4LVOB

Crystal structure of pfsub1-prodomain-nimp.m7 fab complex with added cacl2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
212
structure length
212
Chain Sequence
DIVLTQSPATMSASLGQRVSMSCSASSSVSTSYFHWYQQKPGSSPKLWIYSTSNLASGVPGRFSGSGSGTSYSLSISSMEAEDAATYYCHQFHRSPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The malaria parasite egress protease SUB1 is a calcium-dependent redox switch subtilisin.
pubmed doi rcsb
source organism Plasmodium falciparum
molecule tags Hydrolase/inhibitor/immune system
molecule keywords Subtilisin-like serine protease
total genus 51
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2013-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4lvoB01
4L8BB 1IGMH 1FGVL 2CDFA 1AI1L 2C3HA 1FVDB 1N4XH 3KYKL 5J7CC 4ZUTB 1QA9B 3T0AA 2NY2C 1J8HE 3O6KH 4X7SL 5FEBA 4DCQA 4PJ7B 3HE6A 3MGTA 5TF0A 1YPZE 1CFQA 4OFVA 3D3VA 4PJGE 4X6CA 3ET9F 6FABH 3UTPD 4TSAH 2W0FA 4G6JL 4JY5H 2DWDB 3PL6A 2PCPA 4JFFA 5BJTB 1DLFL 4MJ6B 2A0LD 3DXAA 1XGQB 4HPYH 1A4KB 2WQRA 3BPCB 4WFFD 4LLQA 4PGEA 3QDJE 3MRQA 1NSNH 1C08B 3IF1A 1JJUA 2YMXH 5IKCB 1U8PB 1OAQL 1CR9L 2C3VA 1C12B 3MV11 3ARDB 3QDMA 1AP2B 3IETB 3WFEL 4MZ3A 4LVNB 4BH7A 3MLYL 4PJAE 3UPCA 5FM4A 2CLRB 4KMLB 5B4MD 5JW5B 1MJ7H 3CK0H 4R2GC 2BP3A 1UKSA 1PLGH 1I3UA 4I8DA 4KROB 4UT9L 4W4OA 3UDWA 2N4IA 2F5BH 4KI5D 1DQML 4M6OL 1I9EA 2DL2A 5B3JF 5FYLD 1ADQA 4U31A 4WIQA 4OUUA 2VH5L 3UAJD 1VFOA 2FBJL 1TVHA 4PV9A 1UYWH 2VUYA 5I76A 4M8QB 5CIPA 3I2CL 5D7SH 5DUBB 3OL2A 4PJXE 3ARRA 3TBYB 2HRPL 2WBWB 2E7LA 2P8MB 3SE3C 3OKOB 4PJEA 5LXGL 4PBVC 1LILA 3BUYB 1YEHL 3JTTB 1T83C 1OQXA 2R23B 3WIFA 4U1IB 2MKLC 4OD3L 3BXNA 1A0QH 5L2KD 1QP1A 2WUBL 3DRQA 2ZSVA 2VDMH 5GZOC 4NKOB 4QRPD 1MY5A 4MLSA 5T5FL 5DD0H 3EFDH 3D2UB 3QUXB 4X6BB 5DLML 3T65B 3DROB 4KK5C 2OR7A 2QR0B 1D5IH 4J6RH 3FFCE 4NQEE 4KKCC 3KPMB 2HH0H 3QRGH 5DMIH 3OPZL 3O45B 3EOAA 2XWBB 3CMGA 4NGHL 3UBXI 1BZ7B 2ILLA 4NQCA 3RIAF 1NH6A 1V7ML 25C8H 4U1LB 2VABB 4OZGE 1I1FB 3QIUC 3JWOH 1S7UA 2DICA 2RQ8A 4ETQB 5DMKB 3AUVA 2HJFA 3VXOA 1G0DA 4G8GB 5IEKB 1VEMA 4WI9A 3KXFB 3S36L 4M8VA 1ZA3B 4LVEA 5C0GB 1MCLA 1DEDA 4D2NA 3N0PB 4PJCE 4HC1H 1C5BL 8FABA 1VFAB 1YEKL 4MYWB 2DOCA 1MY7A 4AMKH 2ATKA 4LLWB 2BNQD 1B2WL 1HI6A 2A6KB 3QEHB 4ODTL 5HI4C 3VG0H 1PZ5B 4XAKD 5ITFA 3D85D 3KWWA 4EN3A 2AK4E 4HSQA 1L7TH 2AERT 2X4NB 3QG7H 4NNYA 3K81A 4JG1L 1B88A 2YD3A 3DV4A 2QADB 3P77A 1KCUL 1YY8A 3JTSB 4DVBA 4GXVH 5FYKD 5CGYC 2JCCA 4PLOB 1Q9WB 1CGTA 2HKHH 4LNVA 2NXYD 4BUGA 2MOVA 4JO4L 2AJVL 1HWHB 3LKQA 1MLBA 4XPGH 4S2SB 5HY9B 3L3KB 4F57H 1U42A 3HPLB 4S2SA 4I3GA 1CE1L 5C2BH 4B50A 5IOPB 2ESVB 4U1HB 2AJUL 4JO2L 5I8CB 3L7FB 1B4JH 2YUVA 3PGCA 1DLHA 4KJYB 3U9UB 3ZDXE 4WW2F 5E6ZA 3EUUA 2D2OA 3D48R 3JTSA 5DRWB 15C8L 1B6UA 3P77B 1T04B 1DBAL 2N1KA 1BFOA 5I1KL 2J5LC 3MCG1 3EZ8A 1LE5B 2F74B 4JQXA 1KPVA 2GYSA 5K9KA 1U92B 4IMLB 4XPHL 2VZ3A 3FZUD 4FFVD 4GUPB 1R5IB 4Y4FC 1MNUL 2AEWA 4MJID 5BRZE 1HI6B 4JHBA 4OGAD 3ZTJH 2PW1B 1P9MC 3U7AA 1FL5B 2VDML 4TOYL 4HK0B 2FX9L 1VSCA 4X80H 2UWEF 2VLRB 1P7QA 1EGJA 1YJDL 5TE7L 2RR3A 2Z4QB 4MMZC 3Q3GB 5F9OH 3FTGA 2IADB 1BM3L 2AV7B 2F53D 1T5WA 1KJ2B 4LK4A 4PJIF 1A14L 1S7UB 5BMFH 1ORQA 1IL1A 3QFJA 2FBOJ 2YRLA 3VXUA 2F54D 1KCSL 3E8UH 2H1PL 1BJ1J 4I9WD 4NO0A 5EU4B 3OB8A 1NLDL 4DFIA 2WWMC 4XNXL 3O45A 4CDGC 5I1CH 3G5XA 4DEPB 4Y1AD 1S9YB 4EBQL 1KN4H 2LAGB 4XGZB 1PZUB 3BP7B 1Z0MA 2MQCA 1N5AA 2Y72A 4HF5L 4F9LA 1XAUA 5C6TL 2RIKA 4DZBB 2J6EA 2N7AA 3MREA 5DD1L 3MACL 3PWVB 1B2WH 1ULVA 2VXSL 3U4EB 1RZ8A 5HVGB 1A3RH 5EN2A 2H9GB 3BKML 3FB5A 5DJ6A 5K9OA 3ZKND 4WI6A 2IAND 3LS5L 2YRZA 5ISZE 2A1WL 1MFEH 4PJ5D 4UV7L 3VXUE 3VWKD 3RAJH 5L8JB 4KTYA 3TNNB 1MWAL 1PGRB 1CIUA 3C8KB 3BEWA 2IAMA 2ITCA 3UTTB 5FYJL 1J12A 4OUUB 3SOBL 3CJJA 2WIIA 4M7LH 4YNYB 3IDJA 1G7JB 4PRHE 4P2OB 5F88A 3C5ZC 3G6JA 2NY5C 1CE1H 3U2SA 5JA8B 1QEWA 1JPGA 5GGVL 5E1AB 1CL7H 5KW9H 3RRQA 5JW5A 3VD3A 4EI5A 5E6ID 4QTHA 4Z7QF 4JFED 4K94H 1Z9LA 2DQDH 1OGAD 3IETA 4O5LH 5EU3A 1AP2A 4WWKC 1B3JA 1JPFA 4U1KB 3S6CA 2DJSA 1CFBA 4HAGA 3RJDA 3MLWH 3SDCA 2YA1A 1C08A 3IF1B 5IKCA 5DO2C 4XVUC 1M6OB 2EKSA 1HSBB 1Q0XH 1MWAB 2UZIH 4RWYL 1TZIA 2DAVA 3JSSA 4G6FB 3LOWA 1LEIA 1RSFA 3KPQA 4D94A 2M26A 2DLGA 4NNXA 1T22A 4GW1B 1H3XA 1FZKB 1FLRH 2ZCLL 5DVOA 3WNLA 5HHXH 1NGPL 3MRJB 4U7SA 1HHJB 5JA9A 2OJZL 3WKML 4KAQH 4RX4D 3D3VE 3I3EA 3HE6B 3MGTB 4XH2B 5E99L 1T89A 1E4WH 3E2HC 1HYSD 4OGYL 1HWGB 4K9EL 4ZUTA 1AGBA 4HWBA 1XIWA 2CMRL 2CDFB 4L8BA 4OZHB 2Y1VA 1AFVH 3DXAD 2VSDA 4RFEB 2BNUA 3AAZB 1PYWB 2DLFL 2OK0L 4OM0L 3FZUC 3VFNB 2BMKB 3RZCA 5DS8A 3LN5B 1EFXD 3IFPA 1MEXL 2XG4A 3QDME 4CVUA 1T5XA 3ILQC 3FN0H 2HTKD 3P3YA 5J6HA 1BVKB 1T3FA 4NQEB 1OF2B 5HYSB 5IR1A 5KVFH 1LP9A 3GUTB 1I1AA 3B3IA 3PP4H 5IM7B 3QZWA 3BKMH 3U7WL 4QHMB 1FZJA 1Q9LA 1T7ZA 1YMME 2DQGL 4X5XB 4Z7WB 3EYUH 3KNBB 4WI7A 1IBGL 5IG7A 3TO4A 3WN5A 5D7LA 1KFAL 4PBXA 3OKEA 4XAWL 5F7EH 1QZ1A 5CEZH 3BIBX 5EU6B 4H25B 5GPRA 3ZE2F 1KEGL 2I9TA 3EYFB 4P2QB 2WP3T 2F15A 1ZHBA 2UY6A 4ZFFA 3GBNL 1OP9A 2XT1B 1QFHA 2GTZA 2BSRB 2NW2A 2NY5H 2VITA 1I4FB 1OM3L 4I77L 5I0DA 5I1EL 4DTGL 3T4YA 5L2KA 4TRPL 4K2UH 3V6OE 2H41A 4XX1G 1H8NA 4QXUH 3VXMA 4QRPA 1CICC 2JB5H 2QHRH 4OQTA 4OZGA 1DN0B 3V4VH 3AVEA 4JN1L 2EEBA 4Q6IB 3O3BA 1T2QH 3T8XB 4ZNCD 1BJ1H 3OV6A 5GQBA 4LNRB 1OAXH 1QFUH 1T66C 4N0UE 4LU5L 3MRIA 5E8PA 2J8HA 2HTKC 3QI9D 1DJSA 3C6LB 4F3FB 3I3BA 1CLYL 2FATH 4FFZH 4G42B 2C4XA 1IGTB 2ZCHL 1RD6A 5DQ9A 1EXUA 4P9ML 4Z76A 3ARGC 1B4JL 3I6GB 3SKMA 3TH2T 3EOTH 3RPIB 3ETBF 2VIRB 1PSKL 1UCBL 1WWCA 5HYJA 3MRFB 4TNWK 3L5HA 4CW1A 1AR1D 3MFFB 3EJJX 4JPVH 3G5VA 5GJSH 4JY6B 1G1CA 5D9SA 4KXZI 3FO9B 2IALB 2BNQA 5JOPE 5L7XH 1A47A 3NCYP 3F7YB 1JRHL 3SPVA 5EBGA 5CJBA 2GFBA 3WSQH 2VJXA 4ZUWA 5I8OH 1AHWB 5IV2B 1KB5B 2OXGA 3IFOB 3S35X 4JVUA 3OR6B 5LWYL 4G8GE 3GMQB 1NEZG 5C0DA 1WWBX 4N0UB 3VDCA 2LTQB 4XPFH 3NFPB 5IBLD 3B9KB 5BV7C 4GXVL 1UXSA 2OSLB 1AGFB 1XIWC 3GHBH 3BH8A 4HFUH 1L6ZA 2G5RA 1J1OL 4BZ1H 5C9JB 2Y7QA 3KLDA 3OGCA 5GRWA 5GGSY 3I9GH 3L1OL 5TF1H 5A2IH 1MLCB 5EOCL 2APTA 5I30H 1HZHL 1WAAF 4JN2B 5EFIB 1ZS8B 4PJBF 5A2JH 4U1SB 4PRNB 3FMGL 4WGVB 4Y19B 3RIFF 4KY1H 4OLZL 1LO0L 4TRPH 4WI5A 5C0CE 4D3CH 4RGNE 1NCBL 4OLWL 1YEIL 2LAAA 1SJVA 3PDDA 3SCMB 3FCTB 3STZA 4PGCB 5ACLA 4YO0B 5DHVA 5C08D 4O58H 2FJFA 3PQYD 3HLAB 4J4PC 3LZFL 4HX1A 5IQ7H 3DX7B 1KT2A 4DUWA 3LH2H 4WUUD 4LLDA 4YHIB 3H7LA 2D4FA 3GJFK 3KYNA 1WIOA 1JGUL 4CVXB 5E6IB 4FS0A 1FPTH 4P57B 1OW0A 3OF6D 3O0RH 1RZ7L 5D6CA 5FO9B 1G7HB 3BPLB 4NO0D 3ILPB 3FONB 2XN9E 4UT7H 5JO5A 1KV3A 5KSBF 5AZ2L 2XN9A 2FDBP 2DM7A 3BO8A 5ID1A 1KCSH 1JIBA 2D9CA 3S3SA 2F5BL 4CU8A 4NRXA 3F7VB 4I3RL 3S96A 1LEGB 3GBMH 1AD9A 2HP4A 4I4WB 5J1AB 1EO8L 3S4SG 5FF6B 5IIEB 4LARH 5I75C 4W68A 3QHFL 4EBQH 4YDVA 1E28B 2PW2A 2F53B 5JORA 1TNMA 3ZDZF 2Q8AH 4X6DF 1WICA 3I2CH 4H0IA 1AXSA 3ARFC 3IDIA 1JFQL 3QCUL 4OCLC 5ISZA 3HMXL 4EIZC 4V2BA 5GXBB 1EVTC 4TNWF 1KLGB 5ALCH 3O2WL 3U9PL 5HD8C 3TBTB 1ACYL 4KTDL 3TCXA 5F7HA 4G6AD 5IB5B 5E00A 4P23B 1UVQB 3DNKA 4N1EA 1OGAB 3FQXB 2XZQL 3EFDL 4QEGA 2F5AL 3VFOA 3MROA 1IAMA 1VESA 3TFKC 3QISA 5KVGH 4TPRL 1A6ZA 5C0JB 4YFDB 4I18A 1A6ZB 4Z7UB 3ARUA 4HKJA 5E2UH 4H0HB 4AJ0A 1RK1A 2AJYL 3DYPA 4TSBH 5T1KA 2H32H 4OI7A 3VFOB 1A6WH 4JHWL 2EXWC 4E5XA 1IC4H 4FQPA 2HT4D 3RGVD 1T0MB 3GSRB 1RK0A 1YNLH 4TUKL 5D71L 1EHLL 1CGUA 5ESQB 4F37F 2DMKA 4Z77B 3ZHLA 4ZFOL 1WAAE 3KPPB 5DZOA 2DYPB 5DFWH 3V0VB 4ACPA 3Q6FA 3W39A 4PRID 4LCIL 5F7DB 4M7ZC 3WUWA 4NUJB 4HUXB 3TYFB 1EEYA 2Q20A 3SE9H 4XNZB 4AMKL 4PJGA 5ID0A 3P4OB 4LP4A 1BBDL 1RK0B 3AXLA 3F7PC 4NFBA 1LEGA 4M9PA 5D1XC 4DN3L 1NC4A 5DVMA 1MH5B 3IDGA 2HTLD 5H94A 1GGYA 5J57B 1URLA 3FONA 3MROB 3KS0H 4NHUA 3JWDH 5FO9A 5FYLH 4Y88A 1RQ5A 1CXLA 2N56A 4KRPD 4XP6H 4YHML 3ABZA 1PKQA 32C2A 2R69L 3OAYK 4BFBD 4QOKE 3W9EA 3F7QA 4GMTL 5E00B 3DX7A 3UTTD 4MQXC 2ADJA 4X6CF 3L95B 3HLAA 4OLEA 5KSBB 4OT1L 1MREL 4K2UL 3RFZC 4JKPH 2GEEA 2JB5L 2QHRL 4NBZB 4LRNL 1T7XA 5ISZB 5DJ0A 4MQXD 2BHUA 4Q6YA 4LLUA 5IVZB 5T1MA 3U0WH 4JANA 3GJFB 1TCMA 3PP3H 1U95A 3TBSB 2LVEA 3IXAB 2GJZB 1E28A 2PW2B 3KYOB 5JORB 5FGBA 2R1WB 4ZSOA 4JREC 2L0DA 4I4WA 3GMOA 4ZSOE 1FAIL 3QEQD 1KEGH 4M5YH 2DS4A 3HUJE 3QWRD 4D0CB 1RHHA 3HI6H 3CXDH 1T1WB 3CH1B 1QBAA 4K23L 2FJHB 5D8JH 5C9JA 5GGQH 2R8SH 1JGVL 4TQEL 4HULB 3BH8B 4P57A 2XWJA 4HJ0D 4GQ9H 1UXSB 2IH3B 2OSLA 3B9KA 3D2UD 3QUXD 5DK0B 4MZ2A 5FHAL 1H3PH 5C09B 4YAQA 1NGXB 1DBBL 4YBLB 4OZFH 3NIFF 2FJFB 1S7XB 5L2JB 4K7PL 1A2YA 4S1SH 2HYMA 1YEGH 1T21B 4XXDA 3WS6A 2NY4B 3QP3A 4P4RA 1YDPB 4YK4C 1S7VB 4LHUD 4JN1H 3QFDA 5ADPL 3GKWL 3GSXB 2YA0A 4GAGL 3CX2A 1AXIB 1TLKA 1ORSA 2P47B 4NQTA 2VDOH 3GMMA 4WU5A 4XPFL 1KPUB 4L8CB 3FO9A 1DQJB 4FQQA 2FH6A 1M4KA 3EDFA 4OI9A 5CSZA 3TJHD 4O02H 3LKNB 5F7WC 1OAUH 5LGJB 4PRHB 4ZNEE 5KN5A 5SV4A 5DQ9B 4FNLH 4QXTA 2E6JA 1S8DA 4Z8FL 2E9JA 1I3RB 3K3QA 4PRBA 5B38G 5GSRB 1AGFA 1JGLL 4FTVD 4XWGL 4XB8A 3SDXE 3NFPA 4ZTPL 3LQZB 4F33A 3B9KC 5BV7B 3O3BB 4KJQC 1TQBC 3K2UH 2XTJB 3MA9L 1RZKH 4WFGE 4OD3H 1UACL 1KSRA 4JRXD 2GFBB 3W2DL 1ZGLP 1TMCB 2DQDL 1XMWA 5L2KB 1R0AL 3U1SH 3LZFH 5BS0B 3TO4D 3RKDC 4ORGB 2Y4SA 3GMPA 2DTML 4XNYH 3QXTA 3DGGB 1DVFB 3HAEB 1JNHB 1LP9E 1L7IL 4GQPH 3G5VB 3BDYH 4JR9H 3KDMA 4QRQA 2HT2C 3PNWA 3MGOA 3L5IA 3MRFA 3QDGD 1KXVC 4ZOBA 5FYJE 1EHNA 3FRPA 2BHYA 1JN6B 3ECBB 4C55A 3QEUA 1TIUA 1ZHBB 3CVIH 1BOGA 5ACZB 1KTRL 3I84A 5IHZB 1XGRB 4OCXH 5GRJH 5E24E 4JHAH 3GBML 2GK2A 4KAQL 2ARWA 1R3LB 4NJAL 4MNQE 1QFOA 1CG9B 3MLSH 5D7LB 3WN5B 5E8PB 5EO9A 3QXVA 3PJSA 3EJZC 3KNBA 1A21A 3CZFA 1YEDA 2QQNL 2YMXL 3MGAA 4FZEL 4JDTH 4LSVL 5DRNA 3ARZA 3INUL 3N50A 1I8MA 5CP3A 4HUVA 3QCUH 4S1SL 4KU1A 4OM0H 2ITDB 3CAFA 5IR1B 4YQXL 2DB8A 2MSPA 4QRPB 4L9DA 1MEXH 1XH3B 2K3TA 5KSAD 4XRCA 5I1LB 3K8KA 4O58L 4PJ9B 4R4FL 3L5XL 1SYSA 4FQXD 4AL8L 3LAFA 5F9JB 3SKJH 5HTSA 2DDQL 3T3PE 1S78C 1H5BC 2GSGA 3CXHK 3BDBA 5HDBE 4MJ2A 1XIWB 1T80A 2R0WH 1IGYA 5HYJD 2QSTA 3HS0A 2GJJA 4YHZL 4RRPG 1U6AH 2OX5A 4M9OA 4UOW0 2QKIA 1HHJA 2PO6B 2BOCB 3ZKMC 5F9AC 1BAFH 3T04D 1EO8H 1K3ZA 4RGNC 1A7RL 1OARH 1W72B 4NNXB 1EUTA 2IBBA 3WCYA 3IJHA 4NKMB 1HEZB 3HMWL 4X6CE 1BX2B 3UYOD 1Q9LB 3OR7B 3SY0B 1UACH 3DX6A 3SDCB 4APQA 1BVKA 1T3FB 3ARBC 3H42L 1T5XB 4UUJB 3L3GA 5LCVH 2ICCA 3U9PH 3AREA 5SWZD 5H37G 4TVPL 3WLBA 5MI0B 3QUMA 3BKYH 3MBEA 3C5JB 5JW4M 2XTJD 5KS9A 1WZLA 3RU8H 1A14H 4FQJH 1ZLWK 2AJ3A 4BELD 4MDIA 4R7DB 2JIXB 4OAWA 3NA9H 3GDBA 4DAGL 1AGBB 3IFLH 4RNRB 2OYPA 4LSDA 4ZUSB 1U0QA 4M7JL 3NCFB 1XGTB 3WLWD 4X4XB 4XH2A 4F2MB 3GSOB 1FFOB 4X7EC 3MLUH 5LGHL 3D5OF 4Y4KA 1A6WL 3ARTA 5MEPA 3VD9A 4QY8A 1FZKA 4GW1A 1YEKH 1TCRB 4FQ2H 3SGJA 1U8HA 4HHAB 4LSQL 1WVZA 3G6DH 2X4PA 5HJ3A 1NQBA 4TSAL 5F1IB 5FA3A 1ZHNB 2EKSB 1NGZB 5DJDB 1SVZA 4HCRL 3U4EA 5K9JL 1A3RL 1UT9A 3SDAB 5KSVB 2PYED 1ZKAA 4LF3A 3O6FA 3LVEA 5KS9E 5B39G 3BAEL 1KCVH 1C5DA 1L4IA 1NMAL 4JM4L 12E8H 1SYVB 2HG5B 4YHOH 1BVLA 3L5XH 4YWGL 5IBUG 4U6YA 4BM7A 2XRAL 2NX5A 1DBKL 2X1WL 1QNZL 1XF5A 5T3XE 2XN9D 4FABH 4MJ5A 4GRLA 1A3QA 4P2CG 3LD8C 4P3DB 3LRSA 1WK0A 1X5GA 1BJ8A 4EOWL 4HH9B 3IDJB 3VXUB 1KJMB 1ZANH 3O2VH 5GZND 1OLLA 2IAMB 4HPOH 4NCC2 3Q3GA 4Y5VC 1ZOXA 3MNZA 1DE4B 5EOCH 1V7NL 4J2XA 3SDXA 3S7GA 1KGCD 1S9VB 1NFKA 2QSCL 1KC5H 1NDGB 5K9OB 4IIQC 5DTFA 4TOYH 3V6ZB 4LRNH 2YWYA 1J0IA 3JV6A 4YBQD 4DQOH 3VU2A 2R0KH 4JFXB 3VFTA 1R5IA 3CLEL 4Y16C 4XMKL 4OLZH 1LO2H 2PYFB 2X40A 4PREA 2OLDA 1DBJL 4DZBA 3VXME 4KDTA 2L7UA 3BMWA 5IVNA 4IRSB 3S37H 1AKJB 2FEEL 4QHLB 3OJ2C 3EFFB 5C09D 5FDWA 5E99H 5L8KB 3FRUA 1KYOK 3IFLL 4Y89A 4POUB 4XNMB 5CJOL 3SO3B 1A5FH 1MLBB 3KPTA 5EDXA 1ZSDA 1BVZA 1PBYA 2DLFH 1NLBH 1Q9WA 4XWGH 4N5UA 2Z35A 5E70A 5D2NB 2IADA 3QJHB 1NCWL 3MLRL 1IARB 1WZ1H 5GRVK 3TESA 1RUPH 4DKDC 1IC5H 1PX4A 4N8VG 2P46B 4D9QE 4HK0A 4HUUA 3K1KC 2XNAB 1FL5A 4EN3B 3CMOL 1PZ5A 5D5ME 1MJJB 1ZT7B 3U7WH 2ATKB 2VXUL 4F15B 2XNAA 3H6JA 3G5YB 2CSPA 1F4AA 3M8OH 1U92A 5K9KB 4JZOA 1INQB 4UNUA 3QB7C 4X9BA 2C26A 2HJFB 4AK1A 3OAZH 1R3HA 3UYPA 2XQYK 4ZPTB 5JMRA 4ODUA 1QNZH 4NWTL 1UWGL 4LSSL 1I1FA 3CVIL 3ZKSD 1U3ZA 4XBPB 4PJDB 1ZSDB 4FQXC 5IGXH 2GT9B 4HWUA 4EOWH 5HY9A 3B2VH 5T5NF 2GQHA 3FRUB 5CEXA 3VXQA 5KVGL 4YGAB 5FGSA 3ALXA 4QHLA 4DVBB 2DBLL 4G9FA 4IRSA 4KMTH 3HE7D 3G9AB 1FNHA 1XF3A 3KPSD 4JJ5B 4U1NA 5TQ0L 1CLCA 4ZOAA 2JJUA 3BD4A 5T5NG 1GGCL 4DZ8B 5I17A 5GISL 1GCFA 3GNML 4M62H 1IKFH 2X4NA 1G7QB 5D1ZB 3VFTB 4GT7A 5ITFB 4Y4FB 1Z9MA 3W9DB 5F72S 2B0SH 2I5YL 3QPXH 5F3BA 3V6ZA 5DTFB 5EZIH 2EH8L 1A1NB 5KS9F 1ZMYA 3HNTH 1LO2L 4UDUB 1JTPA 1GHFH 2XI9A 3OKOA 4EEEA 3SDXB 1T2XA 1AJ7L 4XBGB 3WN5C 1DE4A 3MNZB 1KLUB 3OJVC 4WI8A 4GKSB 4OLXH 4H8WC 4M8QA 4ETQA 1MCJA 2IPTL 5IWLA 2QLVB 2VQ1A 3MV7B 4PV9B 4XX1E 3IKCA 1X5XA 4XCFH 2R0WL 3C9NA 4JKMA 5F9OL 2FSEB 4ZPVB 5FO8A 3QDHA 4EDXA 3VXRA 4KVCH 4P3DA 4HMCA 1FSKB 4MA7H 1FZMA 3I6LD 2XWBA 2J4WL 3NCCB 5CLTA 5GSVB 4FQHB 5GJTH 4GAJH 4DEPC 2QR0A 3A6BH 1BVLB 3RTQB 1DQTA 3ZZ1A 3VCLA 1B0RB 3KYMB 4TULL 4LMQE 4CRPA 1QO3B 3NH7H 4XPAH 1J7VR 5A3IC 3RX8A 3WD5H 3MRQB 3V0WL 3ULVE 3EYUL 2KZWA 2VXUH 1FYTE 2FEDD 5HI3C 4AENB 4C56D 7FABH 3C6SB 1A4KA 3BGAA 1S7RB 1QBMH 4LFHD 1JNJA 3PL6B 5IVXA 1TCRA 3DI3B 1A6UL 3LN4B 4ODWA 1RJCA 4RMTA 2DDQH 4XVSL 1FO0H 2CXGA 3OG6B 4LCWB 4PJCF 4PJ7A 2CK0L 1XGTA 1B6DA 4YPJA 1FAIH 1X3DA 4M6NL 2WSKA 1T1ZA 2VTFA 4OAWB 2OP4L 4Q9QH 1A22B 1QR1A 4KVNL 1FYHB 4NBYB 3FL7A 1JWSB 2BDNH 3G6DL 3TEUA 4C4KO 3H9HB 4H20L 4YHPB 5TDNB 2ORBL 3H7BB 4APQD 5H37H 2IEPA 1UC6A 4MS8C 5KW9L 4UUJA 3ARDA 4HFWB 2ZUYA 3U30C 3VGDA 3DX6B 3VWJD 3FB7A 1FL6B 4PGDA 4DW2L 2YBRB 1F4YH 4W4NA 3O9WA 2APBA 2XKNA 2BY0A 3MLWL 1FIEA 3CFJA 2XRAH 1JUFA 3SE4C 1UM5H 5F93C 4Y19D 3O6KL 5CGTA 4S10A 2VDOL 4OCYH 4RQQA 1WT5C 1E0OB 4G80B 2P5WB 5DF0A 5HYQB 2EH7H 5H8DA 5JXAL 3VGAB 2WMPA 5MEOB 3RL1B 5ABDE 1OSPH 1X5FA 5ENWA 4UZGA 5F1NB 1MJ8H 1IT9H 2X4QB 1R3KA 3TA3B 4XP5L 5C0BE 5C07A 4Q9RH 4LSUH 3WE6A 3BIKB 1BP3B 1ZT1B 1MHPL 4G43B 1MQKH 5MERB 3ZKXC 1NGWA 3LKPA 4IRJC 4YR6A 1V3MA 4ISVA 2J8UA 4KKAD 3O6MH 4LKCA 5J12C 1P7KB 5K9JH 4X99B 2HFEA 1AGCB 2FEEI 2HKFL 5SWSD 3RNKB 2VE6B 5L9DH 2NX5D 3R0NA 3IDMB 1R24A 1I7UA 4UT9H 5FYJU 1MVFA 1VACB 4I0PA 4XP9L 2Y36L 4Z7UF 2MCG1 4HGWA 4OCNC 3MTRA 2NTFB 4PGJA 5C86A 2PETA 1D9KD 4PJBA 2OTWA 5IHZA 4X0KB 2E9WA 3QEUB 1XT5A 1XGPB 1SVCP 1T89C 1NBVH 1D5ZB 4XPTL 1J0JA 3MGOB 1IC7L 1PG7L 3TO2B 3OJMB 3D3VD 2VDNH 1N5YL 1DVFA 3HAEA 1WISA 4GXUM 5BZWA 2V7NA 4HJJL 2X4TA 1P84K 1HILA 3MRLB 3VXNB 4MJIA 3CNKA 1A6AA 3R8QA 1XGUB 4RGMC 4EZMA 3ARQA 5J56B 5FAAA 2XQBH 1K4DA 5GRXG 1D5MB 4LCUA 2PKDA 1B0GB 3SE9L 3S98A 4HBCL 3MBED 5E08H 4G8GD 3SDCC 3ZHDA 3PL6C 4MA8L 4I2XA 1K2DA 4C83B 1ONQA 4KDVA 3QDMD 1RIHL 2EDXA 5EBMA 4F33B 3QIUD 3TCLB 4LDOB 3SDYL 3QUZC 4WJ5A 4B0MM 3KJ4B 4FA8A 4TUJA 5GS2D 5J13C 3LV3A 3ROOB 1VFBA 3GIZH 4LHQB 2CKBA 2IG2H 4PRBB 5I0ZA 2CO7B 2JJWA 4R0LA 1I1RA 1M7IB 5I1JL 3MRCA 1A5FL 1EFQA 3L3JB 1RI8A 1U91A 5F3HB 3ZYIA 5FYLL 5I73C 1NDMA 2ATPB 4XVJH 3N1GC 2G75A 4K8RL 2R69H 4HCRA 1NLBL 3C60C 4J8RA 4P9MH 1CICA 5E8OA 4HC1L 3E6FA 5GZOD 2P5WD 4NQUA 4FQQB 1JFQH 1JTOA 2OQJA 4JKPL 4L9LA 2KQMA 3CU1A 4HWBL 4WU5B 4MQSB 2XY2A 1MHCB 4JPVL 3BRFA 3QG7L 1L7TL 4RBPH 3WL9A 4LRIA 1XCQB 2F19L 1YDPA 3NZHL 1PEZA 4PJEE 5TDPB 1BEYL 4YXKL 4NQDB 2BVPA 1EAJA 1U3HC 3QCTL 1A02N 1T21A 3OAYH 5KSUB 2ZUQB 4NO5B 1TJGL 1A6VH 3QNYA 5D2NE 4JO4H 3WFHB 3X17A 3EGSA 1UM4H 5B8CC 2XV6B 1XZ0A 2EDDA 1INDL 4F57L 3B6SA 2VR4A 3MNVA 1P7HL 1CLZH 4WEMB 5CZVH 5F7KC 3AU1A 3S3PA 2CK2A 5LAXB 1OTTC 5TJWK 5HPMA 5C0IB 2R8SL 1FFNB 1N59B 2DKMA 4PJ8A 2J3SA 3VD5A 2VLJB 1YEJL 1A1OA 5GHWL 2XKUA 4LSRL 4F7MB 2VZ1A 3EKCA 4ZSOB 2NW3B 3FT4B 4AQOA 2AV1A 3FO2B 3AB0C 5FA4B 4DJMA 2GJZA 1C5CH 5FKPB 4NM4L 3IXTA 3TH3T 2EDJA 2ADFH 2E3VA 1FBIH 2I60H 4Z0BH 4LHJB 2DKSA 1S9WA 1N3NA 2FX9H 4X80L 2RGSA 4NWUH 4UQ2A 4L3AA 4YDJA 1MJ7L 3CK0L 1TFHA 4N8PA 4YDJB 3O2DH 4Z78B 4X6FA 2DI9A 2FD6H 5FHBL 2XA3A 1ZEAL 2HVKA 5INDB 3DOSA 4L29A 3UTSE 3MZTA 4OLWH 4PD4K 5FKAA 1CF8H 3T3PF 1QSFB 4YDKL 4YHNA 3ZDYF 2XXMB 1EH9A 1LP9F 3HKFA 2AV1B 2FEDC 3FO2A 1OOAA 4JJHA 5D2LF 4ODHL 3SDYH 2ZOLB 1NMAH 4AEFA 4A6YA 4KJPD 3W81A 5B8CA 1UYWL 2H1PH 4ZXBD 3ZE0E 1RUQL 2EDQA 2WAHA 3LH2L 4ODXB 4MVBD 1P6FA 3TC9A 3SJVE 5HPMB 1UG9A 4PJHB 5J0BA 4KK9C 3AU1B 5B38B 1FJ1B 3DURB 1NCUA 4IOSD 1HNFA 4GRWF 4YX2H 1EFXA 4NJ9L 4LRIC 1I9IL 1J88A 2IBGA 4CADA 1KUMA 4HXBH 4BFGA 2FLBT 5CSBA 4LAJH 3TVMD 5ID0B 3UEZA 3ARYA 3MBEC 4XMLH 3WIHH 1FFQA 4YE4L 4X9HA 3RKPA 1R0AH 3TWCH 4Y2DB 2FB4L 3QCTH 2HJKB 4ODSL 2CPCA 1MHCA 4APQC 4Z77A 2GCYA 4OZIB 2DTMH 1FVEB 4Y4FD 2OZ4L 4DQOL 4XHQA 4R0LC 2VO5A 3HMXH 1AXTH 3LS4L 1DUZB 4ONHA 3EZJB 4XP1H 3CLEH 1UWXK 5E8OB 2C1PB 3QG6A 2MWCA 1OCWH 2YD9A 4WU7A 3TPUB 4E5XB 1CT8B 4P2RE 2EDYA 3RVUD 1JGVH 1LO5B 1Q94A 5CD3A 3ULVF 3OXSA 4ZTOL 4NN6C 4HKJB 4Z7UA 2XZQH 3QQNA 3D69A 4HWEL 5IUSA 3VFSA 4BSWB 1ZLVK 3RWIB 4FQXB 4L4TB 3QDAA 3NIFE 3QPQC 4QOKD 3KPSA 3H2WA 4CVZA 1C5BH 5KVEH 4JVWA 3WO4C 3NTCL 4Z7WE 5D96C 3RGHA 3QWOA 3RWHB 4RMUA 3CX5K 2EDKA 3MV7D 2AEPL 5DJ2A 5GGTH 4JRXB 4JFZH 2LFGA 1DVFC 3L3DA 2ZJSH 2JJTC 2EIDA 2EXYC 4WW2C 4P3CL 4JRYD 2CIKB 1LK3H 2YD8A 2NTSP 1JHLH 2F58L 1ZEAH 1UJ3B 2OTPA 2V7NB 1VFMA 3UO1L 1DZBA 1IFHH 2JJSA 4RGOH 4AEIH 1YEFL 2AQ2A 3WUWG 4GXUN 3LMJL 1FO0A 1Z3GH 1JYVA 1VHPA 3FT2A 1MI5E 4Y4HB 2ARJB 3BVNB 5CD5C 1RV6X 2CR6A 1D5ZA 2R0ZH 5IVXF 2D03L 3RUGF 4XHJC 4WENB 5E8EA 4FFWC 3HZYA 3BPNB 1SQ2N 1TJIH 1OP5H 3BO8B 1V3LA 4J12A 3DMMA 5DMJB 1I9RH 2ADGB 5DA4A 3O2DA 5D2LB 4NHCL 2AJZB 3WNKA 5AEAA 4XPBL 4KDTC 1C1EL 1UM6L 1PAMA 4TYUA 2ZSWA 1MQKL 4OZFA 2X9YA 4F7PA 1KT2B 4YIQB 4R7NB 1P5UA 1J10A 1R24B 2B1HL 4Z7VA 3M07A 2OXHA 3MODH 5DHVB 1MCRA 4KQ3H 3U1SL 3LIZL 2DQCH 3ULVD 3DVGA 4JFEA 3V7MA 3HR5A 4X99A 1P7KA 3LKSB 4LKCB 3TWCL 1RU9L 3PDGA 3BKYL 4XTRD 4MCZB 3O4LB 4FMFA 4BQCA 2NY4C 5L88L 1ZT1A 3CDFA 4FQJL 2AJSH 2D0HA 3E8UL 4CDHA 1RZKC 1GHFL 5FGBC 3GB7B 2JE8A 1FCGA 5ETUB 1VB9A 3QEQB 3EO1B 5ELIA 1U58B 3T1FB 1YQVL 1AQKL 3CIQA 4LIQE 5E2WH 5EOCJ 2XZCH 3ARVA 5EC2A 3C60A 3SDDA 4ZODA 3QFJD 3CGTA 2AP2A 1S7QB 3NN8B 5IFAL 4MNGA 2KZ1B 2QQNH 4FZEH 1ZLUK 1K3IA 4XPTH 2IJ0C 4PB0H 4PJCA 4PRAB 4XCCH 4HIIA 3RX5A 4NC1C 4G6JH 1IAIH 4WFED 4ZAKB 1S7SB 2V7HA 4M61A 3CFJB 3LKOB 1I7ZB 1QTYT 3GMQA 1MAMH 4YQXH 1JHKL 5E2TH 3OR6A 3SBWC 2H6PA 4P59H 5IB1B 2VDKH 1TZHA 1NSNL 1J18A 2UZXB 4P3CH 3IJSA 1U8IA 5D1QC 3BPLC 3QIUA 5I8EA 5I1IH 5HI4D 4HJGB 5CGMA 2FIRT 3AS3A 3OHXA 5JTWA 4M7LT 2BNQB 1FNLA 4Y5XA 3MRNB 3MRGB 4JY6A 3IRPX 4RIRB 1A1MA 3MFFA 4K71C 2FWOA 1G7MA 1KEML 2CGRH 1CDBA 3K8LA 3C5ZB 3F12B 2GK0B 1PSKH 5A1AA 2DQTH 4FQ1L 1QYGL 5C07D 1R5WA 1OAYL 3PV6B 4RFOH 4JRWA 4LCWA 6CGTA 1EERB 2R29L 4G42A 2V2WA 3W82A 5I71C 5JUEH 5D93B 3SKNA 4JKWA 2CK0H 5EUKA 2I9LA 1BPVA 1MCEA 3UPAA 4U3XA 5IVXB 2DQJH 1MCSA 5HHMB 3GIVB 2EC9T 4X6DB 3ARGA 1LWRA 2UZIL 3V8CA 1P4BH 1ZXQA 3MUJA 3FO1A 4Q2ZB 4AENA 1NL0H 2BERA 3A6CL 2MNUA 4ZTPH 3IT8D 4U6HB 4W81A 2AKRB 5H2BB 3MJ7A 4XMKH 4YPGA 4OLYL 3KYMA 4X4YA 5DR5H 2Q86B 4R96A 5EZOH 4QF1B 1FCCA 5B39B 1BHGA 4S0TD 4U2YA 1U3YA 4ZUVA 4PLKC 2ZOKA 1VADB 4KRLB 2VDQH 4WEBL 2IC2A 2EDBA 1INEH 5T1KD 5HI5D 4GW4A 4HD9A 3V2AR 4XHJD 4FQCL 4ZFFB 2FSEA 4BUHA 1ZVSB 2IPUK 1LO4H 5IMOA 2VQ1B 5DHVH 4PY8I 1YECH 2X1XR 2AEIT 3JV4B 4KY1L 1CDJA 1ZLWH 3VRLE 3AC0A 5CZXC 1JRHI 4XNZC 1D5BB 4KDWA 4NZRL 4PRIB 3E6HA 3NCYS 5DQDL 3ZL4H 3ULUL 4XP5H 4G9FE 4J4PD 3OKMA 3L7EB 2PO6C 1ZHLB 3MLSL 1G7LA 2I60L 4LVOB 3HFML 2KH2B 3GGWB 4QHNB 2BSED 2HT4C 3RGVC 3W9DA 4HMDA 3HZMA 3UYRH 4JFQB 5J6HB 2WIMA 4OQTH 1U8LB 1U2CA 2PTUA 3NOIA 5DJYB 4QRRA 3T2OA 1FPTL 3DIFA 4LBEA 1WBZB 1FG9C 3LN5A 2JKXA 4ODVH 4G9FB 3VFNA 3JXAA 1MRCL 1GGUA 1X44A 2E9IA 3AAZA 1GZQA 3T77A 5I15H 2VZOA 5C2UB 4FQLL 4Z7QE 1KEMH 2CGRL 3VXQB 5HHVL 2VXQL 4ZDHA 2W9LA 1WSST 2VDPL 4FQ1H 4HKZA 3CDGB 4GKZB 4R4BB 1Q0YH 4UINL 2AJUH 5L6YL 2VAAB 2B4CC 2BC4A 3MA7A 3HC4H 4NRYB 1T1XB 5IW1B 1AO7E 3T0WA 5L8LB 3O4OC 4HUWB 2FHBA 4YXLH 3KPQB 3QDGB 4JY4A 2X2YA 1MCPH 2A9NL 3HNVL 5HGHB 1TZIB 4DOHB 4PJFF 2DLIA 3D9AL 3L3OB 2A74B 1QACA 3BD5A 3QULA 5KZCD 5BS0D 5E2VL 1HIMH 4GBXD 5FO7B 4NYLA 1AY1H 4UT6H 1CFTA 5DVLA 5EU3B 4R3SA 1E4JA 5T1DL 3S37L 3TJEH 3RIAK 1A7OH 1QRND 3IFNH 3LMJH 1L6XA 4EI5B 3RY6C 2YD1A 4OSUH 4OM1L 3CVHH 5D2NA 3EYVA 1OHQA 4IJ3B 4MAUL 2J8OA 1BIIB 1JMZA 5E2UL 2X41A 4BSJA 4XNMA 4MA7L 5JXEC 4IOIA 4L9LC 4P2OA 5F88B 1AO7A 2WIIB 4M7KL 1T1YA 5E94A 5FDWB 2C7UB 2DQHH 5GIRA 2J4WH 5KVEL 5DJ8A 5E9DB 5DK3A 1QSFE 3VXPA 1I8KB 1KGCE 3SCMD 3CUPB 2Q6WA 2NY1D 1A6TB 2ICWB 5IWLC 2DQCL 4U0RB 2BOBA 2NY6D 1D3CA 1W8NA 1S5HB 2VC2L 5AG8A 3F7RA 4FXLA 3UTSD 1CU4H 2ARJQ 2F58H 5JNYB 2ICWA 4JKLA 5CEZD 1A6TA 2FX8L 4LVNC 5ESVB 4X4ME 3PGDB 4LPXA 3X14B 4F7EA 1N5AB 3BP7A 3VXPB 1VGEL 4JAMA 1S9YA 1CFSA 5J3HD 3BAEH 4O00A 3DUHA 4HLJA 1RULL 1RY7B 3MV01 4NO3A 4J3UA 1NMCB 1CGSL 3WMSA 2I07B 4AQ1B 4HH9A 3MUHL 4K3JH 4S1RH 2VSCA 4WO4B 1QD0A 3U6RA 1Z5LA 3QFJB 3QHTC 4AM0B 4MD4A 3EO0A 2EC8A 4NO3B 1RUMH 1YN6B 3LQMA 1C1EH 1YY9D 2AV7A 5EG6C 1GSMA 4G7VH 1P7QB 1NEZB 3PGDA 1C5DB 5GRYA 3D39D 5JNYA 4XI5C 3D9AH 3SDAA 5A2KH 3QULB 1C5CL 1HE7A 4WHDA 3QRGL 2BZDA 1CGVA 5FA3B 4L4VE 5F1IA 1DANU 1AY1L 5A16B 1HHGB 5ADOL 4FZ8L 1KPVB 2Q6WB 4HHAA 1DR9A 4I18C 3QQ9C 5FYKE 1T1XA 5IW1A 1T04A 1FNAA 5GS1C 5MEPB 3RWCA 4HZLB 4L5FL 2VLKA 5DJ8B 2X42A 5MEQB 4KRNA 1UKQA 2FX7H 4U3CA 1DLHB 4KJYA 3GSOA 3PGCB 5GIRB 3U9UA 4V1DD 3H3KA 4X4XA 1DSFL 2ESVA 5E5RB 4MXQD 3V6OA 4HKZB 4N0FB 4PLKD 4IOIB 4ZUSA 4N9OB 2WUCL 3VFWA 4PP2B 4P46B 3K74B 2XZCL 1F00I 3BQUB 3HPJB 2HWZH 4R7DA 3GJFH 3FHQA 4P99A 4HLZG 2C3XA 3MOAH 2AJ3B 1JBJA 1BIIA 3EYVB 4YFEA 1YEGL 1LDPL 4HBQA 5IROC 4ERSH 2FJGA 1P4BL 3PDOB 4LBEB 2RCSH 5CSGA 2G5BA 2PR4L 5DJYA 4R3SB 1CFTB 4KTDH 2O5ZL 3FN9A 2Y23A 3P9WB 4OLYH 3PGFH 1QBML 3S34H 3QEHA 5EOQH 3EO9L 5I1HL 1MFAL 3SY0A 1EEUA 1HHIB 2R1YA 3UJIL 2EE9A 3OKNB 3QH3A 4Y8AA 4MLIA 4GLRH 4NKMA 4Y16A 3LQAC 3E6HB 4I0PC 4U1MA 3GSQB 5C0GA 1H3TA 1KB5L 1W72A 1H5BA 2VXTL 4WHYG 3JV4A 4EUPH 1NMCC 2PTTB 1WITA 1FGVH 4N90E 3LQAL 4FNLL 5DYOA 3MA7B 4PJBE 3TH4T 4OIIH 5I2IA 2BVOB 4LCWD 4X7SH 5CS7A 2Q7NA 3I6LE 4YDIL 2B5IB 1BZ7A 2YD7A 1YNTA 4AY0A 2EXWD 2CUIA 2VDNL 1N5YH 1CI5A 1SYSB 4BK4A 3KPMA 4UV4L 2IF7A 1DEEB 5EZLA 2Z8SA 4U0RC 3T65A 3RZWA 3QIWA 4PJ9A 4QRRB 3IDUA 1XH3A 4P23D 5AUMB 1ETZA 3ARED 4JFQA 4HS6B 2AKRA 5H2BA 5BVPH 4E41D 3DETC 2R23A 4U6HA 4W70A 4OCMC 1IKFL 2GJ6D 4DN3H 1G7LB 3BUYA 1ZHLA 3MXVL 3ARGB 1T7YA 3GIVA 4X6DA 4Y4HC 4LPYA 4RFNB 1DBMH 4PRIA 2UWEA 2P8MA 2EH7L 3O3EA 2VLRE 3ZT7A 2EH8H 4PV8B 1CG9A 2IAMC 4MA3A 1U93A 4P9HC 3SO3C 4JHAL 3U0TB 5JXEA 5IMOB 3DYMA 1K4CB 3A6OA 4HS8L 1IT9L 1R5WB 3PV6A 3EOYG 3UZVB 3FO0H 4NKQB 5LBSH 3MX0A 1JN6A 2JF1A 1KIQA 3PWUB 3T0ED 2FWOB 5I19L 4J4PA 3NIDE 3ULUE 3HNSH 1JNHA 3ZHKA 1MUJA 5IB2B 5DC0A 2YZ8A 3QJFA 4HUNB 4FHBD 1C12A 4QRRD 1KN2L 4J3WA 3PQYB 3S34L 2HN7A 4YUEL 1OAQH 1CR9H 4LCYA 2ICEB 5IB1A 1SHMA 4X83A 2FGWL 3T09A 1RMFH 4JREB 4MJ6A 5FGCE 4IMKC 8CGTA 3D1MC 1VPOL 1U8NA 4PJCB 2I9LB 1W2KT 4FQLH 2DLEA 3TT1H 5SX5H 3T2NH 4MNGE 3O3UN 4F58L 4Z18A 4QXTB 25C8L 3S5LA 1HXMA 4Z7OF 2R56L 4XBEH 2D7TH 3QEQA 3RBGA 5KN5B 1DBBH 4K94L 2D9QB 4UB0L 3BX7C 1RIVL 4I48A 3MRHB 3IJYA 2JJVA 3STBA 4M6NH 2VWEE 1FAKT 4HIXL 1KPUA 5J1SC 4L8CA 3NCJL 3CSYA 1Q0XL 3UC0H 5ADPH 4HJGA 4KVNH 1D6EB 3GSXA 3ZDXF 2A6DA 2NY3B 3GO1L 2NY2D 3RVVD 1NANI 2YC1A 3IJSB 2HLAA 3IB4A 2UVEA 3IAPA 1E27B 4OLVH 5EIIB 3RVWC 3HR5B 5FHBH 4P4RB 4EVNB 1ES0B 2BNRA 3KLHC 4HXAL 4P59L 2ZUVA 5GRVL 2YD6A 3LKOA 3HG1D 4OZFB 4F7PB 2A77H 3T0BA 5BW7A 3X3FH 2DIAA 5KSAA 4DW2H 3QXDB 4LQ1A 1RULH 2X6MA 5I1JH 3DI2B 2IH3A 5DMIL 4XZUB 5KAQG 2AJZA 5DK2B 1RUQH 4NC0B 4ZMAT 1CGSH 3DPBA 1B9ZA 4DKEH 1BQLH 3RKDD 1DQDH 1M71A 2DWEB 2NXYB 2OK0H 3C8HA 3HZYB 1RHHB 2W91A 3X13A 4LHUG 1NFDB 3EOBA 4QWWC 1GAFL 1KBGH 2O26U 3P30H 4I3RH 3REVA 4JFFD 3VI4F 4XVUD 1CIDA 5B3NA 1IEAB 3BJ91 3S36H 4H1LH 2A83B 4WFFE 1NC2A 4Q9RL 3HUJA 2YEZB 5JPNB 4OZGF 2WV3A 2EICA 1KFAH 2VLMD 3L3DB 4PRPE 4WTWA 4TVPD 5GRUL 4JRXA 2NPLX 4FABL 2ADJB 4D9RE 5EORH 4NFDA 4DUVA 1MHHA 5GZNC 2CRZA 3NFNA 3RWHA 2A73B 1U8JA 4L3CB 5KOVC 4L8SB 4R97B 2YUZA 5D2LA 5T1LA 2XA8L 2ZUSA 3RWIA 1YEJH 3IAQA 3DMMB 1SBSH 4KQ4H 2D7TL 1NFDE 1T4KA 5F1KC 5IBUB 3VD4A 4P5MB 5F6IB 4L4TE 4UB0H 4ALAL 1KJVB 4YHKH 3LRGA 1TTGA 2ARJA 3BVNA 4NM4H 3LEXB 4X98B 4ZO8A 1J8HB 3FT2B 1D9KB 4M43L 2RJMA 3NCBB 3MUZ1 3N1QC 5GS1A 4KKLC 2BHZA 3NCJH 1V3KA 2XTLA 5CBEA 3VDBA 4XC1L 4OZIA 5IB3B 4RISL 1UJ3A 5EB9A 1BZ9A 3QEGL 2NY6B 4QKXB 4NUJA 5F7DA 4GBXA 2Z91B 3Q6FB 2YPLA 2GAZA 2NY1B 1N64H 4N8CL 1CBVL 1EEQA 3KPPA 1FV1B 3HB3D 1YPZA 5IJVA 4RGOL 5FCSH 4OZ4B 4NQED 1CQYA 3BPOB 5DJ2B 1BBDH 1QSVA 1KELL 4NQSA 5JR1H 4W4OC 3SE4A 1EFXB 4CVZB 2X4UA 4OBSA 1UCBH 3DURA 3F6IA 1KNOA 1O0VA 1RK1B 1TETL 4FQXA 4J7RA 1CK0L 4PJIE 3N9GH 4I18B 4L3EE 4GRLD 5GRZA 1KCKA 4AEHL 5CCKH 2RFXB 1EPFA 4A6YB 2H3NA 1X9QA 1NGQH 1UVQA 5K9QG 3D18B 2C1OB 1DUZA 1FH5H 4YE4H 4O5LL 1MREH 1FVEA 2IMNA 2WBJB 5C0CD 2AK4B 3BQUC 3D85A 4J1UA 4K94C 3EYSL 4KKBD 5E7BA 2Y5TB 5F9DC 3PGFL 4UOW1 1S7TB 3VFPB 4KHTH 3HAEG 2YWZA 4B41A 1G6RH 4U6VL 1MHEB 1HHKB 1W8OA 4MD5B 3UTSB 1OCWL 3IXTB 3NA9L 4HT1H 1SEQL 4OZFG 3BYTA 5FA4A 5IFHL 5DXWA 4WNQA 2H32B 4F7MA 5IGXL 3OMZA 1A7OL 1J05A 4IS6B 1A6VL 4BQBA 2X1PA 3KPNB 5IMLB 4OM1H 35C8L 3BT2H 5DJAB 1N59A 3FO0L 5LBSL 4M7LL 3G6JF 5ID1B 5F9WC 2ZG2A 5D8JL 1JZ4A 5IMLA 5D6CB 1DQLL 1CD1B 5HBBA 4WVRA 3B6SB 5F8QC 4CVXA 2CLZA 1AR2A 2H32A 3S37X 4WNQB 1QLFA 3WFHA 1NCCH 3ARDD 4Y4KD 3QNYB 5GHWH 3ME0A 1GIGL 5FKAB 4YO0A 4QTIH 3PG2A 3Q2CA 3C08L 2FRGP 1MHEA 3GMNA 4X6DE 5JOEA 4F8QA 5BVPL 2GI7A 1AJ7H 4UQ2B 3VXRE 1I3VA 3AFLA 1D5XA 2FYYB 1FC1A 3EJZD 2EC9U 2V2TA 4PRNA 4U1SA 4OD1L 2BXZA 3E1F1 4JFDB 3V0AC 4L9LB 1DBML 3O6FD 5EFIA 3WEXA 1QBBA 4PJXB 3E6FB 3D18A 1CU4L 3NABH 1QQDB 1P5VA 2A6IA 3T2NL 1S9XA 1G9NL 4XBEL 1QVOA 4P5TD 1HYSC 3ZKXB 1NBQA 3VE0A 1E4WL 4PGBA 3WHXB 3WXVL 2Y7QB 3PWPB 5JUEL 1Q8MA 1FFPB 5GS2H 2GW5A 3O3AB 1KNOB 3MNVB 1PD6A 1U3HD 3Q48A 4OI8A 5JW3H 3RDTB 1KJ2L 5EBMB 5DFVC 5C0DB 1UZ8B 1JYNA 2BVUA 4GRWH 3PV7A 1JNNL 1S5IL 3IFOA 4IRJD 3MRKA 2BVPB 4NQDA 5CBAB 4H8WH 4KHTL 1MCKA 2GAZB 2FZ3B 2NNAA 1XCQA 3KVQA 3STLA 1A8JH 3F6LA 3RVVC 2E7HA 4OGXH 4MJIB 1XF4A 4XVSH 1QKZH 2IALA 4LASH 1WFUA 5BZWB 5GS1B 3MV8B 1IGIH 4UNTA 1D9KA 1G7IB 3LEXA 3ELAT 3DETD 4X98A 5HYJB 3CFEA 3P11H 3ULVH 4PRHD 1IQDB 3ALPA 5JHDD 5IW3A 1G7PB 1T4KB 2E7BA 4X0KA 5DRZA 4WY7H 5EU7E 3P30L 3FFCD 2CKBB 4K07A 1KB9J 1BQHG 3GSVB 1YY9C 1YC7A 4ZTOH 2J8UE 3VG9C 4TUJB 4NKDA 2P42B 4JY5L 2WUCH 3BMVA 4O4YH 3K2MC 4LNRA 3K4DA 5DMGD 2HWZL 4X7TB 5ICXA 1ONQB 1F13A 4Q6IA 1A9EB 5DSCA 4E41A 2BNRD 2HVJB 3I02B 1AGCA 5DQJB 3UYRL 1D5MA 4LCUB 4OQTL 1MCFA 2WK2A 3QCVL 3HG1A 4WV1B 1BGXH 5SV3A 2EYTB 2EYRB 3MCLL 3VW3L 3RVUC 4NZDA 3HUJB 2HFGH 4KROC 1A6AB 3LKPB 2X4SB 3KLSA 4FTVB 1W0WB 1ZTXH 2EEDA 4C56A 2C3GA 2VN7A 2HJLA 5JXED 1I4FA 1SJXA 4ZUUB 4AL8H 2NW2B 4LIQH 1Q1JL 3VFVA 2X4QA 1DQMH 4M6OH 1OTUD 1CLYH 2X70B 3A67H 1MJ8L 1XGPA 3RL1A 2EKJA 4UU9B 4RMSA 3PXJA 2OTWB 5TE6H 1F90H 2NTFA 2YUXA 1GAFH 5SWQB 3GNMH 3OKEB 3RZCD 5HI3D 3BGFC 2F9BT 1F6FB 1NJ9B 2WINA 5FK9B 1VACA 1EA9C 1TPXB 5L7XL 4O9HL 5EO1A 1UWXH 2VE6A 2ESVE 1VCAA 2I24N 3QZWB 4U7MA 2ZKHL 4ZO7A 4PGDB 3BHBB 5EZOL 1IGFH 1T83A 2BNRB 2HFEB 2R4RH 5HYSA 4U3HA 1EJ6A 3L3IA 2G60H 1YMMD 4AEEA 2Q76B 2A6DB 2PXYB 3LSOB 1WFOA 2UY7A 4HKBA 3H7BA 1JCKA 5DS8B 1NGWB 1JWSA 1XCTA 4WWID 3S3JA 2R9HD 1J0YA 1PYWA 3DECA 1RURL 1QR1B 5C07B 4PJ8D 4NRZB 1J8KA 2HTLC 1IM9B 1LMKA 4P2RB 3WYRA 4R26L 5AYUH 1CFVL 3SDDC 5DUPL 2HFFA 1REIA 2X1OA 3T08A 4UILL 1C7SA 1FNGA 1MFDL 3MRJA 4G80A 4PBWD 2F53E 4ODWB 2LTQC 4IHOA 3LN4A 3H9SD 1T22B 4QCIA 4ELKA 3KPOA 1PX3A 4M43H 4H5SA 4HEPG 1LEIB 3T4AA 3BRGC 2CJUH 5E4IA 4MMXC 4PB0L 3JWOL 1MWAA 3WDIA 1M6OA 2Z31A 5JIKA 1V8HA 1FL6A 3EHBC 1IQWL 5DJXB 4ZG1A 4Z7UE 4ONOA 1QO3A 1UZ6F 4HFWA 4MCYA 4QNPE 4MSWA 3KPRE 3WHE1 3PIQB 3QJFB 2QQQA 4PYHA 5DJCA 4L4VA 4DOHE 3C09C 5SWSA 3V52H 2VXQH 2EYSA 4I9WE 4UIKL 1DBKH 5HGBB 1F97A 5E1AA 1MQ8A 1JPGB 3PWUA 4KV5F 3E2HB 3I6KA 4XPGL 5KOMC 5I1GH 2AGJL 1CK0H 3VXRB 2AS5M 1WAAA 4UBDC 2OJEA 4Z0XA 1XF2B 3DLQR 5FUZL 3ZMRA 4NOBA 3TT1L 3K2UL 4LPUA 3U0TA 2Z31C 4WHCA 2X7LB 5I6XC 4GLRI 1U93B 4JFDD 2YK1L 5C0CA 4G7VL 5F70A 1KLUA 2Y06L 2J7LA 1OB1B 1DFBH 1S7RA 2YXMA 3W0WB 4O9HH 1A1NA 2C5DC 4P0DA 3PWLB 4XNYL 5C0ND 2NR6D 4Y4FA 3SJVB 4GRWE 4QRTA 4TTDC 4QWWD 2GTWA 1G7QA 4KTEH 3MRPB 2GSIA 2UYLA 4P4KD 5CILH 3RTQA 2X4OA 1ZGLB 1IKNA 3NABL 2UUDK 3BGMA 3JUZA 4XGZA 4QRSA 3VMPA 5CUSH 1XF3B 5EZLB 1DEEA 1BM3H 4XWOC 4JDZB 5JDSA 4OCXL 2BRRL 4FQHA 3O9WD 3PWPE 4KXZH 4PJAF 4R4ND 1A6PA 1TENA 3L5WA 4OCWH 4NO0B 4TUOA 4MA1C 4QOKB 3BKJL 2EDOA 1IL1B 3C9NB 2BSTA 3MBXH 4YHMH 3MV7A 4QYOB 2P8LB 1T5WB 3RL2B 4Q0XH 1GGBL 5DYOB 1UH3A 5D1QD 2PTTA 4GKSA 2KPNA 2RCSL 43C9B 4I0CC 4GG6A 1WZ1L 4J3TA 1JNNH 1S5IH 2CJUL 2KL6A 3W5NA 2O5YL 1EHLH 1NCNA 3G5YA 3P73B 4UDUA 1W0VA 2P5EB 1GYAA 4QGTA 1HHIA 2LU3A 2PW1A 5IHLB 2AJXL 1MJJA 1ZT7A 1D7FA 2YSSB 4JZJB 4KGLA 4HUUB 5T3ZE 4JZNA 2ICES 5JDJA 2JTDA 2A1WH 1YYML 5TQ2L 2F74A 3Q5YA 3VXTB 3BP6B 3B43A 2FJGB 4U1NB 5J1TC 3GI8L 3QJHA 4QO1A 4P5TA 3T0DA 3VWKC 4G6ML 1JF1B 5SWSE 4U1HA 1F3JA 1AHWC 2W59A 4I0PD 5IOPA 4WW2B 1KTLB 3DUUB 2VLLB 3LKQB 3D25A 4YBHA 4KKAC 5IMKB 2F54E 4PLJD 4FFYH 3HZKB 3WFZA 3J7HA 4KI1A 1A7QL 2JCCB 4HZLA 1AKJA 1UH4A 4UV4H 1JYWA 2ZUUA 1U8MA 5JIHA 4NQDD 4Y2DD 3DV4B 5EA0L 1NAKH 3MLVL 2P5EE 4NP4L 1K6QL 5ADOH 1MCOH 3CSPA 2XWTB 4OD2B 2ED9A 8FABB 1EK3A 3NA4A 4MXQC 4LOUC 3PHQB 3BIAX 1NEZA 2FX7L 2CDGA 2EIBA 4Q7DA 1IGIL 4G8GA 2Y9RT 4HIJA 5JHDA 4FQIL 5IESH 2VWEC 2FO1A 1LDSA 1KYOJ 1WC7A 2R2EB 1OAUL 3TZVB 3QIWC 4GKNA 4FRWA 4EQ2A 4M3KB 1MCNA 3EO0B 3C60D 4AM0A 3MV9D 4LP5A 1NANH 4YFLI 1N7MH 1JF6A 4U1JA 1EMTL 1CLOH 4GRLB 3EFFA 4XNQB 3QO0A 3ULUF 3ROLA 1K5NB 2HFTA 4JAMB 1MCBA 2QJDA 1X5KA 2HG5A 1SYVA 4JPKH 4D0BB 12E8L 2PYFA 2R4RL 2ZSVB 2V9RA 3BXNB 2AXHA 3FQUA 1HHHB 4QGYA 3TVMA 2AJXH 5D96B 1FYTB 3D87B 1FZOB 1CLZL 5HJ3B 5CZVL 2VQTA 1J87A 3CUPA 3EHBD 3WNPA 4LSTL 5CGYD 4CU7A 5J6GA 4GG6E 5I71B 1WBXB 1IEHA 1Q1JH 5CIPB 3NPSB 5J3HC 3S4SB 2P8PA 1TVHB 3I75A 1G6RB 4HPOL 1I9RL 3AM8A 5EU6D 2H45A 4QRPE 3TNMB 2JJTA 2X9WA 3GBNH 1AO7B 3N06B 3O8XC 3VMNA 4I0KA 3CFCH 1QRNE 4OBRA 1T7VA 1PKQE 2Z92A 5HHOA 3LN9A 5I16A 2OR9L 3BT2L 1KF9B 5DI8B 2JELH 5AD0A 1G0YR 3MUGA 2NX5B 4G3YL 3FAXA 4PRPB 1RZJH 2AVGA 3DXAE 4NSKB 3C5JA 4LLVB 3MBEB 1IAIM 1XFPA 1QOKA 4PJHF 1WFNA 2DQUL 2V5RA 3UJTH 3QDMB 4NYLB 4OLVL 4KWUA 2XTJE 1IGFL 4APQB 3K46A 4MD0A 3H3PL 4MXWH 2LE9A 3W2DH 1P4IH 2A74A 5DJDA 4HW6A 1NGZA 2HAZA 2YRPA 1QUNA 4KMQA 4AZ8A 1RZFH 1FL3B 1RZGB 2NLJB 2ZP0T 1BX2A 2Q3ZA 1IRAY 4L1HA 4N8VB 1XGQA 3EIFA 5E56A 3V5HA 1J8HD 2PCPB 4JFFB 4M1DL 3N85H 1Q9KB 5E1HB 1E6OL 3QUKB 4QY8B 2XY1A 4JE4B 4X6CB 5I1GL 1A7BA 1KJ3H 1DQDL 2VAAA 3ALWA 1FFOA 5CJ8A 4KV5E 4J23A 4R4BA 3SE8H 4R26H 3CDGA 4GKZA 4YHZH 3K8MA 5D7KE 5L0QB 3RI5F 2MQ0A 1QA9A 1I8LA 5FDYA 1RUPL 1BREA 4U4BA 1FVDA 3C87A 2GSGB 2JIXA 3AY4A 2FATL 1GZQB 3T77B 2PYEE 4AG4L 3C09B 3WXVH 5HPOA 2YPVL 4TN9A 1JI1A 1N8ZA 2YN3A 5D2NC 1PDKA 4PJIB 3QUMB 4DN4H 1P2CB 1X4XA 2QSVA 4OLUH 4IDJL 3CFDA 3L3GB 2D31A 3RVWD 3WSQL 4C57C 1PQZB 5DHYA 1IQWH 1SEBA 1UJ3C 5D7JA 2W0KA 4OFDA 4XNUL 1IKNC 3P4MB 2BCKA 5JLZA 4HUVB 3GGWA 2IWGA 4M93C 5DVNA 3WIIH 1ZGLM 4UAOB 3L7EA 3IDNA 5CMAB 4PJGF 4YDLC 1D5BA 1EHAA 3X11A 4BH8A 5EO9B 2XZAL 5F21B 5KBNC 1YEEH 2YD5A 3FQWA 3WHE0 2QKIB 4PYGA 3BN9C 4RMQA 1FGNH 4F7TA 3ARBB 4JM2F 3HI1B 4QT5B 1IGYB 4URTB 4BZ2H 4LCCB 4NFCA 4KJWD 2ZPKH 4CJ1A 1CGWA 4P5KA 3MJ8A 4DGVH 5I30L 1BAFL 5IHBA 2H2SC 4JFHE 5F9JA 2WBKA 1A7RH 1OARL 5C09E 1DUYB 1JTTA 5HHQA 5J4MA 4YHYB 1NBYA 5SX5K 3RJQB 5BS0A 2NZ9C 5IMMB 4QF1A 5B39A 3CFKB 3K0WA 3WS6C 3EJYC 3DUSA 4R96B 1EZVX 3UO1H 5E4EC 3GI9L 1ZT4B 2WZPD 5DEZA 1PY9A 1Z3GL 3BISA 2W38A 2ITDA 3TA3C 2DD8H 3V8OA 1VENA 3MV7E 5D2LE 4BZYA 2D03H 1I8MB 1MIEH 4LSPL 2MHAA 5E8NB 1UH2A 3ZDYE 1MCDA 3P9LA 5CEYA 3TPKA 1NCBH 3WKNA 3PHOA 3CZFB 3PJSB 2W65B 2VL5A 5BXFB 4K3EL 5F6HI 1Y18A 5ERWB 4PUBH 2B39A 2H2PC 1XGRA 1ZA6B 2D7PA 1CXHA 4G5ZL 4JLRA 3SGKC 5LGJA 4E0RA 3JVGC 1I8LC 2F8OA 3KPLB 3ZE1F 3V4UL 3IDXH 4ZNEA 1JYXA 5DQDH 4EUPB 4EI5C 3BUTA 5C71A 2LVCA 2FLRT 5DGRA 3MLXH 4RIRA 5JIIA 5D70L 4KZDH 3GKZA 3CSBA 3QXUA 3GMPB 1H3UA 2HT3C 1ORSB 3O81A 3IS0X 3MYJA 5I19H 3BWUC 5I8EB 3RI5K 3PF2A 5J9PA 2VXVL 1F3DH 3ARGD 3O6FC 1G6RL 2PXYC 3NZHH 1HCFX 3RA7H 5HYSG 2Q8AL 1T6VN 3BZFA 3LEYL 5L2JA 1S7XA 3TT3L 1F11B 2AXJA 2CH8A 2VISA 4ONFL 4PP1C 1DN2A 5ILTL 5FM8A 2XA8H 3EJYD 1I75A 1T0NB 2OZ4A 1AQKH 3SGEI 4XI5D 1INDH 5INCA 4LEXH 1R5VA 2V5TA 1RMFL 2CRYA 3QQ3B 4TPRH 1I3RA 2OL3L 1FGNL 3SDDB 2FJHA 2L4OA 1IAIL 3HC4L 3T1FA 5BRZA 2CXKA 4RMRA 3T2QA 3EO1A 3MLPA 3LKNA 4A2MA 3GMOB 4M6MH 4X6EA 4YHYC 1OTSD 1PG7W 3VFMA 1IC5L 2IBZX 3KYOA 5AAWA 5T3ZL 3ZKNC 4BA8A 3GEWB 1V7NH 43CAB 3GMMB 1MCQA 1N64L 5E2VH 3O4LA 5ESAA 2BVQA 2RHEA 4JANB 3BP4A 2YD4A 3WLWC 5DJ0B 4PS4L 4LVOC 3RTQD 5FECB 2FD6L 3UTQA 1CQKA 3QDJB 4JG0H 4RZCB 3U4BH 2AI0H 4XCNB 5JMOC 4G9DB 4V1DA 2ZSWB 4ODHH 3P0VH 3TBVB 1OSPL 2IGFH 1PKQB 5DK0A 1ND0B 4LLYA 2ADGA 2A77L 3MRDB 2DRUA 3CFCL 3QNXB 1CTNA 3SCMC 4KZEL 5FUCE 1YJDH 3QHZH 4OKVA 1KG0A 4MJ4A 3SDXF 4JDVA 5D1ZC 5FYKH 4KK5D 4GKOA 3B9DA 5F8RC 4Y4HA 5FXCH 1FO0B 5TQ0H 3KAAA 1E6JL 4GJTB 5DD6A 1R6VA 3IXAA 4PJGB 4U2ZA 1AGEA 4U6VH 4TNVK 4JGJA 2VLJE 3GJFA 4LLUB 5IVZA 3W39B 4QHKJ 5L0QC 1UENA 1UB6A 4OZIE 1RZIB 1CXEA 3UROR 4LASL 5DEGB 1X5AA 3DRTB 3KYKH 3L95A 5KSBA 2B1AL 3D39B 5TGBB 1H3VA 2EDLA 3QT2A 5DUMH 1V5JA 4KI5E 1OLZA 1BF2A 1ODAA 2W92A 3CC5A 5C0JA 1YYLL 1FVCA 4AT6B 1UFUA 2M8XA 1AKJD 3OXSB 1KPRA 1NCCL 5EH1A 1MH5A 3IDGB 5I1DA 4NQCD 4M7ZB 1OTSC 2IQ9L 1CT8A 2EEAA 5I8KH 4WU7B 1OGAA 3FQXA 3MRMA 1F4WH 3C08H 4P23A 5IB5A 4ONHB 2KDGA 2PYEB 2V5MA 3TBTA 1UB5B 5E08L 1BMGA 4KK6D 4HV8B 2GCYB 5EIQA 1KLGA 4HUXA 4RSVA 5L2KE 3CLFH 5C0AE 2DYPA 5DMGC 3V0VA 4LAQH 4RISH 2NY1C 4DKFL 2MKWA 1AXSB 3QSKB 5C8JB 1BOYA 4HV8A 3TN0B 1TVDA 5ESQA 4OV6F 1I9JL 2F53A 5KANG 3FHAA 2Q7YB 4RX4A 1T0MA 3GSRA 2IPKA 1FO0L 3GSWB 1RJZA 1E6OH 3MV9A 3BP5A 4F8TA 5I6XB 3V6OC 1BBJB 5HYEA 3VH8G 4UTBH 3LDBC 3ZTJG 1FJ1A 3GI8H 4PRPD 3GSUB 3BFOA 2JIXD 3GSNH 2XN9B 4XTRC 2ZPKL 5MENA 4GW5B 4G6AC 1G7HA 1MCPL 2A9NH 5JPMA 3ES6B 4S0SD 3TIEB 1E4XL 3GM8A 3MPCA 1AD0A 1J0HA 3KYNB 3OGOE 2QADC 3VFUB 4P3WA 1NPUA 4DN4L 5ALBH 1ZK9A 4IEFB 4L29B 3SDAC 3GI9H 2WP3O 3VXSE 3FCTA 5I75B 3OB0H 1SJHB 4PRIE 4OGXL 1H0DB 4Z78A 2QHLA 4UQ3A 1FG2B 1MAKA 5DD3L 5CEZE 1N3NB 2Z0BA 4OJFL 1ROWA 1DQQA 3SDAD 1MCWM 3LQAH 4HKXA 1UEYA 5FKPA 4O2EB 1ZLUH 5DD6B 2IAMD 1F6AA 2VUOA 3BKCL 2DMBA 2ZNXA 5E6IC 3S96B 1NFIA 2UVFA 2YHGA 1A1OB 2GITB 2IQAA 4NRXB 2EIEA 1JZ3A 5IK3B 4KGJA 1FFNA 1RFDH 1L7IH 4JR9L 1IAII 5JO5B 1D9KC 2HLFD 35C8H 2AK1L 1P1ZB 5E6IA 4JEGB 1QSEB 1N7ML 4JZJC 4XCYA 4YFLF 5HVWA 4LVHC 4LLDB 4YHIA 1TQCB 3NMEA 4PG2A 5JW4R 4FG6C 1OL0A 3HN3A 4NO5A 3QDJA 4RZCA 4UMGA 5KSUA 1KTKE 4N0CD 3MCLH 1KB5A 5IV2A 4L3EA 2EE6A 3UZQA 3SCMA 2NY5L 1AQDB 1F58H 5L9DL 3FFDB 3TT3H 4C59B 1JP5A 1TTFA 2VOTA 4N9GB 1I9JH 4OZHE 2XICA 2FO4B 3WDHA 4EKXA 3PWNB 3QUYD 2MJWA 1U9KA 3EDEA 3OTTA 5CJQL 4PJ5A 5DT1L 3O8XB 4W6WB 3VWKA 3I6GA 3SKMB 3VJ6B 1XIWD 3T3ME 4H26B 3BRDA 1QYGH 3OGCB 5E9DE 2NY6C 3DSNA 3MLTA 3MSPA 4RGMB 1N2RB 3RWFB 2DN7A 2NXZD 4Z5RA 5DVKA 4E42B 4OB5L 4JQXC 5INCB 4G6KL 2ZCHH 4KC3B 4DK6A 4MWFA 4D8PB 5J06A 1JWUA 4LKXB 1KN2H 1WBYA 2FB4H 1FNSL 5EPMA 1K2DB 2WWKT 3U36A 4I2XB 2W0LA 5AG9A 3BZFB 1RZJL 2R4SL 3LS4H 3BESR 4HBCH 3X12A 4MXVF 4P4KC 1K4DB 2IFFH 2OBGA 3IKKA 4L5FH 5DR5L 1Z6JT 1XGUA 4H8WL 1M7DA 1HDMB 5JHLH 5IFJB 1CXIA 3BI9X 1OPGH 4P23C 3H42H 2NZIA 2Y36H 3ULVC 4CW1B 2R56H 1CFVH 5BRZD 1EVUA 2GTZB 3P0YL 2OL3H 3P40A 3H9SB 4GBXC 2XACC 3U7YH 5D1QB 1T0PB 4RDQF 2VLKD 1EIBA 4P2QE 4WHTA 4P2QA 4HMEA 5GGTL 5CINL 4PJXF 2FH8A 3O6LH 2MCPH 1VEOA 4CL7A 2NMSA 5IT2L 3QA3B 3O4LD 3TJHC 1PG7H 2A2QT 3MRIB 1SM3L 5I9QB 5IG7B 2B2XH 1KTDB 1QLRB 4FP8L 1XGYL 4BK5A 3K80A 2YPLD 2BY2A 4N1CA 3SGKA 3UBXG 4AG4H 4OV5A 1FZJB 1MFBL 5D4QA 3O3DA 3NGBB 1CVRA 1VERA 3VWJA 3RNKA 1LP9B 5C6WH 3NAAH 1HZHH 4NQEA 3V4PL 2OI9C 3FOMA 3VXSB 2JCCF 4ELME 3TGXA 1YMMB 4MX7B 3RWDA 2J8UB 3T4YB 3VGGA 5FFLA 5IMMA 3IFPB 4H88H 4DKEL 3OKKB 1JPSH 5IVOA 2QV2A 1QFWI 4YGVB 2BNUB 2Q8BL 3WIIL 4RFEA 2HFGL 2BSRA 3MJ8B 3TA3A 1F42A 2APFA 5F1NA 3O9WC 4LCCA 3WJLA 1CDCA 1YEEL 4LIQL 2WWMD 3HI1A 1JGUH 3BPNC 2WM0A 1MPAH 5GS0C 2I9TB 3FAWA 3GJEA 3QPQD 4WI2A 4CGTA 5FYKL 3ULUD 4YHLL 2A38A 4RQQB 4QXGL 3LEVH 3QYCA 3UXFA 5AZEL 2VERN 4P2RD 4XAKE 1IM3B 4MAYC 3KJ4C 5DZNA 3K4AA 1NAKL 3X11B 3OKDB 2R9HC 3HRPA 2XKNB 2FHFA 4KTEL 1JPTL 1OT2A 3FQNB 3PABA 1IGJB 5GRUH 3FB7B 5KG9B 1OF2A 2NY3C 3RWGA 1OSZB 3MO1B 3G6JE 1HIML 4PJDE 4U1KA 5DC9B 5GGVY 5MHSE 3CFBA 5T1DH 1DANT 1HQ4B 3WKMH 1TJGH 4Q9CA 3QQ4A 2A6JB 2Z8RA 4YHPA 3DX8B 1BD2E 1UM4L 4X9GA 1A7NH 2SEBB 3DHJA 2ZG3A 5ALCL 4ZAKD 4YBQC 1QEWB 1T1ZB 4ZFZB 3G6JB 4Q0XL 1DDHB 2D7OA 3MUY1 5C92A 5T3XL 3CXHJ 5B21A 1OT1A 3QUZB 3IVKA 4BSVA 2NY7H 3FKUS 2O5YH 4XC1H 4QRUA 3TNNA 5I8KL 1KACB 3U82B 4OTXH 3VRLF 2J1KA 4HWZA 4YC2B 4EJ1C 1Q9KA 5HHNA 4OFYD 3VH8A 3F65A 2AJYH 4F80A 4YBLC 4HGMA 3B83A 3FB5B 5DJ6B 4X4ZA 3H0TA 5EN2B 5E6YA 3ZE2E 3V5DA 2X9XA 3V4PH 3PWVA 1NCWH 1EV2E 5F1OB 4JRYB 1JPFB 3MQIA 1B0RA 3MREB 4HQQL 5I18L 1U8KB 2BK8A 4LSTH 4XP1L 3CMOH 1A9BA 1JPSL 4IRJB 1SMAA 3U46B 2Y6SC 4PRPA 4WFGD 1A3LL 1TXKA 4ELMF 3MUGB 4NWTH 4U6TA 1HXYA 5F7YC 3ZTNH 5MEND 4PJ9C 5I16B 1FZMB 2R0LL 1RFDL 5FM5O 5E5MA 4OFKA 4ZD3L 3B2VL 5HHOE 4EDXB 1A7PL 5F97E 1G7JA 3V5KA 1ZVHA 5DMYA 2OR9H 3FFCB 1JGEB 3LRHA 3IKCB 4QHUA 1FH5L 2ITCB 1H9VA 3UTTA 1FHGA 1RUML 3ARWA 4MA1B 3MLVH 3RVTD 4X7DC 3F62A 2YPKA 2AEPH 2ZCKL 2Z4QA 1I7TA 4ETYA 2GIYA 5GISH 2R2BA 1YN7A 1PEWA 3D0VA 1TQBB 5ISZD 1NEUA 5D7IF 2OTUA 1FZOA 4NO2B 1OAKL 2H9GA 2WLYA 4LMQI 1JHLL 2XIDA 1DFBL 3FQUB 3TVMB 4KRPC 5IFHH 1J0KA 4OT1H 4WFEE 3BZEB 1I8IA 5IESL 5JOFA 1BQLL 1IFHL 4D0BA 5I17B 4O2CA 4ELMB 1ZV5A 1LE5A 1BFOB 2YD2A 4JJ5A 1K5NA 3SE3A 3FOLA 4MXVE 5EU4A 5IW6A 1EMTH 4WUUA 4BFEA 1EAPB 4JCMA 5I8CA 6FABL 1TJIL 4U1JB 5F6IC 4ENED 1CD8A 3QI9A 4KJQD 3OF6A 4JFEE 4L4TD 3KPRA 4HWEH 4PJDA 2APWA 1ORQB 1MFNA 3B5GA 1KJ2A 1OWRM 4DVRH 1IAOA 5ITBH 4ODUB 3QHZL 1FQ9C 4ZPTA 4GAJL 1X5LA 5JHDB 1FNSH 2YA2A 1J5OH 4KUZL 5D7IE 1INQA 1GZPB 4MAYD 2VLRA 4OLUL 3PHSA 4WW1A 3PWJA 4H1LA 4BQ9A 2H8PA 5GS0L 1ED3A 1TZGL 2ZG1A 2H2SD 2IFFL 4WWKA 2EIZB 2A6KA 4XC3H 4XVTH 5FCUH 1NC2D 2EIZA 4N0CC 1VFAA 4DUXA 1ED3B 5CP7B 4IMLA 3ESUF 4XXCA 1GZPA 3KXFE 1F3RB 1ZA3A 1P4LB 4RAVA 1NC4D 1WWWX 5K9QI 5F71A 5DD5H 2Z35B 1EZVY 3GKWH 4B5EA 1PLGL 7FABL 1FSKC 2H26B 4U05A 2ENYA 5M95B 1F6LL 1U3HB 1H3WM 4NQCB 3UTZB 3QI9B 4X9FA 1IVLA 2BJML 3EAKA 1FORL 5IW6B 2H26A 1YEHH 2AABL 3FOLB 5EU5B 3WJJC 1W72H 1YY8B 4JO3L 1BFVL 1JHKH 5E2TL 1P4LA 3R4DA 4RAVB 1MOEA 1QHOA 4UT6L 1R3IL 4PREB 5JOFB 4JFPB 5T5FH 1I8IB 3QO1A 4NNYB 4JPIA 2YXFA 5J12B 5IQ7L 4JFXA 5C08B 2AK4D 5CFHA 3TN0D 3CZJA 3JV6B 4LLWA 5FIEA 3VRJA 1NCTA 1K6QH 3THMH 1NDGA 4J3VA 1S9VA 2WUBH 2H8PB 1LO3L 2UWEE 1YN7B 3PWJB 4WW1B 4LDLB 1MJUL 3TLRA 2VL4A 3P11L 2P48B 3ULVL 4GG6B 4IBLT 3TBYA 4DKFH 1I1YA 3MNWB 5IEKA 2YPKB 5DUBA 1MFCL 1TPXC 2IBZY 5DMKA 1IAOB 4IJ3C 4QHUB 3RUGB 2DQTL 1CTOA 4U1LA 4QOKA 1AC6A 3TIDA 4WUUE 3G5ZB 4DK3A 1EAPA 4PJDF 5AZEH 4MJ5B 2K1MA 4HK3J 3EOAB 1NMBL 1XF5B 3QIBC 5JDSB 4JDZA 3VA6A 3JZ7A 3DX9A 4U6YB 4R9HA 2O93L 3DROA 4JFYB 3S97C 1E4XH 2IMMA 4HH8A 2X4OB 1HK6A 3ORJA 3KS0J 1WTLA 4JRYA 2C3VB 4LSUL 3B8SA 4LF3B 4TTGA 5I1AB 5KSVA 3SJVA 4L4VD 3WIFB 5IB4A 1JI2A 4PGEB 2I25N 5IROA 4JDTL 4LSVH 2OTUB 1UKTA 4ZXBC 3PXHA 3D0VB 4H88L 2CKBH 1OB1A 2X4PB 4JG1H 5CAYB 3TA3D 1U8HB 4YXHL 1I7TB 3LB6D 3RTQC 4S1QL 3V7AE 4CAGA 5HVHB 1RIUH 4NCC1 3V95A 3D3VB 5D7KD 3IVKB 2FNBA 5C0AA 3V5KB 2CD0A 4Z0XB 3HC0A 4XP9H 2M2DA 3BWAB 2W60B 4RAHA 3K7UA 4G6FD 2AABH 2SEBA 5T3ZH 4HJJH 1BFVH 3SBWA 3CX5J 3BH9A 15C8H 2CLRA 3QQ4B 1A9BB 1EGJH 2BXYA 3UC0L 4BH7B 2E27L 2J8UF 5DEFA 1U8KA 5JQ6H 1NL0L 1WT5A 3A6CH 4G3YH 3BDXA 3AY4C 1U8PA 3SQOH 5KG9A 1QFWH 4ZS6C 4D0DA 3FQNA 4LLQB 3OR7A 1HEZA 4GG8B 3DXAB 4KH2A 3IJHB 4P9HH 1UEMA 5BJTA 4GO6B 3X3FL 1RUKH 4HG4K 4PUBL 1EUUA 4ELKB 1EBAA 1Q72L 5I15L 2W0FB 1A7NL 3QEQE 4IHOB 3RHWK 4QRUB 1HOCB 2PO6A 4KZEH 1FNGB 3N85L 4WEBH 4BSVB 1CFQB 1MFDH 3V4UH 4HWNA 1K8DA 4DCQB 5C0EA 5D7LE 3RU8L 5D70H 3CU7A 3QUML 1KENH 4NIKB 1YA5A 2YR3A 2BNQE 4XB7A 2LU7A 4YGVA 3G08B 1JMXA 4OTXL 3DX8A 4NZRH 3U0WL 4HKBB 2D7NA 1OGTB 3MLUL 5LGHH 2AEQH 5I74B 5I1LA 2Q76A 3RWDB 1BECA 1MFEL 4UV7H 1G9MH 3RWGB 3FOMB 4KI5F 3OG4B 4I3SH 3BHBA 1IGJA 2X09A 5TH2B 4MVBC 3OWEA 2R4SH 3O3DB 4KK6C 3UTTE 4DFHA 1WCBB 4OIIL 5DWUL 5FYJH 3CVHA 4LEXL 5DRNB 3NPSC 4M00A 3MJ9L 3OKDA 4PR5A 3SOBH 1YEDB 4DGIL 4PG9A 2AGJH 1CDYA 3BE1H 4UNVA 5F7UA 5FK9A 5JQHC 3QUXC 1CE6A 3ZTNL 3RAJL 3WFDH 3U30B 4M1CC 4JM4H 1R3LA 3W0WE 1TJHH 3DVNA 1FRGL 1CCZA 1MI5B 5FHAH 4OFIA 5ACZA 1BOGB 4CNIA 4OZHF 3RWJA 5BW7C 5KSAC 1T6WA 2JB6A 4LSRH 2X70A 1X5YA 3VFVB 5ICYA 2DQEH 3IU3A 3PNWB 4C56B 3DGGA 3QIBD 3WJJA 4ORGA 5EC1A 3ZO0A 2JLLA 4Y5VA 4MDJB 2W0PA 1OQOA 2EYTA 2EYRA 1OD7A 4YJZL 1CZ8H 5SWZA 5CUSL 4JM2C 1BQUA 1U2HA 3VI3E 3QXWA 5E8DL 3I02A 5HHXL 2HVJA 4Q58C 2ADFL 4OV5B 5CKGA 2PNDA 5EUOF 2ERJC 4X7TA 1UA6H 5ICXB 1JWUB 2NY2B 4LKXA 3T0EB 2NY3D 1KELH 3LQZA 3CVHL 1QLRA 2O61B 5KVDH 1Q72H 3RX7A 1BZQK 4MAUH 5GSRA 4E42A 4LSPH 4PTUA 2F54B 2WQ8A 3MLTB 4Y1AE 1AFVL 3L9RB 3UTOA 3GSNL 1AE6L 3HNSL 1GGBH 2J6EL 3DV6B 2Z93A 4K3EH 4H26A 1G7PA 3D6GA 4N1HB 4IIQB 1EO7A 1MF2L 5D6DC 4MNQD 5FYLE 4PJ8C 2V17H 3CFEB 2VNCA 4PJ5B 2W9EH 4OKDA 3ZE1E 4NN7B 4HXBL 5IQ9A 5E5UB 3MV8A 3UZEA 1KULA 1JL8A 5IFJA