1W6LA

3d structure of cota incubated with cucl2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
503
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 143
structure length 503
sequence length 509
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA02
3PLYA 4BWTA 2VSKB 4M3HA 2YAFA 1SHXA 3FQYA 1B3IA 3H56A 4YSQA 2VW6A 1MZYA 2H47C 2FTAA 2YAOA 4YVUA 1W6WA 1T5KA 1SDDA 4KO7A 1GS6X 3FU8A 1TKWA 2PPFA 4UF7C 1KDIA 1SF3A 3CVBA 1NIAA 4GYBA 5I5IA 2AFNA 3WI9A 4Q89A 5LDUA 3AG1B 1SFHA 2IDTA 1RKRA 3CVCA 1MG3C 1BQRA 2CBPA 2RACA 2AZUA 2DYRB 3IN0A 5I6OA 1BEXA 1JZEA 2YAMA 3DIVA 1PZBA 4YSAA 1JERA 5B1JC 4HHGA 1E5ZA 1L9OA 1PLCA 2GIMA 3HB3B 1J9RA 1A65A 2EIMB 3FU7A 1ILUA 4PAZA 2VW7A 3UACA 1AZCA 1WS8A 3PPSA 7PAZA 3QJUB 4YSSA 4GP4B 3CDZA 3S8FB 3JT2A 2HRGA 1L9PA 3NJHA 5I6KA 1OOWA 1BXUA 2BZ7A 3NJGA 4A2DA 1NIFA 1AS8A 4F2FA 3NP3A 4YSOA 2HX9A 3MX0B 1CYXA 3UADA 1NDTA 3AZUA 3DKHA 4HCIA 2NRDA 3QPKA 2FQEA 2IH8A 2GBAA 1JOIA 1PY0A 4NB7A 3CZUB 3OMNB 3GDCA 1NPNA 4GP5B 2OCCB 3RYMA 2JFCA 3X2QB 1F56A 4KOBA 2BP8A 4BDVA 2EIJB 4X4KA 1ASQA 4JKNA 1BYOA 5B1KA 1SFDA 2BO0A 1NWOA 5D4JA 5B1JA 1CUOA 1AG6A 2HX8A 5I5JA 1GS7A 1L9SA 3X1FA 3NSCA 5B7MA 3T6VA 1PZCA 2X88A 1BAWA 1GR7A 2VN3A 2ZWNA 4AKPA 1M57B 2UXGA 4UAHA 1PMYA 3NJKA 5AZUA 1NWPA 2B3IA 1GW0A 3NSDA 3BQVA 1R1CA 1PZAA 2H5UA 3SQRA 1KBWA 2P80A 4A2GA 3PAUA 1XMEB 2QT6A 5F7AA 3NJNA 1DYZA 1OCCB 1NPJA 1JXDA 1OE3A 3X1GA 1RCYA 3NJFA 5PAZA 1KV7A 4YSDA 1AOZA 1AS6A 2E86A 1XB3A 3FSZA 5D4HA 1BYPA 2GB2A 2QDVA 1OE1A 1JZHA 4TXVB 2R7EB 2YXWA 4DP5X 4GP8B 2XWZA 3PAVA 3PCYA 3FYEB 4BK5C 2XX1A 1GS8A 4KNTA 3V9EA 5I5MA 3JTBA 1WAEA 3NT0A 3NSFA 2PLTA 2XV2A 3SBRA 3FYIB 4DP7X 2YXVA 3ZX1A 4DPCX 1JVLA 3X1NA 3H4FA 3OQRA 2HRHA 3G5WA 3UAAA 2DWSA 2N0MA 1XB8A 5PCYA 3TBCA 2YAQA 1AZUA 3EHBB 1OCZB 3C75A 2HZHA 5B7EA 1DZ0A 4G72B 1AANA 4E9VA 1ILSA 4P5RA 3AG4B 2P80D 4HHWA 1MG2C 2FNWA 4WKXA 2IDQA 4AI7A 3WKPA 4K9JA 9PCYA 1BQKA 4N4YB 1PCSA 1JZGA 2FQGA 3ZBMA 1GYCA 4E9RA 1RZPA 2I85A 4HCGA 1OF0A 1JZFA 1W6LA 2QPEB 3QJTB 4DP6X 8PAZA 4F2EA 2XU9A 2PP7A 1FA4A 4N8UA 4E9TA 3NJMA 3OMAB 1KYAA 1PF3A 1SDDB 3ASOB 2IDFA 3PAZA 1HAUA 3NJIA 1IKOP 2Y69B 5I6LA 1OCRB 1GSKA 1SNRA 1MDAA 4G7RB 2UXTA 1V10A 1CURA 4A2FA 2MRYA 3X1BA 4E9YA 6PCYA 4NERA 1ZIBA 2J57A 4M4RB 3FPYA 3WIAA 2FWLB 4KNSA 4AKOA 2YAHA 2AZAA 2GC7C 2DWTA 2J55A 1E30A 1I53A 2YAPA 3S3CB 2XX0A 3GXUB 3EF4A 3WNIA 4YSPA 4JHVA 1E67A 1E65A 1OV8A 1PAZA 3NP4A 2CJ3A 4DPBX 1GY2A 3QJQB 1SHWA 1AZRA 2XV0A 4CSZA 2HLEB 3UABA 2FQDA 3FU7B 2ZXWB 3NSYA 4DP4X 5A7EA 1TEFA 1PNCA 1ETJA 1SJMA 3QJSB 2FQFA 4GY4A 2OV0A 1ET7A 2W8CA 3CDZB 5E9NA 1AQ8A 3ABGA 3OM3B 1YLBB 2VM4A 4BXVA 2IWFA 1AR1B 1M9WA 3ERXA 1KCWA 4CSPA 2IAAC 1WA2X 3ABLB 2BW4A 1L9RA 3NJJA 1J5DA 4PCYA 2JKWA 1WA0X 2ZONA 4UANA 2FJSA 3CG8A 1QNIA 2YAEA 5D4IA 4DP1X 2BZCA 4QLWA 1KGYE 1ET8A 1AAJA 2VMJA 3L45A 1A4BA 4G71B 3SBQA 2BP8B 4BDVB 1PLBA 1JZJA 1CC3A 3CVDA 4A66A 2BP0A 2LLNA 3T9WA 1FWXA 3PXLA 2CAKA 4DP0X 4ZK8A 3OMIB 1A4CA 1KBVA 4RH4A 4AX3A 1AS7A 1J5CA 1XB6A 1AG0A 2JXMA 2AVFA 3FU9A 1A4AA 2IWEA 2ZOOA 1RZQA 3ASNB 2IDSA 4F7KA 3IN2A 4YSTA 3ZIYA 1UATA 3WG7B 1W8EA 1PLAA 2BP0B 5F7BA 1V55B 4YL4A 1J9QA 4QKTA 2FT6A 4W9ZA 2PP8A 1PNDA 2UX6A 2HXAA 1MZZA 5I28A 3N2JA 1KDJA 5B7FA 4YSCA 3H4HA 1TU2A 1URIA 3ABKB 4KO9A 4AZUA 1ZDSA 2IDUA 1L9QA 3FSWA 4YSRA 1EHKB 1NIEA 2VSMB 2QDWA 3FT0A 2EILB 4FAAB 4YSUA 1J9SA 4MFHA 1HAWA 3QQXA 3WKQA 2XVBA 4A68A 4A2HA 3IE9A 5AKRA 1HFUA 2YQBA 2X87A 6PAZA 2BWDA 3AY2A 4BWWA 4A2EA 2DV6A 3WNJA 3TA4D 3FQ1A 2PP9A 4KOCA 5AFAA 2PCFA 1BXVA 4A67A 3FQ2A 3SBPA 1JXFA 2WSDA 1AACA 2HX7A 3EH5B 3ZDWA 5I6NA 2XUWA 3T6ZA 4GXFA 1ASPA 1L9TA 3FSVA 3ABMB 3KW7A 2WO2B 1BQ5A 4HCFA 3EH3B 2CCWA 4Q8BA 2PPCA 1AZBA 3NJLA 2I7SA 3AG2B 1IBYA 5TK4A 2XV3A 4E9XA 5B3SB 3FPXA 4L0PB 4BXSV 3AG3B 5B1AB 2W88A 2UXFA 3OD3A 2VW4A 1QHQA 3T6XA 1AIZA 2XXGA 1ET5A 5EHFA 4G7SB 1NINA 1EZLA 2BW5A 3FSAA 1JZIA 1X9UA 2DYSB 4JHUA 3S3DB 2XLLA 3DTUB 3S3BB 3TASA 3BVDB 4KO5A 1JXGA 2CUAA 3UGEA 2GC4C 1TEGA 2J5WA 1ID2A 4EF3A 3TU6A 2UX7A 2YARA 2UXVA 2QPDB 1AZNA 2GI0A 1BXAA 3QJRB 2GHZA 2A3TA 4HALA 5TK2A 5I6PA 1VLXA 2CALA 4P5SA 3T71A 5FC9A 3UAEA 4KO6A 1WA1X 4BWUA 4NAJA 4WTQA 1J9TA 1IC0A 4FA7B 2TSAA 1GY1A 2J56A 2GSMB 4DPAX 1JVOA 7PCYA 3IEAA 4YSEA 3T6WA 2DY2A 2OJ1A 1NZRA 1X9RA 4ENZA 2H3XC 5ANHA 1OE2A 3AW5A 4DP8X 3HEIB 4DP2X 1NTDA 2FT7A 2IH9A 2TSBA 2EIKB 2EINB 5IY5B 3NYKA 3S8GB 2PCYA 2I7OA 2AANA 2MTAA 1NIBA 1ASOA 2VM3A 1A8ZA 3V9CA 2R7EA 3FS9A 1SF5A 3GYRA 1CYWA 4HAKA 2WO3B 1WS7A 2XXFA 1V54B 5B1BB 2PPDA 3X1EA 1ZDQA 4G70B 2IWKA 2Y1AA 3EH4B 1ZV2A 4DP9X 1N68A 1NICA 3IBOA 4AKQA 1QLEB 2FT8A 1FFTB 1IBZA 1M56B 2PPAA 5I26A 4E9WA 1KCBA 2XYBA 4HIPA 4G7QB 3MBWB 4E9SA 1ADWA 3D12B 2BWIA 3KW8A 4KNUA 4YVNA 5I6MA 3N55A 4E9QA 1A3ZA 4W1TA 2B08A 2Q5BA 1ZPUA 1N70A 2Q9OA 2BHFA 1IUZA 1OCOB 1E5YA 1NIDA 3U25A 1ZIAA 3QJVB 2PPEA 4HZ1A 3TBBA
chains in the Genus database with same CATH superfamily
1PZ3A 4QO1A 1D7DA 5I0YA 3V6ZB 4U1NB 4J12A 4OLZH 4QDGA 3BIKB 1MJUH 3FQYA 3V0VA 3BGFC 1TU2B 3BZEB 2PO6D 2Y1YA 5F1OB 3TLRA 4HUMB 2EJ1A 3BVWA 4TQ8A 4OSUH 5D7JA 3LQAH 2D9QB 2GK2A 3ATEA 2XTJB 3G08B 1XF3A 1G7LA 3CFEB 1JYVA 3G6AB 4KVCH 4N8VG 1N12A 5E2TH 4UF7C 1FH5L 1NCTA 2P5WD 4Q52A 2UZYA 1NBQA 2WP3T 1QATA 1ZTXL 5DEGA 1FYHB 5AAPA 3ARBA 3P0YH 1OPGH 4UQIM 2GEQA 1L7IH 4RESB 3C08H 1M2VA 2XFXB 3H7LA 4I3RH 5D6CB 5EU4B 3UJTH 1RKRA 2G3MA 1VIWA 3LH2L 3MDJA 5DRXA 2FX8H 5C07B 3SPVB 2ZX5A 3IFLL 1X7SA 2RACA 1DDHA 4PJFE 4YS4A 5IESH 2B16A 1S7SB 5I8OH 1YPZE 3FRUA 5LBSA 1QBMH 3GSXB 5CBEB 2CHXA 2DKUA 4G3YH 5AB1A 3VXUE 3NG5A 1N0LB 1R75A 3VQMA 1CD8A 4PBXA 2WC7A 4XZUB 5DUMH 4F15B 3AGWA 1X3DA 5FX3A 3QZWG 3QHTC 4CC4A 1E9PB 3EFOB 2NQDA 3QJUB 1E28A 1CICD 2VDQL 2ZXCA 1AI1H 3PGDA 4JJ5B 1K6QH 4HEPG 4MBOA 4A2DA 4MA1C 4GG8B 1AS8A 3U0TA 4MKTA 3NP3A 2NXYC 5FO8B 1JTTA 3EGDA 2V37A 4CMMA 5KYUB 2M1KA 4NN6C 3VWJC 1FAIH 2CBQA 1OAJA 1UXMA 4QJ5B 2BHYA 2ZYSA 1ZLWK 4XBEH 1J5OL 3SE6A 2EE3A 3SGEH 2AS5M 1N6QL 4YO0B 1DVFB 5DJCB 4Z7QB 7FABH 1ID5I 3C5SB 5IEKA 1EHXA 3NEXA 1J7VR 4JQIL 1OGAD 4GAJH 5MERB 1GPOH 4UV4H 1YQVL 1EEZB 1CUOA 2ARJQ 2DM2A 2HX8A 4KDVA 4L8BB 5I5JA 1L9SA 1VZIA 2JSFA 1AR2A 3RWIA 3HFFA 1YAIA 3MCLL 4RMSA 4FP8L 5EPMA 3VCLB 2VN3A 2AQNA 2ZWNA 4Y19A 3U46B 1IEAB 1G7JA 3LQZB 4NO2B 1V8HA 1LL1A 3KWXA 4GMSL 1DVZA 3WSQH 4U4BA 5LXVA 1HH6A 3BQVA 3AMLA 4LHUD 1BFOA 3RL2B 1IGTB 4U6HA 1MJ8H 5IFAL 1QSFD 1XMEB 4NYLA 1Q0EA 3G5ZB 4NDMB 4NN7C 5ERWB 4YIQA 3FQ4A 1XFPA 3F6JA 5I18L 5EOTA 1Z9OA 1KSRA 4HS6B 5GRVL 1DJHA 1JXDA 3FO2A 1Y1DA 3G6JE 3DMMC 1F4WL 3HRZB 4IDJL 3BVTA 4QT5B 1VENA 1WFJA 2CM6A 2E86A 2KC0A 3FTWA 1MLCB 4FLQA 4IRJA 3HE6D 4MNQB 1H3UA 5JA9A 4UT7L 2EKJA 5JPNC 5C0EA 4KJYB 1B2WL 3OC5A 1AIFB 5IVXB 4YHZL 1PGRB 2CO6A 2WZ6A 1X9LA 4Y9CA 5TD4A 4ETQA 3BH9A 3MJGX 2VDOH 2XWJB 3RL1B 3G5VA 2ZOUA 3H4FA 3RUGB 4IRSC 4RAUA 5JHLL 4XPGL 1N0XH 3Q9QA 5C09D 2R2HB 1N4XH 1HCVA 3RX8A 1BECA 4L48A 1UA6H 2NY6B 3WFDH 4WFGE 5CLTA 1A1OB 3SPHA 1CLCA 5FFGA 3GBNH 2DKSA 4EIGB 4PBDA 5J4MA 1JPTH 4YGAB 5BS0A 2IDQA 4Q14A 4BCXA 3PWNB 4NENA 1HYRC 1M53A 3Q01A 5GRXG 4BGLA 2VC2B 3BUTA 4H8WC 4GUPB 5JPNA 1WQVT 4IOSD 1F8TH 1JZFA 3ZN6A 4KUZL 4DP6X 1RQ5A 5KYNA 3LZFH 3QQ9D 1OHQA 3PHOB 2HFGH 4ZUUA 2WSPA 1PZ2A 4LP5A 4E9TA 3RTQC 4O4YH 4FCAA 3KPNA 5ECGA 5GQBA 5T5NF 2XTSA 1XF5A 4YDZA 5J1AA 2A73B 1QLRB 4IYKA 5EO9A 5F89B 2PTUA 1NFDF 2LFEA 4TLKA 5FGCE 4PCKA 3EG9A 4NQED 2R4SH 5DMIH 1KLGA 4XNDA 2LFGA 1CWVA 4LSPL 3WEMA 4E41D 4ODHL 4HCRA 4RGNB 1XGUA 3GMQB 4J6IA 5F88B 4OCXH 2XWTB 4RX4A 2XX0A 3KL0A 4MQXC 1EEYA 2W0KA 4YQXH 5DEZA 4GW5B 3UBXB 5DJDB 4XVJH 3NP4A 2WBWB 3MGAA 4DKDC 3GJEB 3QJFB 1XGTA 3VX1A 4X6CF 5B1CA 4BUQA 4XMLH 3ZTJH 4BE5A 2FQDA 4QXGH 4WDIA 4F9PC 1PNCA 3QFJB 2FQFA 2GHWB 2I60H 1KACB 5A40E 5J0BA 4HPYL 1UYWL 3FONA 5HY9A 3PXHA 1I8MA 4L9DA 2EE2A 1KFAL 2D03H 1IGFL 4QRRA 4DGYL 3R1GL 3U4EB 4CSPA 2FHFA 3U6RB 3CN0A 1EMTH 1P9MC 1U21A 2VLME 3BH4A 3U1PA 4AUUA 1E5UI 3RA7L 2YOAA 2RQEA 2FJSA 4OW6A 3CG8A 3ZIMA 1FPTL 3GKWH 4EI5D 1GZPA 5AL8A 5DZOA 1G9MH 1WAAF 2NTSP 3QEQE 3OXSB 3KGTA 3PYCA 3I9GL 3D39D 3OLGA 3Q9PA 3FKUS 2NY5H 5AVRB 2O5ZH 4Z3FA 4OCYH 1JFQH 1M7IA 1XCQB 1BV8A 1CC3A 5FUZL 2XTJC 1LK2B 3WAJA 3T9WA 2J71A 1RPQA 2W92A 2WBXA 1ZWIB 3GXIA 3UJJL 4DP0X 4LP4A 4QRBA 1A4CA 3WNNA 4RMRA 1Z0MA 1AQDA 2GTZB 1NJ9A 5AW9B 2VLJE 3SSGA 5IT2H 1A66A 4BQCA 4CC0A 3AS1A 3OG4B 5EO1B 3NDZE 3BZDA 3QNZA 1G9NH 5HGGS 2ZOOA 5FYJL 4AW4A 1RJYA 4Y88A 4OY9A 5ALBH 1YJDC 1HHJB 2EYSB 2P44B 1GHFH 1ZXQA 1IAII 1QPKA 3HMWH 3RPIB 1LE9A 5CGMA 3V6ZA 4U1NA 3CTTA 5KSBB 3MBXL 1PY4A 4I2XE 4PJ8C 2NW3B 3BIKA 1SJVA 4PJCF 4F15C 3S48A 3CXFA 3H4HA 1TU2A 1B6UA 1JVKA 4GXUM 1ZV9A 4HLJA 3LS4H 1NCDH 5EU6D 1JGEB 4M62L 4L8CA 3IRPX 3G08A 4YOKA 1TT6A 1UWEL 3CFEA 2JCCA 3G6AA 3VXSD 1BMGA 2VQ4A 1A9BB 1ZT4B 4I4WA 2CR3A 2OP4L 4PGDB 1PEZA 3BAKA 4CDHA 2W9LA 5BVPL 5EWIH 1WBXA 2OM5A 2XFXA 2AXJA 2J5LB 2XWEA 5D6CA 5AKRA 5EU4A 4WU5B 2ZXEB 3LN4B 3ZKMD 6PAZA 5C07A 2JELL 5AVTB 3WNKA 3SPVA 3NPZB 4P9HH 1OM3L 4AH2B 2HFEB 1DVFC 3FQ1A 1S7SA 5CLZA 2V5YA 3UZEC 3FQ2A 5HSFA 1ZTMA 2Z7YA 5CBEA 2VLLB 1DVSA 3ZDWA 5T3ZH 1N0LA 1WHPA 4KKBC 1DBKH 4L3CB 2K70A 4GXFA 4XZUA 3N41B 1E9PA 3KW7A 3EFOA 4HCFA 2C9PA 5C0ND 1CLZH 3B3BA 2ZUYA 4JJ5A 3KPRB 4EKXA 3RE0A 3L3OB 4GG8A 2PTTA 2OZ4L 4N5ED 5FO8A 4I0PD 1MRCL 1N19A 3NIFF 4H4NA 4HJGB 4AE1A 5KYUA 4KQ3H 4HGWB 1DLFL 3WO4B 5F96L 1HT6A 1KXTB 4GQ9L 4Q4IA 3FQWB 3BE1L 1JZIA 2X4SB 4OIIL 3ZTCC 1Q9WA 3N3EA 3RVWD 5F7DB 1HQ4B 5BRZE 3L4TA 4DKFH 1JZ7A 5DJCA 5EO0B 4L4VE 3BZ5A 5E5MA 1TEYA 3UZEA 1NAMH 2NYZA 3C5SA 4J3UA 4FMFA 1W72H 4KKCC 3S36L 1M05B 4WGKA 5MERA 3D09A 4L8BA 3ZKXC 1T04B 3ARTA 4KVNH 3N1MC 1K85A 1F13A 1TQUA 3D07A 3PREA 3UG5A 1QPPA 2Y5QA 1P7HL 3VCLA 3U46A 1IEAA 3LQZA 2HTLD 4NO2A 4ANUA 4M5YH 4KFMA 1JVOA 1REIA 3O11A 4JZOB 3RL2A 3MRQB 1IGTA 3VA2C 3INOA 3L4ZA 5I30L 3TVMD 4PUBL 1MCDA 3G5ZA 1U8MB 2NY6C 3HNTH 4NDMA 2F5BH 3F7QA 5ERWA 3MGOB 3T5WA 3VXUD 3FHAA 2IPUK 5FUCE 3ILEA 1A7RH 1SXAA 1SMAA 2QELA 3VWKD 4XP5H 2EINB 5A3IC 1B4JH 3HRZA 3FFCE 1OSPH 4QT5A 5CBAB 3S8GB 1YHPA 3NMEA 4YE0A 1MLCA 3MRNB 3WFBH 4U2YA 5CSGA 3O9WB 1KPUB 3KBFA 4YBQC 3Q43A 3GINA 4QR7A 3JWNH 4G8EA 4I85A 1P5VB 1VFUA 2YR3A 4KJYA 4ONOA 4XMZA 3DJ9A 5TQ0L 5KVEE 1DN0A 2Y23A 3U36B 5GS2H 4PGEB 2J8UA 3IGUA 1IQWL 3EOTH 4F7EB 1KMGA 1RVFL 2XWJA 1IO4C 1J1OL 3EH4B 3RL1A 2G3XA 4ZQTA 3MREB 3EFDL 3RUGA 1H6UA 1XCXA 1ZANH 3N91A 3L7FB 2R2HA 3R4RA 4MB3A 2HAZA 4XAWL 5CJQH 4HP5A 3PFUA 1A1OA 2BWIA 4U6VH 5CSZA 5EZLB 5L9DL 2BIHA 2DS4A 3QQ3B 2Q5BA 4RGNC 3RX5A 2GIXA 3MODH 1IUZA 1VCAA 4GRWE 1UURA 4MASA 4PHXA 3NCXA 4N2HA 3EFFB 3PWNA 2DQ6A 4ELME 5D2LE 3V4VH 4BWTA 3SYQA 4GUPA 3P2TA 4LSTH 2XA8H 2ZJSH 2OTPA 2GJ6E 4FNLL 2QGCA 5DJAB 1M71B 1OAQL 4PIRF 4QTHB 3LIZL 1G94A 5IK3B 2YAOA 4PS4L 2AJVH 5D1ZB 4YVUA 5C70A 4J7RA 3QORD 2ZNXA 3FJTA 3FU8A 1A8JH 2PPFA 3B9KB 4X6EA 1Q9OB 5E9DB 5TH2B 3VI3E 3TFKD 2A73A 1QLRA 1U93B 3PHQB 3QDME 2EQDA 5F89A 1NCJA 1A7NH 5F1IB 5I74B 4P2QB 4MAYD 2MEJB 1JZ4A 4GG6F 3SO3B 4EE2A 3GMQA 2F8VA 2XWTA 1VKXB 1J0ZA 2GJPA 3NH7L 4HUCA 2R69H 4TLTA 4U7SA 2YAMA 3GZOA 4GW5A 4WI8A 5SWSE 1EDHA 4XGZB 1R3HB 3QJFA 2A4ZA 4E9LA 1BM7A 3T0EE 1JN6B 2EUWA 2OMYB 3SGEI 1SPDA 1P7BA 4WFGD 3BH8B 3UACA 2EDNA 3PPSA 3QFJA 4KK6C 4MJIB 4Y5XB 1Z6JT 4OQTL 4LOUD 3VFNB 2CZNA 4GKZB 3GF8A 3WUWG 5JHMA 3GIVB 5F9OL 1KBKA 5A7BA 3B1UA 3U6RA 2Q0ZX 3DK2A 3MRFB 3PIQB 3SN6N 3U4EA 2K9UA 3MUZ1 3WKNA 5DMYA 4QWWC 4M93B 4TM9A 2AMUA 4ATTA 4PR5A 1JOIA 1W2KT 3SJVB 3OMNB 5GZOA 2RTTA 3LRKA 3A6BL 3OXSA 1A14L 4GP5B 2ROYA 5J9PB 4Z3EA 3D3VE 2NUPA 4R7VA 1NL0H 2E6PA 3V6BR 1GYVA 1KBPA 2EDQA 1ZVHA 4HD5A 3QT2A 4X4KA 1VCBC 5TE6L 1SXBA 1XGRB 4BCZA 3LH2H 3MV8B 1ZWIA 3LNIA 4ZMTA 1LM8V 3PY9A 4JQXC 2MPAL 1I8KA 2BVPB 2VR9A 3QQDB 1P5UB 1KYDA 3GI8L 2VLKB 3F85A 1NFAA 5FM5O 3GTNA 5EO1A 2J5LC 3UL4A 5ABZA 5HHQB 2BSTB 4XNAA 5CEXB 3DETC 4F7CB 1HHJA 2EYSA 1N64L 1CFQA 1KPVA 3ARRA 4FNQA 3AQDA 1W0VB 1RUPH 2VDQH 3ZHLA 1S5IL 5HI3C 1DYZA 4L9LA 2C7FA 5KSBA 1KV7A 4ODWB 3CUPA 2AP2A 1GAFL 4E5XB 2DKMA 1AS6A 1QFHA 2VJ0A 4KTDL 4K5PA 3VH8G 5LWYL 1MCBA 2QDVA 3CZSA 3QBTB 1JGEA 1OAZL 1ROWA 5KWYC 3QS3A 5CZXC 2P52A 1NMCC 4M7KL 5IBUG 3L3OC 2VLMD 4JDEB 1A9BA 1N6QH 1OSZB 4NBZB 4HF5L 5H35B 2R29A 4PGDA 1R3JA 4F57L 1TVHB 4GUCA 2VDNL 3WO4C 4YHNA 1OEZW 4JQIH 3D2UB 3QEQD 1NEZB 1DJYA 3FH7A 3X1NA 4ZX4A 1YQVH 3OF6A 4WU5A 3LN4A 1WTLA 1P6FA 3D9AL 4KKAC 3CBRA 3UAAA 3JV5A 1L5GB 3MCLH 2W38A 2JH2A 4OI9A 4AH2A 3UMTA 4AXWB 5IB1B 2HFEA 2ZYIA 3C75A 4AQOA 1DZ0A 4GRLB 4LRNL 2QQLL 3SE3C 5FO9B 2P80D 2VLLA 5AOZA 3QRGH 4WHYG 4L3CA 2VLJD 2HH0L 4NXSA 3SGJC 5GJSH 3ZDYE 5I18H 5CKGA 2OYPA 1JPST 3VXRE 2A5UA 2I27N 4PJ7B 3P9MA 4U1HB 1F4WH 3I3EA 3KPRA 1I8AA 4FQCL 4JLRB 3X11B 1XDTT 2ALWA 5ESVB 3ULUE 3EOBB 2ITDB 3B9AA 3KPSE 4G6FB 4HJGA 2VZUA 3TF7C 5I1GL 4UT7H 4HGWA 4PRPB 2DQJH 2FWSA 4MJ5B 1B2WH 2ZSWB 4WENB 4BZ1A 1CD9B 2C9AA 3VXMB 4MNGB 1HQ4A 2PXYD 3O9WC 4PY7B 2J57A 5EO0A 4I77H 5CUSL 4MXVF 4YWGH 1LLAA 3SE3A 4UILL 2EIZB 4H1LG 4BHUI 5JHLH 3ARPA 2EDKA 4XPGH 3CDFA 1JD7A 1M05A 1AHKA 2CHDA 3S3CB 4HK3J 1LP9E 3DHMA 4AW7A 1DVQA 3SGJA 1IBFA 1NBZA 4PRHD 1XXFC 4ILDA 3RFRA 4YHLL 1FGNL 2BK8A 2BS71 3HZ3A 2DMHA 5D7HA 4NQQA 4N24A 1SOQA 1HN1A 4CUCA 4JZOA 1J10A 4R7NB 1TZAA 1UENA 5GGUB 15C8L 3QJSB 4G7YL 4JVUA 3GT6A 5MP6H 5GZNC 1KXVC 1U8MA 3TCXA 2GK0B 4LMQE 3T4YB 3MGOA 1XBRA 4GUOA 1T66D 1BQSA 1IBGH 4KKRA 4L2LA 3MRCB 1CLYH 4D8PB 3IETB 5CBAA 5GRWA 2GPZA 35C8H 1O5PA 3O9WA 5GRJL 3SPJA 2WLNA 2X6VA 4BSWB 4OFDA 3L4XA 3DBSA 1BW8A 3O3DB 5I73B 1P5VA 2WCPA 2EDBA 4AJWA 3U36A 1X5KA 4PGEA 1CTOA 5DURD 4YDVB 4P5MB 4LSPH 4YC2B 5D1ZC 5J3HD 1KPRB 4ODHH 2BP0A 2LLNA 3UO1L 5DK0B 4WKZA 3WY2A 1LHZA 1HCZA 5BRZD 2YPKB 1WUNT 1AYRA 3B9KC 4XBGA 2AXGB 1G9HA 1KTDB 4HSQA 2O6PA 3B8SA 4DGUA 1T1YA 4NI3A 4H8PA 1R3LA 4HXBL 4L4VD 3VGFA 4PJDE 3L7FA 2G60H 1N5AB 3A6CH 1AS7A 5GZNA 4ZMAT 3OHXB 3AY4C 4YFEA 4H1LA 1WICA 1ZTXE 5EZLA 3SO3C 3TEWA 3QQ3A 4AVHA 5KN5B 2WQVA 4LQ1A 4HIIA 2IDSA 4JJHA 3BLKA 4HPYH 1IFHL 1I4FB 1ADQL 1KG0A 1MHEA 1G0DA 1KFAH 2VZ1A 2Z91B 2XKNB 5F7BA 1CTNA 3TBWB 4DGYH 3IFNH 4M6NL 4NNYB 4Y9FA 2DEWX 3VD5A 5DJAA 3RA7H 4DUVA 1M71A 4QTHA 2NUTB 2X3AA 2AI0L 4TNFA 4Y5XC 3RVXC 5IK3A 4IBZA 1AXTL 4PD4J 5D1ZA 4RA0C 2EZ0D 3SYAA 3O4LE 3WTUA 3F04A 3T0XA 3FFCD 5B4MC 1YEIL 3GLEA 4NFCA 1R3IL 3B9KA 5E9DA 3I9GH 3OJ2C 1U93A 1I9RL 3BYTA 43C9B 4TS6A 2QR0B 3TM6A 12E8L 4M93C 2J73A 4XCYB 4X2UA 5DVKA 5FUZH 3JZYA 2X2JA 5F1IA 3DUUB 3EW3B 4P2QA 3UJJH 3ULSB 5I75C 1P84J 1OP5H 2Q3ZA 3L9YA 3AY2A 2Q86B 5CP7B 1QLFB 4KJPD 2IMNA 1VKXA 1NANI 1J12A 2CBOA 4FZEH 2G0KA 4FN0A 1UM5L 1YNKL 4XGZA 1R3HA 4GINA 1KXQE 2C3WA 1JN6A 1UG9A 3CDCA 1H9VA 2OMYA 2WXLA 1LWHA 4GQRA 4LKCB 1ZCRA 4PJHB 4TUJB 3BH8A 4ANWA 2AKRB 4PJ5A 4HAFA 1BQ5A 5SWZE 1P5UC 1QYGH 4P46B 4Y5XA 2O5NA 1MI5E 5DHXB 3VFNA 3MBXH 1VESA 4GKZA 4LFHD 5JMOC 3GS0A 5E00B 3E9UA 3QVAA 4O51B 3PIQA 1YEFH 4JG9A 3UC2A 4CN4A 4H8HA 1FFPA 4M62H 1WZMA 3OAWA 1QHQA 4UU9B 5HPMB 1YMMB 1UWEH 3ALWA 1EZLA 3U9PL 1HS6A 1NUFA 1X9UA 1OOAA 4JY4B 1F4HA 1VEPA 5BO1H 1AMYA 1FUNA 5DQDL 3ZL2A 1YG9A 3ZO9A 4LOEA 5J9PA 2C3VB 3AVEA 4NZ8A 3S3BB 1YRKA 2ZUTA 5BVPH 1ERNA 2IH3B 2VNCA 4P3DB 3CU1A 1T7WA 4HJSA 1ID2A 2GT9B 3CDGB 4XNZB 2YARA 1XGRA 3VAEA 2JELH 5HDLA 3MV8A 2WNWA 3QDMD 4LHQB 3LPWA 2CALA 5M95B 1IJ9A 4Z7WB 2BVPA 2XN2A 5E2WL 3FUDA 4XPFL 1P5UA 4NRZB 2VLKA 4FA7B 1E3XA 2TSAA 1RK0A 2BSTA 5CEXA 1KB5B 2WLMA 2BSRB 3NJVA 4GRMB 4F7CA 3GZKA 4PMEA 1X9RA 3MRDB 4GOSA 5SWSD 1LWJA 1PJ9A 1NCUA 3VSQA 1W0VA 4EUPB 5BV7L 5DD6B 5IBLC 3T0ED 4GRLC 2DI9A 3IDGB 1KN4L 2DQIL 5D7LB 1T4KB 3C6SB 3GJFK 2OZ4H 4XP4L 4XR8C 5IY5B 1WIOA 4ODWA 5LBSL 2WXFA 3WJJC 4E5XA 2DLEA 5K9QG 3ZHDA 2DYPD 2MTAA 1DLFH 5A2FA 3BE1H 1V3KA 3FS9A 4OIIH 4P57B 2JKTM 3GYRA 1DCLA 4Z3GA 4KY2A 3DPDA 3NRPA 4JDEA 1V54B 1OSZA 3RKPA 5T3ZD 5TQ2H 2I5YL 5H35A 1YYML 3LPFA 1TVHA 3B7UX 4WEEA 2BPBA 3TBSB 3ZHFA 4LVNB 3WKML 5IP4A 3D2UA 1NEZA 3S36H 1SOSA 5DHMC 3ALXA 3RZCB 3D3VD 4LPCA 4Y2OB 1YY9D 1I8LC 3JWDC 2WXJA 1L5GA 4L1LA 2F74B 3CWGA 3FUEA 3MTRA 4FI7A 4QHKJ 4N86A 3T3MB 2XG4B 4ZNEA 3GWJA 2BSCA 3LNFA 2H3NB 2CPUA 1JZ5A 4GRLA 2XETA 1JMXA 5FO9A 1V27A 2ZWKA 1BG1A 4WTXA 5I30H 1DVUA 3WJJA 4PUBH 4ZTPL 3R7QA 1G1OA 2LU4A 2BSED 4I48A 3WN6A 4FQ2L 4MB1A 4IEFB 1JPEA 4LMQI 4EPSA 2VSKB 2BRRH 4JLRA 2ADYA 5GGVY 1EUUA 5JQ6L 3X11A 4AGMA 1X4XA 3WHE1 5DFWH 2VW6A 3EOBA 1B6DA 2ITDA 3VXTB 1FFRA 4O02L 3NZHL 4W9KC 4PRPA 4MJ5A 1G4MA 1FLRL 2QHLA 2WAQA 2ZSWA 4CKVX 3VXMA 4QHNB 4F3FB 3U4AA 2R56L 4IMKA 1VFOA 1I8LA 4MNGA 3D7PA 1IQWH 2Y7NA 4NQTA 3HKZA 3K2UL 4H0GA 1A47A 4PY7A 2KLTA 3AG1B 1J1OH 4GJTB 1OLZA 5IW1B 3EFDH 3QIWB 5EOCH 5I73C 2XT1B 1BQRA 2EIZA 3A67H 4PMFA 2GBUA 4FNRA 2PMZA 4HEMA 2FGZA 3OWRA 2AZUA 3OXRB 3BP7A 4D0BB 4OTXH 4XAWH 4WI5A 4GQQA 1JTOA 4YC2C 1EXUA 1K5NA 2CH8A 5KAQG 3B5TA 1FJ1B 1NFDE 5FDYA 2BNRE 3CSBA 2E75C 2NR6D 4EZKA 4H40A 4R7NA 3V6FB 1OSEA 4CVWA 2QSQA 2QLVB 5HPOA 3OHXC 5DD5L 3T3PB 3KGSA 2GK0A 2E4FA 3T4YA 4WEBL 2KPWA 3FMGH 3NJGA 3K6OA 4X80L 4XNXL 3JWOC 2P43B 1W80A 2BRQA 2X12A 3ESOA 1OAQH 2NYKA 1CL7H 5EBMB 3MRCA 4D8PA 1CYXA 3IETA 4G8IB 3WFEH 4L3EA 3MBED 4AUJA 3LIZH 4P23A 3VXRD 3C6LB 5FYJE 4KZDL 4DFHA 2E27L 1DBJL 4FG0A 4BSWA 2BNQE 5C8JB 1PY0A 3M86A 3GDCA 3O3DA 3KPSD 1PZ5B 3UZQB 4BQ6A 1JI1A 4U3XA 1I7ZA 2X1PA 4YDVA 2HA1A 2IXQB 2PR9A 2OTWB 4UM9B 1KPRA 2B14A 2W81C 1HC1A 2J44A 3P69A 1TETL 3H9ZA 5D1XE 3GQFA 2YPKA 1NC4D 4DVBB 3RFZB 5EF2A 2AXGA 2KDYA 2MOGA 3ZQ9A 1YN7B 4MD4B 4B3VA 3OAYH 1HXYB 3ZGIA 3OHXA 3STLB 2FE0A 4PWKA 3NSDA 3WN5B 3MRBA 5KN5A 2BY3A 5E2JA 1OTSC 5FPIA 2P5PA 5CR1A 4UQ9A 3SDDB 3GEWB 5FYLL 4OQTH 3MLYH 1IVLA 1I4FA 2Z91A 4A63A 2XKNA 2Z31C 1KJMA 3UAJC 3TBWA 5F9OH 2AJ3B 4WUUE 1NCOA 4NNYA 3IGAB 3K80A 3DX7A 4H8WL 3FBQA 5HGBB 3TA3C 3WEXB 1URLA 1OCWL 4LPXA 4P46C 2PWHA 2V9RA 1JZHA 1KF9B 3VQ1C 1NCNA 4J4PD 1KIRB 5I0WA 4JPQA 2WKLA 5CILH 3A6BH 1LEIB 4N87A 3EJUA 1GS8A 1S7TB 1PQZB 3EZ8A 3L5WB 43C9A 2XOTA 4X4YB 5TE6H 3OMZA 4XCYA 5E95B 3QDJE 4XP1L 1Q8MA 5AB0A 4PJCE 1BX2B 4XB7A 3QO1B 4JFDD 3ULSA 4BM7A 4JGJA 4LLMB 5M94B 4NPYB 4PP1D 3DDGA 2Q86A 2NY0D 4Y1AD 2JCCF 2MPAH 4I1NB 1QLFA 5CP7A 1A9EB 3W11D 1LYQA 3S3JA 2K4AA 3GI8H 3W2DL 4EQ2A 1E7UA 4QRQB 4OCWL 1CQKA 2BERA 4XNZC 3UAJA 1SQ2N 4BUGA 4IGBA 2ZX6A 5FV2A 1N64H 3H2PA 1GGBL 4TV3A 4LKCA 1J0HA 2B77A 1O0VA 2YD0A 4LB8A 5AOMA 1S5IH 4PJHA 3Q8EA 2AKRA 3S9DB 1PD1A 4OLYH 2P5EB 3DARA 5L4IA 3OLEA 4P46A 5DMJB 1X5ZA 1R47A 4CNIB 4RRPG 4J1UB 2QGEA 2Z1PA 2MOVA 3BOVA 4PSRA 2HKHL 3WIHA 1CXEA 4MMZB 3BUDA 2VRAA 4O51A 4AYBA 2F53E 4JUTA 4K3EH 4GKNB 4X7DC 1E9OB 4C47A 4XCFL 5LWYH 3L2NA 1JCVA 1QVOB 1OAZH 4UU9A 5HPMA 4N0CC 1YMMA 4M7KH 5FGSA 1IBHA 3FUMA 1TG8A 2PYEE 2APVA 2Y69B 4JY4A 4HF5H 5T1KD 2C3VA 2BWQA 5GS0C 4J3XA 2VDNH 2IH3A 3O4LD 3LKOB 3D34A 2FWLB 2GT9A 3CDGA 1HL5A 3BPOC 1TZOA 2VXQL 1T2JA 3UTTB 1D6VL 4PV8A 5C71A 2IOOA 2R2CA 5T3XH 1VPOL 3VW3H 1N7ML 1PAZA 4TSCL 4Z7WA 4LRNH 4LVNC 2QQLH 2B9AA 4NRZA 3BT2L 1QTYT 4Z7QF 4PLKC 1T1ZB 1MFEH 1Y1UA 3RZCC 3UTSD 2BSRA 4GRMA 1RIUL 1UVQB 2HH0H 4NGHL 1NCGA 2FB4H 2QSVA 4YL9A 4ZO8A 4CGTA 3BHBB 2ZAHA 3HVDA 4EUPA 1YJDL 1CE6B 3FF8A 5DD6A 2CIIB 2AQSA 2CLZA 3IDGA 2K78A 4FQCH 4X6DB 3RKDC 3R7RA 5D7LA 4CVXB 1T4KA 3C6SA 4TQEL 3ATFA 1EO7A 3K4AA 1L9RA 5SWZD 1WWWX 2VSDA 3FT4B 1TTCA 3D2TA 1MI5D 1HL8A 1NBCA 3PP3K 1QNIA 1UXLA 3X13B 1UXWB 1RY7B 4OF6A 1WT5C 2CKBB 1MOEA 1M7XA 4Z1PA 2CSPA 4NAMA 3RVTD 2SEBA 2IAMA 1JGUL 5CUSH 4YX2L 5ID1B 2B39A 5IM7B 3QCUL 3FDWA 3B7RL 2XIDA 4KXDA 2G2PA 2QGDA 1IAKB 3OMIB 4Y2OA 3U7AA 4CL7A 2F74A 3QARA 1KBVA 4RH4A 1YEHH 2FX7L 5IVXF 2XG4A 3DLQR 2H3NA 4PS7A 4YZFE 4YR6A 2EYRB 1FGNH 1E4XI 2J8UF 3VFRB 2WOYA 5DSCB 2FUQA 5J11C 3QIWC 3HCVB 1RXLA 2DMCA 1BG9A 4JE0A 2PW2B 15C8H 5ITBH 2NY1D 3RUGF 1GGIL 3ZDZF 3CFKB 5IROC 4G8GA 4WHCA 3WY1A 3ZE1E 3SE4C 1AZVA 4DO5A 5INDB 5C6PB 3LVEA 4IEFA 3B2UC 1CFMA 3GXFA 2YUZA 5I28A 2J43A 2GVYA 3RJQB 2WZPD 3IDMA 3V7AE 5FCSH 3VXTA 2EDMA 3P1VA 1YAZA 2V9TA 2QJDA 2VSMB 4FADA 4H8VA 4QHNA 4F3FA 1W16A 3ZKQD 4R97C 3QYCA 4XNQB 5HGAB 3MLSL 4LCWB 4UQEA 2HVKB 1E3FA 4RFEB 1JDAA 2LQRA 2Q76B 3C6LC 1LK3L 3UO1H 3H42L 2YQBA 5IW1A 2QMKA 3QIWA 3IDYB 3ATBA 1LO5B 3G9AB 2PETA 2PKDA 4Y89A 4PP2B 1HOCB 3EJZD 1UM6H 4MXWL 3SE4A 2IFGA 5I6NA 1FJ1A 1AOHA 3RFZC 1H0DB 3T0WA 1ASPA 4GXUN 4LEXH 5I6XC 3LYRA 3SDAD 1ADQH 3V6FA 1CLOL 4F8PA 4GG6E 1AGEB 2WD0A 2Y3NA 5DDHA 2DWDB 1FC1A 3NCEB 4AE0A 4GW4A 2WXNA 3HOGA 1G87A 4M6NH 4NBYB 1CDJA 2HT3C 3IM1A 4DZBB 2X6BA 2ZOKB 4R7DA 2IQ9H 5C2BL 5EBMA 5ICYB 3GBEA 1QRNB 3CMGA 3CZFB 4R96B 2RA1A 3INUH 3SDDC 1AXTH 2CUHA 2XI9A 5C0JB 5DZVA 3IXTB 4H25B 3DSFL 1YEIH 2OXGB 5C8JA 1R3IH 4LF3A 2AEPL 2Y7SA 3MRJB 1ZSHA 3GGWB 4JFFE 3I6KA 2VC2L 5ID0B 4IKKA 1I9RH 1PZ5A 4WWKD 4NKDB 3UZQA 2VO5A 2UY6B 4HJ0D 4LZKA 2HMID 5E94B 2UX7A 5HYJE 2OTWA 4UM9A 1WWAX 2NW2B 4AQAB 4O58H 1IC4L 5FUOL 5TK2A 3FTZA 4LSUH 5I6PA 4DVBA 4FKKA 2Y2TA 5I1DB 3RFZA 5L0QB 1QX1A 3B3IB 3FSOA 3MZTA 5E5RB 5JXEC 4Y4HB 1YN7A 4MD4A 5JHDE 2R0ZH 1HXYA 4WTQA 3STLA 3NQIA 2WP3O 3MJ7A 2D3LA 1DQDH 3PWLA 1S4IA 3GEFA 3WN5A 4B7IA 1JFHA 2K45A 4HW6A 5T1JA 1FG2B 2DY2A 3D85D 4TSAL 2HG5B 3SDDA 2VKXA 1NSNH 4XO3A 1EA9C 4ECNA 1P6WA 2BNRD 1NTDA 1PX8A 4CRPA 2AJ3A 2O72A 4KVPA 3DRTA 2V7NB 3IGAA 4S1RH 4LIQE 3HFML 3OKLA 2AXWA 4Z95H 3WEXA 5CP3A 5HGBA 1TJHL 1UCTA 4FEMA 3TP4A 4K2UL 2FGWL 3U9PH 4FXGB 4NZRH 4HJJH 3S34L 2TRHA 2YEQA 4WY7L 1KIRA 1G7MB 1MVFA 4C56E 5DQDH 3QIBD 4MQSB 3ELQA 3AQXA 2NSQA 1LEIA 1OTUD 4QGTA 2D3VA 2AF2A 4MMZC 1S7TA 1PQZA 5FYJD 5AWNH 5KSBF 4B60A 3L5WA 1QO3B 4JPKL 2BNQD 4X4YA 3TYGL 5DEFB 2YD8A 2CM5A 2F7QA 1FRGH 2DQEH 1BX2A 4DP9X 4OZGA 3QO1A 4AKQA 5EB9A 1MCKA 1QEXA 3REVB 1K4CB 4NPYA 3ZHKA 1A9EA 4NHUB 1G1YA 2WVSA 4XPFH 2AABH 3IGKA 2B4CH 1HHHB 3N55A 1A3ZA 1U8CB 1CVSC 1N70A 5I71B 1MCJA 1V5JA 1AGCA 3BI9X 3GSNB 5F6HJ 4HX1B 1OWRM 1J87A 1LD9B 2R39A 5J12B 1N26A 5BV7H 3W9DB 3HG1E 1AY1L 1KN4H 2P5EA 2DQIH 3KLDA 4DVRL 1E4KA 1M6UA 4CNIA 5LBSH 2HVJA 4J1UA 3CQQA 1BA9A 2CIKB 1CI3M 5KANG 1B3IA 4R3SA 2EO7A 4MMZA 4CADA 4GKNA 1E9OA 3CAFA 3FUNA 1QVOA 4UOJA 5ILTL 1FO0B 2P9RA 1T1WA 3BVNB 1J1PL 2KZBA 4LNRB 4QRPE 4S1DD 3DUSB 4DSYA 3FUFA 4YHML 1TLKA 1UOLA 2C3XA 2I07A 1L6XA 1UD2A 4GMTL 4IKLA 3SE9H 1KB3A 3Q5TA 4MXQC 4WF7A 1SFHA 2WCGA 3LKOA 1MCCA 4U3HA 1VFAA 3I50L 1NCBL 3E38A 1OPOA 3UTTA 2QL1A 4IKNA 3MRGA 3ZZ1A 5I6OA 4FLRA 4OVVA 4PJ6A 2P8LB 4JO8A 4AQ1B 2ZX7A 1QNZL 4YHOH 2R29L 2JJSC 5B1JC 3T65B 4ZZFA 4HHGA 1T03L 1T1ZA 3NK3A 4ZTPH 3J07A 3MXWH 2EIMB 4TRPL 3ZE0B 5EEZA 1UVQA 3RDTB 3ETSA 1SMDA 4FQ2H 2Y5TB 4J2XA 1Q38A 5EU7C 3HG5A 3S8FB 3BAJA 2R8SL 4I18B 3QA3B 1L9PA 1CE6A 1MFAL 1WEJH 2CIIA 3FW6A 3MACL 2JE8A 4X6DA 3R19A 5JQ6H 5IV2B 2EXTA 4CVXA 1IVTA 3AFLA 2R15A 1FBIH 4HK0B 4RDQG 4V1DB 4N26A 3FT4A 1MVYA 5IFHL 4ABWA 1D2OA 3CV5A 3X13A 5AAWA 3DX6B 1UXWA 4DERA 2H45A 2IO5A 2EVJA 2R56H 2F53D 4XB8A 3K2UH 3VVWA 1GL4B 3Q48A 4XVOA 3MOAH 5IM7A 1PEWA 4HOZA 3MA9L 5CLWA 5B1JA 2X9ZA 3V2AR 5IHUL 4ZOCA 1IAKA 4BZ1L 3NSCA 2NY3B 1F0LA 1EJOH 2EDFA 2WYZA 4F8NA 2ED8A 1AKJD 3QUML 3CFUA 4RETB 1KCUL 4WO4D 2EYRA 3G3LA 5DSCA 1DEEB 3RGBA 3VFRA 1K2DB 2GJZB 3OHMB 4QHUB 3HCVA 3IDYC 5EZPA 1Q9KA 1A9VA 4N2GA 2LOEA 3UP6A 2CRYA 4FI8A 3QUYC 3SOBL 3PAUA 2PW2A 1RD6A 2NX5E 2UZXB 4M8VA 3RWCB 3UYPB 5JA8B 3CFKA 3I6GB 2W0FB 3EXJA 4UQDA 1NOFA 1JK9B 1RUMH 5INDA 2VZ3A 4KXZI 4IK7A 4XNXH 5EU3A 4F37K 3V52L 4DN4H 2ENYA 2X44D 3GBML 4J3BA 4DGWC 5LG6A 3MN8A 3QXTA 2Y36L 1IC5L 2VZVA 2APWA 3D8MA 2E27H 2WINB 1DBJH 2QTEA 2OW6A 1X44A 4S10A 4AYDC 2GKIA 4KV5F 3AXIA 3O6FB 3QXUA 1F2XK 1AQMA 4FXKC 2EVHA 3CPLB 5L8KB 3AU1B 5C7XH 3HLKA 5I5MA 5HGAA 4XNQA 2V2WB 3IAPA 5E1AB 3S98A 4WV1B 2XV2A 2HVKA 4RFEA 1T0MB 2Q76A 2W9DH 3IYLW 5KYYB 3ZW3A 1TNNA 3LZLA 5C0AB 3CFCL 3LEVL 4JKWA 3LCYA 3MJ6A 3U48A 1XB8A 1LO5A 3TBCA 1M9SA 1RU9H 4GW1B 3W82A 1IT9L 2GJJA 2IDCA 5EOQL 2JB5H 4PP2A 3AG4B 4TVPL 4W68A 4P4KB 5JIKA 3U0PA 3SCMD 3OJVC 1H0DA 1L9MA 4HCRH 2A1WH 2IANA 4XHQA 4AI7A 5L0QC 3W1ZA 1GOFA 4X9HA 5FYLH 5L2JB 4Y4HC 1NC2A 1XIWB 5EULV 1PCSA 1JGDB 1AGEA 1KY7A 3MJWA 4E9RA 2DWDA 1JNJA 4HPHA 4N3TA 3MA7A 4PRIB 1W6LA 1RP9A 3NCYS 3UEQA 1JPFB 4H8WH 4DGIL 4DZBA 2ZOKA 3CCHB 2B1HL 1OCWH 4HBQA 1QRNA 2XQ0A 3CZFA 4R96A 3QHZH 5H4ZA 1COBA 2CD0A 2J1KA 3CZLA 1YECL 4X6FB 2ATKB 3OMAB 4IBYA 1CE1L 4PB9L 4X7SL 4LASH 3ASOB 3IXTA 4KK9C 5FOJA 4H25A 5C0JA 2OKMA 3BUBA 2OXGA 5I1CL 4UAOC 3MRJA 3GGWA 3M07A 5AENA 2WNGA 5ID0A 4H7VA 1YYCA 4A2FA 1G0XA 4NKDA 2C1PB 5CWSB 1P4BL 1QD0A 3QUHA 4XP1H 2HT2D 4D9LL 4FXGC 5E94A 1T1XA 1TSHA 4KNSA 3HHMA 5C0BE 1GSMA 1HSAB 4AQAA 3DNKA 3O2VL 3CN2A 2EXYC 5I1DA 2CUIA 3WNIA 3B9DA 3B3IA 3FN0L 4JHVA 3W2DH 3OKNB 4Y4HA 2BVTA 5FYKH 2V5MA 4OCWH 3VA6A 3ZHNA 5A6MA 4XI5C 3CFTA 1NGWB 3POCA 4K71B 1JDCA 1QBLL 1T83C 4HT1L 2IV9A 5FAAA 3DYPA 4UBDC 5GGTL 4BFGA 2ADIB 5A7EA 1TEFA 2F7PA 1FG2A 3FT9A 4GY4A 2CO7B 2HG5A 4NO0D 3UOAB 2Z0BA 2IPTH 3OM3B 1YCSA 1YLBB 1CK0L 4X0KB 3FUIA 1WIPA 4MA3B 5I1KL 3GI9L 3O3EB 2OL3B 1KCWA 4Z7VB 1CFBA 3WELA 3AS3A 1RZ8A 2V7NA 2ED9A 4XCFH 3DHPA 2A38A 3I3DA 5J12C 4FFVC 1BREA 1U3NA 3MRHB 4FXGA 1FZJA 4KROB 1JRHL 2YGPA 1G7MA 1YNLL 2IC2A 1ET8A 3II3A 1EJ6A 1G7HB 4NQDD 2OBGA 4LCIL 1IM9B 4GKSA 3KM1A 3PWPA 4UNVA 3ULAB 2BVUA 1KZYA 3T0VA 4Y19E 3LKSB 1QO3A 2VR5A 3GMRB 3WD5L 5DEFA 1NAKL 4JFFD 3WE1A 1T83A 4MMXB 1QTSA 1BM3L 1FL5B 1D6VH 3D48R 2EUVA 3REVA 1A64A 1K4CA 1VPOH 3FCSB 1N7MH 5MENA 5HYJD 2H4EA 1WAPA 3BT2H 3NCMA 1HHHA 4P3CH 3FU9A 1U8CA 2AJXH 2RIKA 4XRCB 1RIUH 3KXFB 2IIJA 1UT1A 4ZQKB 4B9IA 5JHDD 3I3BA 3GSNA 1P7QB 4HX1A 1LD9A 4ZMOA 3LV3B 4AQ1C 5L8LB 2XWXA 3W9DA 3W3BA 5HI4D 5B39B 4QJ3B 3Q6FA 1JG9A 4HD9A 3OJDB 3BWUC 1U3HD 3EAKA 4FKEA 2CIKA 5I9QB 3HE7B 3RDTC 3UROR 1HZHL 1NQBA 2IBZY 2WZ5A 3FTGB 2A6IB 1IEHA 4I18C 3C60D 3AU0A 1FO0A 3ALPA 1NIEA 3FH8A 4LNRA 4UINL 5F70A 3DUSA 4G6AD 4J39A 3KCPB 4LARL 5GRUH 3Q8BA 4FAAB 4ENEC 3OKDB 4M29A 2XC8A 1J9SA 3ZT6A 4UOZA 4FTVB 3SY0B 2R51A 3WKQA 1B2YA 3WU1A 1A6TB 4YE4L 1QI3A 4C56D 3QCUH 2PCPB 2K3HA 1TYJA 3MSPA 1D5IL 3AT8A 5L4JA 3TS8A 1CJYA 2DV6A 2FX7H 3WNJA 3AWEA 3LXUX 5IMKB 3JSSA 2FJGA 4A67A 5FYKU 1DE4B 4MB4A 3VFWB 4AQ1A 2J21A 2R4RH 1UACL 4POZC 2C9VA 3OAZH 4E68A 5J89A 2V3DA 3T65A 1CXLA 1U8NB 1GGIH 2WQRA 1F5WA 5F9DC 3RDTA 4L0YA 3QDHA 1X5YA 1A3QA 2WO2B 2Y5TA 2XCMC 3DOHA 4MA7L 4I18A 3AT9A 3FCTB 3QA3A 1ZJAA 3VTAA 4CN6A 5FGBC 5KSAC 2C26A 3P3RA 5I1JH 5IV2A 4FFYA 1MW3A 2NYYD 3KPLB 4FQLL 3HG1D 4HK0A 1CMOA 3AG3B 4ZYKB 5IBTL 1BLNB 1XMWA 3RHWF 1AIZA 2TRYA 3WMQA 1JUFB 1N5YL 1DANU 1XH1A 3DX6A 1QFUH 5FYLE 1UGNA 1SXNA 4Y7MA 3PWVB 3MLSH 2EE9A 4YXLL 3C9NA 3LRGA 3RGHA 1DFBH 1LK3H 4QRPD 1AO7B 3H42H 3O4OB 5F3HA 3L54A 3ZUNC 3O6FC 4ZFQA 2QPDB 4WHDA 1MY7A 4QY8B 2GI0A 1WFOA 1OWWA 2VWEE 4LAJH 4C83B 4KMLB 4PN6A 3Q5YA 2KZWA 4IOFC 4ZD3H 1BLIA 1C5CL 4WV1C 5CJOH 4HFWA 3JWDL 2VN7A 1M4KA 1F90L 1FV1B 2QKSA 1DEEA 3ZMEA 5FO2A 1ESOA 1K2DA 2GJZA 2B2XL 3GC3A 4LPUA 4QHUA 5FGBA 2Z34A 4PVBA 7PCYA 2EE6A 3CC5B 3FO1B 1MNUL 1CLOH 4N2CA 2FUTA 2UZXA 3UYPA 4BQBA 4Z6AT 5L2KA 2HCZX 3HNSL 2W0FA 3I6GA 4M7ZB 1JK9A 3OR7B 4P4KC 1SM3H 3IGLA 4X7TB 4PLOB 3L2MA 3GBLA 3K74B 5C2BH 2DLGA 4UV7L 1SHSA 2YSTA 3FB8B 3NFSL 4F91B 3HS0C 4XHJD 1XIWC 1OO2A 3MUHL 3K1KC 1JTPA 1QW9A 3V9CA 2ORBL 2WINA 3F6LA 4R4BB 2N7AA 3HG0A 5HYEA 1J5HA 3KH4A 3O6FA 1CYWA 3B83A 2W91A 4RIRB 4I3GA 4WJKB 3CPLA 3HI1B 3VDCA 4KI5C 2V2WA 1GGYA 5E1AA 4XB3A 3L3HB 4Y2NA 4MVBD 4Z3TA 1T0MA 4PRNB 1I1AB 5KYYA 4JMNA 1NGXB 3APDA 5C0AA 3MHZA 4NQVB 5I26A 5K59F 4B3EA 1HSBA 4FHKA 4UTBA 4I0CC 4GW1A 4ZT1A 3BN3B 4E9SA 1A2YB 2IMMA 1S7QA 4QOKE 3S2AA 5LNDA 5DTFB 4ORGB 3BDYL 1DZBA 1KTLA 4QHLB 4PH8A 4HGMA 3NACL 3WXVH 5DJ6B 4ZFFB 4R26L 5K9JL 4X5PA 3RPKA 2V33A 1XIWA 1BQUA 1JGDA 2XTJE 4G6ML 4K71C 4PRIA 3SIKA 3WS6A 1S7VB 3GRWL 1AHWB 2NX5D 1JPFA 4EIBA 3HFMH 3CCHA 3ME0A 2YRZA 3JWOL 4K2UH 2WUBL 2FTAA 4X6FA 3S34H 3NPSB 4WY7H 2FH6A 1BPLB 4PJHF 5CINH 3QUZB 4O2FB 1XV8A 5F7YC 3O81A 4U1SB 4JFSA 3ZE2E 4JPKH 2C1PA 5CWSA 4M9PA 1A0QL 3TYGH 4XNMB 2CUMA 4Q7DA 5FIEA 4KROC 3WY4A 4ZW6A 1W9XA 2BINA 3BUYB 3RIAK 3JYBA 4LSDA 1HSAA 5LKNA 1MFCH 1F1AA 3IN0A 1PW3A 4UI2A 1YSOA 2HFFB 4F80A 2E9JA 1BZQK 2XN9B 4OF5A 3FTVA 4OFKA 4LDCA 2B1AH 3GSQA 1G6VK 5LG1A 2GIMA 2XG5B 3CLFL 3IFPB 4B9JA 3WTTA 5C2UB 1EPFA 1TTBA 3SHSA 4YSSA 2CO7A 1OP3H 5KSAB 4DVRH 2GUOB 3VDAA 4I88A 5KSUA 5JMRA 4MA3A 4Z7WF 3O3EA 2OL3A 2QVTA 3CMOH 2GAZB 3D0LB 1ETA1 4FG2A 1ZE3C 3V4VB 4Z7VA 2R27A 1KYOK 1NM4A 3SQBB 3VFTA 1X6NA 4XBMA 1RJLB 5ILTH 1HKLL 1A4KA 4BZ2A 1SJHB 4X9GA 1J1PH 1U8QB 2FQEA 3K6FA 2A9ML 4RMQA 1O75A 3MRHA 5I1EH 4YHMH 2LHAA 5EIIB 4GMTH 4HUNB 1WFUA 2EDTA 3HE7C 3X2QB 5I9QC 1MCSA 1UD5A 1PJWA 3ZMNA 3D1MC 2DM3A 4JRYA 4MZ2A 3GMRA 4Y4KA 2BM3A 4YPGB 2VH5L 3OV6A 3I50H 3Q2CA 1CIUA 3CC1A 4MMXA 1FL5A 4O5LH 3T6VA 1G9MC 1ZLUK 2VISB 1MRFL 2QEJA 3FCSA 4N2FA 4NUGL 5D1QC 5C0BD 1QNZH 1IIKA 1QKZH 5AVUB 1EEQA 3REWB 2R29H 4AYSA 4OZ4B 4OZIE 3WUZA 3SGKC 2NY5C 5HHMB 4OUUA 1T03H 1PZAA 2WJ7A 1BGXH 4TRPH 4XRCA 4A2GA 3KXFA 4JY5H 1ORSB 1J0YA 5C3LD 3HJEA 4ZQKA 5E4EB 3K5SA 4G1MA 4NXKA 1OB1A 2X2UA 1BQHG 4MNQE 3LV3A 3T3MF 1B9ZA 3MACH 3UTOA 5B39A 3BMWA 5KBMA 3VI4B 2DQCH 3OJDA 1MCFA 2ZYHA 4YDNA 4RFOL 2KLRA 5IVXE 4O2EA 3BPCA 1G9NC 1KIUB 4PJ9B 3HE7A 1KB5L 3FTGA 4WW1B 2A6IA 3CFMA 4FQQB 4ZAKB 4Z0XB 4DP5X 4XVTL 4B0MM 5IB4B 3PCYA 2BFVL 1J05B 1T89A 4OFPA 1ND0B 3F58L 2XX1A 1WD8A 1IFRA 3HUJB 4KZCA 3OKDA 2PLTA 4FTVA 4KFZC 2X4UB 3SBRA 5E8DL 3SY0A 4QPEA 4W9CC 1E4HA 3ZQWA 5E4AA 4FD0A 2PCPA 3MA9H 4X6BB 5IHUH 4TNVK 5GS0L 1JE6A 1RK1B 3WTSA 3IVKB 3FTSA 4NJ9L 4HWEL 3NGBB 4BZ1H 4ELKA 2ZKWA 3IFOB 4Y19D 3EHBB 4PRAB 1OALA 3MVSA 5IMKA 4QRTB 1D5BB 1KCUH 2EEBA 3O4OC 1NDMB 3VFWA 5JIDA 2NXYD 4JY6B 4D9RE 1MG2C 2FNWA 2DQMA 3SOBH 2AGJH 1SN2A 4QXTB 2BVOB 4X8JB 1U8NA 2OSWA 3VWJD 4GO9A 1PX3A 4J3VA 3MRRB 3EYQD 2FQGA 4XXDA 3QAZB 4P9HC 3QIUC 3MLXH 4B0MB 3N44B 3FCTA 1KGIA 1OF0A 3KS0J 2NZ1A 4H0LC 3V52H 3MCYA 5KANI 1BDYA 3O8XB 4V11A 1UD6A 1TCRB 2A0LC 2Y36H 5GRVK 1I9EA 1IC5H 1ZT7B 3KPLA 4U3SB 3F7PC 3BGMB 3U6XA 1BLNA 1H6TA 4YHYB 3QFDA 3LH8A 4M7ZC 1DP0A 1JUFA 5AB9A 1IKOP 3T3PF 3D6GA 1K3ZA 4BA8A 3D30A 3PWVA 2FLRT 3KGRA 3AUVA 4WHYH 3T77B 2EYTB 4N6RB 1A6WL 1ZIBA 1HL9A 1AO7A 5I8KH 2DMKA 2D7TL 2YAHA 3H6JA 4RA3A 3CFCH 3LEVH 2VXUH 1I53A 2VN4A 4EZMA 2BOCB 4X83A 5A6LA 5ACZB 2UVFA 3R06B 2YEZB 3EF4A 3T8XB 2WLIA 4JKPH 4TVPH 2P49B 4LVEA 1I1AC 2I32A 2V7HA 1T6WA 3DMMD 5HHVL 1PS3A 3P3SA 3DIFB 3GB7B 3LRSB 4LEOB 5IQLA 3VYPA 4B9PA 5DVMA 3V0JA 4NLHA 1X5FA 4KXBA 4Y5YB 2ITCB 3CC5A 1ETJA 1JS4A 3FO1A 5E2VL 1A22B 3S35X 5DC4B 4DWHA 5AZ2L 3ABGA 2QVFB 2EEDA 2QFRA 3LEXB 2MQCA 2NT1A 1SZNA 4GSUA 3TEXA 2HP4A 1FCCA 3ML9A 4H1LH 5CO1A 5E1GA 2B1HH 2JKWA 3FB8A 4WFHE 2JKSA 3IMBA 1YECH 4X7SH 2DIAA 4PB9H 4N0UE 3K4ZA 4QMEA 4IRSD 1G7IB 2BZCA 4KHXL 3L9EA 1AHWC 1RUAL 3KPPB 4DF9A 3HI6L 1EJ8A 3HI1A 4KH9A 4YDKL 3KVPA 4B7LA 2ZCKL 4D9LH 3MNMA 2VITA 3L3HA 5IQMA 3NPSC 4PRNA 1I1AA 3H3PL 5FYLD 1PLGH 1YEDB 2C3HA 3X3GH 3QUZC 4JAMB 5HHPB 3RY5A 3R8BB 4H2AA 1DJWA 4JM2B 3M1BB 2OSLB 3VFOB 4BBWA 2NZ9C 4NQVA 2R9HC 3JWNC 3FN0H 1EFXA 2BIPA 4YK4C 5F1KC 3TWYA 3V10A 3D0AA 1AG0A 2ZNWA 3GRBA 4F1ZA 1A2YA 1QBLH 1TTFA 3IKKA 4HT1H 2J12B 5DTFA 5KSBE 3TEZA 1XTMA 2WXPA 1XBDA 2FBOJ 2GJRA 3HC0B 4NQSB 4QHLA 3VG9B 4NLAA 2P5WB 4ERSL 5DJ6A 4ZFFA 2CLRB 3VVVA 3RTQD 4QRRD 4Z0BH 1FE8L 4IIQB 3GI9H 3VFUB 1NFKA 1YUHB 4MDJB 1DJZA 4M1DL 2IF7A 2AK1L 3RI5K 1OK0A 3N2JA 1AHWA 4YSCA 4HMEA 3QS2A 3W0WE 1S9WB 2GW5A 4U3CA 2A9DA 4XWOC 4HOWA 3FSWA 5IW6B 1UT2A 1YNLH 4ZMLA 1C08B 4WTZG 1IQDB 3QUZA 3PV6A 4O2FA 2I69A 3N9GL 4LCIH 4MQXD 3TNMB 1NMBL 3PGFL 4U1SA 1C7TA 4YBLB 1XZWA 5CCKL 4HKZB 3RNQB 3IE9A 1NAKH 3BXNB 1HIML 1K72A 4XNMA 1U8JA 3DXAE 3IS0X 3T4AB 1CICB 3PPEA 4ZBJA 4X5WA 5F0MB 1BM3H 1O7VA 1F18A 3CSFA 2VN6A 3BUYA 4NX0A 4APQB 2G2RB 2WXKA 3A24A 1ZKAA 3C8DA 2L7UA 3A21A 2DM7A 2PP9A 4RVBA 4EOWL 3DC0A 2HFFA 5D70H 2XN9A 2D7OA 5IHHA 5TF1H 2EACA 3EH5B 1CGVA 1BVNT 2ESVA 3BKJH 3V79C 2XG5A 3IFPA 4OD2B 1TSRA 3RWEB 4NCC1 4WIQA 3ABMB 1JI2A 3Q7JA 4S0TD 3EH3B 2O6FA 3M7OA 4PM1A 4Q8BA 2BIQA 3BSZA 4K23L 2CCLA 2GUOA 1ZLSL 3LQMA 1SQMA 2R1YB 4LHJB 4HIQA 1AXIB 5DUPH 2Y2WA 5EZJB 2GAZA 4E9XA 3D0LA 1FZOB 5E4EC 2Q2LA 2YC1B 4P2RB 4Z23A 2V8LA 2Y25A 4XN2A 1RJLA 1TQVA 2XTJD 2O6CA 1SJHA 5KSVB 4Z18A 2VDLB 1U8QA 2E3VA 4UINH 1H9DA 1ACCA 3OGOE 5D71L 4F93B 4MBRA 2ATAA 3U2SB 4LARH 3ZGHA 2ICWB 4JX0A 3S3DB 2L8AA 4H0IA 6TAAA 2JV6A 4X6DF 4PJ9C 4YEEA 3MRIA 4YE4H 1IAOB 1WPCA 2K0RA 4ZAKC 1RZIB 4XN7A 4BRVA 5B3NA 1JZ3A 2NY4D 1D5IH 1S9XB 4PV9B 1KIQA 1GOHA 2UXVA 4YPGA 3V0IA 2UZIH 2IGLA 1XH3B 2X2IA 4QAWA 3S37X 4UT9A 4NWTL 3UAEA 2VISA 1X5LA 3RX9A 1P2CB 1UACH 3HE6B 1AXSB 1KTBA 3REWA 2EDLA 4OZ4A 5DHYB 4PJ8D 4KPHL 3MKKA 3ARFB 1KGJA 3QYNA 1ORSA 2F08A 5ANHA 3EHBC 4AV5A 4WLCA 1OE2A 5JYMA 4MA7H 4PJEB 3CH8A 2F8XC 1I82A 1DUZA 1OD7A 4MD0B 4NUJB 2X89A 3V9FA 3VI4A 4LPVA 3ZTNL 1SJXA 5DVLA 1RFDL 5EEYA 4Q6KA 3KH3A 4KX7A 3B8YA 4N9OB 1KIUA 5IBTH 4M02A 4PJ9A 1AD9B 3VFPB 4WW1A 3QAZC 5CIPA 4ZAKA 4FQQA 5IB4A 4Z0XA 1N5YH 1NCAL 5F7LB 2JLLA 1EVTC 1J05A 1ND0A 3O8XC 1DVFD 2Z93B 4YXLH 4B9ZA 4EI6B 4DHLA 2L0DA 1S46A 4YHYC 5JR1L 2X4UA 3UBXI 1Y6MR 4XCCL 3NAAL 4RBPH 2EXWC 4X6BA 3TT1H 1MJ7L 1RK1A 1VADB 1WE5A 3IB4A 1RIHL 3M8OL 3I2CL 1KELH 5GGQL 5DHVB 1N3NB 3SDCC 1C5CH 4BFIB 1YC8A 4KV5E 3GTVA 2RAMA 3MBWB 2CKBL 4OZHE 3JWDH 5I1HH 4PJXB 4QRTA 1D5BA 1OGSA 4W4NA 4YVNA 1X5XA 4OZFB 2NDFA 4AEIL 2ITEA 3PWJA 4JY6A 1MNUH 3B5HA 2VZTA 3H9SE 2AQPA 4QXTA 2BVOA 4HIJB 1MREL 4X8JA 4J3OC 4KUCF 5AOJA 4DK5A 3P9LA 3HNSH 4FQIH 5J56B 2DD8L 3CVIL 1M1XB 4XMKH 5CJ8A 5HVGB 1UJ3B 2J6EA 4NO3B 2R1XB 4I3SL 3BCFA 1CIDA 3OZKA 3TURA 3NFSH 3BQUC 3O8XA 4A7GA 1TCRA 4MNQD 4HUUB 3GHEH 1ZT7A 5JQIB 1A5FL 2Z0UA 1S3RA 2ORBH 3BGMA 2NNXA 3IKCB 3KVDD 4KKCD 4P2QE 2OMBA 3PJSB 1WZ1L 4MA8H 4R8WL 3QQ4B 3MLWL 3BMVA 4GYBA 2UWEB 1PBYA 3T77A 1B4RA 5DJYB 4F5CE 1J8HB 4R4FL 5IF0B 1JYNA 3KYKH 5FOBB 4MJHA 1CDHA 5ACZA 3DYMA 2NY6D 3R06A 2DYRB 2YEZA 4FCHA 3NESA 3T8XA 4LSRL 1PZBA 4MJIE 4QIRA 5F93C 2XY2A 5D96B 5CCGE 4M1CC 2H0PA 5A3ID 3BDYH 5C9KA 3DIFA 2YQ2A 3LRSA 4LEOA 4JM2C 1H6EA 4QXVA 3NACH 4FC3E 5KVMC 4Y5YA 4R26H 2ZSVB 5K9JH 5KS9B 4FA6A 2L7EA 1L0PA 2Z1KA 4N8PA 4YBQD 5TE7L 3WJLA 2SODB 1R24B 5G55A 3LEXA 1OOWA 2BIMA 3SJVE 3HN8A 3WOVA 4JDTL 1IZJA 2CDGB 4Q97A 1THCA 2ICWJ 3VG9C 3OPZL 3PHAA 3UADA 4ZPVB 3WDHA 3JWOH 2WUBH 2ADFL 2NRDA 2FYYB 4B41A 4IIQC 3ZL1A 3ORJA 1MJJB 4NB7A 2M26A 4LRIA 3TCLB 1G7IA 3LX9A 1XH2A 1NPNA 3QW9A 5FS5A 1KYFA 2VQTA 3VSTA 3EYOB 4ADJA 4AL8C 1A0QH 4Q58C 2W0LA 4XOEA 1ACYL 2FEJA 3QO0B 4LXFA 1E6JL 4G9FE 1PG7X 1IGML 1YEDA 1C12B 2L04A 3TN0C 1JHLL 4FI6A 2Y6TE 4JAMA 5HHPA 1DLHB 4JM2A 1ZLVK 3X1FA 3LPPA 1HL4A 3VFOA 4YBLC 4M5ZL 3B6SB 5C6WH 3IDIA 1EHLL 4PJBE 4NC2B 1M57B 1NEPA 1QR4A 5LAXB 1E6OL 3NJKA 3K6IA 3T4AC 1XXDC 2DPKA 2HT4C 1UCBL 3OAYK 5EUKB 4OCNC 3SQRA 4APQC 1RLWA 1R5VB 4Z7OB 3VXSB 3HC0A 1ORQB 4NQSA 1Q0XL 2P5WA 5F72S 2CLRA 4CDGC 4IIQA 1OE3A 3VFUA 1SHMA 4XX1G 3W5MA 1YUHA 5DI8B 4DOHB 4MDJA 4NPJA 5MEQB 3GJFA 3KWTA 3HIZA 3D52A 1HKLH 2OCFD 4LHUG 1OE1A 2X3CA 4UOQA 2WOBA 1N9PA 3UDWC 5JXAL 1JNHB 3ARDC 3L95B 4I13B 1C08A 4WNQB 4KXCA 1IQDA 4ZMVA 4WFHD 2ZXBA 5EEWA 2V4LA 4NKOB 5IMOB 2X4OB 3IE4A 3WIHH 4AJVA 4TNWK 3FYIB 3GKZA 2NNFA 3MC0A 4HKZA 4DP7X 1RI8A 2VH5H 3BXNA 5HVFB 2HRHA 3T4AA 1T5XB 1CICA 2ZZUT 2ZP8A 4HUVB 1D3CA 4MQ7B 4Z7UB 1KN2L 2G2RA 1CI5A 4ALAC 4NIKB 3H6AA 4KK6D 5B7EA 3MLVH 2EVFA 1AANA 5KTEL 4PJ7E 1FL6B 4ZI8A 3GPSA 5GXBB 4LSVL 4BK8A 1KIPB 4RSVA 2I9LB 4OD2A 2E9GA 3RWEA 4JFVA 1MWAB 5DRNB 4PRPE 2I85A 2R2BB 3UDWA 2R1YA 1I7UB 2Q10A 3EO1B 2QPEB 1YEGH 3BLBA 3ARFC 3GZPA 1FZOA 3C8KB 5EZIH 2L4OA 2YK1L 2YC1A 4P2RA 4XVTH 4JGUA 2BFVH 3GSNL 2HLAB 3PAZA 3F58H 4EUPH 5I6LA 3U2SA 2ICWA 3GPEA 3W0WD 1FNSL 4KGJA 4LHUA 1WCBB 2H6PB 5E8DH 1T7XA 1IAOA 2X3BA 3OF6D 3VM5A 5HYSB 1RZIA 5GS0H 3DETD 1UADC 3PDGA 3GTTA 3VXUB 3AS0A 4PV9A 4M6MH 4OJFL 4HWEH 4WW2B 1XH3A 3CZNA 1FO0L 4V33A 3UC0L 3UFIA 5BUGA 1H8NA 2Q7YB 3V0AC 4JL1A 1NGPL 5HI3D 2AK4E 3O0RL 3QI9C 2IG2H 3DXAD 3L8QA 4Y2DC 3O3UN 1P2CA 3HE6A 1CT8B 1AXSA 1PX4A 5E6RB 4Q4EA 5DHYA 3E8UL 2BC4B 5LN4A 3DHUA 3ARFA 4FNTA 2RMNA 2YXMA 3LNDA 3ZLQC 5AKSA 2OV0A 4NC1E 1AQ8A 4U7MA 1EQWA 4ZUVB 2JKNA 3EZJB 3GXNA 5CZXD 3BSGA 3KPRD 4PJEA 3Q06A 1FIGL 1X5HA 4JO3H 5D1ZI 1ODUA 3AQYA 4MD0A 4NUJA 3CZEA 4FJ6A 2ED7A 4YDMA 2ZKYA 3NJJA 2N01B 2PTVA 3CHQA 5I16B 1GYWA 1UT9A 1ZGLB 1AD9A 5A2AA 1UJ3C 2YAEA 4KKAD 3G5XB 5BXFB 1E4JA 2CLVB 1KV3A 1DBAL 4GAFB 1EV2E 3EYSH 4MZIA 2Z93A 4KGLA 2UY7B 4NKQB 4EI6A 3FL7A 1QFPA 4FFYL 2JTDA 4JNXA 3L08A 2D7TH 5TPWH 3BC9A 2LLGA 2CAKA 5LNGA 1IE5A 3FRPB 4LCCC 5C3IA 1VADA 2XVGA 1VZGA 4IOSA 4PVMA 4B95C 5DHVA 1N3NA 3MRPB 2MCG1 3VGDA 4BKSC 4AX3A 4OSUL 3QZPA 1KY6A 1XB6A 3MBWA 5HHVH 2KI6A 1JRHI 4PJXA 5I1AB 6CGTA 3AWFA 4G42B 1MCIA 4MB5A 4OZFA 3G6JB 4UYPA 2PN5A 3QORB 1G7QB 5JUEL 3KL3A 3ZKSD 5E2VH 4NJAL 3Q05A 4WWNA 4HIJA 5AZ2H 3L5HA 2H0EA 3PDOA 1L7IL 1GMIA 3C08L 5F7EL 3UJTL 4I3RL 4KI1A 5D96C 4OGQC 2FT6A 1BQLL 1M1XA 3EO0B 3P73B 4U1MB 1N6VA 4ADIA 2NDGA 4NO3A 2R1XA 3DO4A 1S78C 4PCTA 2RALA 3PP4L 4E41A 4DETA 1MZZA 1J0KA 1HZKA 1JP5A 4TNGA 5HYQA 4HV8B 1Z9LA 4HUUA 3DGGB 1FNAA 5EU5B 5BW7C 1OT4A 1QBAA 4P2OB 3IKCA 1QBML 2WXHA 4KHXH 2J20A 5LVEA 1FH2A 3PJSA 3RURA 1RUAH 2K3TA 4TVPD 1DQIA 3HI6H 4PS3A 2UWEA 3NJXA 3CVHB 3TJHC 3H3PH 1K6QL 2XZQL 5DJYA 4KI5F 2X87A 3KMDA 5IF0A 1X7QB 3JTTB 3A4FA 5FOBA 3QISA 1H3VA 5GZND 2X7LB 3QH3B 1T7VA 4G1EB 4GSQA 2DM4A 4AMWA 1LXMA 2EVIA 2FEDC 4XNUL 1FAIL 4DAGL 1AR1C 4XPTH 3HAEG 5DZPA 3KHQA 3SYCA 1JBJA 4MS8C 2FJFB 2XUWA 3S35L 3T6ZA 4PW4A 4MJ4A 4ERSH 3P4MB 4GI8A 4XPBH 5KS9A 5J6HB 2A4CA 2VXTL 1FE8H 3DK0A 5BW7A 4NI6A 1I3VA 3CFBB 3D39A 7FABL 5I2IB 2NTFB 1JPSH 2X0VA 1R24A 3NJLA 1B0GB 4UTBL 4M1DH 3RP1A 4P8QA 1G43A 3MOBH 1GPOL 4FQ1H 3H9SD 5DLLA 2CDGA 5GSVB 2VQUA 4ANKA 2W88A 4ZPVA 4HLZG 5D1ZD 1BZ8A 5CZVL 3DPBB 4NCDA 3T6XA 1D5XB 2FYYA 1C16B 3HS9A 3LNHA 2VR8A 2BW5A 3BD3A 3B9KD 5E9DD 1MJJA 2QZ5A 3HMXA 3N50A 4NUMA 3S3SA 3TCLA 4Z7IA 4LBAA 1NMBH 2WK2A 2JTYA 1MJ8L 2WXQA 5EBGA 3TIEB 3ARYA 3EYOA 4P2QD 1KT2A 4QGYA 4Z7VF 1HIMH 3EXLA 5E1QA 4P9MH 3QO0A 5CP3H 4NKMB 2F7OA 3M1OA 1C12A 1DLHA 5DVOA 4HWUA 4QWWD 1G1KA 1MLBB 2DH3A 2A83B 7TAAA 5FM5M 2V2TB 5DFVC 2ZX8A 1DANT 4DFIA 5H8DA 5LAXA 1IC0A 4Z78B 5EU6A 5ENWB 3HG4A 5D93C 3FT1A 1L3NA 3ULVC 4M61B 5EUKA 3ES6B 4UIKH 1R5VA 3VXSA 1ORQA 4MJID 3RVXD 1JXJA 3CH1B 1GGUA 1H3XA 1XSIA 1VSCA 3OGCA 1A4JB 4K23H 3AW5A 1ZLSH 4RZKA 5B4MD 5LGKA 2OJZL 5F3BB 5MHSE 3EUDA 2TSBA 4GT7A 1Z66A 3QEQB 5DI8A 1INEL 5KW9H 5MEQA 2MWCA 5AVWB 8FABA 4DKTA 1ZEAL 3LNEA 1A8ZA 2H7WA 3WFDL 3N6YA 1YMHB 3SJVD 1FZMA 2J7LA 3GBNL 1BBJB 3ZO0A 4JVPA 1JNHA 2CXGA 4WFFE 2ZWLT 3L95A 5ABDE 2XY1A 3GMNB 4WNQA 5IJDC 4CW1B 5F7FA 3WTXA 3F05A 2OL3L 1CDUA 4I9XA 2X38A 2VLJB 2IWKA 4NKOA 5DR5H 2X4OA 5IMOA 1G4RA 5KUMA 4AOFA 5I8CB 2E76C 3RJOA 3CSYB 4KITB 1Z3GH 2DQGH 1T5XA 4Y4FD 4BZ2L 1AD0B 5BUPA 5CCJA 3H7BA 1QLEB 4HUVA 4MQ7A 4NWTH 4Z7UA 3W81A 3HBZA 4G9FD 2JXMB 1SOKA 1AP2B 1Z0NA 2C9UA 2MFNA 4UUJB 4RDBA 1AGDB 1FL6A 3O2DA 4I2XB 5FCUH 2P46B 1BIIB 1E5YA 4WU7B 2ZG1A 5LXGH 2I9LA 5EF1A 1NKGA 4D0CB 5HP5A 1A02N 2KZ1B 1PSKL 3QJVB 2PPEA 3L6FA 5SX5K 5T5FA 3PLYA 4L2YA 3T8MA 4Y5VC 1MWAA 5DRNA 4J23A 3ZTNH 2YAFA 1I75A 5KBKA 2WMPB 3EO1A 3BIBX 1SDYA 2V5SA 4K7PY 3C8KA 1WITA 4W6WB 4YMPA 4XVJL 1HHIB 5IQOA 4YHIB 3LZPA 1QHPA 1NCAH 5TGBA 2KZKA 4LDLB 3NTCL 2YA0A 3WYRA 2IH1A 2HLAA 3WV0A 5KYXA 5EC1B 4ZUSB 4MS6A 4R9HA 3H54A 4H2CA 5AYUH 4W4OC 2IFFL 3S8WA 1WCBA 2H6PA 4IRZA 5ACLA 1YPZA 3TVMA 3K6SB 5B3JF 2D03L 4XCCH 4KTEL 5HYSA 3S37L 3ZY7A 3NAAH 5LCVA 1CCZA 1MJ7H 1PDKA 3CIAA 3VXUA 2E59A 1RIHH 3M8OH 3I2CH 4WW2A 5GGQH 1EMTL 3FU3A 4K94H 5D7JB 4QHKI 3QUXD 2PCFB 5I0VA 1V3LA 2WWNA 5IBLD 2BFGA 4GRLD 1U8LB 3T3PE 4HBCL 3GSOB 5I5RA 4AEIH 2N1KA 1CT8A 3AMKA 2OYKA 3TC9A 3JV4B 4Y2LA 1PLCA 2BC4A 4NP4H 3VD9A 1A1NB 3LKQA 1G6RB 1KNOA 1MREH 2R23B 2NY5L 1A7QH 2Q8AL 4RMTA 3V8CA 4TL4A 5DURB 1NKRA 4I3SH 2BZ7A 2AEWA 2BHUA 5EEVA 2YD5A 3QORC 4NQXB 1USQA 4G6FD 4LQFL 4W4OA 3NFNA 2P4AB 4PYGA 4PRPD 5I16A 1ZGLA 1M42A 1G9NL 3V0EA 2YD4A 4GO8A 4GSDL 3G5XA 5BXFA 3S97C 3EYFB 2ZG3A 3FB5B 4TULH 1GHFL 3PGDB 4KOBA 4P2OC 2EIEA 2J1WA 3G7TA 4OD1H 4R4FH 2D7MA 2JJTC 4QD2E 2BO0A 3I74A 4FFWC 3FRPA 2B9BA 4M3JA 1QQDB 5LDSA 4YNYB 4IHBA 3MRPA 4KMQA 4ODXB 1X5AA 3TZVB 4XZ4A 4PGZA 3WBDA 4A38A 3G6JA 1B0RA 2X09A 4QRUB 3FFCB 5F6IB 1GMEA 3QORA 1DVXA 1G7QA 5KYWB 5TE7H 4HIEB 4OV6F 5C09E 3MUGB 4N8VB 5G2NA 1UWFA 5DLMH 1SLVA 3UG3A 4CU8A 3EO0A 3P73A 4JDTH 2D8KA 4GQZA 4U1MA 2LV4A 3RWIB 3OPZH 4G59C 4G6JH 4P9HL 3HI5L 3FSZA 3SKOA 2ADFH 1KTCA 2GB2A 3HZKB 4N68A 4HV8A 5B38G 4KQ4H 3DGGA 5C0RL 3ZOAA 3Q1SL 4NZTL 3FTYA 4P2OA 1MW2A 1SYVB 1TZHB 1BFOB 2JJTA 2F0CA 5AW0B 1Z32X 2UV3A 1NGQL 5EOTB 2AITA 4LDOB 1ACYH 2E7BA 4KKLC 1CLZL 2HFTA 1E6JH 3CVHA 1IGMH 5I1LA 1Y6KR 4PI2A 3OQRA 1JHLH 4Y8DC 2Z4QB 3QZWB 4H20L 4MCNA 1FFQA 1X7QA 2R2EA 4NO5B 1URZA 2N0MA 1UXSB 4UB0L 1J1XH 4IRJB 1I8IB 3EGXB 1EGJA 1HE8A 4GRWB 4M5ZH 1VF5C 4PW9A 5B22A 4G1EA 4KQ3L 1EHLH 4RMBA 5LBGA 1E6OH 4ELMB 5D2LB 1ZY9A 4UWQB 5KG9B 1UCBH 4IBWA 2CO6B 5J6SA 2Y7QB 2NY7H 1WIUA 2GJ6B 4Z7NE 2FJFA 4DEWA 4PB0L 1Q0XH 3P4MA 3ZXAC 1JGVL 2JKXA 3T0BA 3G5VB