4LVOB

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex with added cacl2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPATMSASLGQRVSMSCSASSSVSTSYFHWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGSGTSYSLSISSMEAEDAATYYCHQFHRSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Subtilisin-like serine protease
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/inhibitor/immune system
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoB01
1V7NL 4WW1B 4XPFL 3T2PA 5E2UL 3VFNA 4P5TB 3HE7C 5TGBA 3OXSA 4AM0A 5J12B 5GGTL 3SDAD 4QO1A 4MQ7B 1QRNB 4UT6L 2CR3A 3T1FB 1X5ZA 3TVMB 4D3CH 2F58L 2X2YA 2IALB 5BQ7B 3RTQB 3OWEA 4BSWB 2XXCB 3OHXB 3IFNH 1C8PA 4K8RH 2H8PB 3I6KA 1ORQA 3A67L 1GC1H 2A6KA 1F4HA 2ICEB 1UADC 2XWBA 4WFEE 3KWWB 3IGAA 5C0IA 3MLXH 4PRBA 3WDHA 2EH8L 3RKDD 1F97A 3U7WH 3ZL4L 3DXAD 1HSAA 5SX5H 2ILLA 1IEAB 3RA7L 4OZGA 4U1HA 2JB6A 4LL9A 3QDHA 4ODUA 2VXSH 4ZPTA 4X6EA 5DJAA 4Z7NE 2YSSB 3DBXA 3S88H 1PG7L 1YEEL 4FQCL 2ADFL 2AEPL 5F7WC 4R2GC 4GG6B 3CK0L 4PREA 5CSZA 4WI8A 3WS3B 3BMVA 4QRRE 3GMQA 4DZBA 4PRID 2OS7A 4G6AC 4HS8H 1HQRA 4IJ3B 3V6OE 1T22A 5I75C 2DWDA 2X5PA 4HJGB 2IG2H 2ADJB 1B88A 4F7MA 3GNML 5IW1A 1D5MB 4JG0H 4WI7A 2AXGB 1N3NA 5GQBA 4U2ZA 1ZTXH 3AREA 5D6DA 5HDBF 1KNOB 1UWGL 3HFML 3QXVA 2FYYA 4HS3B 4ODXA 2AEQH 1KPRB 1MVUB 1R0AL 4P4KD 3CSPA 3WLWD 1T3FA 4HUUA 3RPIA 3PDDA 3C5ZD 4MQ7A 1QRNA 5KW9H 3BGAA 3FQXB 5CJXC 3TVMA 2YD8A 4P23D 2VMFA 4M7LL 4HZLB 3RTQA 3MYZA 4BSWA 2NZ9D 2BSRB 3UYRL 4LEXH 2NY5H 3VGDA 2JK5A 1C5DB 2H8PA 1JHTB 5CEYB 1MCBA 1NMCC 4MXVF 4MDJB 1UFUA 5CEZD 1CFVH 1TCRB 2EDLA 4TUKL 3TN0C 4KK6C 4Y1AE 3VH8A 3VXRD 1A8JH 4ONFH 5DI8B 1N5YH 3PJSB 3EO0A 1FDLH 4NKMB 4HWZA 1JMXA 2BFVL 4ODHL 5I6XB 3QUXD 4HJJH 5ESVB 5EU4A 1I9IH 2YSSA 3MTRA 4A6YB 4JREC 1S9YB 1FZKA 2VDOH 4NZUL 3NZ8B 3UTPD 4LLQB 1I1AB 1K4DB 3WS3A 5A3ID 2GITA 2NW2B 3E3QE 4LRNH 3D85D 4ZAKD 4D3CL 5HI5C 1KJ2A 4O02H 1KEMH 5TQ2L 1C1EH 2VR9A 3CH8A 3ZT6A 1KTKE 3L5HA 3IFNL 4U1KB 1TJIH 5E24E 2BOCB 4V1DE 3LSOB 4RGNC 1FRGH 5HGDA 2ADJA 4KRMB 1D5MA 5GRYA 4YHNA 4K7PH 5SWZE 4YHYC 5JQ6L 2AXGA 3MLXL 4YPGB 1HH9B 3BGFC 3QEQB 3WN5A 1KNOA 4HS3A 1KPRA 4KKCD 1F3JB 3H9HB 5I1KL 2G5BB 2OR8A 3RAJH 2Y6SC 4S1SH 1A1OA 5EBGA 4G6JH 5GGRY 3BT2H 3FQXA 5I1EH 2ZUVA 3N9GH 4AMKL 1BVKB 2HVJA 1RUQH 4MAYD 4L4VE 4WUKH 5DZNA 4IOFD 3T1WA 1NGQL 1OW0A 1NBVH 3SDYL 1JHTA 5CEYA 4XNXH 3WV0A 2DWEB 4PP2A 4MDJA 4LNVA 1A64A 2X40A 4C56E 3HUJB 5FIEA 3UPCA 5DI8A 5DMGC 2R4SH 5D7KE 2MQCA 2CLZB 5IROC 4NKMA 1U8IA 4ORGB 1EX0A 4PLKC 3WNPA 1QHOA 4K3JL 4RFEB 5AZ2H 4HPOH 1CXIA 4KRNA 5KTEH 4QF1B 2YN3A 4K9EC 4XVSH 5CS7A 4YR6B 5ESVA 4X6DA 1PKQA 1ZTXL 3BP5B 4YLQT 1L7TH 4JKMA 4A6YA 4LVNB 1KTRL 3LPGA 2AEQL 1B4RA 2CIIA 1DBBL 3ULUC 5CKAA 1S9YA 4E41A 3HG1D 3NZ8A 1VGKA 5I74B 4FA8A 2A0LC 3GJFH 1OP9A 4L4TE 4J3TA 2I5YL 1KB9K 3L3GA 2DMKA 2A1WH 2EEDA 1NDMA 3HMWH 2DQIH 2EC8A 4Y4FD 4O58L 5C08E 3WO3B 1ZGLA 1B9ZA 5HHXH 3BX7C 3OBAA 3KPMB 1J05B 2BOCA 5A16B 3LSOA 1VEOA 1TZIB 4HK3N 3WFEH 3BH8A 4OZHB 1U2CA 3FOMB 4ONFL 2VKXA 1N5YL 1EPFA 2EIBA 4I0PB 3FN9A 1FDLL 2GJZB 3MSPA 1WBYB 4MMXC 4FABH 1M7IA 1EO8H 5DUPH 3H9HA 5D9SA 1RY7B 3AXLB 4OCRL 1IILE 1ZOXA 4XNQB 1U95A 3V4UH 4ZUTB 2VR5A 4HJJL 4YFEA 1I9IL 1BVKA 4FQQB 2AEIT 5CHNB 4GRMA 2UWEF 2Q8AH 4JKWA 3GMNA 2RJMA 4WDIB 5HDQH 3CLFL 1Q1JH 4JPKL 1MY5A 3T0EC 3HUJA 1BP3B 4PGDB 5GRUH 4M3JA 2IC2A 1F3DJ 1KEML 1K4CA 1F11B 1NCUA 2CLZA 4Q9BA 5EIQA 4G7YH 1NQBA 4Y19E 4F7TB 3ULUE 4ORGA 4JPVH 1TJIL 2VLRB 4RFEA 1FPTH 5GZOD 4QF1A 2ERJB 1P6AB 1FL6B 4G9FA 4YK4B 1V7MH 1JYNA 1S5IL 5IMMA 4KI5C 3AB0C 2AV1B 1EBPA 1H0DB 1RUKL 4W4OC 2GAZB 3T4AB 4YBHA 4K9EL 1SBSH 3BT2L 4FMFA 1I3GH 4X99B 5I1EL 3N9GL 3EDEA 2DYPD 1DBML 3HNVH 1OSPH 4WUKL 5J8OA 3ULUL 2ZUTA 3LVEA 2AK4E 1CDUA 2CRIA 3WS6C 5GGSB 5I17B 1J05A 1UH2A 5ILTH 2OP4L 4X83A 3WJJC 4JO2L 3I6GB 6FABH 4UAOB 3DECA 1T04B 5KOMC 1U8OA 3FOMA 2E3VA 1NLBH 3VXQB 3H3PH 1YEGH 3WHE1 5C07A 5ICZB 3MRLB 1TTUA 2GJZA 4KVNH 4F57H 4ZFOL 1A21A 1WBYA 4PY7A 4HPOL 5KANI 1OTTC 5IKCB 4J8RB 5KTEL 1P1ZA 2AGJH 1YJDH 4X7EC 3CSYB 4ZUTA 4JRXD 4HIEA 1L4IA 1FC2D 2GEEA 3W9EB 1Q9OB 4QXUL 1SJEA 4JFZH 5IGXH 1NLDH 1A14H 4OBRA 4OZGF 2VZSA 2HLFC 1GGCH 4KU1A 1TJGL 5KANG 5HI4C 1CL7H 5E8OB 1F02I 2OMNA 2AQ2A 3LPFA 3TA3C 5L2KB 5GXBB 3ZO0A 4JLRA 4KI5E 4WHYH 5HY9B 4PGDA 4HMDA 2A1WL 5EPMB 4IRZH 2YKLH 4QTIL 3QDGB 4BQ9A 1FZOA 2HG5A 1PAMA 4F7TA 2GFBB 1X5KA 3F58H 1W0YT 5EH1A 2VLRA 4KTYA 4IHOB 5E5RB 3QXDA 4NO3A 4Y5VB 3TWCH 1GHFL 3HC3L 4NCC2 2J6EL 3U30B 4Q58C 1H0DA 2VE6A 5DUMH 5K9QI 4FABL 5GGVY 5DUPL 3T4AA 1CYGA 4NKOB 1MEXL 2EE2A 5BJTB 3V4UL 2OL3B 3HA0A 4MD4B 4X99A 3QUMB 2EDQA 3QQ3B 4OCYH 4NO0D 5JO5B 1UM4H 1KB9J 2CKNA 3CZJA 3VXUE 4CU7A 4GW4A 1MCSA 5K93A 1B2WH 1Q1JL 5DEGA 3I6GA 1MNUH 3CFBB 3MLYH 5DC0A 4FXGB 1K6QL 1TQCB 3MPCA 3QG7L 3B5TA 4FTVB 3MJ9A 3MRLA 4G7YL 1I9RL 5E95B 2NTSP 4FQ1L 2ZOLA 4QGTA 2J12B 5IKCA 5E99L 3VXNB 3CSYA 4GAYB 3PWPE 1PQZB 3KDMA 1QO3B 3ZT5A 1CICC 3W9EA 5GS0H 1AH1A 1NUFA 2HH0H 5TH2B 5DXWA 3TZVC 1JFQH 1FNLA 3WCYA 5KS9B 1SBSL 2YD1A 3C9NB 1U8HB 4NUJB 2ZPKH 1FGNH 4PLJC 1YDPB 2B2XH 4N0UE 5HY9A 1DQDL 5EPMA 1OSPL 4PV8B 3U9PH 4GG6F 4IRJB 5BV7H 5DMKA 3T04D 1UM5H 3QDGA 1AIFA 1MUJB 2EDDA 5DFTA 3TH4T 12E8L 2OZ4A 4UOJA 4CDGC 5ILTL 4IHOA 2NY2C 1QBLH 1B3JA 5HPOA 4Y5VA 1ZE3C 1NLBL 3WDIA 4OAWB 3WD5L 1YEGL 3PWJB 4EBQL 1NCCH 5JMRA 4KVNL 3O2WL 5E8PB 4F57L 1KENH 1S3KL 4PR5A 1BD2E 2H2SC 4EUPA 1ACZA 1IAIM 2P47B 4QRSA 3WFCH 1YJDL 5CJ5A 4R7NA 3T0VA 2OL3A 4FXKA 4XNMB 4MAUL 3G6DL 5DRNB 1VB9A 1EK3A 1ZA3B 1PLGL 3ARFB 4LP4A 1B0RB 5IB5A 4HW6A 5BW7A 4JFZL 4LHUG 1A14L 2VDRL 3UO1H 3N85H 3C60C 1F00I 5E9DD 4OLWH 4GQ9H 4U33A 1V05A 1CL7L 5DC9B 1DDHB 3E2HC 4HV8B 2EE9A 2FLBT 3ZYJA 3DX7B 2AKRB 4OQTL 2EEBA 2R0ZL 5MI0C 2R1WB 3V0AC 4LVOC 1KV3A 2YKLL 2R2BA 2YA1A 5GISL 3BQUA 3S98A 1BZ7A 3F58L 1EEZA 4KUCF 5F9WC 4PD4K 1F2QA 2B1AH 2FBJH 2P8LB 3JXAA 1KGCD 4IOSD 3VXNA 4JFDE 1IQDB 4GAYA 4FN0A 1PQZA 4JHAH 3CGTA 3CZFB 4RGOH 2XZCH 4LSUL 3NN8A 2DQHH 5T1LB 3ARGD 4Y4HC 1VERA 4RDQF 5JIIA 5TH2A 1FFQA 5JW5B 1MPAH 2OR9H 5KSAB 1FAIL 5KS9A 5ERWB 3C9NA 3WXVH 1U8HA 2ICWJ 1YDPA 1M4KA 4QOKD 1OLZA 4PV8A 4ONHB 3VI3E 1ZAGA 2HJLB 3QUKB 5C0NC 1UM4L 1MUJA 1SM3L 3OXRB 3QHZH 4HWBL 4BFIB 2A9MH 2GTWB 5DHXB 4AENA 4P9HH 1IM3A 4I9WD 1EZVX 1MNUL 4LRIC 2YUXA 1J7VR 4ZUUA 5F89B 1KIRB 4WWKC 3MLWH 4LBEB 3MLYL 5E2VL 2V5SA 5E4EC 4XVTL 5E8PA 2WK2A 3ZE0E 2QQQA 3UTSD 3I2CL 1YY9D 5D5MB 3JUYA 4WVRA 2B7DT 4P2QB 4Y2DB 1AY1L 3R0MA 3ARFA 1B0RA 4HQQH 1RULL 4UINH 1PX4A 3GMLB 1NCAH 2HH0L 2GY7B 3VD5A 3RBSA 1H3WM 1JFQL 1HWHB 4X6BB 5FHAL 5SWSB 3VWJD 1JGEB 4YHZH 1DDHA 4OFYD 4HV8A 4Z6AT 4TNVK 2KZWA 3T3MF 2ZPKL 1FGNL 5HYJE 3DX7A 2AKRA 2YMXH 1M7XA 3T08A 2R1WA 4HEME 3U9PL 4GSDH 5BV7L 4MNHA 1UM5L 5CEXB 5GS1B 2WIIA 1MWAB 5AAMA 3HUJF 2P8LA 4DJMA 2YBRB 4R97B 3JV4B 3D0VB 4EIZC 3CPLB 1WT5C 3K80A 5IEKB 3OKLB 1DBKL 3NMEA 1ZHLA 3JBG7 5T1LA 4ZNEE 1XF3B 3V4VH 4MHHG 1LHZA 3K0WA 1H5BA 5JW5A 5KSAA 3VDCA 3NVQA 1P4BL 2EO1A 3R8QA 2LU4A 3VG0L 4PUBL 3EYUH 2J4WH 3QQ4B 1DEEB 1JE6A 3PQYE 4ONHA 3UO1L 2HJLA 2XQBH 2V7NA 3WMSA 2FL5B 5ID1B 4ZSOE 5D1XB 3OXRA 4FG6D 5T5FH 1L6ZA 3BPOB 2GTWA 2XWJA 3SDAC 2YN5A 5T33H 1JPGB 5ITFB 1CD9B 3NFPB 1R6VA 4NNXA 4LBEA 2X9YA 5GSRA 4QTHB 1OP3K 2C1PB 2X1QA 2FBJL 1JRHI 1MHHB 1KG0B 4OZHF 4Q9CA 1FSKC 1X4ZA 5D5MA 4C54A 4NRXA 3N1MC 1ZANL 3I85A 1U8LB 1YPZE 4RGOL 2ZUUA 4RGMC 1WZLA 4JFXB 2DQHL 1A5FL 5AEAA 3GMLA 3L5WB 5IQ7H 5IW6A 3RKDC 5JLZA 3FONA 5DJZB 5AYUH 1QFOA 5J06A 1MPAL 1PYWA 2OR9L 2PO6D 4XGZB 3OTTA 4R3SB 3EGSB 1BQLH 3WXVL 5F93C 4QRTB 1B0GB 3DTXB 1EH9A 1UKSA 3EZ8A 1RV6X 1ACYL 4OZIE 4XHQA 5DEFB 4P9HL 5IHZB 5FO9A 3D0VA 3S36X 3CPLA 4I3GA 4FZEH 2QADB 1IAII 3H3KA 2X10A 3AFLA 2E5EA 5E8NA 5BXFB 1ZSDA 4O2CA 3BOVA 4NN7B 3HB3D 1EHAA 2FH8A 4RMRA 3DO7B 4UDUB 3SBWA 2V9RA 5I73C 4EI5A 1BFTA 3KPRD 1QLFB 4UINL 3MCG1 3VFWB 3SGKC 1I4FA 5TE6H 2FL5A 4NOFA 1KYOJ 1SY6A 2X4UB 1LILA 2AJSH 2JJSC 4P4KC 1NGYB 3WLWC 3SKJH 4PJFB 3EW3B 3GRWH 4BFEA 1EHLL 1JPGA 1PD6A 1JF1B 1ZT7A 2YMXL 4YXKL 3WFDL 3ZKXC 3NFPA 3MV9E 4P23C 2BC4B 4Y5XB 1FZMB 3R1GL 2NZ9C 5IVXE 5IQ9B 4LVHB 4TRPL 4YHOH 5F9OL 2JJTA 4HC1L 1CG9B 2QQKL 1OARH 3A6CH 1KG0A 4E9LA 4P2RD 1WC7A 4NM8H 3S4SA 2MNUA 2EDYA 2V2WB 2VLMD 2E6PA 2B1HH 1GIGH 4I48B 1VACB 2KQNA 3OAYH 2E7BA 4JFXA 3V4VL 1S7VB 5DJZA 4U6XB 4AL8H 3VI4E 4XGZA 3GMPB 4JRYE 4LKXB 2DQGH 4R3SA 3EGSA 1G7IB 5FAAA 1B0GA 4NQCA 4PRIE 5DJDB 3QUXC 1XT5A 2EDKA 4WFHD 1H8OA 3UPRB 2YD7A 3T2NH 2XA3A 3SCMD 2XQBL 5MERA 1AGBB 2ICWA 2FZ3B 5DD1H 5T5FL 5DEFA 5D2LE 4PIRF 3QJFA 5IHZA 2AXHA 2X89A 4X6FB 5A3IC 5EOCL 5FYLH 4ZAKC 3ZDXF 4GRWB 5IVNA 1NFDB 2D0FA 3HPJA 5I71B 4Y16D 4HH9B 3BISA 4NC2B 4GS7C 4DQOH 4CVXB 5JDSB 3DO7A 4TULH 3MRDB 2PYFB 1FYTB 4U49A 3BO8B 3LIZL 4G6MH 1QLFA 4K3EH 4OD3H 1P4IL 5DJYA 1U93B 5C0GB 2X4UA 3ZHLA 4KKCC 1BQLL 5CEZE 1QSED 4OUUB 4XMPL 5DS8B 1JMZA 4PJFA 3BKMH 1HINL 5MEOB 1JF1A 1RIUL 3VXRE 3NFSH 3VA6A 2IANA 4Z7UE 5ESAA 4MZ2A 4Y5XA 5JHDD 1FZMA 4MAYC 5IQ9A 4IOFC 4LPXA 2O5YL 3S37H 4EJ1C 3TESA 1HIMH 1G1YA 1KCVL 1JGDB 4R4FL 1ZXQA 3VDBA 4I48A 4FZEL 1VACA 3KS0H 2NX5D 4YJZL 1OGTB 3C5SB 1S7VA 4LIQE 2WWMD 4U6XA 3RWJB 3KPLB 4U6VH 5CEZL 3UTPE 5INCB 4LKXA 1T0NB 4ODTH 1XMWA 1ZMYA 1E6OL 2BCKA 5CP3A 3SDCB 3ZTNH 3QH3B 4KTEL 3KPPB 4LARH 5DZLA 1U8KB 1ZHBB 5KS9F 4XPBL 2FZ3A 3CXHJ 2VB5A 5DA4A 3DMMA 4X4YB 4FFVD 3WDJA 2O5ZL 4PG2A 1D5BB 4X6FA 2VLKB 3GRWL 4N5ED 3PDOA 3NFNB 2OTWB 1JPFB 5BO1L 4LIQL 4Y4FC 4HH9A 3ULVH 2EDEA 4DN3H 1NMAH 5JW4Q 3MRKA 1TFHA 3EOAB 2V7HA 1OARL 3MRDA 2B39A 2PYFA 3A6CL 3GJFK 5DURB 5EA0L 2LE9A 1FYTA 3BO8A 4LCWA 1FO0B 3FHAA 2JJVA 5T1MA 3ROOB 3JWDC 1U93A 4YPJA 1S7TB 2EIDA 1JI1A 1IFHH 4FFWD 3E8UL 4OUUA 3NA4A 4XXDA 1XF5B 5MEOA 4I18B 2IEPA 3RZCA 3LKOA 3MRJB 1AGFB 1K5NB 5J6HA 4I0CC 4XWOD 2KQMA 5DD1L 3UBXB 1J8KA 4XMLH 2IPKB 2IBZY 1J5OH 1JGDA 4KKNA 3RWEA 3GJEB 3LEYL 5DHVB 3S96A 1FG9C 4CU6A 3E0GA 3BMWA 5GGTA 1OGTA 1EFQA 3C5SA 1YEIH 4QRUB 4EEEA 3KPLA 4HS6B 3MA9H 3HG1E 4GG8A 4TULL 4Q9RL 5INCA 1FVEB 1PFCA 1T0NA 5CD5D 5GZOC 3SDCA 4G6ML 1HN1A 1A2YA 2VIRB 4YE4H 4K3EL 2Y5EA 3IDYB 3KPPA 1FFPB 2D7OA 3F65A 3ARED 4X7TB 4X4YA 1I7ZB 1ZEAL 2XKNB 2VLKA 1R3JB 3BKML 3EYVA 4IM8A 4M8VA 3TIEB 3BYYA 4U1JB 3P30H 3CFEB 3NFSL 3NFNA 1QRND 1N8ZA 3RY5A 3BP6B 3ABZA 2JIXA 3TVMD 1MCCA 4JDZB 5SWQB 4MZ3A 1YMMB 4K07A 4E5XA 4F9LA 3EOAA 3RJDA 1HIML 2ZUWA 1M1SA 1KSRA 4U1LB 5IHLB 2QHRH 4XAWH 5D72H 4Q2ZA 4ELMB 4RRPA 2R8SH 4ZUVA 5KVDH 5E00B 5D5MF 3S9DB 1BVZA 1FNGA 3FB7A 2ENSA 3MRBB 4I77H 4ODTL 1Z3GL 1XF5A 3S36L 1AC0A 5CIPH 2D7TH 3DX9A 5I1JH 5F96H 3Q3GA 4IIQC 4LARL 1K5NA 1SMOA 4K55A 1A7NL 2ITCA 4BELD 2JF1A 3VFPB 4HZAA 4OLXH 1CD8A 3O6MH 2X4OB 1FFOA 3WL9A 4AK1A 3GJEA 1J1OH 1IT9H 3GK8H 4OCSH 3ESUF 4NZTL 3NPZB 4GFTB 3MUHL 3JUZA 3O4OB 2HFGL 4HUMB 4OF6A 5ISZB 1UXWB 1G0XA 2FIKB 3UP1A 2VISB 1RMFH 2DIJA 2VIRA 4M6AA 4JM2B 3FCTB 1FFPA 3LDBC 2CGRL 3X11B 4X7TA 3WIHA 3B43A 1MRFL 1I7ZA 4B7LA 1IFHL 2VXVH 3WJLA 1BFVL 4Z8FL 1J1PH 5I76B 4OJFH 3BP6A 4JDZA 5SWQA 2FATL 1VFOA 3JTSB 1YMMA 4XMLL 1R3LB 5I9QC 1U92B 3M1BB 4OGAD 4U1LA 5KVFL 3GM8A 5GGVH 4TTDD 4L9LC 4JRXE 1CQKA 4ELMA 1G6RL 5KBNC 1IE5A 1KACB 4LHQB 4XBPA 3FOLB 4KUCD 1WVZA 1E6JL 5E00A 5E8EB 1YEIL 4M1DH 4Y1AA 2IQ9L 5FDYA 4ONGL 3OKDB 5EO9A 1BX2B 2VWEE 3V6BR 3KYMA 5EUOE 3ZHDA 1UJTA 4YE4L 3DJ9A 4L8SB 5JXED 3PE9A 2FDBP 3RIFK 4WTXA 2XA8H 5HHOE 3U4BH 2C7UA 1ZVSA 3VFPA 5CCKH 1QFWM 1AFVL 2X4OA 1SVCP 1JRHH 1X4YA 1YNKH 3SGJC 2ORBH 4E41D 1OSZB 1INEH 2FECI 4KQ3L 2OJEA 5K9KB 4LLDB 3H6JA 3UTQB 1QFPA 2ITDB 3D39B 1HILB 4L8DB 4MLIA 3QZWB 1JGVH 5DDHA 5ISZA 4XP5H 2EKSA 4X6CE 4DOHE 3VMNA 1TXKA 4CNIB 2CDFB 2FIKA 2VISA 4K71C 2VABB 4HSQA 4JM2A 1PEZA 1G0DA 3STBA 4UIKH 2YEZA 2DLTA 3X11A 3QCTH 3VWKB 1X5FA 4I77L 1JK8B 1J0KA 4HKZB 2DLHA 2JB5H 1H3TA 4HX1A 4QHLB 4JFEB 4NGHH 1I3RB 1IAIH 5I76A 4DW2H 4M6OH 1MAMH 3EYFA 1Q38A 4H88H 5HTSA 1U6AL 2R4RH 4PJFF 3BGMB 3MLZH 4LOUD 2CDGB 5EOTB 1U92A 3NIDF 3M1BA 1KLFA 4B7IA 3TJHD 1KCSH 2ATKB 5CAYB 3ISWA 1UXSB 3GK8L 4OCSL 1OPGL 4NQXB 4J3VA 2XIDA 4LLMB 5E8EA 1WIOA 3B4NA 3HS0B 3QEGH 1AD9A 2VXQH 4PGCB 4PJCE 5L8LB 3ZKSD 4OBSA 3OKDA 1BX2A 3SOBH 4L8BA 4MA3B 1EIBA 1WFUA 4YQXL 3BN3B 2VDKH 4G9FD 1JGUL 1MRCH 3MRIB 3ARGC 1OL0A 1LP9E 1A3LL 2R39A 2ZWLT 4DGIH 5IBUB 1J1PL 3E6FA 3UZEA 1KPVB 4DEPB 5K9KA 4LAQL 4RISL 2ITDA 4IMKA 5IHUH 2X4QA 3D39A 3UTQA 5KAQG 4FHBD 1HILA 1AO7B 3JVGC 4XVJH 3QZWA 5HGAB 4GRWF 3FRPG 1DUYB 3HRPA 1NFDF 3SY0B 2CDFA 5GGVL 5C08A 3GBML 4O5LH 1RHHB 3X3FL 4IMLB 5L0QC 4UT7H 2VABA 2DQFB 5B38B 5LGJB 1F2XK 1GGTA 2PXYB 3HC0A 1MJ7H 3ZDYF 3ZE2F 5DYOB 2C4FT 3CU7A 5C07D 3VWKA 1CLYH 5IG7A 1YY9C 4HKZA 2ZOKB 5DD6B 1P9MC 2V17H 3SE4C 5EZJA 2HJFB 4YX2H 4MNQB 2CRMA 5HVHC 1N5AB 1I3RA 4IOIB 4TVPH 1HCVA 2ED8A 3SGDI 3HZKA 3U4BL 5HGBB 2GJ6E 3MRMA 1T7WA 4P57B 4MNGB 4X4MA 5GGSY 3V4PH 4X7SL 4Z95H 3BGMA 4BZ2H 3VWJC 2YRZA 3O3DB 2CDGA 5JPMB 1TZHB 5EOTA 2ATKA 4P3DA 4PLOB 3EBAA 1RD6A 2D7QA 4NQXA 2Y25A 2WINB 2R69H 3NZHH 4RAVA 3HS0A 4DKFH 4PGCA 3HHRB 1U2HA 3NAAH 2BP3A 3A6OA 3B2UD 4MWFB 3HR5B 2VLRD 5AWNH 1JNLL 4QOKE 3ZSSA 1EO5A 1EGJH 4MA7H 1S9WB 1T83C 1RVFH 3KXFD 4U7SA 3MUZ1 4UIKL 5ADOH 5I8KL 4NQEB 2R23B 2VNCA 2CXGA 4XAKD 3B83A 4QWWD 4RDQG 1XZ0A 4I9WE 5E6IB 1KPVA 3D3VA 3V2AR 4DW2L 4M6OL 4ZFOA 2W0LA 4HAGA 2OR7A 1KEGH 2FD6L 5F7FA 1CXHA 1DBAH 4Y8AA 4IRSB 2B4CC 1H8SA 2WBJB 2CRYA 4QCIB 2JELH 4FG6C 3UTSE 4YHLL 2QR0A 5HGAA 3QI9A 1FP5A 4RFNC 3SY0A 3U83A 2IAMA 2UYLB 3DURB 4HDIB 1RHHA 5CMAB 3C2AL 3L3OB 3MROA 4PJGB 5B38A 5LGJA 2BY3A 4YDLC 3G08B 2PXYA 5B8CB 1HEZA 5D93B 5DYOA 3GJFA 4M93B 2ZCHH 4TOYL 4P4RB 1BEYL 1H3VA 2ZOKA 3CVIH 3OKMA 3JV5A 2HJFA 5FKAB 1F4YH 1QFWI 2XQYK 4MNQA 4WHDA 4JKPH 1AXTH 2VDKL 4WUUB 2DJUA 5HGBA 1BM3H 1EEQA 1IGJB 4MNGA 3VGAB 3IDUA 5CSGA 2PO6C 4JQVC 1WZKA 3JWOH 3O3DA 5JPMA 3MC0A 1XF1A 1QYGL 4URTB 3IKCA 5T3ZH 5IM7B 4I4WB 5BMFH 3GFUA 3OKYA 2WINA 3KPQB 5TPWH 3MYJB 4NPYA 4LVEA 3QDGD 5C0BE 1A6TA 4NKDB 4MWFA 3HR5A 5HDBE 4WRLA 3IRZA 3B6SB 5EU5B 1V5JA 4M02A 1RZJH 1MJ7L 5L8KB 4M8QB 1KIPB 2HJKB 3CLEH 2W0KA 3HB3C 4NQEA 4R6UA 2R23A 4M43L 4F7CA 4EN3D 1FVCA 2V17L 4H25A 3G9VA 1MQKH 3MOAH 3RWIA 1Q94B 1RZ8B 4KRPB 3EDKA 3Q1SH 5F3HA 3RL1B 2A6DA 4CADB 2J2ZA 4G7VH 4ZXBB 1CGVA 4ZUSB 3V79C 4MXVE 3ZDZF 3V4PL 5DUBA 2WBJA 5JW4R 1QLRB 4QCIA 2Z31B 1BMGA 3L9RB 5IB4A 1BBDH 2UYLA 3DURA 3M07A 4HDIA 4QRQB 1HHIB 1YEFH 3MREB 3L3OA 3T8XB 5L6YL 4PJGA 1F58H 5B8CA 3NZHL 1BOGA 3KR3L 5D7JA 3BQUD 4ELMF 4R96B 2O5XL 5FKAA 4NWTH 3T2QA 1X7QB 2GSGB 2PW2B 2J8UB 43CAB 5CBEB 1RVFL 3TO4B 3RNKA 5ADOL 4EDXA 1DVFA 3RHWK 3AM8A 5M94B 4U1GC 3P4LA 1K2DB 3P4OB 3OKKA 1WZMA 1XR8B 5CLWA 1TJHH 4S1RH 5HHPA 1FLRH 2W0PA 2A74B 1Y0LB 1KEGL 1DBAL 4I4WA 1NC2B 1D6VH 3C08L 3SCMC 2XWTA 3KPQA 3DX6A 5JMOC 4W6YB 5EIVA 1DL7H 2JELL 4N0UA 3MYJA 3GMMB 2IBZX 2YPVL 2XTLA 2D7MA 3FMGL 4G6FB 3X3GH 3P40A 2LU7A 4LCCA 1P2CB 3B6SA 5EU5A 2WSKA 3RUGB 5JUEH 4M8QA 4Y16C 2BJML 3OPZH 2ZCHL 1JZ2A 1KIQB 4OQTA 5IT2H 4JM2F 1CFBA 2YZ1A 1F4YL 1G6VK 4FRWA 3HCVA 1Q94A 1VESA 4U0RC 4CADA 3RL1A 1BD2A 4ZXBA 1VPOL 4ZUSA 1PSKH 4RMVA 1BM3L 2V6HA 3BEVA 4HUVB 3ARFD 5C70A 4YUEH 4AJ0A 4KHXL 2XY1A 1QLRA 3I02B 4O00A 3MRHA 5CKGA 4P2RE 2Z31A 3L9RA 4WTWA 1LEKB 2DQJL 3K3QA 1ITCA 4Z0BH 1HHIA 3MREA 3T8XA 3F7YB 3MOQA 5BMFL 1JWSB 1XEDA 3BPNB 3U4AA 1CGTA 1AR2A 4XPGL 5I15L 5TPWL 3HZMB 1UCTA 4J12A 3FRUB 1X5JA 5C0CE 3P4MB 5EOCJ 4CW1B 1X7QA 4WFHE 4JG1L 3BWAB 43CAA 3GSNH 5CBEA 4CBPA 4PBWD 4B0MM 1YEDB 3TO4A 1RU9L 2BERA 4OCNC 2WWMC 3FQUA 5T1LD 3P11H 1CFNA 4XZUB 5DRWB 4R7DA 5IB1B 3K8MA 1K2DA 1MQKL 1X6LA 3MOAL 5KSAD 3P4OA 3INUH 3SEPA 2ZZUT 2YHGA 3Q1SL 3V5DA 4G7VL 3KYAA 5DD0L 1Y0LA 3RJQB 1J8HE 2Q3ZA 1NC2A 4J4PA 4HXAL 4MB3A 4WEBH 1S7RB 4M5ZH 1KB5L 1DQTA 3CUPB 4FFVC 5I1GH 1A1NB 4NQVB 5DQ9B 2EXYD 5IR1B 3CMOL 4M4RA 1YEFL 4N5EC 3O2DH 5FYKU 3QDMD 3N0PB 1E4WL 1WBXA 1F58L 4HIIB 3QDJE 4UNTA 3B9DA 3RX5A 3RUGA 2Q20A 1EV2E 1BF8A 1BBJB 5D1ZC 2DF3A 3TPUA 2XTJB 2AP2A 4S10A 2W1NA 2HMIC 2P45B 2IADB 2UWEE 1FL5B 4APQB 5IFAH 3P0VH 4P2OB 3RWHA 1YN7B 3IFLL 4FQ2L 4K94C 2FHFA 5JHDE 4R26L 4DN4H 3C09C 3MNWB 2IH3A 2FJGA 1DN0A 3I02A 1YEHL 4FZ8L 4WJ5B 4FFWC 1SQ2N 2QLVB 2BSTB 3F7YA 3VG9C 1KC5L 5DD3H 2NX5E 1JWSA 4WI6A 4KK9D 2WP3O 4P5KA 4XWOC 4HUXA 3EHBD 5HYJA 1DL7L 3HZMA 2ZG3A 3I6LE 4PS4H 1JI2A 1FL3A 1P7QA 3P4MA 4CW1A 4LQFL 1BJ1H 3AMLA 1CU4H 3BWAA 5J1AB 1MJUH 5TE7L 2F15A 2PW1B 4PJIB 1IARB 3H0TB 1PKOA 2AJZB 1YEDA 5HD8D 4M9PA 5SX4I 2X09A 2EO9A 2YD9A 4XZUA 5DRWA 5IT2L 4PTTA 1F5WA 5CD5C 1WLHA 2VXTH 5LKNA 1PSKL 2NZIA 3IYLW 3STLB 4EI5D 4HIXL 3G5VB 4YUEL 3VFOB 1OGAB 1LO3H 4MA1C 3AREC 3QG6B 3O6KL 2PKDA 4NQVA 1OCWL 5DQ9A 5C0EB 4W4NA 4XHJD 1OLLA 4Z0BL 5LBSL 5D8JL 1EHNA 1PVHA 4HIIA 1S9XB 2YA2A 3TVMC 4MXQD 4OZFG 4PJ9B 5E6ZA 2VITB 4Z7OF 2D0GA 3IU3B 4CMHC 4JFQA 1Z6JT 4H20H 2BMKA 2CUHA 1MJ8H 2XZAH 3MJ7A 3OZ9H 2IADA 1FL5A 4OZGE 4APQA 2X1PA 2PF6A 4P2OA 4YDKL 5EU6B 3RKPA 2ZJSH 2AJXH 1U3HB 1JZ4A 3FO2B 1CXFA 3MNWA 3LKQA 3QNYB 1AQKL 2ESVA 2V5TA 1UM6H 1VFAB 2J5LC 2CMRL 4WJ5A 3LKRA 5MHSD 5IEHA 3INUL 5MENE 4PRDB 4HAFA 4RX4A 4WI5A 5HVFB 4NQCD 3G5XA 1L9MA 1IZKA 5I1LB 4WEBL 3NTCL 4LLWA 4M5ZL 4LFHG 4G8FA 2BDNH 4PJBB 3EFFB 5FA3B 3TJEH 2X89D 1MCDA 3GM0A 3SGDH 5J1AA 4OLEA 3TIDB 2PW1A 3MODL 2QADD 3BH9B 5K9OB 4XWGL 4Q0XH 3A6BL 5KN5A 4NC0B 3LH2H 3O3BA 3EIFA 4IJ3C 3GO1L 1EEUA 4ONOA 1OY3B 2FECL 4W70A 3LY6A 3CH1B 5T1KB 1A6ZB 3P2TA 1QRNE 1CN4A 1RZKH 2AJUL 2CK0H 3EO1B 4HC1A 2PNDA 3STLA 2Z92A 3G5VA 2FR4B 3VFOA 1OGAA 3FFCB 3LQMA 4Q9QH 4XMKL 1MAJA 3QG6A 3WN5C 5EIIB 3ARDA 1LE5A 3I84A 4PJ8B 4NQSB 1PX3A 5ANMB 4LP5A 3LMJL 3PHSA 4PJ5B 3BN9D 2Q3AA 5C0EA 3B2VL 5CFHA 3O41A 3U0TB 3KG5A 3V95A 3IXTB 1S9XA 2QTEA 1XFPA 2IAND 4M4PA 4PJ9A 2P42B 2R56H 3FO0H 5DMYA 3MZGB 4PS4L 2QBWA 1OW0C 3QEHB 4PJGF 1NC4B 3F7QA 2XXMB 4OGAC 5DFVD 5IVXA 5E08H 1RUMH 4TTDC 3QUYB 5EU6A 1TLKA 1U3HA 3FO2A 4KMTH 4E0RB 4BYHA 2P1YA 4MJIB 3B8SA 2NY1B 1D5IH 3C5JB 1A0QL 1VFAA 4GG6E 3SKMA 5HGHA 3O9WB 4EXKA 1IGMH 1JHLL 4PRDA 5JXEC 4JRYA 1Y6NR 3VFSA 1OP5H 3BD5A 5I6XC 1S7QB 4X4XB 4UB0H 1F4XH 1LO3L 1KELH 1UVQB 3LKSB 1F45A 4MQXD 4ZD3L 1QFWH 4Z7QF 3DMMD 4XCFH 4MQTB 5FA3A 1U3JA 2EDJA 5D2LA 5HPMB 3RX8A 1VEPA 3DETD 4QKXB 3TIDA 5K9OA 3BESR 4C55A 3IDJB 2VH5H 3DVNA 4H20L 1HHGB 3F6LA 1CE1H 5LQBH 4G5ZH 2XZAL 2AAVA 3CH1A 5T1KA 4N9GB 1A6ZA 1FYTD 1L0YA 3QFJB 2ZJSL 4LCWD 1RIVL 2FR4A 1GVIA 3FFCA 1I75A 5IV2B 3B5GA 2F53A 4M1CD 3PGCA 5EIIA 1GZPB 1J11A 1C5BH 3EDJA 1JF5A 1IC5H 4XCEB 4Q6IB 1F3RB 1G7QB 4NZRL 4ZS7H 2LAGB 4YC2C 3N06B 5IB3B 4PJHB 4X5LA 2AJ3A 5B21A 5LXGH 5J1SC 3RZCD 4YIQB 4HD9A 2W9DH 4DZ8B 2BDNL 4LOUC 2VERN 2EDOA 4KQ4L 3QEHA 1NC4A 1U8QB 1T1XB 3LS4H 3TJHC 3TJEL 1YQVH 4HCRH 5ACLA 5TFSH 1AKJD 1D5XB 1MI5B 4LSPH 4E0RA 4JCLA 1W0VB 4M5YH 3VFMA 4Q0XL 3B9KB 3WE6A 3GRWA 4MJIA 3C5JA 2J8UF 2RCSL 1RUPH 3EJZD 1KPUB 2E7LA 1RZKL 2KL6A 1WWAX 1RZFH 4UQ3A 3OB8A 1A6WH 5IIEB 1IM9B 4S0SD 1XGYH 4KDWA 4Q9QL 4POZD 1UVQA 2FWOB 3QT2A 4G8GB 5IFHL 1MF2L 3R0NA 4WV1B 3CDYA 1DQLH 1N4XH 4OFVA 2VUOA 4LU5L 3V8CA 2VLKD 5HPMA 3C6LB 1P5VA 4MD0B 2WANA 4A6YL 5I1DB 2JIXD 3IDIA 3QEQE 5F44A 4EI6B 1YC8A 1MCLA 3OGCB 3B9EA 3IDJA 1HHGA 2DDQL 4M1GL 2C3HA 4IDJL 5DURD 3RUGF 4N9GA 3M45A 2VLLB 3PGFH 5IV2A 2KPNA 1GZPA 1EVUA 1L7IH 2DQDL 3CX5K 4AH2B 4OFDA 1C16A 5AZEL 3DLQR 4Q6IA 1G7QA 1IGML 4H0GA 3MJ8A 4PJHA 3N1PC 4UILL 3HUJE 4UB0L 4M7KL 4YIQA 1QBML 1W0WB 1T5XA 1A3RH 3KHQA 5FV2A 1J0JA 2C26A 2PYEB 2XZQH 1U8QA 1T1XA 2EH7L 3MLTA 3MNVA 1VSCA 1BQHG 4KVCH 1D5XA 1HCFX 1E28B 1OAQH 3VFUB 1W0VA 3PDGA 35C8L 5MP6H 4KKBD 4QRRD 4OLYL 2IQAB 5HSFA 3D69B 1CE1L 5C2BH 5LQBL 3B2UC 4MJ4A 1KPUA 4OGYH 2QQNH 3DVFA 2G2RB 3KPSB 1KJMB 4PJDB 1XIWB 4UMGA 4MX7B 3V52H 3ES6A 1QZ1A 1FORL 4DTGL 2FWOA 2HFEB 5ABDE 4O2EB 1T2XA 1C5BL 4NCDA 2GYSA 3HE6B 1IC5L 4G8GA 2XFXB 3NACL 4QWWC 4AIOA 5HBBA 5GGRA 4WV1A 1GOGA 4PJAB 1FN4B 3CSGA 3W5NA 3I50L 1YEKL 3C6LA 5IK3B 5F7NC 4MD0A 3RFZC 2K1MA 2DTSA 3LEXB 3O3AB 4OZHE 5I1DA 4ESKA 5C07E 1SVZA 4EI6A 3VJ6B 2BNRB 1YMMD 4UV4L 4B50A 5F1NB 1XGUB 3AS1A 1MCEA 2Y5TA 4OT1H 3UTTB 4CJ1A 5TFSL 3IETB 4O4YH 3GSQB 4UAOC 4P9ML 3LN5A 3MV01 1S9VB 4P46B 5F7LB 3ZT7A 3HE7B 4HFUH 2VZTA 5ADPH 4Y1AD 4LSVH 4KXZI 5JW4N 2IH1A 4GKNA 1FYHB 1A6WL 1ZVYA 4AQ1B 1XGYL 3RI5F 5D7LB 4K8RD 4GAGH 3OKOA 3C8KB 4XC3H 1W0WA 2JCCB 4A2LA 5J4MA 4KKLD 1J0YA 2VLRE 2PYEA 2F9BT 1DQLL 1C5CL 1RURH 4Q7DA 3IT8D 3P9WB 1LO2H 1LE9A 1E28A 5EBLB 5DD5L 2NLJB 3WNNA 3LD8B 2HT4D 4YAQA 3VFUA 3IVKB 2NYYD 5CIPB 2IQAA 4U1IB 1N6QH 3D69A 4M48L 2X70A 1YN6A 3MRCA 4ORZC 4C4KT 1DSFH 4LHUA 4PJIF 5ISZD 1LK3H 2H32H 4UIMB 5GS2H 5J57B 3PNWA 3KPSA 4Y5VC 5I1CL 4M6NL 1XIWA 3TH3T 4IEFB 4JM2D 4MX7A 3U30C 1DANT 3WNKA 4EN3C 1LDSA 3HE6A 4Y4KB 3RGVB 2XFXA 3WXWL 3FB5B 4GMSH 3WNMA 4PJAA 5GZND 1MFDL 1O7VA 4UV7L 5IK3A 1NFKA 3LEXA 4NO2B 5SX4H 3QRGH 4NQDB 4QHUB 5BW7C 4NBZB 1NCWH 2FLRT 5DMJB 2Q7YA 2PCPB 2LU3A 3ARQA 3MLUL 5F1NA 2D2OA 3ARRA 4RFOL 3UTTA 1EDQA 1HHJB 4X9HA 4KVCL 5GRJH 3DRQB 4P2CG 1S9VA 3AVEA 4P46A 1QUNA 4OZFH 3HNTL 4ETYA 5I1IH 3VFVA 3HRZB 4YGVA 3HE7A 5MP6L 3O4LB 3S3SA 1MCHA 1G7HB 3BQUC 2DM2A 4JHWH 1CGYA 1MELA 1IL1B 4OGYL 3O0RH 2QQNL 1I8KA 3CX5J 1KLGB 5L2KE 5SWZB 3V52L 2ZSVB 2ZSWB 2EDXA 3BUYB 3FT3A 4GOSA 1F8TH 3C8KA 3ZDXE 1AD0A 2JCCA 3QDGE 1RIHL 4JHZA 5HHOA 3UBXI 4LKCB 1NMCB 3P77B 4D0CB 3DGGA 1FNEB 2QQLH 5FGBA 3K81A 3LZFL 1BWMA 4XCYB 1TETH 3IVKA 4PJBF 3BPCB 3F5WB 1MH5B 2VXUH 5CIPA 4U1IA 5I2IA 1DN2A 1T21B 1NAMB 1NKOA 5TE4L 2CO7B 5FA4B 4O4YL 5C08D 1A3QA 3L3JA 4UIMA 1VGEL 1IEBA 1CLOH 5HYSB 5DRXB 4JREB 2AJVH 2VC2H 3NCYS 2OZ4L 3TNNB 1GZQB 4Y4KA 2W92A 3RGVA 3VWKD 1NCNA 4LSVL 1E27B 3VRJA 1NAKL 3STZB 2VZ1A 1YNLH 1N64H 2YRPA 3CD4A 3F62A 2C5DC 2WIMA 3ARFC 3DOSA 4QHUA 4DKEH 4P3CH 4AEEA 1AGCB 1OF2A 4ZO6A 1CVRA 1CR9H 3F7VB 5DSCB 1J1XL 2FB4H 1RURL 4RGNB 5F71A 2OL3L 3M17A 3QUML 2CLVA 5HGGS 1U8PA 3UJIH 4XH2A 4JFYB 4XX1G 3BGFB 1FNSL 2DLGA 3D0LA 1WAAA 3O4LA 3WNLA 2GK0A 4LEOB 1G7HA 3RU8L 5EOQH 4UDTB 1XGQB 4G43A 5KS9E 4XPHH 2G60H 1KLGA 5B3JF 4EOWH 1ITBB 1NCDL 3BUYA 1RZGA 4K2UL 2L0DA 4LKCA 4AEHL 2DM3A 3QYCA 1H5BC 5KSAC 2Z35B 2Q87A 3P77A 4D9QE 2X4NB 5ACMA 3T4YB 1QPXA 2NY7L 1A6VL 4Z0XA 1KN4H 3D3VD 1F13A 3QRGL 2DM7A 1NCWL 1LD9B 3F5WA 1MH5A 5CLTA 4XP9H 1ZLWK 1T21A 2EDFA 3QO1B 2EXYC 3RQ3A 1NGZA 5EZLB 1HK6A 3QI9D 5GRJL 5FA4A 1JZ5A 2B20A 2IAMD 1G7JB 2YRLA 1MCWM 1W8NA 4ODWB 1I1CA 2FX8L 4C59B 2VYRE 2PXYD 3TFKD 3H9YA 1MWAH 3TNNA 4JHWL 5FKPB 2DD8L 1F6AB 3U46A 3VH8G 3P0GB 4HIHB 1T2JA 3O0RL 4O51A 3UX9B 3GDBA 2CKBH 3GI9L 4MNQD 1OTSD 1OVZA 1J0HA 2NW3B 4HXBL 4LGPB 1F8TL 2FSEB 1AGCA 2NQCA 1HH6B 4JGJA 2GJ6A 4PJHF 2W91A 4NZJA 3FKUS 5E56A 4OLZH 5FYJH 5LGHH 2WBKA 4ZUWA 4TSBL 2APVA 4NJ9H 5FGRA 1JGLH 1TETL 4KK9C 1FIEA 3AGVA 4JFYA 5H94B 3V7AE 1CDBA 3EHBC 4W68A 2CDEB 3VMPA 5GGUB 2AK4B 4LEOA 1MFCL 5FGCB 1RPQA 1XGQA 3QP3A 3P9LB 2XN9B 3BUTA 4CN1A 5M7QA 4R97C 5TJWK 3PP3H 5JNYB 4LPCA 1MRDL 5D2NA 4BQ8A 1IGIH 4HGWB 5HD8C 4MS8D 2AJVL 4M3KB 1QHPA 4BQBA 4K23L 5GIRB 4NQED 5FK9B 2AI0H 1T2QH 2Z35A 4KJYB 3SBWC 2X4NA 3F12B 3T4YA 3NCBB 2Y36H 5IW3A 3T0EB 1N64L 3MUJA 4EI5C 1KF9B 3MZTA 7FABH 2NXZD 4NP4H 1Z5LB 5I1HH 4LLVB 4OSUH 5T1DL 4P3CL 2DLFL 3T0AA 5DT1L 2WBJD 4NUGH 4U7MA 2FB4L 3QO1A 4JFOB 4LAJH 4YDJB 5EZLA 4BKLB 4XHJC 5D5ME 2E7MA 4P2QE 1UC6A 1G7JA 5I19L 3CFCL 4MXQC 2HLAB 4ODWA 4J6RH 3NCMA 4F80A 5F3BB 4JKKA 2ADGA 4OD1H 4QGYA 2YD3A 5D7JD 5EOQL 5SWSE 3U6RB 4N0CD 5FKPA 4N9OB 1Q72L 2JJTC 3WEXB 4HIHA 4LSQH 4DGYL 1ZLUK 3HZYA 5FM5M 2V2TB 4EOWL 3T77A 4FQLH 3MFFB 3IF1B 1RJLA 3MUGB 3ULVF 3PWPD 1DVFD 1HH6A 3AROA 4G8IB 5DLML 4LGSB 3BAEH 1AQDB 5KVEL 1KN4L 3OJMB 1IQWH 2XG4A 5F6HI 4L8CB 5H94A 2FEEL 4H26A 2CDEA 5GGUA 4XP9L 1A4KB 2NY0D 2IPUG 3K8KA 2X4SB 3HZVB 3P9LA 2XN9A 2Z91B 5FHBH 2BVYA 3R06B 5F8RC 5C0BA 4CVZB 2QADC 4XT1C 1PZ5B 1OAKL 3MGTB 1T5WB 1BJMA 2OJZL 1BAFH 1MWAL 4JN1H 1TNMA 5GIRA 3ZLQC 4WTZA 5FK9A 1IGTB 2ICCA 4PJDF 4KJYA 3TA3B 1S9KC 3PL6A 3F12A 2DMBA 3ARYA 5C0RH 3BSZH 4KRPD 1D6EA 1GAFH 2D7NA 3ULSB 4DFHA 4WW2C 1BD2D 4ZXBD 1HZHH 4LLVA 1UJ3A 4PJAF 2I60L 1T4KB 5BVPH 1ZWIA 3BN9C 5FYJL 3F6IA 4BKLA 5KZCD 3BDXA 2XICA 4J23A 5AUMB 4F37F 4NJ9L 3GBLA 2MOVA 3N1QC 5GJTH 3KLDA 2OMBA 4ZTPL 2C3XA 4RZCA 5F3BA 1QPPA 3U6RA 3BKJH 5DFVC 3WEXA 1AGDA 1D7FA 1SYVB 2EXWD 5ITBH 2H9GB 1ADQL 1MREH 4GRWH 4D9LH 5FYKH 5HJ3B 2RIKA 2G75A 4KPHH 1W72H 1IGIL 4V2CB 4FFYH 5C09B 4EVNB 1HOCB 3MFFA 5GRWA 5E4IA 1A6AA 3CCHB 3IF1A 3K8LA 2AW2A 4JPWL 4G8IA 4C83B 2AI0L 1T2QL 4CKVX 1BGXL 1QSFB 2Y36L 1WZ1H 4OLVL 2WM0A 5EULV 2JCCF 4PBXA 5FOJA 4NP4L 4LASH 4JQIL 1G9NH 1NC2D 4J4PD 1GPOH 1DQQA 5C0JB 3VXMB 4MQXC 2CJUH 4NUGL 3DMMC 1LO4H 4KXZH 4YHML 4PG2C 1IGFL 3RWGB 5GS0D 3ILQD 4G6FD 3DETC 1KBGL 5CINH 4F33A 4GKOA 1YYLH 1CICB 5F9JA 1PZ5A 4F7PA 5I71C 1QVOB 3MV8B 5DQDH 1HHHA 2Y06L 3EOBB 3MRPB 4Z5RA 1WIPA 4UZGA 2OBGA 2GIYA 1CT8A 4PJFE 2Q1EA 4NIKB 1BJ1J 3I9GL 3TBTB 3NIDE 3ULSA 3S97C 1FZJB 2V2XB 2YS4A 4M1CC 2MKWA 1BFOA 3WKML 5I0DA 2YWYA 2NY2B 4HFWB 1UKTA 1UYWL 5AUMA 1II4E 4N8CL 1IQWL 2RBLA 3TO2B 1EMTH 3RZCC 1J87A 1KCRH 1INDL 4UQ2B 5C9JB 3MRGB 1ZT1A 2UV3A 5HYJD 1YNTB 5JW3L 1FLTX 3PV6B 3OJ2C 2H2PD 1UT9A 2IJ0C 1P7QD 1KB5A 2J88L 4B41A 1WAAF 5C0CA 1CD1B 1LO5B 1G9MC 1LEIB 2VQUA 5C09A 4EVNA 1MIMH 4WCYH 3C60B 4JZNB 5KSBB 4JN1L 4N0FA 4WU7B 4GW1B 3E2HB 4C83A 4L3CB 3EJZC 1QSFA 5IOPB 1CTOA 3OKEB 3BSZL 1GAFL 4JDVB 4GRWE 3KYKH 5MI0B 1WGOA 3CVHB 4LVOB 5D7IB 1HZHL 1NFDE 1VFBB 2ZCLL 3VD4A 2ICES 4POZC 2IBGA 1J8HA 5FO8B 5BVPL 5C0JA 3VXMA 3GSNB 5F9WB 3RVTD 4BJLA 1QRKA 5AYQA 3D9AH 1FYTE 3ZDYE 3ZE2E 5HHNB 3PWNB 4LDOB 5JXAH 1FVDA 2Y23A 2GTZB 1U42A 4PGBB 1E4XL 4GUPB 1QVOA 3MV8A 1WTGT 2B5IB 3QDJA 3MRPA 3BIKB 2XTJD 5ITBL 4OCXH 4D9LL 4GKSB 4RBPH 3TBTA 4APQD 1DFBH 1XCQB 1W72L 4P2OD 1QLEH 4JVWA 4NM4L 2UWEA 1M7DA 2V2XA 2VZVA 4HWEL 3T0WA 1F4WL 1K8DA 4FQIL 3UCRA 1UCBH 3BDYH 3ARVA 3FTGA 3QNXB 4I3RH 2ESVD 5C6PB 1NBYA 1X5AA 3L7FB 2UZIH 3MO1A 4NKIH 5L2JA 1WZ1L 2AV7B 3BVNB 1OB1B 4WWKB 1KJVB 4WENB 4FP8H 5J13B 4RX4D 3IU4H 1YUHB 1G9NL 4QY8B 1N59B 1T03L 3BHBB 3LQAC 4F58H 4ZSOB 3IJYB 3MRGA 2CJUL 1MFEH 3PV6A 1R3KB 5SV3A 4WIQA 3VW3H 3WNOA 5E1HB 2VOTA 1CD1A 4HKXB 1YYLL 1LO5A 1LEIA 2YPLB 1B4JL 4JZNA 4LCIH 4KKBC 5KSBA 3S35H 3Q2CA 2BNQB 4NO5B 1FIGH 3QWOB 5B3NA 1BZ9B 2VLKE 5IOPA 1G9ML 4N0RA 3V6OC 1D3CA 1DJSA 3VD3A 5D7IA 3P4NB 1VFBA 1X44A 3GBNH 4K7PX 1OGAD 5FO8A 3IXAB 2W59A 4GXUN 4NN5C 3GSNA 1EAPB 2NMSA 3ARDD 4JB9L 1FAKT 4JO1L 3TT3H 3BKYH 2D4FA 1T0MB 3CC5B 3V9FA 3GHEH 3WJLC 1N7MH 2X1WL 2BZDA 1WK0A 2H6PB 5IJKA 1WEJL 4PYHA 1HI6B 2DBLH 1VEMA 2DICA 1TCMA 5DK0B 1JZ8A 5MEPB 3OB0H 2GTZA 4PGBA 4GUPA 4RQQB 1WWWX 4PJ9D 3H9ZA 3MV9D 1HQ4B 5E2TH 2BVTA 2AABH 4JM4H 1TMCB 2K7PA 2ARJQ 4Z77B 1INQB 5L7XH 4GKSA 5DK2B 2FBOJ 1CE6B 1Z2KA 3OJDB 4K3GA 1L6XA 1OTUD 1QR4A 2HWZH 4MQSB 1U3HD 4WCYL 2FJFA 3CIQA 4JDTH 4X0KB 4MSWB 4ODSH 3O8XB 2FCBA 3DV4B 3E6HB 1RJYB 3QNXA 4NSKB 3P9MB 5DRZA 3NBNA 3QFDA 3SDAB 5L8JB 3L7FA 2BHUA 4WGWB 3UC0H 1ND0A 2AV7A 2ZG2A 3BVNA 1FO0L 3ILPB 4WWKA 4JRYD 4LCYA 1JPTH 1YUHA 4K8RC 3TV3L 5MENA 2UVFA 1N59A 3BHBA 1GC1C 4NBXB 2OTUA 4KKLC 1FCGA 2HRLA 1SYSB 1UA6L 2Q76B 5LCVL 5I8CB 1AHWB 1R3KA 1FSKB 3D9AL 3TT1H 2HTLD 3MXWH 4OIBA 1TZGH 2HP4A 4ENED 4HKXA 4RGMB 3NABH 2HT4C 4G8EB 3LQAL 4OD2B 2F8VA 2YPLA 4X4ZA 3U7YH 4RIRB 3T3PF 1EO7A 3E3QC 3DXAB 2NYYC 1UKQA 3PP4L 5B4MD 1RI8A 4WW1A 4NO5A 4RMWA 3ZDZE 1U36A 4P5TA 1BZ9A 1RHFA 3LOWA 5DMIL 5T1KD 1QLEL 1I85A 1A7OL 3CXDL 3GSOB 2DQTH 4JM2C 3T65B 3U2SB 4H8WH 3FQWB 1YMME 3IFOB 3T1FA 3FFCD 3IXAA 3PWLB 5GGQH 1R3IH 2IALA 4JR9H 5BQ7A 2F53D 2UZIL 4P3WA 2MHAB 1T0MA 1MCRA 5GZNC 3OHXA 4FP8L 4ELME 3MMEB 5AD0B 3DHMA 4NNYB 2UZYB 5BZWB 5MEPA 4RQQA 1FG2B 3WIHL 2ICEA 5CUSH 4PGEB 3KWWA 4RMQA 5ICYB 3VRIB 4KAQH 2I9LB 4PP1D 3V6ZB 5KJRL 1NC4D 3QWRA 3VW3L 5I73B 2A6IB 5IBLD 3FQRB 5GJSH 4R0LB 3OJDA 4NWUH 1IEAA 4X5XB 4LCIL 5F6IB 3QNZB 1RZ7H 4X0KA 3S35L 3O8XA 4RAHA 3E6HA 4P4KB 4NSKA 4DVBB 3P9MA 4MJID 1FIGL 1IAMA 2NY1D 3BFOA 5JOFB 4UI2A 1TVBB 5I66B 1C12B 4QRPB 4TQEH 4GMTH 5CJQH 5IF0B 4YHKH 5TQ0H 3ILPA 1SJHB 4GG6A 1CBVH 2NY5C 4RA3A 2W0FB 3FRPA 3QIWB 3GBNL 4RSVA 1KXQE 1IEHA 3VFRB 1AJ7H 4Q97A 1SYSA 2Q76A 1MJJB 3S5LG 3OR6B 5I8CA 1AHWA 5ISZE 3TT3L 3BKYL 2NR6D 4XRCB 3GHEL 2CUMA 1XH3B 2R15A 4K8RL 4AZ8A 3NPSB 4G8EA 1GC1L 4HJGA 5EO1B 2MTPA 4RIRA 4EKXA 4IMKC 4G6KH 4OGZA 4MJ6B 3KJ4C 2VLJB 1T7XA 3QWQB 2AABL 3U7WL 3BJ91 4DFIA 1IVLA 1MVUA 2X42A 3BEWB 3GSOA 1MFNA 3T65A 3U2SA 1ETZB 2VXSL 3FQWA 3BP7B 4F2MB 3BRDA 5FYLD 1OWRM 2XYCA 3S88L 4HZLA 4AG4H 3UC0L 2BSRA 4FQXB 4ZAKB 5BRZB 1C5DA 2NPLX 3I75B 1JPTL 4NNYA 3IJHB 5BZWA 1TCRA 5F97E 2DBJA 1A9BB 4UT9H 4BUGA 3VRIA 3TT1L 4EDWH 2UUDH 3RY6A 3OF6A 4PB0H 4HS8L 1TZGL 3UPAA 3V6ZA 3PJSA 1X3DA 1KLUB 2A6IA 4KY1H 3FQRA 3NH7H 4R0LA 3D1MC 1XCTB 1CLZH 2IG2L 4X5XA 3U7YL 3W9DB 1A4JB 4JG0L 2ZNXA 3HI5H 4BZ1H 3RGHA 3EDFA 4L9DA 5JOFA 1TVBA 1C12A 4QRPA 1FQ9C 4D8PB 1LGVA 5IF0A 4LMQE 4LGRB 1GH7A 3ZZ1A 4LLQA 1R5VB 2MWCA 2W0FA 3QIWA 1I1AA 1K4DA 4MAYB 2WNGA 4MB5A 5KW9L 2NW2A 3D39E 3ARPA 3WLBB 3VFRA 3BIBX 5GGQL 2VDLH 2XPGB 3U48A 1MJJA 4X80H 3CFIC 4XRCA 4G8GD 1H15B 4LEXL 1XH3A 2NY5L 4OIIH 4U1KA 4HUWB 1NMBH 5EO0B 4LDLB 3OAZK 1CFVL 3K46A 4J3WA 5EO1A 4U7KA 3QPQD 4N8VG 2R0WH 3GSXB 5CUSL 2AERT 4MJ6A 4R8WH 2VLJA 4YPGA 1HH9A 3NGBC 3QI9C 3QEQA 3ZKMD 4ODBD 3QHFH 4JFEE 1K8IB 2IAMC 3WUWG 4WFFE 3W2DH 1F3JA 3MX0A 4FQJH 1A6UH 2G5BA 5MEQB 2PXYC 3TFKC 1RZ7L 1M6OB 4M62H 1NBQA 4X4ME 3BP7A 4YXLH 4F2MA 3HG1B 4XXCA 3L5IA 4TQEL 4BFGA 4FQXA 2C3GA 5CJQL 5BRZA 4YHKL 2MMXA 2VDOL 3GMOB 1OTSC 2ZG1A 3I75A 1HKFA 2DWEA 4LRNL 3DVGB 3UJJH 2EYTB 1AJ7L 2BVPB 3LQZB 4TSAH 3S3JA 3L5XH 4HMEA 3VFGH 4O02L 2VL4A 5DF0A 1C1EL 1ZLSH 1UEMA 5ETUB 2PYED 1KLUA 1Q9KB 4Y2OA 5GRXG 1HYRC 5T3XH 4HH8A 1FRGL 3W9DA 4ZO9A 2A73B 5C7XH 1A4JA 4K7PL 5IJVB 3L3KB 3BZFB 4YR6A 3BP5A 4UTBH 5GRVL 4U6TA 4D8PA 5IHBA 4G3YH 1U0QA 4LHUD 3RZWA 3D3VE 3THMH 5KSBF 2KDGA 1OT1A 2MQ0A 3MGOB 3RAJL 1R5VA 4S1SL 3KPSD 4G6JL 1FFNB 1CCZA 4MS8C 1XIWD 4HCRA 1CK0H 4YNYB 2FJHB 5DEZA 1AO7E 2XPGA 1RUQL 2DM4A 5D7IF 3HE6D 4OGXH 1H15A 1NBVL 4Z7OE 5LJYH 3Q6GH 3U0PB 4XNXL 2NXZC 3KPMA 3LEVH 5EO0A 5A16A 5B39B 4JZJB 1TZIA 3QXWA 5F72S 2WBJC 4OZHA 2NY4D 2R4SL 4I0PA 4ACPA 4ALAH 4MNQE 4KY1L 1K8IA 3UTTD 3NH7L 5HHQB 2Z9TA 5JORB 2CSPA 4HGMA 1E0OB 5B22A 5AZ2L 5FB8B 3AXLA 3O3UN 4YDVB 5MEQA 4XNQA 4ZTOH 5B8CC 1M6OA 4P46D 4XVSL 4XC1H 4MNGE 3O11B 5E5UB 1VFUA 2HRPH 5D7JC 3HE7D 2Y7QB 5D93C 4M93C 4ELKB 1L7TL 4FQQA 5CHNA 1IMHC 2E6JA 2EDWA 3EO9H 2ZKHH 2QKIB 4GRLB 1ZLVK 4Z7WB 4WDIA 3R4DA 3GMOA 3TBVB 1QFUH 1HDMB 3DVGA 4CUCA 2EYTA 2BVPA 1CFSB 1DVFC 1DLFH 4X80L 3SQBA 5HHOD 3HMWL 2DQIL 3H3BC 1U58B 4DUVA 1F11A 5ETUA 1YQ2A 2E27H 5HHXL 1Q9LB 1Q9KA 4BSVB 1URLA 1NMBL 3TYFB 2X4PB 1K9TA 1UACH 1QACA 2R0WL 1IAOB 3WFEL 5IJVA 3L3KA 5JPNB 1JIBA 4NQEE 1FL6A 1YJDC 2NY0C 3BZFA 4KUZH 1HXYB 2AV1A 3QHFL 3BE1H 4HKBB 1T7ZA 1EO8L 4YH6A 3W2DL 5JHLH 2GAZA 4ZQKB 4LCCC 4FQJL 1A6UL 3MGOA 4M62L 4H5SB 3O3EB 3FFDB 2DI9A 3OJVC 3L3HB 2GT9B 1DQJB 2VN7A 3REVB 4Y4KD 3RGVD 2Q8AL 3NIGF 4KRPC 4PJGE 3V0WH 3QXUA 4XP4H 4XB7A 5HDQL 1Z0NA 5EZIH 5GGSA 1MCPH 5I17A 3U0PA 4KFZC 4JZJA 2H32B 4G6AD 4WI3A 1T04A 3L5XL 5IMKB 5GRUL 3FT4B 4WY7H 1GCFA 1Q0XH 1ZLSL 3VXQA 5IESH 4N8PA 5ICZA 1G9EA 5HHQA 4JPVL 2KZ1B 3D18B 3ZHKA 4J3UA 4WUUE 3GI8H 1FPTL 4J8RA 1FCCA 5C7XL 5DR5H 1QR1B 4PGJA 4P49A 4X9IA 1V7ML 2Y7QA 3O4LD 1IGCH 4I3SH 1Q9OA 4QXGH 2EXWC 4UTBL 2FX9H 4QXTB 4OM1H 1H3GA 4GRLA 4Z7WA 4Z7VB 3M8OH 3THML 1VENA 5E8OA 3TBVA 4Z7QE 1RK0B 3DUSB 1PGRB 4M7ZC 1HDMA 1F3DH 1I3GL 2DB8A 3MLRH 3O2VH 5FM4A 5KAQF 1U8MB 2YXMA 5L2KA 1CFSA 3MCKB 3HNVL 5E7BA 1U58A 4OZFB 4OGXL 5J9PB 3WSQH 1Q9LA 3ZKND 2GFBA 4BSVA 5I0ZA 3U4EB 3TYFA 2X4PA 3LEVL 1FJ1B 4R4BB 4KROB 6FABL 4J4PC 2P44B 3QULB 5FUCE 5C3TA 3JTTB 3H3PL 5HYFA 3KPOB 3D48R 1Q0YH 4ZOCA 3SDXB 5GS0C 3DARA 3ILQC 1X5GA 4HKBA 1JV5B 4ZQKA 3P73B 4NKOA 3MRRB 1G84A 2AGJL 1BQUA 3UJTH 5BJTA 4XC1L 4MD4A 2HRPL 3FFDA 4NRZB 5E94B 3QUMA 1MIEH 1JTPA 1JPSH 3L3HA 3QQ3A 2A9NH 5IGXL 1NLDL 5JO5A 1GGCL 5BV7C 4DKDC 1QFUL 4BA8A 2NY3B 4RWYH 3W82A 2H32A 4L3EB 5I8OH 3CFBA 1R24B 1DLFL 5IMKA 4BFBD 4TPRH 3FT4A 4IRZL 4H1LG 4FXGA 4JZOB 1V3KA 2GJ6D 4FTVA 1S7XB 1ED3B 4L3AA 5J11C 2EYSB 1UWXH 3D18A 4LHJB 2J8UE 1ZT4B 3BPNC 2VL5B 1QR1A 1LVEA 3TWCL 2OXGA 4N68A 1OQOA 2CK2A 3OX8B 4HULB 2D31B 1QO3A 3VXPB 4KUZL 4WGVB 3QJHB 2H2PC 2WUBH 4QXTA 1PW3A 5DUML 1LDPH 4Z7VA 5F70A 1RK0A 1IC4H 3DUSA 3TYGH 3SE3A 4NUJA 1CXKA 3PXJA 5E9DB 5KG9B 5K59F 4OCYL 1KYOK 4R90H 1IKFH 2DIAA 4IRJA 2XG5A 4OZFA 2YC1B 2FHCA 1A7RH 3S3PA 3LRSB 3V0WL 4GJTB 2BVOB 1FJ1A 1DBJH 1B2WL 3RUGE 3TC9A 5C6WH 5E5MB 1H8NA 1YECH 3QULA 4U3CA 4WY7L 3RVTC 5IESL 4OAWA 3PWJA 3KPOA 4UNUA 5FUOH 4EXPX 4OV5B 3SDXA 1JV5A 5DJCB 5E70A 3P73A 1PY4A 3MRRA 3ET9F 3VGFA 3S34H 5DR5L 1DE4B 2ARJB 4XNMA 5E94A 5DRNA 1ZA3A 1NANI 1P4LB 2E7CA 2ARWA 2IPTH 5GS0L 2XTJC 3PABB 4JQXA 4OM1L 1FFRA 3OR7B 3W0WB 2XRAH 4APQC 4P2OC 4PJXB 1NSNH 3ARXA 3MLRL 4P9HC 4L3EA 3SE8H 2B2XL 1R24A 2L7JA 3RHWF 2Y9RT 3FB6B 5IBTH 1S7XA 2EDRA 3DIFB 5L0QB 1ED3A 1KCLA 1JNNH 5HHVH 4MHHI 1W2KT 1ZT4A 5H2BB 1QBLL 2IFFH 3VDAA 4YHPB 1KJ3H 1IQDA 2CKBB 3C6SB 3OX8A 3DWTA 3CZFA 4TVPD 3VXPA 1JPST 1NCCL 2QL1A 2W38A 3QJHA 5HVHB 5CGYD 3FB8B 1KENL 1Y6MR 2XN9D 5EN2B 1JWMB 1OQXA 1XGRB 3S6CA 2CIKB 5C0BD 3WFCL 5ERWA 5LVEA 3UTOA 4X7FC 4OFKA 3GEWB 1MIEL 2PR4H 3ROLB 3K74B 3VWJB 1U8NB 1UGNA 2A9NL 3DI2B 4CDHA 4ETQB 3N85L 3L6FB 3QUKA 4OLWL 4GQ9L 1CF8H 3SE9H 5FGSA 4BFIA 2WQ8A 1BLNB 3PL6D 3KJ6H 2YD5A 2BVOA 3SN6N 2ZP0T 4RWYL 1WF5A 5E5MA 5F89A 1KIRA 1A7PH 2XTJE 1EVTC 3DHJA 4XP1H 3ARDC 2DL2A 4GKZB 5DK3A 3QO0B 1U3ZA 4M6MH 2DQUH 5JIPA 1BIIB 5DJCA 2B1AL 3UROR 5DVLA 4P2QA 4PJ9C 2ARJA 4JHAL 4Y2DA 2ESVE 3HI6H 4KKAD 1P4LA 2XZCL 1T1WB 2X7LB 3FT2B 3S37X 4X6BA 5SWSA 1JGEA 3W0WA 3VFTB 1OTUC 4HKJB 5HYSG 1U3HC 4DVRH 5SX5K 3CXHK 4POUB 4RFNB 3V6FB 2A2QT 5CEXA 1A7RL 1IGYB 3DIFA 3L1OH 3QHZL 1ZS8B 2A9ML 5GS1A 1MWAA 1VKXB 1EHXA 2XKUA 2YBRA 1CDJA 3I3DA 4PJIE 5E03A 4YHPA 3JV4A 3VXTB 2CKBA 5IEKA 1XF4B 3OKLA 3MLWL 2HTLC 4HG4K 1XF3A 4ENEC 1I1FB 4NJAH 1J12A 1YEJH 3FB8A 5EN2A 1JWMA 4HK0B 4N1EA 4FMKA 2CIKA 5CP7B 3LKNB 5DTFB 1OGAE 1RJZB 2OQJB 1RAMA 1NDGB 5B4MC 3SHSA 1C08B 3FO1B 4HQQL 3VE0B 3QQ4A 1DEEA 1NCAL 5T3ZD 3L6FA 3VGGA 5ID1A 1YY8B 5FUZH 2D0HA 5D1XA 2XRAL 4YHZL 3K4DA 4POYA 5LAXB 3C5ZC 2X4TB 5CZKA 4ZG1A 1F90H 3WYRA 5ITFA 3SO5A 4CGTA 1BQHB 1ADQA 1WIUA 2NXYD 4Q74A 2PN5A 5DJ2B 4GSDL 1LNUB 4GKZA 1HHKB 3HR6A 1LWRA 3RVWD 3BD4A 4QTHA 2C1PA 5EU6E 1B6DA 5HHVL 3H42H 1BIIA 3Q6FB 4ZOBA 2EZ0D 1MHHA 1KJ3L 1J10A 5KVGH 1TNNA 3NA9H 1CDYA 1U8LA 3HTLX 4RMUA 1T1WA 2X7LA 4PP1C 3L5WA 1B90A 2FX7H 3IAPA 2W65B 1N6VA 4U2YA 2E8YA 4JJ5B 4OQ1A 3KPRB 5IBLC 2RB8A 3QCUH 5C0CD 4OFIA 2SEBB 4HKJA 4QRTA 5C09D 3VGHA 3DTXA 3EYUL 4XBGB 4Z7WF 2J4WL 2NY1C 3DUHA 4HF5H 4PJBE 2GI7A 2VTFA 2LFGA 1UWEH 25C8H 2E7LC 4Q6YA 1QSFD 3KJ6L 1FBIH 3J7HA 4U6HB 1VKXA 2FIRT 4MGXA 2C3VB 4JY5H 5T33L 4OF3A 3VXTA 3VXOB 1XF4A 2KUTA 3C2SA 1A7PL 4PLNC 1J8HD 1W72B 2BXYA 3VXMD 3FHQA 2NR6C 5BXFA 1PBYA 1I1FA 1EJOH 2DQUL 4KGLA 3DV6B 4HUKB 4UDUA 5DZOA 3PUCA 4JAMB 5CP7A 3LKNA 5DTFA 2OQJA 3FFCE 8CGTA 5JW4M 4U1GB 5A2LH 1C08A 4ODVH 2F53E 3MV8D 3FO1A 2BOBB 3VE0A 3VFWA 3QDJD 5ANME 5IQ7L 4PJ5E 2GSIB 1D5ZB 5AYUL 3QIUB 4KDTA 1XGTB 1YY8A 1VADB 2COQA 1NGYA 3SCMB 5LAXA 1CFTB 2X4TA 1BQHA 2WMPA 5GRVK 5LGKA 1FNAA 5DJ2A 2BC4A 4ISVB 4MMZC 1LNUA 3T09A 2YK1H 1HHKA 4Q6IC 1G1CA 1CG9A 2FEDD 1J9CT 3JV6B 3Q6FA 3LKPB 2V2WA 4Y16B 3CFKB 4KZEH 1CGSH 3TCXA 1YMHB 3MXVH 4I0KA 4MJIE 4AQOA 2MPAH 1YZZA 1RZIB 4NJAL 3B9AA 3F7PC 3MCLH 4JJ5A 3GMPA 3IDNB 1ONQB 3I6LD 1V7NH 4XPFH 1G7IA 5F7YC 4L4JA 4Y5YB 4PTUB 4PB9H 4X7CC 1CIDA 5DJDA 4LK4A 4XBGA 3UPRA 4Z7VF 1QSEB 4XI5D 5TE6L 4ZS6D 1AGBA 1OAXH 2AJSL 1RQ5A 2V5RA 1CDGA 3SKJL 3UZVB 5JHDB 3BZDA 4QNPF 2F58H 1Z9LA 4KV5F 1IAKB 2N7BA 3VXOA 1HKLH 1NFDA 1W72A 4KK5D 4QHKI 4YHOL 4WV1C 5JDSA 4CVXA 3A67H 5J89A 3QFJE 4HG4J 2R9HD 3U36B 2NX5B 4NM8L 2B1HL 3EFDH 4JAMA 3QPQC 4M03A 1GIGL 5FYLE 3SDXF 3ZL4H 3ECBB 3ZKMC 3O6LH 2FX7L 1D5ZA 3QIUA 2HT3D 4AL8L 1EFXB 1VADA 5C0GA 1I8MB 4OV6F 1TQBB 4TNWF 2DQGL 3K1DA 4PJHE 5C2UB 5INDB 1CFTA 5DS8A 3PF2A 5EU7C 1PG7H 3ZTJG 4NFDA 3QXTA 1RUAH 2ADFH 3OXSB 3T2NL 4AM0B 4ISVA 2AEPH 3DGCR 5CJBA 3CK0H 2BK8A 1FBIL 3JV6A 2UVEA 1MI5E 3FAXA 3EYOB 3DSNA 3LKPA 4WWKD 4YWGH 5FYLL 1HE7A 3CAFA 5D1ZB 5MEND 4EQ3A 4WHTB 4H1LH 3I6KB 4CN4A 1RZIA 2JE8A 3TBSB 4XNYH 3LB6D 2OYPA 1ORQB 4DQOL 3RWJA 2A6KB 4BSJA 3GNMH 3IDNA 5AG9A 1ONQA 2XWBB 3AAZB 3C09B 2M2DA 3QH3A 2D4DA 4Y5YA 4PTUA 4ODVL 1UWGH 3HFMH 4OD3L 4DKAA 5KSUB 5HXMA 4G8GE 1U8KA 1ZHBA 2CQVA 4U1HB 2JB6B 4P5TD 1EUUA 2DS4A 4ODUB 4AY0A 3IJSB 1D5BA 4X6EB 4LF3B 4M7LH 4Z18A 3L5JA 2VO5A 2OTWA 5ELIA 2EE3A 2P48B 4YFLI 1JPFA 3ELAT 15C8H 3HE6C 1GOFA 3PHOB 3RTQD 3S37L 3H2WA 4TUKH 4DZBB 3TBWB 4KZEL 1CGSL 1E4KA 5EU7E 3MXVL 4HT1H 4JVUA 1FO0A 1QNZH 2MPAL 2NY4C 3WKNA 3ROOA 2DWDB 4S1QH 1HWGB 3QISA 4U6VL 3ULVE 1EFXA 1S7TA 3QWRD 5C8JB 1I8MA 4F7MB 4YZFE 4EIGB 1EA9C 2BFVH 4ODHH 2NY6B 5INDA 1N3NB 2HTKD 3ZTNL 4PB9L 4P46C 1EBAA 4I18A 4MA1B 3AREB 5FOBB 3MRJA 2FYYB 1AGFA 3O8XD 4ODXB 4WEUD 4NT6B 2PYEE 4PJXF 1T3FB 2L7UA 2R0LH 1OAXL 4HUUB 4NZUH 3RPIB 3UBXA 2IPKA 3OL2A 4LQ1A 4PRAB 1OP3H 5CD3B 5F6HJ 3EYOA 1VA9A 4C4KO 2CO6B 4XP6H 5D1ZA 2VWEC 1NANH 5DHVA 5TQ2H 4CMHB 3GKZA 1HKLL 2QHLA 4WHTA 5F9AC 2JK5B 3ULVL 3TBSA 4DN3L 1I8LA 1NMAL 1MHEB 4QRUA 4HS6A 5H8DA 2JTDA 1FVEA 3KPSE 5FGBC 4PJDE 3AAZA 3EFDL 3VH8B 2VDNH 5JQ6H 1NCBH 4ZYKB 3LD8C 1ORSB 3GB7B 3VGEA 1J0IA 3EO0B 5KSUA 2J5LB 5HI3D 3O6LL 1V8HA 4NNPH 3GSWB 4PJAE 5I1KH 4HWZB 2EIZB 2D9QB 3IJSA 5EC1B 2XKNA 5EU4B 3ALPA 1R3JA 4LF3A 4AMKH 4QLRA 3TIEA 4KHTH 4U1JA 3CFEA 4J1UB 1RUAL 2BNRE 2VZ3A 3RVVD 1NGQH 3SDYH 1UZ8B 1ZHNB 4X8JB 3VXSB 1FZKB 1EZVY 4Y4KC 3RGVC 3PHOA 5E2WH 3UTTE 4LPWA 4OLUH 1J5OL 2GITB 4W6WB 1TTGA 3TBWA 4YWGL 1KJ2B 3B9VA 2WQRA 5F7MC 1MLBB 4XNYL 4XCNB 4K3JH 3OF6D 4AEIH 3MA9L 2G5RA 5HGDB 5C8JA 2M1KA 3MRBA 4GT7A 4YHNB 1J18A 5D7LE 3GSUB 4M7LT 3WN5B 2W9EH 2JCCE 4S0TD 5FOBA 1S7WB 3ARBB 4OB5H 1NAMH 2OSLB 1DBBH 4NT6A 1P6FA 4YBQD 3QSKB 4PRAA 1A1OB 4QRPD 5CD3A 2OI9C 2AS5M 1CI5A 3JWNC 1X4XA 1WBZB 2EYRB 2I5YH 2HVJB 3P30L 3QIWD 1I1AD 2YXFA 4O58H 1UZ6F 15C8L 4JY6B 1MHEA 4PP2B 3ZKNC 1JJUA 5C1MB 1MCKA 1QSZA 1NUDA 1UXWA 5DJ6B 2ZUQB 4GH7B 2QHRL 4XAWL 5D72L 4ZYKA 4HT1L 1ORSA 3GB7A 1QNZL 2R8SL 4PY8I 1U8IB 5KVDL 3FCTA 4S1QL 2VLJD 3GSWA 2YD4A 4OCRH 3QEQD 2EIZA 2A6JB 3I3EA 2LVEA 1KN2H 5EC1A 4X6DB 1PKQB 4NQDE 2D7TL 5I1JL 4J1UA 5F96L 4DK3A 2CIIB 1UZ8A 1ZHKB 1ZHNA 4X8JA 3VXSA 4OLXL 4E41B 2R0LL 4G9DB 3JTSA 4JPIB 3AU1B 3O6ML 1VGKB 1R3LA 2F8XC 4P5MB 5E7FA 3CLFH 1ZV5A 4FQXD 4YFDB 5FFLA 4JPKH 5BRZD 4AYFA 4XP6L 2M26A 3JV0A 3L3GB 1JYVA 3TF7C 1J1OL 1NDMB 1IT9L 1WAAE 3O4LE 2Z4QB 4NHCH 4JFPB 1ZGLB 3FOLA 4OCLC 1J86A 1MLBA 1LO0H 4XCNA 3EYQD 1FGVH 4XBEH 5E0QA 3G6JB 4WU5B 3BH8B 2VDNL 1NCBL 1S5IH 1RMFL 3KLAB 2GY5A 3GSUA 4L8SA 1S7WA 3ARBA 1RUKH 5C6TH 2MQ3A 3WHE0 2OSLA 1M7IB 2V5YA 1UWXK 4I5BB 4NNPL 5D9SB 4K9EH 4YC2B 4OCMC 1U95B 1X5HA 2VXVL 1ES0B 1OSZA 5D2NC 1WBZA 4KHTL 2EYRA 4KWUA 4W6XB 1DBMH 4GRMB 4OJFL 3ULUH 4LLDA 3GMNB 3REWB 5E2WL 4UOW0 4JY6A 4OLUL 5FXCH 5HVGB 3H7BB 1CIUA 4L8DA 2OP4H 4JO2H 5DJ6A 4CNIA 1KFAH 5ALCH 1K4CB 4F8TA 4CL7A 3WO4B 2I27N 4N1CA 4GBXB 4M1DL 4AEIL 1Y18B 1DEDA 5CWSB 2YR3A 4I0PD 5TF0A 1KTDB 1U91B 2EICA 2E9WA 5JXEA 1JK8A 2A6JA 4G9FB 4ZOAA 3RI5K 2DOCA 5IMMB 4QHLA 4JFEA 1E4JA 4QXUH 3BPLC 2W9EL 2XA8L 4OB5L 1NAML 3RWFB 1ZHKA 1TJGH 5CCKL 2BX5A 4G9DA 1T7VA 4JPIA 3AU1A 4RGNE 1JRHL 4P5MA 1O7SA 1YNKL 2ORBL 2XQYG 1INEL 4F15B 1UXSA 5GRZA 1T66D 2Z4QA 3L3DB 4QTIH 4RNRB 4JFPA 4F9PA 1Z9OA 4LLMA 3LAFA 2WZPD 2XNAB 5DC4B 1MCQA 3LRHA 5C92A 5HYQB 2VZUA 1JGVL 4XP5L 3DSFH 3G6JA 4WU5A 5BS0B 5D2NE 1GHFH 4MA3A 3HC3H 1U8OB 2J6EH 2RFXB 3KLAA 1A02N 2C4FU 4YGAB 5C07B 5FO7B 3UZQA 3MRIA 4I5BA 4PY7B 1MEXH 5CGYC 3LPWA 3QCTL 5JOPE 1P1ZB 2RR3A 4DK6A 2JB5L 1KN2L 3HLAB 4HIEB 1ES0A 4NGHL 1WJ3A 1SJEB 1IAIL 2F19H 1MAML 1JZ7A 4H88L 4FFZH 2HT2D 1OM3H 3ZKQD 2YD6A 3REWA 2DKSA 2R4RL 3CMGA 3MLZL 3H7BA 1AO7A 3PL6C 3VRLF 4JLRB 1DUYA 1AXIB 5EZOH 1KCSL 1KTLB 2IF7A 4IMLA 4NHCL 1K6QH 2DQFA 3QG7H 1UJ3C 1FZOB 2HG5B 1I9RH 1NL0H 1LO0L 2H3NB 4FQ1H 1NUGA 3QEGL 2VXQL 1FGVL 4GBXA 4XBEL 4G80B 1Y18A 5CWSA 1DZBA 1KTDA 1U91A 3QXDB 5E99H 4NO3B 2LAAA 5DD6A 3MACH 5A1AA 3KXFB 3SOBL 3GIVB 1F6FB 2OK0H 4MVBD 1N5AA 4IOIA 2AEWA 2VE6B 4ZOEA 4KKAC 5C6TL 4U05A 1MRCL 3RWFA 4P57A 2F54B 4WO4B 4DGIL 4EQ2A 2J1KA 4GRLD 3RDTB 3GSRB 1TZHA 2CLRB 3VMOA 1CTNA 1DQDH 4OF0A 2LTQB 4LLAA 3ZTJH 3L3DA 4RNRA 4TVPE 5L2KD 5FGCE 5IHUL 4OZ4B 12E8H 4GW4B 3T3PE 1JF6A 2XNAA 4FXLA 2XN9E 1WCQA 5HYQA 5DEGB 4XVJL 2DN7A 4X9GA 5BS0A 1KFAL 3UDWA 5ALCL 4PRNB 4O5LL 2RFXA 4UT7L 3FN3A 3WD5H 5C0AB 4EBQH 4LLUB 5FO7A 2L4OA 1S9WA 3O2WH 2HVKB 1A7QH 4I8DA 2ZOLB 1S3KH 1N2RB 4KJQD 5KOVC 5BCAA 2BVQB 1CLYL 2V9TA 3T0EE 3HLAA 3G6DH 3JWOC 4MAUH 1EJ6A 2N4IA 5E6IA 3KDMB 4YX2L 1PLGH 3CFJB 4TVPL 2VDRH 4RA0C 1QBBA 5H35B 4UOW1 4IRSA 2R1YB 4Z95L 4BZ2L 5LG1A 2BNUB 4OQTH 4OI9A 5FF6B 1KTLA 2R0ZH 5CMAA 5DMKB 4HBQA 5GISH 5IWLC 2NXYC 3AY4A 1AIFB 4J2XA 3S7GA 3O81A 3G08A 1I9EA 5GS2D 3OGOE 2R69L 2H3NA 1RZJC 4DKFL 3RVWC 4G80A 4FTVD 4P4RA 3NAAL 3DSFL 2EZ0C 3KXFA 3GIVA 4DUWA 5AWNL 3U82B 4LSUH 5FECB 4R9HA 1EGJL 4MA7L 4EN3B 4U31A 4WUUA 2ADIB 4PR5B 5ECJE 5TDOB