1W6LA

3d structure of cota incubated with cucl2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
503
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
total genus 143
structure length 503
sequence length 509
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA02
2GIMA 3G5WA 1NTDA 3NJLA 3ABKB 1SDDA 1AR1B 1GY1A 4G7RB 2H5UA 3T71A 1ILUA 2WO2B 4CSZA 4HHGA 1GYCA 1XMEB 2YAHA 5I26A 2B3IA 2XX1A 2BW5A 1JOIA 1EZLA 2EILB 1ASPA 2J56A 1HFUA 4A2HA 3DIVA 2BZCA 2GSMB 1ET8A 1AG0A 3ZIYA 4KO7A 3NYKA 1WS7A 2CALA 3C75A 5AKRA 3PAZA 1AZCA 1DZ0A 1XB8A 3EF4A 5I5MA 3WKQA 3S3DB 1JVOA 4AI7A 3H4HA 4YSQA 2PPFA 4GY4A 3BVDB 3CG8A 3FQYA 2FT6A 3DTUB 3NJKA 2GC7C 5I6MA 1EHKB 5I6OA 3T6VA 2PPEA 2PCFA 1PZAA 2BWDA 4CSPA 7PCYA 2UXTA 1KBWA 1NIAA 1J9TA 1IBYA 3OMNB 4E9RA 2XXFA 1SF3A 1GY2A 2MRYA 3X1GA 4GXFA 2P80D 1AS6A 1FFTB 4E9TA 2GBAA 3SQRA 4G7QB 3WIAA 2HZHA 3NP4A 3BQVA 3NSFA 1AZNA 4G72B 4DP1X 3U25A 1NIEA 4Q89A 5AZUA 3S8FB 3HB3B 2HX8A 2VW7A 4A66A 2YAFA 2J55A 5I6KA 1NIDA 1IBZA 5TK4A 3T6XA 9PCYA 3QJRB 3T9WA 2VW4A 2IDTA 1CC3A 1JVLA 1F56A 3FU9A 4KOBA 3FPYA 1JZHA 3WNJA 4G71B 2H3XC 1E30A 4KO9A 1W6LA 4YSCA 4F2FA 1PCSA 1L9PA 4N4YB 3SBPA 3S8GB 5PCYA 2E86A 3MX0B 3EH3B 1WAEA 2OV0A 1TEGA 2P80A 3CVCA 3IBOA 1RZQA 4QLWA 1ZV2A 1IUZA 1SDDB 5D4HA 1N68A 2IDUA 3CDZA 1ZIAA 1KDJA 2HX9A 4QKTA 1J9RA 4DPAX 1OOWA 2BHFA 5B7FA 2PP8A 1SHWA 3MBWB 3QJQB 2IWFA 3WKPA 1IC0A 3FSAA 1OV8A 8PAZA 1AZRA 1NWOA 2IDFA 3IN0A 1URIA 4HALA 1V54B 3CVBA 3GYRA 4M4RB 5F7BA 1KDIA 2ZWNA 1R1CA 4NB7A 2DYRB 1ZIBA 5ANHA 2RACA 1FA4A 2XYBA 2J57A 2VM4A 4RH4A 3SBRA 5A7EA 1JERA 3EH5B 1OCOB 1YLBB 1PLCA 2BWIA 3EH4B 3GXUB 1A8ZA 2FT8A 2VSKB 2FQEA 3FSWA 1A4AA 1NIFA 1SFDA 2UXVA 2I85A 2XVBA 4YVNA 3OMAB 1JZJA 1QNIA 4G7SB 2YAQA 1A3ZA 2EINB 3GDCA 5I5JA 4Q8BA 4ENZA 2GC4C 2X87A 3L45A 2R7EA 1JZGA 3FU8A 4JHVA 1ASQA 2PPDA 4A67A 1WA0X 2QPEB 3FS9A 1JZIA 5B1KA 3FT0A 4FAAB 4KO5A 2W88A 3QJTB 5B7MA 5I6NA 4TXVB 1V55B 2Y1AA 3TBCA 1JXDA 1SF5A 3QQXA 1AQ8A 2BP0B 3TASA 4GP4B 2ZOOA 3AW5A 2FJSA 1DYZA 2I7OA 2FTAA 2IAAC 4E9YA 4YSUA 1J9SA 2QPDB 5D4IA 1OCZB 3T6ZA 1OE2A 2CBPA 4GYBA 1OCRB 4DP7X 1NPJA 4DP2X 2IH9A 1V10A 2DYSB 2JKWA 1GR7A 3OD3A 2N0MA 5IY5B 1NDTA 3UGEA 4HCFA 2DWTA 2XV3A 2EIMB 3DKHA 3QPKA 1AOZA 1X9RA 6PAZA 3FSVA 2DV6A 2MTAA 7PAZA 4A2DA 2YARA 1PLAA 4M3HA 4DP9X 3NJNA 3X1BA 1NWPA 1IKOP 3FYEB 3ASNB 2I7SA 1E65A 1AANA 3RYMA 2ZXWB 4KNTA 4UANA 3EHBB 1OF0A 4PAZA 2CJ3A 3TA4D 4YSTA 1M57B 3IEAA 3N2JA 3PAVA 1GW0A 3S3BB 3OMIB 2XV0A 2OCCB 1VLXA 2UX6A 2BZ7A 4AKOA 1PZCA 3UABA 1JXGA 4YSRA 3NJJA 1L9TA 3NSYA 1HAUA 1MG2C 1T5KA 3PPSA 2J5WA 2HXAA 1ET7A 1PMYA 1NICA 5B1BB 4AKPA 1AACA 1KYAA 1KCWA 2HRGA 3ASOB 1MZZA 4JKNA 4ZK8A 2PCYA 1ET5A 1SJMA 3WNIA 5FC9A 1CYWA 2VMJA 1NINA 3H56A 3OQRA 4YVUA 4DP0X 4W1TA 5I5IA 1W8EA 3PCYA 4BXSV 5I6LA 2AZUA 3PAUA 4YSEA 4KNSA 4G70B 2NRDA 2VM3A 1AAJA 3NP3A 3UACA 3FQ2A 2WSDA 1PF3A 2EIJB 1PZBA 3CDZB 3V9CA 2IH8A 3HEIB 4K9JA 4E9VA 4HAKA 1XB3A 1RZPA 2BP0A 2CAKA 1KCBA 1QLEB 5I28A 2AVFA 1BQRA 4N8UA 2VN3A 1A4BA 1MDAA 4BWWA 1WA1X 5E9NA 1OCCB 2XU9A 3X1NA 1L9QA 1NPNA 1E5ZA 3AG3B 1J5CA 2XX0A 3NSCA 2R7EB 1I53A 3IE9A 1PY0A 1JZEA 2B08A 4JHUA 2BW4A 2CCWA 2W8CA 3AY2A 4MFHA 2Q5BA 2QDVA 3ZX1A 4A2GA 4AKQA 2X88A 1GS8A 3FPXA 1ZDSA 1CURA 1BXAA 2FNWA 2FQFA 1AZBA 1KGYE 1JXFA 1AIZA 2TSAA 1BYPA 5B1AB 1J5DA 4F7KA 2ZONA 3H4FA 1B3IA 2EIKB 1AG6A 3AZUA 3ZBMA 4BDVB 2QDWA 1SHXA 1GSKA 4HIPA 3TBBA 4DP6X 2LLNA 1ZDQA 4P5RA 1GS6X 4NAJA 1PLBA 1TKWA 2FQGA 1KBVA 2A3TA 2PP7A 2WO3B 2VSMB 3N55A 2XWZA 4BWTA 2GHZA 2PLTA 3UADA 1HAWA 2XXGA 4HCIA 4BXVA 1N70A 1PNCA 3AG1B 2BP8B 2TSBA 2YXWA 1BYOA 1NIBA 4BWUA 3NJIA 2XLLA 4A2FA 5I6PA 1AS7A 1TEFA 1QHQA 4P5SA 3CVDA 4DPCX 3JTBA 1L9OA 4KOCA 3QJVB 4KO6A 2HLEB 4A68A 1M56B 3AG2B 1BXVA 2FWLB 1A65A 2AZAA 2IWEA 3NSDA 3UAAA 2UX7A 3QJSB 4PCYA 2DY2A 3FQ1A 2PPAA 4BDVA 6PCYA 2IWKA 1PNDA 4UAHA 1MG3C 1ADWA 1WS8A 4EF3A 4A2EA 1JZFA 4YSSA 4FA7B 2BP8A 2YAMA 5PAZA 3NJGA 5TK2A 2GB2A 3JT2A 3WG7B 3NJMA 2GI0A 3OM3B 1RCYA 2BO0A 5D4JA 3ZDWA 5B1JC 5AFAA 4GP8B 4YL4A 4YSDA 4E9XA 3S3CB 4AZUA 2Y69B 1CYXA 4DP5X 1BQ5A 4WTQA 3NJHA 3WI9A 4DPBX 1BEXA 2OJ1A 2JFCA 2PP9A 4HZ1A 5B7EA 1UATA 3QJUB 3AG4B 4L0PB 5B1JA 2Q9OA 1TU2A 1ASOA 1MZYA 2PPCA 2QT6A 3T6WA 1ID2A 3PLYA 2YXVA 2UXFA 4E9WA 5EHFA 2DWSA 1E5YA 2JXMA 2YAEA 1RKRA 4HHWA 2VW6A 3ABMB 3IN2A 1ETJA 3FSZA 2H47C 1KV7A 3FYIB 4NERA 1OE1A 2AFNA 2XUWA 1WA2X 3KW7A 2YAOA 3V9EA 3X1FA 4E9SA 4YSAA 4GP5B 3NT0A 4YSOA 1FWXA 1GS7A 3KW8A 2YQBA 1CUOA 3PXLA 4BK5C 3ERXA 3X1EA 1AS8A 2UXGA 1SNRA 4X4KA 2FT7A 2IDSA 3TU6A 3X2QB 2XV2A 5F7AA 3ABGA 4YSPA 3NJFA 3SBQA 1X9UA 1M9WA 4F2EA 2FQDA 4W9ZA 1ILSA 1E67A 3FU7B 4DP8X 1PAZA 2CUAA 2AANA 1OE3A 1BAWA 1W6WA 1BQKA 1L9RA 4UF7C 2IDQA 1A4CA 3UAEA 1AZUA 1BXUA 1SFHA 4WKXA 4E9QA 2YAPA 3CZUB 2HX7A 1XB6A 4KNUA 1J9QA 1ZPUA 1L9SA 3FU7A 1NZRA 5B3SB 4AX3A 5LDUA 3ABLB 3D12B 4DP4X 4HCGA 2HRHA
chains in the Genus database with same CATH superfamily
3B2VH 3HUJF 3NJLA 2UV3A 3W0WD 3MOBH 3P30H 3C6EA 2A73A 3KVDD 4PB9H 3AB0C 2A9NL 3P69A 3KWTA 3MTXA 4NC1E 2DQGL 2BIMA 5KSUB 1I1FA 5HDBF 1ZTXL 1TTUA 1BLNB 3SKNB 4YEEA 5ESVB 4AE1A 1I1YB 1ZA3B 1EZLA 3AWFA 4PB9L 1PQZA 4KZ0A 3O4LA 1XBRA 2VDPH 3O6FC 5IB5A 3SODB 1RERA 4MJ2A 3FQXA 4NOFA 1UJ3C 2DQUL 4MNQE 5FR3A 4XBEL 4JAMA 2V3EA 1RZIB 1CDGA 3EF4A 3NCJL 5J5EA 4Y1TA 3TBSB 4FFWC 2X53A 2RGSA 2VDQH 3CZFA 3QORC 5D7LB 4TQ8A 3T8XA 3KL3A 5CILH 1NDGA 1TJMA 2W80C 3HZVB 3T6VA 1IQWL 1DVTA 2CLVB 3D25B 4JB9H 4E9RA 4L3AA 1GOFA 4MWFA 5IMMA 3H85A 4O51B 1NFDB 2NY6D 3B5GA 1JXJA 4X4ZA 3ES6A 2K6YA 3PWPE 5ESQA 4ZAKD 2ZKHH 1HYRC 2DDQH 2VXSL 5CGBA 4EKJA 3IFLH 12E8L 4YL9A 2V8MA 4AUJA 2BC4B 4YE4H 3ZE0E 3E80A 1KC5H 1LEGB 2ZG2A 3NG5A 2VLLA 2VSDA 4JDTL 5HJDA 3CFUA 5A2KH 1KPUB 4OD3L 5JYLA 3S8FB 1VKXA 4NC2B 3OR7B 1OF2A 4U1SB 3FQUB 5FOBB 3L7FA 2MMXA 3ZT7A 4AT6B 3EKCA 2CRMA 2KLRA 3V5HA 4ZZKA 3BPCA 2OI9B 3ORJA 5LBSA 1LILA 4PP2A 1DBKH 1C08A 1MW1A 1W80A 2HG0A 4KO9A 5CJQL 5F3FA 3GK8L 2NDGA 3KPRD 2RB8A 2YD7A 1KTLA 1YZZA 2QSVA 2R29A 4MNGE 3WKML 5BXFA 1JF1A 4PJDF 4FMFA 4OIIH 3LRSA 3QWRD 3MJ8A 2P9RA 5IFJA 2JQZA 4XP9L 4FNUA 4M93C 1M7IB 4OCMC 4O2EA 5I8EA 4MS6A 4LIQL 1MI5D 4Y1AE 4HIXL 1MHEB 4WDIB 2C26A 2SEBB 3H9SE 5LAPA 2E6PA 3QDJB 2HX9A 4AZ8B 1OOWA 4FLHA 4OZHB 3MBED 1QI3A 3MLSH 3IXTB 1FNAA 4QRTB 4XE0A 2XZAH 1JP5A 4DK6A 2BSCA 2XACC 1QO3A 3OB8A 2K78A 1KDIA 3K8MA 4FZEH 1K9TA 3NFSL 1MLCB 3FONB 2VLKB 3MFFB 2RACA 4RFEA 3RQ3A 3SIKA 2G75B 3DX7A 3BZEB 2CIIA 3WY2A 2XZQH 2VM4A 3U7YL 3LNEA 5E1AA 5C92A 1EZVX 2NX5A 1OCOB 1KEGH 1AKJB 3GINA 1Q1JH 1LQSR 4I1NB 1JFQH 1P0SE 3H9HA 5FKAB 3UO1L 2O5YL 1A4AA 5KS9B 4YHKL 3QZWA 3MDJA 3C60A 4MAYC 3BUPA 5L9DL 2OXGA 4AIXA 2Z6FA 3MRLA 3LKSA 3LXCA 4LHUB 5D1XD 4YVNA 1QNIA 1AC6A 4N2LA 1NCCL 4L9LA 3FNKA 5TJWK 1OQOA 2X87A 4IJTA 2FYVA 1UUNA 3LKQB 2IMNA 2HMIC 2D0HA 5EU7E 1EZVY 2LOEA 1WFJA 1YMMD 5EC1A 1DBMH 3GMMA 4MS8C 3U4EB 3DETD 4AQAB 3UTPD 3C6LD 4FXGB 1JXDA 2HLFD 4I0PC 3ZYZA 4RFEB 4NJ9L 5DRXB 3TASA 5C0BB 1FNHA 2I7OA 3U4EA 3G08B 3FZUD 3OZLA 3CFKB 3SQOH 3MRDB 2FTAA 4WWPA 4PGJA 2YRLA 3WMQA 1D7FA 1H6FA 3BKML 2I5YL 5J12C 1RJZB 2D3JA 2E7MA 4PJAE 5D2NC 3FU3A 5JR1H 4LHUG 4XP4H 1JPSL 5IBUB 3K80A 3ENEA 4N22A 3C6LB 5J1AA 1ZT4A 2XWTB 1LO3L 1A3LH 5DGRA 4N8VB 1XT5A 3RZCB 4OF8A 1HL9A 3MCYA 1CFQA 3P4MA 4NDMA 5DQJB 3REWB 3H9HB 5D1ZA 5FKAA 1LP9F 2BZDA 5LJYH 1ZHKB 4JMNA 5T5FA 2NQDA 4LSPL 5E1AB 1Z32X 3OJVC 4NPYB 1JGDB 3T8MA 4M48H 3US9A 2O1AA 2KERA 1AANA 4X5RA 3UTSE 3DVFA 3KYNB 1O9ZA 4WO4C 3MNZB 4LBAA 4WHCA 1ANUA 1OF0A 3MYJB 3NDZE 4EQ3A 1JPFA 4WHDA 1JPST 4KDWA 1G7LA 4OF6A 1ZOXA 5DMIL 2YSSB 3MV8A 1Z0NA 3WIFB 2ADIA 5F96L 1J05B 1UVQB 4DETA 1XV8A 2X6MA 2XHNA 3VSVA 3QUYB 3DJ9A 2PKDA 2V7NA 5D7IA 3BT2H 3F5WB 4ILDA 4TTDD 3MBXL 4L1LA 3CX5J 1DBBL 2NY0C 2ZQKA 4PRID 4X6CE 4DZBB 1IC4H 4PJFB 2IXQA 2HXAA 5E99L 5F9JB 1YYML 2HJLA 1XSKA 5KANG 1UJ3A 1QD0A 1K8DB 1XL6A 5DUJA 1OLZA 4R7LA 1IKNC 4TSAL 3RWDB 5TGBB 3TEUA 4ZW5A 3FCSA 3KYAA 3LDBC 2MHAB 2Y7QA 4ZMYA 2K3HA 3HE6B 2H32H 2Q3AA 1Z5LA 3BQUD 3T2NH 3KZ8A 3SPCA 4BFJA 4ADJA 2IALA 2AZUA 4NM4H 1UZ8B 5JDSB 2EDBA 3HR6A 1E6OL 3UTTA 4UTAL 4ZUVA 4H5SA 4AW4A 5HYSA 1BOGA 3LDBB 3DSNA 3QPQC 3ZT6A 4J1UB 2EDJA 3DDFA 4V33A 1LDPL 3MO1A 3T0XA 2OMVB 1DVSA 3RVWD 5MEPA 1IKNA 1O9WA 2Y1YA 3B6SA 2CHXA 3FFCB 1VGKB 4XP5L 2C3VB 1G7JB 2NY0B 4WFHD 3QIWD 5E24E 3RDTC 1HESA 2EUVA 4P23B 5FUOL 5FECB 5HYSG 1VSCA 1WA1X 3MLVL 1KT2A 4N5ED 3U9UB 5B8CA 2XWBA 4EZKA 1NKOA 2IADB 3HC2A 2R7EB 4EUPG 4XBGB 3MV8B 1QA9B 2BVPB 2QELA 2JSFA 2OSLB 2XTLA 3P73B 4IBTA 4BZ2H 5L2JA 4LBEB 3NCWA 5CU5A 1CMOA 4G6KL 3T0EA 2YGPA 4GKOA 2L3BA 3QJZA 4OZIA 1BECA 1R9FA 4LT7A 2FNWA 1LK2B 4LGRB 1TOXA 3QZMA 5CCGE 1KLUA 3JZ7A 2WQWA 1HCYA 2JB5L 2F68X 4NHCH 3UYPA 2WQUA 4I2XB 4LLMB 5T1MB 5I18H 3FT3A 3TBWB 3WJLC 1AG6A 3KH4A 3N85H 4NRZA 3WL9B 3U6RA 1IRAY 3RFZA 3QDGE 5T1MA 2ZD0A 3FN0H 1WZLA 1G1YA 2Y1VA 4MB1A 3SJVB 2L4OA 4IOSA 5C07D 4DPRA 2CXKA 1DBML 1F3JB 1BMGA 1HX0A 2D7NA 3THML 1TT6A 3KBEA 4PW3A 4X9FA 1IE4A 3AAZA 1EGJA 4LGPB 1YY8A 4WEMB 2IGTA 1OD9A 4KJPC 3IU4H 2PWDA 5A2AA 2EC8A 1EHLH 2YWZA 4LCCC 3H9ZA 4GRWF 3N1FC 1REIA 2YPLD 5I6PA 3ZPDA 3TZVA 4FQQB 4GQ9L 5ETUA 2ZOLA 1BCIA 5C71A 3T3MB 1CLYH 3UTTD 5DQDH 3CVHH 1A66A 3ZZQA 1JZ2A 4BHUA 2B15A 4HSAC 4I77H 4QXGL 2DH3A 5K9QG 5EU7C 4XN8A 2E74C 3GMMB 3NSDA 4PJCA 1BM3L 3L54A 3RIAK 1ZLUK 3T0BA 4G8FB 2X09A 4I9WD 1XCQB 3ILQC 2J6EH 3DJZA 2W94A 3S96A 3BUIA 4AG4L 4XC1H 3MKGA 1UCTA 2EIEA 4E41D 3B2MA 2P7TA 2A6DB 1DBJL 2KZ1B 1HINH 1XQ4A 1UENA 4OZ4A 5L4MA 4KK6C 4TSCL 4XMLH 1CD9B 5FGBC 1YNKH 4HKZB 4AMWA 4GG6F 1S7RA 2QZ5A 4L4TB 3LZRA 1LE9B 3BYTA 3DHMA 5B7EA 3V6ZA 3RVVC 1ZVHA 4JKWA 3KPSD 5JO5A 4RMTA 1PZ5A 4RFOL 1XAKA 1Q1PA 1DBBH 2X4RB 2VDLL 4I2XE 3WFDL 5GRJH 3GB7A 1JK8B 1RU9L 4GRWE 5C6PB 2RFXB 3IGFA 4X98B 5SWSB 1RKRA 3GHEH 2D9QB 2NTFB 2VW6A 4QPEA 5HYIA 4MDIA 3TA3A 3G6JF 4NQSB 4POYA 5CCKL 4WSGA 4G6ML 2LTQC 2YAOA 4XODA 1DJHA 2EEBA 5D1ZD 4S1SL 5I5RA 4EUPB 1L4IA 4UOZA 3DJTA 5D6CB 3A3YB 1MJ8L 5CGYD 1GKOA 2B1OA 3L4XA 4I87A 2K45A 1TU2B 4WI3A 5K9KB 2IDSA 3O41B 3K6OA 1K6QH 1SXNA 4HKBA 3W11C 2FO1A 1S7WB 2F5BH 1LO4L 2BSRA 3ABZA 4MDJA 3ARRA 3IJ7A 2X12A 1E67A 2JTDA 3BJLA 1RUKL 1BVKB 1AGFB 4KXZI 4PJHA 1WGVA 2ZXDA 4H8WH 3REWA 5EU5B 1MFBH 2YSTA 3VSUA 1YECL 1HCVA 3OHXB 2UWEF 4LCWE 2LW3A 2ZUVA 4UT6A 1MWAL 5CINH 3VWJA 1BXUA 3HI1B 5IB4B 3CZSA 3VD0A 5ACLA 1NZRA 2KZBA 4FYRA 4ZNCD 4P2QE 2VJ0A 3S5ZA 4JDVB 1H9VA 2EDXA 1A6PA 1A3RL 2VB5A 2JB6B 2W0LA 5E00B 3HG2A 5ADPL 3ILQD 3P0GB 2Y7SA 4DGYL 5IVZB 1IILE 5K69A 4I1PA 3PP3H 4C8XA 1IBGH 3PJNA 2MCG1 3WNLA 1OP4A 2J8UA 3U0PA 4HKZA 3BZ4A 2BFVL 3MRNA 2EP6A 3QBTB 4H2CA 5KSAB 5AVQB 2XWRA 3DIVA 2BZCA 1QTSA 3MAWA 2AJYL 2CALA 1RFDH 2NXZD 4LCYA 5MENA 3Q06A 2G2NA 2XBZA 1XB8A 3J2PA 3RLSA 3W2DH 1LL1A 1ZGLB 4S0SD 4O2FA 1P84K 4WEBL 5F7KC 3SKOB 3V4UL 4UNTA 3BVDB 1Q1JL 4JVPA 1KGIA 1JZDC 4MDRA 1FZJA 1MELA 3OKEB 3GSWB 3IU3B 1BQUA 4UDUA 5FYKD 4CSPA 3VI3B 3AFLA 2X10A 3K2UH 2FJGB 2W9LA 3LZNA 4XXWC 4L4VD 1GY2A 3N50A 2UWEB 3NAAH 3FONA 4GSXA 6TAAA 4JEGB 1T1WB 5ID1A 4OF5A 4UM8B 5FUOH 2MWCA 3VWKD 2QSQA 4R7VA 1MDTA 1IAIH 3BDXA 3HPJB 4X7SH 2K8MA 3BD3A 4WFFD 4UNUA 3MROB 4HC1L 4IJ3C 4WFGD 3M86A 3IK2A 3ML8A 4KHTH 3T6XA 1C7TA 5D7IF 2X0VA 1F56A 1MLBA 4PJEF 2C3VA 2MQGA 4XVJH 2GBVA 1X5YA 3LCYA 1FO0A 2W65B 2XG4A 5T1DH 3CXDH 5CBAB 4YSCA 2GEQA 4PRHD 4JQVA 5C9JB 3N1QC 4KUCD 4IU3B 3C5ZA 5KW9H 3VW3H 4WF7A 3CIAA 2P24B 5EOCL 1KGUA 2XQBL 4DTGL 3M07A 5EO9A 3MRBA 2WZPD 5GHWL 1S7SA 1KG0A 4NFCA 4QHMA 2WZ5A 4FQIH 1KCKA 3S6CA 5DJ6B 3K4ZA 4LCWD 3WHXB 1AZRA 3TJEH 2P5EE 3UGXA 2AGJL 2FSDA 5GZND 4OZGA 3KPTA 2YKLL 4GKZB 3NZUA 2F2HA 2BSDA 4P5MB 5CZVL 5LLIC 3VXRA 5DUML 3F7QA 1FA4A 1U95B 1WT5C 2O5ZL 1NCTA 5J56B 2G0LA 2AV1A 4FTVE 5CEZH 2FH8A 2WIIB 4FADA 1K8IA 1BJ1J 3QHFH 4RA3A 4FL4B 4WW2B 1B4TA 1A1NA 3DV6A 2VSKB 5B38G 5GS1A 3FJTA 3FRPB 4HLZG 1J8HE 5C3TA 2ZXAA 5FM5M 4Z3EA 1P4BL 4EE2A 1EXUB 1NM4A 4PWFA 2WXQA 5E94B 3ZHNA 1OGTA 2IOMA 35C8H 1UWEL 5FHBL 2OZ4A 1FP5A 3EFDL 3QRFM 4V2CB 1DP0A 4LDLB 1A7RL 4ENZA 3DGCR 1A02N 1FNLA 3QAQA 3MRHA 1G84A 2MHAA 5IM7A 3TESA 2Y7LA 3QDMD 1Z7JA 1T5WA 4G7VL 5ESVA 3QUMA 1YNKL 4ZFQA 3UZVB 4ESKA 4DEPC 1EFXB 1T6WA 3KDMA 3AREC 3FT2A 4NZUL 4KKAD 2W88A 3ZZSA 1F11B 4TVPL 4BELD 5C2UB 3R4RA 1M3IA 3QWNA 3JQOB 1CF8H 2OMNA 2QQLH 2WUCL 3UXFA 1S9WB 2Q7NA 1MFAL 4HH9A 1ND0A 4DGYH 2NR6D 3ECBA 2X4QA 4OT1H 4E41E 3I75A 5CUSH 3T6ZA 5D7JC 3R7QA 5C2BH 5CEZE 1Q9OB 1T0OA 2IFFL 1KN2H 2V8LA 1JNNH 4JKPL 4KZCA 1A0QL 2VZ1A 4LE8A 2F0CA 2WVSA 1DUYB 2NY5H 4H0GA 1Q9OA 1FIGL 3E0GA 4PW4A 1X5IA 4KV5E 4L8BB 5GISL 4K8RC 5KS9F 2VRQA 1DUZB 3FAXA 1NC4B 4ZPTA 1S9YA 3M88A 3POCA 3CFDA 5KJ4A 1GYVA 3WN5C 1MRCL 2UVFA 1IGCH 4GI8A 1JWSB 1P7KB 2R0LL 2VLRD 1F4AA 1BFSA 2HFGH 3T0EE 5E6IB 1K3IA 1H3WM 2HUEA 1ZMYA 3HI5L 4LVNB 1BVLA 3KM2A 3L3OA 1JN6B 3L4ZA 3T08A 3PP4L 4KX9A 5KAQF 5I1DA 3D3VE 5F3BB 4XRCA 1SQMA 4X6CF 1KEGL 3A67H 1ZLSL 4Z3GA 4OCXL 1JRHL 3ZMEA 4Y4KD 2OMWA 1M57B 3IDIB 5IQLA 3UO1H 4JZOA 3E9TA 3VD5A 2E6JA 4MKTA 4RRPM 4GLRH 1E5AA 2ZUYA 3KG5A 4MA1B 2EDMA 5HHOB 2BZ7A 3BUQA 1E8YA 2JNZA 1PIGA 1T1XB 1G6RA 4TVPE 5E94A 3TTSA 2PO6D 3NSYA 4HXBH 4XP1L 4O00A 1E40A 1KPUA 3MZTA 2AQ1A 2F61A 1ET7A 1DVFB 1R3HB 2X4UA 3JV6B 3RP1A 3QFJD 5E00A 2BVQB 3N9GL 1ZY9A 1P5VA 4ZK8A 4IIQA 4PJ9A 1K5WA 5DHXB 2X4RA 3D08A 2VZUA 3C09B 3Q2NA 5KJRH 5E9AA 3OKKA 4LVNC 4AXWA 1MJ7L 5FYKH 3S34L 3HE7D 1TJHL 1Z5YD 2SEBA 5I6LA 4YDZA 1ZWIB 2ZX8A 32C2B 2HFEA 2OQJA 4MB3A 5F1IA 5H37H 4P2OD 4OD1L 4NQXB 1IBBA 1NDGB 1TQSA 3VXSD 1EAJA 5DHVB 5FPIA 2W1NA 4LGSB 4CDHA 4IIZA 5JIPA 2FX8H 1EAPB 4R0LA 2ZT9C 4HOMA 3UJIL 2R4RH 3CDZB 4CN6A 3U2SB 2QR0B 3QFDB 5SWZE 3HHSB 2R4SL 3LEXB 5I8KL 5I75C 1GGBL 1RZPA 1D6VH 3IMBA 1IT9L 5I8OL 3AWEA 3OKOB 5A2CA 5KS9E 4IU3A 5C8JB 3JXAA 4ABVA 1NSNH 3CBRA 3HZYA 3U1PA 1ZLEA 1VKXB 3NIFF 4XPFH 1AE6H 4RGMC 2BFGA 4MJID 4NN7B 3EJYD 1M05B 2FEDD 1PY0A 2VXVL 2FH6A 4G42A 3RVTD 3ZX1A 4F2ME 1YJDL 3OLIA 4NQCB 3RDJA 1FAKT 4WI6A 1DLFL 1BD2E 3WMPA 4WHTA 5B1AB 1NBVL 4JZJB 4Y1AD 5CLXA 3IPBA 3QUKA 5DUBB 3EOBB 4ACTA 3TOPA 1GSKA 1V7NL 4LLVA 4AMKL 4AQOA 1U9KA 1HDMA 3SDYL 3GMNA 3PDGA 5SWQA 3LN4A 3QP3A 4JRYD 1PLBA 4U1KA 2A3TA 4X4XA 3QC6X 3STLB 4GQZA 1OK8A 3MZGB 1NBZA 5B38B 4R4BA 5IJDC 4HCIA 3KLHD 4N2EA 1FNEA 4U2YA 5J6HB 2OULB 3V4PL 2YRZA 1KYDA 3D4GA 3SCMC 4AM0A 1JWMB 1MIML 3I84A 2VLLB 3JVFC 5I1AA 3HC3H 2XLLA 5F88A 2WSPA 3TNNA 1EHAA 1LK2A 4OZFA 2Y9RT 1ZGLA 3D51A 4BK5A 3IPEA 3NJVA 1QHQA 1KYFA 4Q4EA 1IQWH 1PGRB 5AVWB 4XZ4A 3MNWB 1OB1B 1GPOL 2IBGA 4LL4A 4ZSOB 3FO2A 2IJ0C 3MRQA 1L7IL 4EN2A 4QRQA 3GSOA 3KPNB 2DY2A 2JF1A 2PWEA 4TUKH 5AYUL 5EEZA 4I5BB 4P2QA 3ULVC 3QUKB 4CDGC 1ECZA 3DNKA 3HZ3A 3MRQB 3ZKNC 3U7YH 3L5HA 1CLZL 4PV9A 3CZNA 3LQAL 4JPVL 3EJJX 1G7JA 2XIIA 2VNCA 4MLSA 5MEQB 3DK2A 1T1WA 1KB5L 4P46C 1RJYA 3KD4A 1E50A 4TPRL 3A4EA 1FGNH 3E6HA 1BXXA 5GZOA 1T04A 3FT4A 1TZHB 2W0FB 4HHAB 3N42B 1MCJA 3P9MB 4I85A 4MNGA 4P4RB 4POUB 3GBLA 5C7ZA 1AXSB 5KYXA 2OP4L 3HRPA 4GW5B 4UT7L 2JELL 4JM2D 2XI9A 2JFCA 3FCTB 4HJ0C 4CN4A 1IM3A 2R2BA 3O45A 4MNQB 3ZDXE 2R23A 1H8NA 3EH1A 1Z5LB 4AK2A 5FO8A 4KK8D 3ALXA 4FG6D 2CHWA 1BG9A 3HBQA 2WXOA 1CD8A 2OYLA 3O8XB 2GJ6E 1RJCA 4ONHA 3B5TA 3S97C 3C5SB 1DCEA 4P2YA 4JFEA 5KVFH 3WAJA 2BDNH 1XCTB 2HJLB 1PL3A 3IFNH 3AQZA 3ZL4L 5AW7B 4P9ML 3X1FA 2EEAA 3L48A 1Y6KR 5DMJB 3FBQA 3DSFL 4IEFB 5HHMD 3GSOB 4LSDA 4Y16D 2VT0A 2WWKT 3LQAC 2NPLX 3BFOA 4G5ZL 1CUOA 1NJ9A 2VR5A 2H2SC 3WGUB 3GSNB 4XVOA 1H9DA 1JVKA 5BVJA 3SEPA 5I1LA 3CFEB 3ZL1A 2DM7A 1F0LA 3M8OL 4L23A 2OMVA 4QRUA 4Z0XA 5AAMC 1VFOA 3FOLB 3CVIH 4ADIA 1XHHA 2LFEA 1GJUA 4MD4A 2V17L 2DQFA 3BVNB 4ELMF 2VYRE 1FRGL 2A9NH 4F8LA 1W6WA 2R4SH 4PRPE 4PJAB 1T83A 4FMKA 4N68A 4RISL 3T65B 1I3UA 3S7GA 5E8EB 4YPGB 4N3UA 3BIKB 4A55A 4EKXA 2QADC 4CW1B 5KW9L 3L6FA 4CMMB 2BCKA 1EJFA 3E8VA 3EYSH 1UH4A 5CP3H 4KRNA 2MSPA 5DLML 4A7GF 4R7DB 2WYIA 3KPRE 4W6WB 1W91A 4NUGH 5GRVL 4AC2A 3MLYL 3O41A 4GKLA 4L3EA 4X0KA 2ICCA 1RJLB 4OIBA 4JQIH 2V9UA 5ITFB 2J7LA 4MQXD 1J87A 3VFOA 4W9JC 2BMKA 3Q9PA 4NO2A 1YEDB 3ULVH 2DIAA 4U3SA 4XHQA 4Z76B 2UYLB 2APWA 1MCOH 5CIPB 5TE6L 1G9NC 1ZXKA 2A0LC 3PWUB 4ZTOH 3OJDA 1Y0LB 3ZSTA 2LFGA 4GRLA 3HZYB 2IC2A 5B1CA 4DWHA 4MCZB 5A7BA 1G6RL 3RZCD 1TZIB 2FLMA 4ZS6C 4PJGA 3BAWA 3WKQA 5DK2A 2R83A 2WUBH 5H2BA 3CG8A 4HBQA 2Z7WA 4GNKB 1GGCL 5I6MA 3WDIA 1LWRA 4HIHA 5CKAA 2YN5A 4TM9A 2P5WA 2QKSA 4JRYB 1AO7A 1UZGA 3L3OB 1KCRH 4B27A 1BEYH 2EXSA 2JJTA 3VYOA 3JWDL 3C60B 4NQEA 1AHMA 5IB3A 1CICC 2YWYA 1CICB 5AOZA 1E27B 1U91B 4AH2B 3MXWL 1MFUA 3L3OC 4P4KA 2X28A 5D7IE 3WIAA 2WB1A 1I8KB 3N41F 3HCVB 3PF2A 3GSRB 2CK0H 4L8SA 3HHRB 3NSFA 4H0HB 5C0IA 3OX8A 4DP1X 2B59B 1T66C 3WOVA 3W39B 4WEEA 3MTRA 2FLBT 1CWVA 2DQDL 3QJRB 2ARJA 1R3HA 4QHKI 3RTLA 1NDMA 4LBEA 2D4FA 1JVLA 4NN6C 1LYQA 1PZ3A 5FYKU 3TVMD 4XC3L 5HYJD 2X2YA 4HIJB 1OY3B 4MXVF 1VJSA 2J2ZB 2GJ6D 2H3XC 4H1LG 5IK3A 3WO4C 2VM9A 2CKBH 3GS4A 3LNGA 4HH9B 15C8L 2BRQA 3V5KA 1NEPA 2IH3A 1MFCH 3P4OB 3LD8C 3GEWB 1LLAA 3KHQA 3SDYH 4Z8FH 4M7LT 2YD3A 4XWGH 5F7YC 1FH5L 3V0DA 3OAUL 3ETSA 2K3TA 4R2GB 1DHKA 4DN3H 4QKTA 3JWOH 3FO1A 5FHAH 5B4MC 1QW8A 1G9EA 2GUYA 2KQMA 3QJQB 1MJJA 3S37X 3LB6D 5HBBA 1OV8A 4UUJB 3D87B 2FHBA 3GHBH 3AVEA 4M61B 4WNQA 4GSDH 2QADB 4OSUL 3VNZA 4PLJD 1M53A 3OAUH 5D5ME 4PV8A 5JHLH 2WCSA 5BV7L 3LKNB 3QNZB 3D3VA 2Z8RA 4MD5A 1O7VA 2XA8H 3UBXG 1C16A 1NMCC 3OAWA 3VA6A 3I3EA 2AK4E 4DFIA 5MHSD 4E68A 1LEIB 3EYUH 3L1EA 1LEGA 4RH4A 5CZXC 3QRGL 1QO3B 3EH5B 3OGCB 1YEFL 3VRIA 2DLHA 2HLFC 4I0PD 3GXUB 4WKZA 1B88A 3UG4A 3ES6B 2FQEA 2GAZA 4YDNA 1N26A 3PHOA 5E5RB 3NPSC 1CXEA 3LD8B 1KJ2L 1UXWA 2I85A 1YNLL 2B4CL 2PCXA 3VFVA 3AREA 3OV6A 4HC1A 2CDFA 2QJDA 3V5DA 1LJMA 3MV11 1IM9A 2BIIA 1THCA 1AIFB 3OAYH 4X5WB 4HEPA 3T2LA 3QQNA 1NCWH 2E8ZA 2BNRA 1GTNA 4PHZA 3SDDD 1ZKAA 2CBMA 4XVUC 5D2LB 1AGEA 1GC1L 4XMLL 5B1KA 4QRRA 3LXUX 2XTJC 5HI5C 1E3FA 1XFPA 1MWOA 2C7UB 4LQ1A 3NVQA 4J3UA 3S9DB 1BPVA 4APQB 3MC0A 4QRRB 2CDEB 2VXUL 2ATKB 3U0TA 4BQ9A 3S36X 3DK0A 1BZQK 3P11H 2EUXA 1EAPA 4Y89A 4L5FL 3S35L 1A6AB 5GS1C 1ZHNA 2LHAA 4ZPVA 2PYED 4Z78A 2W81C 4WO0A 5D1QB 4P4RA 2WQAA 3L3DA 1UFGA 3U0WH 3WE6A 5LQBL 4FHKA 4JQXA 1KENH 5TE6H 2FEEI 1U3HD 2X6UA 1A7BA 4GQ9H 1CGWA 2F15A 3BH8A 2CO6B 1EWHA 5JZ7C 1Q9KA 1N0XL 1TZGH 3DPBA 3MA9L 1F4WL 5ACMA 5DO8A 1CD1A 2ENSA 1N8OE 5EZLA 5EO0B 5K9OB 3EIFA 3BVVA 1DQJB 1J05A 1E65A 1FUNA 2NYKA 3UAJC 3ARGA 3HE6C 1XF2B 4AIOA 1J0KA 1SVBA 3SDCD 1YMHA 4UQCA 1C9SA 3K7UA 3EGDA 4OGAD 2A9AA 5F7UA 3R7RA 5AB0A 3QHFL 2GTZA 4NEHB 3TA4D 5GRWA 2WVVA 1I8IB 2VMDA 3O4LB 1QKZL 2BSSB 5D71L 1E5BA 3GJFK 1I9RL 4M8RA 2OR7A 3TL5A 2OMYA 3I9PA 5AVVB 1VEOA 2P4AB 2XETA 4LB8A 3K72B 1KXVA 3K5SA 3B8SA 1F3DJ 4K5PA 1EO8H 1LEKA 1BD2D 1QEWA 3EBIA 3DXAD 3GLDA 3E9UA 2WXIA 4ZFFA 1SY6A 1CFVL 5ILTL 3I74A 1A21A 1U93A 4NSKA 3BKYH 1DVZA 1WZ1L 1SJMA 1L0XA 2O6CA 2OW7A 2JIXB 4NHUA 5LXGL 1B0IA 4JZJC 2L7QA 4M1CC 5I1GH 2XC8A 2UY6A 4MQ7B 3D0LB 1P7QB 4PSRA 4PGZA 1EHXA 3PAUA 3GMRB 1IAIM 5K39A 2UY6B 1ZT1B 4RA0C 5DJAA 2NSXA 2JMRA 5TDOA 1Y0LA 3NP3A 4NNXB 1DQQB 3EO9H 2O61A 4OZHA 4K8RD 5F7DA 4J3OD 4IGBB 1VADA 2IH8A 4NKDB 1GGCH 3C6LC 4AL8C 1RZ7L 4MA8H 4J3TA 4PLOB 1U8HA 4XNAA 3TH2T 4GI6A 5K1JA 5C0AD 1YPZE 5DZJA 3UBHA 3MQIA 2WINA 3KJ6L 4PJHB 5BV7H 1JCVA 3MU3A 2K1MA 4RIRA 1F4YH 1FLTX 3RWJA 5I75B 3S37L 1Q0EA 3MXWH 3B3IB 4AENA 2XX0A 3QXAB 3GZPA 2LR4A 2N01B 1XL4A 1KTDA 3MRNB 3TCXA 4I0PB 4FKKA 1V3MA 5BVPL 5E6ID 1JZEA 4JHUA 1FO0H 4KK9D 3EGDB 3M1BA 3QXTA 3HJ0A 1AHWB 3RKPA 1XEDA 1XIWB 3AU1B 1N7ML 2DQ6A 5IVZA 4AJWA 5SV4A 4Z76A 4ABQA 3H4FA 5D5MB 1T2JA 1B3IA 4IYKA 4HUVB 3GXPA 2VL5B 2Z4QA 4XCNB 1BAFH 4KKPA 4BDVB 4LAQH 1GA2A 2K0RA 5A3IC 4FQJH 2FQGA 2BX5A 3RFRA 1B4RA 4GG6E 4NUMA 3T6QC 3GLEA 5IQ9B 5I74B 4PU2A 4FRWA 3SGEH 4L1TA 2JI2A 4XX1G 4Z3JA 2X7LA 5CMAA 4NQDD 4PVMA 4RZCA 4GBXC 4K5MA 3U2IA 3BWZA 1OGAE 1B90A 3M17B 3LRHA 3FUMA 5DJ6A 5FYJD 1J5IA 2BSRB 4MDJB 5BOZG 4XOBA 1TEFA 3ARDD 3WLWC 1OALA 4RIRB 3O2DH 3RL2B 4UB0L 1SVZA 5AL0A 4PJ9C 3ROOB 2HT3D 5AW9B 4LIQE 1KXTB 3OKMB 1P9MA 3TA3C 1DJGA 3QO0B 1M1XA 4PCYA 4DKTA 4GUPA 1CTMA 1RK0B 2XVKA 4B60A 3P9LA 3PFUA 1CD0A 2YMTA 4N28A 4PP1C 5TDPB 3QJXA 4EF3A 5T3ZD 3P9MA 2JCWA 1FYTD 4MNGB 4UBDC 5JA9A 5DC2A 5DHYB 5JIHA 1YNTB 3U4AA 1YY9C 3ETBF 1U8IA 3WFDH 2Y06H 3TZVB 3T3MF 1HKLH 4PV1C 5ALBL 5GSRB 5LNDA 3V6BR 3DO4A 2JJUA 5FB8A 2PW1B 1QVOB 4XBPB 1AI1L 2KC0A 2PN5A 1ZTXH 5BS0E 1QAWA 1CI3M 1NAKL 2GCYB 1B6DA 3EJPA 1B2WL 3HUJB 4RSYA 2OMUA 1DVUA 2ZYSA 1XGYL 3QIWC 4EIUA 4X4YA 5E8DH 2WKOF 4KROC 4Y2OA 4GMSL 5SX4H 3WN5A 5C0DB 3WUZA 3GBDA 4YEFA 3AS3A 5EHFA 4L1HA 4XCYA 3K2MC 3D2UB 3ARQA 4HHWA 4H20L 3LRLA 3ZUCA 4R97C 2ZX9A 1XWVA 3BDBA 3E1F1 3SCMD 1LO0H 2WLYA 2XUWA 1TZHA 2EIBA 2J43A 2QZQA 2IG2L 4H5SB 3V9EA 1T04B 4E9SA 4PJ5D 4YSAA 2FGWH 1NAMB 1Z2KA 3FMGH 3CBJB 3RWFB 3TZVC 3WTUA 1AS8A 1U30A 1WAPA 1NCUA 4DVRH 4G9FA 4TRPH 4WI9A 2HH0L 2E5EA 4XN2A 3TU6A 2P5PA 4G8AC 2ZOLB 12E8H 2B5IB 4TVUA 5F7AA 1IGTB 3SCMA 2FBRA 2XBTA 3IDNB 4XVTH 2IQAA 2AF2A 3GZQA 1ESOA 3I50L 4BFKA 3WEMA 4H8QA 2AEPH 1NDMB 5IW1A 2AANA 1B9ZA 1UWXK 2VDLB 3B6SB 2DQCL 5FOJA 3EYFB 3ARPA 1DQDL 3BWAA 2ZOUA 4G59C 1P1ZB 4KUZH 4AEIH 3PL6A 4E42A 4HUXB 5FHBH 5INDB 4AV5A 1U6AH 4ODXB 1C8PA 3HNTL 4MXWL 1CLZH 3BP5A 3KEDA 4JHWL 5HGDB 1CBJA 4BFEA 1XVSA 4OLWL 5A2LH 1DQDH 4KUZL 2YD2A 4AEIL 5JDSA 2A77H 4PRHE 5AVZB 4AJVA 4APQA 4JGMA 4ZMTA 2DBLL 3ZQWA 3MCKB 4R7NA 5C6TH 4ETQB 1WF5A 3QYCA 3EDFA 3GIZL 1XMEB 1YC7A 2HLAB 2NY2D 4IK6A 2WKGA 3T0EC 3UYOD 4AY0A 5EZJA 2J6EA 1KXQA 4WFGE 2LT9A 3MLSL 1JOIA 2AW2A 4IM8A 1G9MH 1BZEA 1HFUA 4AYEC 3FTGB 4NKIH 5IHZA 4DZBA 4A7QA 5FECA 2E9JA 1A6TB 3AUVA 5AKRA 1QSZA 4DN4L 4R26L 4G8EB 5I5MA 4Y9GA 4YOKA 2N0KA 4OZHF 1X5AA 3QUYA 4AIZA 1OSZA 3HS0B 1VGKA 3PWNA 4K94H 2GJ6B 1L5GA 3P0YL 3E3QE 2GITB 4U7KA 4KU1A 3CPLB 4NIYE 1N6QL 2FIKA 4FG4A 1CBVL 1G9HA 1KJ2H 5ITFA 2WBWB 5H4ZA 5T1JA 1AY1L 4HWBA 2IPKB 2QL1A 2ORBL 5D7JB 2H45A 3CFQA 4ZMWA 1WHPA 2VR8A 4NWUL 1IV8A 2B16A 4H2AA 1JSYA 2GBAA 4GUCA 4Q2ZA 1Q38A 4G7QB 1ADQA 1IFRA 4Q56A 5GS0C 4L18A 5DEGA 3ARGC 3HE6A 3LPWA 3JTSA 5HHOD 5IMLA 2A6DA 2A6JA 4XNMB 1MNUL 3ZRCC 1GSMA 2EZ0C 3RWJB 1ZWIA 1K4DA 5ECJE 5I1HH 3QYMA 4ZSOE 4D94A 1LP9A 2ATPB 2F19H 3DC0A 3RX8A 3AMLA 1QPKA 2PR9A 4FQHB 4HXBL 1ZSHA 2LE9A 2VDKL 4UAOB 1OAUH 3JWNG 3ZQ9A 5CEXB 4Z7WF 3PREA 4F7MB 4QRAA 5KZCD 5GS2H 1AHKA 2QHRL 4OLEA 3GRWL 2PNDA 3TURA 3UAJD 2EACA 2P42B 3ZL2A 1ROWA 3H54A 4LP5A 5JHBA 1TEGA 2YK1H 4W9IC 2EC9T 1T5XA 1AQKH 3ARZA 3CVCA 4LVHC 4FL4C 2X05A 1DTUA 3KLQA 4L8CA 3WIHA 5CS7A 1DQIA 4YQXL 1PY4A 1J9RA 4X8XA 4A38A 4B53A 3CHSA 4ZTOL 1IU1A 1JGLH 8PAZA 2YK1L 3IN0A 4OI7A 1URIA 3BH8B 4N9GA 4B9PA 4H1LH 1HSBB 2A4ZA 4HS6A 3F7YA 4W68A 1K4DB 3UBXI 5DQJA 2K7QA 4Z7UA 5ANHA 1ZIBA 1BVLB 4IMKC 2DQHL 5DC0A 3Q1EA 2QSTA 2ZCKH 3CXHK 3UOAB 1J0IA 3RY6A 5SX4I 3RFZB 1HXMA 4GAAA 5A7EA 2PYEB 3T4YB 5JQIB 4N8PA 1MIEH 1BEYL 1U3ZA 5IM7B 3BGMA 2V9TA 3CTTA 1R0AH 2EUZA 1PZ2A 3WFHA 3U82B 2WVVB 2VOTA 1E2ZA 5F9AC 1EAQA 1H6EA 2OBGA 2GJJA 2Q10A 2P5EA 3MLUH 3A6BH 1CL7L 4MX7A 1ACXA 3QNXA 1JNJA 1A3ZA 2EINB 5HY9A 5HGBA 3WTYA 1R46A 4GOSA 4N2AA 2COVD 2R7EA 2R8SH 5IFAL 4Y7OC 3D2UD 1UM6L 5HJ3B 4J12A 2P46B 4LLQB 4MJJA 3VWJC 1IB5A 2DD8L 4FXKA 4WO4D 2JXMB 4NGHH 3K71A 2I32A 1F8TH 3A6BL 3GDBA 4IJ3B 4OLUH 4S2SB 5H8DA 3IJ8A 1A0QH 1NCAH 3LKQA 3SGJA 4TXVB 5C09B 4L9LC 1MRFL 5IESL 3FTGA 4JFEE 3GMPB 1G0YR 3U9PH 1DYZA 5C08B 1E4XI 5T1LB 2WQRA 5FA4A 1KIUA 4C54A 1MCWM 4OLVL 3TF7C 4KXAA 4L29B 5BQ7B 2ZXEB 4XGZB 1OE2A 3EFFB 2A83B 1SRDA 1WT5A 1QQDA 3ALWA 3LZFL 1WEJH 2IH9A 4AOFA 2ZE0A 4GBXA 2OYPA 4HUWB 1DJXA 4BQ8A 3L7FB 4UQEA 4LRIA 4DNLA 2OZ4L 4ZFZA 2Y7MA 2JCCB 1G7IA 2W9DL 3QS3A 4HKXA 3BFWA 1ZHLA 2OMZB 5DZOA 2XWCA 2F8XC 4XH2B 4ZODA 5FKPA 2Y5QA 2G4GA 4H25B 4EMZA 3WFEL 4UV7H 4UU9B 1UQSA 2PXYB 3Q43A 2W07B 2FHFA 3ZE1F 4IBZA 3L9YA 2ZUSA 5KSUA 2HN7B 1U58B 3HVNA 4GRMA 3WSQL 4PRNA 1YEWA 2XBDA 4LEEA 3EGSB 1MHEA 4PAZA 2IAND 1T0MA 3F6LA 4M7KL 3PHQB 5HP5A 3IDNA 3VTMA 5LNEA 1OARH 1T1YA 3WNOA 1R3LA 5IHZB 2GBTA 4YHZL 2Y7NA 3AS2A 1RD6A 3PAVA 3I9AA 2IQ9H 4JPKL 1YEEH 4OTXH 5IBTH 3DXAA 4XWOD 1E8WA 2UX6A 3FCBA 2ZCZA 1OM3H 1OTUD 4LMQE 3UABA 1CCZA 1GIGH 4YSRA 1XTMA 3AT0A 1WFNA 3G5ZA 3VU1A 4IU2A 4LKCB 5A16A 4YHZH 2VXQL 4HKXB 3DROA 2KUTA 5HI5D 4AKPA 1JBJA 3VG9B 3CZLA 2GTWB 4YIQB 2QR0A 3QFDA 1DJWA 3I6KA 3M45A 1X9QA 2XV6B 3RX9A 4PP1D 3V0WH 3FH5A 1MZZA 1CFSA 3RI5K 3EO1B 1CYWA 2PTUA 5HGDA 2VMJA 2JKSA 3E2HB 4GIPD 3MRGB 1HWHB 4YVUA 5FW7A 4TV3A 4MA7L 2XRAL 3GJFA 4XO3A 1BZ7A 5DR5L 3SDCA 3OKYA 3ARGD 4OLXL 3QYNA 1TQCC 4KNSA 4PB0H 1MNNA 1A1MB 2NRDA 3TM6A 1ZA6B 1SHSA 3P77B 3H2PA 2CGRH 5FGRA 3IGAA 4AM0Q 1MFEH 1NEZG 1H3XA 4WSKA 1VF5C 2WSDA 4K94L 3ZKQD 1EA9C 4GT0A 4MJIB 1GOHA 2VLJB 1H8OA 4XNXH 4I5BA 4FQ1H 1AD9A 2P44B 4KVCL 1U8IB 3VFGL 4P23A 4ZS7H 1XB3A 5LBSL 2A9CA 4JGUA 2NCEA 2FZ3A 2VR7A 1AGBA 3H2QA 3QEQA 3QUXB 1YYLL 4BUQA 4ZXBA 5EF2A 4TQEL 5EU4B 3IVKB 4MBOA 2H2SD 4GEJA 3WMSA 1IAIL 1Y1UA 3QIUD 2CPCA 4PJ5E 3V7MA 1M6OA 2R29H 1HINL 3B9KD 3BGAA 1I53A 1P4BH 3MNVB 3O0RH 4YHML 2VMCA 2F7QA 4ZOCA 2B2XL 5I66B 1UWEH 2CK0L 35C8L 3EH2A 1Z9MA 2WMPB 4X5XA 5I8CA 1QFUH 1DLHB 2DJMA 4NQUA 4WI0A 3ULUF 5E08L 4R7XA 1IGFL 2C5DC 3W9DA 3CDGB 3C08L 3FFDA 1QBLH 5GGRA 3T4AB 3V5KB 1CL7H 2A38A 4WK0B 1HK6A 3AZUA 3B9KA 3IKKA 4Q2ZB 1NL0H 4HPYH 4GQQA 3V0FA 1IAOA 4JZNA 3U83A 4M6NL 5EORL 1NLBL 3TPUA 4DUWA 4XXDB 3S3SA 4EVNA 1TKWA 3GUTA 1YN7A 2NT1A 2OXHB 3D06A 1F58H 5D6CA 4F92B 3BP4A 1B0GA 3EJTA 1L7IH 2MOVA 3FB7B 1T7VA 4MJ5B 1EHNA 3S5LB 3SKMB 1LNUA 4P23D 1S7VA 3VMNA 4BSWB 3Q8AA 1AO7D 1G0DA 5A2FA 3HMXL 2YR3A 3P4LA 5BRZE 5GQBA 4K9EL 1V3KA 5EUOA 1KY7A 4GEIA 1S7XB 4P2RA 4WJ5A 5D2LE 3UTSD 1R5IA 3VJ6B 1NCDL 4G8EA 1LO4H 4WDIA 1RK0A 1D2PA 2PUQT 4XP6H 3KS0H 4XN1A 2ZKHL 4KTEH 1CK0H 3L4UA 4FYQA 4LMQI 1HZLA 2WLNA 4L3EE 3GI8L 3B9KB 2H41A 3FHEA 3RWHB 3L2MA 1TLKA 3UFIA 2ZSWA 3TS8A 1MIEL 1FI8C 5CMAB 1VA9A 5IJKC 4U1MB 2DLFL 4P3WA 3RPKA 1JRHH 3DUUA 4LKXB 4FYTA 2PWHA 4I1RA 2Y6SC 4FTVA 3Q48A 5ISZD 3CN4A 3UZQA 3QAZB 4YL4A 4I3SL 3ZE2E 1HHHB 4FA6A 1M6OB 3GLZA 3RWEB 3GRWA 1C5BH 4ECNA 4YGAB 5D2NB 4D0DB 1S5HB 2Z0BA 2EYTA 1HHHA 1UD3A 4X80L 4GAGL 4Z77A 4NZRH 4EOWL 2HJKB 4XO9A 2F53B 1ASOA 2Y3AA 3J27A 4Y8AA 3T6WA 5MEQA 1TXKA 4C57C 2X4OB 3L17A 5CUSL 4WWOA 2Z4TA 1S9KC 3ZTNL 5EC1B 2Q8BL 2MNJB 1IZJA 3BSZL 4N0YH 1T2QH 4JUSA 2AAVA 5EN3A 3K91A 2UY7A 3QIUA 3RDTB 2HUHA 1XGRA 3RB5A 4LHJB 4RSVA 5J89A 1J0YA 4N26A 3DBXB 3KPOB 1JGUH 1LMIA 3QGVA 3QEQD 3QZWG 1LDSA 4QHMB 3LNDA 1EAOA 5F1NA 2VO8A 4P46B 4OBSA 4LNRB 4UOJA 5FO8B 1FQ9C 1U2YA 4B5EA 3X2QB 1OSPL 4PUBH 4U1HB 4Z5RA 4CC4A 5TE4L 4PTTB 1PS3A 1H0DB 4FN0A 4LARH 3GSVB 5BW7C 3AT8A 3DHJA 3MR9B 5F9WB 1UOVA 4OAWB 3UTQA 4X6DB 4ZUTB 5JHDA 2ZUWA 5C0DA 4IMKA 4FGMA 3MLXL 1WC7A 3TCLA 2EYRA 4AYFB 4FQ1L 2GTQA 3FT4B 4YLQT 5I1JL 4OQTA 5JLZB 4NT6B 3TBYA 3EGXB 4UZSA 2DWXA 1VB9A 3PNWB 4FFZH 5GIRA 1WK0A 1RZKL 1XB6A 2EE9A 2WCPA 3RIAF 4CVXB 1T22B 4XNYL 2KL6A 2XQYA 3BO8B 3PDOA 3ABLB 5CD3B 5E4IA 4J27A 1F3DH 4Y5XC 1PX8A 4ZFFB 5L4JA 5I8EB 3COOA 4KX8A 4F57H 2W91A 4ORGA 1MAJA 2XYCA 4JDEB 3RWCA 1OB1A 5B21A 4WV1B 4MMZB 3LIZL 4TSAH 4ERSH 3DECA 1KCUL 2V6HA 3FB5B 3MR9A 5F2FA 4R5TA 5F88B 1FZJB 2X3AA 1WJ3A 3WLWD 3JV0A 4WO4B 2CUIA 3UJTL 4J4PC 4HA1A 3W0WB 3TJEL 5C97A 2FATH 4Y16B 3GSNH 1ET8A 2V7HA 2NNFA 4G6JH 1WS7A 3C75A 3QUXD 1H3TA 1QEXA 3SDAB 1WWWX 4WVRA 5L2JB 2WJ5A 4NCC1 5AYQA 1N3NA 2PPFA 4G5AA 3H2WA 4M7JL 4NQTA 1OAXH 2Q20A 4XMZA 4KVNH 3HC0B 4FNLH 2IDCA 4Z7WB 3VFWB 1S3KL 2PCFA 1W0WB 3ZDYF 3EXLA 5CD5C 4FJYA 3CFTA 4LF3A 2WAQA 5EOTA 1S5IL 1O5PA 4XCFH 4J6RL 3GXIA 3NIDE 1KPVA 5IEHB 5D5MF 3N44F 1JNHA 2BINA 3GJFB 3GTNA 3O6LL 2GSIA 2O6EA 4ZMOA 4O5LH 2Y36H 4LVOC 2F9BT 2QQNL 1U21A 5DA0B 4TUUA 3SKJH 1H3PL 4JREC 3UAJA 1J9CT 3VI4E 4ES8A 5HPOA 3V4PA 4JANB 4TPRH 5LBVA 1CO1A 3QUZD 4IDLA 2X4PA 4OD2B 4RMSA 5HDBB 4C83B 5T33L 3SZ6A 4YHIA 3EJSA 4WU7B 1Z9SB 5HVHB 3IT8D 4YHPB 3VFNA 4TL4A 3VNYA 4OFKA 4I88A 1H6UA 2F5AH 2L7JA 1O5DT 4HD5A 1CZ8H 1K2DB 4HLZH 1ZHKA 3HG1D 3FB5A 4N4YB 4N20A 5FUZL 5HHXH 2N56A 4MAYB 1SBSH 2P5ED 4KJWC 4ORGB 4QLWA 1MQKH 1MF2L 2X1QA 1ORSA 4HF5H 1VADB 2HFTA 2BHFA 4QHNA 1DUZA 4ZPTB 5AL8A 4RESB 4ELMB 1OSEA 4NKIL 5TDOB 3SYQA 4HALA 3ZYOA 3F6IA 4XP5H 1Z66A 2R1WB 1V54B 2EO9A 4EDWH 1BJ8A 1Q0XL 3GYRA 5D70H 1UWXH 4LCUB 4DGIH 2FB4L 5DJCA 4KKLC 4JQIA 4EVNB 3NFPB 3TCLB 1I85A 1QFWI 4ZAKC 5DRNA 4B5ZA 4PJIB 2GSGA 2Y24A 3F01A 4PV8B 3ISWA 3U2SA 3D8MA 5I1KL 1AXTL 1TTFA 4ODTH 4PY7B 4XTRD 3NSJA 1I1AC 1BJMA 4G6KH 2AVGA 4C4KO 5AW0B 1FRGH 3EZJB 4YHOL 1WZMA 3CK0L 3S5LG 1ZLVK 1CVSC 4OZIF 3FHQA 5T1LA 3EBAA 5BRZB 5AOMA 4G7SB 4OKVA 1MI5E 2PO6A 4HEMA 3DBXA 3BKCL 2AEOA 2L0DA 5C09A 1KTJA 4RAUB 5CR8A 1BZ9B 4K71B 3JTSB 5FDWA 1C12A 2PYFB 4Y1AA 2PPDA 5H2BB 5IMLB 3F3HA 3LH8A 3LS4H 4JVUA 1ADQL 1JZIA 4LESA 1CXHA 2B0SH 4ZO7A 5BV7B 5DC9B 3D9AH 4K7PY 1IGYA 4OZHE 3QRBA 2X3CA 3KLLA 3NCEB 5LVEA 4W6YB 3GSUA 4FQJL 4R6UA 4BA0A 3JV4B 1WO2A 43CAB 5GGUB 2QHRH 5DMGD 1E8XA 1IBDA 2QGDA 4HKJA 4JY4A 1A7QL 1T20B 3EDDA 2WIIA 4MJIA 2PABA 4P06A 4J8RA 2XIDA 4UDTA 3ZTNH 3WFHB 2BMKB 2VDMB 3DYPA 4PJXF 2VLRA 4GYBA 2E9WA 2N3JA 3MBEC 3GO1H 2R0KL 2J5LB 3V6OA 1TYJA 1FDLH 2JKWA 1YY8B 4XPGL 4ZBJA 4H20H 2E7HA 2JK5A 4UQAA 1JHKH 1UA3A 4JR9L 2Z8SA 1I85C 4JFZL 3VRLE 5GRUL 3HNVL 4UIMA 1QRKA 3PQYE 3X14A 4KAQH 4AW7A 3BW9A 4CMMA 3OG6B 2XPZA 1Y1DA 3ESMA 4EXKA 1RZFL 2R29L 4RAVB 4Z95L 1PLAA 2JQMA 1DJYA 1ZS2A 4PJ8C 3FT3B 1EEZB 4WW2C 5TE4H 3NH7L 3Q3GB 3QUYD 4DGVL 4X6BB 2Z8WC 2I7SA 3K6DA 4XC1L 2C4FT 1OT4A 4O02B 5E6YA 5EUKA 4PS4L 1Y7VA 5K9KA 5C0NC 3LKOA 4OCRH 3T2QA 2MH4A 3U36A 4IMLB 1EO8L 2AQRA 1A7OL 1YAZA 5E6UB 1I1CA 4K55A 1A4KB 4IKJA 5AW1B 3RAJH 2ODIA 4YXHH 2ZOTA 3W38A 3BZFA 4PJ9D 1XSIA 5ICXB 2LQRA 2Y25A 1TYRA 1AGDB 4N0CD 4TSBL 3OJDB 4LCIH 4WUKL 3II3A 1SOKA 2Z91B 3N6YA 5IOPA 3D4ZA 4RNRB 1OTTC 4FD0A 2AJUL 2CJUH 1H15B 4L1BA 1QSEA 3BP4B 5E2UH 3QEUB 1RU9H 1HYSD 3UCQA 3TJHD 3T2NL 2OJZH 2BSTB 2R0WL 1PMYA 2WOBA 3LPGA 4TF4A 1KYAA 4XXDA 1MCHA 3TVMC 3UBFA 5EOTB 3QQ3A 5FGSA 3QI9C 3F6JA 3QO1A 3HE7C 1URLA 3L9BA 5CJOH 1RVFL 4F9LA 4Y4KA 5MHSE 5IROC 5C0EB 1A6UH 2XSKA 5J9PA 3O6KL 4ZUVB 5HYSB 3PL6D 1G7PB 1P7HL 2Y07L 4FMVA 2HKFL 4G9FE 2ERJB 2JJTC 4PS3A 3TBSA 2DDQL 2ERJC 4E0RA 4EZLA 3SOTA 4YSEA 5CGMA 3OR7A 2HG5B 4JFDE 1RUML 2XFXB 3EFFA 5KVEH 3CSGA 2I60H 4IBQA 3FCSB 5HPMB 4J3OH 4QHPA 3DX8B 2TAAA 3AC0A 4NO0A 1N18A 3UDWA 3MHZA 2OMTB 1AQMA 1B4LA 3LIZA 3CGTA 5DS2A 1A5FL 2BP0A 1IIKA 5CJ8A 3FQWA 2HFFB 1NANH 4HGWB 3OKDA 5EBLB 2YD0A 2C9SA 3W56A 2LU4A 3VXMD 5CD5D 3BH9A 1W0WA 3SE6A 3KS0J 1FGNL 3BLBA 4G8GD 2VR3A 4KKBD 3NSCA 1BPLB 3S0PA 3PS6A 2Q6WB 1QVOA 1TLMA 4AC4A 4KKZA 2WOYA 1H3PH 5IMKA 3AY2A 3DO7A 2JELH 3PJSA 3U9WA 3T1WA 5GIRB 1A1MA 2PW2A 4ZQTA 1URZA 2QPFA 1IEAA 3EOTH 2E7LC 3L4YA 3QDAA 1I3VA 5HGAA 1WRFA 3RA7L 1XF4A 1X3DA 4L3FA 3VXMB 4Z7WE 1H19A 1GZHC 2XICA 4PGDA 3A6CL 1GHFL 4U1GC 2F19L 4JFQA 4PJBB 3BPLC 3SD5A 3JUZA 1NBZB 4AITA 4MMZA 4DP6X 4D3CL 4R5XA 1MJJB 1HHJA 4KXCA 4XZUA 1K85A 5I9QC 1HDMB 2EH8L 4P9HL 4U33A 1CLYL 1HAWA 3TO4C 4H7VA 5F1OB 5C0AA 3AQYA 4QXTB 1N70A 3DIFB 4DOHB 3TJHC 3CQPA 5J11B 3FB8A 4J28A 2NUTA 4S0HA 2ZKYA 5LGHH 5IFHL 3UP1A 5JIDA 2Q6WA 2DJ4A 2QVFB 2UY7B 5DI8A 1KLGA 2AJSH 4P9HH 2X1PA 3DIDA 1IBHA 4KROB 2QKIA 3H1ZA 3VXRD 2WWOA 3QIWB 5FM5O 1Z3GL 1RPQA 3EGSA 1OL0A 2HLEB 1FL6A 3V55A 1ES0A 2Q0ZX 3IJHA 1KMGA 3BE1H 4Z18A 2UZIL 4GQPH 1WP6A 4IRSB 3WXVH 2Y7OA 3RDTD 5C0JA 5LUMA 3MO1B 4NQDA 2FIRT 3PXHA 4PG9A 1A1OA 4DZ8A 4Y16C 4ZFOA 2HRPL 4KI5E 5B4MD 4Z7NB 5I19H 3QUZC 4PJHF 3RTQC 1P4IH 3HRZA 2VABB 2YHGA 3PGCB 1XIWA 4YC2B 1EMTH 3W5MA 4R4BB 1CLVA 2WWMC 1VZGA 4DW2L 3HLAB 2YKKA 2GK0B 3BAIA 3MJ7B 3ZSSA 5EIIA 1UZ6F 5SWQB 2ZUQC 1E4HA 4F3FB 1XGPA 4Z3IA 3UJTH 2Z31C 2GSGB 3C5ZC 3K8LA 1OP3K 4DPBX 4DW2H 2BIQA 2G9HB 5T3XL 4CSTA 1FFPB 1CT8B 3BD4A 1YC8A 2A6IA 3EYQD 1TU2A 4IHOB 3OKKB 3P02A 1MEXL 2P8MA 3KR3H 2RD0A 3FQNB 3MRRB 4KXZH 4WHYH 4GRWB 2CE6A 3QVAA 4HWUA 4BM7A 5I76A 2BS8A 3UJIH 1MJ8H 3MV9E 2P8PB 4B95C 2L7EA 1JMXA 2YAEA 3OAYK 3HZKA 1LD9A 5LQBH 5ERWA 1CGSH 1D6VL 3NIGE 2CUHA 3MBWA 3KJ4C 2X40A 4JB9L 4MLIA 4OLVH 4U6VL 5L4IA 3WIFA 3FULA 1JF5A 4Y9FA 1FFOA 3BPNC 5CLYA 4MQXC 2EDFA 5IHLB 1XGTB 3KW8A 4TQIA 3CPUA 3LRSB 3QCTL 2QGBA 1AGFA 5EBWB 3LQZB 4QRFA 2GHWB 4TKWA 1QASA 5BCAA 1IGCL 5KBKA 1FE8H 3JBG7 1X5KA 4YSPA 1LP9E 3K8KA 4Y4HC 3HR5A 4Z95H 1L0PA 3DHUA 5GZOC 2PYEA 1ILSA 1E3ZA 1YSOA 5MP6H 1X5HA 3QEHA 1W0YT 1XIWC 5MEND 4LHQB 5D7SH 5FO2A 2BXZA 2ITDB 4DQOH 3UL4A 3HG1E 4PJ8D 1D5IL 5IVXA 2IDQA 3FQUA 1FFRA 4HSQA 4JANA 5HGHA 3CHXA 2HX7A 4KC3B 3DUSA 2RH0A 3WKMH 3B4NA 1KCVL 2BNRD 2BXYA 5I24A 1ZVNA 3J8F7 4LCCB 4PJHE 4P9HC 3VXQB 1HWGB 3GXTA 4R0LC 2Q87A 3PL6B 3FTZA 1NAML 3G5WA 2QQLL 1EK3A 2WUCH 3ABKB 4R3SA 5DEZA 3U1QA 4DCQB 3CFBA 4ZFGH 4G7RB 3E1ZA 5JPMA 2WO2B 2J21A 2OMBA 3GNML 4GAYA 3RU8L 3EUUA 3JWNC 4CMHB 2BOBB 2ZAIA 5EU3B 5IESH 3KXFB 2CGZA 4YNYB 5DSCB 1DQJA 4DO4A 5I26A 1NGZA 2ZF9A 5EG6C 3IE4A 4P57A 1TFHA 2X1WL 3L9EA 3BVXA 4XNZB 1SY6L 4LSVH 4QWWC 3NIFE 5A2JH 3VWJD 3E38A 4JPQA 3CFJB 4MASA 4J3VA 1U8QA 2WIMA 2Y4SA 4OUUB 4YWGL 4NWUH 4FJ6A 1DZ0A 3IMSA 3IETA 3C6SB 4GMTL 4KK8C 4AI7A 3D3VD 5FYLD 1BFVL 5D8JH 4GY4A 1VRSA 1WIOA 5F9DC 3NJKA 4N6RA 2CGRL 5GXBB 3VXUE 4UWQB 1OTSD 4OJDH 2A9MH 4TNWF 3CSBA 4YBQC 2F18A 4AEFA 1XCXA 2MKLC 1EH9A 1KBWA 4R8WH 4U1NA 1FCGA 5A43C 2AEWA 4UIKH 2AJSL 1YQVL 4K5NA 2XXFA 2EXYC 4Y9BA 1U3HA 1YUHA 3IJ9A 1AZVA 3DBSA 1AP2B 4PJEA 3FO9A 2MRYA 4KRMB 3UTOA 5J1SC 4CADB 5ES4B 1R5WA 2H1XA 3I6LE 5C07A 4XPFL 4M1DL 1DANT 5EZLB 3J07A 1KLFA 1AZNA 4G72B 2GJ6A 1TQWA 2YBRA 2O6FA 2WCGA 2CR3A 3CNKA 1KT2B 2APSA 3CUPB 3E8UH 1I7ZB 3QEUA 5C3LD 5A1AA 2CDFB 2WD0A 1S9XB 1ML0A 1UD8A 1CGYA 2CNYA 3LN5A 1F3JA 2Z92B 1OM3L 5JOFA 1U8NA 1HH6A 1T0PB 4GFTB 4LEXH 3IDJB 2I25N 4QRRD 5FO9A 3T4AC 3N42F 3MJ8B 4MJIE 1C5CL 1M05A 2CMRL 4OR1A 5DQ9A 2I24N 3QH3A 3QZNA 5JORB 3GPEA 1YN6B 4LSRL 1ZLDA 1R24B 4LU5H 1JUFA 4HK0A 5ALCH 1FDLL 4HYTB 3V79C 1E4XL 4XAKD 4ZUSA 2WNKA 2E86A 1WAEA 3ARED 3WAKA 2X9WA 2P80A 1KV3A 5HHNA 4X6CA 1ZLVH 4LSRH 2WZAA 4NQED 2QFRA 4ZFZB 4Y4KC 1NGQL 2EE3A 2VC2L 3EJZC 5C6WH 2H1LM 3SDDC 1OXYA 1UTDA 2GEEA 1G7QB 5KZCB 3LN4B 3CLEH 5L8KB 5GS1B 2IADA 3FSAA 1BBDL 3BVWA 3GMNB 4HJSA 5FGCB 5IJKA 4HG4K 3L1OL 2ALAA 1UD6A 4UOW0 4N2FA 2QQKL 3OXRA 4PJ7F 1F45A 2JTYA 3LPFA 3BQUB 1R75A 1MY5A 3BWAB 2CO6A 1A14H 5CJBA 2NDFA 1O6SA 5HI4C 4S1DD 3TZVD 1GKEA 1P9MC 1V8HA 2Z31D 4HCRL 4NRYA 1BQHA 4JCWA 3V8OA 2YPLA 1H5BC 2F74B 3EFDH 3BQUA 4TSBH 5T5NG 3LNHA 2CLVA 3SBRA 4BINA 5MI0C 2OSWA 1JTOA 3CXHJ 2PCFB 3P4NB 5AVSB 3GLAA 3WDJA 1YLBB 1PLCA 3LQAH 5D71H 3HI6H 5JPMC 3G08A 1FHGA 4QMEA 3B7RL 1DL7L 3Q5TA 3WTWA 3RVUD 1IGIH 1N8ZA 4IBLT 3DRQB 1UZ8A 1J10A 4ZYKB 1PW3A 4XBEH 1OAZH 4OCWL 2FX7L 1D5XB 2GC4C 4TNFA 2CM5A 2WLIA 3QT2A 5H4YA 1TQVA 2CQVA 5C0EA 4BYHA 1GAFL 5SWSD 1B2WH 5EIVA 3O6KH 4MRBA 3BKYL 2QPEB 3QQ9C 5TF1H 2WM0A 1KIUB 1K8DA 2CGYA 1CFVH 4R0LB 1KTCA 1A6VH 1UH2A 3QNYA 5EV7A 2AMGA 3JYCA 1EEUA 3ZKXC 3BXNA 4LL9A 1HJCA 4HS8L 4WV1A 1MRDL 3BW9B 2XN2A 2CLZA 2EO7A 2VDOL 5EZOL 3T0ED 2P8LA 3V4PH 2HVKA 4IRJB 4ZFGL 2JK5B 3VJ6A 1QRNB 4UV4H 2QPDB 3D05A 2ESVB 4PJXB 3IMUA 5LB1A 1UA6L 2VLME 5CP7B 2VZ3A 1EEQA 3ETBJ 2VUOA 1YEIH 3HG1B 2WP3O 1NPJA 4P5TB 1GCFA 1MCIA 2OX5B 1MLCA 1OPGL 1A4KA 1E6JH 4LDCA 5IY5B 3QDGA 3KPQB 1EXHA 3L9RA 2R0LH 1D5ZB 4A39A 2DWTA 2JB6A 1J0JA 2NTSP 3LQMA 4KZDL 2P5WD 1L6XA 1O6TA 1KWKA 2YC1A 4AGOA 3L95B 3EADA 4AV0A 1MCEA 3V8CA 4HOZA 2H2PD 2HA1A 4OF7A 1PD6A 1OSPH 3CFMA 4ZW7A 2PTVA 4JFED 3VFOB 1NOFA 3RZCA 1WWCA 3IPFA 3GMQB 4M43H 2R9HC 4LNVA 4BZYA 3T3PB 2XZCL 4HGMA 1I8MA 3TP4A 4Z7OE 2GG1A 4YXKL 4PWIA 3DX6A 5I1KH 2RAMA 4NO3A 3NIGF 4EBQL 2AITA 3N41B 3CFJA 4G8IB 4G6FB 4YFDB 4D9LL 1D5BA 4JM2A 4XHJD 5B39B 3BZ4B 5KVDH 2NLJB 3HUJE 1IEBB 3V4LA 5IK3B 5IP4A 5C0BA 1AVAA 4QTHA 2CJSA 2NW2B 2Y22A 4KI5F 2WKOA 2Y6SD 4WEUD 4X80H 3OAZH 2J5WA 1S3RA 4XMPH 3MSPA 4JCMA 1DQVA 4NUPA 5C0CD 4NP9A 3LS5H 5IEKA 3HZKB 25C8H 4M6ML 2B0SL 3D52A 5CJ5A 2RALA 3KYOA 4JKNA 4J7RA 4QGTA 5CEXA 3X12B 3RTQB 5F9OH 2OJEA 5TFSL 2NX5D 4QAWA 1DQKA 4W4OA 1KN4H 2AQNA 4P5MA 3RILA 1LHZA 2HVKB 5IQNA 1NGYA 2W5PA 4GKNA 1AFVH 5CHNB 3HW7A 4FE9A 3BD5A 4XB3A 4I48B 5GRYA 2R0KH 5IUCA 3CQFA 1YYCA 4P49A 3IMWA 1FG2A 1JPTH 3D85A 4ZXBC 5EFIB 3VG9C 3MNDA 2BVYA 5L6YL 2JKIS 3NFPA 4AYBA 1IQDA 3IDMA 2JKNA 3HN8A 5DJYB 1G7HB 1H3VA 3DVNB 1T0NB 4N8UA 2JQAA 1SM3H 2VN4A 4LEOA 4ZYKA 4NWTL 3WNPA 5EEVA 4U1SA 2ZX5A 1AGCA 3V4PB 3HBGA 3FRPA 4PS4H 1PG7L 5ACZB 1AI1H 3IE9A 3ZTCC 4PWHA 2F54A 2W8CA 2CRYA 1UCBH 3HI6L 3O11A 4XXWA 5ENWA 2YD6A 4PI0A 1GS8A 1CTOA 3UZEC 1IM3D 3RNQA 4NKMB 4JM4H 2VUKA 4F57L 4PPTA 1LK3H 3GSQB 3I6GB 4DGWC 2JI3A 1LO5A 4PGBA 3F7RA 1YG9A 3L7EB 1KENL 1KBKA 1ODUA 2DBJA 1XZWA 4H25A 3EYOA 3EJRA 3VMPA 1SHMA 1LEIA 2O30A 4FXKC 4NAJA 3TBTA 4ZSOA 1M2VB 3N55A 2VDPB 4PTUB 3C60D 3JWOL 2CNZA 4UTCA 5EO1A 1DLHA 3HMWL 5BO1H 3G5VB 2AXFA 5EO9B 2TSBA 3S96B 4DJMA 2ZJSL 2EYSA 4M5ZH 3ULUD 1PQZB 1X5MA 2CBOA 2HH0H 2CIKA 4OCYH 2GFBA 3CX5K 4UTAA 1B0RA 3PWJA 2EVIA 4XX1E 3LVEA 3SDXB 1IC7H 1JNHB 5FWQA 5BO1L 3CDCA 3O4OB 4DPCX 4WNSA 4P2OA 2ICES 4KO6A 4FULA 4KITB 4XO4A 1M56B 1KB3A 1I9RH 2E46A 1DEEB 3DMMB 4HIIB 4KI1A 1ZJBA 4QJ5B 3I3BA 4LLVB 1GYWA 1FSKB 3O4LD 5DRWA 4NAQA 1CFTB 1MUJA 5I30L 1JGVL 4NHCL 4GT7A 3IKCA 1MG3C 4URKA 4X9BA 3QFJA 4FA7B 5BZDA 2ARJB 3D34A 3DIFA 2GB2A 5AENA 3WG7B 1MXGA 4OFDA 2EC9U 1BZ7B 2ENQA 4B9CA 4XO8A 4S1QH 1NGWA 1TCRA 3E3QC 5D4JA 1D7BA 1BOGB 1I9JH 2NUPA 2Y69B 3K6IA 3X13A 3TEZA 5KVMC 1JRHI 3TV8A 1GIGL 4GG6A 4FXLA 2NUPB 2IALB 4U1HA 3AG4B 2AJXL 3L5XH 5BJTA 3RY6C 2A99A 3ROOA 3UJJL 4R2GD 2AI0H 1GMEA 3PLYA 4U1IA 3BHBA 4WCYH 1HI6A 5C7XL 5ISZB 4MNHA 4YDJB 2K9FB 3NCBB 1E5YA 5C0RL 5HDQL 4P5KA 4XPTL 3ABMB 1ETJA 3B2UD 4C56E 3HS9A 3UJJH 3WNNA 5T1KB 2D0GA 1RZGB 5I71C 2V17H 1EO5A 1IFHH 2A9BA 2O93L 5E2JA 4OCXH 5F7WC 5HDQH 3MRKB 3O0LA 1WC7B 3OSVA 3OWEA 4O02H 5FGBA 2HJKA 4MDIB 2BNQD 4JNXA 3QR1A 4Y2DD 5BNXD 1NUNB 1UFUA 2RTTA 4OZFB 1N19A 4URTB 1UADC 4W9ZA 3KGRA 4JKKA 2J5LC 5DWUH 3FQNA 3MRRA 4DP8X 3OKOA 4OM1H 2Q1EA 3ARDB 3P30L 2NR6A 3OGOE 3BUBA 3Q44A 4DGVH 2EDNA 2Q76B 1X44A 4PRBB 4WRLA 1J1OH 4X6EB 1OAJA 3BKMH 4R7DA 3ZRFC 2OLDA 2IQ9L 2KPWA 4JPKH 3EJUA 4CKVX 1C7SA 5JR1L 1YEJL 3IFPA 3ECWA 1BDYA 5KANI 3ZDZB 3QDMA 3KGSA 4JFHD 5B3SB 5DUBA 5CHNA 3ZHDA 5BV7C 3GHEL 4GSRA 1RMFL 2X6VA 2HRHA 4NO3B 5F6IC 2DAVA 1WTLA 2H5UA 2EDQA 2AQTA 2KLTA 3A6OA 3S35H 4H8PA 1WISA 4K73A 1CTNA 1GYCA 1QSEB 1S5HA 4KDTC 3SB3A 1U8OA 3KLSA 5I23A 1T7YA 2X4TA 1ONQA 2B3IA 3OF6A 3K71B 2ZKMX 4F58L 1R5IB 2YPVH 4HKJB 1BMWA 1M7UA 2OSYA 3APNA 5CJXC 4Z7OB 4NNXA 2J56A 2FZ3B 4ODUB 2L04A 1LXMA 1VAHA 1QHPA 4NKOB 3TBVA 4BSWA 3ZHFA 2GSMB 3OZ9L 1ZVYA 1TTCA 4KRPC 4KO7A 2ZX6A 5DJDA 1FAIH 2GJPA 5FAAA 1LE5A 1NCHA 4TMPA 3QWOA 1JHKL 1YN7B 2E76C 1VACA 1X4XA 3GUFA 5F96H 4MAZA 2QHLA 3DVIA 5DZNA 2B59A 5EUKB 3HFML 3P3YA 2JIXA 2PR4L 4FQ2L 4KVCH 3CFCH 4P5KB 4QO1B 4YO0A 2CBTA 3MBXH 5BZWB 2OCFD 1N64H 4P4KB 4XRCB 2L7UA 3AUWB 4JM2C 1ZT7A 3ZMRA 3O2WL 5DD3H 1SF3A 3LVTA 3S98A 5DUPL 4ABWA 1ZT7B 2AHIA 4OH2A 4QRSA 1GTFA 5I8CB 1MREL 3L3HA 4OJCA 4NWTH 2D2OA 2NY4B 2HZHA 2R8SL 2BVUA 2FBJL 1R3KB 2LU7A 2KLSA 1CXLA 1I82A 4J3WA 4TTDC 3HB3B 2VW7A 3TXAA 4KZDH 1BX2B 2VGLM 3VI3E 3MGTB 1MREH 1LE5B 4JN1H 1D5MB 4PJ7B 3DO7B 1A2YA 2ZUQB 1KCVH 3ATAA 2APVA 1BQHG 1AD9B 4G71B 4KTGA 3ECBB 4UTBL 1JHTB 4QRQB 1ONQB 4IRJA 4FA8A 4JS7A 4BGLA 4HWEH 1YMMB 1JPGB 4XX5A 5J8OA 3VQ1C 2NUTB 3FB8B 4XNBA 2ZG1A 1WCQA 2H9GB 3MLVH 4L4VA 2OXGB 4XVSH 2VAJA 1KFGA 4R96A 1YVLA 4HJ0D 1XF5A 1WIUA 3TPKA 4H40A 3BAXA 1KOAA 5T1KD 4M4RB 3FXIC 5FOBA 1R1CA 4JFTA 4KGJA 1PYWA 4FCAA 1AMXA 2DYRB 3OC8A 2Q8AL 2EDTA 4GH7B 4ALAC 5F0LB 2DQJH 3KHOA 5GZNA 4D9LH 3SDAC 4B97A 3FH8A 3B3BA 1G6VK 2DKUA 2VLJA 4P2RE 5D2LA 5FS5A 4LCWA 2NW3A 4X99B 4GJTB 3NPZB 5FB8B 1KPVB 2X9YA 2GUOA 3TONA 3IRZA 1ZK5A 1AIFA 2EDDA 3K0WA 3NSXA 5KSVA 1TETH 4A6YA 4LLWB 5ITBH 2X4QB 1ZAGA 1NC2B 1JI2A 3ARBD 4QY8B 4M5TA 4MCNA 3BN9C 3D25A 2R1YA 3PDDA 1JMZA 1BOYA 3WTSA 1TZOA 1CE6B 3HTLX 1NC2A 4WV1C 3JV5A 3V6OE 2VN6A 3DRTA 2YQ3A 3V0JA 4LRNL 5D1ZC 1OT2A 1R5VA 1Y18B 2OZNA 3CIQA 4WKZB 4JFPA 1NFIA 3NJXA 3O3BA 1NPUA 1PX4A 5LWYL 5G4MA 3HOGA 1WE5A 3TBCA 5E9DB 5DK0A 2WZ0A 4GP4B 3K2KA 1QLEH 2LVCA 5I0VA 2Y5EA 1PVHA 2FJSA 1OSYA 2IOIA 4MXVE 2R2BB 1B6UA 1TMCB 2VZSA 4E9YA 1JV2A 2FX8L 1P4LB 3VWKA 4OLXH 4GBXB 1JPTL 1JGUL 4YBLB 5E4AA 3CFNA 3D4YA 1PFOA 4KK5C 2XJKA 1S78D 4ODXA 1RURH 3VI4F 5DJ2B 2R1YB 1DN0B 3E6HB 3MROA 1I8AA 4OD3H 2H9GA 1P6FA 4QTIL 4ICXA 1KJ2A 3QCUH 1JZ6A 5IW1B 3B43A 3V52L 3L16A 1H15A 4HPOL 1OTTD 1ZLUH 4NI6A 4RGNC 2I27N 2C8NA 5LAXB 3QHTC 2ENJA 2CK2A 4JDZB 3X1BA 4QIRA 5MEOB 3LMJL 1BP3B 2JI1A 3FYEB 4XH2A 2NNAA 3O0RL 4AUYA 2HT2D 4BZ1H 4PJEB 4HFWB 2BNRE 4JQIL 4KNTA 2HYMA 3OJMB 4F27A 3LH2L 4Y88A 4GIOA 2CO7B 4ELME 3CMGA 3ULVL 3AWGA 1U6AL 3WENA 3QI9B 3V0VA 8CGTA 2RQ8A 3OC5A 2Z93B 3CZEA 4GXUN 4PTTA 3Q8FA 3VGHA 4YHNA 1GW0A 4HIEA 4TNWK 3RL1B 3OMIB 4QHLA 4Q14A 5C0CA 1J8RA 1BLNA 2GABA 4GXUM 1CDUA 3V2AR 2XTJD 4FQXA 3BLPX 1M6UA 2Z7ZA 5I1GL 1FIEA 2JLLA 5DQ9B 2LV4A 1X7QA 5I2IB 4G8GE 2F8IA 5F89B 5IF0B 1MIMH 4LOUD