1BIIB

The crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MHC CLASS I H-2DD
publication title The crystal structure of H-2Dd MHC class I complexed with the HIV-1-derived peptide P18-I10 at 2.4 A resolution: implications for T cell and NK cell recognition.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (mhc i/peptide)
total genus 15
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1998-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1biiB00
3BN3B 1X4YA 2BVOA 5MHSE 4PJ7E 3QH3B 5ESQB 4EIZC 4JFZL 2AEQL 2EH8L 3PE9A 4MXQD 5CCKL 1EK3A 2VZ3A 4MNGE 2PXYA 4YK4C 3RGHA 5I1HH 3WS6A 2OS7A 1S7VB 2FHBA 3PWVA 2Q7YA 5HGAB 4L4JA 4UT6H 3W39B 5DUML 1DLFL 3OG6B 4HW6A 1RI8A 4EN3B 5E2TH 4MDIB 1MFBH 3CLFL 3IU4L 4DZBA 3IU3B 3P73A 1A2YB 4UQ2A 1ROWA 5BS0D 3ZKXC 3W11D 3DGGB 3DX6A 4QOKD 1YYML 2F54B 1IKFH 1NMCC 3VG0H 1YJDH 3GO1L 4P3WA 4YHKH 5DFTA 1X7QA 4EI5A 3OKMB 4HIJA 4HIEA 3FKUS 1X5AA 2BP3A 5IB4A 5JHDE 3S88H 1IL1A 3T65B 5E6IC 3U4BL 5I1EH 1DQQA 3GSRB 1Q0XH 4YDVB 3IS1X 2E27L 2XZCH 2NY6C 5FO9B 4FS0A 3QCUH 1Z9LA 4IRJB 4YX2H 4XPFH 3B9KA 3W9DA 3OR7B 4F15B 4DGIL 3KPQB 1N6UA 4M6OH 1PG7W 2E7BA 1R24B 2WUBH 2HLAA 4GS7C 5I71B 3T0DA 3UJIH 1YECL 5I8CB 1A3LH 2R1WA 3UBXB 4JDZB 1NCCH 3E6FA 4HUNB 4XWOC 1MNUH 1QSEA 3GSNA 3RDTC 2QEJA 5CHNA 1BLNB 3HMXA 2H2SD 3FT4A 3FB8B 4L5FL 4EDXA 5L8JB 4AT6B 2A9MH 4OIIH 1A7OH 2R2BB 2XZAL 4QYOB 5GJTH 3BZFB 5B22A 5DXWA 2FL5B 4B41A 4N0FB 5CJBA 5KOMC 2NY0C 2P5EA 1XGTA 1CDBA 5HYJB 5FEBA 4WWKD 4G6JH 2FYYB 2YZ8A 1CGUA 1FJ1B 1T7ZA 1YZZA 2CIKA 3OKLA 4KVCH 3VWJD 3WHE1 1UA6L 2X4OB 3IRPX 5I75B 1NC2A 5D9SB 1BVLB 4UDUA 4NZTL 1E4XL 2OR8A 4P23C 3VFPA 4NSKA 4PP2B 4PS4H 2LAGB 4XBGA 4ZUSA 1IZJA 3JXAA 1LGVA 3QULA 1MJ8H 4R7NB 5E94A 3LH2L 2NZIA 3GSXA 4FXGB 1HILA 3BPOC 1AY1L 1ZSDA 5GS3A 1GHFL 2D9QB 4CVZB 1EJOH 2NYYD 1YUHA 4M7JL 4U1KA 4OT1H 4YFLF 5CWSA 3QFJB 4LF3B 3ECBA 4M6NH 2DQUH 4Z7UB 3FO2A 4HFWA 1QSZA 1ZHNA 5KSAA 4OCNC 1FZKA 4XMPH 5F7HA 2OI9B 3D39E 3VFOB 3R0NA 1K8IA 4QXTB 3RJQB 3BP6A 1T0NB 4NKDA 2OX5A 2ZOLA 3PHQB 4GUPA 3VXSE 3IFNL 1IKNC 1ADQA 1K6QL 5MEQB 1YN6B 4P4KA 1MFDH 4PYGA 4Y4KD 5DHYB 2N7BA 2NX5A 3EZJB 1N3NB 2IPTH 2IFFH 1U2HA 3MLVL 4XBPA 3PQYE 5HI5D 3MJ7A 3I84A 1UEMA 1A8JH 1I8LC 3QEUB 1GYAA 2VERN 1HH9B 3TIEA 4IRSD 4URTB 4TTDC 5T1DL 3M07A 1DQLH 1W2KT 4FHBD 3VA2C 4EVNB 2VDPL 2F53B 3DXAA 4ODXB 2BMKA 4OI9A 4PD4K 4LP4A 1KIPA 4XVUC 3BJLA 3ZTJH 5D7LE 1IC4L 1GIGH 1B90A 4MAYA 1JWSB 3LQZB 3ZTNH 4TPRH 4FQLH 3MJ6A 1KPRB 1FG2B 3IS0X 1T3FA 3BH8A 5I1CH 4P3CH 2I9LA 4XRCA 5JZ7C 1JHLL 1DQTA 4LVNC 2IMNA 5T3ZD 1FYTB 3H7BA 1OTTD 3NPSB 4RAVA 3HMXL 2FZ3A 3L3OB 5HDOA 1MFAH 4LARL 5D5MB 2PYED 4PGEA 1FVEB 1FZJB 2L0DA 5I1GH 5TDPB 3I3DA 4LK4A 4NNXB 2DAVA 4OD2A 3ZT7A 3UYOD 4KXZI 4LCUB 4NN7B 3ARDB 4ORGA 3KPRB 1ED3B 1QHPA 5D7JC 2G60L 1QSFA 2WWKT 3LN9A 4PGDA 3JWDH 3VE0A 5ID0A 4K2UH 5KW9H 1N5YL 1OSPL 5CEZL 3QG7L 3TF7C 2W0FB 5L8KB 2IBZX 4LSQH 5FUZH 3H3KA 2AJ3B 3U9UB 1NCBH 1MREL 3QYCA 5DJ8B 3X3GH 4Y19E 4UTBL 3WUWG 4CADA 3K46A 4H0HB 4X4MA 5JO5B 2E7MA 4X7TA 3FB5B 3SE4A 4PBXA 1XFPA 1U8OA 3A67L 4X99A 2ZUXA 4V1DB 2J1KA 4XH2A 1IFHL 3O8XD 1INEH 4FQ2H 1MCQA 4TUJA 3CFDB 5C9JA 4WI2A 1FL6B 2AV7A 1N59A 5DF0A 5EBLB 4KRNA 4FQQB 2AK4B 3NFSL 3NGBC 2KDGA 2B0SH 1LO5B 1U8IA 3H42L 5FA4A 4JY6A 4YWGH 4KHTH 2DWEA 2CR3A 1MIEH 4I3SL 4OCWH 1JNJA 1KACB 5EU3A 5DA4A 1UQSB 2OCFD 3VFRA 3AB0B 1BZ9B 1K2DA 3RVUD 3IFOB 4EUPH 3PHSA 5DVNA 5TDOA 1FO0H 4JO4L 4WCYL 2EKJA 3SKOA 3QUML 1TDQA 4X98A 1HHGB 5H94A 5A16B 2R1XB 4KROD 2P47B 5FHAL 5CJ5A 2BNQD 5KVMC 3VWKD 1J18A 4WDIB 4OM0L 4HMDA 5BS0B 4JFYB 4YFLI 3TJEH 4QRPB 5CZVL 1NKRA 3RBGA 5JOFB 1BIHA 3WE6A 3HTLX 3MBEC 4O2EB 2X70A 5DQ9B 3EFDL 3MV9D 4JDTL 4CAGA 3GBNH 1XR8A 4NZDA 5KN5B 2APXA 2RR3A 3MRMA 1FFRA 3UC0H 1WIOA 1IGMH 3O2DA 1DQMH 5C3TA 5FUCE 3UJJL 1I9JH 4PLNC 4KI5E 1V7ML 4AY0A 4NUJA 1EH9A 4YBHA 3E8UL 3VRJA 1S5IH 4F9PC 4U1NA 5F9WB 4ZXBA 3MRRB 5GGUB 4V2CB 2L7UA 3BGMA 5A2LH 1ZT1A 1RJZB 4S1DC 1U41A 4LSVL 2XKNA 3HFMH 1JGDB 3UAJC 3P4OA 4HXAH 4BZ2L 2BNRB 1LEKA 1A9BB 5CSGA 5TJWK 1DEEB 1MAJA 1YN7A 3ZDXF 1WWCA 2Y72A 5I73B 2R0LL 1AGBB 1AP2A 1T1YB 3GHBH 4OB5L 3T65A 3TGXA 1IGCL 1R3JB 3U30B 5BV7H 4XVTH 4DGYH 5FO9A 3RZCC 4FFWC 4HKXA 3G6DL 1A6WH 3M1BB 4WWKB 2ZCHH 5HGDA 4YBLC 5J0BA 4FABL 3KPLA 3L1OL 1MY7A 2K3TA 2ICCA 3L5HA 4X8JB 1ZANH 1B6DA 3L5XL 4RFNB 3C6LA 2DQFB 4YHZL 5JQ6L 4XCNA 1UVQA 4S2SB 1P69B 2B2XL 2QJDA 4NYLA 1H3GA 5IT2H 4Y2OA 3T04D 1YEHH 4J3SA 5GS0H 1QSEE 5CJQH 5HYSG 5DD6A 4LDEB 4MWFA 1P4LB 2VKWA 3SE3C 4LDLB 5E08L 1E4KA 1F2XK 5E99L 5GGQH 4Y2DA 4YPGB 3CSYB 2Y7QB 1WWWX 5F71A 5BXFB 4F7MB 3ZHDA 2FO4B 4TSBL 4KQ3L 3SDDD 5KTEL 2W1NA 4NUGH 1T2QL 3DMMA 1RUPH 2UZXB 1G7IB 1OB1B 3K0WA 3MXWH 4U1JB 3MRHA 1N6QH 3QDJD 3HE6C 2EYRB 1A1OA 5FM5O 2A74A 5IW1B 1P7KA 3QRGH 3VMPA 5K9QI 4XCEB 1ZVSB 3RWDA 1KYOK 4TOYH 4Y4KB 1NFKA 4GAGL 4R0LB 2J3SA 1M71B 4PP2A 4QRUB 3BHBB 1IAKA 4R7NA 5EU7C 2EZ0C 2E7HA 4FXGA 1VPOL 1J0IA 3KJ4C 1JHKL 4XCCH 4M7LL 5AYQA 2VXUL 1VFOA 1MY5A 1MJUH 3Q5OA 1AXTL 3GMLB 4RX4A 1TVHA 5BZWB 1IEAA 1OAQL 2HFEA 5KVGH 4KUZL 1ONQA 4I13B 4C56B 4QXTA 4QT5A 3ULSA 2R56H 8CGTA 4X4ZA 3PHQA 1SBSL 1KJ3L 4NQCA 2W0LA 1T6VN 2VC2H 2WWMD 1YQ2A 2GITA 4OCYL 5DDHB 4O2FA 4NHUB 3MRJB 2MCPL 1JMXA 2VDOH 1IE5A 2PO6D 1UXSB 1MRCL 3V5HB 3L5JA 3U6RB 1LMKA 4H25A 4PGCA 1DCLA 3MJGX 4OJFL 4JFFB 4TN9A 4WEBH 1NBQA 3HMWH 4CNIB 4GT7A 4WFGE 2BX5A 2ZOKB 1WJ3A 3QUKA 1FG9C 5GRZA 1TTGA 4TUOB 5A2KH 4TSCH 3NCJL 2BC4A 4PJDF 5FM4A 4AEHH 4R96A 5TPWL 3NAAL 3ZHKA 4OD3L 2ZG3A 4JKPH 5LVEA 3V4PH 1K8DB 1KPRA 1LP9B 2DICA 3JV4A 4OM1L 4HGWB 4TSAH 4FTVE 4IOSD 3WIHL 4ZPTA 4NNPL 2QHRL 1KJMB 2VLJA 4FQXD 4HWUA 4YJZL 1A6VL 3WNPA 4WU5B 1FYTA 1KJVA 2J2ZA 3EYOA 2GY5A 1CGYA 5EO1B 3CK0H 5SV4A 3BH9B 3CH1A 5D5MA 2D7PA 5IROA 1QFHA 4MNHB 4EXPX 2YMXH 5ILTL 2B1HH 3QXDB 2DOCA 1T7VA 2FDBP 5J13C 4YE4L 4HJJL 4KRPB 1R6VA 1ZAGA 5CLTA 4A2LA 1WTGT 2R0WL 3KPRA 4UV4L 5CS7A 4EIGB 3EO9L 1RHHA 5C1MB 1U3YA 1OAKH 1BZ7B 1QSFE 2PN5A 3MCLL 5EPMB 1ND0B 4R4BA 5ETUB 5EH1A 4OFDA 5F8RC 3X11B 2A1WL 2ADIB 3EGSB 5C0NC 4PTTA 4YDJB 3TO4B 3GMOB 1CF8H 4GOSA 1BVKA 4JM2A 4DK6A 5FCUL 5CJXA 5C6TH 4KJQD 3AC0A 4RDQG 4ZOCA 3EJZC 1KJ2H 4Z5RB 3ULUC 4XC3L 4KTDH 4HUKB 4E41A 3BT2L 1WGOA 1VFBB 4XP4L 3HAEB 4MLIA 1FL6A 1MEXH 3UTPE 3C08L 4H1LH 3ZKNC 2B7DT 1I3GL 1ZLVK 1SEQL 2QR0A 4YHMH 1Z3GL 2COQA 2X10A 4MQ7B 1YEDA 4Z76A 5DMGC 1ZHKB 2FBJH 4Z7VF 1HXYB 3FN3A 1UKQA 1T5XB 4U0QB 5DHVA 4U1GC 5GZNC 3I50L 4NO0D 1X6LA 4WV1C 4PFEA 3V52H 3SGKC 3QBTB 3QNXB 4ODUB 4ZAKC 4ZMAT 4C4KO 4UT9L 3QNYA 4PJCA 1I8MB 2PF6A 3QDGD 1EEZB 2Z8WC 2IBGA 1JGEB 2C4FT 4NN6B 1XT5A 1T1XA 1QFWM 5A16A 2E8ZA 4XPHH 4LSTL 2NXYD 1AJ7L 4JQVC 4MDJA 1G7PA 1QFUL 5DLMH 4KJWC 2YD1A 1OD9A 2V5RA 1MQ8A 5JW5A 2EH7H 5BS0A 1G9ML 1D5IL 1KIQB 1WV7T 2BERA 3BI9X 4QOKA 1MPAL 3RIFK 5GGRB 5ADOL 1XGRA 2FR4B 5DFWH 3L3GB 1IGIH 4K94L 3MRKA 4LLMB 2OK0L 3C87A 1J88A 4M1CD 2X4SA 3FB7A 4G8EB 3L7EA 4GKZB 3GJEB 4L8SC 3KWWB 3SE9H 3C2SA 3KPSD 3H9SB 3UO1L 5F70A 2NTFA 4YC2C 1DBAH 2B39A 4ONFH 3RY4A 4QRRD 2X4QA 4JDVB 2XWJB 4HS8L 4IS6B 3EBAA 3WD5H 3O6ML 1A5FH 3PNWA 4MD5B 3MRRA 4NO3A 1A6AB 3SQBA 2DLFL 4QRSB 1NBZA 3MRGA 2XZQH 2FX8H 3HUJF 2FX9L 4IIQB 1OCWH 3QHFH 4KH2A 3TH2T 2EXYD 1YDPA 4NQVB 2NY7L 4X7EC 2DI9A 2QSQA 1RZFH 5C0CB 1TJGL 1C08B 1XIWC 4XPBL 1IMHC 4O4YH 4DAGL 1TETH 2R69L 3MLXH 3RUGA 4M61B 2EIDA 5C8JA 1UFUA 1ZTXH 4MX7A 5DJ2A 1LO2L 5D2NC 4OZ4B 1T1WA 2OMBA 4G6FD 4QO1A 2EC9U 3V6ZA 4OV5A 1KTKE 4WWKA 2OXGA 4P2QD 5FHBH 3ULVF 3QDJB 4NM8L 5T1LD 4J3VA 1CDUA 4WFED 3LS4L 2IMMA 4L29B 3VWJA 2VB5A 2AJYL 4JVPA 4N1CA 2PYFA 1A7BA 2ZUTA 2DJUA 3TBTA 1MLCB 3MRDA 5IBLC 1MFEH 3PWPD 3PDOB 4AEIL 3CSYA 1K9TA 3SY0A 1INQB 1D6VL 1ZVYA 5TQ2H 4ODTL 2NR6C 4QGTA 5CBAB 4LCWD 4CU7A 3IVKA 4Y19B 3MA9H 4MHHG 3IETB 4LFHG 3C9NB 4U6XA 4S1RH 5DRWB 1YMMB 5E95B 4IJ3B 4QHMB 5AD0B 5LBSL 1IT9L 3MUGA 4RMUA 1QG3A 3QIBD 1ZVSA 4KI1A 2G75A 2R23A 3HZYA 4Y4KA 3ESVF 1TVBA 4QRUA 3WFHB 5BJTA 2CUHA 7FABH 4ODWA 4PJAA 4XVSH 2G5BB 1A7RH 2DQTL 4R2GD 1JGVL 2BSTB 1BECA 4YNYA 1OLLA 5K93A 3C5SB 3HI1B 1IC7L 5DYOA 4PJ8C 5SV3A 4IRSA 1MI5E 4OKVA 3OKKB 1CDJA 4MGXA 3LPFA 4Y5VB 1DBKH 4NHCH 3SO3C 4O02H 4GW4B 4GRLC 4N0CC 1DQJA 3BVNA 4N0UA 4X4XA 1AHWC 2XACC 4EBQL 3V7AG 1KXVC 1OD7A 3LSOA 2QQKH 1ZHBB 1I7UA 4BH7A 1I8IA 4M5ZL 5E8PB 3MV7D 4N9GA 1FAIH 2HFFB 5F7LB 4NQCE 1JUFB 4ZS6C 4S11A 4G7YL 2CIIB 2J6EL 4YR6B 4WW1B 5IF0B 2JJSC 2ERJB 3IDMB 2DKSA 1JFQH 3N50A 2PYEA 2OL3L 2W60B 1MIML 1NMAH 4GAFB 3BP7A 4RFEB 3QIUB 2ZUQB 3IFLL 2HRPL 1ITCA 2PW2B 1GSMA 1IGFH 2HJFB 3JWOC 4LPVA 3K8LA 3IJHA 1J1XH 3QIWB 4DUVA 3PUCA 1CFNA 5DGQA 5C7XH 4K71B 2ICWJ 1AE6L 3GIVA 1CL7L 1BJMA 4RGNB 2JTDA 2VXSH 3KS0J 1EEYA 3GI8H 4XT1C 4KMQA 3VXNB 2EEDA 1OARH 3DRQA 1RZ8B 3HRZB 4AH2B 1OOAA 1SM3L 2GJJA 3AMKA 2VLJE 4JFED 2APTA 4W4NA 2DM2A 3ZHLA 2EIBA 3NA9H 5IEHA 5DVMA 1PQZB 3ZE1E 5TE7L 1ZOXA 4P5KB 5K9KA 1JTTA 1DN0A 2F5AL 1CWVA 4JGUA 3O8XA 2NY1B 1A4JB 2BSRB 4OLYL 1F4WL 5ALCL 5IQ7H 1D5BA 2V7NA 2QQNL 4PJEE 3I3EA 1KG0A 3WJLA 1P1ZA 4LU5H 1B88A 1DR9A 2FO1A 4FQJH 5I18L 4FNLH 3OHXB 3X11A 6CGTA 4OF3A 2ADIA 5DWUL 2J88H 4Y16B 4LSPH 2XG5A 4YDJA 3W2DL 1PSKL 4NO0B 2EKSB 1KCVH 3B2VL 4FMKA 3EOAA 4JKMA 2Z92A 2R2HB 5KSVB 5F93C 3C5ZC 3K80A 1HKFA 1RJCA 4DGVH 3WO4C 2OZ4A 5ID1B 3GUTB 3CFEB 4BSWA 2NXYB 1GVIA 2JK5B 2UVEA 5BRZE 3DUSA 3SKMB 1M7IB 2BNQA 4WWID 3VWKA 4HUWA 1SHMA 3V5KB 1ZHKA 3TNNA 4U6VL 4IRZL 4OIBA 4OCSH 2C3VA 4PLJC 3QA3B 2AJUL 5L88L 2ILLA 3MV9A 2AXJA 4P46B 3UZQA 3VFUA 1CGXA 4HEME 2X4RB 2FJHA 2Q3AA 3VGFA 4UDTB 4G43A 4PJCE 3MJ9H 2OM5A 5DEFA 4AJ0A 4KKNA 2C1PA 5B38G 3MRFA 1BJ1J 1F42A 5FKAB 5IWLC 2BFVH 4XNZC 1JPTH 4H88L 3ARUA 3KR3L 4U0RC 4MCZB 4PG2C 4LPXA 3A6OA 3L3GA 4QOKE 3ARXA 1PKOA 1TTFA 2ZJSH 4HFUL 5DD1L 3ZE0E 4LLMA 3LDBB 4NZUH 3LEYL 4KDTC 4G8EA 3GM8A 5H35B 1WSST 4QXUL 2DL2A 4CDGC 1A7QL 3S36L 1N8ZA 1FZOB 1U8LA 3NIDE 1T5WB 3QDMD 1QRKA 1EO5A 4I0PB 3G6JE 4LCIL 3QUMB 1FORL 5CD3A 1KV3A 1HI6B 1NCDH 4MD5A 3HC3L 3T4YA 1P6AB 1XEDA 1SJEB 4OZFH 3BEWB 3LZFL 4OGXH 4EN3C 1PVHA 5ITBH 1XMWA 1JZ3A 3BEVA 2H1PH 2Y23A 1G7LB 1UJ3B 4OLWH 1U91A 2DB8A 2XN9D 3R0MA 1JNLL 3DBXB 3QEHB 3VW3L 1UH2A 5MEOA 3PWLA 1DBBH 3UCRA 5GSVB 3U1SL 1INDH 3BJ91 1II4E 4BELD 2DMKA 3RUGE 2IJ0C 3CVHL 2BHUA 4XMLL 3TPKA 3LQAL 4NQTA 3T0WA 3SDDA 1BFVH 2JB5H 1NGXB 5GS1C 1KLGB 4LIQL 3QDJA 1Y6KR 2OZ4L 5BQ7B 3VFNA 4IRJC 5HD8D 1ZS8A 1CCZA 1FL5B 4HQQL 4OFYD 3DTXB 2DWDB 4DKEH 3SGDH 3HPLB 3V79C 2D9CA 3Q6GH 4AIOA 1AO7B 1KLUB 2Y5TA 4YHLL 5CBEA 1LNUB 1KEMH 2Y6SD 3LPGA 1ZMYA 2EC8A 4KY1L 4YHPB 1M6OA 1P84K 1N6VA 1EGJH 5F9JA 1NFIB 1A4KB 4GG8B 4KDVA 1F8TH 3WNMA 5L6YL 3EDJA 4OAWA 4OLXL 3H3PH 4AIZB 5IM7A 1DBJL 2FD6H 3P0GB 3U0TB 4XCYA 5JIPA 3P9MB 2QQLL 2Q8BL 1LK2B 1HZHL 2E5EA 2CLZA 3WLWC 4LCCC 5J6GB 2AK1L 4Z7NE 3H7LA 2D7TL 3BDXA 4G8IA 1IC5L 2O5YH 3WNKA 1A7PL 2PO6A 4PV9A 2CMRH 3VH8B 2ATKA 3HNVL 4IM8A 3WJJC 3ZL4L 2FIKA 1NSNH 4NJ9H 2VXQH 1EHLH 2VE6A 1KCRL 3R1GH 4GFTB 3G08A 5C0EB 5JMOC 4GW4A 4KAQL 2AEPL 4EQ2A 3RI5K 1TZGL 4H5SA 4PTUA 2FEDD 3OGCB 3LRGA 4P2OB 4N0UE 5GS0D 4QWWC 4L8DA 5H8DA 5C07D 5FYJH 1MVUA 2EDKA 5C71A 1U3HB 1BEYH 2DTMH 2PR4L 2BOBB 3NH7H 4J3OC 3QNZA 1SJHA 5F6HJ 43CAB 4J1UB 5GRVK 5IV2A 1OL0A 1KB9K 4FQXA 3ARED 3CDFA 4D0DB 1SJVA 4FOMA 5T3ZE 2AJSL 3RX7A 1E4WH 4WGVB 2PYEE 3EYQD 4X6CB 4X6EB 4GJTB 2K9UA 5E00A 2YPVL 4JAMA 4M8QB 1I1FB 2VDQH 1S8DA 3QCTL 3W0WD 2VQUA 3FZUC 1A1MB 2O5XH 1R3LB 5JIKA 4G5ZH 1CXIA 2IBBA 3HZMA 3QXVA 5DT1L 2C26A 4X6DB 4PB9H 4JVWA 5I1KH 3MRNB 3GIZH 3VXRB 5INDA 2LU4A 2ED9A 4MQTB 2F74B 2P7TB 3T0VA 4APQD 3A6CL 1NCAL 3L6FB 4JB9H 1EAPB 1Z9MA 1ZLWK 2WNGA 2D7NA 1L7IL 1DL7H 4JR9L 1NC4B 1RIUH 3V9FA 3GNMH 1T1ZA 1XCQA 2CSPA 2YSSB 3C09C 4P4RB 4ONGH 3RVWD 3DYPA 4NC1C 2WIIA 1M4KA 3NACH 5C6WH 3JV6A 4I3GA 3HC4H 1MWAA 3UYRH 4YFEA 3AFLA 1RIHL 2P8MB 3LKOB 3MGAA 2XQBH 2HRLA 1PKQE 4NO0A 5HJ3B 1N0XH 2Q8AH 4JPKH 2W0KA 3BE1L 1Z5LB 5F3BA 3QEGH 5GGVH 2YC1B 2OYPA 4P5MA 2GK0A 1JGUL 4LVOC 3QDGA 2LU7A 4G9FD 3CPLB 1I7RB 4CJ1A 3V0WL 4Z18A 4PV8B 1DSFL 2AABL 2V5YA 3BKCL 5MERB 2Y06H 2OQJB 2DQGH 3ARFB 4BFIB 1I7ZB 4JHAL 3LCYA 1Q9WA 2CLRA 3Q0HA 1T03L 5F7NC 2BNQE 5H2BA 4AMKH 1L9NA 1NDMB 3CZFA 2ITCB 3ETBF 1FLRH 4I18A 4G6AC 5E56A 5EB9A 1FCGA 2JJTC 1QRND 3WHXB 4N5ED 1WCBA 4CVUA 3KPPB 3CXDL 3MV9E 4F7EA 3OJVC 2X4PA 5F7MC 3NIGF 2M1KA 3X14B 3WSQH 2NW2B 4OQTA 3KPSA 3BN9C 1GGIL 5FV2A 5DZNA 5I0DA 2JIXB 4QRRA 4DN4H 1YY9C 4GKSA 5EDXA 4LNRA 1C12A 5ABDE 1CXEA 2R0KL 2VISB 4Y88A 4NGHH 2ICES 2WP3T 4OCLC 4PJDA 3GKWH 4KKCD 4Y4HD 1JJUA 5D7SH 3VXPA 1ZXQA 4P9HL 3TIDB 2N56A 3FQRA 4MCZA 5C0GB 1KIUA 4KUCD 2ED7A 3WNNA 4YEEA 3ALPA 2DQHL 2IQ9L 2JELH 2Y5EA 4MQSB 1KCSL 3VGHA 4NDMB 4YXHH 1JPGB 2BVTA 4HWEL 1QACA 4RGOL 1LEGA 4P2CG 5GRUL 3KYOA 1MFCL 3VGBA 2ZKHH 1O0VA 5H35A 4LSRL 1S78D 4Z95L 3SDCB 4YIQB 1TENA 3HG1D 2W9DL 1C1EL 2ARJA 1JYNA 3L3DA 4Q9BA 4XXDA 4P2QA 3TBSA 4X4YA 3NCBB 5T1LA 4AEFA 1FIEA 4WW2F 3DUHA 5J11C 3EKCA 2X2YA 35C8H 4G3YL 4D2NA 1I3VA 1KPUB 3TVMC 1JRHH 3UYPA 5GSRA 5CUSL 3PWPA 3O9WB 5DK2B 3IF1B 5IB1B 1TZIB 5IMLA 1QFOA 1KT2B 4YZFF 5B39G 3UZVB 5I73C 1FPTH 3RA7L 3H6JA 4LCWA 1U8QA 4LP5A 3QZWG 4F7PB 1M7DB 2AKRB 4CGTA 5DQDL 3ISWA 1J12A 4J2XA 1RUKH 3I2CL 1MCJA 3QB7C 3U30C 4Q9QL 4LEOB 3PXHA 4M9PA 5BVPL 3U79A 1YY8A 1X5LA 5FUOL 4IOFC 3VFGH 4YHYC 4MD0A 1TQCC 1GC1C 3QIBA 5EC1A 3TO2B 5HYFA 4X9FA 4X5WA 4MNQB 3UTQB 4POZC 3OKOB 3TV3L 4YHNB 4RFNC 3PP4H 4OZGB 4U7KA 5F9DC 1IARB 2CK0H 1BQLH 1ZT4B 3SCMD 3OKDA 5I8OL 1BQHB 4S1SL 1FNGA 3VRLF 5CFHA 4NCDA 4LCYA 3ARSA 5E2WH 4JZNB 3HZVB 1C16B 1DJSA 5AYUH 1NFIA 1P5VA 3OSKA 1D9KB 3BW9A 3CXHK 3RTQC 43C9B 5TE4L 4O58L 4OFIA 4AIZA 3WN5B 1BVZA 2D0FA 5DJDA 2O61B 2SEBA 3HCVB 3QFDA 4OD1H 3L95A 4YAQB 4DW2L 1A9EB 2CKBL 4Z0XB 5HVWA 1XGUA 1H8OA 5BRZB 4TVPH 3CNKA 2YBRA 3MV7A 3QAZC 3U7YL 2FATH 3RWEA 5F96H 1J86A 1C5CL 1ZKAA 1I4FB 2FHCA 2V2TB 1Y6MR 3P4MB 4NIKB 3N1FC 2R39A 4U1SA 4ZUUB 1NMBH 2LAAA 3Q5TA 4ELMF 3G5YB 1A6UH 4LASL 1K4DB 2GT9B 4B5EA 2GFBA 2HMID 2YHGA 3RKDD 3K4DA 5DEZA 1ZA3B 3V4UH 5JIHA 3MACL 2VNCA 5FECA 2IALA 5HPMB 3DUUB 3HUJA 4C57C 3GSOA 5F7DB 1EZVX 3CC5A 4I1NB 4XNYL 1IAOB 3MLSL 5D6CB 5EU5A 1MUJA 4JHWH 2XTLA 3IDXL 3PL6C 5SX5H 1ZLWH 4N68A 2XKSA 3ZDXE 3BRDA 1RZGB 6FABL 4D0DA 4JFEA 3GBML 3S4SA 2VQTA 1JPFA 4XI5D 1A7NH 1IM3A 2HFGL 3RIFF 3MJ8B 4APQB 3KG5A 2VR4A 4L4TB 3MYZA 3FTGB 1G1YA 5C0JB 5JW4R 4NQDD 1BBDH 5IMKB 4AK1A 4MA8H 1YQVH 2IAMD 4OGAD 3OPZL 2QLVB 5AZ2L 3G6JB 1JYVA 2CGRL 3W5MA 4FXKA 4GBXD 2BY3A 5HHOD 3BD4A 5JPNB 1J7VR 1R3LA 3ARGB 4JO2H 1J05B 2OSLA 3GHEH 5I76B 3U4AA 2HT2C 4D9LH 1BGXH 5KAQF 4JO3H 4WI5A 2NY5L 3A6BL 2WWKO 2DLEA 2Q3ZA 3T77B 3MV8D 5JR1L 4QHUB 5I1EL 2A6IB 3GEWB 1BMGA 4JRXB 3ULUH 2FRGP 3L6FA 3B6SA 4JZJB 3IKCB 3UTZB 3ALXA 1B0WA 2QADC 4OF8A 4YX2L 1MCIA 3MRBB 5KSUB 3MRQA 5AZEL 4M6OL 2WUBL 1T4KB 3B2UC 4MJ6A 4XP5H 3UJIL 1V7NH 4KRPC 3TA3B 1A3LL 4BQ9A 1UACH 3EYUH 3G9AB 5E8EB 1AQDB 5LQBH 1TJHL 5ESAA 5C9KA 4HUVA 4KMTH 5B8CB 5BW7C 4HKZB 1S7QA 3SGJA 2V2XA 4YDKL 3T0ED 2ESVE 3VJ6A 3MR9B 1JN6B 1UADC 3QXUA 3SDAB 4OIIL 2IWGA 2NLJA 2NXZD 4N0RA 3O6FD 1Z5LA 5GJTL 1CG9A 4BH8B 3JTSB 8FABA 5TF0A 4NRZB 4C59B 4HUXA 2DMBA 5T3XD 5IKCA 4KZEH 4K07A 4TUKL 1XF2B 5D1ZB 4UAOC 1LVEA 1U8MA 4FQ1H 3RPIB 5J1TC 2RFXA 1FNAA 4K8RL 4BFIA 4Y4FB 2QKIB 1WCQA 4MA3A 4KVCL 2G9HB 1FH5H 3O4LD 1HDMB 4ODHH 5CSZA 2WBJB 3D69B 4RAUB 3LV3B 3HI6L 4FQHB 1MJ8L 4JJ5A 1VGEL 4ZFOA 1DDHB 1DN2A 3HHRB 4K9EC 3QQ3B 2XY1A 3BQUB 1ORQB 3MXVH 5A3IC 3HG1B 3SKUD 1A3QA 3KPSE 3MGOA 5IFAH 3QDMA 4M6NL 4JN2A 3SPVB 3PV6B 4E42B 4QRRE 4U1IB 5BO1H 1S7WB 4LQFL 4XMPL 4O51B 2NY2D 4LPCA 3BDYH 4PRBB 2HJKB 3S6CA 4M7KL 3O6LL 3ULVL 1AGEB 2E6JA 4PJDE 4W70A 1ZA6B 5TDNB 2HA1A 2JCCF 3HNSH 5E8NA 4HS6B 1QA9A 2Y07L 2XN9A 4X7SL 4EUPA 1OT2A 1JNHB 2IFFL 2GSGB 3ES6A 2R4RH 5JPMB 5GGTL 2EO9A 4P5TB 3KLSA 3C8KB 1WC7A 4XAWH 3DURB 1G6RH 5JXAL 4ISVA 1S9WA 4JANB 2DM3A 1CS6A 2ICEB 1VADB 2AEIT 5C2UB 3NBNA 1GIGL 3WUWB 1PW3A 3OR6B 3ZTNL 2XNAB 4TPRL 4WFEE 4M5YH 4OFYA 4L9DA 1S7RB 5B3JF 1PY9A 2BVPA 1OHQA 1B9ZA 4P3CL 4WY7L 3P3YA 4H8WH 1HE7A 1IGTA 5LWYH 5F3HA 4IIQC 2ZP0T 3O45A 5DK2A 5IB1A 2X4TA 5ACLA 3OAZK 3EOTH 1NCUA 5I1GL 1E0OB 2E6PA 1RJLA 4HUMB 5DJXA 3DV6B 4ZOAA 3GSQB 2FLRT 2JJWA 4LCWE 5C08D 1D6EA 1JGLL 1I1AD 3BZ4A 1EEUA 4QGYA 3TNMB 2A73A 3DVNA 4LEOA 1MAMH 1X4ZA 2L4OA 4NQEB 1S9KC 2X9XA 1REIA 4K2UL 4XNMB 5D7IA 3UPRB 3F7YA 3SEPA 2A6DB 1I1YB 3FCTA 5I19H 3UTQA 4OLUL 2FWOA 4YHNA 3CU1A 2NY6D 3CUPB 3TZVB 1NCBL 4LRIA 5D72L 3HPJA 1CU4L 2FSEB 3MUHL 1C5DA 1JMZA 2H45A 5HHVH 5E5MA 3AY4A 3HZVA 2W65A 1C16A 1GGCL 3CVHB 4XWOD 3RDTD 4FQ2L 1MQKH 1HEZA 4MA1B 2APWA 2EECA 2UWEA 3IFPA 5F21B 3VFSB 2DRUA 5C07A 4YAQA 1RZJH 4X6BB 2ATPA 4MQXC 4HJ0C 4WU7A 4YWGL 4QXGH 2DTSA 3MV7E 3CLEH 4I5BA 2EEAA 2C7UB 3Q1SH 5EBWA 1UYWL 1KULA 1U8JA 5C0BD 4JLRB 3B8YA 1CDHA 3AREA 2V2TA 4JKLA 1OP5K 2OJZH 1CLZH 1NJ9B 3FHAA 2OTWA 1FO0L 2OJEB 4ZNEE 5D6DA 3FO1A 4U1LB 1CFTA 1BX2A 1E4JA 3JWOH 3P9WB 4NQDB 2E9JA 4JFOA 4Q9RH 3MRCA 2WUCH 3D0LB 3ZT6A 2E7CA 4P23D 1W0VB 2V7HB 3W0WA 5I6XC 4LPWA 1NLDL 4Y5VC 4QTIL 3HUJE 3KYMB 3S96A 2AJVH 4PRDA 4TNVK 1SYVB 3JZ7A 4WI8A 3IDGA 5IB3B 1E28A 4CN4A 2DBLL 2H9GB 3BKMH 4C83A 1KENL 3SGDI 4MMXC 1QEWB 3T4AA 3UC0L 4G80A 5DMKB 4JFEE 4APQA 2ZCLH 1WEJL 3IDIB 4QF1A 5JNYB 4P2RB 3SKNA 4XC1L 1OGAB 5GHWL 4CW1B 5HYSB 5JA9A 3OJDB 2AEWA 2VIRB 1EXUB 5L7XH 5IVXF 3WS3B 1WWBX 2PCPA 3LEXA 4JPIA 4MCYB 1IJ9A 1FL3B 4LGRB 4CVWA 2EDWA 4EKXA 5J06A 2PXYC 5FUCC 2EDYA 2A0LC 1J05A 4KI5C 1VFUA 1HHIB 5C09D 1NAKH 4AL8L 4D9RE 3D3VB 3WFEL 4QHUA 4E5XB 4J3TA 2A6IA 2BVQB 4NRYB 3P0YL 3RWHB 3JVGA 2J8UA 4ELKA 1U95A 1F3JA 2FX7L 5BV7L 5KS9B 2DQDH 4JFDD 1KB5H 4G9FA 1G9EA 3B3IB 1S9VB 3RX5A 4G8GB 2Z91B 4HIHB 1Q1JL 2BJMH 4Z77B 1IQDB 5DD3H 3WV0A 1IQWH 2OR9L 3UJTH 3O41B 4UZGA 5F89A 4U05A 2NY1C 1BOGA 3O4LB 1LD9B 5GS0L 2YK1L 2KL6A 5CJQL 3L3IB 3G04A 2MSPA 1U8HA 5E2JA 4FG6D 1QRNA 2UZIH 1W8OA 3B9KC 4Y5XB 5GGQL 2ZG1A 2YXFA 4MB4A 3G5VB 5AUMB 1S7TA 3NFNB 1FAKT 1X5GA 1BM3L 5F7EH 4Y16C 3U83A 3LKSB 3MCKB 4R90H 2VR9A 4NUGL 5LGHH 2AVGA 4D8PA 3HLAB 3RPIA 1U6AL 5C2BL 5JOEA 4Q6IB 1N6QL 3S5LA 5F6IB 2ID5A 3EOBA 4BK5A 3IYLW 4PJHF 2NY2B 3RIAK 2EYSA 1WZMA 2Z31B 4Y4HA 3QRGL 2O5ZL 5DJ6B 4NQXB 2Q6WB 2VUYA 1YEGH 3T3PF 3LV3A 3RWIA 1VKXA 1T0MA 4QNPF 3QQ9D 4MA7L 4RNRA 1KJ2A 4LPYA 4XCCL 2P42B 3V7MA 4MJ5B 4FFYH 1MJUL 1GPOH 3HG1A 2APBA 4P46C 4H1LA 5IGXL 3QDME 4U1IA 4FFVD 4XP9L 3L3HB 3RWGB 2BCKB 3SE8H 4O51A 1L9MA 4Y7MA 5IUSA 5IHUL 2CDEA 4EQ3A 3LKRA 3OAZH 1GH7A 3RWFA 1RFDH 4D0BA 3P77B 2VDOL 3RI5F 1JNHA 5ACZB 4WNQA 1MFNA 4RA0C 2RGSA 1QBBA 3HB3D 5IW6B 5J57B 3FFCB 3IJYB 1WBZA 3L5WA 4YXKH 3BKYH 4B53A 3FQUA 3OAUH 4M62H 3LRHA 3KPOA 1NMCB 2C3WA 4X0KA 2LTQC 1TXKA 2VXVL 3PWUB 2I9TB 4LLYA 4TSCL 3S34H 3TYFA 4I0PC 2ICWB 1ZLUK 5E6IB 3ILPB 1CR9H 4I4WB 2FEEL 1HHKB 1FNFA 3I6GA 1CFVH 4HBCH 3P0VH 4EI6B 2DYPB 3SCMA 5J3HD 3IXTB 5EZIL 1PD6A 1WISA 3CFKB 4HBQA 1HQ4A 1RIVL 3B4NA 4S1DD 5HHQA 4UIMA 3FQTB 3PGDB 5IW3A 5JQHC 4I8DA 3UAJD 2LVCA 3RDTB 1KNOA 5F6HI 4F2MB 4WHYH 1HCFX 3NVQA 4HF5H 4PGBA 1QLRB 4JZOA 2R9HD 1R0AH 4DUXA 2DQCH 1OTSD 4LSUH 3ILQC 2FECI 2EDOA 3TBWA 1OM3H 4RCAA 2NY0B 4LKXA 4GQ9H 4GG6B 3U36B 1FGNH 2YPKA 1P2CA 2UYLB 5TE6H 4BQCA 5HBBA 1EO8L 2I60L 1F4YL 4L4VE 2ESVB 5C6TL 1IM9D 4ORZC 1NFDF 2EXWC 3MTRA 3KNBA 3T8XA 1GAFH 3QJFA 5EC2A 5DMIL 2NQCA 1XH3A 3EFFA 3GFUA 5GIRA 1MEXL 2EDXA 4NKOB 3DNKA 1MHEA 4I2XA 4HG4J 4NWUL 3ZDZE 5L2KD 3BPOB 3O6KH 5C07E 4Y1AD 4JM4L 3OXSA 3SE4C 1AXSB 3OKNA 3O0RH 1U58A 4WUUD 2C7UA 2DJ4A 1H15A 2F9BT 5EZLB 4K3HA 3V52L 3HE6D 3OKEB 1S7SB 2Z8VC 3NZHH 2HVKB 2B5IC 3QHTC 5CZKA 2YD8A 4U1LA 3LKQB 4NQDA 4UI2A 2R29L 3UTTE 1WBXA 1OAXH 2WW8A 1Q72L 3C5JB 4U1MB 1AGFB 2IAMA 4DOHE 5CLWA 1EA9C 1UT9A 3N9GH 4WW2A 3BRFA 5EUKB 3RVTC 4M1DH 3W0WE 4HWBA 4GBXA 5HHOA 3STLB 4NP4L 2IADA 4RAHA 2YPLD 2CKBB 1QUNA 4NKMB 5C86A 4Q7DA 1IGIL 3AS1A 5GXBB 2VLMD 1XF4A 2H9GA 4UB0H 3GI9L 3MV8A 1TZHA 5GISH 3RU8H 3KPMA 1CK0L 4RMRA 2YD3A 4YO0B 1G7JB 3D5OF 2P49B 3BSZH 4ONFL 4QCIB 1QBAA 3KYKH 1GJIA 5IR1B 4CW1A 5D70H 1A6TB 2Y25A 1N64L 3V0VB 4TVPD 3FQWB 4ZUVB 1N2RA 2FX8L 4ZOBA 5I2IB 4HPOL 2RJMA 4U1HB 2XXMB 5DUPL 4PRHD 4ZUTB 5I30L 3HR5A 1NLBL 5DS8B 2VLRE 3TESA 2IBZY 5D71H 2H2PC 3WBDA 3T0EA 3SJVE 1ES0A 1R3KB 1LQSR 4L8CA 3RAJL 1FC2D 1TETL 5CD5C 4ZXBC 3MLXL 4XPTL 5I8KL 3O6FA 5D7JB 25C8H 1BP3B 1UXWB 2DQEH 4O2CB 5F97E 3BAEL 4ENEC 4AM0B 2KUTA 1NCWL 2KZWA 4X5XB 5KS9A 1Z6JT 4LNVA 1U8PB 5ADPH 5EIVA 5IFHH 1H0DB 4G9FE 1LILA 3V2AR 1YNKH 1NGQL 3GSWB 1XR9A 2QSTA 2R2EB 5F8QC 3O4LA 2X4UA 1CDCA 4F8QA 2PETA 3LPWA 1S9XB 1EO7A 3KLAB 1QPXA 3TEUA 3U7WH 5I16B 2PKDA 2X4NA 1MFEL 1WUNT 1VFAB 1FP5A 5TFSL 3WFBL 4Z7VB 5E1AA 1X5ZA 5TQ2L 5IESL 3WDIA 3THML 3JTTB 4LVHB 1EHXA 3MCKA 2VLKE 3MA9L 4ELMA 3TPUA 1LO0L 3NGBB 5ICYA 1NBYA 2JB6A 4FQCH 1HQRA 3X12A 1E4KC 5C0ND 4PG9B 2A6KA 3CX5J 5IFJA 1NGPL 4AENB 4EDWH 1YPZF 5IMMA 1OF2A 1YEEL 1KN2H 3FRUB 3I3BA 4GAYB 1KEGL 3EJZD 1ORSB 4KPHL 3ULUD 4JEGB 2BHZA 4XVSL 3DV4A 4LOUD 1A7RL 4DCQB 4QTHA 1QBMH 3PIQA 2Q86A 3VCLB 4BSVB 2V6HA 1F6FB 3NTCH 3G6AB 4Q9CA 1RMFH 1RAMA 1G0XA 1ZLUH 1J1PL 3MUY1 2G2RB 1B4JH 4O02L 3DSFL 4XHJD 4PJXF 5C6PB 4PR5B 4UU9A 3CMGA 1ZT7B 4UT7H 3MBEB 4RBPK 5HGBA 5I1AB 5GZND 3UTSD 4D9QD 3O3AA 4C4KT 2KZ1B 4F7TB 2R4SL 4ZAKD 1OY3B 4K23L 2VABB 4MSWA 3Q3GB 5EU6D 3P77A 3IDNA 3SO5A 7CGTA 2D4FA 4QHLB 4MB3A 3MLPA 2ZSVA 5JLZB 1MOEA 4NO2B 4PRAA 3MJ9A 3QEQB 4KJWD 1ZK9A 1X4XA 1XCTB 1T04B 1CT8B 3DX9B 1A1NA 3C8DA 4F7CB 1YNTB 5C08A 3TJHC 1CLOL 1I1AA 2V2WA 2MOVA 4XP6L 5IBTH 3O2VH 4MXVF 1J1XL 1B0GB 5C7XL 3OMZA 3LN4A 3ZO0A 1MJJB 5GZOC 3CMOL 5I15H 2DQJH 1QFWH 1UWXK 3EW3B 1OARL 5J1AB 3W9EB 3D48R 3RVXD 3RZCB 4Q58C 4KZDH 2RCSL 4OKDA 1KC5H 1OVZA 3UZEA 4K3GA 4WENB 1G9MC 3MRIB 4YBLB 3OXRB 1OTUC 3U0PB 3NA9L 4J23A 1FVDB 5CJOL 4QY8A 4NWTH 1X9QA 2EYTA 4K7FB 4K94C 2HT4C 3O9WC 1QNZL 4OLVH 4OZFA 5BZDA 3RDTA 5GJSL 1NANH 4LLDA 5I17A 3SOBH 5IQ7L 1LE5A 4R26L 4DFHA 4RA3A 3BD5A 4LU5L 2C1OA 5ANME 3SQOH 5IROC 2YUVA 2GJZB 4FNLL 2WSKA 1H3PH 3WHE0 5JDSA 2J88L 5GRYA 4LSPL 1UM5L 3D2UD 4GG6A 3CSPA 5C0BA 2YD4A 2V5MA 3H9HA 4PJIF 4OI7A 3MRLB 1YEFL 4RSVA 3WL9B 1UM4H 1HK6A 3NIGE 5DJAB 5IB2A 3GGWB 1JWMB 5FO8A 4DGVL 4I0CC 1DUZB 2VZSA 3V4VH 4CVXB 3MFGB 4P23A 2P45B 4M7LT 1D3CA 2EIEA 4NKOA 2CXKA 5IBLD 2VAJA 4JM2C 5INCB 2IQAB 5IHZB 2N4IA 4Z7WB 2EE6A 1UKSA 4I2XE 4JO1H 2Z35A 1ZEAL 4LMQE 2NR6D 3FO0L 4AQOA 3AAZB 3F7PC 1D5XA 3GMQA 4LSSH 1AD9B 4PRID 2ZCKL 4WFHE 1EGJA 1I3RB 2ADFH 3C2AH 5LCVH 3K1KC 4P3DB 1T21A 3KPNB 2IAND 1Y0LA 4WTWA 5TH2B 1MHHA 3L9RA 1IKNA 3TP4A 3ARBB 1R3HA 3DO7A 4ODVH 5DC0A 2Q1EA 3BXNB 5I1LA 3BGFC 1LE9B 2BFVL 1GL4B 3VXQA 2AJZA 5SWSD 4MXQC 2CXGA 1QLFA 1BQUA 3M17B 2CO7B 5T33H 3X13B 3QQ4B 1CBVL 1I8LA 4LLVA 4LHUD 4F58L 1BFOA 5HHOE 5FF6A 5C09A 5DI8B 3QO1B 4PJ8D 5MEPB 3VU2A 3EOYG 4R7DB 3G5XA 4NZUL 4N0CD 3F7VB 1F6AA 5C0IB 2XZZA 3MV8E 2FH8A 5FGCB 5HDQH 4HH8A 4S10A 3ZYOA 4YZFE 4OZIA 1VESA 3Q6FB 4JFDA 4RFOL 4JG1H 3S35L 3TLRA 3MFFB 4OCXL 4UIKH 4XX1E 2JLLA 1TJIL 3AXLB 3S37H 5MEND 1BIIA 2DLTA 1C5BH 4XNQA 2D03H 5FYJU 3VRIB 3IT8D 4LEXH 3PJSA 4OLZL 2Z8SA 5DSCB 3RX8A 2CKNA 1OP9A 5D8JH 5F1OB 1G7QB 1FFOA 4CN1A 5E8OA 1OPGL 3TCLB 5J6HB 5DVLA 2VQ1B 1SYSA 3NFPA 3ARGC 5KOVC 1DBBL 3VRLE 4K7PH 1INDL 4ZFZB 1UENA 4ONHA 1YEJH 2FIRT 1NAML 1C7SA 3I85A 3REWB 1F4XL 5ICZB 5HGHB 4MAUH 2JB5L 2PW1A 4AG4H 1E6OH 5EIIB 1FRGL 2H2SC 1I1RA 3MROB 5ICXA 3ZMRA 3O2WL 2ZSWA 1J8HD 4HD9A 1JF5A 4I3RH 1UWGL 3HAEH 1JK8B 4LKCB 5KVDL 3DX8B 4YBQD 2ITDB 4M6MH 3NABL 5EZJB 1JVKA 5EN2B 4MJID 1V8HA 1T80A 3Q6GL 3VFWB 1UZ6F 2I07A 4ERSH 1AFVH 2HVJB 3O3DA 4B50A 4HGMA 3MRPB 4RBPH 3V8OA 1G7MB 3VWJC 3SDAC 4L4VB 5FO7A 4ELME 1OGTB 5I66A 3N85L 5F7FA 4L3EE 1RURH 1QZ1A 3HNTH 1QD0A 1I1CA 1FFNB 1XGPB 3QI9D 2K7QA 4AENA 3EDDA 4WV1B 1RZKL 3VFMB 1HWHB 2NYYC 2AJXL 1JF1A 2MHAB 4PRNA 1HXMA 3R06A 1RUAH 1U2CA 4GAYA 3BYTA 1MELA 3EO0B 4HPYH 1BD2B 5D2LA 3PHOB 1HHJA 5DUBB 2WBJC 3MNZA 4XWGH 3MOAH 5DJ0B 4RQQA 5C0AD 1I9RL 2VRAA 3MLWL 5EBMA 1FGVL 2VDLH 2VXQL 1EHLL 5KSBA 3KYNA 4GMTH 3V95A 5I1DA 1MCWW 1UWXH 2ADGA 4G6KH 4J6RH 5CEYB 4DQOL 2QBWA 4PR5A 1AIFB 5EO0A 4PLJD 2BXZA 5IVXA 4JKWA 3UTTB 1HYSD 5M95B 2IPKB 4J8RB 3FONA 5HI5C 2CR6A 5IK3A 2NW3A 4IOIB 4F37K 5FYJL 5EORH 5EO9A 2BHYA 2DTML 4L8SB 5K9OB 2VL5A 3GRWL 4PJGA 5E9DD 2PNDA 4HT1L 4IRSC 3FHQA 1I9IL 3BUYA 1KTDB 1RY7B 4QRQB 2LU3A 2BY2A 1H3TA 3H2WA 4IEFB 2FB4L 3MNWA 3E6HB 4F9PA 1EBAA 3KXFE 4X80L 4TNVF 4Z0BL 3FRPA 4F80A 5F1IB 1CT8A 2AEQH 2EH8H 2YD2A 3PGFH 4HHAA 5CCKH 4ZFFB 4L3CA 5C08E 1D5MB 4M48H 4UNTA 2H41A 1JZ7A 2AXFB 5DUMH 3BMWA 1XIWB 2P24B 3CLFH 1FV1B 4PRPB 4YHIA 2GCYB 2HWZL 4PB9L 5D2NB 4PJBB 2XG4A 5EBGA 5I1KL 3T2PA 3RJDA 1YYMH 4KTEL 5I1IL 4NT6A 1QQDB 2C4FU 5E0QA 4ACPA 1ACYL 1A3RL 5F7WC 3MZTA 5SX4I 1SY6A 1IM9A 3SJVB 3AS3A 3IB4A 3KDMA 4EN3D 4JN1H 3DI3B 2X05A 4P57A 3U4BH 5HHXL 2IH1A 4ZO7A 5EG6C 1LDPL 2E27H 3CCHB 3H9YA 3MO1A 4JGJA 4PJHA 2IG2L 2OP4H 4ONGL 4O9HL 2F54D 2GTWB 4DGIH 1M05B 5L2KA 1CFQB 4Y1AA 1MHCA 1G1CA 4WUUA 2XQBL 5B38A 1U8KB 1IAIL 1N0XL 2Q8AL 4JPKL 5C0BE 5D5MF 1AD0B 1MRFL 3HE6A 3K2MC 4L5FH 3TZVC 4Y8AA 4IRJD 5DJAA 4LLQB 2XZAH 3WYRA 1GZQA 4RGMB 3MBXL 4DVBA 2BSED 3O3UN 3L7FB 3FOMB 3RVUC 3CFCH 4HV8A 5FA3B 4MA1C 2EDHA 2P43B 1FLRL 1EMTH 2YPLA 3F12B 4LBEB 3WFZA 2P1YA 1EHNA 3FT2A 3GMMB 1E4XH 3UBXI 4GRLB 3ZKSD 3WSQL 3IAPA 2HTKD 3LH2H 4WUKH 4OI8A 3VWKC 5HYJD 4NOBA 1AY1H 1I8KA 3WLWD 3VD5A 3V8CA 3FT3A 5DEGA 2VZOA 4NGHL 3GKWL 5DQJB 4GKNB 3DVGA 3K1DA 5JW4Q 1WWAX 5B39B 2EC9T 4PRHA 3H0TB 3QZWB 4YXHL 3MMEB 1E27B 3V5DA 1Q9LA 2ZKHL 4PJCF 3ZKMC 3QFJD 3MNVB 3MLVH 1S5HA 3FOLB 2CJUL 2EIZB 3RY6A 4CRPA 4LL9A 1OSZB 3BD3A 3PWJB 4JFDE 1QPPA 2CDGB 3L3JB 2CH8A 2W9EH 5FYJE 4P49A 2ZUYA 1F11B 2VDPH 3PGCB 2NNAB 1H9VA 1KIRA 4HWZA 1J9CT 1JRHL 3EJJX 1MWAH 2VQ1A 4JY4A 3RWCA 3MLRL 1HKLL 3TM6A 4MXWH 1JHLH 3EO1B 3TT1H 1FPTL 1CDYA 5IBUG 2F53D 4LARH 4HDIB 1PX3A 5GGRY 1JHTB 5FDWA 3NCCB 4A6YA 1K4CB 5DO2D 5EUOB 4ODSH 1G9NC 4K9EL 5EZOL 1CD8A 2FGZA 3LB6C 4XTRD 5IQ9A 1H3UA 2XQYG 1FYTD 3C5ZB 3DROA 1N5YH 2CK0L 4NRXA 1BQLL 1OSPH 5ANMB 3IAGC 5CEZH 3QG7H 4HKJB 2D7QA 3WLBA 1QO3B 4FXLA 4JJHA 5T1KD 5E2WL 1N5AA 1T7XA 5E2VH 1Y18B 2WMPA 2N7AA 3ARDD 2C9AA 1PYWB 1CE6A 4PY7A 2RHEA 5HDLA 5LAXA 3A67H 5GRVL 1FFNA 1XGPA 1IFHH 4UV7L 1AQKL 3UTSA 1MCFA 3ME0A 1B4RA 2DIBA 4OD1L 1VGKB 1JV5B 2GJ6E 4TVPL 4ZAKA 3GMNA 1IGYA 2RIKA 2YZ1A 5SWQB 5EU6A 1XZ0B 2ZPKL 3CFBA 5D2LE 5DUBA 5DJ0A 4I3SH 3BP4A 4JQVA 4ZYKB 3KLHD 2Q87A 1A6PA 4UUJB 1NMBL 4V1DD 4XNZB 3F62A 3TH4T 2WLZA 5KG9A 3P4NB 5EOTB 1CGVA 4JO4H 2G5RA 4WCYH 4G6AD 3IDYC 2X44D 1AIFA 3QUMH 5E7FA 3O3BA 2AK4D 5IVXE 4Z78A 2F5BL 1FYHB 4ZPVB 5HVGB 1IILE 3QJHB 5K9OA 5EULV 3K3QA 3DHMA 4PJAF 3AU1A 3LKPB 1YY9D 1BBJB 2A38A 4HWNA 3CDGA 1A7NL 5BOZG 4JDTH 1QLEL 3T2NH 1BBDL 4R3SB 4BZ1L 2VOTA 3QCVL 4X6FA 3MLTA 1YQVL 5DRXB 4KVNH 4YHOL 4PJ9B 5FXCH 3PXJA 1AH1A 1L0QA 3FQNA 1RHFA 2HYMA 5HHME 4QRPD 5CMAB 4CU6A 4HK3J 3E8UH 3BO8B 3O3EA 2PUQT 1PDKA 2P24A 3DI2B 2YXMA 3QO0B 5JXEC 5DMYA 4LSVH 1BGXL 4D9LL 2VDRH 1NGYA 1FNEA 5CGTA 5GRJL 2P8LA 4BZ2H 2D3VA 3D2UA 5JORB 3GK8L 3BIAX 5GS1B 3MV11 1G6RA 4P9HC 4GRWB 4G7VH 5JUEH 3ZT5A 2R0LH 5A2FA 4HH9B 4BQ8A 2GAZA 4U6YB 3IDJB 4OB5H 1I85C 1VDGA 1JPSH 1P5UA 5TQ0L 4HC1L 1KCUL 4ZSOE 3SBWC 3G6DH 1V7NL 4PJHE 3P30L 2BNRD 1YPZA 2F8OA 1UACL 1K5NB 3EYUL 3FAXA 3REVB 4FABH 2NZ9C 1LP9F 3L1OH 5KJRL 3UTOA 5L2KE 5ESVB 4M8VA 4YHZH 3L5XH 4IMLB 3C6SB 3T3PE 2HLFC 3U0WH 2B2XH 4QNPE 4PRIA 5D1QC 2LQRA 2GSIB 4OZHA 1HSBA 4WUUE 1UB5B 4DTGL 5E08H 5E99H 2VR5A 3UEZA 2IANA 4KZEL 2FJFA 4LLUA 4LCCB 2VLLA 4PJXA 4TSBH 3MA7B 4POZD 2HH0L 5KTEH 1WBYA 1F3DJ 4Z8FL 2VYRE 4GW1B 2F15A 3JUZA 4HIIA 4L3EB 5SWSA 4G8FB 4EOWH 4ODHL 4BKLA 3VXOA 3LD8C 4LHUA 4KU1A 4LBEA 4PJ8A 4OUUB 2YN3A 2D2OA 1XF3A 4S1QL 1QOKA 3NN8B 5IG7B 2DDQL 1QFWI 2VLME 4WJ5A 3LRSB 1AHWA 3QG6B 4ZFGH 3EYFB 4PP1C 5FGBA 2B1AL 1WQVT 3BPCB 3VDCA 4KK8C 4I18C 5CP7B 2VXUH 3MCG1 1HINH 2GTZA 3P9LB 1ACZA 3U82B 3T0AA 5MENA 3FQXA 1H8NA 4M1CC 2JJSA 4TVPE 3BPLB 4NPYA 1J1OH 1OAQH 4KUZH 1NANI 3ROOB 3HNSL 4XCFL 1T22B 1NEZA 3QZWA 1ZE3C 4PRHE 2VAAB 3T3ME 3DVFA 1FIGH 4RRPA 1W0WA 4OCYH 5H37G 4ZG1A 1UWEL 2YD7A 3FO9B 1GOGA 2MCPH 5CIPB 2I5YH 5T1MB 1MRCH 4OUOA 4GMSL 1G6RL 1OSZA 2X09A 3KXFB 2VXTH 2EXYC 3GM0A 5I1JH 3BIKB 2OTUB 1FFPB 4C56D 4OJFH 3G5ZA 3UPCA 3T1FA 1J8HA 4N8VA 4JQXA 2YR3A 2APVA 1RV6X 1XGQA 1XF1A 5FIEA 4OCMC 3CFJB 5ITFB 4MJIA 5TPWH 3GSNL 3NAAH 4H8WL 4XXCA 4OD3H 1CICB 3HS0A 5LWYL 4MS8D 4PJIA 2FJGB 1U3JA 5IVZB 4OM1H 1TCRA 4UQ3A 2D31B 3WIHH 3QXAB 2QHRH 5T1KB 5L0QC 4JFFD 5FGSA 3C09B 3HI5L 1A6VH 1W72B 1NFDE 3BWAA 4PREB 4D3CL 1FBIH 2A83A 3GB7B 2MPAH 4XP1L 1LHZA 3LN5A 2AW2A 4YE4H 4HJJH 4DN3H 3QI9A 1PFCA 2R0WH 4UV4H 3DRTA 2FCBA 1H3WM 3DX7A 4KJYB 5SWZB 2GQHA 2ZUWA 4UNVA 4LVOB 4JRYB 4YDIL 3VXMB 2XWBB 3GMRA 2W59A 3B5HA 4NM4H 4L3AA 1KB5A 1PLGH 5C0AA 1YJDC 3LEVL 4X7DC 4JHBA 3TBVA 1RULL 1YYLH 2OLDA 1NGWA 1G7HB 4KRPD 5J1SC 1Y18A 1CGTA 3DARA 2NY5C 1I7TA 5FCUH 1NAMB 1FC1A 5KVEL 3DLQR 1MQKL 5E8DH 4LVHC 3MREA 4XNUL 1QVOB 4XC3H 1CTNA 3BT2H 4WO4B 2ZUSA 4L8BA 4R2GC 4XP4H 2EICA 3DIFA 3F5WB 3D0VB 1RZJL 4D9QE 2VN4A 2J4WL 3WNLA 4I77H 1CLYH 5EFIA 1EPFA 2DLHA 3EYSH 3GSVA 4Q2ZB 4WHTA 5ECJE 3TO4D 3C08H 4QXGL 5E9DA 1ADQL 1I3GH 4RWHA 5SWQA 2AGJH 3C60B 1SEQH 3RNKB 5E70A 1Z3GH 1KTLA 5EU6E 1V3MA 2JCCB 3L3KB 2OJZL 1CLZL 4I0KA 3STZA 1HOCB 1CXLA 3VXUB 5IWLA 5HI3C 1B2WL 5F7UA 3BPNC 3I50H 5FOBB 4ZDHA 3VGAB 4R4NC 1MCHA 3WEXA 4UT9H 2WUCL 4GXVL 4H20H 4JFPA 2BY0A 4DVRL 2AI0L 2FGWH 4CL7A 2Q76A 4LSTH 4KDTA 2KPNA 2XWTB 4XPGL 4ZPVA 3K81A 3MODH 3QUXB 5HHPB 1HHHB 4E0RB 1QFUH 3BZEB 3LY6A 3EYVB 3QJHA 4K8RC 1S7UB 3QH3A 5A3ID 1D5IH 5ESQA 3OX8B 1TNNA 2QTEA 4L9LB 1MPAH 3JSSA 5ADOH 2BOCB 4JFQB 5E1HB 1HSAB 5BCAA 4K55A 4PJFB 1TIUA 1S7VA 5HGAA 1TTUA 3W39A 2YRZA 4EN3A 2DL9A 4MDIA 1SMAA 5J11B 2X7LB 2WLYA 1AC6A 3IU3A 1A2YA 1WAAF 4W4OA 1EFXB 3TVMB 4UINH 3QWOB 4HS8H 3DGGA 4Y89A 2F54A 3BO8A 1NH6A 3VD9A 3PABB 3I75B 2AXHA 3DYOA 3V6FB 2DLFH 3OKMA 4PBWD 4PJ5B 1NAKL 4DKFH 5DK0B 5L9DH 2FX9H 3LAFA 3ULVC 5GS1A 1SEBB 2NY7H 3GSRA 4YDVA 3H9SD 1TJGH 3VFTB 1Q94B 4XGZB 3E1F1 1R5VB 3QUZB 2DQDL 4IRJA 4DAGH 4YHYB 5CZXD 2R69H 2AV1B 1TQCB 3OR7A 1UB6B 3KPQA 4NFCA 1R24A 2H6PB 2AXGB 1IQWL 5I8CA 3UJTL 2QSCL 3UBXA 4JDZA 1RZIB 4LVEA 5D7LD 2P5WB 3MUJA 1BLNA 1YPZE 5F9OL 1ITBB 5IVOA 5C0CD 3FB8A 3LS4H 2AJYH 3ARTA 4AT6A 1MLBB 2UZIL 2R2BA 3RTQB 5CEXB 4QYOA 2MQCA 4TRPH 3BZFA 4OZHE 2FL5A 2CLVB 4N0FA 3BRGC 2OTPA 1JZ5A 4P2YA 5F7EL 2EDTA 2MMXA 5ISZB 4R90L 5HYJA 2P5EE 5LGHL 2IANE 2FYYA 4NCC2 4ODTH 3N1GC 1FJ1A 3QAZB 3SGJC 3INUL 2YS4A 4PJXE 4ZQKB 32C2B 1Z2KA 2HKFL 2X4OA 4M00A 3D85B 5D9SA 3VA6A 4ZOEA 1BVLA 2GUOB 1EZVY 1OQOA 3SDXB 4JFHD 3LMJH 4LRNL 4ZD3H 5TF1H 5L8LB 2X89D 5K9QG 1QR1B 1RK0B 1I3UA 2A2QT 1T66C 4CVZA 1FVCB 1CGWA 1ULVA 4Y19D 1Y6NR 3QFJA 5C0DB 4FFYL 1AKJD 2DQTH 1GPOL 2IGFL 3R4DA 4LF3A 3O2DL 4Z7UA 4WTZG 3NCFB 1YMMD 2GIYA 3VFOA 1IC7H 3SE8L 5IJVB 5DZLA 3PL6B 1T0NA 2HJLB 5I9QC 4MXVE 4YQXH 3ARBC 4MVBC 5MENE 5IMOB 4HKBB 5MEQA 1SJXA 1YN6A 5DHYA 4EBQH 1T7WA 2V9RA 1N3NA 1F4AA 2NX5E 5BVJB 2DQIH 4GO6B 4XHQA 4AYFA 3U2SB 3QEUA 4KK9C 3HKFA 3S35X 4PJ7B 2XFXB 1MCEA 4G7YH 1HH9A 4F37F 2J6EH 5ACMA 3TYGL 2CDFB 4MNGB 1U92B 5F1KC 4EVNA 2F53A 4ODXA 4M62L 4Z7OE 1LO3L 2OR7A 3QUYC 3DXAE 1MIMH 4FQIL 1F3RB 5J89A 1NGZB 3IFLH 1JWSA 2HRPH 2VZUA 1PZ5B 1MCBA 2Y9RT 3LQZA 3RWJB 1J8HE 3TN0C 4KC3B 3QSKB 1FG2A 2XTJE 1S7XB 3C8HA 5HHMB 3CFJA 1AE6H 1CL7H 2NY3B 5GPRA 4MJIE 2Z0BA 3P0VL 3N1PC 1X5IA 3L3OA 2QADB 2FJGA 5ERWB 1FVEA 1FZJA 3NMEA 4GXUM 4PJIE 5DTFB 5JHDB 4RZCB 5TDPA 2XIDA 1FZMB 4NNXA 5T1KA 1FSKC 3QIUD 1SM3H 1L7TH 2DKUA 5FGRA 5HD8C 4O5LL 1W72A 4LCUA 3ARDA 1E4XI 1JCKA 3U46B 1OWWA 1ED3A 1RZ7H 3QIWD 4KI5D 5TE7H 4OGYL 1D7FA 4U3XA 1P4BL 4RGND 1CE1H 2F5AH 2VH5L 1DE4B 4QXWA 2Y6SC 1RPQA 4OLYH 2W0FA 3CU7A 1FDLL 3K8KA 4OQ1A 4LSUL 1V3LA 2AJ3A 2QQNH 5H37H 3MOBL 3U9UA 2O93L 5DJ8A 3ARVA 4N8PA 1FGNL 4NQSB 3MGTB 4UAOB 5JO5A 5TE6L 3AMLA 4X4ME 3FB5A 4KQ4L 5C0AE 3W2DH 1PSKH 4CMMB 4V1DA 4U49A 2NY1D 1GAFL 3UX9B 3U4EB 2PTTB 3CFDA 1MJ7L 5DURB 3QPQD 1DVFC 1IGJB 4D0CB 5EBLA 4KV5F 2JJTA 2L7JA 3BISA 4FQQA 2AK4A 4KTYA 5BV7C 3ORJA 4H26B 4UBDD 1CD1B 2BNUB 1LO5A 3AY4C 2BRRL 4Y16D 5D93B 4L1HA 1A6ZB 1UQSA 2VDNL 5E9DE 1JE6A 1FFQA 1BZ9A 3GJFB 1HNGA 5J9PB 3T0XA 3IFOA 2VUOA 4U6VH 4IRZH 5EOCJ 3IKKA 1TITA 5GS0C 1WT5A 4M7ZC 1X6NA 4HZLB 2YEZB 5L88H 1HHGA 1SVZA 3IXAB 1DUYB 2R1XA 1OAZL 4N90E 3LKNB 5A2JH 1CFSB 3FN0H 3MPCA 4QHNB 4WDIA 3AREC 2P8PB 1LEIB 4JFYA 4QRPA 2VN7A 3D39B 2XWTA 4NQUA 5JOFA 1HHHA 2H26B 3RL1B 1GZPB 5CEZD 4B0MM 4HLZG 3VXSB 2BRQA 4K3DL 4O2EA 3EYQC 5DQ9A 2XPGB 5KN5A 5DVKA 1ZHLB 1LK3H 3GMPB 4UB0L 4P46D 4JFQA 3I6KB 5GISL 1YMHB 3RU8L 3OBAA 3HA0A 2BSSB 3W82A 1B0RB 3E2HB 3PQYB 4PJFA 4WI3A 4ZNCD 1EHAA 4MLSA 5DD1H 1CD9B 1R3IH 3LEYH 3BSZL 3O11B 3MLZH 3F6IA 4QXUH 5GGUA 3S36H 2VDML 1RJZA 2B4CH 5HXMA 1S9YB 4LCIH 1JGDA 4LLWB 2WINB 1FORH 3ZYZA 2Z4QB 2BNRA 5D7LB 1A9BA 1DEEA 2IPUK 5EA0L 3LIZH 3LZFH 5D71L 5IOPB 1AGBA 1RJYB 1UZ6E 1T1YA 4GRMB 4RWYL 1R3JA 5HDBF 25C8L 5C0FB 1JNLH 4X6CF 1RUQL 4GLRH 4I0PD 3M1BA 2AV1A 5ADPL 4MJ4A 4HUUB 4X5LA 4XBEH 1YNKL 3CVHH 4XMLH 4JGMA 3LQAH 1NFDB 5TGBB 1UCBL 2CRYA 4X8JA 2DQFA 3VGEA 2HG5B 5HYQB 4S2SA 1BQSA 5DC9B 4LIQH 4EEEA 1U42A 3JVGC 4N8CL 4X6DF 5F1NB 1P4LA 5D1XB 1EUUA 1EVUA 2Y7QA 2Z93B 4YPGA 3WXVL 3IGAB 4HIXL 5DJCB 4XZUB 5BXFA 4F7MA 2FO4A 4AIXA 4YHLH 1NDGB 3EIFA 3QPXH 3DO3A 1XGYL 4DZ8B 2CRMA 1AKJB 4KDWA 4QHKI 1G7IA 1UC6A 1OB1A 3SN6N 4U1JA 5HYJE 4KY1H 2IH3B 4A2MA 4RIRB 2Y36H 3RNQB 4R4FH 2EYRA 1JWUB 1VFMA 2J8OA 5IW1A 4I9WD 2C3GA 3PDGA 4LAQH 5L6YH 4N5EC 4XCEA 4EDWL 2GUOA 4Z9KB 4RGMC 1T7YA 4KKLD 1U8NB 4R0LA 1M71A 1PGRB 1AO7D 3FB6B 3BHBA 4HWBH 2QQLH 1RU9L 2Q8BH 1D5ZB 1HZHH 1U93B 1QR1A 2AK1H 1P6FA 3QDAA 2D7TH 5GQBA 1QBML 1UZ8B 5HHNB 1IC5H 4FZ8L 5ENWB 4KKCC 5I6XB 1RUML 3GMLA 3HC0B 3NTCL 3OZ9L 3QFJE 1RMFL 2J8HA 3HNVH 3RL2B 5BZWA 3ZL4H 2H8PB 1A14L 4X7FC 2V17L 4C56A 1ZGLB 3MQIA 1KCRH 3ESUF 5IMOA 4KAQH 4HKBA 2AEPH 4JKKA 1TZGH 4L1DA 5DDHA 1S78C 4NHUA 1VCAA 5I8EB 2XRAH 3MRJA 5DD5L 3TC9A 4Q0XL 1UXSA 3V5HA 1IEBB 3OB8A 3VFVB 3U6RA 2IC2A 1MSPA 5I74C 1XF5B 3WDHA 2VITB 3S3JA 2BVOB 1AR1C 2MTPA 1MCCA 5K33A 4JFFA 3BKJL 2YN5A 4CNIA 1JI2A 2ZOKA 3D9AL 5MP6H 1F58H 2YUWA 2PXYB 2AJSH 5T3XH 1PY4A 4TUOA 4P2OD 4CJ0A 3O2VL 3PWVB 2Q7YB 2F19H 1PZ5A 4OV6F 3VD4A 1U3HD 1K8DA 1LP9A 4PBVC 2DI8A 5DGRA 4DZBB 2DQJL 4HGWA 3P73B 1QFWL 3QCTH 4UQ2B 1KJMA 4K3JH 4XVJL 4WU5A 1WITA 3QXWA 3Q48A 4NKQB 1FYTE 3CIQA 5EO1A 1X7QB 2WQ8A 3BH9A 4EI5B 3K2UH 4M9OA 4HIJB 4QEGA 4HIEB 5D5ME 4MNHA 3KYAA 3QXDA 3D87B 4NWTL 5IB4B 1IL1B 1YEKH 4OLVL 1DQQB 5EWIL 5AG8A 3F58H 3KPRE 3A6CH 1NCAH 1BZ7A 5BW7A 4HZAA 4JR9H 5EPMA 1ND0A 2IF7A 3B9KB 3WFDL 5CD5D 1LWRA 5ETUA 2W0PA 4WTXA 3SQOL 2HLAB 3S4SG 3EGSA 1BF8A 3TO4A 4OIAA 1H3PL 2AQ3A 2R1WB 3VXRD 3GMOA 3E6FB 1R5IB 1QSEB 3GSNB 2EDEA 1TMCB 5CHNB 3OGOE 2BXYA 3OJMB 3FT4B 4PUBL 1BAFL 5C0RL 4Z5RA 1T83C 5DFVC 3BE1H 1NC4D 1VFBA 2QSVA 4E41E 3VXTB 3HAEA 1KGCD 3V4VL 5JDJA 1KBGL 1P9MC 2P5EB 4DK3A 1XGTB 2MNUA 4FFZL 5D96B 4NZRH 3V0WH 1DSFH 5D7IF 2AABH 4MQ7A 2WBKA 5IP4A 2AK4E 2BNUA 3EHBC 4ALAL 2NPLX 4JHAH 4OBRA 1BZQK 1HXYA 3I02B 2CIKB 1T5XA 2M26A 4OZGF 5D7KD 3V6BR 4BZYA 1T03H 1NC2B 1NL0H 1CGSL 3ZTJG 4UDUB 4BUGA 3QNXA 4ODUA 5CJ8A 3RKDC 3VFPB 4NSKB 3CVIL 3C2AL 5LCVL 1I8MA 4ZUSB 5T3ZL 1EEZA 3QULB 1JGEA 5E94B 1J5OL 3GSXB 3STBA 1HILB 2F58L 1ZSDB 3CXDH 5KANI 4OF0A 3ARFD 1YUHB 2DLIA 4ODVL 4U1KB 2HN7B 2J5LB 2OXHA 5CWSB 2UWEF 3ZDZF 4LGPB 3ECBB 4KRLB 1LEIA 1KIQA 5BS0E 3FO2B 1EV2E 5GGRA 1JZ6A 4HFWB 1ZHNB 2FR4A 4QRPE 1FZKB 1PX4A 5CILL 2H26A 4XI5C 1K8IB 3BP6B 4NKDB 4JY5L 2ZOLB 3TH3T 4GUPB 2MFNA 3KS0H 3NZ8B 3X3FL 1F6LL 3QISA 2CQVA 1ZHLA 4ETYA 4P4KB 4GKZA 3GJEA 5E6ZA 2NX5B 3KWWA 1T0PB 2IQ9H 2D7MA 2LTQB 3H9SA 1KCSH 1B0RA 4WW2C 5FYKH 5HDQL 4R8WL 2JIXD 4RGOH 4XBPB 2Q7NA 4GBXC 3MJ7B 4JDVA 2XWJA 1IC1A 1DBML 4IS6A 1W0YT 4JG1L 1CQKA 5LXGL 4LSRH 3SDYH 4Z95H 1DQDL 1MI5D 1A6AA 4GAJL 1PG7H 4QRSA 3TIEB 3S37L 2W9DH 1C1EH 1TVDA 1C5BL 4IIQA 2D03L 3DXAB 2BMKB 1KIPB 5D7LA 4NQVA 4PJ9C 1P53A 4JPWH 2HKHL 5C0CA 2V5TA 1C08A 4MAYB 2X41A 2XTJB 4FTVB 3NCEB 4XMKL 3TJHD 4M61A 1T3FB 3BH8B 3IDUA 4G3YH 3SDCD 4K7PL 2I9LB 4XRCB 5FB8B 4OZ4A 1YEJL 5C0FA 4ETQB 3H7BB 5DRNB 4RAVB 2FZ3B 5HVHC 4ESKA 4PGEB 1IBGL 4HUUA 3S97C 3AGVA 3RA7H 2DBJA 4OD2B 1KLFA 3EDKA 4L29A 2GI7A 1BJ8A 3B9EA 4EUPG 5DQDH 4ORGB 3S98A 2NXZC 3O6FC 1RQ5A 1QSFB 4M6ML 4PGDB 3VE0B 5BVPH 5ID0B 5FUOH 1MLCA 3E3QE 2X89A 3LS5H 3KVQA 2HT4D 2RB8A 3O9WD 3PDOA 4ERSL 3SKJH 4HX1B 1INQA 3IGAA 3TV3H 5EOCL 5CBAA 2J8UF 4Y19A 5I8OH 4S1SH 2AAVA 1AKJA 1JIBA 3IETA 4ZTPH 4CADB 3C9NA 4X8XA 4X7TB 5DRWA 1YMMA 5FM5M 4RIRA 2OBGA 4QHMA 1U8OB 3HNTL 4X99B 5AD0A 5TE4H 1BJ1H 1HYRC 4MNQD 4O58H 4TUJB 3UDWC 5C9JB 5KVFH 1J0JA 3DOSA 5FYLH 2AS5M 3FB6A 1N59B 2B5IB 3WFHA 1EERB 3U9PL 4HPYL 1U93A 4DW2H 2CKBH 2G5BA 2VJXA 4C58B 5BOPA 1M7XA 2BSTA 4PJAE 1U8IB 5FA4B 4XWGL 4JY6B 3MOAL 2DWEB 5E4EC 3U7YH 3ZSSA 3C5SA 1C5CH 3HI1A 5ENWA 5EU3B 3OF6D 1D9KD 3DECA 3OKKA 1K2DB 4Y5VA 4GMTL 2A77L 3RL2A 5TDOB 1JYWA 1WAAA 2WQRA 3SKOB 1J87A 4NFDA 1WICA 3DWTA 4X98B 5H94B 1FNHA 1YNLL 1ZHBA 4KHXL 2CUIA 3VI3F 5BRZD 2YRPA 4NO5B 5E8PA 5EORL 2HFFA 2YKLH 4TULL 3D6GA 3MACH 1JUFA 4KUCF 2CIIA 4YR6A 4WW1A 5IF0A 4BJLA 3KAAA 5CINL 3BPLC 3IDMA 3WE6B 2EDRA 4UMGA 2ZWLT 2W60A 1G9NL 3QDHA 4RFEA 2X70B 1GRWA 1L0YA 3QIUA 1F5WA 6FABH 1XR8B 2PW2A 3MRMB 3PGFL 4JFFE 3GBMH 3MX0A 2HJFA 1OAUH 4OFVA 2HFGH 3QIWA 4M48L 3MLUL 4WHDA 1KFAL 1QKZH 4OCRL 2X1WL 4NUJB 3VRJB 2XKUA 4F57H 3VXNA 4M4RA 3OPZH 4U1NB 4ZXBB 1LP9E 3BGMB 1RZ8A 1ZT1B 5AZ2H 3HRZA 4JQIL 4AH2A 3M8OH 4YDLC 2CGRH 2XKNB 2H32B 2A9NH 3U7AA 3P4OB 4OSUH 1YA5A 1I1AC 1LEKB 1JZ8A 1PQZA 1B3JA 1YN7B 4L4TD 4P5KA 5SX5K 2NY5H 3A6BH 1CICC 3CDYA 4FZEH 1AP2B 2XV6B 5JR1H 4JN1L 4DKAA 1A4JA 2BSRA 4DWHA 2DF3A 2ZUUA 2OP4L 4UTAH 4HKXB 5HGDB 1E6JL 3ARGD 5AZEH 3CSBA 3KPLB 1X5YA 2EEBA 3OHXA 4ZTOL 4BA8A 3C6LB 4Y16A 4XCNB 15C8L 1LDSA 1UVQB 1TLKA 4YFDB 1R5IA 2EKSA 4NYLB 1TJHH 2MKLC 4KK6C 12E8H 2NY4B 2R2HA 4JRXD 5KSVA 1KPVB 3J7HA 5DD6B 4MWFB 1KCKA 4KGLA 4YDKH 1TPXC 4Y2DB 5ID1A 3GUTA 3CFEA 4HLJA 3VXTA 3MLYL 4J3UA 2JK5A 3SKMA 1M7IA 1UG9A 3TA3D 4Y5YC 3DMMB 4TUKH 1MCOH 5HTSA 3V5KA 5E6YA 3MRHB 1K3ZA 3CFCL 4K8RH 3I02A 1A1OB 4LDOB 1EMTL 2A74B 3QA3A 4WO4C 1P7KB 3BYYA 3SDAD 3RWDB 4P46A 3HI6H 4OFPA 4ZS7L 2X4RA 3KHQA 1CL7I 3C60C 4UDTA 1IAKB 3QHZL 4WUKL 1VGEH 5D1ZD 3FJTA 4Y4FD 5FKAA 5HYEA 4HGKC 1MI5B 2HN7A 2K1MA 3LQMA 1ETZB 3VGAC 2WBJD 1TVHB 1FNSH 1IEAB 2HFEB 4LQFH 4K3EL 4NCC1 1ONQB 5IBUB 4QT5B 3S3SA 3ULSB 4M4PA 4M7KH 3VDAA 3O6LH 3ULVH 4HXBL 3NZ8A 3QUXC 4NQCB 3BQUD 2GITB 1RZKC 4O2FB 2Y07H 3S5LG 1CFBA 4X7SH 1ZVHA 1FZOA 4JCMA 1T5WA 3H9SE 4L9LC 4I0PA 1SY6H 3QUMA 4H25B 5GGTH 4PGCB 2DN7A 3TT3H 1HI6A 1P4IH 3S7GA 5L2JB 3GDBA 1SJEA 4NZJA 2W9EL 3BEWA 5JXAH 5J12C 3QUKB 1GGBH 1G7LA 1UJ3A 2BC4B 2EDBA 3DBXA 3QEHA 4R96B 5C0CE 4M1GH 1MWAL 4FTVA 5GSVA 3JV4B 1WZ1L 4H1LG 1PAMA 4P5TD 4ZPTB 4MXWL 4WY7H 5FB8A 2VLJB 4ETQA 3TT1L 5DRNA 3WFCL 1KJVB 1DP0A 3EYOB 1NGXA 4UILL 1H5BC 3CH1B 1KLGA 1O7SA 3CDCA 3QDJE 2O26U 5BQ7A 3QUZC 3ARRA 2ZNXA 2VO5A 4ODSL 4FG6C 1AGCB 1FL5A 1JGLH 2GHWB 2E9BA 3DTXA 2DWDA 4GSDL 3HPLA 4F9LC 3ELAT 4PJEB 1RHHB 3RY5A 3KJ6L 3B83A 1AO7A 1KLUA 4JFHE 1FE8L 1LNUA 3HE7C 3B9VA 1ERNA 2YOCA 3R8BB 1CZ8L 4R4BB 4HX1A 4OLUH 1EFQA 4YHPA 2XA8H 4PTTB 2I25N 2DKMA 5FV1L 5KS9F 5D72H 1CU4H 5E2VL 1A4KA 1BVKB 4GG8A 4JM2B 5E7BA 4KJPC 1X5HA 4OQTL 3U0TA 4NQED 1GGCH 1YMME 3P9MA 1LO4L 1LK2A 4E41B 4J4PD 3QQ9C 4IMKA 5J6GA 1U9KA 1MCKA 5JW3L 3TZVD 5D4QA 2QR0B 5BMFL 4Z76B 1YEDB 3VH8A 2E9WA 3VI4F 4FFVC 2YD9A 1UYWH 5DHVB 3BGFB 1MCPH 5C0EA 1KN4H 3VG9C 3OWEA 3QNYB 3I6LD 4PJCB 3OGCA 4P2OA 3WIIL 2BDNL 4GLRI 1WAAE 1T1XB 1AI1L 3WXWL 1MRDH 4NO5A 4M43L 1U3HA 4MDJB 2BOBA 4BK4A 3HB3C 1G7PB 43CAA 4J1UA 5JW5B 2EDLA 1MCSA 1NLDH 5ELIA 2UZYB 5DVOA 4QOKB 4QTIH 4PD4J 1XGRB 2MKWA 5DK3A 2HTLD 5I1HL 2IFGA 3MRKB 4X6EA 4X6CA 4W81A 2DBLH 4UT6L 2X4SB 1KENH 3FB7B 3T2NL 5JTWA 5E2TL 3L7EB 1MFBL 4M8QA 1I1FA 4KVNL 1WEJH 2NTFB 1A1MA 5T5FH 2R8SH 3MUZ1 2X4QB 2JE8A 4XC1H 5J3HC 4A6YH 5GHWH 3CFIC 1IKFL 4RGNE 3VG0L 1YJDL 3PNWB 4YHKL 5E03A 4X6DA 4NO3B 1NBZB 3MRGB 4NBZB 1H3VA 3ZKMD 3ARZA 1KTRL 3MRNA 2VDRL 2H32A 3VXRA 3S88L 1EVTC 2YWZA 1YDPB 1U0QA 2F74A 1Q0XL 2P7TA 2XZCL 1JI1A 2NY3C 4G7VL 5JUEL 4P2RD 1EAPA 2OL3B 4AL8H 4NNYB 2R9HC 3QCUL 5JHLH 1OGAD 4XPFL 2E7LA 3WFEH 1NC4A 3RUGB 1OTSC 3P0YH 5C8JB 5DJ2B 4MX7B 3GZKA 1T1WB 2FX7H 2YSSA 2GYSA 4P4RA 3WCYA 1JPSL 3V6ZB 4OV5B 3P11H 3RGVC 3IAQA 1NCCL 1MNUL 1Q1JH 3T0BA 4RDQF 2OR9H 2P8MA 3LKOA 4ODBD 3VWJB 3WIHA 3D3VD 2A9ML 1VENA 3U0WL 4XAKD 2PYFB 5HJ3A 1DLHB 1A7OL 2YK1H 4XX1G 1KPVA 2YC1A 3TBTB 2VL4A 4WEMB 3MRDB 3CPLA 5AAWA 1I7RA 3QDGE 4G8GD 3SY0B 4PV8A 4G6JL 5MERA 3LB6D 1BM3H 2OQJA 3ARFA 1I7ZA 3IVKB 4LPUA 3ZKQD 4M3KB 5E2UH 4U6XB 4G42B 1U6AH 5C2BH 4EOWL 1NDMA 2ITCA 4PS4L 1DTUA 1CXFA 5CEZE 3MUGB 4GG6F 3WHXA 2O5ZH 5CGYD 4JG0H 3KPPA 2G75B 2R23B 3T1WA 1EJOL 3HZYB 1TVBB 1FN4B 5D93C 3X14A 2NW2A 1F13A 4OT1L 5BJTB 1JL8A 4ZFGL 4ODWB 4PJAB 2JIXA 1ZLSH 2D7OA 4MA7H 2DQUL 4YNYB 1OWRM 3QWQB 3ARWA 2DD8H 2VISA 1HINL 1MI5A 5DYOB 4IRSB 2Z31D 4OKVB 1ETZA 5IGXH 5F7KC 1DQJB 1RVFH 3BVNB 3TIDA 1J1OL 1MFDL 4N0UB 4XP9H 5C0GA 4X4XB 4W6XB 4KKBD 5IVNA 3LSOB 4NDMA 1JPGA 1L4IA 2IPTL