1W6LA

3d structure of cota incubated with cucl2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
503
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
molecule keywords SPORE COAT PROTEIN A
total genus 143
structure length 503
sequence length 509
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA02
1CYWA 1PLCA 2VM4A 1IBZA 3CG8A 4BWUA 1TKWA 4BK5C 4A2DA 3FQYA 2QDVA 3IEAA 4MFHA 1R1CA 2VN3A 2EILB 1SHXA 1BXAA 3ZIYA 2CCWA 3JTBA 3L45A 1AIZA 4F7KA 1SHWA 1CURA 1NICA 2MTAA 3ZBMA 3PAVA 4KO5A 2DYSB 4DP1X 3UAAA 6PAZA 3GYRA 2EINB 2J57A 1JERA 4BXSV 3KW8A 4GP5B 1WA2X 4UAHA 4CSPA 3MBWB 4G72B 1YLBB 2X87A 3NP4A 3NJKA 2IDUA 2WSDA 2XXFA 4A68A 4BDVB 2FT7A 1WS7A 1BYOA 3IN2A 1MZZA 2OJ1A 1SFDA 1NIAA 4DPAX 3FU9A 4BWWA 5I6OA 3N55A 4NB7A 3X1GA 5AKRA 1MZYA 1JXFA 1OV8A 5B1BB 5B1KA 3QJUB 2WO2B 1NZRA 3ABMB 3NSDA 5I5IA 2YAFA 4UF7C 1OCOB 2BWDA 3ABGA 3QQXA 2XV0A 4YSQA 4YSCA 1V10A 1ET7A 1OCRB 3NSFA 3TA4D 3WI9A 3FSWA 1ILSA 1AS8A 2IDSA 2XVBA 3IE9A 4M3HA 2QPDB 2YAEA 1J9SA 1M9WA 4HCFA 1KBVA 1EZLA 2GSMB 2JKWA 1RZQA 3FQ2A 2HX8A 2UX7A 1IKOP 2X88A 3ASOB 4KNSA 2W88A 4YSPA 1J5CA 5AZUA 4A2FA 2XLLA 1AAJA 3X1NA 4GY4A 3WIAA 3QJRB 4DP8X 1A4BA 2BP0A 1QNIA 1AZBA 2BP0B 2OCCB 2IWFA 3PXLA 2EIJB 1NIFA 3GXUB 2IH9A 3QJQB 3PAZA 2XU9A 1SJMA 1BQ5A 3NJMA 1JXDA 1X9UA 2IDTA 4L0PB 1PZAA 4W9ZA 3T6WA 4WTQA 2VSMB 3CZUB 3S3CB 4YSSA 2YAQA 1HAWA 1NPJA 1IUZA 2FQFA 4YVNA 2BZCA 1AACA 3T71A 7PAZA 3PCYA 1TEGA 4K9JA 1SFHA 1XB6A 4P5RA 2AZAA 4KO6A 4M4RB 4X4KA 4HALA 4E9QA 2ZWNA 3WG7B 2J56A 4E9TA 4QLWA 5B1AB 3OMAB 1AR1B 1AZCA 2P80A 1NWPA 1ID2A 2A3TA 4P5SA 4E9RA 3AZUA 4E9XA 3CDZB 2EIMB 5I6NA 3FT0A 1ASOA 1L9SA 2H5UA 4DPBX 1SNRA 2PP9A 3D12B 2PP7A 2IDQA 6PCYA 4PAZA 3T9WA 1GY1A 4YSRA 1L9RA 3TBBA 3S8GB 2B08A 3FU8A 4A66A 4GYBA 1A65A 2IWKA 3V9CA 2R7EA 3N2JA 4GP8B 1ET5A 2IH8A 1NINA 1N70A 2VW4A 3X1EA 1QHQA 1AZRA 2E86A 4AKOA 3T6XA 1TU2A 3MX0B 2PLTA 2PP8A 1M56B 1A3ZA 1L9OA 1W6WA 5B1JA 2B3IA 3FYIB 2YAOA 2BZ7A 3FSAA 4A67A 1ETJA 4E9YA 2YAMA 4RH4A 1NWOA 3OMIB 3TBCA 2GHZA 1JZJA 3ZDWA 3ABKB 4A2EA 1E5ZA 7PCYA 4EF3A 4N8UA 4AZUA 3RYMA 2I7OA 1AG0A 2PCFA 2CJ3A 1MG2C 2FJSA 3OMNB 4E9WA 1GS7A 1CUOA 1T5KA 3ASNB 2XYBA 4KO7A 8PAZA 3AG3B 3EHBB 1NDTA 1PAZA 2TSAA 2UXTA 4N4YB 2I7SA 4DP5X 2ZONA 4AX3A 5I6MA 3S3DB 3FYEB 1JXGA 4YSAA 2UX6A 5I5JA 1ET8A 3EH4B 3NSCA 3TU6A 1GR7A 3SQRA 1SF5A 1A8ZA 1WA0X 5F7BA 2FT8A 3NSYA 3WNJA 2GI0A 1OE1A 3EF4A 1OE3A 1RZPA 3NJFA 1AOZA 1IBYA 1J5DA 2XX1A 2IAAC 1JZFA 5LDUA 3X2QB 3OM3B 1J9QA 2GC4C 1JVOA 1BXUA 1N68A 3NJGA 5E9NA 2FWLB 3IN0A 3OD3A 2Q5BA 3H56A 4YL4A 2XUWA 5B7EA 4Q89A 2GBAA 2UXVA 1V54B 3X1FA 1ASQA 4F2FA 3NJNA 3HB3B 1L9QA 2GC7C 3DIVA 2BW4A 2VM3A 3NT0A 3NYKA 3SBRA 2BP8A 4YSEA 4JHUA 3PPSA 4G70B 4HZ1A 1SDDA 4YSUA 3FU7B 1NIEA 4DP2X 3UABA 5ANHA 5A7EA 1KBWA 1V55B 2HRHA 1NIDA 2PPCA 3T6ZA 4BWTA 4DP0X 1PNCA 2VMJA 4DPCX 5D4IA 5I6KA 1EHKB 4FAAB 1KGYE 4JHVA 2N0MA 1KV7A 2TSBA 2HX7A 3C75A 1BQRA 2LLNA 1BQKA 1BYPA 4JKNA 1GSKA 2W8CA 2J5WA 1PCSA 4HCGA 1GYCA 4KOCA 1ZIBA 2R7EB 3NJHA 4QKTA 3U25A 1ADWA 2JFCA 1PNDA 1JVLA 5B3SB 1VLXA 1JZGA 3QJSB 2FQDA 4DP4X 3CDZA 3BQVA 2FTAA 2HXAA 2OV0A 1BAWA 2UXGA 2I85A 2DWSA 3HEIB 5PAZA 2CALA 1AZNA 1OOWA 4GP4B 3AG1B 4TXVB 4HCIA 2FNWA 4W1TA 4KNUA 5F7AA 3FPYA 1DZ0A 2IDFA 3WKQA 1X9RA 2BP8B 1HFUA 1WAEA 2MRYA 1QLEB 2CUAA 1ZIAA 3ERXA 1IC0A 3UAEA 1PF3A 4UANA 1CYXA 1ZPUA 3FPXA 1TEFA 3FU7A 1E30A 2HX9A 2PPEA 1URIA 1ZDQA 3WKPA 3NP3A 1L9TA 3IBOA 2RACA 2H47C 5PCYA 3BVDB 2J55A 1PMYA 2NRDA 1UATA 1ILUA 2PCYA 2AVFA 1I53A 1BXVA 2FQGA 3AG4B 4AKPA 4AI7A 1SF3A 3CVDA 3H4FA 3NJJA 2GB2A 1OCCB 4HHGA 1JZIA 1XB3A 3AG2B 5FC9A 1OCZB 2YXVA 1OE2A 1KCBA 2XV2A 2ZXWB 3EH3B 1JZHA 3UACA 1PZBA 4Q8BA 1NPNA 4WKXA 1W6LA 4DP7X 4G71B 3QPKA 1ZV2A 5B7MA 3FQ1A 1XB8A 4ZK8A 1JOIA 4HHWA 3CVBA 1GS6X 4G7RB 4G7SB 1A4AA 1A4CA 4KO9A 1PLAA 1RKRA 2DYRB 2JXMA 1KYAA 1W8EA 1NTDA 2CAKA 2P80D 1ZDSA 3PLYA 2Y69B 9PCYA 1L9PA 4BDVA 1BEXA 5B7FA 4A2GA 5I6LA 2BHFA 2PPFA 2PPDA 1F56A 2YQBA 3GDCA 2BO0A 3DKHA 1CC3A 1AS6A 2Y1AA 5TK2A 3OQRA 5AFAA 4BXVA 1PLBA 4KNTA 4AKQA 2XX0A 2XV3A 2BWIA 5I28A 2GIMA 1WA1X 4GXFA 3FSZA 1SDDB 2FT6A 3AY2A 2QPEB 3NJIA 4ENZA 3EH5B 1MG3C 3ZX1A 1NIBA 1GS8A 1GY2A 1KDJA 1PY0A 2IWEA 5EHFA 4DP9X 2EIKB 5TK4A 4CSZA 1J9RA 2CBPA 5B1JC 1PZCA 2DY2A 1B3IA 1MDAA 4NERA 1E65A 1HAUA 1AZUA 2AFNA 3H4HA 5I26A 2QT6A 1KDIA 3QJVB 4PCYA 3V9EA 2YAPA 3NJLA 5D4JA 2DV6A 3UGEA 2WO3B 3T6VA 1DYZA 1AG6A 2BW5A 3DTUB 1RCYA 2FQEA 2UXFA 3JT2A 3PAUA 4YSOA 1E67A 3SBPA 4YSDA 5D4HA 2XWZA 4DP6X 4HIPA 2AANA 1ASPA 2AZUA 2PPAA 4E9SA 5IY5B 5I5MA 2YARA 3X1BA 1OF0A 3KW7A 2VSKB 5I6PA 1AQ8A 3FSVA 4G7QB 3AW5A 1AS7A 4YVUA 2QDWA 1FA4A 1J9TA 1FWXA 1JZEA 3QJTB 3WNIA 3UADA 2HRGA 2DWTA 1E5YA 3TASA 1M57B 2HLEB 4KOBA 1XMEB 1KCWA 1FFTB 3ABLB 3S8FB 2YXWA 2H3XC 2HZHA 2ZOOA 4E9VA 2YAHA 4NAJA 1GW0A 3SBQA 1WS8A 4A2HA 4FA7B 3CVCA 4HAKA 4YSTA 1AANA 2VW7A 3S3BB 3FS9A 2Q9OA 2VW6A 3G5WA 4F2EA 2XXGA
chains in the Genus database with same CATH superfamily
3G6JA 1TJHL 1IBZA 4WF7A 1L7IL 3FTUA 3O6KH 4QKXB 3QUML 3ZHKA 2NZ9C 3QUXD 1KYUA 4YO0B 4KZEL 1FVEB 2AK4D 5CHNA 1E8ZA 2X70A 5CBEA 2EILB 2OZ4L 3MLYH 3O8XD 4KVPA 2DBLH 3CCHA 4XMKH 4WHTB 5DJCB 2NXZB 2FO1A 1NLDL 3JTBA 1YMMA 2W65B 1FH5H 5F8QC 1NICA 1KGWA 2OQJA 1T5WB 3H2PA 4MJHA 1WYJA 3LXBA 3FRPA 4JVPA 1BQSA 3RGBA 1MUJA 2VLJB 3N06B 1L0YA 3ULAB 4BXSV 1HEZA 1I3VA 3UG3A 2OR7A 1MF2L 5LAXB 2EVIA 4LOUC 1OQOA 4XPAL 2IDUA 3ARED 1DBAH 5HYSA 4NZUL 1HKLL 2B4CC 3V0FA 3CXHJ 2OJ1A 1F13A 3ESVF 4U05A 1XR9A 4P2AA 4MJIB 5AVWB 1TYEB 3FHQA 2ZYSA 1JGLH 1N26A 1W15A 4P5MA 2BSDA 4TNVK 1A3RH 2XZAH 3FHAA 1Y1DA 3X3GH 3HC0A 3L8QA 1OCWL 2B39A 5BRZE 4ATWA 1U95A 3BPLC 2XT1B 3SPIA 4O00A 3QQXA 4U2YA 4YPGB 3B37A 3D39B 4PWKA 5FW8A 3QNYB 1FRGH 1G7QB 5T3XD 3QI9A 4Y1AD 5DJ8B 1NCUA 1CB4A 1TYRA 1UM5H 4G6KH 4TVUA 2GUOB 1MCPL 3QP3A 4HCFA 1LEIA 3P4NB 4URKA 3II1A 5KAQF 2JKWA 2VDLB 4JR9H 1XCWA 2Y5TA 5A3ID 2WYTA 1GAFL 5IMLB 4G5ZL 3ENEA 3PREA 3OKNB 1EPFA 1YRKA 5IB5A 2VZ1A 4RBPK 1TITA 5FHBH 2FLRT 2X1WL 4LCUA 4FQIH 3RZCD 2H1LM 2IH1A 3CIQA 2YQ3A 2OR9H 3VG9C 4PJ9B 4H1LB 1E9PB 1F00I 1LLAA 3BYYA 2EUWA 1EHLH 1WSST 2I60L 2WO4A 5D7LE 4J27A 4EXPX 2JK5B 4Y4KD 2O6EA 3RB5A 2E8YA 2ICCA 2OLDA 3V5KA 1BQ5A 2APSA 4BD4A 1OGTA 4PJ5B 3O2VH 1MAMH 1DUZB 3E6HB 2ZQKA 1QFHA 2P7TB 5FUZL 2WXKA 4HG4J 3QG7L 2ZOKA 1DVSA 4UQ3B 1YEWA 4UIKH 3EO1A 4B27A 5E5UB 4U1JA 1A7BA 1RQ5A 3LNIA 4Y9EA 1YNKH 3WU1A 4E5XA 2XA3A 1JJUA 4YHPB 5GGRB 1QTYT 5J9PA 1NCDH 2VJ8A 1RUPH 2DYPB 3MOAH 2BC4A 4YDIL 4CJ1A 5GJTL 2KDYA 3RFRA 4Z7WB 1X6NA 5I16A 2LLLA 2FWOB 4W93A 2N0KA 2DQFB 3LD8B 3ZLQC 2P42B 3QEGH 3DROA 5ITFB 4QMEA 3FONB 5I6NA 1RZGA 4JQVC 4GKSB 2DBLL 2X2UA 2X4TA 4OZGA 5DK3A 3IJYB 4BINA 1FO0A 4M03A 5D55A 2FL5A 3BKML 2OCFD 3BN9C 4R0LA 5DJZB 2IWKA 2LGNA 2BY3A 1M05A 1MDTA 1XGUA 3QCUL 5C0CB 1OLZA 3FRPG 4NC2B 4WSKA 3SGJC 3IF1B 3CHOA 1NINA 5DJ2A 2IAND 2JCCE 4J3WA 4XX1G 2R8SL 5AG8A 3HMXA 2VQUA 5FGBC 4ZUVB 1V7NL 1KBPA 1J1XH 3HAEA 3OKYA 4HGWB 3TT3L 5FDWA 5JW4Q 1HH6B 3APCA 5IG7B 5E8DL 1I1AB 3VQLA 4XE5B 5DD6B 3BZ4A 3BD3A 3NRQA 2XWJB 3QQ3B 2W95A 3GXNA 4MD0A 2O5NA 4UIMA 1LGVA 3ZDWA 5GIRA 2VZTA 3ARTA 1WD9A 3OPUA 3WKYA 3QIBC 2FWUA 1IL1A 1JK8B 1TJIL 1A6VH 3VDBA 2GSIB 5IIEA 2FJSA 3OMNB 2VR3A 4NQCA 3MGOB 1KB5B 1OM3L 4PIBA 2BHZA 1MIML 5LG6A 4LASL 1PAZA 1RLBA 4PV9B 4G7VL 5FO7A 2VLKE 2XG4A 3BT0A 4WFHE 4B9KC 1LK3L 4FE9A 3DI3B 3GPEA 5GRJH 4I1NB 3N1MC 3NUKA 5E9DB 5DVLA 5T3XL 3KS0H 4BKLA 2ZOKB 3NSCA 2JLPA 3PWUA 2YRLA 5EMYA 3MRHB 3SDDC 4K7PY 1WTLA 3WV0A 2BVPA 5T5FH 4ELKB 1A6ZB 5ID1B 4FXKC 2TAAA 2GI0A 1OE1A 4G6MH 2IALA 5LBSL 2A83A 3LVTA 5FYLL 3VCLB 3UTZB 4BUQA 1ZHBB 3HNVH 2QVIA 5SWSB 4POZD 1QPKA 3D2UA 4DKEL 1JYWA 3GBNH 3BUBA 3RVTC 1YY9C 1SBBA 1XCQA 4GG6E 4DGWC 4DKTA 4OZIF 3ZYZA 4L3ED 4M7LT 1YNTF 3W0WD 4JAMA 4YGVB 2CR3A 1U2YA 2O5XH 2QEJA 5AKSA 1QSFE 4YL4A 3UTTE 4PRBB 1HXMA 3L48A 1HHIA 3Q9QA 3X1FA 4PGEB 5D4QA 3KPSE 3KLHD 3PYCA 1T7VA 1XGYL 2BP8A 1MEXL 1INQA 1YEHL 5EEVA 3SPJA 1NBYA 2XPZA 4PJ8A 4EIZC 3BAJA 4Q9QL 2K4AA 1NUGA 3ATEA 3D69B 4HH8A 1M7DA 1FLTX 1OM9A 3FO9B 4LCWB 2Q87A 5A40E 3DX9B 1FSKC 2EDWA 1JPFB 1NGQH 1TR7A 3E1F1 1AHWC 4FQ2H 3SPHA 5IFHL 4P57A 2JI2A 5IBLD 1D5MA 2UWEF 1G1KA 1MQKL 4LCCB 2N1KA 2Q0ZX 5FM8A 5C08D 1GYUA 4TULH 4FFWD 4JANB 5FUOL 3CWGA 4X6CA 2AITA 4DVBA 2X4QA 1RUKL 2WCGA 2YOAA 2WQWA 3LQAH 5KS9E 1ZT4B 2Y22A 1ZHKB 4Q0XL 2HG0A 4HAGA 3OSVA 1F02I 1MFDH 1JI1A 3NJHA 3ILEA 1I7ZA 4QKTA 1MIEL 1OAZH 2A1WL 1BPLB 4GUPA 4I0PB 2PXYA 3BDXA 3DYOA 3TA3A 4WCYH 1GGBH 3LYRA 5DFVD 2K3TA 2XVGA 1C12B 4S1SH 3U46A 4JFFA 5FYKH 4GMSH 3BSGA 4RIRA 1KLUA 1UOWA 2QADD 1RLWA 2IMNA 3EUDA 1UYWH 5L88L 1UC6A 2NY2C 1CE1L 2AS5M 1A4KA 3A6BL 1DLFH 1DQLL 4LFHD 3WKPA 5A6MA 1T03L 1UTDA 1ZA6A 4HEPA 4XWGH 5T5FA 2WW8A 2DRUA 2KS0A 3TBYB 4ONFL 3BD5A 1AO7A 1OAXH 2FECI 4JFPA 3K80A 4XXDB 1BXVA 5L2KA 4GW1B 3FQTB 5SV4A 2ESVD 3I3DA 3PV6A 4NM8L 1K4CA 2FJUB 3B5TA 4DTGL 2WNWA 2ESVA 3T3PB 1JZHA 5I76A 4M5ZH 2L04A 1WDAA 1XF3B 4X5LA 4XP9H 2X4QB 3C5XA 5EORH 4Z3FA 3RWCA 2W9LA 4ONFH 5D1XB 4XI5C 2CBMA 2OXGB 3UPRB 1A7OH 1MCHA 4YXLL 3T3MB 1L7TL 5FO7B 5D1ZI 5I0DA 2P48B 1KY6A 2P80D 2AJZB 3BXNA 1LEGA 4NZRH 3REVB 4IOFD 1IKFL 3QZWA 2AXGA 3BUDA 4R2GC 3L5IA 4R0LC 5DZNA 1UOVA 3O4LA 1E9QB 4UT6A 3PABB 4ZYKA 1W8OA 3HA0A 3VFRA 2W9DH 3MRBB 3PUUA 1Z0NA 3CFEB 4LDEB 5T3XE 4BELD 4KQ4L 1F3RB 1RK0A 4B7LA 1X5ZA 4YNYB 3RX5A 3HMWL 3TN0A 4OM1H 3LRMA 2QPEB 3NJIA 1EO8L 2VXQH 4KK9C 3MV7B 5IVOA 1ORSA 4Z3EA 2FJFB 2EIKB 4U6TA 1PZCA 3C09B 1OLLA 2ADFH 1CLZL 4ZUTB 3RTQD 3SB3A 1NC2B 1MDAA 2A6IA 5DFVC 4ZAKA 4I5BB 1NGZB 3PHAA 4AZ8B 3PWPA 1NEUA 4HSQA 3TV3H 4F8QA 2G5RA 2F54D 2ZX5A 3QDHA 4TULL 4TQPA 3CLFL 3VCLA 1ZJAA 1I1YA 3DHJA 1DN2A 2DV6A 1YYML 1QLFA 3RTQC 3VXSB 4XP6L 3M88A 2J4WH 1EMTH 1IAIM 3RZWA 2J8HA 2I5YH 4F33A 1NCBL 4ODUB 1ASPA 4CSTA 2N7BA 4EI5A 1CTNA 5LGJB 1UJ3A 4Q9QH 3FFCD 4IOSD 1RZGB 3KW7A 1Q0YH 2VSKB 5D1QC 3UTTB 3ZKND 4KX7A 5T1DL 2R9HD 3WMSA 2OMNA 4L8BB 3QJTB 4MSWB 3ME0A 5F0LB 3RGVA 3U9UA 5IV2B 2DWTA 5TH2A 3BO8B 5E6ZA 1NDGA 4UTAH 1CICA 1J48A 2ZG2A 5FOBA 4XZ4A 1N10A 2A9BA 4GLRH 5LBGA 4QO1B 1Z0MA 1CICD 6CGTA 3L9YA 4K07A 3HBZA 2EUZA 2NY0C 1S7XA 4P5TD 3IGAB 3EJTA 2EDNA 3S3SA 3VFOA 2ZG1A 2OCJA 3PQYB 4JFWA 3C60B 4KXCA 1N5YL 4H8WC 3CJJA 3C60A 3IJ7A 3MLSH 1F4HA 2N7AA 4XAKD 1KCSH 5LBSH 5TFSL 4CBZA 1TJMA 1N7ML 2PN5A 3IEAA 3E8VA 4BGLA 4QF1B 1I3RA 3HG1A 4PJFF 4CRPA 3LY6A 4EO5A 3SGDH 3VFSB 1B0RA 3O0LA 5T3XH 5IQMA 3ARGD 3L1GA 4EVNB 2CBOA 4K3HA 3LX9A 4MNQE 5KSBB 3A6OA 1U8NB 5EUKA 3UCQA 2MKWA 3ZBMA 1DJWA 3SOBH 2ZE0A 2WYZA 1Z32X 1HN1A 4K55A 1AGFB 5HJ3A 4XOAA 3V6FB 2CHXA 1HI6B 1TZIA 1WA2X 2Y9RT 3CPLA 3CZFB 2VDKL 3CPLB 1UD2A 2VO8A 4FI6A 5DQDH 5E4IA 2ENQA 1UFGA 1NUFA 1WUNT 1F4YH 2FWSA 2RQ8A 4QRQB 4GMTH 2ICWI 2WTPA 2DICA 3QEQA 2VE6B 1II4E 1PX3A 4NGHL 2K78A 1MZZA 4GG6A 4FQ1L 2ITDA 4QHMA 5ESQA 4FZ8H 1CXLA 5D7LB 4AYBA 1SM3L 3EDFA 4K3EL 4Z95H 1G9NC 5F7YC 4BWWA 2B59A 5CEZL 3G5VB 3V0WH 5IQ9B 1QSFA 1NCHA 2BFGA 5FF6A 3LHPH 3GLEA 3QJUB 4ES9A 4DKAA 2R8SH 4NNYA 2J4WL 4Z7QB 3T09A 3VXQA 3TA3C 2WIIA 1IBFA 3G5YB 4PGJA 1PVHA 5F9WC 4Y16D 4BZ1L 2PXYD 1HCYA 4M1GH 3FUKA 1ET7A 5KYWB 2E27H 3J2PA 2VQ1A 3W9DB 2O5YL 1ROCA 4Y1AE 3MV8E 1N6QL 5A6LA 3LQAC 1KBVA 3U2SB 4RA0C 5LXGL 1UVQB 4L1HA 2X0WA 5LAXA 2YPLA 3PQYE 2DQHH 1S9YB 1DVFA 5F7EL 4JO1L 4F3FA 1ZS8B 2YKKA 1JWSA 4I2XB 3X1NA 5C8JA 2XTJC 1LO0H 5F21B 4ZMQA 3P11H 1BVOA 5EIIG 1KIQA 2WTRB 1AI1H 3MNWB 3STZB 1IM3D 5HXMA 1AGFA 3BE1H 3BZ5A 4PW4A 5GJTH 4GKLA 4N1HB 3ECWA 3EBHA 1SMOA 3CVHA 4W9CC 4WNQA 4HKBA 3EDEA 4NKMA 3U4KA 5CP7B 3TCXA 1MRFH 2XNAB 1SJMA 5TE6H 4ZSOE 3KNBA 4KVNL 1ZHLA 2DQIL 2CGRL 3UJJL 3MRIA 4GAYB 3DGGA 5IEKB 2VSMB 1D5XB 5EUOF 4GBXB 4DJMA 5AW6B 2V17H 1IGYB 4YAQB 3T2NL 4U3XA 4F1ZA 1YMME 3VI4B 3UZQA 1ZA3B 4YS4A 1IAII 3BUYA 4M1CD 1M2OA 1HL8A 2J6WA 3VSTA 2I60H 1AY1L 2P80A 3OAWA 1UB6A 1IJNA 4M3KB 3CU7A 3CMOL 1MHHA 4HJ0D 2DQDH 5ABDE 1B9KA 4E9RA 5T5NF 3Q5TA 4XWOD 3WY1A 2NY2D 5AYUH 2VT0A 4QIRA 2RFXA 3GSVA 2AAVA 2YPVL 1YEKH 1NC4A 1TO4A 2PWEA 3PABA 4CC4A 4RAVA 5DMGD 4MRCA 4JY5H 4HWEH 1BAFH 1MCFA 4UZSA 4PJ9C 3ARBC 3BFQG 2ZUVA 3EDJA 3VFMB 4Z0BH 5EG6C 4JFVA 4M43H 4OKVA 1TZIB 1WE5A 2KERA 3WN5B 4L8BA 3MLUH 4UM8B 4GRLB 2CLRB 3Q3GA 1JZ5A 1BF2A 3BW9B 2QQNH 1WWAX 1WFNA 2GK0B 5FYKU 3PUCA 4PFEA 3EJZD 4JKMA 1BD2A 1VZGA 4XVUD 4IM8A 4TTDD 5EU4A 5SWZA 3VXSA 4N6RB 4DAGL 3NG5A 1ZSDB 3RU8L 4W4OC 4HIJB 4WTWA 1OAZL 3D39A 5FUCE 5B1JA 2B3IA 2DMKA 1HNYA 5KVDE 3NACL 5C0DA 4M93B 1JNLL 4CMHC 4E9YA 3C2SA 1LE5A 4R7NB 1J8HB 2FD6L 3QWNA 1X5KA 4F7EB 1ZLEA 4BE5A 1EAQA 2NXYB 4PRID 3MI6A 1NGWA 4ZFZA 3FFCA 3OKKB 2ESVE 4QF1A 3MOBH 1P53A 4CGTA 3TYFA 2KLRA 3RYMA 2VLKB 3F84A 3MCKB 4HIHB 2R2BA 4U31A 1KJVB 1T5KA 2O1AA 1ZV5A 4G8GE 3SDAD 3T3PF 1A1NB 1ZCRA 2JXMB 1J8RA 4AYSA 3NK4A 4KXZH 1GW6A 3VE0B 1FAIL 2Z4TA 1DP0A 4MMXC 4N8VA 5AVRB 2GCYA 3L1FA 4UT9L 3I6GA 5L2KD 4XC3H 3UC2A 2DMHA 3DUUB 3CN3A 4PVNA 4R3SB 4BK5A 3T4YB 4G8FA 3ZE0E 5TF1H 2D0GA 2Y7MA 2QGCA 4W9HC 4XN2A 5C09D 2DJ4A 2FZ3B 4JM2B 1XCTA 3DX0A 4N2AA 1U41A 3O2WH 1LO5A 4O58H 1BAGA 4WDIA 5HYJD 4RGOL 3ZKXB 5E99L 3VD3A 4YO0A 4XP1L 1N68A 3U0TB 3U48A 3VM7A 4JPQA 2VL5B 4HOZA 5DHXB 4TUOA 2ATKB 2DM7A 5D93B 4MNGA 1UXSA 3AWFA 3K6SA 2KZ1B 3B2PA 1G1CA 4U6HB 3MLWL 3ARBB 2VXVH 1SDAB 1LO3H 3DIVA 1BECA 1GYAA 1WFIA 1KEML 1F90H 4YSEA 1S7RB 3DOIA 3RX7A 1S78C 1BF8A 5DLLA 1IM9A 5EEZA 4RGMB 5JIIA 2P5PA 3UZVB 5EO0B 1V3LA 2Y6SC 1S3KH 3DGDA 3NEOA 4V33A 4WZ9A 4RETB 1ZA6B 1NM4A 1INQB 2UWEA 5DMIH 3UJIH 4JHWH 1VFOA 3O6FB 3SPCA 5CCKL 4BWTA 2K1MA 2KYIA 3MA9L 2EEXA 2VMJA 5JORA 3ROLB 4EZMA 2TSBA 4OD3H 1UQSA 3GRWH 5E2VH 5F44A 5IG7A 5CEZE 1NEZB 1R3IH 5ADPH 1ZVYA 2WXMA 2A6DA 3BLBA 2Z8WC 3L5WA 5HHOB 2FIKA 4KOCA 4FJZA 4Y5XB 3GSNA 4I3RH 5DD0L 4EAEA 1LO3L 2VXVL 3SIKA 3KPPB 3ZYJA 2M1KA 1UENA 1HH9B 2JFCA 3MA7B 2VDKB 3UIZA 2WMPB 3WMPA 3HE7D 4A1RA 5J13C 2VITA 3QJSB 4LF3B 4XHJC 1RZFH 4JM2C 1O75A 3G6JF 4GKZB 5DMKA 2EEFA 4U1GC 5AALA 1BAWA 2AJUH 3SDCB 3KPNB 4UINH 4ZMLA 5PAZA 5DC9B 5HHQA 1HIML 4K71B 2J1YA 3TESA 2IQ9H 4FD0A 1IV8A 4G8EB 4HWBL 3UGXA 5A2FA 3FPYA 1KTLA 1CGUA 5CIPH 2XPGA 4FJ6A 1BFOA 4N0UA 1LWHA 2NY1C 3OZKA 4PM1A 5I74B 1S9XA 3JTTA 3VD0A 4XB3A 4XHJD 4KTDL 3TPKA 3G7TA 1E30A 3UOAB 1CGXA 4KI1A 5I75C 3ZTJG 2WN3A 4BZ2L 5CINL 5IW1B 3VNZA 2FO8A 2W0PA 4YUEH 1U92A 4R7DB 4XMXA 5AG9A 4KKCC 4H0LC 1D5ZB 4YDVA 4IW4C 5F9OH 5D2LB 2RQEA 5I18L 3DRTA 4ZFFB 3FF8A 1FAIH 5DJAB 1BIHA 3MRDB 2Q3XA 3FQWA 4QCIB 1MJ7L 4OI7A 2HT3D 2ZXWB 3PJNA 4UQ3A 1FNGB 2VDRL 4EOWH 1RUPL 3B2UD 1F86A 3TA3B 3CBRA 5J12C 5JUEL 3HG1D 1W6LA 4OAWA 1A1MA 4G71B 5CGBA 1K3ZA 5CILH 5DC4B 1RURL 3US9A 3VB9A 1Q1JL 3FH5A 3UC0H 1Z3RA 4LGSB 4HISA 3HZ3A 5EF1A 3TZVB 2NW3B 3EUUA 4IGBC 1YJDH 1UACL 5FUZH 3VI3B 5HYJE 2BDNL 4BZ1A 2P5EA 4N3UA 5BRZB 4WY7L 3KYAA 5M94B 3IMSA 4IU2B 2LAGB 32C2B 2B15A 5TQ2L 1JGVL 4OR1A 5I1DB 1CFMA 2ZOLB 4PV9A 4AYDC 4WEUD 2NNAA 2QQNL 3QEUA 4QRPD 3BLPX 2SEBB 5LG1A 2ERJC 2XV3A 1R0AH 4KFMA 1MWOA 1G5AA 1D5MB 3CSFA 1XGRA 4JLRA 5D7SL 4PCKA 2Y06H 4L0ZA 1PY0A 3P4LA 2IWEA 1IGJB 4NPJA 3WKMH 5IOKA 4G82A 3U4BL 4G5ZH 1BAFL 5B3JF 1BD2D 4RMRA 4XO8A 5I82A 3BH8A 5CO1A 4ZO7A 5EU5A 4GBXC 3VSVA 1XT5A 1E65A 3EYQC 3IDMA 1TYJA 3OKDA 4ELMF 2BNQD 3APFA 2J6EL 4MMZA 5KOVC 2NY1D 1ZE3C 5DGRA 4OCSH 5DQJA 3I74A 2WMPA 3SHSA 4Z7WF 2Y25A 1NKOA 3G04B 1AXTH 1ML0A 3A67L 2J1KA 2ZAHA 5AWNH 1ZTXE 2OJZH 1X5AA 3IM1A 4HK3J 4Y2OB 5E8OA 2Q3AA 5EZLB 3EOBB 4NQED 2AZUA 4DETA 3GMQB 5HHPB 4JY4A 1OF0A 4LSVH 4ZG1A 1MVYA 5JOPE 3FSVA 3HAEG 5I74C 4OZIE 2EEDA 5B8CC 3LKNB 1TZAA 3GI8L 2QDWA 5C71A 1D5IL 3OZLA 2GFBA 5GSVB 1HKLH 2D2CC 3DV6A 4Y2DC 4ANVA 3B7SA 4HFWA 4PWGA 2HH0L 4KVNH 2VUYA 4FXKA 3S37X 5DJAA 1KBBA 1DQKA 4I77L 3ZDXB 1EDHA 2CRZA 3ZE1E 4BKLB 2HG5B 1E43A 5F3FA 4DZBB 1D5ZA 4ZUWB 4KMTL 1WBXB 2OMXA 4OUUB 5DEZA 3ZSSA 3DA0A 5DJ0A 5K9OA 3OG6B 2IDCA 4JFFE 4QRRD 2K45A 5DHVA 1TF4A 4GEJA 1LO0L 4ECNA 1GPOH 4IRSA 4IBWA 2DQTL 4HIXH 4OCXH 4R90L 2FR4B 3IVKA 6TAAA 2DIEA 4HMCA 2ZJSL 4JRLA 4PUBH 1R1CA 4RDBA 5DD6A 5F1SA 4LNRB 3LEYL 3T77A 1YEEL 5JW4M 3QEHB 4WJG3 4YLBA 2DQGH 1HDMA 4HGWA 32C2A 1WZAA 4PREB 4R5XA 4D9LL 2VR7A 5JIHA 1RH8A 1RJYB 1HKFA 2APFA 4M6ML 4WI9A 2CXGA 1UOLA 2DTMH 4YBLC 2G2RA 1O5DT 4A2LA 5J4MA 3FH8A 4BFKA 4GQ9L 3TURA 5EZLA 5LNGA 4XC1H 3IJSA 1H9VA 4KJQC 4GRWB 5J3HC 3CDYA 4E41B 4Z7OF 2VRAA 1OAQL 1UQSB 1QBLL 1J86A 4N8VB 1SM3H 1HC1A 2EXTA 3P9LA 4NPYB 1GHFH 3IN2A 4QCIA 1YEGH 3BKJH 1HYSC 2KLSA 4DPAX 4DO4A 3BZFA 1OTTD 2X4NB 3IDMB 1A7NL 1VAHA 4B7IA 2M2DA 4GI8A 4OJFH 4XVTH 4C4BA 1D5BA 5B1BB 1DEDA 1Y6NR 1Q1PA 5E9AA 3S7GA 3GZQA 3JWNG 1K8IA 2O6FA 2D7MA 3IPFA 3QUXB 4FTVB 4L5FL 5JPNC 4ZFGH 3TWCH 2WXIA 1OCOB 1U8PB 3EJYC 2OXHB 4AT6A 3WTXA 3T0EC 2I9LB 3V4PL 1MPAH 5DJYA 1MHPH 3LH8A 5DURB 3ZE1B 3QRLA 4TNEA 1G9NL 1U3HB 1FFPB 3H6JA 2ED8A 4OGXL 3CH1A 3ESOA 3SYQA 1NMCC 2WSKA 4S1QL 4IOSA 4AITA 3LZRA 3BVNA 1E90A 3A22A 3AWEA 3FQ2A 3MU3A 4D9QE 2HWZL 1CFTB 2UX7A 3VMNA 5I0VA 4XNZB 4HUXA 4XVSH 4K3DH 4F58H 3L3GA 3VFUA 1KCSL 4CN6A 1DVQA 1OK8A 1U42A 4U1HA 4CDHA 1SHSA 5IMMA 5BNXD 2ZUQB 4HWZA 4XBPB 3BIKB 4HCRL 1NCCL 2NX5E 3V0GA 2YFOA 2DPKA 1A7RH 1TCRB 2BP0B 2R23A 5ESAA 4O02H 1LK2A 5I8CA 2CNYA 5B3JE 2JK5A 5JDJA 1JFHA 2QHRL 3H2QA 3G5ZA 3GTNA 4OJFL 1EJFA 4NT6A 2AERT 2XTJE 4BQBA 4PRHB 4R9HA 3SPVB 2QLVB 5HDQL 3LQMA 1DDHA 3KYOA 3UTSE 4F9LA 2ADGA 3TBTB 1CGWA 1KGXA 4ZD3L 3VQMA 2C8NA 4IK7A 4L8SC 5F7HA 2HJKA 1AACA 1IQDB 2QL1A 5JXAL 1OAQH 4MAZA 1F4WH 4PJIF 4Y1AB 4P5RA 4ORZC 2Z31A 2XWCA 2GPZA 1NCBH 1LP9F 3CFJB 5GGQH 3VH8A 2X0VA 1KUMA 1ZLUK 3RFZB 2CLZA 1UT9A 1AKJD 3EOYG 2JVUA 2GAZA 3K2IA 1XF5B 4F7EA 3PL6D 1AD0A 3NOIA 2YXMA 3PWNA 4JM4L 1CDJA 4LU5L 1HT6A 3VGEA 4LBEB 1JFQH 3NAAL 5G4NA 4PJIA 1BFOB 2ZSVA 4FI8A 5IFJA 1XTMA 3DXAA 1CLVA 4X6DE 4Z1PA 4MS8D 4UAOB 3U36B 3BAEH 1KB9J 5JZ7D 1KTDA 5CP7A 2R4RL 2IDQA 1CLZH 3MUGA 1VJSA 1WBZB 2ZX8A 4J3XA 3F7VA 3N42B 4F2MA 5KSAA 1JCKA 3KYMA 1B9ZA 1EO8H 2VXQL 3WNKA 1FLRL 1G6RH 1N67A 4XAWL 4XBEL 5E2WH 4PJ5D 1ETA1 1JV2B 1MVFA 3N2JA 1MNNA 3BKCL 2XN9B 2XN9A 3MBXH 3WTSA 3HHSB 2TRYA 1HE7A 4XP4L 1RFDL 1QX1A 1NFAA 2IGLA 3AS2A 4ODHL 2E86A 4PS3A 4PJCB 2DLFL 3WEMA 3TS8A 3CQFA 4PJCA 2AQQA 1QBBA 2YWZA 3RTQA 4N86A 1HJCA 3VXUA 4K9EC 2PLTA 2PP8A 3FMGH 1WUZA 1I1FB 4NZRL 5TQ0L 4UI2A 1UZGA 3C87A 2EC8A 4LAJH 1FVEA 2YAOA 1X5MA 1UJ3C 3R4DA 1OAYL 4LDOB 2R9HC 3SPGA 1DUYA 1ND0B 4OGZA 1KJVA 5B8CA 3FB6A 2HVBA 4QRSB 1VFBA 4LRNH 3NEXA 4JREC 2CMRL 1CT8A 2AW2A 5FV1L 2WKOA 3VI4A 4QOKB 3U7WL 2I7OA 1CF8L 1CFTA 1QFWH 2CJ3A 1XR8B 1KXQA 2DLEA 2OJZL 4TVPH 3QO0B 1OP3H 3E9TA 5A2CA 1XO8A 1E7VA 3RY6C 1AXTL 3EFOA 1JZDC 1QWHA 2BSSA 4HZLA 3HG1E 3V4PB 3IFOA 3X3FL 5T1MB 5T8IA 3W39A 1IBDA 4G5AA 4AX3A 1M71A 2E6QA 3S3DB 4MJ5B 3K4DA 3SDYL 3HRPA 2UZIH 4NKMB 5CXPA 1GL4B 4ZDHB 5DUPL 1SPDA 1YDPB 3L3KB 3KWVA 4NZTH 4M6NH 2VYRE 3WNJA 2YMXH 1IO4C 4JZNB 3L4VA 3N44B 5F2FA 4M6AA 2B3RA 1AOZA 1F97A 1YA5A 4MNHB 2XX1A 1I1AD 5DTFB 5GHWH 4OV5B 4YHZL 4HZAA 3R8BB 3OHXB 4JJOA 4L4TA 1MXDA 5GS0H 1MY7A 2YPKB 2JIXD 5DDHA 1JVOA 4CSSA 3A4AA 3CE1A 4OZFB 4HQQH 4FNLH 3K91A 1HL4A 1ZLVK 5A43C 2FEDD 3ZR5A 1HQ4A 2PNDA 3GB7A 1RI8A 1E9OA 3IU3B 5E9NA 4AYEC 3P3TA 5TQ2H 3P3RA 4XWOC 4M7ZC 5C0RH 2YGQA 4G6AD 1I9IH 3EJPA 1G6RB 1H8SA 4PMEA 3IB4A 3ULSA 1JPTH 3BIKA 1DBBH 4LCYB 4EI5C 3L6FB 1MIEH 2K6ZA 2ZP8A 5I1AA 1CIDA 4PTUB 3RWDA 3SBRA 1A14H 4NBYB 5KSAB 4LQFH 1S8DA 3EHBC 1PKOA 4Q0XH 3GQFA 3CHQA 4EIUA 1SDDA 3LQAL 4FQXD 4YHOH 7CGTA 1MSPA 1NBVL 1RU9L 4ZW6A 5A7EA 1KN2L 4E42A 4EUPG 2R39A 4UTBL 4IKKA 2AXWA 4I18A 3BIAX 1WFTA 3CDGA 4I85A 4UU9B 4XPBL 3K7UA 5ESQB 5JO5B 4AEHH 2FSDA 5CZXC 4OIIH 3ZE0F 2KT6A 2F19H 3JVGA 2JV6A 1B2YA 1XF1A 3QAZC 4GAJH 4YHIB 3QHFL 3W9EA 1KLFB 2EDDA 2VC2B 2EE0A 3PIQA 1BYPA 4HUCA 3TJEL 3S35L 4G8GD 4FTVA 4PJ5E 2J1ZA 1BV8A 2WLIB 4JKKA 3GHBH 3U1QA 3V0JA 4L3EB 1MQ8A 1Q0XL 1XGYH 2H6PA 5E6YA 5L8LB 4JFHD 1CD1A 3GXFA 4YEFA 5GS2H 2XFGB 1BQUA 3IMBA 1PNDA 3OLEA 1DDHB 3BAXA 4G6FD 5FA4A 2HRPL 1HYRC 3FBQA 2F1EA 1PG7H 2HXAA 4JO2L 3EYVB 1FI8C 3P77A 4HSAC 4I3SH 2NQ3A 4MYWB 4QTIL 4Q97A 1A3LL 1EFXB 4X8GA 2F2HA 4PV1C 1RHFA 1BLIA 2IPTH 1F2XK 2A6JB 1WZMA 3VI3E 3UMTA 5ESAB 5AEAA 3OAZH 4AV4A 4PLKC 1KJ2A 2H7WA 3HNVL 4X9YA 4HS8L 1TEFA 4RAUB 4ZXBB 4M5YL 1B6UA 2NUPA 3GS7A 4KTEL 1BWWA 5DD0H 5IESH 4YBLB 5CD3B 4XB7A 1PMYA 2JQAA 3VXRB 3TNMB 2NRDA 2VAJA 4NCDA 3W81A 4NKOA 4KWUA 2CHWA 4MXVE 4H0GA 2NX5B 5DR5L 5D2LA 4AKPA 3BN9D 1Z5YD 3GS4A 4U3HA 3TL5A 1A21A 1AZZC 3QORB 4QXUH 2PCPA 4NHUA 4FFZH 2X6VA 3W3BA 5E08L 4GT0A 5J11B 2J3SA 4P4RA 3QULB 4Q2ZB 3LKOB 1TJIH 3V5DA 1WAAA 5GGTH 3VWJA 3PU7A 4PGBB 4PRDB 1XAUA 4OM0H 4EMZA 2H2SD 2VDOL 4LP4A 2BK8A 3FH7A 3QDGB 1A7PH 5DWUH 1JV5A 4F27A 5DRXA 3CVBA 3VFTA 4Z7QF 2P28B 3HR5B 3X17A 4AQ1B 4PG9B 3WS6A 4K7PX 2CAKA 3EOBA 2VLMD 3DOSA 1ITBB 1M1XA 1W0VA 4BDVA 4HIEA 2HFFB 5T1LA 2F53A 3F5WA 1P7QB 2PPFA 4DSYA 3CTTA 3R7QA 4BSJA 3KH3A 1HILB 2NNCA 3IJSB 4WK4B 3OLIA 3BWAA 4NS0A 4WTZG 5IQ7H 3ZRFC 3BRDA 4POUB 1OIOA 5CJBA 1GXEA 2CDFA 3VGHA 4QXGL 4KQ3L 2AJXH 1GTFA 4YXHL 3ZX1A 1SYVA 3MN8A 4N2FA 4Y4HD 3WNOA 3G5YA 2WJ7A 4MHHI 4DGVH 1R33A 4L4VB 1Q0XH 5D96B 1MCWM 1G87A 3QWRD 3UO8B 1UZ8B 4G3YH 4JHZA 3BH8B 1SEBB 2MKLC 3PWLA 4ZW3A 4UT9H 2K4WA 2JKIS 3B4NA 1NBCA 1IJ9A 4NO3B 4Z7UF 3GXMA 5JHLA 3V9EA 2QKIB 4OIIL 4AEHL 2V7HB 1PZ2A 3JWDC 2X4SB 2BW5A 3BAIA 4LEXH 5F0JB 4MNGB 2ZPKL 4UT6H 2KC0A 3K1KC 1BYNA 3QIBB 2R1XB 3MV8A 1E8XA 1F3DJ 4R4NC 2J8UF 3APDA 4KK8D 6FABH 1YYLH 5ISZB 4HMEA 4AYID 3WTYA 4JPWH 2H1PL 4N3TA 1TSHA 1MRDH 2J44A 3QG7H 2YD8A 4OJAA 5F9DC 4AE0A 1TQUA 2F8OA 3QDJB 2H6OA 2KMWA 4Y2NA 1UWXK 1KIUA 2F74B 3HE6D 5KG9B 1HWGB 4BJLA 2YXWA 2H3XC 1ZGLB 4YQXL 4MDJB 4JFYA 4ZMOA 1M53A 2R69L 1HCFX 5IR1B 2R0KL 4YZWA 3NESA 3S3BB 5CSZA 4WK2B 1JTTA 1QSVA 1A1OB 2B4CH 4LVHC 4NWUL 4TNWK 1MH5A 5D7JC 5FGSA 2ENJA 1C16B 1Q72H 2F8IA 3RWJB 2MFNA 3RWJA 2XICA 1D5RA 4WUUD 2M26A 4LOVA 2VERA 3OJVC 5EC2A 3WTVA 1RPKA 1NFDF 1WTGT 4JPVL 2R2CA 3GGWB 4FXLA 5HY9A 4EKXA 4DN3L 4GKNA 3UP6A 1VZHA 3OZ9H 5HYJA 3OXRA 1F11B 4LIQH 5KN5A 1A9BB 5T1JA 3L45A 4G6KL 1ONQA 4KQ0A 1Q9LB 2W9EL 4OZHE 1Y07A 1BD2E 4Q9BA 4EZLA 4U6HA 2BNRD 5DA4A 3N9GL 1NFDA 4AMKL 1AVAA 1QOKA 2SEBA 4A38A 2XN1A 1JHKL 2X4PB 3GMPA 4WW1A 4XVOA 4NJAL 5F6IC 3ULUC 3EOTH 4YR6A 3W56A 3ZDXE 3V79C 4GRLC 3IDXL 4Q14A 4KZDH 3K6OA 1TZHA 2XN0A 3EJZC 1IM9D 2ERJB 3F12A 4EI0A 1G7HB 4QD2E 1EBPA 2R1WA 1GIGL 3RWHB 4HKZB 1MREL 1NIAA 3QEQD 1A64A 3JZ7A 4GQQA 3JV6B 5I6OA 1YC8A 3FQTA 3DX9A 2WQAA 4GRWF 3X1GA 3GPSA 4PYGA 2IPKB 2NTFA 2H32B 1AO7B 1QWUA 1UA7A 3ABMB 4JJ5A 2A6DB 3L5WB 3HG4A 1EQWA 3CFDB 3D0LB 5EBWA 1KCRL 4CVWA 1NMBH 4OAWB 3ETTA 1D7DA 5FGCB 4RFNB 3WD5H 1GZQA 4RMSA 2DMGA 1UD3A 3ARDA 2F08A 2VISB 4MD5B 1FGVL 4Z76A 3T0BA 4PY8J 4XPFH 5DO8A 5FR3A 2FYYB 1U8IA 2WCSA 1KJMB 3COOA 2CUHA 1EERB 1M9WA 5FA3A 1YNTA 1RZQA 2YS4A 2WLLA 5F9AC 4BA8A 3B7YA 3P1VA 4DK3A 1XVSA 4U49A 4YX2H 3LMJL 3MTXA 1F6FB 3ULUE 4WU5B 3BUYB 4ETQA 3BSZH 4EJ1C 4Z7NF 3BAEL 5DFWH 1TJHH 5MI0C 2XLLA 1KIUB 2F74A 1P1ZB 5KG9A 2V9RA 4OFQA 1GOFA 2WQ8A 2QR0A 3WIAA 3ZL4L 1PPIA 1KF9B 2WUCH 2KQNA 4W81A 2P43B 3DOSB 5IJBC 3DO3A 2YJLA 3LPWA 2WB1A 2OCCB 3WSQL 2ZX9A 4HUUB 4A6YA 3DGGB 3DJSA 5IEKA 3HN3A 3QR0A 4Z78B 2XNAA 1AYOA 4JFED 2Q6WB 5GGQL 4Y19E 4FG2A 3MZGB 4NKIL 2KLTA 4KXAA 2J8OA 5F9JB 1CFBA 1CBVH 4PN6A 3GKWH 4X9IA 3FN0L 1J0JA 3I75A 3UROR 2JQZA 4XN8A 4YSSA 3DK0A 1I3GH 4TNGA 3ZIMA 4U3SB 4APQB 3ZXAC 1VFUA 4GSXA 4LLVA 5J6HB 2VXSL 1EHNA 2H3NA 4RISH 4M4RB 1E5BA 1INEL 5IEHA 1E2WA 3KXFB 4G1MA 3EJQA 1H8OA 4U6VL 3GLZA 4QLWA 3OMAB 4O02L 2ZF8A 5EUOB 3AACA 3U2SA 5BXFB 4OF3A 1WHOA 3SOBL 4PGEA 1LD9B 3F6IA 3F7LA 3DHPA 3RFZC 1M7XA 2HA1A 4LLDA 2MCMA 4AW7A 3MUUA 3VMOA 2Q10A 3B7RL 1JBJA 5F1OB 1MAJA 1AP2B 4N87A 2EXWC 2PP7A 1W0WA 4PAZA 2VLJD 3RGVC 1GY1A 4YHLH 4BQ9A 1N7MH 4IRJA 2XHNA 1JPSL 4XTRC 1PU0A 3S35X 4S1DD 3FQNB 1OARH 2AK4E 1P84K 4DFHA 1LO2L 4RX4D 5E2JA 4HT1L 4H8PA 1I7TB 5F6HJ 4OFYA 1AC0A 1FL3A 5T33L 2LW3A 2QGDA 1RHHA 1MPAL 1C8QA 3WNMA 3AT8A 2BVPB 3BGMB 3MRIB 4GAYA 1ZHLB 1RK1B 1THAA 1DQMH 1UH3A 4C83B 3T6XA 2IFGA 5J11C 4EUPB 3P4MA 3C6SB 1K5WA 3MODH 3RIKA 5A16B 3QDMD 3P4NA 1W91A 2M83A 1HHGA 4YHNB 4P06A 4KHTL 5IHZB 2QKIA 2ZXEB 5BMFL 3TYGH 5EWIH 4ZAKC 1D9KD 4K4KA 4M62H 3OB0K 4K5NA 3UMNA 2DYPA 3UX9B 3SCMD 2HFEA 3B3IB 4GNKB 4C55A 5E0FA 3FL7A 4CC1A 3DIFB 4OJYA 1E5ZA 5I15H 1YECL 2YHGA 1Z9OA 1DVFB 2VC2H 1HXYB 4MA7L 2P8MA 1G1OA 2B1AH 3KWXA 5CJ8A 5C0JB 5E6IB 2EADA 4XNXH 2V7NB 2Y7LA 4EXKA 1PDKB 1SOXA 1NCIA 3HS0C 2QJDA 2BVQB 1IC1A 5DU7A 4JG0L 2E4FA 3KXFE 3L6FA 4AJVA 4YHYB 5C7XL 2IOOA 5BO0D 3HRZA 5TDPB 2ADJA 1K3IA 1S7XB 3IGUA 3O6MH 3Q44A 2YQ2A 3WKNA 2AV7B 4N0RA 4BRJA 2DQGL 1O9VA 1D7FA 2BH0A 4TQ8A 3EH4B 3H2WA 5HGHB 2BNQE 1FNFA 1GR7A 1QSZA 5KBNC 1SF5A 2ATAA 3N42F 3MJ9L 4KKBC 1MJ8H 5EIIB 3CZKA 5IK3A 4X99A 5T1KA 4NQDE 3G5VA 4Z3IA 1OGSA 1FHNA 5T1KD 1GPOL 2FL5B 4JJHA 5F7UA 5GSRA 4GBXA 3AWGA 2CDEB 1EEZA 5JPNA 1PQZB 2B0SH 1E8WA 2ZP0T 3F7YA 1OY3B 5EU4B 5SWZB 4A04A 2PO6C 5CSGA 1LWJA 1OAUH 4M93C 4ANXA 5IMLA 5CBEB 1UJ3B 4JPIB 3D3VE 1OHQA 5KUMA 4LFHG 3FONA 2O5ZH 3KEDA 5D6CA 5AL8A 2D7OA 3CU1A 5EOQL 4JN1H 3VXMB 4F7CB 2YPLB 4F57L 1G7LB 4EIGB 5B39G 5LWYH 1S2EA 2GSIA 4GO6B 5D5MF 4E42B 2ROYA 4ZW5A 1EDYA 3QXAB 3Q01A 4UTCA 2WXFA 2CIKB 4J3OG 1E2ZA 1XD0A 3MLVL 3QRGH 5CP3A 5E8PB 4DQOH 1R5IB 1QBAA 1X5GA 2BX5A 3A67H 4ZUTA 5MENE 3ULUH 2CXKA 1LM8V 4NNYB 1PNCA 3LB6D 3RAJH 2AABL 2MQGA 1OGPA 4M61B 1O9WA 5DEGA 5DO2D 3HAEB 3WXVL 3BCFA 3EAKA 4PV8B 2I24N 4OJCA 5CUSL 4JFDD 4OZFH 3HJ0A 2W8CA 4I48A 5A1AA 2BVYA 2PTTA 4IRSC 1QLRB 3QWRA 4Z7VE 1XGUB 3OGCA 2TRHA 1IGYA 3ZDYB 2B59B 5EA0L 2ADIB 3RB7A 3ELAT 4A6YL 3A6BH 1T03H 3D2TA 3PWPD 2ZCKH 4HFUL 4L3AA 1NKRA 4OU3A 1D5XA 3D9AH 3QIWB 4CNIA 5ICYB 4F20A 4K7PL 1YMMB 3V6FA 5DHVH 5DZLA 1IVTA 4KKZA 1HHGB 4YHNA 3UBHA 4RDQG 5H8DA 3AG1B 2WNGA 5LGJA 3LZPA 1E6OL 3MBEB 5KOMC 1DZ0A 1KBKA 1J18A 2W0FA 4JDZB 1CMOA 4WCYL 3ERXA 1IC0A 4UANA 2D2OA 4XE0A 2A1WH 1GTNA 3LRHA 5AVSB 1S78D 3H3BC 1UACH 4F3FB 5CNHA 1JDCA 3IETA 1MCLA 2J1XA 3B2XA 1UH2A 2VDQL 3UYPA 1QR1A 1Q9OB 1F2QA 1S7SA 4HGMA 4V1DD 2OK0L 3NJJA 3VVWA 2G60L 2IBBA 3GF8A 5TDPA 4B0MM 3VA2C 2DMBA 1A4JA 2P7TA 3W37A 2WJ5A 2DIBA 4IRZH 3CDFA 2BSED 4LVOC 5JOPD 1LNUA 4XCYA 5D1XC 4ISVA 1QSEE 3KPOB 4X4XA 1BVKA 1K9TA 2ED9A 4KKPA 4N0CD 2OULB 3U4EA 3HMXL 3SE9L 2ODHA 1HXYA 1KJ2H 3I85A 4DERA 2H4EA 3QNXB 3DBSA 2YD1A 1CDBA 1RZJL 4D0DA 3U46B 3TIDB 1SJHB 2OQJB 3WIIL 5GZOC 3KH4A 3Q2NA 4I0PA 2CR0A 1KZYA 2Q3ZA 5KVGH 3DRQB 4Q74A 1A6WL 4LARL 5HHMD 2PPDA 1TDQA 5HI5C 4EZKA 5DJ6B 3QH3B 3HG5A 1HZHL 1SMAA 3V9FA 1K2DA 1SDYA 5KZCD 3MRMA 3ESUF 4X6EA 4UINL 3K3QA 4ZS7L 5G2NA 2ISDA 3S4SA 4ONHB 4K15A 4R4BA 3W9EB 1MFEL 2D73A 4TV3A 1ZLDA 3WN5C 2P47B 3B9EA 3AY2A 1HOCA 1FL3B 4ZNEE 5KJ7E 1XZ0B 4ONGL 4PJBB 3GRBA 4YHMH 3CXHK 4NENB 1H8NA 4I89A 1JP5A 4J6RL 4C56B 4KXZI 2A0LD 2DLGA 4IMLA 1VKXA 4WVRA 1KTCA 4N1CA 3HHRB 3EXLA 1PZDA 3GIVA 1XSKA 4KKQA 4Q9CA 4HOXA 4ZSOB 3LRSA 4L1TA 4D8PA 3TBWB 2AGJH 4L0YA 5HY9B 1YMHB 4JG1H 2E76C 3N40F 2NCMA 2YA2A 3UGEA 2ETWA 3ROOB 2OMTB 4LPXA 5KAQG 1NCOA 1RZKL 1FNEB 1OL0A 3GSUA 3QB7C 1T1XA 4HC1L 5DEJA 3GO1H 5J13B 1S6NA 4D8OA 4UT7L 2YUWA 1CL7H 4OIBA 1NL0H 1MCRA 3VXME 4XMTA 3E3QC 4PVLA 1HHKB 4DNLA 1VADB 1U8OB 2IF7A 2FYVA 4NSKA 1CS6A 4RLDA 4HC1A 4AUJA 5LLIC 1DJXA 4NNPH 1XMEB 3F7VB 3FTVA 4IDLA 4F2MB 1FFTB 1KNOB 2ZOOA 3OMZA 1WAPA 3PXHA 1KTDB 2HT2D 5D5MB 4G11A 4F8TA 5E99H 3SKMB 4J3TA 1YN6A 5CD5D 3AJ7A 3QCUH 3O2WL 3SKNA 4CW1B 2HTLC 3GHEH 4O2CB 1TVHB 4DVRL 1DBMH 3D06A 3PV7A 3BKMH 4F2EA 2F8XC 4OI9A 2X4UA 1GJWA 5C09E 4JFQB 4B53A 2VQ4A 4FL4C 5ETUA 3NCFB 4F7MB 3LEXB 1ONQB 3DLQR 3B2VH 4ZS7H 3MXVH 3VI3F 4ZAKB 1K85A 1K8IB 3V0VA 4GFXA 4XC3L 5F70A 2OP4H 2X53A 3BAWA 3CSYA 2JJVA 3WO3B 1WVZA 2P24A 1IQDA 3LN4B 5D93C 2FJHA 3GGWA 3BYTA 1MAKA 4Y1TA 1XZWA 2MTAA 3J07A 4PJCE 2OKMA 4KO5A 2DYSB 3BP4B 3QISA 1UXWB 4NO0A 4X7TB 5CZVH 1CO1A 5D1ZC 2J57A 3QWQB 3S88L 3D30A 4I18C 3WY3A 1HNGA 1VCBC 3CNKA 5G5DB 2UUDH 2YEZA 1ROWA 3SO5A 3DXAE 3GZOA 4LK4A 5J8OA 5L4MA 2Z3FA 4QY8B 2GABA 3DVFA 3AGVA 1WS7A 2L0DA 1E4WL 4PWEA 4N2LA 3BP6B 1WZ1H 1MNUH 4LCIH 1RZIA 3N55A 5H2BA 3RU8H 2H0EA 2R1WB 3CXDH 3OV6A 3OXSA 1ZS2A 1T6VN 4N5EC 3KYKL 4YE4H 1ZT4A 1SGKA 4M9PA 5ALCL 2WY3B 3K72B 3TO4C 3O9WC 5HYQB 3DX2A 5C0BB 2O4EA 1DJSA 4PLJD 3DMMD 3D08A 1D9KA 4PGBA 1QTPA 1N9PA 3VWJC 5KBDA 4LBEA 3U30C 2VLLB 4ADGA 2V7HA 1XEUA 1S9WB 4PI2A 5DC2A 4M43L 2V2TA 1BZ7B 1QEXA 5MEOA 2YAEA 3EDDA 1ED3B 4Z0BL 4AENB 1Q9WA 1QAWA 1JN6A 1YC7A 2QPSA 3GMOB 2CRMA 4QJ3B 5F89B 4HWEL 4JY5L 2YC1A 5J9PB 1MI5B 4NHCH 2HJFB 4IHBA 3RWGB 1J5CA 5AZUA 5K9KB 5FA3B 1HZLA 3QUYD 2XFXB 1B0GB 2N7SA 5AYUL 1GGIH 1UM5L 3FT4A 2Y6SD 3B83A 4HFWB 1MCSA 5CJQL 4L23A 3DV6B 4RSYA 2P5EB 2EDQA 1E5AA 2MQ0A 3AY4A 3QJRB 4JKWA 3U6XA 4LAQH 1AQDB 4HFUH 1QNIA 4LSSH 4NT6B 1ACYH 3CFBB 1AY1H 3MGTA 5MP6H 4HPYH 5AZ2L 3E7JA 1T20A 1U91A 2H3KA 1RJCA 1XTLA 1NGXB 3D0VA 3OKMA 3ML9A 4PD4K 1T2QH 4B50A 2R2HB 3SGEI 3QC5X 4AQ8A 3A0OA 4L0PB 1FDLH 1ES0A 1BFSA 4TQHA 1SY6L 4WTQA 4J8RB 3VWKB 2YAQA 3GHPA 3VGAC 1JNHA 1IUZA 4NZUH 3GNMH 5FEBA 7PAZA 1GZPB 3PDGA 3KYNB 3L3IB 4P2QD 5JPMA 3IDIA 3L9RA 5D2NA 4I0CC 4NCC2 2W38A 5GQBA 1MF2H 1VHPA 1BCIA 4L4TE 2FH8A 5EO1A 3FUIA 3V6ZA 3WG7B 4CVZA 3UPAA 3L4UA 3O45B 4FG4A 3D4ZA 1BQLH 2X4PA 4KUZL 4F8PA 5T3ZE 4IBLT 2R2EB 2QGEA 5AW0B 5INCA 2A74A 2H0PA 4DCQB 2EDBA 4NJ9L 5K9JH 2NY4B 4J3UA 2XPYA 3Q9PA 3RUGA 2EIMB 2EIBA 4JRFA 1W16A 2ITCB 2MNWA 4H25B 3MGOA 4M1DL 4BM7A 2ALWA 3VU2A 4I18B 3BPCB 2OZ4H 2VN4A 1I8LC 2PP9A 4W9DC 5KYXA 1ZWIB 3RVWD 3QEQE 6PCYA 4KZEH 4UUJB 1X5XA 4Y19B 4I0KA 5FLUA 1UKSA 1YO4A 2XWBA 3OXSB 5AW4B 1UWEL 2GFBB 5GSVA 4LRIA 1SYVB 4MJIA 3POCA 2CHNA 3TN0D 3HJEA 4E5XG 5DVKA 5CSZB 1C08A 3BEVB 4H26A 4QHLB 2PR4H 4WI0A 3GIZL 1DANU 1Y18A 5BS0B 1MJUH 1E9OB 2XRAL 3GMRA 3P4OA 4JDEA 4JQIA 5B39B 2DQ6A 1M56B 3IF1A 5DJ2B 4H7VA 3CBJB 3H9SD 4K3EH 4PJAB 5HPMA 5E9DE 3ZDYE 1UXWA 2E56A 1MWAH 3QVAA 5C3LD 5H4ZA 2XFXA 4U1GB 4F5CE 2HFTA 2KKQA 4FG6C 4PJDF 4ZFOA 3OKNA 1JE6A 1SVZA 4MD4B 1UUSA 2CCLA 2ITCA 4XT1C 1HSBA 3X11B 1H9DA 3AG3B 4MA1C 2LABA 5CBAA 1XGQB 5AZEH 1MY5A 1XGRB 2OW7A 4N4YB 3J7HA 1FAKT 3QFDA 5BMFH 4R2GD 1MW0A 3FO1B 3FUEA 3O0RL 5LGYA 4UB0H 5BJTB 1N18A 3SKNB 3BH9B 5MERB 4OCRH 2ZOLA 2IVFC 1X5IA 2R83A 1MRCH 4DN4L 1A8ZA 5F7BA 1RIVH 4JB9L 1OGTB 4FS0A 5SX5K 2AEPL 4P5MB 4C57C 3R0MA 4QHUB 3NJFA 3NQIA 3VYOA 1NAMA 1Z3GL 4K8RL 2QELA 2X4OA 3IAGC 3NJXA 4O9HL 1D7BA 3GC3A 4NIKB 1A25A 3C08L 5C9JB 1JK9B 3QZWG 2RAMA 4S10A 1LO2H 3VSQA 4UQDA 1XL6A 3T0VA 5J12B 4HJIA 3AITA 2BMKA 3I6LD 4HXBL 4PGCA 4RGNE 3ZDYF 1GSMA 5C70A 3I9IA 3MCLH 1E4XI 3P3UA 4NUJB 1TLKA 5EF2A 4OCRL 2FWLB 5AOZA 3F5WB 5F6HI 3V95A 2HVJB 1U8QA 2GBAA 1FGNH 2JELL 1EJOL 3CN1A 5E6RB 3R1GL 4OCWL 4RGMC 3UZEA 3DX8B 5BS0E 4PY7A 4JDVB 3KPLB 7TAAA 4MDRA 4OQTA 3SJVE 3FB8B 2XETA 3QHZL 4RVBA 2PABA 5EBMB 4YSUA 3W11D 3S48A 3NFPA 3D87B 3LKSB 3RVXC 4NAQA 4MJ6A 3EJUA 2DOCA 4TNFA 5IW1A 5CJ5A 4MJ5A 2A4ZA 3QIUC 2IADA 4NDMA 2P45B 1I3GL 3VRIA 4G9DA 3CLFH 5I8EA 1CE6B 1QW8A 3JV4B 4C8XA 2YSSB 3CK0L 3SDXF 2HX7A 5ERWA 3IXTB 4KK5D 2GTZB 3T1FB 3GINA 3QDMA 2E7HA 3P0VL 2YUVA 3N50A 1L6PA 1SY6A 4PRHE 4XTRD 4MX7B 1GVIA 3L4ZA 1A3QA 1PIGA 2OL3H 4JX0A 4RFEA 4U1JB 5GGUB 5G55A 5FCUL 3T8XA 1EANA 1CQYA 4CILA 3Q5YA 4TN9A 5H35B 3ISWA 5C6PB 4M8RA 3BQVA 5ENWA 2FTAA 5ESVB 1J0YA 2EDYA 4OZ4A 2OV0A 3IAPA 1CG9B 1DEEB 3V0DA 4H8UA 5F88A 2W9DL 5TE7L 1F58H 3ULVL 1AZNA 1OOWA 3INOA 3QR1A 3NPSC 3SE3C 1T3FA 2A9ML 4KNUA 4YX2L 1WBYB 2IDFA 1EXHA 2E59A 2NSQA 3CFBA 3EO9H 1GYVA 1U6AH 2RFXB 5I1KH 1ZLWK 1TTGA 5K33A 3PS6A 3FU7A 4LESA 3BDYL 2VN6A 3ORJA 5GGSB 4R6UA 5D7JD 3CD4A 3QUYC 4OW6A 5D1XE 5D8JL 3Q8AA 2H47C 4LVEA 4KJWC 4TM9A 4I4WA 1NMBL 4U3CA 5D7IF 1X44A 4KKLC 1G43A 4R26H 1I53A 1S7SB 1U8MA 3RG1C 5BV7B 3CVDA 5D2NC 2WWOA 4PB0L 3MUZ1 5FYJL 3CDCA 1M4KA 1OE2A 2FATL 4F8LA 5IHBA 4U1NB 4PW9A 4QT5B 3UTSD 2YRBA 1IGIH 1PZBA 1CE6A 3JV4A 1T0NA 4TUOB 3O9WB 3V0AC 3QGVA 3D18B 4C56A 3O6LL 1P4LB 3TT1L 3L2LA 1T2QL 1UB5B 2NY4C 4WJ5A 5JHDE 1IGTB 4PBWD 4AIEA 2WBJB 5KWYC 2Z6FA 3QIWC 3H0TA 4PJAE 5AZ2H 2VOTA 3U9PL 1A4AA 2EO7A 3S2AA 3D0AA 4IGBB 2MPVA 2Y07L 3MA7A 1NTDA 1UZ6E 5F96L 4FKKA 1BEXA 4ZXBD 4KZ0A 3I3BA 5L4FA 1F56A 4NM4L 2GW5A 4NZ8A 2YEZB 1QFUH 1VEMA 2LTQB 5G5DA 3OQRA 3WFBL 4FMKA 5DFTA 3CSPA 1YY8B 2YFNA 2DS4A 2BJMH 1T89C 2Q86B 4YOKA 4X6CE 4ENZA 4XCYB 3GRWA 2AI0L 1U4EA 5I71C 5ICZA 1BOGA 4YHKH 3EYUH 1J1OL 2BNRE 5DD3H 5GZND 5JHMA 3RVTD 4N20A 1UD4A 3QUXC 1CL7I 4O2FA 2X9XA 1CFSB 3HE7A 3I50L 3SGEH 3D18A 1QTSA 2GTZA 4KRNA 4PCYA 2UVEA 1DVZA 1HQRB 3T2OA 4QT5A 2QPFA 2WO3B 5KANG 3T6VA 5IFHH 2FQEA 4M6OH 2LVEA 1NGQL 4ZW8A 3AQYA 4FTDA 2EDJA 4BFFA 5CBAB 3EFFB 4FYSA 2D9QB 3MBEA 2EXYC 4PP1D 2ZYIA 4E9SA 1WRFA 1NEPA 5JA9A 3RFZA 1QKZL 1DO5A 1A7QL 4LSRH 4Q4IA 1Z9SB 3TBVA 5I5MA 3VD2A 5ILTL 3U7YH 4OD2B 4I4WB 4LOUD 4X6FA 1IAIH 1U8LB 4LEXL 4FX5A 2K8MA 3LPFA 1XGZA 5I19H 5I1HH 4ODTH 3IAQA 5GGSA 4PY7B 2EKSB 4P04A 1JWMB 4XOCA 3AXLA 2HT3C 3MROA 1LJMA 3QCVH 1GZHA 1X5HA 2FX9L 4IIQC 1AANA 4FYQA 4N2KA 2Q7YB 4HGKC 1UHVA 1UH4A 3FS9A 4PGCB 3BEVA 1I85C 1R5WA 4AIXA 5JQHC 2LOEA 4EDXB 3LIZA 2EC9T 2Z0BA 3HAEH 2Z31D 1LE9A 1KTBA 3D48R 2ZOWA 1Q9KB 1TKWA 3ALPA 3LXUX 1NFIB 3P9MB 4P59L 3F6JA 2RJMA 2Y23A 5C0EA 5D96C 4MFHA 2QKIC 1G4MA 4P4KB 2QSVA 4PLJC 3KBHE 3F8UB 1N6UA 1IGTA 2QSTA 4MX7A 4HS3B 3BESR 2JB5H 2CH8A 4OLZH 4ZPTB 4CJ0A 1CURA 3K2MC 5EZPA 4WQOA 3W2DL 4I9WE 2HFEB 3AS1A 3B3IA 4GAGH 3EJRA 4FDWA 4DKFL 5J7CC 3RGVB 1LTXA 2Y1ZA 3UBXA 1X7QA 2OMYB 4ONHA 4R4BB 4CN4A 5EBLB 3L7FA 3N1PC 1TO5A 1ERNA 1JSYA 3DJZA 3RWEA 4EUPH 2Z92A 3MBWA 2COVD 3HE6B 3LKSA 3B2MA 2W0KA 4YBHA 4UQEA 4BZ2A 1KTKE 1CJYA 5CM1A 1AMXA 4FFTA 1A6AB 4XBGA 5BOZG 3MJ6A 5FUCC 2V33A 3DVGA 4XNUL 4LLYB 3S8WA 3BHBB 4WI6A 4NLAA 3ESNA 5FB8B 2CR6A 5E94A 5J06A 3IKKA 1RUQL 2ZXQA 4JG1L 4PRHA 4DKFH 5IQOA 1EVTC 4X0KB 2DWEA 4OKDA 2ZCLH 4DEPB 2PXYC 3PAYA 5EBGA 2EABA 1QSFD 5I5IA 1RVFL 5BS0A 1NGXA 4X4XB 3T0EB 3HNSH 2BMKB 4Y2OA 3V5HA 3VXUD 1PKQB 1SZNA 1NSNL 3BKYH 1RERA 4P5KA 2BNQB 4M5YH 3P73B 1RJLB 1B4JL 2BOCB 4Y5VC 1YN7A 1Z5LB 1H6TA 4YDZA 1A47A 2J73A 1ZHNA 5E03A 1EZLA 4MMZB 1IMHC 4U1KB 2EDRA 2BS8A 4OZIA 3LV3B 2HX8A 1F4AA 1DVTA 5H4YA 1ORQA 4KNSA 4IK6A 1JD9A 5AOLA 1CVRA 2X10A 3THML 2XWEA 2ITDB 4QHMB 4MSWA 5IV2A 1DE4A 2L7EA 3LVEA 5HD8C 3QFDB 1OP3K 3MJ8B 2OYMA 3SE4C 4GW5A 3ZZSA 5DD1L 4HAFA 3C8KA 2GJ6E 3CHPA 3HC3H 4DPRA 1NCDL 4W9KC 2Z8VC 3WE6B 3U7YL 2Y3NA 4HYTB 2ICEA 3C6SA 3ECUA 5HYQA 1I8IB 3N85L 1CDHA 5GGVL 4LKCB 2D9CA 5KVFH 4FLRA 3CZUB 2HTKD 4M6OL 4ZO8A 5BO1L 5JHDA 2ZOUA 3GBEA 1AFVH 1IX2A 1KCUH 1V5JA 3GMMA 1YNLH 3KHOA 1H3UA 4IEFA 4KROB 3PV6B 1SFHA 2NW3A 1EXGA 3GK8H 4IRSD 2YMTA 5FV2A 4I0PC 4QRUA 1U2CA 4U1MA 3C9NA 1NCNA 3LH2H 4HF5L 4AY0A 4FQCH 4L4JA 1MCKA 1YNTB 1A14L 1EHLL 1ID2A 3QZLA 3B8SA 1P5VB 4P5SA 1WIOA 2L4OA 4N68A 3M8OH 4FQIL 1R5IA 3WN6A 2GYSA 3FT0A 4PJ9D 4OLVL 4O5LL 1MLCA 2WV3A 4HS6B 1KN4H 5AUMA 4MB3A 4CC0A 3L3JB 5INDB 3BJ91 4QYOB 4HQQL 3GSQB 3K8KA 4RX4A 3MACL 1N8OE 4NQQA 1S5IL 2XZCH 4K3JH 4W6XB 2MJWA 3S8GB 4K7PH 5GHWL 4LSUL 4H0HB 5L6YL 4MCZA 4G80B 1H0DB 2WP3T 5LHDA 4JO4H 3AMLA 1I7ZB 2OTPA 1DL7H 4CW1A 1FYHB 1IE4A 1KPUB 2HKHL 3P4MB 4M7LH 4POZC 3K72A 1FIGH 3MX0B 1UZ6F 3QCTH 4MDIA 3VXTB 2HMID 1CI5A 3KL0A 1A3ZA 2BVOA 3FQUA 3ISRA 2JCWA 1GGCL 2KH2B 3RPBA 3FYIB 4GXVH 4YFEA 4ODBD 1XCTB 5L8KB 3HLAA 4RCAA 5EPMB 4JVWA 5MEND 2FATH 3NIDF 4PJFA 2F58H 4HEPG 1XFPA 2BOBB 3GMQA 2LVCA 3UIYA 4WU5A 1I82A 1QNZH 2FGWL 4KPHH 2PCFA 4LHJB 4WENB 4NC1E 3DOHA 3ASNB 1XMWA 4WEBL 1DBJL 3KJ6L 5I8OL 1ZRUA 4FMVA 5KBPA 1EEYB 5D8JH 1PZ5A 2D7NA 3LTVA 3ARFB 3ARFA 3CLWA 4DP5X 2R4SL 3C5ZA 4JRXA 3DETD 1NLDH 3D85B 2HN7B 1YPZE 2KPNA 1ZV9A 3O4LB 1YQVH 1ETZA 3LPGA 4N2IA 2IANB 4WUKH 1U3ZA 4Y2DA 4XB8A 1WA0X 3GJEB 4BCXA 2VABB 3HPJB 3QPXH 3RHWF 4IMLB 2ZX7A 1VKXB 3QNZA 1ZANL 1D2OA 4ZI8A 5C0FB 2XN2A 5EEUA 1HS6A 1DCEA 3FOLB 1LQSR 1D9KB 4GAFB 1SHMA 1AKJA 3H7BB 3MJ9H 1PW3A 3V6ZB 1AHKA 4XPTL 2X44D 4H2CA 3MX0A 2OJEA 4JFTA 3IKCA 4TSBH 2VLRE 3FO0L 3H1ZA 4Z3JA 3FCSB 3ZL2A 3NCYP 3O3UN 5B7EA 4Q89A 5IW6A 4KY1L 1V54B 4MLSA 5DQ9B 3GLAA 4NC0B 2BVEA 3PL6C 2BW4A 1QQDA 3NYKA 5BZDA 1OTSC 2RH0A 2I07B 2FBJL 2DKSA 2VR8A 4JFPB 3B6SA 2GIXA 4DUXA 3B2DC 4XXCA 3WTTA 4BFGA 2FJFA 3MGTB 3PDOB 4PCSA 1X5JA 1F4WL 5FXCH 3DBXB 3D85A 4DOHE 3A5VA 2IV9A 2Z91B 4TUUA 2IOMA 3SGDI 1SXSA 4MQXC 4ISVB 1K5NB 3WUWA 3CFEA 3IS1X 1GMIA 4J1UA 4MXVF 4OF6A 5F1IA 3KPMB 4KHTH 3JWOC 3VGBA 1IT9H 2XN9D 4WW2B 3VRLE 4L8SB 5E4EB 5A2LH 1E27B 4IIQB 1EAPA 1X7SA 3HFFA 2OMVA 4G8AC 3BMWA 3TZVC 4JN2A 1ADWA 4F91B 1A7RL 5I9QC 4RNRB 5CEYA 3WTWA 2FAUA 3S5LA 4YJZL 4HCRH 2X4UB 4DP4X 4TSAH 3VI4E 2YPLD 4PVBA 2UXGA 5DUML 2C9UA 2N3JA 2NXYC 4ES8A 3H85A 3ARDC 3DVNA 2FNWA 2PWFA 4DN4H 1URZA 3S9DB 2D03L 4G6JH 1QO3A 3O6FC 4LSTL 4NQVB 4AYMC 3ZY7A 4XVJH 3GI9L 3TFBA 2LU7A 5F3BA 1UEYA 4Q58C 4AJWA 2XKNA 3NJVA 4IBYA 4UILL 1F3JA 1KCVH 2X7LA 3MJ8A 2VR5A 1U21A 2DWYA 4AL8C 5JR1L 2GTQA 1JPFA 1XH0A 3EYFA 2J55A 4I7ZC 5E6SB 2J5LC 1HYSD 5F7LB 1KGCD 2CO3A 4R96B 2PETA 3LKRA 3WEXA 5IJVB 3VG9B 5INDA 2P44B 3A4FA 4YFLF 4EQ3A 3NIGB 1KMGA 1X9QA 3CZLA 3FUMA 1WISA 4S11A 4HHGA 4J1UB 5CZXD 1DVXA 2VRKA 5DWPA 2NY0B 4MZ3A 3M86A 2VMEA 1KCBA 4KI5D 4NQDB 1MWAL 4EKJA 1YEGL 3BKJL 3UACA 1FFNB 4DP7X 2VXQA 2X89A 3MFGB 3B56A 5JNYA 4WGWB 4AVKA 1J88A 4NKIH 4IU3A 5DRNA 12E8H 3RBSA 1E2VA 2DJMA 3UGUA 3GIVB 2MOGA 1GS6X 2NY3D 3RLSA 2QVFB 5F8RC 1JZ6A 3AT9A 1JYVA 2FX8L 4K73A 4XODA 4WHDA 4MVBC 5DQ9A 4PJ9A 2FX7L 3PJSA 4PRNA 4MXQC 4PJ8D 1L0PA 1UGNA 1G6VK 2WUCL 3NCXA 4K5LA 5KVDH 1P7QA 4KKRA 1JMZA 1QEWA 3GDCA 3PWUB 4NFDA 1IAKA 3RY5A 1YEEH 1MCOH 2ZX6A 2ITFA 3TBSA 1XIWA 3IGKA 3G9AB 2D31B 3D8MA 3MNVB 5B3NA 3NTCL 4FQXB 5DK0A 3ZW3A 1NANH 3P3YA 5HJDA 4ZTOH 3MV11 1WA1X 4D9RD 4HIXL 1SJEA 2EVGA 1KELL 2EH8H 3DUHA 2XG4B 3SDDA 5DFAA 1PSKL 1RV6X 5AW1B 1KDJA 2ZNXA 1V3KA 4U1LB 4QAMB 2ARWA 4FXGB 4KUZH 1KGIA 1UZ8A 2NX5A 3ZO9A 3D39D 3FTSA 1TFPA 2Z65C 4P05A 2LFEA 2Z34A 2F58L 4U1IA 2R15A 3C6LB 3EGXB 4L1SA 2W94A 3RWIB 4WTZA 1RJLA 1XBDA 3M1BA 1AE6H 1BF5A 2YR3A 3GI8H 1RCYA 4OZGE 3PAUA 5EN2B 1FDLL 1HL5A 1JPGB 5F1NB 4YSDA 4DP6X 2J72A 1EZUA 5ACZA 3ARFC 3LZLA 2NUPB 4IJ3C 4NQEE 3RZCB 4QRTA 4F92B 1UASA 1RJZB 3ESPA 2YPLE 2HFFA 4JQVA 4YVUA 5T1LB 1MUJB 1KWGA 4XN4A 1JHKH 3DIFA 1KB5L 2AKRA 4AK2A 4WO4A 5T3ZL 2APXA 4R0LB 3DI2B 3B7TA 5HSFA 5TH2B 3U9WA 1E5YA 1GGYA 3IFNL 3D52A 4Y2LA 3HNTH 4E9VA 3CSTA 2XZCL 1QW9A 1S5IH 1SJEB 1U0QA 1UWXH 2HT4D 3JT0A 4K3JL 4OCNC 5E7BA 2ICEB 3CVCA 2AMGA 3D25B 4G7YL 4HU2A 4MAYD 3U6RB 2EKSA 1BBJA 2D31A 3B9VA 4KGLA 2YN5A 3GBMH 4H2AA 3WUZA 4DN3H 2Q9OA 5IKCB 2J6EA 1BVZA 4TMPA 1NCGA 4OLVH 4UM8A 2WLIA 2EO1A 4M7KL 1N0XH 4N2HA 2ARJQ 5KYNA 3OAYH 1RHHB 1QUNB 4QRRA 4U1SB 5BCAA 3QORD 1DLHB 1KLFA 3FQYA 2QDVA 5E2TL 1WCBB 1SN0A 2X9YA 1S9YA 5DYFA 1B0RB 3E2HC 4YDLB 2PTTB 2AEOA 4LP8A 3UBXB 1IAOB 3O3BB 4U0RC 2QZ5A 4YE4L 4AQAA 5FKAB 4D2NA 3MHZA 1ZXKA 5F1NA 3GK8L 3ARSA 3TJHC 1P5VA 1VF5C 4ZXBA 4KRMB 2DDQL 4HS3A 4PQXA 2C1OA 1A9EB 2CDFB 1R3HA 1MRDL 1YVLA 4UQ9A 3KPSA 4PS4L 3TEXA 2XZQH 3HS0A 4JRYB 2O6DA 5J89A 1KB9K 3VFRB 3L5HA 4BDVB 3QZNA 1C7SA 1CICB 3RP1A 4PEEA 4HULB 5LDSA 2JTYA 5C0CD 3QXDB 3V4VA 5DS2A 5DZ9A 2K9UA 2VUOA 3H3PL 5I2IA 5JW5B 2GJ6B 2B20A 3GSWB 4CADB 1WC7A 1DTUA 2HT4C 1J10A 3NZHH 3AGWA 3CLEL 1IGML 1U8CB 4WV1C 3T4AA 5IHZA 3THMH 1HHJA 1IC7H 3LZFL 2XQYA 5AW8B 1WT5C 4JVUA 4TOYL 4JPIA 1VFMA 4MNHA 5D1XA 3D25A 3U6RA 2C9VA 4HJSA 4B9YA 4PGDB 4UF7C 3ABGA 4ALAH 4PSRA 4IOIA 3ARGB 3DUSB 1OCRB 2PCPB 3FOMB 3VXUE 1KCVL 3NDYE 3WI9A 4XPHH 4UILH 3T0AA 4AG4H 4DHLA 3MQIA 4DKDC 2D0FA 4LLWB 2EXYD 4JPKL 4PP1C 1XHHA 2V3FA 3LS5L 1KENL 1FCCA 4AUUA 4QXGH 1NSNH 3BKYL 3B43A 4N0YL 1AD0B 5J6GB 3QUKA 3D4GA 2Y36L 4YMPA 4Y7MA 5KW9L 3FW6A 3RZCA 3L3HA 4LO9A 2MHAA 1ZHNB 2ZF9A 4N90E 4GG6F 3L5XL 1N59A 3WIHA 1JPGA 4YBQC 3GTVA 1T1WA 4DESA 5DSCB 4J12A 4QXTB 2F6AA 4HKXB 3MV7A 1S7WA 5H94A 1NCWH 1AZBA 5I1IL 3SPVA 2A73A 3EJJX 3M7OA 2Z91A 3MRGB 1FO0L 5J56B 3O11B 4WIQA 5BQ7A 5C0NC 3IJ8A 4IKLA 2EECA 1R47A 1LK2B 4Y2DD 1NCTA 3LEVH 4W9ZA 4HJJL 5EV7A 3WFCL 1FUNA 2PXYB 2FQFA 2VQTA 4GKOA 4EI6B 4JGJA 5K93A 1TEGA 2DL2A 2CUIA 3MFFA 4JHAL 5L0QB 5TD4A 2YKLL 3ZTCC 1EGJH 3G6DL 3UPRA 4KHXL 4G1EB 4Z9KB 4B9GA 3IXAA 4KO6A 1QSEA 2A4EA 2ZWNA 2WCPA 4LOFA 2MQCA 4JCMA 2WUBH 1IZJA 3G5XA 2WBJA 4RA3A 4RMQA 3IKCB 2OJEB 4OH2A 4UDUA 4XHQA 5IVXB 5EBLA 4FLHA 3U36A 4AGOA 2FNBA 2NT1A 3FUJA 1FVCA 2UZPA 3WO4C 3CIAA 4UT9A 4EVNA 5LXVA 4YXKL 3QO1A 3CC1A 4UV7H 4DPBX 1IM3B 2E9WA 3NSXA 4FCAA 5JA8B 1H3XA 1MFEH 3ZJAA 3MNDA 4MB1A 1TTCA 3T9WA 4M48H 5GZNC 4O4YL 1JI2A 1K4DB 3AU1B 5KTEH 5I5RA 1TCMA 5HYEA 2WVVA 2OMWA 3IMWA 3AREB 4LARH 4X6BB 4GYBA 1QG3A 1TZ8A 5L4IA 3TBTA 5DRWA 5BW7C 3LRKA 2D3VA 4Y1SA 5HYSB 1I1FA 3SYAA 1COBA 1FL5A 4Z76B 5GGVY 5A2BA 2WBKA 5C0CE 3RPIA 1TFHA 4J39A 5SX4H 3S36L 1YQVL 4HXAL 1A7QH 4F93B 5IR1A 3L4XA 4UV4L 2H2SC 4FZEL 5CFHA 5J6HA 3SZKC 2AF2A 3I3EA 1XCQB 4BA0A 4OLUL 2BZ7A 2FO4B 3V4VL 4GAJL 4H8VA 1UD5A 5DD5L 1DQQA 2AJ3B 2EUVA 3VVVA 5LCVL 1IIKA 3ABKB 5CMAA 2G60H 1UM6H 5DLMH 1S7WB 5H94B 1U3HC 2J8UE 1GJUA 2BRRH 3T04D 4EEEA 1DVUA 2ZSWA 2ZWKA 4F15C 3TM6A 3DO7A 1M71B 3TEWA 1JNJA 4JCWA 2NLJB 3OAZK 1B0IA 1FG2A