1BIIB

The crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Complex (mhc i/peptide)
molecule keywords MHC CLASS I H-2DD
publication title The crystal structure of H-2Dd MHC class I complexed with the HIV-1-derived peptide P18-I10 at 2.4 A resolution: implications for T cell and NK cell recognition.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1biiB00
1YZZA 2P8LA 2B8OT 3V8CA 3V5DB 5DVNA 2E6QA 3D2UB 1MFBL 2VLJD 5FB8B 4AIZB 4AYFA 2E7HA 4X4YB 3HMXL 1JFQH 3OKYA 4P46A 4KK6C 3HAEH 3B5GA 4HUUA 2R4SL 2NY1B 3QQ3A 4FZ8H 1ZHKA 1A64A 1JWUA 1RMFL 4OF7A 1D9KB 3R1GL 2P49B 4XVSH 5C0CB 2FSEA 4C56E 1C5BL 3WIHL 1NUNB 3TYFB 5EBWB 5EZOH 1LO2L 3DGCR 1RV6X 4HQQL 4OCWH 5FYKU 2OZ4L 1T1YB 5GGUA 1F4XH 3MRIB 4XVJL 2WBJC 3O3DA 4K94L 2A83B 4RSVA 1MQ8A 3K7UA 4Z7UE 1CFTA 4GSDL 2VN7A 5F8QC 4K8RD 3BPNC 4QO1A 2H1PL 5I1KL 4KJPC 4EN3B 3B9AA 4L3EB 3DVNB 3GRWL 5I30H 3U30B 5I8OH 4F9LA 5D8JL 3O81A 1C08B 5TDOB 4JLRB 4TTDC 4MA7L 1J87A 3O41A 3EJZC 1A7PH 1UM5L 3KG5A 5FHBH 5DR5L 2FHFA 1NCAH 1QRNB 2A73A 2ITCA 2Z35B 1AKJB 4PJFE 3QPXH 4HK3N 1ES0B 2QQNH 1NAKH 1F11B 3PHOA 2B4CC 4Y4HB 2FZ3A 2MFNA 4JFYA 2IGFH 3KPSB 3NCYP 3NCJH 2EE3A 4XBGA 4YAQA 3O4LE 1K6QH 1SEQH 3ARDA 3QIWB 1FRGL 1G7LA 5CEZE 1WC7B 3O2DA 3T0AA 2A2QT 3OJDB 5JW5A 4OLWL 3LDBB 4KK8C 2IG2H 2VDPH 5HVHB 2FH6A 2J8UF 1A3LL 3BVNB 3SJVE 1I1YA 3S36X 5E2UL 5IKCA 1VFAB 3HC4H 1H3PH 3NVQA 1WIPA 5I1EH 4Z77B 1CE1H 3FOLA 5C09B 4ZOCA 1KLUB 2NY5H 1JGEA 2CKBH 3E6FB 4WU5B 1ZT4A 5I1HL 1CLOH 1AHWA 4NQSB 3TCXA 3QWRA 5FM5O 1PSKL 1EPFA 3HE6D 4FQCL 5J3HD 1AE6L 3VD5A 2KKQA 1KN4H 3EYOB 4YIQA 5E9DA 4GO6B 3DWTA 5GRVK 1EA9C 2N7AA 1TLKA 4HWBA 1BFTA 2YBRA 2XXCB 4KU1A 3QRFM 5DQJA 2JB6B 5GS1C 4L3EE 1U8JA 3KXFE 4WV1B 1MCPH 3MUHL 3GKWH 5J1TC 1MHHA 1NLDL 3G9AB 3VFTA 1X4ZA 3BPLC 2HMIC 1OQXA 1T04A 4LPXA 1Q0YL 3LIZL 4J4PA 3WS3A 4J8RA 5F7HA 3QUML 4ZNEA 1KJ2L 2PO6B 4I4WA 2GJJA 4GUPA 1M05A 2LVCA 1IM3B 2FJFB 5FYLD 2XYCA 3L1OL 4Z95H 4LRIA 4MNQB 3UJTL 4CN6A 5E94B 5DZOA 1F2XK 3Q6FA 2W92A 5DFWH 2EXYC 4M6NH 3TT1H 3MJ7A 3ARGD 4M4RA 4D0DA 4GAFB 4FG6D 4MXQD 1QLRB 1HINL 1MLBA 3MLTA 4W4OC 4GG6E 3O0RH 1IKNA 2BSTA 1J1PH 1EXUB 1F6AA 2W91A 5KSUA 1MJJB 3U46A 2IJ0C 1KB5A 4X4ZA 5C09E 4HJJL 3T2NL 3HE7C 1YMMD 3GJFB 2FX9H 4OGZA 2R2EA 1T0NB 4FTVE 3WO4B 4NSKA 3NN8A 3GSNB 4MAYB 4WI9A 1QSEB 2BERA 4LPYA 1M4KA 1H15A 1S7RB 1YY8A 1WBYA 2GKIA 3TEUA 5HY9B 3QFJB 1WVZA 4XVSL 3E8UH 3W0WD 5KVEL 5JW4N 1NMAH 3QG6A 2NLJB 4PRHA 3FJTA 3Q5YA 5DQ9B 5EZOL 4LOUD 5BW7C 2ZG2A 3L7EA 1XGTA 3OXSB 1F4XL 3CXDL 4TVSa 3TWCH 3VFVA 1ORSA 4BK4A 4Z7VE 3L95B 1JWSB 2NY4D 1RHHA 5K9JL 1B4RA 2BVOB 5TDNB 4QRPA 3SKNA 3JSSA 4WHCA 4LVEA 1QO3A 3E2HB 5I8OL 3L3HB 5FUCC 1GOHA 5JHDB 3BE1H 4K8RC 5ESVA 4A2MA 3F6LA 5SX5H 2HJFA 2WLZA 5F3BA 2YPVH 2H8PB 4UV4L 1NUFA 1P84K 5GS0L 4PJEB 3T4YB 5C0JA 3AB0B 5FFLA 3AREB 4E41D 3LB6D 3HPLA 1T22B 1IAKB 5DD6B 3EFDH 5T33L 1Y6KR 4JDTL 4MNGB 1FN4A 3B9KD 3I84A 1X5GA 4EUPA 1HSAB 4MZ2A 3VFNB 4D0CA 2YD5A 3PQYE 5FGRA 4JRYD 1RZFH 3EYFA 5DQDL 4Z0BH 5HYJA 1PDKA 3W9EB 2IG2L 2X4TA 2X4QA 2AKRA 1X3DA 1DDHA 3HZVA 3ARYA 4PG9A 3C5SA 4IRSD 4JQIL 3ECBB 3HC4L 5FDYA 3WXVH 1JTPA 1CE1L 4N9OB 1YNTA 4YGVA 5EC2B 2OBGA 2NY5L 4M1GL 4BQCA 5E0QA 2D0HA 3WUWA 2DQTL 5EUOB 1ORQA 1K2DA 2J5LB 4MD5A 4YNYB 4YDVB 1F6LL 4YHKH 5IMOA 4M7KH 4F7PB 1QKZH 1CDBA 3C6LC 4V2CB 4CADA 1M7DA 2YRZA 4P5KB 1Y18A 3M1BA 5CJQL 2IBZX 3M45A 3RGVD 3PL6B 4Y16D 4DKEH 3MFGB 4Z7QE 2XIDA 1HHIA 1W0VB 2BC4B 3TPUB 5ICYB 3HNVH 3H0TA 3UCRA 2XTJB 5J3HC 3HE6C 3PP4L 4I3SH 5DRZB 4Q7DA 4WFFD 3GSUB 1HQ4A 5KVFH 4R3SA 2CDEB 4ZTOH 3C9NB 4DN4H 1FNEA 3DI2B 1S3KL 3U4AA 4KMLB 1U92B 1U2HA 3CZFA 1D7FA 3LKQA 1BIHA 2XWJA 1RZJH 2D7QA 2X1XR 2E7LC 4PR5B 4ZOEA 1S9VA 3O6KH 1H5BB 2BHYA 1RZ7H 5C0FA 4JM2A 3BXNA 1XIWD 5HYEA 4G9FD 4X8XA 2NTFB 2F5AL 4PJEE 2PW2B 5FF6B 3P4OA 1T83C 4AEIH 5ID1B 4U1NB 2OQJA 2RFXA 3O2VH 4LIQH 4ODBD 3SCMA 1NBVL 1VEPA 2CK0L 3QNYB 2OR8A 3L7FA 1HYSC 3FN0H 3F7RA 4TVPH 1V8HA 1ZT1A 2GSIB 3GMMB 4QOKB 4FP8H 1JPGB 3FT3B 1SJHB 4XNZC 1AGBB 4FQXA 4E5XA 2QR0A 5IMMB 3G6JB 4FG6C 4PLNC 1S5HA 4GRWH 4OZIE 5IB2A 3H3PH 1RFDL 5CSGA 2FX9L 1UXSB 3CDGB 1CDGA 3T0WA 4PGCB 3TVMB 5KS9B 3GJFK 1BVLB 3CU1A 1CFQA 2CRMA 1HOCA 1UWEL 3KLAB 1T89A 5DHVB 1H8OA 3N1MC 3R8BB 5C0IA 2ZNXA 3FAWA 4PLJC 5HSFA 5JIHA 2OTPA 2XZZA 5I1DB 1RAMA 4JVUA 1EHAA 5BV7H 4XPFL 1NMAL 4O2CB 1NAMB 4EIZC 4XPTH 5LVEA 2Z0BA 2YA1A 4OV6F 3TA3B 1I3VA 3MRCA 1UCBL 3BP6B 4PJHE 5BVPH 2R0WL 5IQ9B 3L3JA 1ED3A 2XTJE 3LOWA 4W6WB 2BOBB 2B2XH 5AAMA 3ARUA 5GRXG 2Z92B 3CDFA 2KH2B 4JFHD 3JV6A 3RUGB 1ZLVK 4LOUC 4ZFZA 4ODUA 4D9LH 4CJ1A 1BWWA 3X17A 4XAKD 3WNMA 1A7RL 4XHJD 3P40A 4UB0H 2NY4C 4I18B 3BE1L 3QDMB 3OHXB 3VXUB 2P5EA 3MCKB 2VLKD 1GYAA 1WWCA 2VDLH 2Y5TA 5D1XD 4AZ8A 2L7UA 2QL1A 1HZHL 3VG9C 4RFEB 5CKGA 4OV5B 4ODTH 3LMJH 1FLTX 3QO0A 3G5VB 1NC4A 4BFGA 3EOAA 1NCTA 4NRZB 4EJ1C 5DTFA 5HI5D 3G5ZA 4ELMF 3QHZH 3RPIA 4M7LT 4LLUB 2N1KA 1RUQH 1UWXK 3S7GA 4QOKE 1YMHA 1FORH 3ULSA 4OCRL 4U1KB 3LB6C 5KVDH 4ZQKA 4NP4H 4DUWA 1S7SB 3FO2B 3SKUD 4QTIL 4FQIH 1RZFL 1XMWA 2ADIB 4Z0BL 4AIOA 4OUUB 5SWQA 2XQBL 5KOMC 2VC2L 3BP4B 4HS6A 2K7PA 2HTLD 4NC1C 2VQ1B 4RMSA 4F15C 2PYFA 4K7PX 3WLWD 1R3KB 2GK0B 4O5LH 4L8BB 1HNGA 4S2SA 1P2CA 5E8EA 1XCQB 4ZXBA 2VXSL 35C8H 4G9DB 5KS9E 3LKPB 3LVEA 4OM0H 3MRLB 4IRSC 1E4WH 1D5IL 1JGVL 2ESVB 2JK5A 2W9EH 5HXMA 3SDYH 3CSPA 4ELKA 5GSRB 3V0AC 5EORH 1UYWH 1QKZL 4XRCB 5IESH 3KJ6H 3WD5L 1DFBL 2EYTB 4F8TA 4WEUD 8CGTA 3SKJH 4HH9A 4HHAB 4CU7A 2APVA 5JOFA 2L0DA 4JANB 2B1HH 3VW3H 4QRRB 3M17A 4NJ9L 1ZVYA 2ICEB 4X7SH 1F13A 2W60A 4Y16C 3NABH 5B39A 1I8IA 3UDWC 2BNRD 3INUL 2SEBB 1FE8L 3NIFF 4XVUC 5AEAA 2O61A 1WIUA 4KFZC 4PJCF 4M02A 2HWZH 5B3JE 2OR9H 4DZBA 2APXA 4PGBB 5TGBA 1LO0H 2XN9A 4XCNA 4PD4K 2XI9A 1CL7H 3ZDXE 5AZ2L 3VD7A 2DQIH 2XWBB 4YEFA 3IKKA 1NGPH 1BWMA 4U1IB 2H2PD 3H42L 1OWWA 4L4TD 5H37H 2EDQA 2BDNH 1XIWC 1FG2B 3O45A 1XR9B 1EAPB 2B39A 2ZOLA 4F7EA 4P3CL 1F5WA 5IT2H 4PJXF 3FN0L 5CZXD 4OLYL 4TVPL 5I71B 5MP6L 4OT1L 1HWGB 3MNWB 3P0YL 4FP8L 1ZEAH 3MC0A 3L3GB 5BQ7B 4U31A 2JJWA 3GM0A 4H8WC 4PJIF 3U82B 1EMTH 3NA9L 3PWPA 3DROA 3WFCL 4IIQA 3H3PL 1H0DB 5FOBA 3TIEB 5DURD 3S4SB 4HUXA 1JL8A 3Q1SH 3LH2H 3BJLA 5JO5B 3C5ZB 2AK4E 1RIHH 5JHLH 4XWGH 2Z93A 1IT9H 4HW6A 3BSZH 2JLLA 1NLBL 3KYNA 4G8GD 1DUYB 5EO1A 4APQC 3S5LB 4U6HB 1KGCE 5BV7L 1MRDL 4P4KB 3WHE0 4FOMA 3LEXB 4XPTL 4ETYA 3K80A 3N1PC 2EDOA 4QRRE 1JNNH 2YXMA 3UTOA 4N9GB 5E7BA 1BQLH 2GITB 2B2XL 5F9JA 4RQQA 5LBSH 3TN0A 5I16A 3T1WA 3MRMA 3VI4F 5ERWA 1VDGA 4OCYH 2V5RA 5E4EC 4Y5YC 4U3HA 2VDRL 3VWKB 4G42A 4D9LL 5IB5B 1S9YB 5HHMB 3EYVB 4RGMB 3QIUD 4QRUA 2VITA 5D5MF 1MELA 5F7WC 1WWWX 3PWJA 1U3JA 4XC1H 3MLUL 4EDXA 4UB0L 3ZL4L 4FQHB 5C71A 4YGAB 2PXYA 4JPWL 1JN6B 2VB5A 4OB5L 3IGAB 5ANMA 4HC1L 1HYRC 1IQWH 5L8LB 4XHJC 4ODTL 3I6GB 1KV3A 4BA8A 5E6IC 2GHWB 2LE9A 2DYPD 3MA7A 2Z31D 4OZHF 3CC5B 5I76B 4F8QA 2HKHL 2DM3A 3VFUA 5CSZA 1UGNA 3CDCA 2DIJA 2I27N 2NX5A 2IALA 5BXFB 3IT8D 5BS0B 1J8KA 3DV6B 3FT2A 3MFFB 4JM4L 5C8JA 5T3ZH 4KK9D 5LGHH 4ZFOA 1RUMH 4R96A 3TZVB 4GAJH 3GSRA 1KTLB 1CLZH 2M8XA 1BX2B 4HV8B 1UXWA 1BEYH 2B4CH 1WFUA 3MNZB 3O8XB 4YHZH 4ONHA 4O5LL 5MEQB 5ESAB 5JMOC 3IDXL 5DFTA 35C8L 2HTLC 3BPCB 3QNZB 3WLWC 5IG7A 1M71A 5IGXH 3R4DA 3SHSA 2DBLH 1IKFH 2X89A 5DA0B 2W9DH 1WCQA 4KHXL 3MBEB 4C59B 3PGCA 2LAGB 3GDBA 3NPZB 3KJ6L 4PGJA 2P7TA 3SKJL 4X8JA 4BM7A 2DQCL 3TV3H 3VW3L 3L95A 4PJXA 1CR9H 1P4IL 1TZGH 5C2BH 1N59B 4WTXA 5JPNB 4LSUL 1MCOH 1OF2B 3PWNB 4OF5A 1MIMH 4OUOA 2LVEA 3RIAF 2YD8A 4L8SA 1ETZA 4NNXB 3O6FB 4O2EA 5HHME 3WFZA 2RCSH 1N5AB 4NC2B 1MRCL 4GKSB 4IHOA 2V7NA 2HWZL 2IQAB 4X80H 1EFXA 1JPSL 4NN5C 1LO0L 1MHEB 2G2RB 5I73C 1CL7L 2VISA 5GJSL 1B0GA 5CEZL 3OTTA 2R29H 2UUDH 1NGPL 3BP5B 5FKAB 3ZYIA 4YUEL 3K4AA 5J7CC 3QUXA 2BFVL 3RX8A 4DUXA 1G7PA 2ZCLH 3D2UD 3GJEB 3BMVA 3M8OL 5IT2L 5BS0E 5E9DE 3GSQA 3ARBA 4P2QA 1X5JA 3GMOA 4HEPG 3U9UB 2C3WA 4O9HH 1U8MA 4QRSA 3OKKA 4XP6L 1S9KC 2E9IA 1XCTB 2CIKA 1FYTB 1IRAY 2GYSA 3BRGC 1KULA 5CZXC 4N0YL 4WY7H 2X7LA 1D9KD 3DX8B 3GGWA 2J8UB 1GOGA 4ZPTA 4ACPA 5EWIL 1G0XA 5C0CD 5D5MA 5FDWB 4LARH 4JDZA 3Q1SL 3LH2L 2H41A 2UVEA 1T4KA 3IJSA 4ZNEE 1I85A 3RNKB 1N5YH 1J05A 5JMRA 1P4LB 1C7TA 4PGDB 4L1HA 3S5LG 1DANT 4NO0A 1CGTA 2HG5A 3LD8C 1VFOA 5CWSA 2V2WA 4DN3L 3TJEL 2EDJA 4CNIA 2RB8A 2HTKD 4OFPA 4EN3D 2IMMA 3QRGH 1YPZF 1JNNL 4L3ED 5KSAA 3B6SA 1T5WB 1MJ7L 4JFEB 2ZCKL 1KPRB 3SGDI 5LCVL 4OZGF 5EBLA 3RWDB 4HJGB 1MUJB 5LGKA 5DF0A 1MCSA 5DT1H 4OGYH 4X99B 1AFVL 1HHJB 4YHPB 5DEFA 1HHKA 3TCLA 1IGJB 5E8PB 1QRND 3MRGB 2C1PB 4NGHH 1Y6NR 3QBTB 4JAMA 4Y4HD 1PKQB 3RU8H 4X5XB 1ACYL 3KPSD 4P9ML 4DVBB 2V6HA 1JUFA 1HHHB 3V2AR 1LEKA 2EE6A 3PXHA 3UXFA 1IQWL 2HP4A 3D48R 3QIWD 2BVQB 1FIGH 2DMKA 4YHNB 3QXAB 4X98B 3KPLB 1MIEH 4ODVH 4PRHE 3T65B 1A1MB 1WBZB 3O2WH 4D9QE 4ZYKA 3AY4C 3CNKA 5JW3H 5CILH 3LKRA 3SDDA 2X10A 5D1ZB 4XNXH 1DQQB 1NDMA 2Z31C 3KJ4B 4K8RH 4WTWA 4EI5D 5IMKA 4JPKL 1IAIH 2VYRE 5C09D 1QFWH 1WUNT 3RTQB 5HVWA 3B3IB 5LGHL 1FAIL 1RUML 3EZ8A 5DK0B 4HAFA 3QWQB 3E6HA 4GAJL 4X7TB 3LKSB 1IL1A 3TP4A 5F3HB 2J8UE 4IMKC 5LAXB 4QRPE 4HGWA 3TNNB 2EDRA 2AABL 4D3CH 1XGPB 3CMOH 5J9PB 3OKMA 4KK9C 5EZIH 4OGXH 1T2QH 1K8DA 1NC2A 3QEUB 5ALBH 5J4MA 1EGJH 3CUPB 3RBGA 5HGBB 3MXVH 1PX4A 1SJVA 4MDJA 3MMEB 1DQDL 3SGKA 4JZOB 4Y2DA 4FN0A 3FB8A 1IZKA 4U6XB 2ZZUT 5IGXL 3BKCH 1R5WB 1JV5A 1QR1B 3EYSL 2FECI 4WFED 3FRPG 5FGBA 2R1YB 3KS0J 5GGRA 3IFPB 2DDQH 3GBMH 4XCFH 5SWZB 4ORGB 5DA4A 1UKQA 4KAQH 3WL9A 5FUOL 4CBPA 5IJKA 5GGSY 1KT2B 3ROOB 4RWHA 3SBWA 2HVKB 1CR9L 4GAYA 4M7ZB 2CRZA 1OTSD 2XG4A 4P59H 43C9B 1G6RB 3LRSA 1MCOL 3WE6B 1G0DA 2DQUH 2WINA 4OD1L 4UI2A 3ZKXB 3P11H 2PO6D 2JCCB 2RCSL 2DWEB 5JNYB 3CCHB 4GRLC 3FQXB 1SQ2N 2WUBH 5TFSL 3BO8B 4QRTA 5FXCH 1S7XA 3QIBB 4MNQD 1TZHA 4WVRA 5GGTA 1NGWB 1E6JH 3P77B 4M61A 5F6IB 2R69H 3QEGH 1QSFA 4WJ5A 2DQHH 4R8WL 4GKNB 4P5TC 2R0LH 4LF3B 5C0DB 3ZE1E 3GO1L 5DD0L 1YEIH 3TT3H 3PQYD 3R8QA 2VZOA 5HHXH 1XGRB 3ULVC 5D6CA 1K8IA 2G9HA 4ZS7L 4HF5H 3PHQB 4NBZB 2ZCLL 3EDKA 2V2XB 1HXYA 1YPZA 4Y4KB 4CN4A 1BM3H 4Z9KB 5F7KC 1A3QA 4M8QB 3QDGA 4DJMA 1KBGL 3HB3D 5A3ID 1T80A 1QSED 3E3QE 3X14B 1QSVA 3IVKB 2IADA 2ZG1A 3D39B 1PLGL 3B5TA 2J1KA 1GOFA 5EC1B 4EVNB 5C6WH 4L3CB 5IV2B 5I1JL 5IR1B 5ACZB 3QFJD 4XB7A 4GXUN 4LARL 4D0BB 1A4JB 1HILA 2NY1C 5FYLH 2NY6D 4F58L 4XCEB 3KYOA 1D9KC 1OAXH 3BUYB 3RNQA 4KKAD 4U05A 5D96B 5AYUL 1T2JA 5INDB 4LHUB 3OAZH 5TH2A 5L0QB 3CLEL 1CCZA 1MCNA 1P4BH 3SQOH 1QFHA 2VAAA 1KIPB 5JORB 3AMLA 4NKOA 1AD9B 5DS8B 2XZQH 1U8PB 5D7SH 4MJ6B 3N1GC 2BJML 3N85H 5FA4A 1CQYA 1MLCB 2ZUWA 5ICXA 2H9GB 1FFOA 5ACMA 2CGRH 5MI0B 1RIVL 1L4IA 5TJWK 1BZQK 5DRWB 4N68A 1AQDB 3NTCH 3MRQB 4MWFB 4DFHA 1BOGA 4QXWA 3GSVB 5EB9A 5BVJA 3BESR 5K9KA 2HTKC 2HVJB 1OP5K 5DT1L 1N2RA 4OGYL 4EN3C 3U2SA 4NRYB 25C8L 3TGXA 3U30C 1UB6B 1DE4B 1MI5A 4XHQA 2R0ZL 5DJ2A 2O5YL 5TDPA 1CGUA 2FATL 1KUMA 3ARED 1DEDA 3WN5B 1IC1A 3U36B 4L29A 5CGYD 3AU1A 3VFRA 3UX9B 4LSQH 7CGTA 2YZ1A 5BCAA 4OLUL 3ARTA 4YWGH 3RX7A 1FIGL 4Y4HC 3AM8C 1T1XA 1YEGL 5J6GA 1U8KB 1MIEL 2NXZD 1XEDA 3O2WL 1F4YH 3QIWC 5K59F 4OF8A 1T1ZB 2FR4A 3QFDB 2IPUG 1I9IL 3G5YB 2VDKH 4NNPH 4O2FA 5J06A 3W9DA 3SE9H 2XFXA 4UAOB 3LDBC 5DMKB 5DEGA 5HVHC 5FO9B 4F7TA 3J7HA 4HT1H 2IPUK 4UDTA 5I1LA 1TENA 4HCRH 4GG8A 4P3DA 1CFVH 1GSMA 1PFCA 2ATKA 2BVYA 4HWEH 4LLMB 3KYMA 4UQ3B 4WI2A 2FBOJ 3ILQD 3TO4B 5L8KB 3SDXB 3CMOL 5D7KE 2UY6A 3X3GH 4GW4B 3V6BR 2W65B 1YNKH 4NQTA 3CX5K 1F4WH 2HLAA 2P5EE 2AXHA 3FQRB 1FL5B 1TQCB 2EE2A 3PL6D 4X7EC 3HHRB 1M1SA 4ZUWA 2C3XA 4LSPH 1JZ2A 4XXDA 3BKCL 3D18A 4X5LA 5A16B 5E56A 4U1MA 2XTJD 4JFQB 2CD0A 4JGUA 1JRHH 4KXZI 1FC1A 3HUJA 3L5WA 1MFCH 3WEXA 1Q94B 1F3JA 3MREA 4IMLB 1AD0A 3FB6B 3FONB 4P59L 5IBTH 4QHUA 4WV1C 2JELL 3IDMA 3CVHH 5KTEH 5C08A 5A2FA 2D7TH 3LN5B 3DX7A 2IFGA 4WO4A 1OTSC 4PREB 3ZYOA 1I1FB 3X11A 4MQ7B 4CMMA 1L7IH 5BJTA 3WFHA 4I8DA 2O5XH 2PNDA 2AP2A 3VFWB 1FVDB 4JGMA 2N7BA 3MA9H 5I1AA 3LQAL 2GAZA 1E6JL 5T5NF 2PO6C 3FN9A 4HZLB 4LGPB 3ZDYF 2QSQA 3K1KC 4QOKD 3QZWA 2R0LL 4Q6YA 5C3LD 2Q8AH 3IU3B 3KPMB 3HI1B 4LP4A 1ERNA 1WEJH 4LCYA 2GTZB 2FHBA 4OFVA 5HHXL 1ZLUH 2I60L 1HI6B 4WGVB 2AQ1A 3V4VL 4ELMB 4H1LA 5CBAB 5EZJB 5D93B 1U95B 5DD3L 1BM3L 1KTDB 3RIFF 1X9QA 4YDKL 1KXVC 1KIRA 3FT4A 4TQEL 4HMEA 2M26A 4UT6H 5F7EL 1R5IB 4XCYB 1DZBA 4HWZA 4L4VB 1SMOA 1FO0A 5D72H 5ENWA 3WO4C 3ZLQC 3L3OB 4R9HA 5E6ZA 4F3FB 2IBGA 4MAYC 5C0BB 3RZCA 1BFVH 2XN9E 3VGBA 4ERSH 1D6VL 3MLRH 1FNHA 1MHCB 1ZVSB 3THMH 2O5ZH 5IM7A 4LHUG 4HIIB 4G3YH 3FRPA 4YHIB 2AXGA 5D70L 2AXFA 4K9EC 1JGUH 1REIA 3KGRA 3VCLB 4H8WH 3SQOL 3C8KA 4HFUL 1W72L 4KKAC 2XZQL 5DMYA 4DGVL 1G84A 3N85L 5TE6L 3RVVD 2DQFA 4LSVL 3Q0HA 3E0GA 4LKXB 1PG7H 3HAEG 3NTCL 4LCIL 3X12B 5F96H 4U3XA 1HDMB 3VXUD 1J8HB 4HG4K 4OI8A 3W39B 5B22A 1J0HA 4HFWA 4PRBB 3E2HC 4UINL 4WWKB 3EO9H 3BKJL 3PWPE 4NYLA 5DEZA 1F3RB 1V3KA 2C3GA 2YZ8A 2DJSA 2F8VA 4PJCB 5DVMA 2AJZB 2WBKA 1OGAB 5F9OL 4ZAKA 3CLFH 5J1AB 3T0EA 1QQDB 2WP3T 4LSQL 1R3LA 5F7LB 3AB0C 4TRPL 3AREC 4YWGL 2IANA 5ELIA 2R1WA 3LHPH 2UZXB 4ZSOB 4X4MA 5CGYC 4MJIB 4TSAH 2P45B 4X9IA 1LO5A 4O02L 4EI6A 3K46A 4ELME 4PS4H 1JPTL 4M7JL 4X6DB 1FNGB 5GRWA 3AGVA 4OGAD 2WM0A 2VDKL 4MJ5B 4LDEB 3OJ2C 2XWTA 3SE9L 3PF2A 2WQRA 1KCVH 1ZHNA 1EEYB 4KVNH 5E8OA 3QHFH 2ESVD 1DSFL 4HCRL 3MRJB 5KAQF 3VFOA 3DYOA 1YYMH 1MRFH 2HFFA 2J4WL 4PJIB 4O51B 5C0EA 43CAA 3X3GL 4L5FL 3ELAT 2VL5B 2J5LC 1N4XH 4LBEA 2VZTA 2MOVA 4PJAF 2EDYA 4KROD 5ANME 4LSPL 3ILQC 4QRRD 3R0MA 1A9BB 3MLVL 3P9MB 2MMXA 1R3HB 5D7LA 2A0LD 4DK3A 3CMGA 2FJHA 3PL6C 3OL2A 1JRHL 5CEXA 4P5MA 2BNUB 4HKJA 3FFCB 1INQA 1DCLA 3QI9A 2IH3A 1MFCL 1KPVA 4PRPB 2XTJC 1JYNA 3DO7B 3UPRA 2Q6WB 2CLVA 2D4DA 5C0RH 3EW3B 3DMMA 3OKNB 1J8HE 1G7IA 4XPBL 2YPLA 5L2JA 1CF8L 5HHOA 1BIIA 1NJ9B 1FL3B 4Y89A 4MXVF 4P46D 1YEEL 3MLXH 4N8PA 4NZDA 2D7TL 4JR9H 2F9BT 5EULV 1ZLWH 3RWGA 1IAIM 2YD1A 1H5BC 1L7IL 1QFWM 2O5XL 2HFGH 5HHPB 5AWNL 4L9LB 1DBKL 1N6QH 1OB1B 4J3UA 3P4NB 4M1DL 4R4BA 2HN7B 4TSBL 3FFDB 4YDJB 1WEJL 3KPTA 3FB7B 3Q3GA 5I6XB 4OZHB 3H9SB 2DI9A 2HJKB 2VTFA 3FQUA 4PJXE 4GBXB 1VADA 1QR4A 5F6HJ 1BREA 3LN4B 2BXYA 1XF5A 3MNVB 3S3JA 3V4UH 2J88H 4ZMAT 3C5ZD 4UT6L 3WHE1 3MRKA 4J12A 3MYZA 1C16B 4BSVA 2NW3A 4YC2B 2ZSVA 2AQ3A 2C26A 4PJIE 4BQ9A 3VMOA 4GQ9L 4HS3B 4NIKB 3ARPA 1YJDC 1H8SA 3VMNA 3VXTA 1F8TH 3ARXA 3EUUA 4P2YA 3TVMC 3NAAH 4P4KD 5DJZA 3ALXA 1OT2A 5C0GB 5EIIB 2IFFL 3RDTA 4ZUSA 1I3GH 2J2ZA 2DL2A 4G3YL 3CFBB 3DVGA 1DQLH 3VMPA 3FMGL 5E99L 3U0WH 2P8MB 2YPKA 5L6YL 3VXSB 3FL7A 5I74B 5EU6A 3FFCE 2E9WA 2DTSA 3HNSL 3QCUH 3EHBC 5TQ0L 3TA3C 1T7YA 3ZDZE 3VWKD 4LAJH 3BUTA 5HHMD 5IBLD 1S8DB 3B2UC 4OIAA 4YBHA 2VXTL 4P2QE 4WI6A 1PG7L 1M7IB 5GS3A 3IDNA 4XNUH 3VI4E 1CFNB 3O3BB 1F58H 5EOQH 3RVVC 1A5FL 1KCKA 3U9PH 5CGMA 5FYKD 1I1AA 1RZGA 3EO9L 2AJXL 4I18C 2I24N 3TBTB 2V9QA 2CDFB 4Q9QH 1XGUB 1NMBL 5D5ME 1RVFL 2GJ6A 4NQEA 2HT3D 1B3JA 4OKVB 3SOBH 3BZFB 1JI1A 1B0RA 5I8KH 1LE9B 1GIGL 1RZKL 1JGDA 1FFNA 2IBBA 4U1HA 1JK8B 4PJAA 4X6CB 1UZ6F 3MLSH 3FCTA 3HI5L 5BS0D 4HWBL 1FDLH 1BD2A 2NYYD 3RI5F 3OPZH 4TSAL 2GQHA 1DR9A 4OZHE 3LN9A 1IQDA 1KEMH 4FHBD 3TZVD 5I15L 2VIRA 1WF5A 3L5HA 2H26A 2WWMD 3QUMA 1KJ2A 3HG1A 1N7MH 3O8XD 2CH8A 3WNKA 2BSSB 3WFBH 5E8NA 1D6EA 2CLZB 4JO2H 5I2IB 3QT2A 4P2RB 2ZPKH 5HGHA 1ZWIA 3DRTB 5IFJA 3VXRB 3K8LA 4R0LA 2P24B 4OGAC 3JWOC 3MJ6A 1ZANH 4HS8H 5JDJA 1NCUA 4X9BA 3BEVB 1AGCB 1MRFL 3MBED 4LFHG 1GAFH 5GSVB 4A2LA 1J1XH 1YN7A 2PYEB 1HXMB 4OLVL 4Y8DC 3RPKA 5IF0A 4WNQA 4M1CD 2GY7B 1N4XL 4NO2B 2I9LB 5BOZG 1MWAB 3OMZA 1LEGB 1CD1B 1IBGL 5C07B 3BD4A 2P44B 3O3AA 1PQZB 3ZHLA 2JJTA 1A6VH 1L9NA 3DJ9A 3O6FD 4U1LB 5T1LA 3HAEA 4P2OB 3P73A 1I7RB 3B43A 2A0LC 4YXHH 3FO1B 2UZIH 5F1IB 3GI8L 4XNYL 4Z0XB 5EBMA 4OZGB 5CBEA 2BRRL 4O00A 5CJXC 1G7QB 1KFAH 1XF1A 5KBNC 1C12B 4N5EC 4NJAL 1MCWW 4AEHL 5CD3B 1ZGLP 2IAMB 1RK0A 3BZ4B 5HYQB 1SM3L 1X4YA 2AV7B 3P30L 2OP4H 4KJYA 3JTTA 3VGDA 3UJJH 5E1AA 1D5BA 2R1XB 4CVWA 4NT6B 2EO1A 3NCBB 4D9QD 2X70A 5I1CH 4LSTH 1QD0A 3WHXA 4KZEL 3MV9B 1GZPA 5JXEA 2BXZA 1YN6A 5CD5D 1FVEB 5T1MB 1R3JA 5BMFL 3JV4A 1FYTD 2ORBH 3QJHA 1FNSL 4WW2A 3D3VA 5JUEH 5L2KA 1ZLSL 3OKOA 5I71C 1TZIB 4LLWA 2C7UA 4QRPD 3BP7A 1FLRL 1KLGB 4AQOA 4POZD 1JZ8A 1FFPA 3KDMA 3EO1A 1AGEB 3V4UL 2CUMA 5JA9A 4LSSH 1KG0B 4OLZH 1XH3B 2NY0B 4JFPA 5MEOA 4CVXA 3VGHA 4NM4L 4TNWF 5JR1H 1UM4L 4DZ8B 5ISZB 3ULVH 1AXSA 2APBA 2FD6L 3C5ZC 3KPRA 2YHGA 5T3XD 2Y72A 4LQFL 4LPVA 4Q58C 1A6ZB 5ESQB 2A6IA 2FNBA 5H35B 1I3GL 4HUVB 4YR6B 1FGNH 1QACA 4PJBF 3P4MB 4P4KC 5DJ6A 4MX7A 5F1NA 3KPQB 4EEEA 3U0WL 4HX1A 3TBSA 1S7VA 1SYSA 3SE8H 4DW2L 3PIQA 4QXTB 2W59A 1OGTB 4PRAA 3UTTB 1RURL 3QCUL 1E4KC 4FRWA 4P23A 3ARFA 4L8CB 3BKYL 5ABDE 4NKDB 1YPZE 1T1WA 1X6NA 3BWAB 2CKBA 5F7FA 2BOCA 5E03A 3QDGE 4LVHB 4V1DB 4OZGE 2Z4QB 3S3PA 3VWKC 5C6PB 4DTGH 5ETUA 2V9RA 3CSYB 5F72S 4F7MA 3EOBB 4RGMC 1CXLA 2HRPL 3LS4H 3PGDB 3WXWH 4JN1H 3B9EA 1HQRA 3UYPA 3MRDB 4F57L 1CVRA 4XNMA 2G5BA 4ZPVA 3RIAK 4G8EB 3IFOB 3RL1B 2QKIA 4OFYA 4PRNA 4DCQB 4Q2ZA 1R24B 5D1ZD 1U3HA 1I8MA 4LMQI 3OKDB 2HT3C 1RIUH 4AT6A 1FDLL 2R2HA 1ZS8B 5IVXA 3RTQD 1F90L 3OPZL 1SJEA 4ZUTB 3CFCL 3DX9A 3CD4A 3QCTL 3HCVA 4UIKL 3LZFL 3AAZB 2NZIA 1G7JA 2NYYC 2HFTA 3B9DA 1B4JH 5IMLA 3TZVC 4BH7B 3S96A 4MJ4A 5CZVL 5DO2C 1GVIA 1RJCA 2WWMC 4JJ5B 1RZ8B 5FEBA 3O8XC 4FXKA 4HS8L 3AS3A 3SGJA 1MI5E 1RJYB 5B4MD 1NGQL 3FTGA 1NCNA 4RAUA 1EUUA 1B6DA 1TXKA 4PTUA 1EEZA 1J1XL 1JPFA 4Z18A 4EOWH 1LE5A 4M43H 5SWZD 1T66D 2ID5A 1EIBA 4JRXA 3I3BA 5MERB 3ZTNL 5DYOB 3DIFA 4YLQT 4NHUB 3MBEC 3SY0B 4U2YA 4ALAH 5KSBF 4HGMA 5CIPH 3H8NA 4IOIA 5ADOL 1W0WA 1FNFA 3FQNB 2KZWA 1W0YT 2VLME 4M1CC 3SDAB 5JIPA 4RZCA 1FP5A 1LEIB 3UTTE 2UWEF 2VKWA 1TCRA 2VMFA 1RUPH 4XMLH 4PJGF 5HHQB 3G5XA 5F93C 1FV1B 1NBZA 4GKZA 4V1DE 3QIBD 1HSBA 4S11A 5J6HB 3TO2A 5T1KB 1LNUA 5GISH 2PTTA 1YUHB 2B0SH 1WWAX 1J0JA 3O6FC 4RAVA 4GW1A 1KFAL 3ETBF 4HIHA 5AD0A 1I7ZB 4NQCA 4JFZL 3BN3B 2X1QA 3UYOD 1IVLA 4OFKA 1X5XA 4XXCC 4LGSB 1NL0H 4KPHH 3OGCB 4B5EA 2ADFH 4PV9A 3TBWB 3RWEB 4EQ2A 4OAWA 4AK1A 4JY6A 4LSTL 1L7TL 2FYYB 3BISA 3OSKA 4GRWF 4AMKL 4PG2C 4JFOB 3V0VB 2EIZA 4FZEL 1LMKA 2ORBL 4G8FB 4Y4FB 2FWOB 5JUEL 3FO9A 3D85A 3D39D 4XP4L 1OAKH 3PWVB 4HXAL 1EEQA 2YUWA 3G08A 3RJDA 5H2BA 2JB5L 4FQLH 1TJIL 5F21B 1WBXA 4ONFH 2QJDA 1J5OH 5KSVA 2Z91A 2EDDA 2F53A 5H37G 5C08E 1VGKB 1QHOA 4POZC 5BRZA 3NOIA 5GQBA 3L5XH 4LHUD 3ULVL 1IILE 1CFBA 1L0QA 2PUQT 4R90H 5EFIB 3N9GH 5DC0A 4RAHA 1FJ1A 2F5BL 1URLA 1ZHBA 3BQUB 3MX0A 4LASL 3DXAA 1KIQB 2A6DA 2XV6B 4QT5A 5GRZA 3KPPB 1KEGH 5F8RC 1S7UB 2V5TA 3OAYK 3QUYB 4LLQB 3QPQD 4NHCH 2NZ9D 4JO1H 2J6EH 3GJFH 3GIZH 1XZ0A 1IGCL 1KYOK 3DNKA 2PW1A 1FVCA 1NCBH 3GSNH 4GRMA 4P48A 4LMQE 4M9PA 2WWKO 1JP5A 2OMNA 4Z78A 4R6UA 2W0LA 4JCMA 4HIXH 3DUSB 4JFFB 3C8DA 2Q8BL 2R0KL 4HPOH 4Y19B 4DTGL 2K7QA 2CPCA 1EJOH 4JN1L 1NCWH 4PB0H 3RKDD 4AM0A 2FCBA 4K9EH 3SKMA 1FNAA 3DSFH 1A02N 2MSPA 1ZLVH 3SO5A 4Q9RH 5I66A 3V4PL 3WLBB 3JTSA 3QCVH 3RY4A 3V6OC 3I50H 3T1FB 1BF8A 5JOPE 4J1UA 1NANI 3WIIH 1RIUL 4WIQA 1NQBA 4LLDA 4I3RH 1VACA 1HEZB 3PWUB 1Q0XH 2XZCL 2FL5B 1OLZA 5E24E 1FZOB 4HJ0D 4QRQB 5D1ZC 2UWEA 3QUKA 3KJ4C 4GMSH 5K59E 1J1OL 3R0NA 4CL7A 3TO4D 1MCFA 3RTQC 3P0VH 1B4JL 4OCSL 2H6PB 2OMBA 1BZ7B 3WIFB 2EE9A 1V7MH 4W4NA 1UWXH 1BJMA 1A4KA 1NGXA 3QDJB 2EO9A 4QHMA 5FYJD 4TUKL 3NZHH 4IS6A 3MOAH 4Q9BA 4EOWL 1IGIH 2D4FA 1G7MB 4QY8A 5B4MC 4U6YA 4I0PA 4WI4A 3T0EE 5IK3B 4ALAL 4PJFF 4DGYH 3VGGA 5DJXB 4NWTL 1PGRB 3LSOA 2IANE 4K71B 1G9MC 1OD7A 5LWYH 3JUYA 4YHOH 1OD9A 5MEPA 2Q3AA 4KUZL 3S35H 3MSPA 1LD9A 1I7TA 5IFHH 2AJSH 2FB4L 4DKFH 1IGFH 1T7VA 4M7ZC 1CGVA 2B20A 4EBQL 1B9ZA 3TIDA 4Y5VB 3PV6A 4HDIB 4Y19E 4GMTH 5GISL 5C0AB 4N0UB 1SYVA 4WW1A 3ZKXC 4PJ5B 1ZXQA 5I18L 4WHTB 4JFDB 4M6MH 1I3RB 8FABA 3QIBC 5DJDA 2HFEB 5HJ3A 1DVFA 3ALPA 1WJ3A 2H2SD 1A7NH 3GMRA 5EO9B 5F6IC 4JZJB 1NCDH 2Q76B 3KAAA 3MXWL 4MDIB 1F42A 2ED9A 5TE7H 3IXTA 1J18A 4NQVB 1ZV5A 5D7IF 3ZDYE 2EKSA 5D7LE 4GOSA 4MZ3A 5GGQH 4G43A 1CFSA 5F89B 3TN0D 2V7HA 3EO0A 4RDQF 4CVZA 3VG0H 3HLAA 3MUGA 3K4ZA 4Y4KC 1EFQA 4L4VD 1K4DB 3HZYA 3F7QA 3QEHB 2MQ0A 4XWOD 4ODXA 4YPJA 4I48B 2NW2A 4HXBH 1WAAA 4A6YB 4XNQB 5C0BD 5DJAB 3PP3H 3QXUA 4OFIA 4RISH 2YPLE 5HHOE 3RP1A 4RNRB 5GPRA 5C86A 2NNAB 2COQA 1ZA6B 4G6JL 3QH3A 4RA3A 3AVEA 5L8JB 2C3VA 4Q6IA 1CG9A 4EDWH 3DURB 1U36A 3NFNB 4TYUA 3REWA 5DRXA 32C2A 1R5VB 3EDEA 3VE0B 4K3HA 2KPNA 5D96C 1VA9A 4XP5H 4I5BA 1UB5A 3T3PF 5L0QC 2P4AB 4PRIB 1KEGL 1D3CA 5IHUH 1AJ7H 3KHOA 2XZAH 1XF4A 1J8HD 4PTTA 4DOHB 4RRPG 5MI0C 2OTWA 3GIZL 2JJTC 1YJDH 4XZUA 4WWKD 2X4NB 3WDIA 3FB5B 3QPQC 1QLEH 2A1WH 2NZ9C 3ULUE 4N0UE 3CFEB 4HIXL 5DHVH 3VFPA 3OX8B 3P3YA 1OGAD 4HBCH 1YYLL 3U1SL 4WDIB 4OM1H 4XTRD 1OARL 3DHMA 2XQYG 3WN5C 3ARGB 1N0XH 4MJID 1VFBB 2QTEA 3KWWA 4XH2B 5GRUL 3DSFL 5JPMB 3F7VA 3O6ML 4TNVF 3UTSB 5SX4I 2DLTA 2VL4A 3QCVL 3RKDC 3MRFB 4UV7H 1X7QA 4WEMB 1KIUA 3TNMB 5EU6E 5FO8B 2FGWL 2VABA 5DUPH 3VWJB 4UAOC 1OWRM 1RPQA 5C9KA 1KPUA 5FO7A 5ITBL 1P84J 2DLGA 4LFHD 1AO7B 2G5RA 4Z7VF 1NSNL 1EFXD 2VLLA 5D7JA 1UEYA 3L6FB 4JN2B 4NQXA 1I8LA 3PGFL 4QTHB 4LEOB 5FGCB 3TO4C 1V7ML 3LKNA 3GMPB 3RIFK 1J0YA 3W5NA 4UUJB 5IW3A 1GC1C 1Y6MR 5MENB 1K5NB 1T0PB 1DLHB 3A6BH 2GJ6E 4NQEE 2IQ9L 1TQCC 1QBML 4MCYA 1IGIL 2DQGL 2VDOH 4ZO7A 3FFCD 1AIFB 2Z8WC 3IJYB 3G6AA 4H25B 1GCFA 2JIXA 2YKLL 3CX2A 4PJAE 4PRPD 5C9JB 3F58H 1U93B 4KJQD 4DGYL 1JJUA 3BZEA 4I9WD 1IGTA 5DJCA 2QHRL 1BD2E 5J12B 4YHOL 1FZKA 3UJIL 3JWOH 2ICWB 4RGOH 5F97E 2ITDB 1TMCB 3SGEH 3X13B 5IFHL 1F3DH 4QHKJ 3FQWB 5EU4B 1IGFL 4DKFL 3HG1E 3DVIA 4P23C 1BBJA 3BH9B 1AI1H 2WQ8A 4KQ4H 3RY5A 4F7CB 3G9VA 2EYRA 4JY4A 5CUSL 2VUOA 3N50A 5IB3A 3GMLB 4ZD3H 3DV4A 3P9WB 4M6ML 4MXVE 4GJTB 1YEDB 3ZTJG 2LU4A 1I9JH 3B9KB 4S1DC 1NGYB 4HUWB 3UTSE 1DN0B 4LLVA 2W38A 1HHGA 2W9LA 3MUZ1 1CGSH 3H9SD 4TSCH 3HRZB 4JRYB 2VE6B 4MA3B 4ZUUA 1II4E 1NFIA 2QSTA 1LDSA 2H2SC 1OSZB 3ME0A 4GBXD 3RBSA 2GUOB 3D0LB 3CPLB 2BVUA 1KNOA 3D5OF 4Z8FH 1E6OH 5D93C 1DN2A 5GGSA 1BQHA 1OLLA 2AEPL 4H26A 2UV3A 2C4FT 2GT9A 1GGYA 1U8QA 5IJVB 4IRJB 4HXBL 3ZO0A 2Q87A 2APWA 5HYSA 1YEFL 3BEWA 2WIIA 1A8JH 1UZ8B 4NM8H 4LCCB 3EOTH 4XWOC 5D2LF 3RGVB 4HKXA 4PJ8B 1TVHA 1A1OB 1E27B 5MENE 3TBYA 5JLZA 2DWDA 3LKOB 3VXSD 5IFAL 2CXGA 5K9OA 4PB9H 3BDXA 3O9WB 5IEKB 4F2MB 3ILPB 2OS7A 1RUKH 3BIKB 1EZVY 3BYTA 4JG0H 5F88A 4KRNA 4ZDHA 1FZJB 4K7FA 4KRLB 4KQ3H 3D69A 4PBWD 5IHUL 1IGYA 3TC9A 3NFPB 4C83B 3D3VE 5IHZB 5A40E 5L2KE 2D31A 2DIAA 1YJDL 1Z9OA 3T3ME 1YEKH 1G7HA 4H88H 2A6JB 1BLNA 4NO3A 3BAEH 1QLEL 4HBQA 4PRDA 2ZCHH 4JZNB 1HN1A 2GIYA 1EH9A 1NC2D 2FBJH 4UIMA 4HBCL 1FYHB 1GPOH 4WWKC 2WW8A 4OM1L 3B8SA 2X4SB 1NAML 4OZIF 2AXJA 1TNMA 1U58B 3KPRE 2ERJB 1NFDB 1JZ6A 1MCQA 2DL9A 4QXUL 1PYWB 3BDYH 1RUAH 1YDPB 2YN3A 2A6KB 4H5SA 3JV5A 1TITA 3N06B 5IVZA 1UZ6E 4WUUA 5BZWB 5CMAB 4P2RD 1Z3GL 2Y7QB 4N1EA 3NIDE 2JJSA 1A7BA 3VXRD 1Y0LB 3TYGL 1H9VA 3MROA 1A6WH 4S1SH 3VDCA 3RWHB 1C5CH 1T0MA 3R06B 3PDOB 5DGRA 4MSWB 5FYKH 5I8CB 1NCCH 1Q9LB 3LS5H 1CLYL 5GS1A 5EOTB 2Y1VA 3QJFB 5IB4B 4M00A 1B2WH 3I9GH 3QO1B 5HPMB 4MYWB 1IM9B 3DTXB 1LK3H 4NNYA 1U8LA 1QFOA 5HGAA 4OZ4A 1ND0A 1JNHB 3UZEA 2XNAB 3MRRA 4TOYH 5E6YA 2VDOL 3RA7H 2VLRA 1JGLH 2N4IA 4WFGD 5I8EB 2F54A 4PLKD 1C5DB 1T3FA 1PBYA 5C7XH 4PJBB 3QYCA 5IVXE 5EZLB 2VDNL 2IH1B 5K9QI 1JMXA 3VRJB 4PYHA 1KJVA 4G8IA 5FUZH 1EDQA 3I6KA 5IQ7L 2A77H 4JFFA 4KJQC 1UM6H 2VLKB 4NUJB 2IAMD 1TNNA 4W4OA 3PJSA 2X4OB 4Y5XB 1BZ9A 2X1PA 5DUBB 1A9EB 4WTZG 4YFDB 4ZD3L 4IJ3B 1SBBA 3CFJB 3NCEB 3NBNA 3MV9D 5KVGL 3HE7A 1A3RH 3VRIB 1KENH 3IDGA 3DBXA 5EO0B 4L9LC 4W81A 2F58H 4GQPH 3PABB 1MFNA 2VLJA 4S1QH 4JRXE 3NFSH 3OWEA 1U41A 4MD4A 2R8SH 2WLYA 1ZE3C 3RL2A 1IC4H 2EDTA 3HPJA 1WISA 5I6XC 4OZFA 1BHGA 3H3BC 3WDJA 1ZTXL 4FQJL 1I75A 4Z8FL 1RZJC 4MQTB 5FKPA 5BW7A 3GM8A 3DX6A 5DJYB 2NY0D 2UVFA 4GBXC 1LO4H 5CFHA 5DMGD 1AGDA 4U1SA 5DHYB 3W82A 1XF2A 5ISZD 1FH5H 2RGSA 2V5SA 4U6TA 3WIFA 4TPRH 2WUCL 2J12B 4YC2C 2X9WA 4NKMA 5C2UB 2GCYA 4QCIA 1BMGA 1FCCA 2VOTA 5B38B 3FO0L 5DI8A 1A7OH 5EPMB 2X4UA 4ODHL 1CT8B 1YQVL 5CP7B 1I7UA 2VLMD 2YEZB 1NUGA 4P3WA 1FFQA 5JQ6L 5FHAL 3T2QA 4BSJA 4PB9L 3UTTD 1T20A 3ZDXF 2FX8H 3MLWL 1TPXB 3BW9A 4JKPH 1A6AA 5DDHA 1WTGT 1A1NB 4QHLA 4N1CA 3ZYZA 2KQMA 5I74C 1MH5A 4Z7WA 4DFIA 4PJBE 5IB1A 4V1DD 5KSBB 2YWZA 2MKLC 4JHZA 3PNWA 4C55A 3FQTB 1EGJA 1SEBA 4OCNC 2VXVL 3STZA 2DQEH 1P6AB 3UBXG 2EDBA 1VKXB 4X6EB 1DBMH 5IIEA 2HT4D 4H88L 3UYRL 4BFEA 4PJGB 2DQJL 2ZCHL 3MJ8B 5D4QA 3WO3B 4BH8A 4CW1B 3BI9X 3KPNB 4FNLL 5LGJB 4KKLC 3IFLL 4NO5A 4RBPK 5EN2A 5T3XH 5IEHB 1BFOA 4X4XA 1QFUH 5BRZE 1QBBA 3AXLA 1RULH 2XPGA 4XX1G 4MD0B 4N0CC 5F7MC 3S88H 3SPVA 4KZDH 3IFNH 3MLZH 3I2CH 1OP5H 4KVCL 5DD5H 5IW6A 1OPGL 1RUAL 4BKLB 2X4RA 3DXAE 5EUKB 1E28A 4OTXH 4UU9A 2CUHA 3C6LA 3DUUB 1DUZB 1CDJA 1S7WA 2D0GA 3AROA 1J9CT 4HK0A 5F9WB 4YK4B 3CFKB 1A6WL 1DEEB 1AP2A 4S1SL 2D7PA 4M8VA 4NUGH 1C5CL 3HE6A 2PCPA 1EJ6A 1T5XB 2QQLH 3NIGF 3U4EB 1LHZA 4KI5C 3CZJA 1NCCL 3ZKMD 5FCUH 1MAJA 2FRGP 2VZ3A 1B2WL 3F12B 3I9GL 2I07B 7FABH 2XT1B 2E7LA 5SWSB 5GZOD 4HD9A 2BVPA 2GJZB 2BY2A 1MVUB 4KTDL 4OFDA 3RA7L 4X5WB 3ZE2F 5GXBB 5AUMA 1W2KT 1T83A 2V9TA 4JO3H 3HTLX 4HKBB 1QA9B 5GGVH 3FZUD 3QIUB 1MHPL 4B7LA 1FZMA 5C7XL 2I9TA 4G6KL 3OR7A 4ZODA 3O3EB 2DLFH 4OLEA 5DVOA 3EJJX 4NZRH 1U91B 2UWEE 5FUZL 4YPGB 4P2OC 4OIIH 4PLKC 2A77L 1UM6L 1I4FB 3MV7A 2F74A 1CD0A 2YUXA 4PJGE 1F3DJ 3MO1B 1OAYH 4JPIA 5E5MB 3GUTB 3HS0B 1CS6A 5GJTH 1I8KA 3CXHJ 3HC0A 3RZCD 2FEDD 1VESA 2IAMC 5F44A 1G9MH 1RY7B 5FV2A 1U8IA 3BOVA 4OCXH 2ZG3A 4J3XA 3BHBA 1UQSB 5E2WH 4I0CC 4TVPE 5TF1H 2EC9T 4PP2A 4RGNB 4NOBA 4ONGL 4E0RB 2QSCH 2C1OA 4Q0XL 4Y4FD 1IEAA 3VFSA 3VXOB 1CXKA 1G6RH 1YMMA 1CL7I 3NZ8A 2EYSA 4FQ2H 2QBWA 4Z76B 1H8NA 1IC4L 4GRWE 4UT7H 2EDHA 2GTWB 4KY1H 1A0QH 2OJEA 4C56B 3GSOA 4L8DA 3WBDA 1IE5A 1LO4L 3W0WA 3LV3B 4NQDA 2BHZA 2AV1B 2MPAH 4V2BA 4ISVB 4HIEA 12E8L 3MODL 2XRAL 1I9RH 2NY0C 1TTUA 4Z7UB 5B38G 4M7LL 1JHKL 1GGBH 4PIRF 1TVBB 1A7OL 3IS0X 1D5XA 4AY0A 3QUYD 1MQKH 3FRUA 3VXPA 1S7TA 4PGZA 4HIJB 4DWHA 3BGMB 4M93B 4MCZA 3JWDH 1WCBA 2QQKH 3GSXB 4HMCA 4PV8B 3LQZA 1M6OB 3IDIB 1MEXL 4K07A 5FECB 5ID0B 4N0FB 4HCRA 4TUJA 3KNBB 4AH2B 2YC1B 3GMNA 1P7KB 1CD8A 3HC3L 4XBPA 4PJFB 5C1MB 4Y19D 2H32A 1MREL 4HPYH 3BFOA 1QLFA 5IW1A 1G1CA 3RWJA 1V7NH 1LK2A 3OKEB 1K3ZA 3QA3B 1HE7A 1IEBB 5F1OB 4LVHC 4E41A 3O4LB 3MV8A 1KCSH 1WAAE 1DQTA 2Y06L 2UYLB 5D6DC 4K3DL 1Z9MA 3B9KA 4PBVC 3I85A 1C1EH 1JTOA 2HT4C 3D6GA 5T3XL 1IFHH 3VXNB 1N3NB 3CH1A 1QFUL 4KGJA 2BNQA 2R23B 4AIXA 1TJGL 3SJVB 4RGNE 5HHNB 2VE6A 3V6FA 4H20L 3IFNL 1WT5C 4MQXC 4M03A 2ARJA 4XPAL 3U6RB 5DD5L 4HAGA 4IRSA 3UTQA 5ICZA 1P7QB 4JO4H 1NEUA 3BIBX 2I5YL 4MQSB 4HUNB 3WNLA 3VD4A 3CVHA 1UC6A 2FEEL 5GIRB 4KKCD 4K3GA 4X0KA 5CHNB 1Q1JH 4OTXL 4ETQB 3BDBA 3IDJB 4XCCH 4FQ1H 1XF3B 5D7IB 4JVPA 3DMMD 1H3UA 5KN5A 3NMEA 1ITBB 4ZUVB 3VXMA 5HHOD 2G75B 4JDVB 1CZ8H 5GZND 5A2JH 5FM5M 2ADGA 1OTUC 3QUZB 3QDJD 3IF1B 3STBA 5HDBE 4NUGL 5DUML 4QHNA 1RJZB 3REVB 3BH8A 1QYGH 4Y16A 3DRQB 3LPFA 4U3CA 1OY3B 3UDWA 4PUBH 1TTFA 1WTLA 4R4ND 5JZ7C 1A2YB 4K3EL 4XPGL 3KXFB 5FM8A 1KC5H 2ADJB 4YXKL 4XGZB 3RWCB 5TQ2H 4QF1A 4WFHE 2KBGA 4PJ7F 3K81A 3O11B 4XVTL 1WK0A 3HFMH 4G80B 4LAQH 4W6XB 4OLXH 3OB0K 4LU5H 3IU4L 1RZIB 3D0VB 5GZOC 3SDAC 3ULUL 3EYUH 2H3NA 3ROLB 5D9SB 1XIWA 5GGVL 4G9FA 5C0AD 1U8HA 4D8PB 4PJ5D 3ES6A 2ZOKA 5DXWA 4RFOL 3UBXA 2X4PB 5DD1H 1EVTC 4JFDD 4R7DB 3T09A 1ZGLB 1GC1H 1WZ1H 3QHTC 3GI9H 1CE6A 2LU3A 3FZUC 3U0PB 1GGIH 1AY1H 4K55A 1OAYL 2WBJB 2P5WA 2ATPA 2Y36H 3WFEL 5GJTL 2BCKA 1YECH 2LFGA 2IPKA 4U49A 2V17L 4GG6B 4FXGA 2GSGB 1T03H 1LP9F 5FYJH 1GGCL 4DGIH 5CIPB 2KUTA 4JPVH 4OF0A 2OTUB 5D1QB 4UDUA 3OR6B 5E2WL 1N8ZA 15C8L 4YBQD 4EI5B 3IKCA 4UQ2A 4FA8A 2FEDC 4GKOA 1CICB 2QSCL 3WFDL 4F9PC 4FTVB 1O7SA 3UTPE 3V6ZB 2HJLB 3WJLC 3C08H 2R2BB 4DVRL 3C5JA 4LNRB 5LQBH 4APQA 3H7LA 4MNHA 5D7IE 4UT7L 4Y4FC 4NFDA 3L5IA 3SE4C 2EH7H 1A0QL 5F9AC 4NFBA 2JJSC 1N64H 1UENA 1H3WM 3VA6A 4K23H 5H94B 4QYOA 2HRLA 1P5UA 3MGTB 2D7MA 2W0FB 2GJ6D 4LCUB 1AR1C 4Y5YA 1DL7H 5GGVY 3RWIB 3GHEH 4F33B 4YJZL 2C5DC 4Z7VB 1GGBL 1ZA3A 5DWUH 1MFDL 2IPTH 3KLHD 2MHAA 4PRID 2GFBB 4P9HC 1BAFH 1S9XB 2Z8SA 1GZQB 4XP1L 3UZQA 1BD2D 4WU7B 1BVKB 4FFYH 3FOMA 3BQUC 2XOTA 5CJ5A 1NPUA 2E7BA 3QUYC 1Q9OB 3IXAB 5E6IA 3T3PE 3ZE1F 3T77A 5KZCD 1DBBH 4P57A 2CDGB 5M95B 5D1XA 4GW5A 1CYGA 1I1CA 4U0RB 5A1AA 5DJ0B 3BYYA 3HNTH 5KW9H 4OD3H 4BSWB 1V7NL 2FIKA 3EGSB 5LJYH 3U48A 5JW4M 1BJ1H 3UTZB 4N8VB 1HH9B 1ONQB 4M48H 1K4CA 2LQRA 3P2TA 2VSDA 3UTSD 2YXFA 3PQYB 3LQMA 2YSSA 4HEME 4FFZL 3SDCB 1G9NH 2AJ3B 1FPTH 2AJUH 1IFHL 1GH7A 4I0KA 3P9LB 3DETD 4NZTH 2NY7H 1EV2E 3VFMA 3GIVA 4JB9H 5CJ8A 4R7NA 4OKDA 4JM2F 5DJ8B 1JFQL 4PJ7A 1EBAA 1FIEA 3VWJD 4FZ8L 4P4RA 5KANG 4MHHI 3HZKB 1Q1JL 4D9RE 4BQ6A 3IDYB 4HMDA 4FQ1L 1AO7D 3HI6H 3H9HA 4Z5RB 5B8CB 1PVHA 3DARA 2NY6B 5EIVA 5EU5A 3T4AA 3RRQA 2Q86A 4OCWL 3L3KA 5DK2B 5I1GH 3QULB 1A14H 5MEND 3MRHA 5KJRH 1QYGL 2KZ1B 1T7WA 4YXLH 2EICA 5GZNC 4PUBL 4JG1H 1LP9A 3RVUD 4XB8A 3GBLA 1U8OB 3QNXB 5D2LB 5I30L 4ODSH 5DRNB 5AZEH 3GKZA 5JXED 4K94C 2BNRA 3VI3F 3CAFA 4Z7NE 4R4NC 1FGVH 2FJGA 4JCLA 3D3VD 2A74A 4LAQL 4K71C 4OLXL 1A7PL 5FHBL 4PJDA 3VH8B 1S5IH 1NCAL 1WV7T 1T21A 3QPXL 4JFXB 4TUOA 2QQNL 1NAKL 4IRZH 5GS0D 2A9NH 3LCYA 5F7NC 2IGFL 3MJ9H 3ESUF 3MRNB 3NCJL 1QEWB 1WZ1L 2V5MA 1K6QL 4L4TA 4HGKC 1SEQL 3GI9L 1GGIL 3ZKQD 4YZFF 1JWMB 1P5VA 5T1DH 1INEH 1LO3H 1YECL 5IOPA 1NBYA 1TTGA 2OK0H 2FO4B 2NXZB 2D7OA 3D25A 1T03L 5FYJL 3U4BH 4DGIL 2VDPL 1XR8A 1Q9WB 3QXTA 4JZJC 4UMGA 2BX5A 1N6VA 1H3PL 3OXRA 1Z5LA 3PWLB 4OZIB 5I1EL 2Y5EA 1OAZH 3HR5A 3F5WB 5D2NB 2VLRE 4YQXH 2VWEC 2X5PA 2F54E 4YBQC 2CKBL 4NPYA 3WCYA 4IRJD 4TNVK 3ULVF 5DLMH 1CLOL 4NRXA 3BKMH 3TJHD 2EH7L 5FA3A 3IETA 4MMZC 1MFAH 4G8GA 5INCB 4PJ8D 1N64L 1CU4H 4K2UH 1KN4L 1U8NA 3W11D 3RWFA 2AGJH 4XPHH 5F6HI 5J0BA 4PJHB 5EU3B 3F7YB 4GLRH 3GSWA 3O9WD 3V7MA 3T08A 2DQDH 1UJ3B 4AENA 4LPUA 2CQVA 1V3MA 1P1ZA 4OFYD 5DWUL 5D2LE 5DSCB 1MCPL 1U3HD 3GKWL 1ZHLA 2HKFH 1BAFL 1OTTD 3OKLB 4FFYL 1QVOA 4R4FH 1HH6A 1MFEH 4BFIA 3QWOB 1VCAA 3ARQA 4X6BA 3KLHC 1D5MB 4E42A 1D5ZB 3H7BA 2VNCA 1MCBA 1DBBL 5KG9A 1VFMA 4Z95L 5BO1H 5LXGH 3AY4A 1ZT7A 2DIBA 5C3TA 3DGGB 1EO8H 5KW9L 2YK1H 2DYPA 3V5HB 5I17A 2Z31A 4N8VG 4UT9H 5SV3A 1IMHC 1C7SA 4M6NL 3TT1L 4FQQA 2VR9A 2PR4H 1RJLB 1JF1B 1LWRA 4M48L 1EHLH 2EDLA 2V2TA 2HT2D 5J56B 1O7VA 3O0RL 3EKCA 3L3DB 1OAUH 1JHTA 1J1PL 4JRXD 1UACH 5BZDB 3BPOB 4IMKA 1UVQA 3ARGC 3QB7C 2OSLB 4MXQC 5FUCE 1DQJB 3GB7A 3FAXA 5HGDB 2CJUH 3KPOA 5JDSA 4YO0B 4CAGA 3EDDA 3C60B 4JB9L 3CFDB 1A6UH 2BMKB 5D2NE 4ZFFA 4HG4J 3J8F7 4X6FB 1ZVHA 5K33A 4BFBD 1CXIA 4OCLC 2EDFA 2Q7YA 2XKNB 3EFFB 4BZ1H 4PY8J 4BZ2H 5E8DH 3DETC 2FH8A 2CO7B 3G04B 3MR9B 4Z7WE 1VGEH 1XGQA 4PJ9B 1QNZH 4Y1AB 1WGOA 2AI0H 3E8UL 3LEYH 2OXGA 3IJHB 3VWJC 1Q9KB 1ZSDA 4LKCB 3QQ4A 1KJMA 3WKNA 1J12A 1IM9D 5FK9A 5I1GL 5F7DA 1IAOB 1A14L 4R26H 1HKLH 1NEZB 4ODWA 2C9AA 5KJRL 4HKZB 5E00A 3TWCL 3L3IA 3IYLW 3VXQB 4PY7B 5JXAH 1OSPH 2YR3A 3V5KB 4GRLA 3VJ6B 1W72B 4AL8H 4RIRA 1WIOA 1E4JA 3QEQB 3RVUC 5L88H 3MRPB 2P8PB 3MRBB 2VZ1A 3AFLA 3U0TB 2BSRB 4P5TA 4HUKB 2YPVL 4PGEB 4OD2A 4EQ3A 4U1JA 4LCWA 1PKOA 4FABH 3L9RA 1ITCA 3GMQA 3QXDB 1NMCB 3C6SB 1AGFA 1S9WB 1CLCA 3STLA 1JRHI 1NDGB 5CEYA 3A67H 3I02A 3MJ9L 3EFDL 3MGOA 2DD8H 5GGTH 3TBVB 4I2XA 1UEMA 3I75B 3ARVA 4HUMB 2PETA 3V5DA 1MWAH 5GS0C 2D03H 5T1DL 4NDMB 3D2UA 5FB8A 5DZLA 2ZUUA 3Q5TA 4AIZA 4NKQB 4X4YA 3SO3B 3B9KC 2LV4A 5E7FA 2CK2A 1WFOA 3SKOB 3HZMB 3WXVL 4NKIH 2CLRB 1D9KA 1NGZB 4LLYB 4OQ1A 2AK4B 1ACZA 1S7QB 4YQXL 5C0CA 5ACLA 2OL3B 2CIIB 2A38A 3TYFA 4KRPD 5EBWA 4YHKL 4Y1AE 1EO7A 4M7KL 3T8XB 1QG3A 3MYJB 1FL6B 1T1YA 2ZSWB 3MRIA 2QADD 4J7RA 2A83A 5FYLE 5EDXA 4JQXC 4C4KO 3MV7E 4IRJC 1GHFH 1PZ5B 4DKEL 4KROB 1IAMA 2Y6SD 3TJHC 1A6TB 3HNVL 4EN3A 5KOVC 4I3SL 4LCCC 4L3EA 3DVNA 4KHTH 3RGVC 3W2DH 5ITFB 1HIMH 3Q5OA 4PJ8C 5KVFL 4DN4L 4ZTOL 3W11C 1FAKT 1OT1A 2P8LB 5TDOA 1C08A 4HLJA 4JLRA 4NZJA 1UG9A 2FLRT 1XGYH 1MNUH 3O9WC 1RZJL 3QEQE 5I0DA 1DBAH 4O4YH 2C4XA 3O6KL 1QRNA 2Z35A 3OAUH 1AKJA 4AEEA 1RZ7L 4YFEA 4LDLB 1ES0A 1YMME 1F11A 2E9JA 3JUZA 1CGWA 4P46B 3VRLF 4HUUB 4Y4HA 3AM8A 3QQ3B 1FNLA 4X9HA 2LTQC 3KPSA 1ZHKB 1OTTC 1JWUB 2X41A 4AEIL 2YRPA 3DI3B 1FBIH 5LXGL 3O2VL 3QIWA 4LIQL 5DZNA 2FSEB 1WC7A 3WNPA 5JW4Q 4RX4D 1QTYT 4UT9L 3W0WE 3OJDA 4NQDE 2Z9TA 3OAYH 2J8HA 5GGUB 3O3DB 3BVNA 4JRWA 4LHQB 3CJJA 1VFAA 3O6LH 1INDH 5L9DH 1CFTB 2F19H 5IWLC 1EUTA 5FCSH 4Z77A 2Y07H 4LVOB 1RU9H 5C09A 5HDLA 1SY6H 1KLUA 4ZG1A 1JHLH 3TLRA 4WGWB 2HT2C 2OXHA 1MJ8H 2D3VA 3E6FA 4WU5A 4GAGH 4NQSA 4BZ1L 1A7QH 3O41B 3FN3A 2I25N 5IBUB 2ITCB 2A73B 3EYQD 3VD9A 4XAWH 2VXQH 3EYOA 4PP1D 2ZUYA 3LEYL 3PHOB 3ZDZF 5DVKA 2FZ3B 4B7IA 4JFYB 4E41E 4XBGB 4YAQB 3MV8E 3ARDB 2P1YA 5BVPL 5SWSD 2JB6A 4R26L 3C8HA 3B4NA 1G7LB 4WV1A 3NIGE 4OCMC 4NC1E 1CQKA 4HH8A 5JW5B 1IJ9A 5E08H 5E2JA 4AL8L 4G6MH 1J86A 2BNQE 3S3SA 3IAQA 4NQUA 1I1YB 1FCGA 5IKCB 2YOCA 4YDIH 3U7WH 4YE4H 2PO6A 2AJVH 3FOLB 3EJYD 1IM3A 2FHCA 2FJFA 1JGEB 4X83A 3VFGH 1PJ9A 4MNQA 2AS5M 2VDLL 2ILLA 5E94A 3BGAA 4LRNH 1CI5A 3ZE2E 3LMJL 1MCKA 1L0YA 9CGTA 1QP1A 5I19H 1ZT4B 4M5ZH 1AHWB 3K0WA 3QXVA 3QG7H 5D1XC 3VXME 2ZJSH 3QHZL 1QLRA 2DD8L 3OBAA 3F62A 3QQ9D 4Y5XC 1RUQL 4YIQB 1EXUA 5E4IA 1FORL 5HI5C 5E9DB 1MJJA 4RGND 2D03L 2FGZA 5KVDL 1ZMYA 4JHAH 4NP4L 3WJJC 4IJ3C 4FQIL 2YBRB 1R3IH 2G60H 2J6EA 2EXWD 3GJFA 4YDLC 5DQJB 1MCHA 1T0NA 4WFFE 1IC7H 1U8JB 3GSNA 4MAYA 1QSEA 1W8NA 2HYMA 5DHXB 1CK0H 1MHHB 4NKIL 3VFTB 1KELH 1S7RA 4C56D 2OLDA 1T04B 4OM0L 5HY9A 3QFJA 1E4WL 3WS3B 4J8RB 2W9EL 4RMWA 2CSPA 2NLJA 3SDYL 4I4WB 3B5HA 3OZ9H 5DQ9A 4GUPB 4G9FE 1M05B 5EORL 1UYWL 4OBSA 5IESL 1DLFH 1T7XA 3OXSA 2ZP0T 3Q6FB 4MAUH 1RD6A 4IDJH 3A6OA 3I3EA 1GHFL 2B1HL 4QXGH 2E9BA 1QFPA 1JWSA 2P5WE 2GI7A 3MJ7B 4K7PH 4D0DB 3G6JF 2BVOA 1MLBB 4WFHD 5TDNA 3MLTB 3RY6C 4X7SL 3L3HA 3NABL 5EOCH 4XX1E 2BSTB 1MF2H 1F6AB 2Y6SC 5KSUB 5JHDA 3U46B 1QSZA 3LAFA 1KB5B 1MNUL 5T5FH 2DICA 2OR9L 5HDQH 1TPXC 2H8PA 1DBAL 2R15A 4O4YL 2R2EB 3OAUL 1MAKA 4NSKB 4PJEA 2DTMH 2YMXH 3NN8B 3T4YA 3JZ7A 3AREA 3O4LD 2DQIL 1T22A 2FX7H 1H15B 1IAKA 5DD6A 1YY8B 1WBYB 5CEZD 1QEWA 1MJUH 4X7CC 5E2TH 4MNGA 2BDNL 1HSAA 3VFNA 2AERT 3QG6B 5J1SC 3DVFA 4PRHB 4P9HH 3RUGF 4UZGA 3RFZC 3SJVD 2H2PC 4KTEH 1XGTB 3W9EA 3CSBA 1JNLH 1ZEAL 3ECBA 3O6LL 1P7QD 3VFVB 1INDL 1ORSB 3B2VH 1RU9L 4L9DA 1SY6L 1RHHB 5EC2A 2JIXD 1VHPA 4FFWD 1EMTL 1JHLL 4FMFA 3S4SG 4MXWH 4QRPB 3SKNB 5EUOA 1QO3B 2JE8A 4YNYA 4YDVA 4XAKE 5ESVB 4X7DC 1RIHL 5JHLL 4F7PA 4XWGL 2HAZA 1A7QL 1IT9L 3QUZD 4P5KA 2HJFB 5F3BB 5J8OA 3LPWA 1K85A 2EH8H 3BSZL 5EG6C 3S37H 3PL6A 2E6PA 4XAWL 2VXQL 5F9WC 5C0JB 4YK4C 3KR3H 3V52H 1W0VA 2BC4A 3HPLB 4PYGA 3TPUA 3T2PA 5ICYA 5DRZA 1FC2D 1I3UA 3KXFD 3GSUA 3EYQC 2CDEA 3C9NA 4PP1C 4U1GC 1FN4B 3K74B 1BQLL 3KHQA 5LBSL 4EUPB 1U92A 3IDUA 4D0CB 1MFBH 4KH2A 3MACH 4RFNC 4MA1B 4OCYL 3EYFB 5HYJB 4B41A 4PR5A 3HMXH 2X4TB 2X4QB 1H5BA 4G6ML 2AKRB 3BWUC 1DDHB 3HZVB 4PG9B 3C5SB 3NCCB 1GL4B 3ZT6A 1GXEA 3U7WL 4YE4L 3EDFA 4XC1L 2R4SH 3GHBH 1YNTB 2NTFA 4KMTH 4YGVB 5FF6A 2PW2A 4PJ7E 2ZUVA 3VFGL 4E9LA 5ID1A 1EAJA 3WUWB 3QIUC 4KDWA 4U1NA 4LRNL 4LPCA 1ORQB 1K2DB 1C5BH 2WBJD 3WIHH 4MD5B 1F6FB 3LD8B 3EJYC 3QNYA 1LO2H 5IMOB 2LAAA 2OZ4H 4CADB 1M7DB 3GMMA 2GSIA 4QOKA 5HHVH 1Y18B 2WK2A 3M1BB 4KJPD 4XVJH 1JPGA 2NPLX 4ZOBA 5L7XH 4K94H 1L6XA 4ZFGH 3FT3A 1SJHA 5D1QD 1AGBA 3V7AE 2OI9B 1HHIB 4JEGB 2P48B 3F8UB 4JHAL 3G6JA 1CICD 1VEMA 3H0TB 5I1KH 5IMMA 4TN9A 2HLFD 5T3ZL 3GRWH 4FTVD 4Y8AA 1HQ4B 3WS6C 1SMAA 1LP9E 3WSQH 3VGAB 4R3SB 2G60L 1FNEB 1CLZL 1UXSA 5D8JH 3CDGA 2UY7A 2BMKA 4I13B 1BEYL 2B4CL 4PGCA 3CZFB 3TVMA 5KS9A 3WMSA 4YHZL 1BVLA 3LKQB 2UZYB 2R4RH 2XWJB 2BNRE 5ALCH 3KLAA 3MZGB 5DHVA 5DR5H 2EXWC 1S9VB 1MAMH 3BN9D 1JZ5A 4KDTC 5I1DA 5C0FB 4JM2B 3BXNB 4M62H 4YHLH 4O2CA 4PJDE 1NAMA 4QNPF 2DBLL 1IKFL 2W9DL 4L1DA 1MCCA 3P4OB 3TA3A 3BP6A 3ZTJH 1C8PA 1YY9D 5IQ9A 2OQJB 2RFXB 3SCMB 2BOBA 1FRGH 2Z92A 2QV2A 4HZAA 4IDJL 3RUGA 5GHWH 3TV3L 2ZNWA 4QXGL 3L7FB 1TZGL 4OLWH 4K7PL 1ZT1B 5C2BL 3U79A 1QBLH 1A3LH 1BQUA 4XMPH 1MIML 5HYJE 4MGXA 4FQXB 4E5XB 2QR0B 4I18A 3QDMA 3OHXA 3VXUA 3MCKA 4M93C 1S5HB 4OV5A 5T5FL 4X80L 1Z0NA 3JBG7 4RFEA 4MVBD 5IB2B 4UNVA 4NN7B 4A6YH 3G5VA 1TCMA 1DTUA 4NRZA 2YMXL 1TETH 1CFQB 3DYMA 1HOCB 2FX7L 1PSKH 2CO6B 1L0XA 2R29L 4FQCH 1AE6H 5C0IB 4LLUA 1MVFA 5E2TL 4G7YH 1P9MC 3HUJF 3SDCD 1X6LA 4U1KA 5LG1A 1S7SA 3FO2A 4P9HL 2YD2A 1ZLWK 2ADIA 4KTEL 3MRCB 4OUUA 4EXKA 3BP4A 2VQ1A 1ED3B 3L3JB 4O9HL 4PFEA 1BOYA 1NH6A 4G7VH 1R3KA 2GK0A 3UPCA 3JV6B 4L8BA 1NLDH 4ZFZB 1JZ3A 1XCQA 5IROC 1KYOJ 4ODUB 2ICES 4G9DA 4WY7L 3ZYJA 4Y7MA 3LKPA 3ESVF 1Q0YH 3LIZH 3MRLA 2ESVA 3QUMH 1B90A 4K7PY 4WI3A 2IC2A 5GSRA 2EXYD 1QBAA 4FFWC 2P5EB 4XRCA 4TULH 2EYTA 3UJTH 1N5YL 2Y5TB 4HHAA 2DAVA 3S37L 3QO0B 2VAJA 4D94A 4JANA 1NC4B 3EOAB 4QRRA 2DI7A 3V79C 1KSRA 5DTFB 3G5ZB 3QUZC 3RPIB 1HINH 3QRGL 2ICEA 3ARWA 2IMNA 4EUPG 4DQOH 4POUB 1YMHB 5FAAA 3ULSB 2SEBA 3IRPX 5CJXA 2DI8A 4ZQKB 3MACL 5HBBA 3T2NH 4HJJH 5SWQB 3DSNA 4PGBA 4HS6B 4LSDA 2PYFB 4NGHL 1KXTB 4S2SB 1P2CB 2XWBA 1X5LA 5E8EB 3VI3E 3GHBL 3RU8L 4KMTL 4ZXBB 3WUWG 3I6LE 4IBLT 4U1IA 2AW2A 1FG2A 5KVEH 1XR9A 2JK5B 1EAPA 1TDQA 3ET9F 5M7QA 4ELKB 3Q2CA 4CDGC 3QAZB 1F45A 4ODVL 1K3IA 4J3SA 4N1HB 5HHVL 4QHKI 3CXDH 3MNWA 3CSGA 5CILL 4HH9B 5JW3L 5L7XL 3L3GA 4ZFGL 5BQ7A 5JOFB 4XNXL 5C0ND 3M17B 4K8RL 4YZFE 1IAIL 6FABH 4WHDA 5K9JH 1QFWL 1OL0A 2W60B 3WSQL 1H0DA 5D1QC 3TIEA 5B39B 3S4SA 1I8IB 4EI5C 5JO5A 3C5ZA 4D3CL 1CICC 5SX4H 2O61B 2HLFC 2R4RL 5EZIL 4OGXL 1T2QL 5ALCL 4DZBB 5ALBL 1EGJL 1SVZA 5F7YC 3MXVL 5TGBB 1MAML 4NN6B 1DUYA 1EBPA 4UV4H 2XN9B 4XCNB 5GS0H 3S5LA 4M62L 4U6HA 4YHLL 4P4KA 3ZT7A 1JF6A 5CP3H 4LCWE 3LEXA 3G6DH 3NCFB 4CUCA 3ULVE 1AR2A 2EKJA 3BN9C 5T33H 4N9GA 2X2YA 1E4KA 4JDTH 2DDQL 3GBML 4XCFL 2R56H 4KUCD 3O45B 2MKWA 2GITA 3MZTA 2ZOLB 4F7EB 2AK1H 4KAQL 4I2XE 5GHWL 1X5FA 5DQDH 1G6VK 3VWKA 1YY9C 2ICCA 3ZE0F 5IB5A 1QBLL 1S9YA 5CAYB 3EYVA 4XMPL 4JQIH 3ZSTA 4WHYH 2DQUL 5EOCJ 1UJTA 3P11L 4FQHA 4CVUA 1EHXA 2WUBL 1JN6A 4M1GH 3C6LD 3PWPB 3DROB 3IGAA 1KCLA 2DQTH 4IIQB 5FOBB 3I6GA 5FM4A 4A6YL 4HUXB 2R69L 3QEGL 5C0CE 1TETL 3CC5A 2DQHL 5I76A 2Z93B 3BMWA 3H2WA 4MVBC 5CJQH 4U0RC 2O93L 3KYNB 1YEIL 2XA3A 3TT3L 5EO1B 1SVCP 4G7YL 5BXFA 1ROWA 5BS0A 4HF5L 1OW0C 3DV6A 3MFFA 3PP4H 1JMZA 1F4AA 2KQNA 4R2GB 3TZVA 4DEPB 3GNMH 1KTLA 3C60D 1S3KH 3SDCC 1BX2A 4HV8A 5D71H 4G7VL 3TN0B 5F9JB 4RQQB 5I16B 3MRMB 2ED7A 3MNZA 3O8XA 2OYPA 5MEQA 5ERWB 5ESAA 4G42B 4F37F 3BPCA 5ADPH 3QNZA 3RAJH 3HB3C 5A3IC 4PJ9D 4Y1AD 4QRUB 2VITB 3PWJB 3DOSA 1QRNE 4EDXB 1F4HA 4RBPH 5FYLL 2F5AH 3MBEA 3NPSB 2VR4A 4M4PA 2PXYB 1HYSD 3IDYC 3MV7D 4OF3A 1OAXL 4KKNA 4TULL 5ANMB 3O4OB 1NBVH 3KPSE 4OQTH 1P6FA 5B8CC 2CK0H 2JKXA 2NY6C 1P4BL 3MA7B 1N59A 3VFUB 5CSZB 5D7SL 5JPNA 2GEEA 1OF2A 3PWNA 5CS7A 2NX5B 2CGRL 3ULUF 2IALB 4DQOL 2M1KA 4NNXA 2VKXA 3O6FA 3QEQD 2B7DT 1N5AA 3FT2B 5C8JB 4GKSA 4ZFOB 2IQAA 4R96B 1RFDH 3GSRB 4XXCA 4PLJD 1MHEA 1UXWB 2G2RA 4ONHB 1TIUA 1UWEH 2NTSP 2CRYA 3BP5A 5FKAA 4J3OC 5DC4B 5IG7B 1M71B 4PG2A 3B83A 4XPFH 5HGGS 5HTSA 2CKNA 3HR6A 4NQDD 3GJEA 4KDVA 3PGCB 3U9UA 1UCBH 1X5KA 2ARWA 1F4YL 2R0WH 1PX3A 2P43B 2P7TB 4WFEE 1P69B 4X8JB 1XCTA 4Y0GA 1FYTA 4JKKA 4NNPL 1HWHB 2LABA 4PJXB 2VZSA 2NXZC 2JCCF 2XY1A 6FABL 2FIRT 3DX8A 5B39G 2J8UA 3CGTA 4B50A 4HT1L 2AK4D 1A7RH 4N8CH 1AXTH 5FDWA 5C0NC 4L8SB 4CU6A 1LILA 1ETZB 3WNOA 1CFVL 4O2EB 4HWEL 1P7HL 2OCFD 4JKWA 1U2CA 4IHOB 3RNKA 2V7NB 5HI4D 5D2NC 4AQ1B 3UP1A 1HZHH 1YNKL 1P4LA 1KGCD 2QEJA 1F4WL 4PGDA 1CN4A 1EFXB 4XBEH 5I1IH 1PEZA 4MNQE 3ISWA 4FQPA 3TH3T 2VISB 3K8KA 3MV8D 1UCTA 2DM4A 1B0GB 3G6DL 5B21A 3ORJA 2EDEA 4JFEA 1J88A 1T5WA 5B3NA 1KPRA 3QUXB 2YN5A 5HYIA 2R56L 3SN6N 4OCRH 3RWDA 4HJGA 1MUJA 2AK1L 1G7PB 2NX5E 2R39A 4LDOB 4X99A 1HHJA 2BNQD 4QTIH 4YHPA 1YEHH 3GSQB 2YD3A 3ARBB 4P2QB 3GMOB 2XQBH 2NMSA 1IGJA 2VC2H 1UJ3C 2NCMA 5E8PA 1U8MB 4QRSB 3MRGA 5IBTL 4HSQA 3OKKB 2C1PA 2CIKB 3CVHL 5KTEL 4JQVC 1PKQA 1V3JA 4X5XA 2VXSH 1QSEE 2X7LB 4DVBA 3GGWB 1HHHA 4BQ8A 3CK0H 1D5IH 4ZPTB 1JGVH 2VZUA 5MHSE 5D5MB 2BVQA 3MA9L 3RGHA 3V6OA 4JDZB 3VXMD 4YHNA 3QXAA 1T4KB 3QFJE 3MPCA 4X98A 2YD4A 3KPLA 3IJSB 3VRLE 3WD5H 1DFBH 3T65A 1A1MA 1WBZA 1J05B 4Q97A 2Q8AL 1E4XH 4NO0B 5D1ZA 2HG5B 1DQQA 3LQAC 3WNNA 4B53A 5CWSB 2V2WB 3BT2H 4CNIB 4NJ9H 4XVUD 3CVIH 3RTQA 3B3IA 4OF6A 5DK0A 5KSAB 2Y23A 3B6SB 1F97A 2E7CA 2VQUA 3LKSA 3GNML 1IC5H 4X7TA 3H9ZA 5F3HA 1UA6H 2J8OA 3INUH 2QSVA 5D71L 3BPOC 1FE8H 5EBLB 5LAXA 3TNNA 1XGPA 5J9PA 1GGUA 5DEFB 3QEUA 5JHDE 1HHKB 1MCRA 3CUPA 3TCLB 5HGBA 5D72L 3C60C 3MMEA 5ADPL 2E6JA 4JZOA 3RAJL 4U6XA 4M3JA 3OV6A 5AZ2H 1R5WA 4L4JA 3RX5A 1QR1A 1BFVL 2X9YA 4JAMB 4ERSL 3MLRL 2R1YA 3H42H 2O5ZL 3THML 4J2XA 1JUFB 4PJ9C 3ARDD 1LEKB 3IFPA 5SWZA 4U0QB 4ORGA 4OQTL 1A21A 2P5WD 5I9QB 4P3CH 1DQMH 1JGUL 1KT2A 4MNGE 3ROOA 5J13B 2HVKA 4WW2F 4H8WL 4OLYH 4MA8H 5MP6H 4OT1H 4ZYKB 3T3MF 1WFNA 4UTBH 43C9A 5JTWA 1G6RA 3P0YH 5E1HB 3LKRB 3SDDB 4W6YB 3WE6A 1NDMB 4DAGH 5IMKB 2JCCA 5F96L 2DWEA 4QEGA 3CCHA 5JNYA 1JNJA 3FQXA 3SDXF 1IEHA 3NA9H 3BO8A 2YD9A 3QIBA 3WFCH 3QP3A 4BZYA 1CGYA 3E6HB 1NGWA 1IL1B 3P77A 1L6ZA 4HGWB 4APQD 2X40A 3UAJD 5EUOE 3OKMB 4GKNA 3QWRD 1K8DB 1NC2B 4LF3A 3JVGC 1NLBH 5C0DA