1BIIB

The crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MHC CLASS I H-2DD
publication title The crystal structure of H-2Dd MHC class I complexed with the HIV-1-derived peptide P18-I10 at 2.4 A resolution: implications for T cell and NK cell recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1biiB00
4Z0BH 4MYWB 4L8SA 3BI9X 4CGTA 1Q9LB 4QY8B 1OP5H 2J88H 1R3JB 2VLME 2X41A 3ZLQC 3RNKB 2HT2C 1KB9K 5FDWB 1NMAH 5HGBB 4HWZA 2J8UA 2VLJA 2O93L 1KNOB 1MHEB 5FKAA 2BOCB 2UZIL 2LAGB 3LH2H 1GHFH 4JPVH 1DE4A 5EU6B 1FSKC 3PXHA 5E6IC 4FQPA 1NBYB 4NGHH 5A3IC 3ALXA 3PL6B 4GBXB 5ACZB 2DMCA 2ID5A 3NFPA 2VLKA 1PYWA 3GBML 1NEUA 2C1PA 3Q5YA 1QQDB 4HJJL 4LLAA 1IGYA 3EFDH 3MRRB 1ND0B 4QHLA 5ECJE 4OF7A 5KVDH 3GGWA 2HTLC 4UDTB 5JIHA 5JQ6H 4N9GB 3GEWB 3K1KC 4X5WB 4DEPC 4YUEH 1NANI 3FB5B 5F7EL 1IKFH 3V95A 2FEDD 1MFCH 1KPUB 4PJGA 5D9SB 3MXWL 2H45A 5GJTL 4ZUWA 5E6IA 2XA8H 5EO1B 3U36B 3MR9A 4LQ1A 5KG9A 3DUSB 2RHEA 5C0IA 4XHJC 2AK1L 5IEHA 4ZUTA 5GJSH 4MQTB 4M4RA 4QTIL 4M62L 4ORGB 1JMZA 5L88H 4PB0H 5CP7A 5I66A 3A6BL 2IAMB 4Y5VC 1FIGL 3MNWB 3RTQB 4LKCA 2DLFL 3U9UB 2P5WB 1LD9A 4KY1L 1C12A 3OJVC 4LASH 4H0IA 3OJDB 1D5IL 4QEGA 1WIPA 5ICZB 2P8LA 3TVMD 3GUTB 1BQHB 1JJUA 1VFAB 4GKSB 4P57B 9CGTA 4R8WL 1KEGL 2O5XH 1IM3A 4YHOL 3JTTA 1BP3B 2B5IB 1CR9L 4W70A 3L5WB 3BHBB 4J3VA 4RGND 4WCYH 4OLVL 3NPZB 3NIFF 3FB6B 4HZAA 4R6UA 1XF3A 2CD0A 4Y5VA 2VSDA 1ZGLB 4M61A 4RMRA 5BVPL 2AQ2A 3NIGF 3UPAA 1TDQA 3E8UH 5E56A 1PSKH 3WHXB 4GW4B 4XCYB 4U1IA 4OUUB 3D3VD 4PGCB 5L8JB 1S3KH 3ARBB 4FN0A 3SJVE 2VZ3A 4AENB 2ICCA 4JAMA 5EZOH 3IDMA 1BOYA 1U8NA 1FCGA 1ITBB 4UMGA 3IU4L 1AGEB 4L9LA 4PBWD 1M7XA 4BSVA 3SKMA 4DVRL 1QFUH 3NCYS 5FOBB 1P6FA 4PGZA 2AEPL 3ME0A 2NY2D 4YNYA 4YXLL 5D72H 2W0PA 1A6TB 1QSEA 3T0WA 2CK2A 3O41B 5JDJA 3DI2B 1E6JH 4NJ9H 4DAGH 3SCMC 4DN4L 5FO7A 3EO9H 1RIVH 5CLWA 4X5XB 3KDMB 1URLA 4ELMA 4D9RD 1KCSH 3HMWL 4U1GB 2D9CA 4YDIL 4XWGH 2VXUH 2OXGA 4P5TC 1AJ7H 2Z8WC 5HDLA 1EHAA 3CFKA 5DJAA 3DARA 4NDMA 3S37X 1FCCA 4GKNB 3QT2A 4NYLB 3I6LD 1CLZL 4WEBL 1DUYB 1CD1B 3WLWD 2Y7QA 4M7ZB 4PJCB 3MFFA 3WLBB 4NQDE 4X6CB 2JJSC 3AU1A 5CSZB 3JUZA 2AXFB 2X1XR 4UBDC 3OR6A 5DQJA 5F9OL 4A6YH 1F3JB 1KBGH 3C09C 3NCJL 1X4XA 3SCMA 4H1LB 3UTQB 1M7IB 2D7OA 2OR8A 4OZ4A 5D8JL 1WZ1H 4AEIL 3VD9A 1HE7A 4HFUH 5HBBA 2VDLH 4QRRA 4UILL 4P5TA 1A4KB 1DEDA 5TJWK 5IUSA 1UFUA 3STZA 5DQ9A 1GJIA 5CSBA 2XXMB 4KKAD 3V7MA 5D6CA 5CHNA 1F5WA 4IOIB 1IAOA 1KTKE 3JBG7 2V9QA 4QHMB 3MLWL 5BV7C 3QEQB 3BZ4B 2JJSA 1A6PA 2PR4L 3QNYA 5T5NF 2WW8A 1QO3B 4Y5XC 1CICD 5DFVC 2V5MA 4LCCB 2DQGL 4OQ1A 4C59B 4ZNEE 4K3DL 4GRLB 4ZFZA 1H3GA 5ADPH 3QO0B 4UT7H 1T66D 5GRVL 3N1GC 4HPOH 1R3LA 1TTGA 2XRAL 3E6HA 3IDGA 5J57B 5I1AA 3BKJH 3G5VB 4HPYL 1CICB 2A6KA 2UWEB 1PG7H 5D7SL 3TBTB 5F1IA 1NMCB 4NRYA 4KQ4L 2DMBA 5I1CL 3WSQH 2G60H 5F7DB 3TESA 4OJFL 3MODL 3QZWG 3AAZB 4Y5XA 3WD5H 3RKDC 1B0WA 5ETUA 3QCVL 4WFED 2NY4D 4QRQB 1TZIB 4TUOA 5JHDA 2NYYD 3TBWA 4LPUA 2JIXA 4JM2F 1E28A 1Q9KB 3NGBC 1AE6L 3IDJA 5DR5L 4OCSH 3WHE1 3SE9H 1IGCH 3BIKA 3U2SB 1OAQL 4NWTH 1BD2A 1U3HD 5IMOB 3T0EE 1EFXB 3EYFB 3EJYD 3UTZB 3E6FA 4MDJA 5FGRA 2PYFB 5C9KA 5I15L 4P23D 5B39A 3UROR 2G2RA 1KPVB 2ZKHH 5DK3A 4ZAKA 3MRGB 4JHAL 2VDOH 4PTTA 3SO3C 5L0QB 4NPYA 3IAGC 1ETZA 2MKLC 3TNMA 4O02L 3OHXA 5LCVH 4PJAB 1MJUH 4C56D 2C7UB 1U95B 5EC1B 2F19H 4R4BB 4H5SA 4LHUA 3MOAH 4Y19A 3WKML 4WEMB 3CX5J 2HFGH 4D8PA 1VPOH 4WI4A 3KNBA 2H2SD 2XN9D 5LGHL 4ODSH 4WFFE 1YEDA 3IETA 2ITDB 4MS8C 4U3XA 3SY0B 3GRWA 2Y6SD 1INDH 2D7TH 4NZUL 2RCSL 4GKOA 4X6DE 4MNQB 3VE0B 2IAND 4LSVH 4N8CL 1R3IH 5FFLA 4N0YL 4Z77B 1AR1C 3LKRB 4B0MM 4Y4FB 1V7ML 4YBLC 1M71A 2Y4SA 4GMSH 3RAJL 3TJHD 4LSRH 2OZ4H 3WIIL 3BUYB 1WBYA 5B3NA 3QJFA 1U8PB 4Q6IB 5IQ9A 1RZJH 5J06A 1EMTH 3H9SB 3RWGB 3QWRA 1OGTB 3BZFB 2AV1B 3ULSB 3RA7L 2IANB 2K7PA 4NQXA 1AGBB 5EZJA 4RMVA 5T5FH 4U6HB 4CMHC 3RPIB 4XNMA 3VXTB 1A0QH 3V4UH 3OAYH 3T3PF 3VGAC 4NSKA 4X4ZA 1JHKL 1X5HA 3FO9B 4JZJC 4K2UL 5CUSH 4XCCH 1LE9A 1CF8L 1FE8L 5C92A 1UH2A 5CZVH 4BH7A 12E8L 4L5FH 3LEVH 3TZVB 1V3JA 3D0LB 1QVOA 1KFAL 2BNRD 4WTZG 5SX5H 3L7FB 5EBMB 2NY1B 3NFSH 1OLZA 3QHFH 1CIDA 1XF2B 6FABL 1XF1A 3OKLB 2HAZA 1ZANH 5JO5B 3BZEB 1OF2B 5BQ7B 5CWSA 2YMXL 3GSWA 1UM4H 1ZVYA 4YJZL 2C9AA 3MLYL 2XKUA 5KANI 2FBJH 3X11B 2FEEL 2A6DA 4JM4L 4QT5B 2V17H 4R0LB 2UYLA 1BEYL 3ARVA 3VXME 5BXFA 3PWPE 1U8MB 1YNTB 4FMKA 4U1LB 3DV4A 3VG9B 1JWMB 3HG1A 2Q8BH 2XY2A 2Z35B 1MNUH 2HRLA 4JZJA 4IHOA 4OIIH 4PRPB 1A14H 4QWWC 5HD8C 5J1TC 4JKWA 4AJ0A 4WDIB 4NN6B 4K7PX 4GSDL 2HKHL 5C71A 3QXDA 1GZQB 5IKCA 3WNPA 5D96C 2JCCB 4L8BA 2OK0H 1G6RB 1OHQA 1CZ8H 1OAZL 4JO4H 3VFMB 4MJ5B 4MAYC 3HRZB 5GS2D 1QYGL 1CE1L 3TA3C 1TPXC 1MAKA 5H35A 1UZ8B 1M05B 5I8KL 4YQXL 1ZVHA 5DD5H 5F93C 2FJHB 3RX7A 3QFJD 1JGLL 2XY1A 2V7NA 4KTYA 1JGUH 3HN3A 1QPXA 3O45B 1JZ3A 2BK8A 4NKQB 5DC4B 1FAIL 3FFDA 2R8SL 4E5XB 3ZKQD 4KZEH 1X44A 4I9WD 3PV6A 1DN0B 5C09E 1CGUA 2NR6D 2CXKA 3B2VL 2MSPA 1NEZB 1AKJD 2Z31D 1S5HB 4MAYA 3DO7B 1T3FA 2WUCL 3D9AH 3UZVB 4ESKA 3W5NA 4HUVB 4G7VH 1CU4L 4M43L 5GGQH 4FFZL 4C4KO 5E95B 3HC4L 2HH0H 2VABA 1QRND 3WFEL 4LRIC 3IDYB 3CFBB 4HGKC 3RUGE 4OCXL 4XNUL 4F80A 1XGRA 3QIUD 4YE4H 3VFGH 1G7HA 1NL0H 1A6AA 4Y1AA 4P46C 2NNAB 4CU8A 1REIA 1FFNB 5ACLA 5DS8B 1A7NL 1P7HL 3GHEL 3MRFB 1ACZA 2X1OA 4EI6A 1EXUA 1K8DA 4CUCA 3OF6A 4KROB 2Q7YB 1L9NA 4HLZG 1OAUH 4JEGB 5EDXA 1NCAL 3QIUB 1OY3B 4O9HH 1X7QA 5I1EL 5DD3H 5HGHA 5JNYB 3ZE2E 5EZIL 3BE1H 5ESAA 3HE6C 4LRIA 3HAEB 4PP1D 3OAUH 5D7LE 1T1ZA 1RUML 4X0KB 1XH3A 3FN3A 3M8OL 4APQB 1DP0A 3HR6A 3EJZC 5ISZA 3G6JA 3CDGA 4M6OH 4HFWB 4P46A 3C9NB 3AGVA 5CJQL 4OZHB 3DX6B 3P9MA 1FLTX 2ITCB 3O2DH 2DB8A 1MAJA 4TNWF 5IMMA 2VDNH 1NKRA 4DZ8A 5KSUB 1U8QB 2PYED 1A6ZA 5T1DL 3SDDB 3QUZC 5IOPA 2EDDA 1DJSA 3P30H 1KPRA 1NBVH 3QO1A 1J9CT 2HFEB 4AT6B 2EC9T 5C08A 1W8OA 3EHBD 5HYIA 1XMWA 4UU9B 3EYSL 5CZXC 1BJ1H 4LU5H 1JNJA 1E27A 3HE6A 2APBA 3VXUE 4ODHH 1TETH 3STLB 3GSQB 3MYZA 1EHNA 4PJXF 3T65A 1NLBL 2D9QB 3MRPA 3FHAA 4NN5C 3MTRA 5F21B 4IRJC 2H3NB 3VFPA 1SEBB 3EAKA 4PRNA 5IMKB 1N64L 5C7XH 5KVEL 4JG1H 2VQTA 4PD4K 1F6AA 1NGQH 4JRXB 3BP6A 1U93B 1J05A 2O61B 3QUZA 4Q9RL 5EU4B 5BJTA 1T4KA 2IBZY 3KXFD 1UG9A 1T5WA 3KPLB 2WUBH 4KHXH 1S9YB 1MFDL 4GUPA 4BUHA 1QFWI 5BMFH 4EOWL 3IVKA 2WBKA 4Y16D 4QRPA 4LVNC 3I02A 4PJ7E 4OB5L 4ZTOH 2R0KL 2IPKA 1WAAA 3U4BH 4XXDB 3MRQA 2XTJE 1DVFD 1GGCH 4IRJA 4X98A 4A6YB 4P48A 5I18L 1WICA 4NNPH 2FDBP 5F1OB 4WFHD 2LVEA 5DD6A 4GRWF 3O8XD 4WNQB 4Z7OF 3IFPA 4OD3L 4HW6A 3A6CH 4ZQKB 3EIFA 5ITBL 1LDPL 4HUUB 3RVUD 3HMXA 4JFPA 2XQYG 1XR8A 4HIXL 1AFVL 1FVEA 1VENA 3AS1A 1FNGB 5D93B 1F42A 1FHGA 4P9HC 3VXNA 1DVFB 4OI8A 1WQVT 1T2JA 1H15A 3VWJB 2NX5D 4NO3A 2E8YA 2IPTL 5H37G 3UBXI 2H2PC 1S7SA 3C5ZD 2YUWA 4X8JA 5HPMB 2XWBB 4KKLC 4UOW1 2VKWA 1CXLA 3K2UH 3OR7A 2EZ0D 2QR0B 4U7SA 4U1KB 3QRGH 1I4FB 3ARED 3DVNB 4NKOB 5CP3A 4MA1B 2JF1A 4L4VB 3F5WB 5L9DL 1G7JB 3KPRD 1Q38A 1IM9B 5C0CB 2C4FU 3C5ZB 4LP4A 5F3HB 5HXMA 2FR4A 5DRWB 3KJ6L 2YC1B 3VXSE 4OTXL 4GFTB 4C83B 1BFVH 2HRPH 4X7SH 2PXYC 5DA0B 1RZGA 2YPVL 5K59F 5I73C 1E4KC 4JGJA 1RJYA 3C60D 3UAJC 3QSKB 2WLYA 1BJ1J 3CXHJ 5DQDH 4BA8A 1FG9C 3IXTA 5B38G 3JV4A 1UACH 4XPAL 2CKNA 4LSQL 2DDQL 4PJ8A 3HB3C 1H3PL 5AG9A 5JOFA 1KULA 1JK8B 3CK0H 2FJGA 1ZHKB 2JJTC 4KKBD 5BRZA 4XC3L 3X3FH 1CGTA 1GC1L 4LCUA 4ZFOB 3RU8H 3S7GA 5I30L 4O4YH 3FMGL 1I8LA 5FGSA 1QSZA 1YNLL 3ILQC 4KK9C 5TDPA 2NZIA 3WHE0 4Y89A 4URTB 1WFTA 1KGCE 4ZFGH 5MEOA 1A9EB 4CKVX 3FQXA 5E99L 5HHPA 4MJID 2PXYA 5JW3H 1LK2B 1LEIB 1KOAA 1E4KA 3EO0B 5A2KH 5TE6H 5CIPA 1E0OB 3T2NH 3LQAL 3E3QC 3L5JA 5I1GL 2SEBA 3S36L 1ONQA 4EN3B 1H5BC 3FRPA 2BVQB 3QDME 4LP5A 1C16A 4JRYA 1NGXA 4F58H 1NGWA 1EO8H 2B1HL 2M2DA 2JJTA 1ZSDB 2R2BA 3HC0B 1KCUL 5HHOB 2EYRB 2EC8A 4M1DL 1ORQA 2H41A 3RHWF 4MA8H 4PRID 4POZC 5DJ6B 3ULVH 2ZOLA 5T1KA 3CAFA 4QOKA 1A3RH 1LMKA 1J18A 1B4JL 2A77H 5FA4A 5GHWH 2DF3A 1DUZB 5JMRA 3HPLB 5IF0B 2X4NA 2IGFH 3HFML 3I9GL 4NQED 1QHOA 1H3XA 2RIKA 1ZEAL 4Z7UB 2N7BA 2NY3D 5DURD 2VLMD 4XNQA 1H5BA 1ZV5A 5F7NC 2AGJL 3SDYH 3UJJH 1N5AB 3HG1E 1VHPA 4CNIA 5DI8A 2AK4D 4D0DB 5J8OA 1VESA 1P84K 4JKKA 2DQTH 5F71A 2VNCA 4NOBA 1I9JL 3G6DH 5DURB 2VLRB 5ADOH 1D5XB 1TCRB 3V6ZB 4Z5RB 4JLRA 4BQCA 2HLFD 3HCVB 3KS0H 5BZDA 3RP1A 4KJQD 4E42B 1XGPA 3FAWA 3F7VB 3WL9A 3VFTB 2AQ3A 5DTFB 1Q9OB 3IJSA 1K3IA 5LAXB 1HEZB 4ZXBA 1CG9A 4YHZH 5DMIH 4IEFB 2AK4B 4R90L 4G9FA 2O5YH 2XT1B 2F54D 2BMKB 4HWEL 4ZO9A 5DYOA 1GGUA 3O9WC 4QYOB 3FCTA 1U6AH 2W9EH 5I74C 5D2LB 1NDMB 4FQJL 3PHOB 4U7MA 1Z0MA 3T4AB 2EE3A 1CT8B 3JV6B 4IRSB 1QSFA 2E7HA 4JFHE 2ADJB 4CADB 5B3JE 5KSVB 4MAUH 3KPSA 3W0WB 3MO1B 5IWLC 4RFNB 2PETA 2XWTB 1HHIB 4H8WL 1BVLB 4OLYL 3MCLH 3BD4A 3FFCE 1ULVA 2F54B 1WUNT 2W38A 3KPMB 3DJ9A 1S78C 1VADA 2E9JA 3R0NA 1XR9B 4TULH 4M1GL 4KRPD 4M6NL 1ED3B 1JL8A 2CIIA 3U0TB 3BWAA 2EXWC 1P6AB 1FG2B 3B5TA 3ZYJA 2ESVD 1JN6B 1YMME 3O9WA 4ODWA 5I76B 1FDLL 3RWIB 1P4IL 2IQ9H 1OGAE 2G5BA 3TEUA 1P1ZB 1QA9A 3LKNA 3OGCB 4BSWB 1AD9A 3KPPA 2GK0B 4D9QE 1MJ7H 5IWLA 5I1IL 1FYTA 2KQNA 1ADQL 4XPTL 4OBRA 3B9KA 1ZTXL 2PO6B 1J8HA 2K3TA 1WCQA 3BD3A 4FXGA 3VDCA 3UYRH 4Q9CA 3VW3L 2VWEE 4HIJB 1OAKH 1MEXL 1UJ3C 2GTWB 3EJJX 4X7TB 3T2OA 3SJVD 3SHSA 4JFFE 1KB9J 1KT2A 5C0AA 5FCUL 3UZEA 5T3XE 5LGJA 5K9QI 5IESL 4UUJA 2X70B 3ARDD 1Z6JT 4MD0B 1OAXL 3G6JE 5EN2A 1JP5A 3ECBA 3RDTC 4N8VA 4I48B 1JF1B 2BY3A 4KI1A 3BSZL 1YEGH 3R1GH 2BFVL 5TGBB 3OPZH 5GSVA 3W11D 5ESVA 4JM2C 3QUML 1R0AH 1YPZE 4ONHB 4LLMB 1CYGA 4XHQA 4TTDC 3QAZB 4X9FA 4IJ3C 1P2CA 5IR1A 4JFOA 4G43A 5E2WL 2BY0A 1FH5H 3F6IA 2P49B 4X80L 3ZTJG 5CJ8A 4XPBL 4G6FD 4PUBH 4WWKA 1R24A 3BX7C 1UJ3A 5FM5M 2I9LB 3KS0J 5T1LA 5IBTL 4P4KC 1UC6A 1L6XA 5BS0E 2YPLE 4MCYA 4OGYH 4YDVA 1SEQL 5D1QD 4M8QB 1T22A 3SKJL 4UIMB 4YHIA 3RDTA 4IIQB 2EE9A 4NQDD 4DCQB 1AXTL 1FGNH 4F7EB 3MQIA 4U2ZA 1T83C 4NQCE 1J1PL 3GHBH 4JM2A 3U6RA 2Y5EA 3RL2A 1IQWH 1CD8A 2LVCA 1RZFL 2NY0C 2Z93B 4LHJB 2GJ6B 1LNUA 1UXWB 3MLXH 1S7VB 2EIZA 5TH2B 3TYFA 1LWRA 3TH4T 1SVCP 2F53B 5HJ3A 2NY7L 4P4KA 1IBGL 4JVUA 2R56H 5A2FA 4XMLH 1X4YA 1FJ1A 2I07B 1K5NA 2E6PA 2XPGA 4MMZC 5CD3B 4GAJL 2UY7A 3CPLB 7CGTA 2DQIH 5A2LH 4N0CC 3FB7A 4ZDHA 1I7ZA 3BWUC 4KVNH 4RFEB 2BNQB 4Y4KC 5CS7A 4L4TE 4KKCD 1DTUA 3TO4C 2X5PA 1P9MC 1TQCC 3RIFF 1T83A 2ZUUA 1EBPA 4EEEA 3H0TA 2Z92B 4XRCB 3QNXA 4HKJA 2L7UA 3U0WH 2IWGA 1MHCA 3S4SB 5C0GA 2HJKA 2AJYL 1NGZA 4HX1A 2B20A 3MLRH 2Q76A 5GS1C 1F8TH 2DD8L 1S9VA 3KJ4B 3DI3B 2WNGA 3G5ZA 4RDQF 3GMMA 3H8NA 1T0NA 4IDJH 1GOGA 3H7BA 1MH5A 5DVMA 1D5BB 1QLRB 2VLLB 5CEZE 4Q2ZB 2AEQL 1HILB 4ZPTB 1KJ2A 1FGVL 1JPTH 4IMKC 5E2TH 1WJ3A 1K2DB 3C08L 4PG9A 1W0WA 4Y4KA 2J6EL 1G6RL 3TO4A 3V0WH 1P9MA 3G04B 2W0KA 4OV5B 3C6LB 5F7FA 3MV01 3I6KA 4JJ5B 1LP9F 4Z7VE 4U0QB 5KBNC 3OKEB 1I85C 4WO4B 1S9XA 1B0RA 3G9AB 1Q72H 1FO0A 1T2QL 2JB5H 2DWDA 4OFYD 3ULUE 3MJ7B 3N06B 2I24N 4K94L 1FRGH 2F5AL 1EUUA 3D5OF 3S35L 3GMPB 4PG2C 3RNQB 1MHHA 3QDJE 5IBUG 2OTUA 1A7PL 5I1JH 1ZHBA 1KTLA 4F2MB 3T0ED 4KTDL 2VDMH 4OSUH 2P24A 3R06A 3ALPA 3VGEA 4IMKA 1MREH 5JQ6L 5BO1L 3GRWH 3ZYZA 4U1MA 4Y5YB 1U9KA 4HK3N 4PJEF 4OAWB 4Y2DC 5FHBL 5IEKB 1U58B 1KYOK 5JXAL 1WWBX 2MCG1 1MVUB 4KJYA 3D85D 2EXYC 3F8UB 5J89A 3VJ6A 4L8CA 4IRZH 4NZTL 5J1AA 2X4RB 2YPKB 4KAQH 1I85A 4RX4A 4UAOB 4EBQH 4AEFA 3H3BC 4K3JL 4NQVB 3KYNB 4HBQA 3INUL 1Q9WB 3C5SB 1ES0A 4PG2A 1ZE3C 32C2A 2BVOB 4XTRD 3GNMH 3BVNB 4QF1B 3D0VB 1Q94A 3VXRA 1L0XA 4UOW0 5EPMB 3GB7A 1N6VA 1JHTA 1KJMB 1P7QA 1PLGL 3IDXL 4WU7A 3FQRB 4UNVA 4JFDD 1JNLL 3L6FB 4LCWB 5A16A 3D6GA 3P11H 4NO5A 5KSAC 3OL2A 2QTEA 2FECL 4ZO8A 1GOFA 1T6VN 3MA7B 1NGYB 5E7FA 4Y2DA 5HGGS 4PJIE 4YC2B 1MIML 4JR9L 4PBVC 3REWB 3WFCH 4E41B 2VXTL 3I2CH 5HYJA 2D0HA 2FYYB 1CXIA 3QI9D 1FNEA 5HI3D 4PJ9D 4DKFL 4KZDH 4FNLH 1IAIH 4NFDA 1GPOH 4BELD 3FO1B 1TJHH 4LOUD 1FFPA 4IMLA 5E8OB 4Z95H 3VCLB 3QPQC 3LMJL 5IVXE 1YEIH 2ERJC 1C5DA 2JK5A 3MX0A 5FA3B 1ZWIA 3CU7A 5KSAA 4K7FB 4ZS6D 3SE3C 2BOBA 5IFHH 3QWOA 2XZQH 3PNWB 2WLZA 3KYKH 4LL9A 3ARFC 4OD2A 2GUOB 5I2IB 1J86A 1CE6A 3THML 5EC2B 1B90A 1P7KA 4O2FA 4TUJA 3NIGE 4LLQA 4JPWL 4MQXC 3F58H 3RWHB 1JPST 5FYLH 3SDCC 1JWSB 5TE4H 4HWZB 2J8UB 2VLJB 4FQ1L 4DAGL 5FKAB 5DUBA 4CJ0A 1DEEA 1S7TB 2CLRA 1H8NA 3IRZA 2KH2B 3O6FD 1DE4B 4HH8A 7FABH 3HI6L 3CD4A 3MLZH 3PWPD 4HIHB 3AM8C 4G9FE 3SE3A 1NUGA 3OMZA 1OAYL 5C0JA 4HV8A 3ARFA 2VLKB 1PYWB 2R1WA 2GSGA 4I2XE 2C1PB 1IGYB 1XF4A 2E6QA 4QHLB 2FB4L 2PN5A 1KIPA 3S97C 3GGWB 3GK8L 4JHZA 2WBJC 4P2QA 4TNWK 4XVSL 2HVJA 4YXKL 4QHNA 3H6JA 1PQZA 2BXYA 4QGTA 4LKXA 3CDYA 1HKFA 2D03H 3SDCA 2YRZA 3BYTA 2DBJA 1KC5L 3D2UA 2VQ1A 4PJGB 4TSCL 1CLYL 1MCRA 4ZUWB 1FSKB 2X7LB 5E6IB 1RVFH 1A7OL 4Z18A 3JWOH 3MR9B 3AM8A 3QA3A 1H8OA 4PV9A 1RY7B 5E9DA 1EAPA 4PYGA 5MI0C 5IEHB 4ZUTB 2ZUSA 1J5OH 3NOIA 3QCUH 1G1CA 4Z7QF 3IFNL 4P9MH 3CSGA 5I66B 2C26A 3DO3A 1BMGA 4GQ9L 3NPSC 1I9IL 4LKCB 1KN2L 2HT3D 4BQ8A 1LD9B 5MP6H 1QEWA 2R69L 5C09D 4XHJD 1JFQL 3PIQA 2WBJA 3ZMRA 1X5LA 3IFLL 3VG0H 4U0RC 4CU7A 1HH6A 4YDKH 2YRLA 1SM3L 3SOBL 4DEPB 4PJXA 5ERWB 4P2YA 1J8HE 2YR3A 5DJZB 5E2UL 1G7IA 1JI1A 3WFZA 4JREC 4OCYH 1I7UA 4YEFA 2Z0BA 4HK3J 1IM3B 1YNKL 5E94A 3WNMA 1T7XA 2R0WH 2YWYA 4FQLH 5ITFA 1JPSL 1GL4B 1XF3B 3BPCA 5ANME 1RZIA 2YD9A 4Y5VB 3BKYH 3B2UD 4M61B 2IADA 1MJJA 4PFEA 4MZ3A 5EUOE 3L3KA 2XKNA 4M9PA 3RZCC 3GMOA 4U1IB 2EDOA 3MFGB 2XQBL 5J7CC 5HGAB 5HY9B 3EO1A 4JAMB 1W8NA 3IDMB 4EUPG 1Q0YL 4NOFA 5TE7L 4W6WB 1OM3H 3SGKC 4L29A 3SGDI 1C7SA 4XGZA 4HH9A 2B8OT 2YD3A 3X17A 1WTGT 1F2QA 2AXGA 4YXHH 3SKMB 1LO5B 4EZMA 3TV3H 4PV8A 3UTSA 4G8GB 4MVBD 3RRQA 5CJ5A 2HLAA 4YNYB 2GY7B 1MCOH 1QSEB 3V5DA 3EGSA 5FO7B 1JGVH 1FPTH 3RZCA 1INEL 4ELMB 4FOMA 4Q9QH 4FQQA 1P5UA 2Z91A 4QRSA 4Y88A 2F19L 1AD0B 3MRMA 5DJAB 4NDMB 5DRXB 4UTAH 4GAYA 4X7CC 1WFUA 1U2CA 3LEYL 4NO0A 3SGKA 4AEHL 1G0YR 4WI5A 5I71B 4S1DC 3VXUD 1XEDA 3DMMC 4LEXH 4JFZH 4CAGA 3QEHA 4P5TD 5FCSH 3QG6A 2W92A 3AU1B 1BQLH 3MBXH 1RU9L 4GLRH 1OWWA 2Y25A 3SCMB 4R96A 4AEEA 5CEXA 4YHML 4O2CA 3OQ3B 3FT3B 3HMXH 4QRRB 4XP6H 3QISA 2C3WA 2MPAL 1PZ5A 4XH2A 4YFLF 3HKFA 3STZB 2OZ4L 2X4PB 3PP4L 2EDKA 4XP5H 3EOTH 1RZJL 5JDSA 5D6CB 1DFBL 5CHNB 4G6MH 4ALAH 4WHDA 3DMMA 1IAOB 5M7QA 4V1DB 1MWAA 2L0DA 2VTFA 2XZCL 5EZLA 1LO4L 2OMBA 3QNYB 3AFLA 1T7YA 4PRHA 3LKPB 2OSLB 4ONGL 3SQOH 2GFBA 4DZBA 3B43A 1W2KT 3C09B 5ALCH 2WIIA 5D5MF 2WIMA 4FQXB 1IVLA 2ED8A 2VH5L 5CP3H 1IL1A 1KB5A 1AXSA 3ZKSD 3ZKND 4JZNA 3LZFL 4ZFZB 3CSBA 1DR9A 2VDKL 3QUYB 5E2VH 5ELIA 3FL7A 3RHWK 2BZDA 5IFAL 1R3LB 3FRPG 2DQEL 1QBML 2JIXD 3IDGB 4P9HH 5I1AB 2EDJA 2E9WA 2A6KB 1OQXA 5KN5B 3IU3B 2WQ8A 3C8KA 4NRYB 4XI5C 3REVA 3L3HA 4H20L 4GRMB 5C1MB 4JPKH 4Y5XB 1R3JA 1RUAL 3RNKA 5ETUB 5FDWA 1EJ6A 3IAPA 4ZAKD 4BM7A 4TUOB 5JHDB 3TBWB 4JCMA 1X5KA 1E28B 1MHEA 3IDJB 4JY4B 1I75A 3MJGX 4FZ8H 2W0LA 3Q1SH 3TFKD 1NBYA 1BD2B 4JE4B 4YHPB 3VMPA 1RJCA 5K9JL 1BBDL 1HYRC 5AUMB 4OCRH 4Y19D 3VXSD 3E6FB 1INQB 5ACZA 2UZXB 2ZUWA 2WWMD 5B39B 5H8DA 2IAMC 1QNZL 5DVOA 3MRLA 1ND0A 3BISA 4PTTB 3IS1X 3RPKA 4H88H 5DGQA 1ETZB 3TH3T 1AGDB 2FL5A 4ZOEA 3TNMB 3OHXB 4NHCH 2NCMA 2CO6B 4N9GA 3RL1B 4X5WA 1U92B 4FQ2L 4H5SB 1ZLSL 4LHUB 4JHWH 4O58H 2HTKD 1K3ZA 4NZJA 2IALA 1KPUA 4Y7MA 1GGYA 4OCWL 4MCZA 4HJGB 1RURL 3KNBB 1G7MA 1QLEH 5EO1A 3U36A 3F62A 5SWZE 1YEDB 4CN4A 3IETB 4NUGL 1EO5A 5DWUH 1PEZA 3MJ9A 1A3LL 3AY4C 1KJ3H 2IAMA 3MNWA 3U9UA 5CJXA 3RWJA 3SO3B 4QCIA 4U6YA 1UCBL 3V4VL 1CFTA 1MY7A 1XIWD 5JW4R 2JELL 4MS8D 5E4EC 4QHKI 1A6UL 3SKNA 2FSEB 1J1OH 2HH0L 5CFHA 4Q0XL 5AEAA 3QH3A 1M71B 2A9NH 4Z7UF 3GUTA 1C08A 1WBYB 3QJFB 4N0FA 4R2GD 3S34L 4WUUE 1AR1D 5KVFL 3U46B 4ZODA 5I8OH 5TFSL 4PYHA 4NQXB 4DOHB 5EZJB 3KHOA 1CFVH 2VE6A 3MA9L 3AY4A 2VL5A 1F13A 2UVFA 3LHPH 3LEXB 4NSKB 3VFRA 2GSIA 3KWWA 5ILTH 4PGBA 4O9HL 3WHXA 4GW4A 4XCYA 3ARQA 1Y6NR 5E8NA 5HYQB 1LE9B 2HMID 3BE1L 2B1AL 3T0XA 4BH7B 4U1GC 3VFOA 3MV7B 3TIEA 1EJOH 5IW1A 4AENA 4NQUA 4YBLB 1HIMH 3GO1H 2JB6B 2P5EE 3AVEA 3WEXA 3HG1D 1QVOB 4TVPH 1N2RA 2DQDH 1KCRL 1RPQA 3HRPA 2AABH 3PE9A 3N85H 2RAMA 2VC2L 5FOBA 3ROOB 1YJDC 5CWSB 5KSBE 3I50L 2VDNL 4CMHB 4GXVH 2A6DB 1QTYT 3VGAB 5L2KA 3O41A 5T5NG 5EBGA 1I1FA 3DV4B 2ZUQB 3P30L 2B4CC 5CD5C 1TZGL 5SX4I 4JZJB 4OKVA 4P2RE 4OGZA 3ZKXB 4AH2B 4HULB 3KDMA 4N8VG 4NNXB 5FYKH 1DBMH 4OKDA 4LBEA 1JIBA 4Z7NE 3MV9A 3MZGB 5E9DE 5EOCH 5IKCB 4JO3H 5C2BL 3X14B 1A02N 3GMLA 3MLTA 4L8BB 5HD8D 4HBCL 1DUYA 5T3ZD 1YQVH 3WLBA 1YEJH 3O6KL 1FFRA 2F74A 5CSZA 1JYWA 1NGQL 3FFCD 3MBEC 1CK0L 4HC1L 5KOVC 3NTCL 3WUWA 1F3JA 4MAYD 4TSBL 4U1SA 5D7IB 4KHXL 4PLKD 1AO7E 3UTQA 1M7IA 1YYLL 3VD5A 1YECL 2FWOB 2YD5A 15C8H 2CUIA 3PWUB 4PGDA 4NCC2 4PJBF 5E08H 2DQHL 4AG4H 4HKBB 2D31B 5SV3A 4F7TB 3PV6B 4GAFB 1RUKL 2VAAA 4MB3A 5DZLA 4LIQE 5D96B 1OGAD 5GZNC 1D5ZA 4LCIL 2WWKO 1MAMH 4J3OC 2CDFA 3MRKA 4X4YB 4HCRA 5GS0H 3TA3B 3T2PA 1TPXB 2ADIB 4D9QD 2J4WH 4XPFH 3BZ4A 1FORL 3O0RH 2A1WH 2VABB 3JWNC 1QO3A 3DLQR 4TUKH 1CD9B 3ZE1E 2R0ZH 4UV7H 1A6AB 4PJDB 4KK5C 4Y1AB 5GSRA 4FFWC 3T0VA 2BDNH 4JFFD 4KQ3H 2QQKH 4OZIF 5T3XD 1E4XH 4YFDB 1N7MH 1WWWX 1UM6L 2FATH 3DXAB 4JQIH 1EXUB 4F33B 3P2TA 1K8DB 2AJ3A 3U4AA 3G5VA 4WY7H 3GI8H 3ROLA 4P46D 4POUB 1CL7H 4FS0A 4R7NA 1FLRL 1P84J 4M6MH 2YEZB 1IRAY 1K6QL 4TVSa 4CVXB 1X7QB 1PW3A 5HGHB 2VMFA 1KLGA 5F7DA 5D6DC 1A2YA 5ESAB 2V5RA 4PB9H 1A1NA 1XH3B 2A73B 4XPGL 2QHLA 5ISZB 1Q9KA 3C2AH 3CDGB 3L3IA 3S8WA 4ZYKA 1MPAH 1UXSA 4XNXH 4M48H 2FX8H 4PJ5A 3P9MB 4TQEH 3HE7D 5IMOA 1RUPL 4YHKH 1EFXA 3EYFA 3TBSA 1EGJA 2A0LD 3UTZA 4DZ8B 3DROA 2BVTA 2PYFA 3HZMB 3B83A 1LP9A 3WXVL 3O6ML 1XAUA 1MI5E 1KPRB 4HXBL 5EOCJ 1ZHLB 4HWBA 4NO2A 5C0BE 4NQCD 1MCWW 5HDQH 5F7LB 3MV8E 5C08B 5FUZH 4P5KA 5D6DA 1E27B 3HE6B 1O7VA 3IDNA 3L5XH 1U95A 3WIHL 5EC1A 2CRIA 3MRPB 4DGYH 4Z7WB 4L3CA 1U8KA 5C6PB 4L3EE 2DN7A 5T1MA 2R2HA 3VFPB 4ZFGL 4PRNB 2HWZH 1OP3K 3BPOC 5JW3L 4QHUA 4PJEA 5TQ2H 1N3NA 1GIGH 1NBQA 3CJJA 3E1F1 4XAKE 4XP4H 3H9ZA 5DUML 3WFDH 3V79C 5EWIH 3AROA 3BP6B 3QIWB 1RI8A 3SY0A 2ADGB 3K1DA 4IRJD 4KTEL 3QUZB 5I16A 2OXHA 2QADD 3PGCA 2FH8A 2FLRT 1G9NL 1T4KB 4L4TD 5BJTB 5HVWA 4PP2A 2DTML 2FX7L 4R26L 1F4YL 3PQYB 3TH2T 4OGXH 3IVKB 4C54A 5LQBL 4QRPB 5I1LA 3U7WH 2IPKB 4UV4H 1TNMA 4NM4L 4MA8L 4OF6A 3OKNA 1FO0H 2RJMA 4Z0XB 3TZVC 3MRQB 4NN5B 4O5LL 4MWFB 4X6BA 1U8PA 2OQJB 4X98B 1QACA 2DQCH 3H9SA 1AY1L 2AV1A 2WV3A 3ULSA 5DD6B 5TF1L 4ZFFA 2LTQB 3DUUA 3MV11 3L5IA 1YUHA 3NABH 4U6HA 2CLZB 4JFPB 5D7KE 4I3GA 4LAQL 3RPIA 1IC7H 4NHUA 1XR8B 1FVEB 2QEJA 2DM3A 3ZHLA 2P46B 3P0VH 1KXTB 1OW0C 1H15B 4LVNB 4NO3B 1CCZA 5EU6E 3OXRA 3UC0L 1S7SB 4OZFH 3SGEH 3ULUD 4X8JB 1UEYA 3QB7C 3TZVA 2F5BH 3LIZL 5AYUH 1F00I 3OR7B 3EDJA 2QJDA 4LGSB 1MF2L 1UQSB 1JGEA 4U1JA 1MCLA 1TVBA 4HUKB 1OTSD 1FYHB 2H2PD 2CGRL 3VDAA 4XBEH 5JO5A 4FXLA 4ZTPL 5BQ7A 4I0PB 1AQDA 3PGFL 3TCXA 3X11A 2IC2A 2DYPA 2R2CA 2YN3A 4PJ8D 1YNTA 4RRPG 2FR4B 5DRNA 1JWMA 1OW0A 1BVZA 4JB9H 4Z9KB 5D70L 5C07A 5BRZD 5MENA 1IFHH 1TLKA 3CDCA 5DEZA 4RNRB 1RZGB 1J0ZA 1SYSA 4WDIA 3TT3L 4JANB 3FN9A 1RJYB 1HHJA 3CLEH 4K71B 4NQTA 3IXTB 3QDHA 4PJHF 3JV0A 2NTFB 3JV4B 5DFWH 3PDOB 3D39A 3FONB 3ARTA 5JOFB 2YA0A 3O2WL 4F8QA 2P5WE 2FJGB 2MMXA 4YWGH 3X12B 5BRZB 2NY5H 2JJWA 3FO2B 1KCKA 4LCUB 1B0GB 1DCLA 3FOMB 3NA9L 4LSTH 3RX8A 1T0MB 4UDUA 2V2XA 3QWQB 5FUOH 1BIHA 5ID0A 3HB3D 1Z3GL 4MXQD 3PDDA 4OLUL 1WEJH 4XWOC 3CFEA 3QQ4A 4D9LL 5CKAA 5MEOB 3RJQB 3O81A 3FQXB 1CDBA 2PXYB 5HSFA 2R29L 2YD8A 5I73B 1EEYA 2A74B 3ILQD 3O3BA 1LE5B 1DN0A 3S88H 1XGYH 3AS0A 3H2WA 2SEBB 4RWYL 3L3DA 4BZ1H 3MZTA 3M17A 3OTTA 1EDQA 3FO0H 3QJHA 1S5HA 4JRYB 1NGXB 1NGWB 4XNYL 3T3MF 5T33L 1FL5A 1W72L 4LARH 5BCAA 4RSVA 5HVFB 1OAKL 1A6VL 2Y36L 1A21A 4ODXA 2AAVA 1S7RA 4PRBA 4F3FB 1KIUA 5T1KB 4QOKB 3SDXB 4APQC 1VGKA 2V2TA 5FA4B 2R4SL 4RGNE 3NAAH 3JXAA 3TT1L 5HDBF 1MHPH 4UT6H 1FFNA 3ULVF 2YD1A 3MRFA 2BCKA 3MNZA 1N59A 5D7JC 3S3JA 4ZUSB 3OB0K 3SDDC 1DBBH 4RAUA 4S1SL 1S9KC 5IGXH 5GPRA 5IHUH 5D1ZC 3ARSA 3B9AA 4CNIB 5LVEA 4ZXBD 2VDPH 5DI8B 5DDHB 4G9FD 3CSYA 1UVQA 2C3XA 3NVQA 1KCLA 1KYOJ 3LS4L 5A1AA 4X0KA 2HT4C 4APQA 4P4RA 1D9KC 5BZDB 3C9NA 4YO0A 1XGPB 1ZOXA 3ARRA 4NC1C 1VGEL 1AQKH 3O6LL 4PJCE 1WFOA 1FGNL 3Q6FB 1N6QH 4X6CE 3KGRA 5D7JA 3TWCL 3NIDE 3SDDA 3RGVD 2H32H 3HLAB 4ERSH 5DYOB 5C9JB 3DSFH 4M7KH 3NH7H 3IB4A 3FCTB 3RIAK 3BQUD 5D1ZA 1C5CL 3IJYA 2E7LC 2YSSB 5L6YH 3I6LE 3HUJB 3LY6A 3A6OA 3VFUB 1SBSH 4GH7B 3T0DA 1QSFB 4WRLA 5FB8B 3U7YH 1OTTC 4LDEB 3KPSB 2CIKA 1D9KA 4F7PA 1VEOA 5J3HD 1FZMB 1J1XH 4ENEC 1BAFH 4WW1B 1VADB 5EU3B 3D48R 3QEQE 3ZDXF 1Z5LA 3UTPE 5BV7L 5L8LB 1U93A 3V4PL 2DQJH 3B9KD 2CIIB 4Z78A 3BWAB 5EU4A 1J8HD 3FN0H 5EA0H 3O9WB 4ODWB 35C8H 3UTTA 1OCWL 4HS6B 5I74B 2G5BB 4K3EH 1HNFA 3MCKA 1QA9B 3LKNB 2W9DH 3GMRB 4R4FL 4TYUA 3KPPB 1ZGLP 2VXQH 4LAJH 2EXWD 2PW1B 5FEBA 4GRWH 4XXDA 4P0DA 1FYTB 1WISA 2ZG1A 4JFEB 3GSNL 4J1UB 4FTVA 1JZ6A 2UWEE 1QBLL 4ODTH 2D0GA 4ZQKA 4MA1C 3QULA 4NZDA 2DKMA 1UCTA 1KT2B 5C0AB 1Q72L 3QPXL 1O7SA 3WCYA 4MJ6A 1FNGA 5LGJB 4UUJB 4OM0L 4WWKD 2VUYA 5LWYL 5EN2B 5EUKA 5T1LD 4DGIH 5E7BA 5GRVK 4NKMB 4L8DA 4OLXL 3ECBB 3V0AC 4F57H 1AR2A 4YIQA 5D5MA 5I1JL 1KEMH 5J56B 1QUNA 2VDML 5GSVB 2XWBA 4MA3A 5ESVB 2E27L 1RIUL 5D1XC 3CC5B 4W6XB 2QR0A 2RFXA 5IR1B 1P2CB 3MLSH 4JFOB 3GRWL 4ZS7L 1I4FA 1I9RL 3DVNA 3QQ3A 5GISH 4NKOA 3U79A 1MIEL 2AI0L 4RA3A 1R24B 2YUVA 4JN2A 4BFGA 1MRDH 3U9PL 5H2BB 1G7JA 4EI5C 2IF7A 4ELKA 4MX7A 3RWCB 1UJTA 3I3BA 4PJAE 4U1HB 2V5YA 2QQNL 4MCYB 3IRPX 5DRWA 4YDVB 5IHZB 2YC1A 1JTTA 2J12B 1T22B 1J88A 4WTXA 2VDRH 5JORB 2ZCLL 4DKEL 3EDFA 5DMJB 4C83A 3UX9B 3BRDA 1YEKH 4P4KD 4YHIB 3RDTB 2X10A 2PF6A 2ATPB 3QFDB 1CQKA 3KLAA 1MWAH 4OF5A 4JM2B 5D1XA 4RAVA 3GDBA 5EOQL 3QCTL 4IJ3B 4EN3C 5IQ7H 3KR3H 5DT1L 3QDGA 4D0BB 4MNQE 5K9QG 2BSRA 2EIZB 2IQAA 3TYFB 2YS4A 1I8KA 2OP4H 1V7NH 4G6KL 4EI5A 4ZFOA 5GRJL 1FJ1B 3RWEA 3B8SA 1K5NB 2NY0D 1P5VA 2XPGB 4G6AD 4LLWA 3WYRA 5CMAA 4HS8L 4OV6F 2VDQL 1DANU 4YHYB 1NSNH 1T1WB 3O4LA 4IOFD 1OTUC 1A9EA 2DLIA 3FB7B 5FHAH 1I7ZB 2Z4QA 3K0WA 1GGBH 3Q3GA 1LK2A 2ZJSH 1QOKA 1RK0A 4JY5H 4LLDA 4UIKH 5A2JH 5GZOD 3EO0A 4OIAA 5B8CC 2IANE 5EOTA 3QNXB 4HKJB 4JN1L 2EKJA 1MCPH 4N0CD 4EN3A 3MPCA 5C0GB 2HJKB 4CMMA 3QP3A 4HX1B 3ZDZE 2IH3B 4X6FA 2Q76B 1L4IA 3TO4D 2Y5TA 3EOYG 1S9VB 4P3CH 1ZSDA 3GMMB 3LN4A 4GO6B 4UTBH 1T0NB 1YC7A 1UWGH 1MH5B 1BFOA 1R3KA 4P2OB 3J7HA 4G42B 4Y4HD 4MXWL 4KUZH 4O2EA 1SY6L 1DUZA 5TPWL 5IF0A 1BQHG 4PG9B 1W0WB 4Y4KB 2KL6A 1TQCB 2BVYA 1U3JA 5B8CA 4Z7UA 1N4XL 3X3GH 1I3VA 1UT9A 3I6KB 4JO2H 2DWEB 7FABL 1Z2KA 1U8OA 3QUXC 3VU2A 1WF5A 1XF5A 1FO0B 5IVOA 2DWDB 5GS1B 1VACA 2YXFA 4XAWH 4PRPE 4DFHA 1JZ7A 3TYGH 1NC4A 2CK0H 1CXEA 3U48A 1ZHBB 4IRSC 1KTLB 2APVA 2DI8A 4LPYA 3IFOA 4RX4D 5T3ZL 1YEEH 1CBVL 3R06B 2B0SL 5HHVL 2EDBA 5SWSA 1D5XA 1TCRA 4UT9L 3V6ZA 3VXMB 3MJ9H 2ZPKH 4U1MB 2JCCE 1U8IA 2QQLL 3QUKA 3MRIA 1GAFL 2ZSVA 1Q9OA 4KJYB 1PG7W 3VWKB 3S6CA 5LAXA 3QXTA 1B3JA 3VJ6B 3BAEL 5J1AB 4WW2F 4J6RL 4OZFB 5JHLL 3W2DL 5C0RH 1XGUA 4JY6A 1KELH 1PKQB 4FQHA 1C1EH 1CDJA 4P3WA 3SQBA 2EXYD 5HYJD 1Y0LA 32C2B 2OL3L 3PHOA 3EYVA 5IVNA 4HF5L 1Q94B 4IRSA 5SWZD 3VXRB 3ZT5A 2CDEA 5MP6L 1GXEA 3GB7B 5F6HI 3N9GH 2FX9H 4E9LA 2NXZC 1JHTB 1P7QB 1RIHL 4XP1L 5KAQG 1EK3A 5L7XL 2Z8VC 2NXYD 1L7IL 2XWTA 1HHIA 5JIPA 4QNPF 5A16B 4FABL 1CFQB 5BVJA 4HJ0C 2XA3A 4OCNC 4Y2DB 2HG5B 1YEFL 4KV5E 3PWLA 4WENB 1U8JA 3GIVA 2IPUG 1XR9A 1QHPA 1FNEB 3V52H 4BQ6A 1EEQA 4AK1A 1DLFL 5DJ2B 1FG2A 2OR9H 3G5XB 5T3XL 1OOAA 5I76A 2FZ3A 4B53A 1YC8A 3RWIA 5H94A 4LPTA 1FFPB 3UDWC 5E5MA 2CQVA 2ZCHL 4WUUD 3BZDA 3S5LA 4H1LG 3MRNA 2R2EB 2I9TA 2AJVH 1NAKH 5KW9L 2GK0A 3NZHH 5CINL 2J3SA 1C5DB 4F15C 3QHTC 3RVTC 1YA5A 4KHTH 5KSAB 4PJBA 4WHYG 1OARL 3OKKA 1OPGL 1C7TA 5HHMB 2BOBB 2VUOA 5DLML 3QWOB 4N5EC 1RZ7H 1MRCH 4OD2B 4JG0L 4HIJA 1BX2A 2GTWA 1WBXA 5E1AA 4MQ7B 2O5ZH 1WFNA 3TV3L 3EOBB 1F4XL 1IGIL 4LLQB 4YX2L 4Y8AA 2X70A 5DMGC 3UDWA 4MD0A 4H0GA 1OLLA 4DN3L 1DQDL 1MCOL 3OSKA 4N0UB 3ZT6A 2Y1VA 4UINL 4IIQC 4OZHE 2VAJA 4I3RL 5DUBB 3ZL4H 2R23A 3CVIL 1DEEB 1I7RB 2CLRB 2ERJB 1KCVL 1YJDH 4MQXD 4ONHA 3KG5A 2YRPA 4Q9QL 4S1QH 5D7LB 5INCA 4OZIA 3FQNA 3UO1H 3U83A 5DK2A 2A83A 4U6VH 2ENSA 2B4CH 3LRHA 5C0JB 4HV8B 3ARFB 4LPCA 2R1WB 3RY6C 5FM8A 1ACYL 5E8PA 2DTSA 4LSPL 2AJZB 1XF4B 2B2XH 4RDQG 5D7IF 1KIPB 5E9DD 4P2QB 1A22B 2HVJB 4YAQB 4QHNB 4M8QA 5JUEH 3PXJA 1PQZB 1BQLL 3SDCB 3H42L 2KBGA 4QTHB 2ADFH 4G8IA 4IIQA 3D2UB 3S37H 4F7EA 1DSFH 4JRXE 3K2MC 2H1PL 3QA3B 1G7LA 4PV9B 1NAMA 4XP6L 4G7YH 4UB0H 1EAPB 1NLDH 5IT2L 1S7VA 3I3DA 3KJ4C 2ZCKL 3RY6A 2Q20A 4K55A 2BSED 1D6EA 3MACL 4FQIH 4PJFE 5IFJA 4F7CA 1QEWB 3O2DA 4RMQA 5CEZH 4G9DB 2WBJB 1CWVA 1HH6B 1NFDF 3ZO0A 2H32B 4M5YH 5ABDE 4LVOC 1BF8A 4KMTH 1BGXL 5IG7A 1G7IB 5DUPH 1Q1JH 1I7UB 1F58H 5MEQA 5I19L 1T04B 2J1KA 2W91A 3SBWC 3KPNA 5E94B 1NMBL 1DBKL 5TQ0L 2AV7B 5MI0B 2DJSA 2XTJB 4G3YL 4M1CD 3ULUL 3P0YH 4GS7C 1L6ZA 5EO0A 5GGVY 25C8L 3VXQB 4JDTH 2ZNWA 3UJIL 4NKIL 3BPCB 1RZIB 4FP8L 2IADB 3NPSB 1U0QA 5DD0L 1PX3A 3WKNA 3L3KB 1QLRA 2XKNB 5F96L 3UTSD 4Q2ZA 1HILA 3GMOB 5E8DH 4U0RB 3NACL 1KTDA 3DECA 3RQ3A 1U3ZA 5M95B 3EO1B 1K2DA 3PWJB 5BOZG 2ORBH 1YN7A 3Q5OA 4HIIA 1G9MH 4JREB 4L29B 3RZCD 4HH9B 3SBWA 4L4VE 5AZEH 3RWDA 2AXGB 5CCKL 2NX5E 4M8VA 5C0CE 1UWEH 2PNDA 4GRWB 1FIEA 5DEGA 4GW1A 1HHKA 3MJ7A 5GGVH 3DBXA 3V5DB 3MOQA 1DQLH 2VSCA 3EGSB 4M9OA 5ESQA 4A2LA 2R0LL 3CH8A 3EZJB 2FEDC 2IG2L 3FJTA 2AXHA 1GGTA 1VERA 4Z7WF 2QSVA 3SE8L 1YMHA 1I1CA 1CDGA 4FQQB 4JFXB 1OSPL 2Z91B 4QRSB 1H0DB 1OSZB 1IE5A 1MI5D 5JA8B 5MHSD 5C0BD 3MRMB 5IEKA 1U58A 2G5RA 3MV8D 1RJZB 1AGCA 4GAYB 1BM3L 4NO0B 1MVUA 2E7MA 5KS9F 4LRNL 1A6WH 2X4RA 3HI5L 3QEHB 1KENH 3CIQA 3QG6B 1OP3H 4BK4A 1MCSA 3VXOA 2QSCH 1DQJA 4L3ED 1E6OH 1F45A 1P4BH 3KYNA 3C5SA 1I1AD 3DX8A 4S1DD 3BDYH 3CCHA 1S5IL 2BVOA 3BVNA 3DMMD 5HVHC 3D0VA 4NZRH 1HHGA 2K7QA 2C3VA 1XGTA 3TVMC 4XAKD 3MUGA 1N5YH 5CEXB 2EKSA 3WS6C 2FGWH 1YZZA 1CLOH 3FQRA 3L6FA 1UM5H 3M07A 4XH2B 1PZ5B 1X5FA 2OI9C 1UKQA 2A9NL 4OFDA 3GSRB 5JDSB 4PJHA 5IB2A 1A7RH 1KG0A 3TJEH 5HHOE 4AQOA 1CLCA 1MWAB 1EEZA 4ODVL 3LQMA 3LQAC 1KN4L 4YDLC 5EZLB 4PRHB 3FO1A 1X9QA 1MFEL 3QDMB 2GFBB 4P59L 4XCFH 4DZBB 1LO0H 1CTNA 3TVMA 3WE6B 1C5BL 4O51A 5E2JA 4XMPL 4ONOA 3VI3E 1KB5B 3WS6A 1AXSB 2ZG3A 4EDXA 1AC6A 4XC1L 5FA3A 5I75C 3MGOA 5FYJH 2P45B 3MRDA 4MHHG 1NEZG 3NMEA 3ULVC 2JLLA 2JTDA 3OB8A 3GO1L 2NY2C 2GW5A 4S1RL 4HEPG 5EC2A 1H3WM 5EU6D 3TN0B 5HPOA 3BUTA 4ZUVB 4KI5E 3C8KB 1TVDA 4WFGE 4RFOH 3PL6D 3L3HB 3REVB 4HKZA 4CBPA 4GBXD 5C6TL 4I3SL 3D3VA 4X7FC 3RWHA 2VLRE 4W6YB 4M7LT 1I8MB 1JWSA 2IPUK 4BK5A 2UZIH 4X4MA 2Y72A 4K9EL 3JTSA 4UQ2A 1S7TA 4PLOB 1QFPA 1R5IB 5EU7C 4MD5A 5LBSL 3MLVL 4XP9L 2AK4E 5EG6C 4HIHA 2FO1A 1Y18A 2BX5A 3QRFM 3NCYP 3GBMH 2F15A 5D2LE 3OXSA 3PHSA 3MRLB 3H7LA 1EV2E 4EQ3A 5EIIA 2FL5B 3HAEG 4TPRH 4GJTB 4PGEB 3W0WE 3LQZA 1CFSB 3LVEA 2BRRL 3P9LB 4RMWA 2IAMD 4K7PL 4RQQA 3RTQD 1F90L 2F54E 4X4XA 5F7EH 2P5WD 2VN4A 1GCFA 3QG7L 3QEUB 1GZPB 1FZKA 2IALB 3MXWH 1YYML 5GJTH 3LRGA 2KDGA 4KKAC 4YLQT 1NGPL 5DMKB 4MCZB 2X7LA 1G7MB 4V2BA 2VIRA 2AK1H 4YHNA 1MFNA 1S7WA 4HWNA 4QTIH 1ITCA 4KK8D 4M62H 2BVUA 2Y06L 3A6BH 1SMAA 1FIGH 2DLFH 1Y6MR 4K8RD 4KY1H 3RWJB 1RZ8B 4QCIB 4U6YB 4JKPL 2BJMH 1J0IA 4L1HA 1CFTB 1MCHA 4KVCL 1X5XA 3SDXF 5C86A 4WUKL 1D5IH 4PGJA 3TCLA 3SKNB 3O0RL 4YDJA 4TOYL 2AXJA 1T66C 1N0XL 1YMMB 3QH3B 5ERWA 4QXTB 4FFVD 5DJZA 1C08B 2ESVE 4TUKL 4N0FB 4R8WH 5ALBL 1KEGH 4NQSA 4YHOH 4NIKB 3ARBD 2CMRL 1N7ML 1ZLVK 2L4OA 3LN5A 1UA6L 4ODUA 5FUCE 2VE6B 1Z9LA 5DJYB 4M7LL 1H9VA 5EB9A 2VL5B 2J8HA 4S2SA 5BVPH 4PBXA 3OB0H 1CIUA 2NY4C 4YBQD 2GSIB 3VFRB 3KWWB 4PGBB 1D6VL 1BF2A 1DQML 4NT6B 2NY6B 5E4EB 5E8NB 3LS5L 2C1OA 5IW1B 3VFOB 5HGAA 5HY9A 3TIEB 1U3HC 3V5HB 1X5IA 4XB7A 3WEXB 4PTUA 1QSVA 5F7HA 1N2RB 3IU4H 4M3KB 4P23C 5I71C 3CXDL 1QZ1A 3AC0A 2FX8L 4DVRH 1LO5A 1J0JA 3BP5B 3OX8B 2GJZA 5KTEH 4G8GA 5IP4A 1ADQA 4YXLH 3T8XA 5E5RB 2GITA 2R9HD 1AIFA 3HUJF 3HTLX 5L2KB 5LKNA 1I1FB 2GAZA 4DN4H 2VQUA 3BMWA 3PWVB 4OKVB 3WFBL 5DJXB 4AYFA 3EZ8A 1PKOA 3HMWH 4LBEB 2YPLB 4YDIH 3MV9B 3BJ91 4CN1A 1U3HA 1AD0A 2GJ6E 5FM5O 3N1PC 1YDPA 5DRXA 1WC7A 4M7JL 3ZT7A 3MLTB 1CLZH 2EH7L 2Y6SC 3GMLB 4P23A 4WEBH 1B4RA 1IEAB 4XPHL 1NUNB 2F53E 1WT5C 3JV5A 2GTZA 3Q0HA 2EECA 4I18C 3QUMA 2F74B 1LILA 2FD6L 2YBRA 1KIQB 3GI9L 1KJ2L 4DKDC 4C56A 2DQUL 5F9OH 1A1OB 3WUWB 3NCJH 4U1SB 4OZGE 5AZ2L 2BNQE 3TJHC 2P4AB 4FQXC 1T03L 4G6JL 4QXWA 3SN6N 3QEQD 5D8JH 3UTPD 4AEIH 2A9ML 3VXPA 3FT3A 3MJ8A 4PGDB 4UILH 2LABA 3QUYC 2GI7A 4AIOA 2BSSA 2VAAB 4EVNA 2CUMA 1G7QA 2WMPA 4D94A 1D5ZB 2X4PA 4AZ8A 4GRLD 5FO8B 1WT5A 2CDFB 3MRKB 3VH8B 4V1DA 1XGQA 3MLWH 3VGFA 4I18A 2C4FT 2X6MA 2PR4H 4RAHA 1MRFL 3LKPA 3MBEB 2OSLA 2QHRL 4OFPA 4YZFE 5EBLB 4KXZI 2GIYA 4O00A 5ID1B 3BEWB 2DQGH 8CGTA 4FQXA 4K3DH 5GSRB 3MOBL 2J5LC 3BN3B 1G84A 2RB8A 3QUYA 4F9LC 1A5FL 3BT2L 3CX2A 3LV3B 2XRAH 4NBZB 2J8OA 1E4WL 2AJ3B 3BEVA 4HPYH 4KK5D 3K3QA 2X4QA 3ROLB 4R7NB 3CLFL 5KN5A 2XICA 2I5YL 3IU3A 3WO4B 3BXNB 5KVMC 4KQ4H 3PJSB 1EFXD 4ZSOE 4OJFH 3L1OL 3MODH 1KLGB 2N56A 1A2YB 4GRMA 1JGDA 4Z7VB 2HVKA 4GAGL 3QCVH 5GGTL 4MNGE 2MCPL 4GG6E 2CLVA 1A1NB 1QFHA 1JF6A 3B4NA 2BNRA 1AE6H 2GQHA 5DR5H 3L3IB 4JY4A 4ZYKB 1BPVA 1UXSB 4CN6A 4JDZA 4OLWL 1FN4A 4PJ5B 5TDNB 3RKPA 4F9LA 2Q8AL 4BYHA 4LPXA 4YHPA 1MY5A 3H3PL 3TBSB 4KWUA 5AUMA 3RVVD 4S11A 1R3HA 5I15H 1INQA 3DROB 3M1BA 3HZKB 4FMFA 2J6EA 1B2WL 1LP9B 4WW2C 4YHLL 4TTGA 4JHAH 3RVXC 4NO2B 3A67L 3B9VA 2FO4A 1AGDA 4O02H 4FZEH 2WP3O 4P5KB 5E5UB 2EO9A 2HA1A 2BVPB 3DETD 3WUZA 1JZ2A 3IDNB 3RL1A 1UB6A 4LCWE 1U92A 4MNQD 1RMFL 3SE4C 3WKMH 2YXMA 1S7UA 4L3CB 1U8KB 4EJ1C 1X6LA 1HH9A 2NR6C 3MXVL 5MEPB 5T1MB 2R2HB 1SVZA 5CJOL 1NCBL 4BUGA 4E41E 2Z31C 5LGHH 1XZ0A 4HJGA 1MCKA 4Y4FD 4QHUB 2HJFA 4AQ1B 1UZ6F 4PJEB 1QFWL 4MNHB 1N3NB 5DK0A 2Q87A 3S88L 4NZUH 3QFJA 3H9SD 5I16B 1WBZA 3PGCB 2RCSH 4WW2A 4JFDE 2X1QA 4PP2B 5KZCB 4EKXA 3LPFA 4LSUL 2MQCA 4N0YH 5I1LB 2FSEA 5D2NC 1BJ8A 2AKRA 4RISH 1V7MH 2AJXL 3RAJH 3OKNB 3WIIH 4NM8L 4X6BB 1AKJA 5L2JB 2Z31A 3O2VH 1V3MA 4L3AA 3BPOB 3RA7H 5B4MC 4UT6L 3U46A 4RZCA 4ZFFB 1IZJA 3TZVD 3DUUB 3GJEB 1YUHB 3UPCA 2D4FA 3OZ9L 5FYKU 2UZYB 2W0FA 2NY1D 2AJSL 4NHUB 4N1EA 5I1HL 5KVGL 1BWWA 4KPHL 1JHKH 3LEXA 2ATKB 1HINL 2CXGA 4MD4A 2ZUQC 1NJ9A 2J8UE 2VLJE 4K2UH 4MXVE 3ZKXC 1E4XI 1JNNL 1LDSA 1CF8H 4N9OB 1FE8H 5HYQA 4LLYA 5D2NA 12E8H 2IFFL 3OXRB 4QXUL 3MV7A 2ZOKA 4HMDA 2JB6A 1K4DB 3GIZL 4PRPD 3C6SB 1JGEB 2VLKE 6FABH 4U1JB 1TVBB 3CMOH 4JDVA 2XG4A 4KUCF 3ZE0F 5I1KH 4X99B 2YMXH 2VXVL 3ROOA 2X9XA 3EHBC 3Q6GH 2EDLA 2YKLL 4U3HA 4Y2OA 1AQDB 2HFFA 3HNSL 4JM4H 3DVFA 1JZ8A 5HVGB 1BEYH 1PY9A 2DYPB 4XZUA 4W4OC 3ARUA 4DTGL 2L7JA 5JR1L 3BW9B 1VKXB 4M00A 5DRNB 3NH7L 1BZ9A 4AH2A 4I2XB 3JWDL 4G5ZL 5C07B 4NNXA 5MENB 4PJGE 1HSAA 1IGML 5J13C 3CSPA 5L6YL 3S9DB 3P9WB 1CD0A 1SYSB 2X1WL 4GSDH 5F1KC 2HKHH 2E9IA 1HHJB 3CFJA 4PLJD 1FL3A 2ARWA 1LEKA 3X14A 4LIQL 1OAZH 1IC1A 2GCYB 1QYGH 3D39B 5HYSB 1J1XL 1CE1H 3PF2A 4LLUB 5I8KH 4Y16C 4YQXH 2LQRA 4FXKB 1JGLH 3ORJA 3JWOC 5EH1A 4D3CL 4LGRB 4UDUB 2V2XB 4S0TD 4W4OA 5ID0B 5D7IA 5KJRL 3CFEB 4GMTL 1HKLL 2IBGA 5BZWA 3QQ4B 2WQRA 4M93B 5JZ7D 2FWOA 3RUGF 2R8SH 1DBJH 3PWUA 4HKBA 2D31A 1EEYB 2N4IA 5EULV 3O8XC 4F7TA 2VXQL 3O3BB 3ARGB 3L9RA 3B2VH 4XWOD 3RVUC 2XI9A 2YD6A 3L3DB 2F8VA 3M17B 3P4NA 4I4WA 3ZDXE 3QJHB 4BZ2H 1NBZB 4OFKA 3KXFA 3O3AA 4X4YA 3TA3A 3D69B 2DBLL 1CU4H 2ADIA 1FL5B 4NJAL 4M43H 2QKIA 4FFZH 2ICWA 4Y16A 3HC4H 3WFEH 3AXLA 4OCXH 2UV3A 4KROD 4ODXB 3JUYA 1S7RB 4PRBB 1MCIA 3ZE2F 1VGKB 4PJDA 2V2TB 2EZ0C 1NFDA 2EYSA 4R3SA 3AREC 2P8PB 1A7NH 3GHEH 1DLHA 2R1YA 2Y07L 2K9UA 4R9HA 3S4SG 3DXAA 2BCKB 4G8GE 4APQD 4F33A 3MNZB 1I9EA 1N59B 1W0VA 1UENA 1F4WL 4RAUB 1QSEE 4DJMA 4HKXA 2YEZA 5I1EH 1KLFA 5CZKA 4CVXA 3SGEI 4JO1L 5J9PB 5EZIH 3DRQA 1EO7A 4ELME 4TRPH 1RUQL 4BKLA 3SDDD 3CSYB 1UVQB 2CRYA 1RZKL 3M8OH 1EAJA 1NAMH 4AM0A 3C60C 2A73A 5D1ZD 4P4RB 2CJUL 4JGUA 4YO0B 3L5HA 1SJHB 3AREA 2ZZUT 3MRJB 5DSCA 1MWAL 1HZHL 4KKBC 2VXSL 3KPRA 3QIWC 5D7JB 3V6OC 2Q3ZA 5T1DH 3HZMA 3MRHA 2PKDA 1A7QL 5JQHC 3LKOB 1ZHLA 1I1YA 5E70A 1NC2A 5D1ZB 3SPVA 3IJYB 1RULL 1QLFA 3QBTB 3EYSH 2OP4L 3EKCA 1KB5L 4JRXD 4OT1L 1NLBH 4S0SD 4QRRE 3RFZC 1TJGL 2P8MB 3CVHL 3C60A 4Z7WA 1ROWA 5IVZA 2CIKB 4N68A 5FOJA 1D9KB 4PJ7F 2QSQA 3V6FA 3DV6A 4EDWL 4F7PB 1N64H 3TLRA 4YEEA 5KVEH 1ORSA 5DVLA 1TJIH 4M5ZL 1L9MA 2LTQC 1CGYA 3C5JB 1KUMA 1Z5LB 3QIBC 5AD0B 3QIWA 3V6OA 5KS9A 2ADGA 4Q9RH 1MCPL 3P77A 3GMQA 4Z78B 3MRCA 2LU3A 1MCCA 1MFDH 4RMTA 2AJUL 4LEOA 3ZHKA 3UTTB 4EOWH 3AB0B 3PQYA 3CH1B 3MCKB 1JCKA 1FNFA 2ILLA 2ZUXA 4OB5H 1UWGL 3QZWA 2NY3C 4Z0XA 3RBSA 4MWFA 2OR7A 2OQJA 4N90E 3BDBA 5I18H 3CNKA 3NCEB 3BN9D 3VWJD 1IGTB 4JJHA 4FTVB 3I75A 5DD1L 3LOWA 1AP2A 3RJDA 4OD3H 5ITBH 1LDPH 3DTXA 3QULB 3QIBA 4I0PC 2CLZA 1CXHA 4Z76A 1OT1A 2I26N 4HIXH 1AFVH 5C70A 3PWNA 4PRIA 1NCCL 4MJ6B 3WFHB 2COQA 2LU4A 5JHDE 1X4ZA 4RGOL 1N26A 5EUKB 4L4VD 3UJTL 2HLFC 3SDAB 1HNGA 2IPTH 4KJQC 1IM9D 4L8DB 1TIUA 5C0CD 4YIQB 5D5MB 2F58L 1DL7L 4MA3B 1BD2E 2BC4A 1YEHL 4K71C 5I9QC 1QR1B 1T5XA 3KYMB 2RFXB 1UQSA 3MJ9L 2D4DA 1I3UA 4WU5A 2GJJA 4JQVC 1CGSH 3G9VA 3QQ3B 3TPUA 4WJ5B 4LMQI 4JN2B 5L9DH 4XCNB 4L9DA 1FNSL 4I0PA 4OD1L 3KPTA 3RWFA 4CW1A 3N1MC 3GZKA 1UYWL 4ELKB 1F97A 4MX7B 4U1NA 4N5UA 3U4EB 1MJ8L 3KJ6H 4KH2A 2NZ9D 3RX5A 4OTXH 4Y19E 3UYOD 3R4DA 4PS4H 4B7IA 3GJFK 2YPVH 5AYQA 2GY5A 5F44A 4RNRA 4UOJA 3KLAB 1CS6A 3B6SA 4K8RL 4JANA 5GGSY 3IT8D 5F1NB 5D1XB 3EYUL 5C3LD 4RAVB 4KRPC 3L3OA 4XPAH 5HTSA 2NTFA 4LSQH 3PDOA 2DDQH 4JQVA 3FONA 1R5WB 3QDGB 5I6XB 2BSRB 1IGFL 2IQAB 4XC3H 3X12A 1I8KB 4EI5B 1GC1H 2CKBA 3FO2A 5I30H 1B6DA 3I84A 1B0GA 3FMGH 3GJFA 4CVZA 4EN3D 3FOMA 1YNLH 2FH6A 1VEMA 3RWEB 1HYSD 4Z8FL 4LLWB 1T0MA 5CMAB 4WI7A 5IIEB 3TGXA 4Q9BA 3O4LB 2NW3A 4NP4L 4XVTL 4LNRA 5HHOD 2Z4QB 3Q3GB 2EDQA 1RK0B 4LLDB 4XB8A 2A74A 5LXGL 1LE5A 3LQAH 5I1GH 4I77L 4DOHE 5EOTB 3S36H 1F6LL 1IC4L 5I8EA 1UADC 3K81A 4H25A 4HK0B 4CMMB 4X6FB 2B1HH 2Y5TB 1MRCL 3ARDC 1NCWL 1Q0XL 1KCUH 3EFFA 4FG6D 2OBGA 3LN4B 4M1DH 3TC9A 1U8LB 1XFPA 4B7LA 1BFOB 1T1YB 1JRHL 1R3KB 2XZZA 3MV7E 4HXAL 3W11C 2GEEA 4F3FA 2P47B 3SDXA 1B4JH 4O2EB 4NBYB 3T2QA 3HFMH 3I9GH 4KI5D 2XZAH 4OM1H 4WFGD 3WNOA 1ZEAH 4PR5B 5B8CB 4DQOL 2VLRD 3SJVA 1U8OB 1MFBL 4OLZL 4S1QL 4ZUSA 2P5EB 1XF5B 1ZVSB 1FP5A 2AGJH 1PFCA 1VACB 3VRLF 4AMKL 5D1QC 5JPNA 4RMSA 3ARDA 4UNUA 1JUFA 3RVWC 4K23L 5DDHA 1NC4B 3PP3K 4N1CA 3BP7A 3IFOB 5AWNL 1I9JH 3UBXB 5SWSB 2D7MA 4KDWA 4DGVL 1U8IB 3EDKA 2H6PA 2WSKA 5B3JF 3WXWL 1PJ9A 3QUKB 3MRIB 4IRSD 4P2RB 2ZSVB 1M4KA 4HCRL 3Q6FA 3W0WD 2V9RA 2NPLX 5JPMA 4R90H 3BFOA 3QUXB 4JVWA 4HWEH 3T77B 3HLAA 3HNVL 3VI4F 1XGUB 4JY6B 4G7YL 5C9JA 4FQHB 5D1QA 4QXGL 2ZP0T 4U6TA 4FQJH 1Y0LB 3EYVB 2YSSA 3HUJA 4U05A 5ICXA 4NQDA 4KKCC 3VFUA 5T3ZE 2E6JA 3BRFA 1ZS8A 2CDEB 5FB8A 4H8WH 4OLYH 3QDAA 1F3DJ 4R4NC 4F8TA 5BVJB 4ZD3L 2DLEA 1FZMA 2DJUA 1AO7B 4LVHC 4WW1A 4KMTL 2AW2A 3PWLB 3WJLC 5ICYA 1U8JB 1HXYB 3GIVB 1MFAL 1A64A 4M1GH 5EU3A 4KJPC 4JPIA 4M6NH 1KACB 3QEGL 1JPFA 2PO6D 1MQ8A 5JA9A 1FDLH 2FZ3B 3ABZA 1P4IH 3P0YL 2X42A 5H94B 1ZLVH 4HS6A 5E5MB 3S5LB 4PJDE 3ZTNL 1AI1L 3MRNB 2VL4A 3MROA 3GMRA 4Y1AE 4YR6A 5I8CA 2I9TB 5GS0C 5F9DC 2PW1A 3W82A 2NXZB 3G6JF 5I1IH 1FVDB 1Z9MA 1ADQH 2YK1L 4XPTH 1EGJL 4LSSL 4JFEA 4PJBB 4CDHA 1ZTXH 3W39A 1ODAA 3OKKB 4J1UA 2YHGA 3F7PC 3L3JB 43C9A 1IT9L 3CMGA 1V8HA 4HQQH 1J11A 3WJLA 5FK9B 1YPZF 4HWBL 2KZWA 4ZNEA 3VW3H 1TQBB 1MEXH 1HQ4A 1BX2B 1WBXB 5E1AB 5HHXL 4F7MA 3QHZL 3T0EC 5FCUH 5IESH 1UWEL 1MQKL 3GBNL 4N5ED 2R4RL 1OAXH 4MA7L 3GSUB 3O3EB 5ISZE 5B21A 1IQDA 1BZ7B 2OJZL 4J4PD 4NKMA 4FQCL 1I1RA 3MLUL 4OQTA 2BFVH 1RHHA 1WITA 1I3RA 2RGSA 2IEPA 2R23B 4WV1C 3QUMH 4F15B 2X4UB 4GKZB 3CC5A 3FAXA 5INCB 4OZIB 5E2WH 3BPLC 3FQNB 2J7LA 4OFYA 4X80H 4HD9A 2A83B 5DK2B 3VFNB 4XPBH 5IK3A 5DVNA 4FFYL 5IBTH 2VZTA 5C08E 4D2NA 5H2BA 3NCBB 5E4IA 5E8PB 2WM0A 3RWCA 4U1HA 2ED9A 3T0EA 1T7WA 1HCFX 1WLHA 2GJ6D 2YUZA 1SEQH 5IHZA 4YHYC 1FBIL 5JORA 3KVQA 3G5YB 2JKXA 2F53D 3SKJH 3TM6A 1LO2L 1AXTH 3BMVA 2ATPA 3QFDA 4G8IB 1S7QB 2XQYK 1J1PH 4WV1A 3D85A 5C0EA 2I60L 3WS3B 1EX0A 2YD4A 3G6AA 3QI9C 5GGRA 1RZFH 4EIZC 3CFCL 4X9IA 2OJEA 1G7LB 1NAMB 4RGMC 3UYPA 2BNQD 5B39G 4D0BA 4LOUC 1A7BA 1JHLL 3PQYE 2NY7H 5K33A 1IBGH 1D6EB 4YK4C 1NCDL 1S7XB 4QRPE 4F7CB 5IFJB 4G8EA 4P2OC 1U8HA 2PTVA 4HLJA 4L8SC 1WAAE 5CBAB 1T1WA 4Q7DA 4LHUG 1G9NC 3CFIC 4ZS6C 4XVJL 3TBVA 1X5ZA 5IG7B 1GSMA 2FRGP 2X89D 5MEQB 1HQRB 3KPNB 3WIHA 4XMKL 2MHAA 2AJYH 3MYJA 4X9HA 2IH3A 2DD8H 4BJLA 5F7YC 1RFDL 5EO0B 5C0DB 1DBAL 5GRUL 5A40E 3NFNA 4Z7VF 3C6LD 1K4CB 4KDVA 3SGDH 4WO4D 4P2OA 5D71L 1FFOA 1FGVH 4HQQL 4G42A 4QRUA 1S8DA 2APFA 4Z0BL 3O6FC 1KTDB 4DK3A 2J88L 2EE6A 3C08H 2HJLA 3B5GA 2J6EH 4LVOB 1ZA3B 5F88A 3MREB 1G6RH 1B6UA 1NMAL 3ET9F 5F89A 1YN7B 1JRHI 8FABB 4HIIB 3CZFA 3VWKC 3LH2L 1GHFL 4JPVL 3RWDB 2DWEA 3A0OA 3AS2A 1T2QH 4NGHL 5B38A 5DEGB 4K94H 5GS1A 4GS7B 2F5AH 4GW1B 1HHKB 3S35H 3I3EA 3DBXB 1EHLH 3I6GA 3J8F7 3NBNA 3IDIB 4Q6YA 5EU5A 1A7PH 3EFDL 3OG6B 3MMEB 4WIQA 5ESQB 4KTDH 5GS2H 5KVDL 4NN7B 1YMHB 3O6FA 5BO1H 4TPRL 3VXMA 2QBWA 3B8YA 2XNAA 3PWPA 4F37F 5FHBH 4YUEL 5JXAH 3I85A 5DRZA 4XCEA 1AGCB 2FIRT 1IKFL 2EH8H 3P4LA 1MFCL 3EYOA 3VWKA 4NZTH 5BRZE 5IM7A 2XA8L 4LCWD 4J3TA 2HT3C 4OZFA 4C4KT 4PJIF 3VXOB 1ZLWK 4K3JH 1PKQA 1DQJB 1MCBA 3FZUD 3INUH 5GJSL 4X7DC 5IB1A 1D5MA 5CEYA 4E41D 3DYOA 3DX8B 5L88L 4PB0L 3CCHB 2APWA 1HXMA 1O0VA 3B3IA 1R6VA 1HHGB 2C3VB 1XGTB 3EDDA 3MUGB 2EKSB 2BJML 2LE9A 1PLGH 2NY5C 4LASL 1FFQA 3IDXH 1IEBA 2NTSP 1KV3A 1JNLH 1EBAA 1DZBA 4WTWA 2IH1B 5IVXF 1CFQA 2HG5A 3BH8A 4JRYE 1MIMH 4JR9H 1OWRM 2VXTH 2Q86B 4PJHB 4KK6C 2EDWA 3LRSA 5IB2B 4LGPB 4L9LC 4FRWA 1KG0B 3B2UC 1NKOA 2O5XL 4DKFH 3EYQD 1EEZB 4XBGA 3V0VB 4E0RA 4HZLA 5C09A 1SQ2N 3HAEH 5DJ2A 3G5XA 3FB8B 1J0YA 1ZLUK 4QOKE 4WCYL 3SDXE 4DUVA 5HVHB 3U7AA 3S96B 3LMJH 2R2EA 3HNTH 3TVMB 4O51B 5DA4A 2X4TA 1JBJA 3E8UL 2CDGA 4XVUC 1PSKL 1F11A 4EDXB 1T21B 3E3QE 3RUGA 5IBLD 2R39A 5FAAA 3MGOB 1S3KL 5J6GA 2OI9B 2W65A 3MRDB 3GMNB 2BSTA 2VLJD 5EZOL 4MVBC 4RGNB 5FKPB 3L95B 3V6BR 5HHNA 1VFUA 3THMH 3OG4B 2OTWB 3NIFE 4MQ7A 5F6IC 5EBWA 5K9OA 1QFUL 4YDLB 5GGSB 3ULVD 3EOBA 4HKZB 4JPWH 5KTEL 4YGAB 2C4XA 3D3VB 1EZVX 3HHRB 5D72L 2VLKD 3DYMA 3LB6D 1JI2A 4FQ1H 4N0UA 5C0ND 1SJEB 4NJ9L 1E6JL 1W72A 1RHFA 4UBDD 3JTSB 3EO9L 4UQ2B 1RIVL 1I7RA 3HI6H 3IKKA 4HGMA 5I75B 4MD5B 3UEZA 2DKSA 1KCSL 5D7LA 4TSAH 2WK2A 2HT2D 2ZWLT 4XWGL 2VXUL 1Y18B 1AJ7L 3OKDA 1OAYH 3OBAA 1PBYA 2NY2B 3NA4A 2PW2A 3OKMA 1IILE 4TVPE 4IM8A 3OXSB 3WDIA 3BDXA 5E6ID 4BFEA 2AJZA 2FB4H 3HUJE 1YY8A 2YZ8A 5A3ID 4PREB 5JTWA 3VFVA 3GK8H 1QSFE 4XVSH 5EIIB 5JMOC 4YXKH 4LCYB 4KC3B 4YAQA 3KPSE 1U36A 3LQZB 5DO2C 1TITA 4QO1A 2AEWA 1KC5H 4RQQB 4A6YL 1KBGL 4X4XB 4QTHA 1JVKA 4TSCH 1FZKB 1CLYH 4HEME 2HTLD 5FYKE 1FZOB 2EDHA 1YY9C 1WZ1L 4NWUH 1A7OH 3VXUA 4HFUL 1HSBA 5HDOA 2VDLL 2VIRB 4LQFH 2CPCA 4EXPX 4YHNB 1S7WB 2XTJC 2CR6A 3IFNH 2BHZA 4NNYA 4GQ9H 1I9IH 1VB9A 1KN2H 2R69H 3TO2A 1JFQH 3B5HA 4G9DA 2DMKA 3IFLH 3DX9A 3G08B 3TCLB 3ZKNC 1BZQK 1SM3H 1FYTE 3SOBH 3LKSA 5EUOF 4YDJB 2H32A 4JFEE 4I5BA 2PCPB 5E2UH 2P44B 3UZQA 1M6OB 1YNKH 1T04A 4NQSB 3N1FC 4PJ7A 2GT9B 5CILH 5ADPL 4U3CA 2AV7A 1PAMA 3FT4A 1BVKA 2EIDA 4UT7L 3ALWA 5C0AE 3LN5B 1JPSH 4GG8A 4HPOL 2XKSA 4ODUB 3VXQA 1ZA6A 3BKJL 4S2SB 2DLHA 4ZNCD 1PG7L 4ZAKC 3B9DA 5HHQB 4JQXC 4G8GD 2AS5M 1Z0NA 4B5EA 3WSQL 2V2WA 2G60L 2XQBH 4TNVK 43CAA 3DURA 2C1OB 3TFKC 1QSED 1BBJA 3WD5L 1QKZH 1A1MA 3PWJA 1Q0YH 5TE7H 2VISB 3F7YB 2FHCA 4PTUB 4BQBA 2WWMC 4OCSL 5GRYA 3DNKA 1AH1A 3SE9L 1IGCL 5SX4H 3MJ6A 1F2XK 3IXAB 4ZFOL 4NWTL 1N8ZA 2GJZB 3BKCH 4RMUA 3T8XB 2E7CA 2GITB 4WI2A 3GSNA 1AIFB 2NY4B 2GAZB 2DAVA 2ZKHL 2HTKC 2VDOL 4JQXA 1INEH 4HS3A 4FZEL 1CVSC 5LCVL 4JFXA 1MJUL 1H0DA 1OSZA 1U3HB 2DI9A 2XXCB 3SCMD 1YDPB 3MOAL 1WC7B 1RJZA 3LEYH 3RIAF 3VXSA 4AEHH 1MUJB 2DRUA 5J1SC 2HFGL 1LO3H 1T0PB 4P23B 4KMLB 3VFWA 1VPOL 4QRRD 2GTZB 4ODSL 2DS4A 4MHHI 3GFUA 3QUMB 1XIWC 2YBRB 1F4HA 4HUXB 2ICWJ 1M7DA 2Q6WB 4X6EB 1RU9H 3MUJA 4C56B 1INDL 2D7TL 5FYJU 4QHKJ 4RIRB 4V1DD 4WGVB 3DX7A 4YHMH 2ICEA 1NCTA 4LSVL 1R3IL 4R2GC 3VXPB 1VFOA 3MJ8B 5DEFA 2XN9B 2MPAH 4RISL 2NQCA 2BSSB 4JZOA 4EVNB 1UZ6E 2MQ0A 5J12C 4FQXD 4GMSL 1G7QB 3PP4H 4LSRL 3GSRA 2WBWB 1DFBH 4KRNA 3TNNA 1EMTL 3DIFA 3O2VL 2KQMA 3F12B 2DL9A 3TN0C 2FNBA 1XGQB 3QUYD 4I18B 2IMMA 2XZCH 1LO4H 1XIWA 3NN8B 4DUXA 5T5FL 4ONGH 1MLBA 1U41A 4N90D 2HMIC 1KTRL 3QDMA 3UTOA 2P42B 1A0QL 3V4UL 3WE6A 2VH5H 2MJWA 2DIJA 3O11B 5F7KC 4XBPB 3LZFH 2VDKH 1G7PA 4XCCL 5CUSL 1IAMA 1IGJA 5CZVL 3K80A 5IFAH 5DFVD 4L5FL 1QFWM 2DQEH 1QBMH 3LEVL 5JHDD 2V5SA 3TBYB 3BEVB 4J7RA 2X4QB 3VA2C 3NFSL 3QHFL 4J3UA 3TN0A 2VZVA 3CMOL 4ZUVA 3BKMH 3T3PE 1BD2D 2KPNA 2E3VA 4L1DA 1GGIH 1ZANL 5I1KL 4H20H 3P4OA 3SEPA 5FF6A 3Q6GL 1JGDB 1UM4L 1RUAH 2HVKB 4BFBD 5DJ8A 2FBJL 5DHVH 5C2UB 3PHQA 5IW6A 1FV1B 2V17L 1I8MA 2CLVB 3ARWA 2BNRB 2Q8BL 4GOSA 1MNUL 1UWXK 4OIIL 1A14L 1R5IA 2EICA 4JDZB 2J5LB 1FN4B 2CKBH 3GJFH 3RKDD 2N1KA 5K9JH 1BBDH 1L0QA 3F7QA 5HI4C 4LHUD 3ES6A 5JW5A 3ZE0E 1R3HB 1PKQE 1SY6A 3M1BB 5FGCE 1TMCB 1MCEA 1QNZH 2ZNXA 1IEHA 2OK0L 1CZ8L 4JO4L 3VGHA 4D0CB 3OWEA 4JHBA 4PLKC 1KJVA 2VR9A 3VXRE 1IAKA 3HZVA 2FO4B 5F3BA 3KPOB 1IMHC 5C0FB 4PGEA 5DD5L 1CFSA 1UB6B 3P9LA 1GYAA 4FQ2H 1ZLSH 1DN2A 3RVXD 5J6HA 1S7UB 2A6IA 1HH9B