZNA 5T5NG 3ZTJH 1PY9A 4F15C 5KVDH 1G7QB 4W4NA 4PJFE 4WUKL 2FB4H 5I71C 1I1AB 4J6RH 5SV4A 1EJOL 1KCSL 4JLRA 1MCBA 1NBZB 1K6QH 2NR6C 4DVRH 5FYJH 4FHBD 3QNZA 1A7NL 5F6HI 2XOTA 4P2RA 3DIFA 4XP6L 3O6ML 3L7FB 4PJ8A 5J06A 2HKHH 3F7VB 3VGHA 1OHQA 4Z7UE 1CN4A 4ZMAT 1ZWIA 2DJUA 3KLSA 4OZ4A 1WC7B 3STLB 4I3RH 3VD3A 2PYFA 4ZFZA 4WO4A 1IEBA 4P2QA 3S3PA 1U41A 4LOUC 4NKIL 4KK9D 2IQ9H 1R3KA 3EOBA 4XGZA 5IJVB 2HKFL 1NMCC 4OCXH 3H9SA 2XICA 5ENWA 2A6KA 5E9DA 4EN3B 5GQBA 4GG8A 1MJ7H 5JOPD 1Q72H 5D7IF 1GH7A 2VDLL 2HFTA 1ZLSH 4TUKL 1T5XA 3U9PH 3CCHA 1DBML 4JDVB 5HGHB 1V7MH 3P4LA 5ALCL 2HTKD 1OWRM 2HFEB 5D9SA 3CMGA 3UTTB 2P24A 2QADB 1JPSH 2RBLA 5T1LB 4HFWB 4HS3A 2YC1A 2DI7A 4UUJA 2A6IA 1TETL 4IJ3C 3VFWA 4CKVX 1TZGH 4MXVE 5I15L 2E7LA 3X17A 1R0AH 5I30H 1IAOA 4NWUL 4JRYB 4E42A 2OTPA 3GMLA 2X70A 5DSCA 4ZAKA 3C8DA 1CICC 2FX8H 5EUOE 3KJ4B 4U49A 3GSOA 3DARA 4HCRH 2DICA 5F96L 4LQ1A 4HJGB 2W0FB 2ED8A 4Y1AD 1YEDB 4ONOA 3FRUA 4KK8D 1DUYB 3EO1A 3ZDZF 5EZOH 3TNMA 3QQ9D 3STBA 3OAUH 3ARWA 3GSVA 4HK0B 3QJHA 4EI6B 3MV8B 2PR4H 4R90L 1CD1B 1TITA 1P69B 4PBXA 1MFBH 5GGUB 2MPAL 3EGSA 4Y19D 1JPGA 5C3LD 4L4TA 4CU8A 1ZTXH 4MCZB 2ERJC 3KPMB 3FL7A 2QSTA 4Z7WB 3NPSB 2X10A 3D69A 1KBGL 2YXFA 4POZC 1FFRA 4V1DD 1XH3A 2GTWA 4GRLB 3BPNC 1JHLH 1P7KB 3S96A 3MRIA 4HUWB 5A16B 2FEEL 4HIXL 1JWSB 4WUUA 4PJXB 4MAYD 4PRHB 1FGVH 3SCMC 1YEJL 5CP3A 2AJ3A 3C5SA 2E9IA 4ELMF 3HAEB 2OZ4A 4XH2A 1YY9C 1FZJA 5EPMA 5J12C 5B38A 4LSRH 5BV7B 5IMOA 1J1XH 3OKLA 1G7JB 3VXQA 3EFFA 4YFDB 4YHOH 3X3GH 4NZRL 3BPCB 3TH3T 3VI3F 3O11A 2F5AL 4DKDC 2VDRH 2H2SC 3VXRD 1IM3B 2BDNH 1HCFX 4HJJL 4PRBA 4M7LH 2FB4L 4M00A 3TA3D 3QIWD 2DYPB 3T4YB 2X1PA 3PP4L 4JG1H 2WQ8A 3QUZB 1MCPL 4WTWA 1K6QL 1S9XB 3E1F1 3MR9B 4HZLB 5FYJL 3S5LB 4DVRL 2L0DA 1I1AD 1UXWA 2YMXH 4UOW1 3OR6B 1FG2B 3CFBA 4RAUB 2BNRD 3PHOB 3AMLA 4NPYA 3HFMH 4JM2A 2EO1A 3ARVA 3EKCA 4HUVA 5GS2H 3O9WA 4NRXA 2HKHL 3SKMB 3RFZC 1YY8A 4K7FB 5D6DC 4Q9QH 4I3RL 4Y2DA 5DD1L 2X9WA 4M8QB 1F8TH 2YWYA 4UDUB 2CMRH 5D1ZB 1HHJB 1BVZA 2IQ9L 2P5WB 4JREB 4GW4B 3VXME 4F8QA 2R2EA 4JRXB 4OCXL 4QHNA 2ZUVA 1KJMA 1MJ7L 1Q72L 1N3NA 1DVFA 4YR6A 4EN3D 1ZLSL 3MNZB 3V4VH 1TTUA 1MWAH 1T03H 5BVJA 1FZOB 3D25A 5DK0B 1RAMA 2NY2B 4M6AA 3NFPB 3PWVA 3MRGB 1TXKA 2G5BA 2BCKB 1ZA3B 5HHVH 1V7ML 1UJTA 3IKKA 5LGHH 3EFDH 2H9GA 2XN9A 4U1NA 5E1AB 5JW5B 2J4WH 3KPQB 1XCTB 1OGTA 1X3DA 4G5ZH 4YXLH 5EO9B 2A38A 2ZSVA 3IFNH 1JPSL 1G6RB 5EU4B 1N26A 4XBGA 4GH7B 1QLEH 5T3XE 5F21B 3UTTD 1JNJA 2QADD 1TZGL 3KLHC 5T1LD 3TPUB 3GMOA 5I30L 4U1HA 5DEGA 1YMMA 5D96C 1S9WA 4YXKL 3SJVB 1G7PB 4R26H 4RMUA 3VJ6B 3DBXA 1FL5B 3QHZH 2FX8L 5EH1A 2D7QA 5D7LB 1BZ9A 1TZHB 4JRYD 3ROLA 2Z92B 2VUOA 4LMQE 4FQQB 3RX7A 1P4IH 1NCCH 4OFKA 5EZOL 4M4PA 1MJ8H 2VLME 4DZ8A 1JUFB 4K55A 3RTQB 3OAUL 3VH8B 4X83A 4LKXB 2ARWA 3V6OE 2ZSWB 1MUJA 3JSSA 3O6FA 4KVNH 3E6FA 4Q6YA 4HXAH 3D0LA 4UV4H 3D2UA 1MFBL 4YGVB 1JZ3A 3V6BR 4N90E 1A4JB 5I74C 4OZHA 3U46B 2CLRB 1R5VB 3H9HB 4ELKA 4RFNC 1JTTA 2DAVA 4YIQA 5DYOB 1H3PH 1CFQA 2CKBL 2R69H 1FO0B 4C56E 4RIRA 4A6YH 5ACZA 3JVGC 2E6JA 4P5TB 3L1OH 4MQ7B 5CKAA 4JVWA 4XVJL 1JNNH 2YPLB 2QQNH 4KDVA 3T3ME 5LQBH 3MJGX 4L8DB 1JMXA 5C0RH 1CXFA 1LP9B 1U8QA 4Y4HC 5HDLA 1U36A 1NLDL 5DGRA 4PRHD 2R1XB 1IGTB 1LK2B 2RHEA 4PJDA 3VGBA 2ZUTA 1PSKH 2A0LC 1P4BH 1P6AB 2P43B 1KPRB 1NGXB 1J1XL 4LLYA 1A1NA 5CJXC 3OXRA 2CRMA 2IANB 3MRRA 1T7XA 1ZA6A 2VDRL 2IALA 1ORQB 1UB6A 1F4YH 1R3HB 5IFJA 3IRZA 3W5NA 4LARH 5JTWA 4Y5XB 4F37F 1CD9B 3NN8B 4X9IA 2NY0B 2AEPL 2KUTA 4NSKA 3VXPB 2YMXL 3QUZD 3VFSB 3U7WH 3W0WB 3PWUA 3HFML 3KPSA 1O5DT 3WS6C 3ZHDA 2QSCH 2A6JA 4D9QD 3S37H 4FQCH 5ISZE 1U3HB 5F3BA 4Q9QL 4Y2OA 3L5XL 1FRGH 4HKZB 5E6IA 4WVRA 2QJDA 3BN9C 2CMRL 3OSKA 5GGQH 1GZPB 1CG9A 3IETB 2W1NA 1EFXB 5ANMB 5D1ZD 3P0YL 1CGXA 4KDWA 3SDDB 1D7FA 3QNYB 2P5WD 5I8CA 1T22A 2ZOKB 4JRXD 2DQCL 1FORH 3ULUE 1QSVA 1BD2E 4PJAB 5B22A 3V4VL 2QQLL 1RZ8A 1MWAL 1T03L 1QR1A 3AAZB 1Q9OB 1EHXA 2BY3A 3VD4A 5L7XH 4JEGB 1AR1D 4U1JB 4IEFB 5JPMB 4MDIA 4R0LB 1KFAH 4XPAH 3CFEA 4HFUH 2NY2D 5LGHL 3EFDL 4OKVB 4RFOL 1IKNA 2V5MA 3MFFB 4G5ZL 5I1LA 4YXLL 1QBLH 1RUAH 4WEMB 1KB9J 2J7LA 2W65B 2OR9H 4D3CH 1QLEL 1WCQA 5MP6H 3MGAA 1VESA 1XGQB 3GSXB 3LSOA 5KW9H 4ZOBA 3L3DA 4ZOCA 2HN7B 3OKDB 4RGNE 3AFLA 3OF6D 1X5FA 1ONQB 3DJ9A 3CJJA 3QHZL 2GITA 4Z8FH 1I4FB 2XKNB 4OGZA 2R0ZH 3SJVD 2P46B 1J87A 4XRCB 5CD5D 1P4IL 5D7LD 4J3VA 2AK4A 1JIBA 4CNIA 3PWJB 1OF2A 3IU4H 2CH8A 5CINH 5HGGS 1RUQH 4RMQA 4P2OA 1FCGA 4GLRH 3RRQA 1AXIB 2I27N 5T3ZE 4HXAL 4MJIA 2YS4A 4UV4L 5EBWA 3DMMA 1HSAB 3RTQD 4MJ4A 1Z9MA 1TCMA 3BGMA 3SDCA 3MLTA 3P4OB 1JHKH 5GRUH 1AXTH 4HH9A 2UWEA 5CSGA 5DHXB 2APWA 3HMXH 1H3PL 3L9RB 5F7NC 2ADJA 5EBLB 5SWZB 3LN5A 1WBYA 2YEZA 1BAFL 4ZFGH 4YBHA 4A6YL 4OKDA 1TNMA 1HXMA 1JZ6A 3L1OL 3GMMB 4ZO7A 1H3VA 4Q9RH 2D4FA 4XP9H 2QQNL 3ZDYE 4LDOB 5LQBL 4P5TD 3T0EA 4PJ5A 2I07B 3ZHLA 4JKWA 2YPLD 1G9NH 2JIXA 2Z93B 1UG9A 4ZO9A 3BZ4A 2J3SA 3TBSB 3GJFH 1UKQA 1PSKL 3UBXA 1P4BL 5EZJB 4HMDA 4OBRA 5F97E 4PJEE 1F90H 3B5GA 4P4RB 2AXJA 4G80A 3PQYE 1NDMA 2UY7A 2JCCE 4QLRA 1C8PA 3ILPA 4CDHA 1OSZA 2CLZA 3MNVA 4UNUA 5I73B 4YBLB 2OK0L 3VA2C 4QTHB 3GRWH 3U9UB 1R3JA 4OM0H 3QCUH 1F4YL 4O51A 4L8SB 4DEPC 2G9HB 3OR7A 5MI0B 1V3MA 4LARL 2N7AA 2XFXB 2DQFA 4OLVH 4L3AA 4PGDA 5JXAH 1JGUL 3TEUA 5DRZB 1A6AA 5B39G 5IEHA 1JTOA 4FQLH 5EZIL 2XPGA 1M71B 3K8LA 4PJ7E 2HFFA 4NN6B 5IBTH 2NY0D 2HT3D 1UWGH 5CLTA 3RL1B 4NZDA 2QSCL 1CFSA 1QSEB 5HPMB 3W0WD 3S37L 5GGRB 1IGML 4GBXA 1QPXA 5B8CA 2CJUH 4AK1A 1FRGL 4LGSB 1NMAH 1U3HD 4I2XE 2AQ2A 5A3IC 3DYMA 5GGQL 4L3EE 2IAMB 2FECI 4PRPE 4PRDB 4ZNEA 5CEXA 3WE6B 4YBQD 3TM6A 2H26A 1AC6A 1XR8B 2PXYA 1EFXD 4NKMB 3SDDD 1FORL 3DRTB 5C0CB 3VFPB 1KLGB 3UBXI 3ARGA 4ZUVB 2DIJA 3QDJD 4HK3J 4XAWH 3EYSH 3MODL 3OBAA 4J1UB 1NGYA 4OIBA 2ITCA 1G7MB 3C2AL 3NTCH 2YZ1A 4N0UA 3RVVC 4CVWA 5L7XL 5F7YC 3T2OA 2MFNA 4JN2B 3VFNB 3DO7B 1EVTC 5J7CC 1CLOH 1KFAL 4HFUL 3GHBH 1TTFA 4OCNC 3U7YL 1QBLL 4PJIB 1RUAL 2A9NH 2X9YA 3FOMA 5KSUB 3SKNA 1ES0B 2OR9L 1HH9B 3E2HB 5FO8B 5MP6L 4XBEH 3CPLB 4OZFG 5FKAA 4TNWF 3RUGF 5GS0H 2NZIA 1U93B 3NCBB 3S7GA 5J0BA 1KJVB 3C5ZC 2J8UA 1ZHNA 2GJJA 2H3NA 3U0TB 4PLOB 4G9DA 4KMTH 5IV2A 4Z8FL 3NIGF 2R0ZL 3TLRA 1B4RA 5ECJE 2XACC 3ZKXB 3IU4L 5CINL 3B5TA 3MOAH 4LP4A 1RUQL 1TENA 2P8LA 2FYYB 5K33A 3H9SE 2EDOA 2W0PA 3IDNB 5E9DE 4LBEA 4LCWA 3VI4E 1OAKH 1CGTA 5DJCB 2YUVA 2NY7L 3MV11 3GSQA 2HRLA 5EU7E 1AXTL 5F1KC 4EBQH 3HMXL 3WKNA 1JGEA 3EYUH 1EIBA 2W92A 1W0YT 4W81A 2CK2A 3DXAB 4JGUA 1T1ZA 3UTSA 1JZ7A 5D70H 2PTVA 1T2QL 1A7RH 1CE6A 1RJLB 1YYLH 3PDDA 3WN5C 4ZFGL 5SWZD 2GJ6A 5BCAA 4Q9RL 2CRZA 4XP9L 3RWGA 2FSEA 3EO0A 1I8MA 2X7LA 3A6BH 4OLXL 4PGBA 4R97C 3E0GA 4X99A 1OTUC 3NIDF 4ELMA 1G9NL 5HYJD 4ETYA 1YMHB 1KPUB 2BMKB 1GIGH 1BZ7A 1S8DA 5D7KD 4Z7VB 3WFHB 3BD5A 3O3BA 4C83B 2YD3A 3WNPA 2ZG3A 4GSDL 4U6VH 3OKKA 4YDVA 3BSZL 3VFTA 1AE6H 3JUZA 1KIPA 2ZUXA 3GBNH 2MMXA 4ONFH 1YC8A 4B53A 1F90L 1JI1A 2APTA 2R2BB 3N1QC 3QHFL 1FYTA 2AVGA 1I7UB 1MJJA 1FFOA 4YPGA 2HJKA 1GPOH 1LMKA 1IT9H 1D9KB 2BOBA 4LLMB 4PG9B 3QH3A 2AXFA 2BSTB 2X42A 4XC1H 4OM0L 3QCUL 4BQCA 4KJPC 1XMWA 1WTGT 1PBYA 2DLHA 5AWNH 1KJ2B 2JJSA 3MYJA 2VXUH 4OLVL 4I3GA 43C9A 3DX7B 5BS0E 2D7NA 4FQLL 3BWAB 5IBTL 1M6OB 1UWGL 1A9BB 2ZG1A 3RKDC 2HG5A 4XWGL 3IF1B 1Q9KA 2HAZA 4BQ8A 2NXYC 4JJHA 2CJUL 4WUUE 1A5FH 5E03A 3BRFA 4KY1H 4WFEE 2Y36H 5DJYB 4MCYA 4EI5C 2VLJA 2O5XL 1S9VA 4OV5A 4PJHF 2JJWA 2IAMD 1HWHB 5E8NA 3ARDA 1WAAE 3SE4C 3I50H 1MCOH 3RBGA 3IXTA 5IVXB 1MHEA 1TVHB 2XRAH 2SEBB 3VFOB 3O3DA 3EYSL 4JVUA 4WWKB 4CMHB 1CLZL 3L7EB 3NTCL 3ZKND 5C0CD 4MMZC 5JIKA 1X5AA 3MMEB 4KZEH 1H8NA 2Q86A 1GGIH 1TQBB 3KNBA 4YHPA 1QLFB 1WUNT 4G8EA 2FJHA 3GZKA 3ULVE 1CLOL 1A7BA 3LKPA 1Z0NA 3GHBL 1INQA 3LEXA 4EIGB 3WO3B 5C6TH 4DGYL 1QPPA 2A9NL 3BYYA 4CW1B 2Q7YB 3VXUE 4FQXC 2VXTH 4PJFB 2WIIA 3TESA 4PTTA 1EXUA 4XBEL 3C09B 5HVGB 4CN6A 2NX5B 5CS7A 3E3QC 6FABH 2OL3B 5GS0L 4DUVA 4R4NC 4HIIB 3KPNA 1BQHB 4RZCA 3I6KB 1CCZA 1TVBA 2ICWA 4KMTL 4U1MB 4NKDA 4L8CB 3O45A 2FATH 3P30H 4P23A 5C0BB 2LVCA 4HUNB 3QXDA 4YX2L 3LPFA 3BIKB 2VTFA 1E4XI 4TTDD 1H0DB 2MKLC 4PJBE 3MV9B 2CLVA 3F58L 3UZVB 5D7JB 1KELH 1S7RB 1ZHKA 1OLLA 2FL5B 3MOAL 5J8OA 1FL3B 4G8GE 3RIFF 5I1AA 5I0DA 2WWKO 4XHJC 3LZFH 4XWOC 3L5WA 5H8DA 2JLLA 2PO6C 3WJJC 1S7WB 2B0SL 1HNGA 2DQEH 4XPFH 4YUEH 1S7SA 5F7UA 1WBZA 4YDIH 5LBSH 5K9JL 2W60A 3MLPA 5D70L 43CAA 4F7MB 1A7RL 1P7QB 3AROA 2X4PB 1UJ3C 3HPJB 1YYLL 1JGLH 1SJEA 3DXAD 2XN9E 5F9DC 2JTDA 1HIMH 1ZANH 3B8SA 1N8ZA 3FQWB 2RGSA 2ZPKH 4YDKH 3HR6A 3IDMA 3A6BL 3CFDA 1D5XB 4X6BA 1JZ4A 5K9OB 5J11B 5IB1B 4XP4H 1AGCA 2Z31C 5KN5A 4Z76B 2ITDA 3CVHA 1FFNA 3THMH 4U6VL 5F9OL 5IW1A 4D9RE 1AE6L 5E4IA 2G75B 3GBNL 3FN0L 5F70A 4ONFL 3FT4A 1MY7A 4F8TA 1T04A 2ICWI 1TCRA 3WD5H 1T83C 3QI9B 3CIQA 4NO3B 2F8OA 5EUOB 3T0DA 1KTDB 1GSMA 4ZS6C 3GKWL 4GUPB 4MB4A 1GPOL 3IFOA 4LHUB 1IT9L 5AG9A 3QDHA 4XC1L 5F7HA 2HVJA 5C09A 4LCCB 1O7VA 1D9KD 2DB8A 2QHRL 5AWNL 2VZ1A 2VXUL 4LVOC 3QZWG 1G9NC 3T0BA 3I6GA 4OI7A 1U58B 5E6YA 2PYEA 4JAMA 5MHSE 4QEGA 1PFCA 2W9DH 3BDBA 1NUGA 2V5RA 3BUYB 3SOBL 2R9HD 4FXGB 3WV0A 1S7VB 2X89D 3C6LA 1FNGB 2C4FT 2ZWLT 4H1LB 4JCMA 4NNYB 4KY1L 2Y36L 3A67H 3O8XA 2DJ4A 4MHHI 4HV8A 1BBJA 1UENA 5D2NC 5EOTB 3UYPA 1IEAB 5BRZB 1E6JH 1OY3B 4GKOA 3ZKMD 1FNEB 3BYTA 3UTZA 5JW4N 2C1OA 3TIEA 1NH6A 2CD0A 1I7RA 3I50L 4Z78B 5IBLC 5JW3L 3S98A 5T33H 1U8PB 2XRAL 3PJSA 3GMNB 1P7HL 5DDHA 5HHME 4KZEL 4PJCF 1NEZB 1GGIL 4WDIB 4WWKD 3T3PF 1EGJH 2NW3B 3MLXH 2Y5TA 2M1KA 3CC5A 2YUXA 4U3CA 5C6TL 3HG1A 3C8KB 1T4KA 1UYWH 2Y7QB 3QCTH 3ZYIA 1HKLH 3CH1B 2BX5A 2VXTL 4XI5C 5DJ0B 4OFYA 4PG2C 1INDH 4DKFH 4URTB 4YEEA 1CS6A 3VXTB 3KPSE 3G5YB 1MCWM 3HUJF 3KYMB 4E41A 2VUYA 1TVDA 5E2UH 3RNKB 2NX5D 4ZFOA 1DQJB 4WWID 3BVNA 2FATL 3P30L 2OI9C 4Y16B 4GRWE 1N2RB 3RGVB 5E4EB 4ACPA 1SHMA 4PYGA 3EYOA 5H94A 4PJGF 2C3VA 5GRYA 5C0BD 3JV5A 1AD0A 1KELL 3IDIA 2YA2A 4TSCH 5ICXA 3V9FA 2E8YA 4X4XA 5D7JD 1BM3H 3QUYC 3R06A 2EDBA 1K4DA 2PW2B 3LZFL 3GIZL 5FUZH 1BIIB 5IB2B 2DQEL 4F7EB 3ALWA 4XPFL 4YUEL 5JMRA 1O7SA 4YDIL 3V2AR 3G6DH 3RJQB 5LBSL 1RZJL 5GS0C 1X9QA 5F3HB 1CICA 3FFCE 5EN2A 5DJ8B 2YN5A 3GJEB 3F7RA 2GSGA 2VLRB 1HIML 4X8XA 4UBDD 1P7QD 1R24B 4YDKL 2ZPKL 2CRYA 2VQ1B 4NT6B 3DV4B 3LB6C 5MENA 4KU1A 4MQTB 4OF0A 1Y0LB 1RZIB 4GOSA 3BP4B 4MQXD 4H5SB 2CDEB 4N9OB 1F2QA 3BP5A 4FTVA 4XP4L 2ADIB 3KPRB 5JNYA 3THML 2QV2A 3MGOB 3V5KA 3HNTL 2KL6A 1KLUB 2VITB 4NRZB 3KDMB 3CLEH 1OM3L 2QSVA 1YPZF 3RVTC 2AK4E 1AXSA 3WD5L 4ETQB 1UB5B 4CVZA 1FPTH 1AP2B 1VFAA 2IH3B 4NQCA 2OP4H 3DV6B 5DJZA 4ODHH 4W70A 3IGAB 3QI9D 4BZ2L 1OTSC 5IQ7H 3D3VA 1BOGA 1XGYH 3B9EA 1UC6A 4LHUD 2W9EH 4GKSA 4R9HA 4Y4FB 3T8XB 4JFQB 2UWEE 2IG2L 1JCKA 3DVIA 4NKOA 3T1FB 4AIZA 1WV7T 3SCMA 4PP1D 4YHNA 1E28B 4LSPH 4KK5D 2W9DL 2Z8WC 4ORGA 1PG7H 4B50A 4OJFH 1DBJH 2A1WH 1CDUA 4U1KA 4C56B 3BI9X 4JFXA 5DVLA 4PJ5E 3H3PH 3Q5OA 4NYLB 2A9MH 4YO0A 3GO1H 2ICCA 3IYLW 1N59A 3QUMH 1E6JL 1UM5H 3O0RL 1I7TB 1J8HE 2YRLA 3ZL4H 4YHYC 5IHZB 32C2A 3OG6B 5DJ2B 5ACMA 5T33L 3AS3A 3OGCA 4FG6D 5T1MA 4ENED 1LO3H 4HJ0C 5ESQB 1XFPA 4X6FB 3DURB 5I19H 2Q7NA 1EGJL 4QRSB 5D6DA 5E24E 5D5MF 1NCUA 3MLXL 1ZSDB 2VN7A 3QXAB 2NY6C 3TWCL 1RI8A 1MJUH 4LSTH 2BNQA 5IEKA 4R4BA 3QCTL 5E99H 1PQZA 3SKJL 5DJAA 1BX2B 1VADB 2X4NA 4DKFL 3B9KB 5H2BB 5D2LF 5CZKA 3L3JA 3I02B 5CMAA 4Q58C 5E2UL 3HB3D 1GZQB 1L0XA 4JB9H 4OM1L 3CFIC 2DOCA 1KEMH 3VFVB 3ZSTA 1UXSB 3NCCB 4RX4A 1LEIA 2R2HA 1B88A 3SKOA 3H8NA 4Y16D 4ZNEE 1UEMA 4QCIA 3RGVD 3TYFB 3S4SG 1J86A 3AMKA 2IBZX 4M93C 1EAJA 3OX8B 1HSBB 1BM3L 2XTJC 5I1HL 1FC2D 3VE0A 3MCKB 2JELH 5FUZL 4FQHB 3ULUH 2Y72A 3U36B 4AH2B 4YZFF 1YJDH 3WLBB 1EHAA 4UV7H 1HH6B 3G6DL 1QFUL 5F7LB 4Z77B 1A3RH 4XNYH 1AQDB 3O3UN 1IFHH 3JWOH 4J4PC 3QQ3B 4LIQE 5C08A 3CSYB 2FWOB 3E6HB 1IGJA 4BQ6A 2YD9A 2H2PC 2VLRD 2WM0A 2D3VA 5LGJA 1EBAA 3IVKB 2IH1A 3W82A 3UEZA 2XWBB 3GSRB 3FT2A 4HDIA 3UAJD 5HHOA 1M7IA 3X13A 1CXLA 3T77A 4XP5H 1N7MH 4BELD 4Z5RB 4UDTB 3RDTC 2J8UE 2ZOLA 1U8JB 2D4DA 3KPRD 2CXKA 4L1HA 3TT1L 3OV6A 2Q8AL 3CLEL 4R2GC 1D5MB 5T3XD 5ALBH 3JV0A 5HGAA 3C5JB 1MCLA 1Q94A 2WBWB 2H32B 2VLLA 2OP4L 3JVGA 3BZFA 5HHPA 4ODHL 3QIUC 3H9ZA 1XZ0A 4JFDB 5FDWA 1OGAE 4LCWE 5T3ZH 5IQ7L 5JHDB 1LO4H 3RZCB 1XGYL 2D31B 2W9EL 4D0CA 1HN1A 2XWJB 4Y4HA 3RVUC 4R7DA 3EW3B 2QR0B 5LWYH 2DI9A 3EUUA 4U6XA 2ILLA 4Y4FD 3AREB 3KLAB 1K8IA 3LOWA 1UKSA 1U8MB 4LSPL 5LAXA 3B9AA 2XKSA 1IC5H 3ISWA 3LKQB 5HGBB 3KYOA 2VDPH 4X0KB 4AY0A 1PG7L 4N90D 2A1WL 1TNNA 5C0EB 2VC2H 5CJXA 1JF1A 4NC0B 2V7HA 3AS0A 3QUXC 1MELA 4PJHA 3H3PL 4GW1B 4ELME 2A9ML 5HI5C 3GO1L 3RWIA 4C56D 1DEEA 1SVCP 3VGAB 4OAWA 4NO0B 3QUML 5KOMC 5A40E 1UM5L 3O2DH 4XXCC 5IW6B 1H5BC 4F9PC 3ZL4L 3TJHD 4YH6A 3WIIL 3ARBB 3LDBC 5INCA 2IQAB 2PTTA 1EEZB 4RQQA 1W0VB 3PXJA 3RBSA 1LO3L 1ORSB 1NGZB 3WS6A 3K4DA 1KNOA 1FN4A 1S7UA 4PY7A 1JNHB 5INDA 2Z35A 1QP1A 1DQMH 2JCCB 1Y18B 1MJUL 2V9QA 5FKPA 4K94H 5E99L 1RUKL 3EYVB 3ET9F 3VW3H 1UM4H 1XGUA 2COQA 1SEQH 3TO4B 4K8RH 5ERWA 3IJYA 1PY4A 5EO1A 3C08H 4MB3A 1HHHB 3OXSA 5I1EH 3CX5K 2VLKB 3B9KD 4TQEH 5DO2D 1MFCL 2NTSP 2VXQH 4NQEB 4RISH 1KEML 2NLJB 4JN1H 3K1DA 4FA8A 2VO5A 3NBNA 4OFDA 5ID0B 4DN4L 5JXEC 1FNHA 3QG7H 4QWWC 2LQRA 5EA0L 1S9YB 3VFUA 1WFNA 2HFGH 4MWFB 4F7PA 4L3EB 2CDGA 2JELL 3TV3H 2FEEI 3JV6A 5IVNA 1MY5A 1RHHA 4HBQA 2GT9A 4XPGH 4KK8C 3UYOD 2WINB 1YJDL 5DI8A 2DI8A 4UV7L 1FNSH 1WFTA 4P5KB 4N0CC 2UZYB 3FT3A 1KTLA 3HRZB 1A3RL 1GGBH 3ALPA 3LAFA 4N5ED 5F1OB 1IFHL 3JWOL 1G7IB 2VNCA 4DK6A 1JGDB 4JZNB 4XXDA 1J5OH 2ZUSA 4K7PH 5E8OA 3VGGA 1P9MC 4FFZH 2EXYD 1CQYA 3Q48A 4ZUTA 1UCTA 4JLRB 1MQ8A 5HHQA 1N7ML 2DQTH 4LF3A 5EZLA 4X5XA 3QNZB 4MXQD 4N0RA 4Z7QF 4G8FA 5D72H 5DA0B 1EK3A 1VSCA 1QEWA 4P2RB 2GHWB 2A83A 3DIFB 3QRFM 3CVIH 2YR3A 4X9BA 5ADOL 5ID1A 2HJLA 3FZUD 1VDGA 4PJ8B 5ALBL 1YEGL 5IHBA 4W4OC 3A0OA 5JPNB 4MS8D 4OZ4B 2OMNA 3BIAX 2PYFB 1KYOJ 4ZFZB 5D93C 1IEBB 4P2QB 1NFDB 4HCRA 5T3ZL 1R3KB 4JPKH 4HUXA 3QT2A 3DETC 4JFDD 5HDBF 4XGZB 4XPTH 5JHDD 3L3IA 4HPOH 3RZCD 4FFVC 4RWYH 5CGMA 5ENWB 4LASH 5LWYL 4QRPA 3HN3A 4GG8B 5DJ6B 4EUPG 1BMGA 3UPRA 1IC5L 5IW3A 2VDPL 3ARED 3G6JF 1T5XB 4IRJC 5HYQA 1G7LA 5HVFB 4CGTA 2YD1A 3GSNH 2VC2L 3ULSA 3CCHB 2FCBA 1ED3A 4F7TA 1DTUA 1L4IA 1Y6MR 2CKBA 1QYGH 5CEZH 1T0NA 1WIPA 2XY1A 4JQIH 5J89A 2X40A 5D9SB 3EZ8A 4OQTL 5DHVH 2P24B 3PV7A 4XC3H 1D5BA 4HS3B 3O2DL 2YC1B 4UUJB 1MVUA 2A6IB 4FQ2H 4M1CC 1SEBA 4NO0D 5K9QI 3DUUA 3C60C 3VWJD 3T0VA 3EAKA 4XHQA 1IAOB 4PJCA 3VFMA 4J3XA 4E42B 3GMLB 2X70B 3P0GB 5DSCB 4ZAKB 4MA8H 5JDJA 2L4OA 4Y88A 5D1QC 1A02N 3OKEA 2KH2B 3NMEA 1T0MA 1IM9A 3GSOB 3ARBD 1D5ZA 4I3SL 4O9HH 4WU7B 5DMGC 2H8PA 3MJ7B 4NGHH 2H6PA 3FRUB 4I48A 3EO1B 3BN3B 2MHAA 3TNMB 5C09E 3FMGH 5EWIH 1DQML 4YEFA 3GSVB 1MHCB 3HUJA 2X4SA 3QJHB 1ACYH 3CMOH 3VW3L 3QXWA 1BVKA 4MVBD 4UIMA 3TN0C 1UM4L 2PYEE 4K8RL 1CDJA 1ZT4A 3EGSB 2KDGA 1JPGB 1CTOA 4L4TB 4LDEB 4P2CG 2BVTA 3C08L 3ROOA 3TO4D 5I8OL 2DQJH 5I1EL 3VRLE 4TQEL 2VXQL 4G9FA 2ICEA 3I3DA 3DYPA 4RISL 2NQCA 3D69B 2VLKD 4LVEA 1XH3B 2GTWB 1HQ4A 2LVEA 4QOKE 5GPRA 3ZE1E 1BJ8A 3OHXA 3MRDA 4NRYA 3MRIB 4JFEA 3SPVA 3JWDH 3QG7L 1ZKAA 4FOMA 4WV1C 4PTUA 3HC4H 4WUUB 1I9JH 5DZNA 4FXLA 5DEFA 5FA3A 2HFGL 4C57C 3UTPE 2QHLA 3PWPE 2OZ4H 3VMNA 3BW9A 5KSAC 4U6HA 2AJ3B 3C5SB 4NO5A 3U30C 4L3ED 4XPGL 1J0YA 5D8JH 1FNSL 2LE9A 4IIQB 3C5ZA 5EPMB 5B38B 5IMOB 3G08A 3OKLB 3VXQB 5A2KH 3EFFB 1GGBL 3ULVH 4YAQA 1E0OB 4JANA 4IHOA 4GG6E 1MWAA 3HR5A 3UJIH 3O11B 1J5OL 4XCCH 4K7PL 5DD5L 5JOFA 3QWOA 4HS6A 4PRBB 3MXVH 4FFZL 2E9JA 2VOTA 1CDGA 2WQRA 4KMLB 1A7OL 3L3KA 5F88B 4E41E 2DQTL 1UXWB 1YPZA 5D72L 4YDJA 3SDAB 4NQVA 4NO2A 3G5XA 2VH5L 3CVIL 3ULUC 4GRLC 4JM2B 2X4QA 4HUVB 3DSNA 5SX4I 3E8UH 4UT7H 1YJDC 4NRXB 4P2RD 2VRAA 4PB9H 2EC9U 1YY8B 4G6AC 3WN5A 4PJ8D 4Y2DB 1WZ1H 1YUHB 2MSPA 4QRQA 3JWOC 5C0DA 1RK1A 5IKCA 4JPKL 4KRNA 3K2UH 4WO4D 4P2QD 2R2EB 4PRIA 1T2JA 5DR5H 4Z7UF 4MDJA 4XPTL 4BZ1H 4MMXC 3ZE2F 5KAQF 4HPOL 2BSRA 4RWYL 3D39B 1LHZA 4ZG1A 4ODTL 2YSSA 1AO7A 4LU5H 1KJMB 5GGVH 1X5YA 4D8PA 1N3NB 4TUJA 4YK4C 4M7LT 4RGNC 1DVFB 4YR6B 1E6OH 4Z7NE 2J5LB 3WXWH 4ERSL 5BVJB 4JFPA 3D25B 3GSNL 4ISVA 3V7AG 1KG0A 3JV4A 4QXTA 5DMKA 3PWVB 1AGFA 2G5BB 1QYGL 5CEZL 2VIRA 3K46A 1JK8A 2HP4A 2H9GB 2XN9B 3L95A 4HGKC 4JQIL 4U1NB 5GSRA 4A6YA 4FTVE 2FIRT 3PGCA 4ZPVA 5JORB 4XC3L 1FFPA 4WI5A 4TPRH 4XBGB 2ZKHH 4FQ2L 4NC1C 3IJSB 1AIFB 3Q3GA 5GHWH 5KOVC 4S1SL 4KKAD 4U1HB 5DEGB 4ODVH 1YMMB 3T65A 5KG9B 1S9WB 1GGCH 1Q1JH 3DBXB 2O26U 1KIQA 1AGBA 1BZ9B 3ROLB 4ZAKD 4O9HL 4FZ8L 4MXVF 5FYLH 4X80H 1K4CB 1NBQA 4NGHL 1CGYA 4LCYA 3ZT5A 4DZ8B 4W6WB 3FMGL 5EWIL 1J05A 4HZAA 4IS6A 5EUOF 2LU3A 5D2LA 1MUJB 3O6FB 1LEKA 4EI5A 3CMOL 3E6FB 3L6FA 3D0LB 4XCNA 1P6FA 3D2UB 5DQJA 5HHNA 2P7TA 4OZHB 3V0WH 4JKLA 3TZVC 4ELKB 3S97C 5FO9A 4P57A 3DUHA 2DQJL 3SE4A 4YIQB 1U91A 3OJDA 4M4RA 4L4TD 4DAGH 1QRNA 3HA0A 2QBWA 4RIRB 5E5RB 4U6YB 2W91A 4YHKL 4R3SA 4S0SD 5TQ0H 5ACZB 1CWVA 4OCMC 3PUCA 4ODSH 1QRKA 5BZWA 3JWDL 3WNNA 3HC4L 1I9JL 1LK3H 1IVLA 2NYYD 1CU4H 1U8QB 3U0WL 4WUUD 3BQUC 4FQXA 4JFYB 4K94C 4KUZH 3RPKA 1MF2L 2D7PA 4OLZH 4PJDB 3L5IA 1IJ9A 3W9EA 4K8RC 1GYAA 5D8JL 2IFFH 3VXSA 2VZVA 4OI9A 4WJ5A 2DM7A 3X11A 4OIIL 4WHYH 2DQIH 4JVPA 4B0MM 1A1NB 1YNTA 2CIIA 12E8H 3ULVL 4IOIA 4PGEA 3OXRB 5HHMB 3MRRB 3QFDA 3CAFA 3EDJA 2EECA 1BF2A 4OD2A 3MXVL 4MX7B 5IHLB 1UB6B 1W2KT 2NY1B 5IFJB 5I9QB 2YXMA 3DRQA 5DD6A 3V79C 1EO7A 2PO6A 4X7CC 5FOJA 3WJJA 4L29B 5A2FA 1LO5A 1OAXH 3PWUB 3Q1SH 3KPSB 1DDHA 2R0KH 3E8UL 4KJWC 4UT7L 3SDAD 2A6JB 4AT6A 4ALAH 4JR9H 2DIBA 4JM2D 1UJ3A 1MIEH 5F3BB 4GRWB 4N8VA 3DWTA 3O9WD 2IPTH 5E6IB 3AU1A 4JM4H 1OP5K 3QEQA 4NBXB 4Y2DD 5HD8C 1N0LA 1AHWC 1CG9B 1EX0A 3K2UL 4R4FH 3IAQA 3MNWA 5DR5L 5HDQH 4BZ1L 2FGZA 4PS4H 4MNHA 4NQDA 2Z31A 5I8CB 5TF0A 1T22B 1G0XA 5C0ND 5GGVL 2JK5A 3DGCR 3RKPA 1R5IA 3K7UA 1YECH 1F58L 1WWBX 5T1DH 4EJ1C 1E6OL 3BESR 1RZ8B 4MA1B 3WXWL 1QR1B 3HI1A 5GJTH 1DVFD 1BHGA 3HMXA 4LVHB 1T83A 3O41A 4MDIB 4M1DH 3CFEB 4HKBA 3QDAA 3CK0H 1HI6A 1IC1A 3NA4A 5I1LB 4CADA 2AABL 4QHKI 2XN9D 5LXGH 1EZVY 4TPRL 3C9NA 2ZKHL 1WWWX 1EEYA 5GHWL 3LSOB 2APXA 3L3DB 4FN0A 5F7MC 4ODVL 4J23A 1JZ2A 1GGCL 2JB5H 1Q1JL 5FM5O 3GJFA 2GITB 1YMMD 3EZJB 3MOBH 5TDNA 4IMKA 4QRTA 5FYLL 4X80L 1FL6A 5J3HD 4J3OC 4CNIB 5JHLH 1OF2B 1BOYA 1ADQL 2BVOA 2AERT 4Y8DC 4JG0H 4U1LB 4X5WA 1IQDA 3KPTA 5D2NA 1DANU 3LRGA 4MJIB 5EBWB 3ZZ1A 3DMMB 1F6FB 4LSVH 3SDCB 3MLTB 2HYMA 5FECA 5JMOC 3GRWA 3O6FD 5C6PB 3V0WL 2DM4A 4WTZA 5E95B 1I1CA 4HH9B 3D2UD 3F12A 4OUOA 5HY9A 4GLRI 3D1MC 5DA4A 2ADJB 3D85A 3LN5B 4XVSH 5IM7A 4QRRA 1WBYB 2YEZB 4UTBL 5TQ0L 1A6VH 1HXMB 4NM8H 4NZTH 1V7NH 4RFEA 4ODSL 4KTYA 5DURB 2D2OA 2J6EL 1KEGH 3T0EB 4LCIH 1LK3L 2E8ZA 3BPOC 4N0FA 3SN6N 5F1NB 1KB5H 2JIXB 3BHBA 2IPKA 3FTGB 3C6SA 3GIVA 1J0IA 3BZ4B 4PG2A 4OLZL 1QSFB 3OKOA 3T3MF 5IJKC 3UBXB 1ZS8A 5JIHA 2IFFL 2DQIL 5JQ6H 1QNZH 12E8L 1YN6A 4G80B 1NDMB 2A74A 1DSFH 5EOQL 3SE3C 1N4XH 3ILPB 2OYPA 2FZ3A 2CLZB 3MNVB 4HH8A 3MLRH 2IEPA 1R3JB 3NAAH 4JKMA 5HHMD 4O51B 3JWDC 3O2VH 3OR7B 1NBYA 4PGDB 2DJSA 3NCEB 4BSJA 2NY1D 1A6AB 1FLRL 1Z0MA 5IEHB 5FYJE 3LHPH 3NPZB 5TF1L 1R3IL 4TNWK 1OAXL 1O0VA 2HFFB 3Q1SL 4UT9H 3B6SA 5F7EH 2R0KL 5B3JE 2X1XR 1LDSA 4ALAL 4OT1H 4JR9L 3KPSD 3MUZ1 1MIEL 4GBXB 5B8CB 5DRWA 5HYFA 2CUIA 3FKUS 1DLFH 2EH7H 1VACA 2IPTL 5EB9A 3ULVC 4XPBL 5JDSB 4JM4L 2R1YA 3IAPA 1RZKH 4OTXH 4R4FL 5CEXB 5E6ID 2FJGA 4YHZH 2H26B 3OB8A 1EHLH 4PS4L 3G6JA 2PXYB 3LN4A 1QA9A 1SJXA 3ARGB 3RVXC 2EDYA 8FABB 3RWEB 3OAYH 2N1KA 1QHPA 4GXUM 1NGYB 5GJTL 2ITCB 1EEUA 1SJHB 4N0UB 4LIQH 4V2CB 1IAIH 4TUOA 1M05A 1I85C 3EHBC 4M1DL 1XGRA 2V6HA 4IDLA 3ULUF 4NQXB 5F44A 3CK0L 4BM7A 1F00I 1ZXQA 3FOMB 3I6LE 4QXUL 4WFHE 2UUDK 3SKNB 5LXGL 5GRVL 3DYOA 1F5WA 5DFTA 1JV5A 5FKAB 3DUSA 4NNPH 2X2YA 2J8UB 3K3QA 4ZFFA 4G9DB 35C8H 5IV2B 5CWSB 2YUWA 2Q20A 4GAYA 2EYRA 1P53A 4W6XB 5B4MD 4K3JH 5CJOH 4LL9A 1ZLUK 1JGVH 5E2WH 2JJVA 2OL3L 1A0QL 4JG0L 2P8LB 4G6FB 2AK4D 1OT1A 1J7VR 4LBEB 4LCWB 4LSVL 4MNGE 5E2JA 2FX9H 2UV3A 3GSQB 3DX8B 4MJID 5EFIA 3DMMD 5DFVC 4G6KH 1A64A 3SDCD 1JGEB 2HLFC 3WSQH 3K8KA 1MQKH 1T1ZB 4XVSL 3UTSB 1CE6B 1MHHA 3P4MA 3REVA 4NZTL 1V7NL 2GJ6B 3R1GH 4M6NH 1NFIB 5DQDL 5BXFA 3RWGB 1RIVH 2FSEB 3S37X 3EO0B 1KEGL 5E8EA 1I8MB 2X7LB 4BUHA 4LCIL 4R8WH 4PGBB 4DUXA 4X99B 5DURD 4ELMB 1KB5L 3T0ED 1A47A 4PJ5D 2DTMH 3RVWC 4HD9A 4TTDC 2VZOA 3T3PE 2JIXD 1JPTH 3J7HA 5IQ9A 3QPXH 3OKKB 4YDVB 3VFTB 4XMKH 1YEFH 1C12A 3W9DA 5JQ6L 1QNZL 5DS8A 1JF6A 2VKXA 1YA5A 1FYTB 3BKML 3C87A 1DSFL 3P4NA 1N4XL 1MJJB 1FFOB 1TMCB 2HJKB 1FVEA 4YPGB 5LG1A 4YC2B 15C8H 2BOBB 1CR9H 3FFDA 2AXFB 3QH3B 2X05A 4PJEF 2O93L 2LFGA 3P0VH 3NAAL 1P2CA 3PL6C 5GGSA 1XF2A 3LD8C 3HI5L 1A22B 3MYJB 2JCCF 4HMCA 4JGJA 43C9B 5DLMH 4E0RA 3LHPL 5DMIH 4FP8H 4AENA 4X6CF 4UT9L 1A9EA 3CLFH 2HG5B 4BH7A 4GKZA 1KCVH 3P73A 2H1PH 1Q9KB 2ZZUT 2UYLA 3KAAA 4JCLA 5ACLA 5AYUL 1IBGH 3RNQA 4CJ0A 4PJ7F 2EH7L 5IFAL 4WI9A 3S9DB 4J4PA 1QFWH 4XPHH 1IGYA 4GBXD 4MCYB 1RZKL 4OTXL 4CN1A 2VLJB 1S9VB 3RIFK 4YHZL 4X9FA 2BSSA 4K2UL 5E8NB 3ARDB 1PZ5A 3HS0A 4KWUA 3T1WA 3RDTA 3MQIA 1QQDA 1I8IB 3IXTB 2PXYD 1MHEB 3H3BC 4C54A 4GQ9H 3O3DB 4KKBC 1MCFA 3EJJX 4HWNA 2BP3A 4LIQL 3ZDXE 3ARGD 2IMMA 2WWMD 3UPCA 5J6HA 3N9GH 2Q86B 1CLCA 1SMOA 1GRWA 3CZFB 3KNBB 4YHPB 3F7YA 3N0PB 4G8EB 5F7DB 1FV1A 2C5DC 1NC2A 3FAXA 1CDIA 1G0DA 3QIUA 1INQB 3LEXB 3MRQA 1F13A 1S5IH 4U0QB 2JJUA 1T1XA 1VKXB 1H8OA 2WIIB 4PTTB 4GRMA 1EXUB 1JYXA 2VDKH 4EXKA 2P5EA 4NNPL 1D6VL 3FQUA 2XQYG 3KPNB 4RZCB 3NGBB 1TVBB 2ICWB 1NAKL 4NKDB 3O45B 4P23B 1KCUH 3QXDB 2UZIL 1T21A 2CLVB 2HA1A 2IFGA 3JWNC 1RQ5A 1JGVL 1ACZA 5E2WL 1ZHKB 3QUXA 5E1HB 3NCJH 4PRIE 1MCHA 2LAGB 5GJSL 5I1AB 1JZ5A 4AL8H 3EDFA 1AO7E 2D7TL 2XQBH 5KANG 4U0RC 3T09A 4G6FD 4X7TA 4MD5A 2FX9L 1H5BA 4ZUSB 4F9PA 2QKIA 4LCWD 4CMHC 4E5XA 1S7SB 1WBZB 3L5HA 5F8QC 3WSQL 1MFDH 1A6UH 1MQKL 3VI4F 4LCUA 4NHCH 43CAB 2C1PA 3DHJA 2R2CA 2QQKH 4ZUUA 1SJEB 2EIBA 4AEIL 3HE6C 1WLHA 3N50A 4M6NL 3CSPA 3LS5H 3UTSD 2ARJQ 4JHWH 3VMOA 2E5EA 1RIVL 3VG9B 3CVHH 3IDMB 3CFDB 4OZIF 2GJ6D 5L8KB 4OZFH 5D1XC 5DGQA 4HC1L 4U1IA 5KN5B 2DTML 2VJXA 2ITDB 1FFNB 1DN0A 3U4AA 2DTSA 4FRWA 5ICYA 5IW1B 2D9CA 4XMKL 2PW1A 1YEFL 3NZ8A 4JO3H 3IFLL 3FT4B 3LV3A 4U2ZA 1OTTC 1UM6H 3PP3H 1TCRB 2YKLH 4GMTL 4N5UA 1F4XH 5CBEB 1T7WA 5FYJU 5D2LE 3ZLQC 3IFOB 1LO2H 5IVZB 5JXEA 1CR9L 3R0NA 1FYTD 4MJ6A 1UZ8A 3P0VL 4D0BA 3RU8H 5TGBA 5C09B 1EGJA 2V2TA 2F9BT 2BFVH 4I77H 5J4MA 5DC4B 3HAEG 4Y5YC 2PYEB 4JAMB 4NN5C 1QRNE 4FP8L 5IIEA 2Q3AA 3CLFL 1EJ6A 1KCVL 1PD6A 1BFOA 2H1PL 5CEYA 5FM8A 1WZLA 4L3CB 2XI9A 5J11C 3HHRB 4KI5E 4NNXA 2YUZA 1D6EA 1QFWL 1E4JA 2WUCH 1PX4A 4XPHL 3W11D 3O3EA 4HV8B 4F15B 3HCVA 3S5LG 1P9MA 4M62H 5DMJB 1RURH 5I71B 4ONGH 3VXMA 3INUH 5HJ3A 2VLJD 3UTZB 2C1OB 3S6CA 4OF3A 1I7RB 4WEBH 4KI1A 2ZJSL 3ARDD 1NCBL 3PJSB 4GQ9L 1HZHH 5FYKH 1CDBA 1S7XB 5DDHB 3VA6A 1NFKA 2QLVB 4RRPG 4W4OA 1WAAF 2PETA 3VDCA 3MGTA 3WHXA 1SMAA 3TJEL 1UZ6E 1OP3H 1QTYT 2Y5TB 1C5BH 3CC5B 4KK5C 1S5IL 3HG1B 2EE6A 1T4KB 4KC3B 3P77A 4QO1A 1RZKC 4JO2H 1JWMA 1NMCB 3DGGA 3HTLX 1PKOA 3ULVF 3TCLA 3T08A 1SJVA 2FEDD 5EOCJ 4E41B 1ZOXA 4AMKH 2LTQC 3RP1A 3KLDA 1N5YH 1RK0A 2ESVE 4UU9A 1MNUL 4ZFOB 4X4YA 3BVNB 1W72H 4IRJA 1KCUL 4DUWA 2OTUA 4F33B 3EYOB 4D0DA 2EXWC 5H94B 2C3VB 4P23D 3BX7C 4OSUH 4R7NA 3IDIB 5ICXB 5I17A 4AL8L 3R06B 1K4DB 1NCAH 4PGCA 4EDWL 2XQBL 4OB5H 4PJBF 4DKEL 1CE1H 3ZE0E 4HT1H 1K8DA 3S8WA 5GGTL 4UMGA 3OQ3B 1WSST 4IJ3B 3BKYH 3L7FA 3C60A 3OG4B 4U31A 2R39A 1PAMA 1BJ1H 1MFDL 1A6UL 3QQ4A 4NHCL 2BHZA 1IKFH 5D1QA 1CICB 5EN2B 4YDLC 4HKXA 1T66C 3VH8G 1C1EH 2VQUA 3O2WH 4EOWH 5IJVA 5LVEA 5C0AE 1X7QA 5MENB 5GISL 4ZYKA 3GSUA 3O81A 2BY0A 4H8WL 5IMLA 3QG6A 3MRHA 3BRGC 2E9WA 4FTVB 3BP5B 5FCSH 5T5NF 4M7ZC 5JNYB 2PF6A 3TN0A 4TULH 5ILTH 3V5KB 3QUMA 4DGIH 1FCCA 2ERJB 5E8PA 4JO3L 4NC2B 2VE6A 5L2JA 1C16A 1ZT1A 1UM6L 4XT1C 4MNQE 1AXSB 2YKLL 3IU3A 4CVZB 1UWXH 1UT9A 1VFAB 2ATPA 1SYSB 4NQCB 1F4XL 5EU3A 5DJZB 3BPNB 1LO2L 4LMQI 5FGBC 5GZOC 1KTRL 1S3KL 2ENSA 4KGJA 4WV1A 3D3VB 5IT2H 1BOGB 4GAJH 1OAUL 2WP3T 4GKSB 1EZVX 4NCC1 3IDJB 2BFVL 4HXBH 4I77L 1INEH 4PP2A 4NKOB 2GCYA 5KSAA 5FF6A 5C09D 3BDYH 4AIZB 3SCMB 3ZTNL 1IAMA 5HYSA 5EBGA 5HBBA 4QRRE 2Y25A 3CXHK 1KC5H 3WUWA 1PZUB 4ORGB 5CHNA 2PYED 3V7AE 3NIFE 1KGCD 5J12B 4KDTC 1DUYA 3B8YA 4ZO6A 4U1KB 4JFXB 5ISZA 2GSIA 4KROC 4BQ9A 2WUCL 3MV8A 3C6LD 4YO0B 1I3GH 2EC8A 3UDWC 1YN7A 4C55A 1N59B 4JFZH 4M62L 3STZA 1RURL 4U7MA 4JDTL 3PWLA 5CAYB 3M1BA 2F53E 3SBWC 4ONHA 1FG9C 4AJ0A 5BOZG 2VL4A 32C2B 4BSWA 5F7KC 5H37G 3D18A 1T1WA 2Y23A 3RWJA 2ED9A 5EIQA 1M4KA 3OGCB 1QOKA 1WZMA 1E27A 2NR6D 4G43A 5T1MB 1HZHL 5FYKL 1GXEA 4GRLA 1FDLH 4PPTA 1M1SA 3EYQC 1YDPA 1OSPH 2DWEB 2P42B 3AS1A 4KTEH 2GIYA 5C0GA 2BC4A 4Z7QE 1C5BL 5C9KA 5TDPA 5IEKB 2BNQB 1K3ZA 4APQC 4R4BB 3RUGB 4GXVH 5HI3C 1KCSH 5C3TA 1PQZB 4GQPH 5DJAB 3MLSH 2X4NB 4LOUD 4JO2L 3HG1D 1DP0A 3HAEA 1A7NH 2R23B 4JY6A 3L3JB 3QA3A 3QO1A 5CMAB 1TTGA 1IQWH 4AMKL 3SE9H 3CDYA 3U0PA 2EYSA 4JGMA 4KRLB 3OL2A 4E41D 5KZCB 4EDXA 3MRPA 3ZYOA 1W72L 5HDBE 1VCAA 1LEIB 1P84K 2R2HB 1RJZB 3SKOB 3MV7A 2BHUA 1F2XK 5FO7A 3HI6H 4QCIB 2A77H 4F2MA 2PKDA 4OSUL 2DMBA 2DYPA 5L88H 3FO0H 2GW5A 2Q87A 4GRWF 3G6JE 2D9QB 1A14H 1IC7H 2P47B 4UT6L 3VE0B 2HKFH 3H7BA 4OB5L 2X1QA 4WHTA 3OKNB 3OR6A 5I1DA 3AB0C 3BEVA 4ZNCD 2YN3A 3BKYL 5HYIA 3RY4A 2DKMA 3DI3B 4QHLA 4NDMA 4LLAA 1OAYH 4TUKH 5D96B 4GW5A 4HWZA 4K7FA 5DMYA 1G84A 4QF1A 1IKFL 2Z9TA 1TIUA 2RB8A 3VD9A 4M8QA 2CSPA 5IOPA 3ZHKA 1C1EL 5C08B 1CICD 3O2WL 2WLYA 5ALCH 1IGJB 3FJTA 5DRNA 4EOWL 5EIVA 3B9KC 2IH1B 4ODXA 3FT2B 4HDIB 4TVPD 3X13B 1M7IB 5HHOB 3T77B 1EH9A 2J1KA 5MEND 4PRNA 4Q9BA 5GRZA 4RDQG 2WIMA 5IK3A 5IFHH 3O4OC 2AP2A 4FTVD 4NWUH 4KK6C 5I74B 3U82B 3O2DA 3TZVA 4RFNB 2FLRT 2FO1A 1N0XH 4JKKA 3RAJL 4MJ5B 1Q94B 2VLLB 4FFYL 2NY3C 3BZFB 5HHPB 3PQYA 4UB0H 2WUBH 2A73A 1XZ0B 2B4CH 2D7MA 2F54A 3QP3A 4RGMC 5FDWB 4POZD 3GJFK 4NQCD 5EU4A 4P46C 5IT2L 4GAJL 5TE7H 3EJZC 2MPAH 4HXBL 4X6CA 1R6VA 4Y4HB 1INEL 3D3VD 4L8BB 4R7DB 3H3KA 3V5DB 4J8RA 3BDYL 5EO0A 4U6XB 4LLVA 1K8IB 3BMVA 1BGXH 1QVOA 5LAXB 1KC5L 3GKZA 3KYOB 5GGRY 3SCMD 1KBGH 3QWQB 4MGXA 2UWEF 4IRSC 1JF1B 3L5JA 3OAZH 2IBGA 2V7HB 4HIXH 3FHQA 4PJHB 2ZSWA 2AEIT 5KBNC 3RWIB 1DEEB 1ND0A 4JFZL 4OAWB 4KRMB 1A4JA 4PRPA 5GZNC 4D94A 4NQUA 2H2SD 3GSWA 1D5IH 4ZDHA 2ICWJ 4RSVA 4XP1H 4IMLA 4H20L 5INCB 4ESKA 2PTTB 4KRPC 4RQQB 3QJFA 5ETUA 2DDQH 1FDLL 2BJMH 5EUKA 1CVRA 4M48H 3QDME 1FN4B 2NXZC 2DLTA 4NZRH 1HHIA 1S7UB 1OSPL 1BF8A 4PY7B 4JFOA 4KTEL 4XNMA 3OGOE 2Z35B 3SKUD 4HJJH 1JNLL 2XTJE 2HLAA 4BKLA 5I18H 3LQZA 3PP4H 2WBJC 4GXVL 4JY5H 1IGTA 1AHWA 1XIWC 1LK2A 1MCPH 4G7YH 2BNRB 1XGUB 2FGWH 2BNQD 3MLSL 5ERWB 3IJYB 4FMFA 4P3DA 1F97A 5EO1B 3S35H 1HCVA 1OD7A 3OXSB 3V4UH 1IQWL 1VEOA 3SE9L 4O58H 3F7PC 4EQ3A 1BQSA 1CFNA 1HILA 2IANA 1KN2H 3ZE2E 1NLBL 2ENYA 5DD1H 5KZCD 1LILA 1ORQA 3WXVH 3HI6L 2A77L 5L88L 3FO0L 4Z6AT 3VFUB 3I9GH 2CXGA 4S1RH 4ZQKA 1A14L 3VGEA 1IC7L 4KV5E 1IL1A 3CU7A 2X1OA 4F7PB 2CDGB 4P3CH 4YQXH 1VFMA 3JV6B 5HPOA 1IC4H 1RHHB 3TBWA 2GT9B 4BFEA 5DI8B 4OF7A 1OAYL 2NCMA 5I8KH 4N8CH 1U92B 1A8JH 3KLHD 1KXVC 1KTLB 3FT3B 5C0FA 3FQTA 4OZIA 4MVBC 2C7UB 2RR3A 1PG7X 1OW0C 4QXWA 1GZPA 1Z5LA 3IETA 4XXDB 3RGHA 3GSNA 5C08D 5ABDE 4ZUTB 2P5EE 5HHQB 3VXNA 5EZLB 4C58B 4X5XB 5DHVA 3U6RA 5IFHL 5HHOD 3FAWA 4G8FB 4YXKH 1QEWB 4PLKC 2Z0BA 4KKCC 5ID1B 1N0XL 2HJLB 4ZXBC 5JPMA 4TSBH 2J8UF 1UEYA 2JB6B 3GUTA 1N6QH 4WI3A 4U3XA 4UB0L 2WUBL 2B4CL 1WT5C 4POUB 4YFLF 2VR4A 3O4LA 2R0WH 2AJYH 4HX1A 5TE7L 1JP5A 4HUXB 5DC0A 1URLA 2CRIA 4I0PC 4AQOA 1YEHH 5DEZA 3L3IB 4JHZA 2CR3A 1A6TA 3CU1A 5FK9B 3WL9A 5FGRA 4QRPB 5GS1C 1ONQA 1BGXL 4Y4HD 4LVNC 5BS0A 3UPRB 5IJKA 2CKBH 5TE4H 1GVIA 3KWWA 1KJ3H 3NCFB 2VXVL 1JWUB 5IB4A 5HYQB 1G7LB 2A0LD 3PWJA 3ULSB 1NUDA 4F7TB 4XVJH 5JOPE 1T0NB 3CD4A 3SE3A 3DX9A 2CKNA 2IWGA 1MFNA 3WO4C 4JPWH 1HSAA 3MRFA 1D5BB 1NLDH 1MVUB 4DEPB 2M8XA 2NMSA 1D5IL 3B9DA 3DUUB 4PJCB 4NM4H 2OMBA 4XP1L 5DVOA 1WAAA 5I1GH 3LQAH 2DDQL 4BFIB 1T0MB 1IM9B 2BJML 3KG5A 4M48L 1D5ZB 2K7QA 2RCSH 2H8PB 2H6PB 2FHBA 3BIBX 2WK2A 4I48B 2O61A 3NACH 2MHAB 1BWMA 1NCWH 2EO9A 5SWSA 5E6ZA 5I18L 3HUJB 3LKNB 2X4SB 4JY5L 2DD8L 3TBSA 1BVKB 4G7YL 4UIMB 4OF5A 5SX4H 2FGWL 3VXUA 3BN9D 2AEPH 1ZT4B 5DC9B 4XTRC 3U7AA 4BQBA 3S35L 1X4XA 3ROOB 2MTPA 3V4UL 2RJMA 4PJGB 2OLDA 4LRIC 4P4RA 4O58L 3OJ2C 4U1GC 4G9FB 2ICEB 1J11A 2DIAA 1KN2L 5FYJD 1HQ4B 4MSWA 2FIKA 3BUTA 3L5XH 3OHXB 3MRDB 4NRYB 4QTHA 4P4KC 5FOBA 3WXVL 1RD6A 4PJBA 4JFEB 3SPVB 1G7HA 1I85A 4OLYL 4PTUB 2HMIC 4JPVL 5KS9E 3I9GL 4LKCA 5DEFB 4S1RL 3MJ8A 5FA3B 3P0YH 4G8GA 5EOCH 5C0IA 2VZSA 4DOHE 3BW9B 4P3CL 1U3JA 4U6HB 4YQXL 4KXZH 1N5AA 1M71A 1BQHG 1IC4L 2DQCH 2HRPL 1DE4A 1G6VK 2J88H 3QRGL 1QSEA 5HPMA 3LEYL 2QQLH 5I8KL 4N8CL 3UC0L 2ARJA 1DEDA 3G9VA 1HWGB 4K71B 4PBVC 4DW2H 2EYTA 1LD9A 3G08B 1IGFH 4YAQB 5FM5M 1X6NA 4JANB 4IHOB 2MNUA 3EJYC 1VB9A 1MWAB 3HR5B 3WHE1 5C6WH 1A1MA 4RFOH 5JOFB 1SYVA 3QWOB 3U4BL 1K5NA 4HS6B 5DJXA 1V8HA 3L3KB 4U4BA 4LRNH 5I2IA 3DRTA 1YPZB 4F58H 1WWAX 3VXRE 4NQVB 3G5XB 4WFHD 4KGLA 2X4QB 4TSBL 2AQ3A 4JN2A 5JIPA 3KS0J 1GAFL 3WN5B 4R96A 2DM3A 1N6QL 1B6DA 2CK0H 1KPVA 1OAQL 1OB1A 4CMMA 3S36H 4FABH 1XF4A 3FB7A 3RA7H 4QRQB 1HINH 5DZLA 5IKCB 2R0WL 2AJYL 1XT5A 4R97B 4MDJB 1YEHL 1CGVA 2BSRB 4TSAH 2YSSB 1AO7B 4DCQA 1Q9LB 2N56A 4D8PB 1MLBA 3MO1A 2DWDA 2OTWA 4TUJB 5TE4L 4JY4A 1KJ3L 4QRPD 1JHTB 1QACA 5I75C 4JFPB 1BAFH 4YE4H 4LHUG 4ISVB 3MYZA 1KG0B 4QXTB 1AGFB 2B1AH 1B0GB 2VIRB 1Z3GL 5F9WC 1JK8B 2FYYA 3BKJH 3L95B 3ZT6A 5GSRB 4A6YB 2DKUA 4JPWL 3CUPA 4O00A 2ADGA 4RA0C 4ZPVB 5GIRA 2B4CC 2YK1H 3KYAA 1FFPB 5ITBH 3ZKQD 3SDAC 3PL6A 3U2SA 1IILE 3Q3GB 1J8KA 3FO9A 4NM4L 3T65B 2ATKB 5I1GL 5F89A 1U2HA 1DR9A 3LQAL 4BH8A 1VEPA 1KIQB 5D5MB 1AGBB 1FSKC 4H1LG 2K1MA 3IJHA 2RCSL 2NXYB 4LCYB 5CJ5A 1IM9D 4OGAC 3FQXA 2OK0H 3NACL 5CP7B 1NCWL 1J05B 3BO8B 4IS6B 2XWTB 2BMKA 3FN9A 4DWHA 1P4LA 4BFGA 5D2LB 4JRYE 1LEKB 4EI5B 4EUPH 4Z7VA 3L6FB 4K7PX 4XCNB 5E08H 1JGUH 4G8IA 5DQJB 3HPLA 5A3ID 3EDKA 5HHNB 2P7TB 5EZIH 2XY2A 3KHQA 1KIUA 5FO9B 4P57B 4MA3B 1U8OA 1NEZG 1U91B 3OJDB 1B9ZA 3ARXA 1QRNB 5L2KA 4EKXA 2EEAA 1IGMH 5J56B 4R3SB 2YD7A 5DRXA 3MV8E 3KVQA 4LLMA 4G9FD 1L7TH 4PV9A 5BZWB 1BEYL 4YLQT 3VRLF 3RVVD 1JN6A 1LEGB 2BVQA 4JFED 5GS2D 2G2RA 3KYNA 5EOCL 1EBPA 5B21A 2EKSA 4FQXB 3ZE1F 3QDJB 5MEOA 4Z7WE 3A6CH 2X89A 2J88L 3Q2CA 2ZUWA 2J12B 3W9EB 1I3UA 1X4ZA 5HGDA 4DFHA 3IF1A 5DFWH 3VXSB 3MODH 2EDHA 3C2AH 4WJ5B 3X11B 4DW2L 5AD0A 1Q9WA 4XNZC 2CIIB 1YNTB 4PJXE 1IGFL 4PRHE 4IOIB 4PGEB 5TQ2H 5DXWA 3C5ZD 4QGYA 3A6OA 3FFCA 5I16A 1IEHA 4NKQB 4JHBA 3QFDB 1GGYA 1DQQA 2J8OA 3U7YH 4OD2B 2AEQH 3W81A 4N9GA 1RU9H 4XX1G 4RAVA