1W6LA

3d structure of cota incubated with cucl2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
503
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 503
sequence length 509
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA02
2AZUA 4BDVB 1PZAA 4A2EA 3FPYA 4DP4X 4YSUA 2X87A 2VMJA 3QJTB 1J9QA 2FT7A 1L9RA 3FYIB 5D4HA 3OD3A 1SJMA 1PNCA 1AS8A 2BZCA 3NYKA 4NB7A 2IWEA 4DPAX 2BWDA 2GI0A 3H4HA 3UADA 3QJRB 1NIEA 2GSMB 4N4YB 7PCYA 9PCYA 3FU7B 5TK4A 5D4JA 1J9TA 2BO0A 3NJHA 3EH4B 3CVDA 4E9TA 2XXGA 4F2EA 2YXWA 3X1GA 4WTQA 1BQ5A 1PMYA 1F56A 2QDWA 3TASA 3ERXA 1ZV2A 4W1TA 4KOCA 1RKRA 1X9RA 3CVCA 3FSAA 1KDIA 3AW5A 3T9WA 3GXUB 1NWOA 4QKTA 2VN3A 2QPDB 4YSPA 1IBZA 2YAHA 2VM4A 2I7SA 2H3XC 3NSCA 4YSSA 2HX9A 1NPNA 2IWFA 2FJSA 2CJ3A 4GXFA 2H5UA 3DKHA 1NINA 3X1BA 2PPAA 4YL4A 2AFNA 3OMNB 1MG2C 3KW8A 2XUWA 1KCBA 1ADWA 1E5YA 1M56B 2AZAA 1ET5A 2ZOOA 5I28A 5B3SB 2PP8A 2Q5BA 3JT2A 5I6OA 1NTDA 1OE3A 1OF0A 1GS7A 2YARA 5E9NA 5AZUA 2BP0A 2YAPA 1KV7A 2XU9A 3FQYA 2OV0A 1BYPA 1PZBA 1ETJA 2JFCA 3PAVA 2I85A 5I6MA 3ASNB 1ZIBA 4CSPA 3S8FB 3N55A 4HHGA 2P80D 1GS8A 5FC9A 5B1AB 1IC0A 4FAAB 1KGYE 2FT8A 1QLEB 4ZK8A 4GY4A 2HZHA 1AR1B 2BP8B 1GR7A 4KNSA 1AG6A 1AQ8A 1TEFA 4PAZA 1A3ZA 3IN2A 5PAZA 3S8GB 1PLCA 5I5JA 2BHFA 3QJQB 2N0MA 1A4BA 4HCIA 3C75A 2B08A 2Q9OA 4E9RA 4F2FA 2PCYA 2IDTA 2GC4C 2DYRB 3ABLB 4JHVA 1EZLA 2GHZA 1ILSA 3FPXA 2J56A 3NJMA 1AZBA 3UAAA 4RH4A 4A2GA 1A4CA 5I6KA 5AFAA 1WA0X 1V10A 3CVBA 3CDZB 1AZRA 3WKQA 3ABKB 1YLBB 2VW6A 2XV0A 2Y69B 2R7EA 4G72B 1JZFA 2B3IA 3SQRA 1E65A 3T71A 2IDQA 1E30A 5B1KA 1WA2X 3HEIB 2HLEB 2XWZA 1SFHA 2DWSA 1J5CA 1CYWA 3PXLA 3UABA 2HRGA 3WG7B 3X1FA 8PAZA 2GC7C 2BP0B 3V9EA 1NDTA 3NJGA 4AKPA 2QPEB 3NJLA 2LLNA 4HAKA 1TKWA 1W6LA 3TBCA 1ID2A 4KO5A 3S3CB 1KBVA 4YVUA 2GBAA 2IH9A 3ZDWA 1CUOA 2EIMB 3GYRA 2XXFA 5B1JA 2DV6A 3AG4B 1ASQA 3G5WA 1HAUA 2JXMA 1ZPUA 2XVBA 3EH5B 2DYSB 5I26A 1DZ0A 1NPJA 3CZUB 2XYBA 2OCCB 4DP2X 1RCYA 2X88A 2FQFA 3X1NA 4YSTA 2WSDA 2GB2A 1NWPA 1CC3A 3QJSB 5I5MA 2PPFA 3FQ1A 3NP4A 3GDCA 4KNUA 2CAKA 3FYEB 2J55A 1EHKB 1AS7A 1NIFA 4GYBA 4E9SA 1L9SA 3NJFA 4P5SA 3DTUB 1RZPA 3T6WA 4WKXA 1ILUA 4FA7B 1XMEB 4P5RA 3OMIB 3PCYA 3AG3B 4UF7C 3UGEA 2JKWA 3RYMA 1BEXA 6PCYA 2Y1AA 2YAEA 1L9PA 4GP5B 1SDDA 1W6WA 4KO7A 1AS6A 2GIMA 2E86A 4HCFA 1FA4A 5F7BA 2FQEA 3SBPA 1GY2A 4YSAA 3H4FA 4ENZA 1OCRB 2BW5A 2H47C 2UXFA 1CYXA 2QT6A 3TA4D 4M4RB 1NIBA 1N70A 4Q8BA 1J5DA 4CSZA 1OOWA 4A2HA 4NERA 4F7KA 2ZWNA 4HIPA 1IKOP 4BWUA 1A8ZA 1T5KA 2CALA 3AG1B 1GSKA 1TEGA 1AANA 4BXSV 3V9CA 4E9WA 1KYAA 4DP7X 1M57B 3WI9A 3S3DB 2HX8A 4BDVA 1J9RA 2UX6A 4AZUA 4EF3A 2VW4A 4BWTA 2EILB 3FQ2A 2IWKA 1SFDA 2DWTA 3T6XA 3H56A 3DIVA 3FU9A 3IBOA 3CG8A 2PPCA 4HALA 4AKOA 1AZUA 4G7QB 1ZDQA 4AKQA 2PP7A 1WS8A 1GY1A 4AX3A 4MFHA 1UATA 3WKPA 4BWWA 3FU7A 1AOZA 1MG3C 3OQRA 7PAZA 2PPDA 2PP9A 4DPBX 3PPSA 1BYOA 1SF3A 2HRHA 1JOIA 1GS6X 3NT0A 2FQDA 1JZGA 1N68A 1GW0A 1OCZB 1HFUA 1JZEA 1J9SA 5B1BB 4NAJA 2UXGA 4E9QA 4YSQA 2YAQA 4YSCA 1ZIAA 3NJKA 3NSYA 4HCGA 3FSWA 2TSBA 3WNIA 2NRDA 1PLBA 5ANHA 1FFTB 4E9XA 2I7OA 5I5IA 4DP0X 5PCYA 2CUAA 2QDVA 2XX0A 1AACA 1NIAA 3AG2B 3FS9A 3ABGA 1OCOB 2YQBA 3NSDA 1OE2A 1WA1X 3IN0A 3U25A 3OM3B 1JZHA 2YAOA 3AY2A 1L9OA 4KO6A 1A65A 3NP3A 3QPKA 3N2JA 4K9JA 5I6LA 3QQXA 4E9YA 4KOBA 1BAWA 2AVFA 4HHWA 1PY0A 4DP6X 1ZDSA 2FQGA 2A3TA 2VSKB 1RZQA 1SNRA 3EF4A 2CBPA 4BK5C 1JXGA 2XV2A 2YXVA 1L9TA 5TK2A 3BVDB 2UXVA 1V55B 2P80A 1ASPA 3EH3B 1WS7A 3QJUB 2IDUA 1BQKA 4DP1X 2W88A 1XB3A 2IAAC 1IUZA 3IE9A 3NJNA 5LDUA 2VSMB 1PZCA 4GP4B 2BP8A 1BXAA 3X1EA 3SBRA 1QHQA 2XLLA 1BXVA 2MTAA 1CURA 2PPEA 1MZYA 4A2DA 1GYCA 2R7EB 3HB3B 1WAEA 2BWIA 1FWXA 1NZRA 3EHBB 1SF5A 3D12B 3IEAA 4A66A 1KDJA 2CCWA 1AG0A 1AZCA 1E5ZA 4YVNA 2WO3B 2MRYA 2VM3A 1IBYA 3MBWB 1PF3A 2AANA 3CDZA 5EHFA 3UACA 1BXUA 1X9UA 4X4KA 2EIJB 3QJVB 2IDSA 1AIZA 1XB6A 1PNDA 3NJJA 4A2FA 1XB8A 3T6ZA 1ET7A 3BQVA 5IY5B 4YSOA 2UX7A 1NICA 1PCSA 1JXDA 1OE1A 1QNIA 3FSVA 5I6PA 1BQRA 3WIAA 4DP9X 3T6VA 1JERA 4G70B 2BW4A 1W8EA 3AZUA 1JVLA 2FNWA 2UXTA 4M3HA 2J57A 4UAHA 1ET8A 2HX7A 5B7EA 2XX1A 1SHWA 4YSRA 1DYZA 5AKRA 2W8CA 1E67A 4KNTA 1R1CA 3ZX1A 2J5WA 1PLAA 1TU2A 1V54B 5I6NA 3ASOB 4BXVA 5B7FA 1I53A 1SHXA 4E9VA 3NSFA 1JZIA 4YSEA 2OJ1A 1AZNA 2TSAA 2HXAA 2WO2B 4GP8B 3X2QB 3UAEA 4DP5X 5A7EA 4DP8X 4YSDA 2BZ7A 2VW7A 4QLWA 3OMAB 2EINB 2ZXWB 4G7SB 3TBBA 3FT0A 3JTBA 1URIA 1ASOA 1SDDB 5B7MA 3L45A 4N8UA 4W9ZA 1MDAA 3MX0B 4A67A 1M9WA 4Q89A 3FU8A 1B3IA 3PAZA 2FWLB 1MZZA 2YAFA 3ABMB 1OCCB 4KO9A 3ZIYA 2PLTA 2EIKB 1JXFA 4PCYA 5F7AA 1HAWA 1JVOA 2RACA 4JKNA 4JHUA 3PAUA 3WNJA 2XV3A 4UANA 3S3BB 4A68A 3ZBMA 2FTAA 5B1JC 4G71B 2PCFA 3FSZA 3NJIA 1AAJA 1KBWA 3SBQA 5D4IA 4L0PB 6PAZA 1JZJA 1OV8A 2IH8A 2IDFA 1L9QA 1NIDA 3TU6A 1VLXA 1KCWA 4G7RB 2YAMA 4AI7A 3PLYA 1PAZA 2DY2A 1A4AA 4HZ1A 2ZONA 4TXVB 3KW7A 2FT6A 4DPCX
chains in the Genus database with same CATH superfamily
2ZKHL 3REVB 5HVFB 4KK6D 3NEOA 1QTPA 3VRLF 2D3VA 4NXKA 3SDAB 3RZCA 2XJKA 3DXAD 2I9LB 2VMJA 3H55A 4K7PH 4OLYH 3VI4F 1KY6A 4IOSA 1KJVA 1E8YA 5JW4Q 5E51A 5IHZB 1HDMB 3NYKA 4P2RB 4AGPA 5KVEE 3H4HA 3NABL 4PRHE 3W81A 4OD3H 1DQIA 5TK4A 2W5PA 2E7CA 3DGCR 5DK0A 3TO2B 2E75C 5FKPA 4WUUA 3SKNB 4U1KA 3VXUD 2W07A 4J23A 1CDJA 4XRCA 5C0BE 1CFSA 4MA8L 1E4WH 1TPXB 3ZW3A 4LSTH 4B9CA 4MB4A 2BNQA 2FSEA 2I32A 1YZZA 4NKDB 4YHNA 3LRSB 3GSRA 5C6TL 1KDIA 4LCVA 3BAEL 3QZWB 3VWJC 1OGSA 4KTEH 4XHJD 5KSAB 3JWDL 4TTDD 4RX4D 4N5UA 4O02H 1GL4B 3VI4B 4EI5D 2EH8H 4X9IA 1JHKH 1YEWA 3NPZB 3KLHC 3MLYH 1DVSA 2YK1H 4PJXB 4HG4J 4NKIL 4F5CE 5FFLA 2O26U 3GLZA 3BUTA 4RGNC 4GKNA 2HJKB 1MG2C 1XFPA 2WVVA 4I77H 5H8DA 3LX9A 1TQBB 3VQ2C 3MOBL 1GZHC 3QNXB 1JGUH 1CFNB 3BQUB 2Q5BA 4S1RH 1B6UA 1PD1A 3F7YB 1DANT 1M6OA 2YAPA 5JOPD 3R1GH 3W0WB 3RVXC 4NRZB 3OHXA 4Q2ZA 1ZIBA 1X5IA 5EG6C 2XKUA 3GRGA 3ULAB 2V3DA 2A99A 3RL1A 1ZT7A 5I71B 3NPSB 4JDZB 3FUIA 3S48A 5F6IB 1AO7D 3OGOE 3BWZA 1FLRL 1U8HA 1ZOXA 1BZ9B 3RX7A 3QEQB 3BWAB 3KPPB 4ZAKA 3VXRA 5BVJB 2NYYC 1VZGA 2QV4A 4PTTB 1IFRA 1O6TA 4PJCF 4BFNA 2ICEA 1L6PA 5BJTA 2LU7A 1PLCA 2UWEF 5EZLA 3OQ3B 4KMTH 1KJ2B 1J1PL 5KSUA 1MI5A 3QNYB 4OR1A 4N90D 4A1RA 4DFHA 1LEIB 3H3PH 2WBXA 2VDPL 1ZHNA 5IHUL 2RA1A 4V1DA 3KHQA 5GGTL 5KBPA 2JK5A 4JPIA 3ZKQD 5GGSB 1NLBL 5GSRB 4QNPE 4UQBA 5I0WA 1WAAE 2IV9A 3CDZB 3HHSA 1J11A 2DKUA 3ARUA 5FYKL 5DRWB 3GEWB 2BVPA 4L4VE 1UM6H 1MUJA 5T3ZE 1KCRL 4KZEH 1P0SE 3QWQB 4ZRGA 3GGWA 3BZEB 4PJCB 4EXPX 4GSXA 1I1FA 1VFAB 1XGUB 3PV7A 1IM3D 1JGLH 3OAWA 4U1NA 4R9HA 3LZLA 2ZUUA 2WXRA 3V6OE 3WG7B 3X1FA 2AQQA 3O9WD 2ZXAA 5FO7B 2V5YA 3V9EA 3V6BR 1H3UA 3ILQD 4EQ2A 1TO4A 1ORQA 2PWGA 2NSQA 3BMWA 3ZE1B 2Y6SC 5IEKB 1D5ZA 2HLFC 5E2TL 5EDXA 4PV9A 3V5DB 1MFDH 3FTYA 4V2CB 5CZXC 2X4NB 4FQJH 4HXBL 4TQEL 4EN3B 4G1EA 5KAQG 1P4IH 5D5MB 4LK4A 4QOKB 2MQ0A 1FV1B 1CG9A 4JM2B 3RWEA 4UWQB 3OPUA 3ESVF 1U0QA 3EOBA 4E42A 3FT3B 2XVBA 5D1ZA 3ZT6A 5D1XD 2X41A 3W2DH 2B9BA 5KSVA 2BY1A 3RVVC 5BW7A 4XXCC 3TVMB 3QJSB 5AW5B 2PYED 32C2A 3ARGA 3UO1H 2AI0L 2GT9A 4HJIA 4ORGB 4U33A 4FNLH 3OF6D 2WGXA 3OAUL 4X80H 3HZYA 1FBIL 3CFUA 4EEEA 1KCLA 1F4YL 4UTAA 5FUOH 3ZRFC 4CVUA 5B39A 4IBYA 2K8QA 2VXUL 5IFJA 4AG4H 3P4OA 2Z8VC 4KUCD 4Y5VA 5I2IB 3ESMA 1OAZL 4Z7WF 4XBEH 4JREC 4PJ6A 3A21A 3S3JA 2GTZA 4LNRB 4MCZA 2AEPH 4F58H 1X5YA 1BREA 3PFQA 4JFDE 4H2AA 2FJUB 4NHCH 4ODTL 4P2AA 5HHOD 5AB0A 4X2UA 5CILH 4IRSD 4P07A 3VFUA 2XQBH 1OF2B 4FRWA 3VFGL 1JHLL 4KKLC 2BDNH 5EZIL 4AJWA 3K6DA 5BS0B 1ZWIA 3L4ZA 2G2RB 4M1CD 5EOTB 1Q9OA 1J5DA 1D6EA 1PG7W 4PU2A 2B0SL 3O6FC 2NDFA 3Q48A 2BOCA 1RJYA 1MEXH 3QDJD 5LNGA 5IMKA 4P9HH 4QRQB 5DZJA 5AAPA 2D31B 1QOKA 4P2QA 2WBKA 1HE8A 4AL8L 2XV6B 1M57B 3MXVH 3O0RL 1HOCA 4IS6A 4POYA 2XQYA 3QORA 4MS6A 2WKLA 2UX6A 3L6FB 1MWAA 4PI0A 1SFDA 1OLLA 3DX8A 4ESKA 5A2FA 5J12C 3F5WB 4LDLB 4Z0BL 4NKOB 4PJFE 1EPFA 2E7HA 2QVTA 4NI6A 2SODB 4G6AC 3K8LA 4KVNH 2R2HA 3IDJA 3NSJA 1D5MB 1SEQL 3UAFA 3GM0A 1BDYA 4UOW1 3RJDA 3P9LB 4KROD 2IAMB 1AYOA 3X11A 4EMZA 3ARDA 1DJIA 4MDIB 4J4PC 5FO2A 3NT0A 3DTXB 2O30A 2X6MA 4OM1H 4HK0B 3WNPA 1SXZA 5B1BB 2VZSA 2LAAA 4I89A 4BZ1A 1OZUA 4C4UA 4YSCA 3RZCC 2WQ8A 2IF7A 3DX6B 3NSYA 2MH4A 3ZHKA 3ETBF 4ALAC 2YXMA 2UV3A 4H25B 3PJSB 5HI3C 3MFFB 1YECH 1QEWA 2I7OA 5PCYA 3P73B 4W9HC 1VKXB 2QDVA 4I3RH 5E1GA 1R24A 1HHKA 3IU4H 3T0EA 3FCGA 3OAYK 3ZR6A 3NSDA 1T7XA 2G9HB 3BD4A 1MCEA 4TSCH 5DQDL 4M48H 3GXMA 2OZ4A 4JKKA 4Q9QH 4A2LA 1QYGL 2D3JA 2Q7NA 4FF9A 2A2QT 4LDEB 2VC2H 3KLDA 3N2JA 1B0IA 1PIFA 3APCA 5BMFL 5IJDC 4L48A 4WK2B 3B2MA 3ETTA 1J5HA 2DM4A 2R69A 4ZX6A 2NT0A 5E7FA 2XC8A 5ABDE 3SQOL 3UGUA 5EU3B 1A3LL 4IHBA 4DAGH 1ASPA 2VDRH 2Z8SA 5HHNB 1FORH 1DZBA 1LP9F 1KULA 1S6NA 3HR5B 4KK9C 1IKNA 4RQQB 3M6DA 4HJUA 1F6FB 12E8L 2YWYA 3IE9A 5E2UL 2F54A 5F7FA 3T2OA 1HJBC 4ODBD 1V7NL 1JRHI 3OR6B 3RGHA 5E8OB 4FERA 3DGGB 1LWJA 4M8QA 4XVUD 4D8PB 3EBIA 4LCWB 4FL4B 5DRZB 4XP6L 1ZMYA 4U0RC 4KMLB 4PD4J 3U0PB 2ZUVA 4OLUL 4W81A 1GYCA 1LILA 4LGRB 1HCVA 1XH0A 3OHXC 1BEYL 4H44C 2OSLA 2W9LA 2G9KA 1WV7T 3MREA 3D0VA 4OTXH 1E6JL 3EHBD 3GKWL 4XPHH 4ZFFB 1ONQA 1S9VB 1S8DB 2WM0A 3B83A 1OSPH 2IG2L 4O2CA 3SZ6A 4G9FA 1UQSB 2CCWA 4QHLB 4PRDA 3ATFA 3QRGH 4LIQE 4M02A 1LP9B 1ZSDA 4Z77A 3TN0C 4ZAKC 5GS0L 5C08A 3ZR5A 1CXKA 3VSQA 3CC1A 2V0AA 4KRLB 1N0LB 3BKJL 1PEZA 2ICEC 4M1GL 1XGQB 1F58H 2Z0UA 5C07B 4F7TA 4J39A 2GHWB 4N8VG 3DV6A 3ULUC 4OKVA 3WIIH 1Q94B 3ZMEA 4IBSA 4APQC 5IQOA 3QULB 1S7TA 3RIKA 3QHZL 2H1PH 1JAEA 2HKAA 3GHEL 3QO1B 1J0YA 1W8EA 1F6AB 4XAKE 3FH7A 5C09D 6FABL 1TZOA 4FQIH 3VXQB 1J7VR 4UAHA 1L5GB 4TLSA 3QCUH 3SD2A 2HX7A 5ALBL 3BDYL 2VAAA 3GIVA 1SHWA 2BIOA 4JY4B 2ZYIA 1QSFE 2MOQA 3GXIA 3NZ8A 4LLMB 4UNIA 4AYID 2FUTA 2VR6A 1BV8A 3GJFK 2XNAA 4QRUB 5DF0A 3IDYB 5TQ0H 5C71A 5C0CE 4Z7NF 3O3EA 4JDVB 1ZGLP 2V8MA 2ZTBA 5F89A 1N59A 3PIQB 1FUNA 2YBGA 5IIEA 2V7NA 4W9JC 5AVUB 5CMAA 1ZJAA 2ALWA 3NRQA 3QZNA 2OL3A 3EBGA 2XN9E 2AHIA 2H6UA 5MP6L 3PF2A 4BSWA 5IG7A 5IMMB 3BYTA 5SWSA 3NFSL 3FO0L 3BFOA 3GLEA 4OQTH 1E4KA 2YA0A 1JZ5A 2EINB 1UYWH 2KZ1B 2OCFD 5FA4A 3TBBA 2Y5QA 5D6DA 5FOBA 2KLRA 5C3TA 3X3GL 5EOQH 3L45A 2CGRL 2H0FA 2O5ZH 4W9ZA 4RGOL 4R7DB 3MX0B 4FABL 3WFHB 4DEWA 4DK6A 5B38A 4QXGL 1QSEB 4W4OA 5KYWB 2FWLB 2BP3A 2NLJA 1RD6A 1CICA 1HH6B 1JWSB 1SY6L 1JVOA 2F6AA 3GI8L 1IBGH 3JV4A 3PAUA 4ELKB 4AWJC 5E8PA 4I48B 1PZ5A 3GMOA 5IB5A 4XTRC 4PEEA 1AGCB 1O7VA 4O9HL 4J8RA 3CPUA 5D1ZC 4ZS7H 4BV1A 3GJEA 1A1MB 2VQ1A 3I50L 1UCBH 4POZD 1L9QA 4DKFH 3V7MA 3ZIMA 5BW7C 3AU0A 4YE4H 5BRQA 2BP5M 4XPGH 5IFAL 2NMSA 3WNOA 2C1PB 1D5IH 2OMTB 3REWB 2HFEA 1PFCA 2KYIA 2XTJC 4ANWA 4YSUA 1NKRA 3LKNA 4GEJA 3QG6A 3LZFH 4Q52A 4O51B 3GUFA 3I2CH 1QKZH 4Y5VC 2GJZA 2CPCA 2EDKA 5BXFA 2HLAA 2IO5A 2R0KL 2VR4A 4EPSA 5SWZA 2Q10A 4HFUH 2B59A 1FO0L 2QEJA 1DVFD 1ZLEA 2XFGB 4AQEB 3AXIA 3ULVH 4YLCA 3VXUB 5T33H 2DH2A 3VW3H 3C8DA 5HGAB 2C9PA 5DHYB 1MH5A 4PJ8A 1FG2B 1PMYA 3CFMA 1Y0LB 4K8RL 4P23A 5KVFE 4YX2L 3LQAH 2FO4B 4N2OA 4WVRA 5JHLH 5KVEL 3BWUC 5C0RL 1EGJL 1XF5A 5C8JB 1RZFH 2VLJB 5F96L 4J1UB 3FFDB 2H41A 4WI0A 1IGIH 4NQSB 3C5ZD 4EI5B 1J8HE 3DX3A 1OK8A 4CVZB 2CJ3A 1E28B 3VRJB 5GIRB 2XWXA 3KPMA 5SX5H 3JVGA 3RLSA 1S7SB 5IROD 4Y16A 5LBSA 5LWYL 1KBKA 3AU1A 1J8SA 4KVPA 5IQMA 4FLQA 4JG1L 5E8EA 1E4XH 1ET5A 5DJ6A 4K9EL 4OV5B 2HT3D 1BD2A 3KGRA 5JMRA 5DA0B 2OP4L 2YARA 2OJEB 1TVHA 3KM2A 3ZOAA 2VXQA 2GCYA 2XU9A 4LAQL 5CJQL 5KG9B 2V2WA 3IGUA 4WW1B 3PHSA 4MAUL 1PKOA 2OCJA 3CFTA 3NIFB 4ZUWA 5K9JL 3Q6FB 4N2HA 4Q6IB 1HHGA 1AO7B 5G4OA 2NR6A 4N2KA 4RAUB 3ARDC 4N2FA 1T03H 2QSCH 1LO5B 4NJ9H 4PY7A 5IK3A 3ROLA 4AQ1A 3DBSA 3BSHA 5C92A 4RFEB 2ZG1A 4QT5A 1DVQA 4WNQB 3QUXD 2GUYA 2ARJB 2VOTA 3GZOA 3PL6A 3QUMH 5LCVH 1AQ8A 2XQ0A 3V4PB 1YNLL 4LESA 2NY0C 1YPZB 2N0MA 2EXYC 1B90A 2F19L 3MRIB 3QQNA 2P5WA 4DKAA 5I8KH 4D0DB 3T0EC 1KXVA 5F88A 1YEFL 2LFEA 3BGMA 4ILDA 4JN1H 1QVOA 3TBSA 4HIJB 3O3DB 3OKYA 1JI1A 4YHZL 5AFAA 2R1XB 1F41A 2Z8WC 4LOVA 2LU4A 3GSXA 3CVBA 1TETL 1JVKA 4CU7A 4W9EC 4KZDL 4UQCA 1E9OB 3BP7A 3SSGA 5ICZA 2EXTA 3F6IA 2GJ6E 2RFXB 4YHKL 3TJEH 4GMSH 3ULVD 2NPLX 4GIAA 5CZRA 3X14A 3CD4A 4IMLB 3CHSA 5HY9B 2GAZB 1IM3B 3L3JB 2R15A 1MCPH 3BEVB 2FJFB 3ARBA 2Y36L 1PIGA 2J88L 2GC7C 3K6FA 3M1BA 1OO2A 4KPHL 2FWOB 4GSQA 2QPEB 1OAKL 5C7XH 3IGAA 4YHLL 2FBJL 1R6VA 2BWQA 5D7JA 4BUGA 3C6SB 1RK1A 1DQMH 1KCKA 1FZMB 9CGTA 1I1AA 4M7LH 3E3QE 1XHHA 3IU3B 4UAOB 3QI9A 3N43F 3L3GA 1EJ8A 2HMID 1VGKA 3GWJA 4DGIL 4MJJA 4WV1C 1M1SA 3V0FA 1AE6L 4LRNH 4NO3B 3O2DH 3HG0A 2ZCLH 3CZUB 1LMIA 4DK5A 1N5AB 2IQAA 2BM3A 5AWNH 3TIDB 4ZI8A 1NCGA 5ICYB 1OTUD 1GIGL 4UDTB 2UY7A 1WF5A 3MV8D 2VDQL 1M2VA 4KNUA 3GDCA 4LPCA 4PTUA 3D18B 4EXKA 2NY1D 1JN6B 5L6YH 1NIFA 1Q1PA 1LDSA 3LN5A 4GKOA 4P5SA 3CN1A 4G7YH 3WLBB 5DD1H 3UBFA 5DJCA 4HBCH 4HQQL 5EBLB 3IAQA 3BGFC 4OGZA 3L17A 4HKJA 4E68A 2G2NA 2WLIB 4XPAL 3BH8A 5D1QB 3QYMA 5TDOB 4LNVA 4AH2A 1P5VB 2Y1AA 5AZEL 3HN8A 1TZIA 3MNVA 3N43B 3NFPA 4OCWL 3DX9B 3E8VA 3HG1D 4NDMA 1FYTD 2B2XL 4ECNA 4H8WH 5JHDD 3MV01 2WKGA 4HWZB 3B2VL 2IJ0C 3UYPA 4DVBB 5HHOB 1PEWA 3S7GA 1UWYA 4YPGA 4IRSB 1QFWI 1DCLA 1Q72H 1ICTA 2UXFA 1QZNA 3VXMA 5C3LD 1IILE 1KB9J 1QNZL 1LEGA 2ADGA 3AFLA 4NBZB 4YLBA 4JHZA 4K2UH 5DD3H 5EUOE 5A3IC 1FNSL 4JFEA 1E9PB 2IWGA 2HT4C 3KD4A 1JZ2A 4M6MH 5JZ7C 1U42A 1T2JA 3FO1B 3B1UA 1IAII 1T1XB 4Y4HD 3QDJB 4K94H 1A8ZA 3GSVA 3N0AA 5AOKA 1E4KC 3BAXA 3FQUB 4QHPA 1URLA 2YJLA 1BBDL 2WXQA 3IF1A 5D6DC 2E47A 3VFSA 5DHVH 2BNRA 5E94A 3DA0A 3NBNA 3WNLA 1HZHL 1RXLA 4JLRA 5CN1A 3SO3B 2CNZA 5GGTA 5HDRA 1CICC 3V6ZA 4HW6A 4J2QA 2EILB 5C9KA 3SDDA 2UVEA 43CAA 3DUSB 4YZFE 1CGTA 3ZKNC 4H1LH 5IMOB 4LSRH 4FE9A 2F8VA 4HSQA 1P4BL 4IRZL 4IKLA 5F7NC 2J71A 2R1WB 4OCSL 4Z7AA 2A83A 1DANU 2WCSA 4KROB 2WZAA 1LDPL 1C8QA 4HJ1A 2HRHA 3UTSA 3Q2CA 3I02A 3WJMB 4JNXA 2APVA 1H8SA 3MO1B 1QRNA 4LP4A 3GK8H 2X53A 3MNZB 4NUJA 4AVKA 3CVIH 1QG3A 1UH2A 2H9GB 2J6WA 2FATH 4XBPA 5ANHA 1T6WA 5A43C 1XWVA 3DX2A 2WKOF 5I24A 2XX0A 4KVCH 3AG2B 1YNTA 3DPBB 3RDJA 1LGVA 4GSDH 4H7VA 3K5RA 5CZVL 4GBXA 4WFED 2CK2A 1BBJA 2AK4D 2FJHA 2ODHA 4OM0L 3U1SL 3CDFA 3RE0A 1IEAB 1TVBB 1DVXA 3V52H 3D9AH 5ACZB 4HAGA 3BPOB 4MAZA 2CJSA 4PJ8C 3P30L 1P7KA 1UB6B 3EJYD 2D2CC 5DLMH 4DP6X 1ZDSA 3FONA 3ZDZF 3AREA 3NIGE 5EF3A 1T1YB 1P53A 3PUCA 3S36L 4HJEA 3BN9C 2NXYC 4Q58C 5EO0B 1MHEA 1JF1A 1B0GA 1F97A 4PREA 2B77A 1ZTXE 4PJ5E 3IJYA 4I88A 3AT9A 5F7YC 3NCJH 5FHAH 4FYQA 3O8XD 4K3EH 1JUFA 4WJKB 2FX7H 4G8AC 1OQOA 4K5MA 3V0EA 4XB7A 3JVGC 4GQZA 1M71A 3VWKD 2RR3A 3DIFB 4YWGH 4Y16C 5GPRA 2V4LA 4TNVK 3MV9E 4JL2A 1RMFL 2WLLA 5EU5B 4P59L 4U4BA 5DLLA 1G7IA 1NANI 1G7JA 1FFOA 1UG9A 2MTAA 2KBGA 2ESVD 2ISDA 3O2VL 3G6JA 5C0NC 3QCTL 5EH1A 4OD1H 1EJFA 1U8CA 2K9FB 5DEGB 1O6SB 1A3RL 3ZDZB 1SUHA 3BMVA 3LV3B 2DL9A 3EHBB 4WHYH 3TGXA 5JW3L 3D12B 1UOVA 4XNMA 1RZJL 1MCKA 1CE1L 1F3RB 3P9WB 5I75B 4CVXB 1CGSL 1XR8A 5L8LB 5CCGE 2APBA 4NN5C 1WFMA 4NFDA 1V3MA 1RZIA 1ULVA 5KYYB 1G7PA 2J5LB 3FT2B 2EIJB 3HZKB 3B9KB 1JMXA 4JRYE 1XF3A 4G1MA 3PL6C 3RBGA 4JO1L 2VABB 1IGCH 4C55A 2MNJB 3PWLB 2CCLA 4G42A 4IGBB 2DBJA 1MCRA 1YY8A 1SM3H 1IU1A 3LB6C 3T09A 3ZRCC 1IFHH 3V95A 1KXVC 1QO3B 5C09B 4E41E 2X1PA 2H2PD 1HQ4A 2DLIA 3FUKA 1VCBC 2J57A 15C8H 4FXLA 1C8PA 4NUGL 1XF1A 3MKKA 1F1AA 4FNSA 4OI8A 2BHYA 3K72B 5DQ9A 3RWJA 1HCFX 4OLZH 4QRTA 1UD2A 3VE0B 3NCMA 2GY5A 5LXVA 4NO2B 2JIXA 3D85D 3L2MA 1WZMA 3GHBH 4YBQD 3ZGIA 1TTAA 3PDOA 4ZMNA 2ADIB 5EU6E 3ZDXE 3UH8A 1JPGB 3NSFA 1L3WA 1H5BA 2VC2B 1AJ7H 2IANA 1EZVY 5DO8A 5E5RB 3CQFA 3FFOA 5AAWA 1C1EH 3MROB 2AEOA 3LH2L 3QE5A 1A9EA 1FH5L 3D2UD 3ARBC 2QQNH 3DDFA 4WFFE 2FH6A 3FTXA 4N9GB 3FTGB 3FUFA 1ZTMA 4G59C 5I9QC 1URIA 1CB4A 3QUZA 2AEWA 3ECBB 2VDRB 2DMKA 3WE1A 1M9WA 2WV3A 5D7JC 4WEMB 3HS0B 1XF4A 2IQ9H 2QFPA 3WKNA 4JRFA 3TYFA 2VWEE 5I1HH 1I1AC 1EHXA 2E6QA 1HS6A 3CLFH 2F7OA 1T4KA 1H8LA 5DWUH 3T4AA 3BSZH 3NESA 5KVDH 2OW7A 3II3A 1KTCA 5IB1A 5TE4L 4D0CB 2BH0A 3WS3A 5DS8A 1I9RL 2FGWL 3N44F 5BRZE 4WW2B 3VXOA 1QQDA 2IH8A 1P5UC 1VADB 5I82A 3SODB 4GS7B 5F9WC 3VWJD 1GYVA 3ZSTA 2Y06L 4GG6F 5GS3A 3PLYA 1QFOA 4ISVA 1AXSB 5FLUA 4MNQA 3H42H 1BM3L 3NOIA 1E5AA 4HZ1A 4KU1A 4MB3A 4KTGA 4TXVB 3VD3A 3LKOA 3KW7A 3SJVD 1Z9SB 4XC1L 1ID5I 1MJJB 3B2DC 3P3TA 4F57L 1A6TB 4FNTA 4UMGA 4XMWA 2GKIA 4I2XE 4Z7OF 5IJCC 5DFWH 4LBEB 5I19L 2VISA 5I1GL 1FFNB 2MPAH 1AIFA 4R90L 2XKNB 5B4MD 4HD9A 3VFWB 4M8VA 4W9GC 3VMOA 4F8PA 2IADB 4X0KA 5KANI 4UZGA 3S0PA 4LF3B 4Z78A 3ENEA 3H9SA 3RVXD 4DPAX 4L8CA 1CT8A 1I4FB 2PW1B 1N26A 4F9PC 2X7LA 3NJHA 1DLFL 1KC5L 3E6FB 5ESAB 1NCCL 4LCCA 3HB3D 1HXMA 5MEND 2QDWA 2YUXA 2NYYD 3AAZA 1J8KA 1DUYB 3EFFB 1QSVA 3V0GA 1BIHA 2VUYA 2FEDD 3UBGA 5K69A 4Z7OB 2IV8A 2L3BA 2RTTA 3VD9A 1QEXA 4BFJA 4OUUA 5BZDA 5I17B 1P1ZA 1U8IB 1Z5LA 5JXAL 3MJ7A 4HMEA 4I87A 3C5ZB 1S7RA 3TBVB 2XJLA 5ERWA 2R0LH 4MQ7B 4QJ5B 1GGBL 4HP5A 4QRSA 1C08A 1U8KB 4YN3A 4RWYH 2YQ3A 4GO8A 2NCEA 3AS2A 3P3SA 1KPVA 2WD0A 2XPZA 4FXKB 5KVFL 4PJHA 3TYGL 4X98A 1VESA 4GW5A 4M62H 1XIWB 2JI3A 3SDDC 4WUKL 3QJOA 2F9BT 4ZNEE 2WANA 2QHRH 1MY5A 4Z95L 1Z3GL 5FDYA 3T3PE 4B7IA 4FTVA 1NGZB 4IDJH 2LW3A 3CFKA 4AIZA 3BT0A 4MSWA 4NX0A 1JK9A 1RIUL 1TQCC 1T7ZA 1L3NA 3LQZA 3GNML 4KY1H 3U7YL 2FT8A 4F8LA 5IEHB 2HVKA 4LVHB 5D8JH 5F9OL 4C56E 1RJZA 4NQVA 1QLEB 4OJYA 1JNHA 3T77A 1SMOA 2J8UA 3GXNA 4QXTB 4TUKH 4DTGL 4P3DA 4P2CG 3ULVF 1BLIA 4NCC2 3QUXB 1UA7A 3MUHL 1T1WB 3KVQA 3S4SB 3CX5J 3VA2C 4QKXB 1NC4A 1SY6A 4GXUM 2X1OA 3ZN6A 4CNIA 4M5SA 2WB7A 4PGEB 3WFEH 1ZLUK 4HLJA 3QT2A 3NGBB 4FHKA 4BKLB 2IGFH 3KLSA 3KYKL 3MRKA 5CZXD 1J0IA 1JGEA 3L8QA 4GAJH 4XP4L 3KPSD 4U4IA 1TJHH 2P7TB 4OJFL 4L18A 4N2LA 4F7PB 3VQLA 1TCRB 5BV7C 3VG9B 2FZ3A 1LVEA 3BO8B 3LZRA 4XNUL 5EF1A 1R3HA 2Z7WA 1WG3A 5CCKL 3RVVD 4ALAH 2NDGA 4QHMB 5EIIA 2KL6A 2H45A 4G72B 1Q9KA 2Z34A 4Y19E 5AYTA 3B9EA 4OFPA 5JTWA 1INEL 1WA2X 3VAEA 4PV1C 4X4YA 1LE9B 1QWNA 3WEXB 2WQAA 2Y7NA 4JRXD 3MFGB 3SGJA 2HVJB 1KENH 4HUUA 1HKLH 2GBUA 5FGCE 3PXLA 2XFXB 3N3EA 2DB8A 3HNTH 5AW9B 3BVVA 2Q8BL 4RZCB 4KQ0A 3MRHB 3SDXB 2OR8A 4OZIE 5C1MB 1KWGA 1S7UA 3QJZA 4M9PA 4QGYA 4BK4A 1JZ3A 4JB9H 1FO0A 1K8IA 3BKCL 4XO4A 3MA9L 2UY6A 4HF5H 1WISA 1BECA 2R0WL 2AQ2A 3IJHB 4WEUD 1PCXA 4H88H 1B2WH 2ZOKB 1W6LA 1XCWA 1UB5B 1UURA 4XC3L 5F7EH 5T1LA 4YVUA 4KKLD 1FVDB 4H0GA 2Y3AA 3Q13A 3GYRA 1MIEL 1OP4A 2DV6A 1G9NC 1CZ8H 5MERA 3B9AA 1NAKH 4QY8B 5D7LD 2GEQA 4XH2B 5EA0L 1JZ7A 1V7ML 3BT2L 1JDAA 1NPJA 3UZQA 5CM1A 3PNRB 2EP6A 4MQXD 3HE6B 4OZHB 2YC1B 2CIKB 4ZX5A 3DO7B 2KLTA 1BJMA 4XPBH 4APXB 4A7QA 2B4CL 1KB5L 2IPUK 2X4RA 3PPEA 3MV8B 4BK5A 5HYSG 4UQ2B 2NY1B 3H2PA 2G2PA 1QFUL 5IVZB 4FJ6A 5JXEA 1TNMA 4N0FB 4XBGB 4JCMA 4W9LC 3CXHJ 3FRPG 3FFCE 4ZFOB 3JTTB 2ZUWA 4H40A 2N0KA 4WDIB 3MSPA 2A77H 5D6CB 4LASH 2PW2A 4UUJB 4PJBE 2NZ9C 1V3JA 2YAEA 4C47A 3CHPA 3QUMB 2W60A 1H3GA 2C9XA 3HG1B 1CK0H 4G6AD 2PCFB 1E5CA 5JHDB 1OANA 4R4BB 1ZV5A 4XMXA 4UV4H 2R56L 3BP4B 4JPSA 5BRPA 1WD9A 2NX5E 2AABL 3PWVB 1PSKH 4FG6C 3KPTA 1QR1B 5J0BA 2Z4TA 4XODA 1GGUA 1TOXA 4NRXB 3ULUH 4J4PD 2OX5A 1T2QL 4R7VA 4Y2OA 1H5BC 1B4LA 1IZKA 1R3KB 5DD0H 4XXWA 3PGCB 4JFQB 4A2HA 3D39E 2DD8L 3W39B 4WHCA 1G7MB 4RDBA 2A6KA 1TZAA 2B5IB 4Y4HB 3RZCD 3FB7A 3MMEA 4KI5F 5DEFB 1EQWA 4PFEA 3DYMA 1KGXA 4FQ1H 1NBVL 1E8ZA 4IOSD 5HI3D 1CTNA 5CUSL 1QBLL 2N7AA 3QUZC 4NBXB 4NZRH 3ZL4H 3RL2A 2Z91A 3IJSB 3C2SA 3QQDB 4MTMA 3RILA 4GIPD 3ZTJG 1KWKA 3WDHA 1H9VA 4OSUH 3D33A 4WUUD 2EDXA 1N64L 4RNRB 3DIVA 3T4AC 1WZKA 5MEQB 1DBMH 1U58A 4K71C 1IGJA 2A9AA 2EDJA 1E6OH 4HH9B 1F86A 1MFEL 2BNQD 2EXWD 4JVWA 4OJDH 4UOZA 4XNYL 5DGRA 3UJJL 5K39A 4LVEA 4WU7B 1WCBA 3ZXAC 1YA5A 3QPQC 4EUPA 4BYHA 1AOZA 4YXLL 4I9WD 2BC4A 3S37H 4DPBX 2NY6D 5I66B 3KNBB 4LB8A 4L4VA 1YEKL 3IETB 4P99A 2WP3T 1IQWL 2XSKA 4AYFA 1DQJA 1JZEA 3UGXA 5DMKB 1LO2L 5AW3B 3MRDA 3VX0A 2UXGA 2FHCA 1UVQA 2Z8RA 4QEGA 5GRYA 1J9CT 3H53A 2OMXB 4H26A 1X5GA 1BQHA 4N0UB 3HLAA 1JGDB 1OP3K 3O81A 4PW3A 3EDFA 1T7YA 5FWQA 4K3DH 4JS7A 3MLPA 2HWZH 3PG2A 2AK4B 3SE8L 1JMZA 1IC1A 5CLYA 4XOEA 4XO9A 5JIKA 1RSFA 4M9OA 3HNSH 1CL7H 5FXCH 4AE1A 5JLZB 3NP3A 5F1NB 5GS0C 2GK0A 2CLVB 4LCCC 4QRBA 4CN1A 4ZAKD 1BAWA 3VXRD 4UTAH 3SPIA 2F1AA 3IK2A 1RZQA 3PY9A 4R4NC 5D2NE 1IFGA 3FK3A 5FCUH 4PJ9A 4J6IA 5AVYB 3ULUD 5INCB 4RGMC 1PQZA 1N6VA 2UZIL 5A2KH 1USQA 3QARA 2X9YA 1DEDA 2DWEB 3O8XB 4FLHA 4Z0XB 3B7YA 3GO1H 5KS9E 5IVNA 1MI5D 3SKUD 4BIKA 3UTZA 1W0WA 2WWNA 3WOVA 5I0ZA 3BRDA 3BESR 1UWXH 1XTMA 1OM3H 3AXLB 2VN4A 5FWRA 3TT1H 1KCSH 2GUOB 1LXMA 4ZMWA 1ZTXL 5DHVB 1DBBL 5L8JB 2GSGB 2ESVB 3EXLA 1DVUA 4A6YL 1CFQA 2F18A 5B1CA 3QDGA 3WCYA 3VSVA 4JW3A 4L5FL 3KLAA 1T3FA 3FUJA 3CVHB 2A74A 1GZPA 1AVAA 2HSIA 2F58L 3ZKXC 1KOAA 3BVUA 4KKQA 3N42B 2HJFB 3BPNB 3LRKA 3CLWA 1OLZA 4H1LB 4M7ZC 1YUKB 3QNZA 1RULL 1FNFA 1MWAH 4H8VA 1LO3H 3FQTB 1XMWA 3MCKA 4MD5B 2PXYD 2DQIL 4PRAA 4AT6B 1R17A 2ZX9A 4L8DA 3K6OA 3DVNA 4TPRL 3UPCA 3WIFA 1TKWB 4AQOA 3MBXL 3BW9A 1NICA 4Z7VE 1JXDA 1KXTA 3VGDA 4JZJC 1EHAA 1OAYH 3TWCH 4DP9X 3SBWA 2X9WA 1LQSR 3FO9B 3LPPA 3RY4A 2OYKA 4A55A 2UXTA 2EKJA 4GO9A 4IRZA 5FF6A 5HDBE 2VLLB 1UT9A 5EC2A 1K85A 4WTXA 2JXMB 4X7TB 1OAXH 3B7TA 1DYZA 2AAVA 3KYMB 5HDWA 3Q8AA 2QR0B 4BZ1H 4AM0Q 5FEBA 1TU2A 1UJTA 3FB6A 1H3XA 4FXGA 1PD6A 1PL3A 3ARGD 4S11A 5E95B 4OGXH 2P8MA 2QPUA 4HS6B 3I9AA 1IEHA 3VJ6B 1O9ZA 1I8MA 2JV6A 3SGJC 5DJXB 1VEOA 1R9FA 3LVEA 2WZPA 2XTJD 3D2UB 2BZ7A 2OZ4H 2JMRA 4PM1A 1ZVSA 2FX9L 3IKCA 4Y1AE 5F9DC 5LQBH 3UC2A 3OMAB 5JR1L 2PCPA 5IVOA 4G7SB 2CCVA 3P4MB 2WTPA 2WBJA 3W9EA 3WDIA 1YUHB 2V9RA 2R69H 2LV4A 5SV4A 4DFIA 1AI1L 1CLZL 1WCQA 2GIXA 3WY4A 2MQCA 2PWEA 2PLTA 3K4AA 5KUMA 3UG3A 1GC1L 1M1XB 3T0AA 5CHNB 1T66C 1MNUL 2JELL 1O75A 1L0PA 4NKMB 4L1LA 4WFHE 4DZ8B 4OD2B 3V0IA 2NNAA 3LKRA 3BE1H 4G71B 3BP6A 4MA7H 4X6EA 2G4EA 1QBAA 2AJ3A 3RWDA 3S35L 1GAFL 4WI6A 5K5YA 2IBGA 1JV2A 1GJWA 2Q76B 2VDMH 2XWEA 3GBMH 5D4IA 6PAZA 1JZJA 1PZ3A 3W82A 3MRQA 3VWJB 3HPJB 4LSSL 4NZUH 4J3OG 5D72L 1NCBL 4G7RB 5E5LA 4AI7A 3EAKA 2WIIA 4Q6KA 4DZBA 1YN7A 1KIRB 4LSUH 5HHVH 5DC4B 3SJVB 3DOIA 4WU5A 4TM9A 5JXEC 2ITCA 2WAHA 1D2OA 3K7UA 3QORD 4HIXH 3GKZA 2OMYB 4KFMA 4RGNB 4BDVB 2Y7LA 4TNVF 5DQJB 4K9EC 4Z8FH 1WPCA 4OVVA 4FQXA 4HBQA 2K70A 4P9ML 3ARXA 2V33A 3T3ME 2FT7A 4FLOA 4M7LT 3VTAA 1OCWH 3WAKA 3IXTA 1PNCA 3QFJA 4JFOB 3QXWA 2R1YB 2RH0A 5DZNA 4PJGE 3ELAT 2GI0A 1BVKB 5E6IC 5T3XL 3OTTA 3MRCA 1MCWM 1J9TA 4N2MA 3BEWB 4ZUUA 3MGOB 1IL1A 1FPTL 4OFYA 2J7LA 2HTLD 3I3EA 3ARDD 3HPLA 4QYAA 3I6KA 4RMQA 4WNJA 5SX4H 4F2EA 1U92B 1W0VB 4XN5A 5J8OA 1HNGA 1DDHA 2R2EB 4XCNA 4XXWC 5IM7A 1XGYL 3G6DL 2CHNA 2UVFA 3KPLA 4BE5A 2EUZA 1AMYA 3ZL2A 3AW5A 1UOLA 1ZT1B 3GXUB 3UAJA 5D4QA 1S7QB 1YMME 2NY0D 1UH3A 3P3UA 4JZOB 4RBPH 4KX7A 3AT0A 1R5IB 4G6KL 2FJSA 3I9GL 4FA8A 3T0ED 3KVPA 1U4EA 3JWNC 4QTIL 3MRNA 4GSUA 4HUWB 4AGMA 5CZKA 2QELA 1XGPB 3V0JA 2ZOOA 1ZGLB 2OL3H 1GPOL 1J1OH 4Q9RH 1U3JA 3RU8H 1A14H 5SWQA 4PS8A 4GRWH 1A0QL 3FBKA 1PLGH 1S7VB 4PJAE 1EHLH 2FBRA 2DWDA 2J6EL 3MLVL 2HT2C 2ATPA 2XY2A 1TFHA 1NFDB 3ASNB 3EH1A 3QQ4B 4UDUB 3BPLC 3RFZA 4ZMOA 2ED9A 1QLFB 2ZXEB 4HJGA 3UBHA 5F0PB 3QR1A 1LL1A 1S46A 4GT0A 4ODXB 2MCMA 5F9JB 3G04A 2CK0H 1UXMA 1DBKL 2F54D 5IV2A 4PIRF 4DSYA 2EYSB 2XZCL 3GSOA 1YNKH 3BZ4A 1KN4L 5I1CL 4YL9A 3QH3A 4FI8A 4FQQB 3WUWB 1HINL 4B0MB 2VB5A 3TTSA 4FADA 2OFQA 4JFZH 1EAPB 2PCYA 4QXWA 2W94A 4LOEA 1ITBB 2CLRB 1Z2KA 2BIPA 2IH1A 4JFFE 4NC0B 3BAJA 3RWFA 1E4XI 3KPSB 2CA3A 3GEFA 3HC4L 3DC0A 3THML 1JYWA 3ZPDA 1H0DA 3OKLA 1U8NA 1XZ0A 5ABZA 4I0CC 4TRPH 2H32A 1MLBB 4YK4C 5GJTL 2ZNXA 4FQCH 5C08D 3WL9A 2R7EA 1MFAL 4Y7MA 2B3IA 3SQRA 1A22B 3D52A 1F3DJ 5B1KA 2ATKB 4PJ9C 1X7QA 1MRCL 4F80A 1WC7B 3IRPX 4JRXB 4MS8C 2MOVA 3MBWA 4HCRL 2E7MA 5KSBA 2EAEA 3BUIA 5TQ2L 3UTPE 4AXWB 5IB4B 1JNNH 4PY8J 5F7KC 3EOAB 3ZTNL 1AR1C 2QMJA 5F6HI 3LH8A 5JPNA 2XACC 3ATAA 4U1IA 5L2JB 1RUQH 3OKKA 4JPKH 4I7ZC 4YFLF 3PNWA 4X6CE 2VDLL 1UM4L 2CLZA 3I9PA 5E2WL 1FZKA 5IBTH 3STLA 3UBXB 4AQ8C 1IGML 3AM8C 3L3IB 3NEEA 4Q9CA 2IH9A 4N3UA 4KH2A 5MHSD 1CUOA 2A74C 5A3ID 4W9DC 5D7LB 2HT4D 1FCCA 3D1MC 3O6FB 3LAFA 4GSRA 5I26A 3IDMA 1WEJH 1QACA 1MRFH 4RSYA 5SWSD 4HWEH 1KZQA 4X4XB 3L81A 2OLDA 5HYIA 5ANME 3QQ9D 3GRWL 2Q2EB 5F8QC 5DSCA 2WOYA 5JYMA 3B7RL 1NBYB 4ZTPH 5GRJH 3Q7JA 1S9YA 5D7IB 2E5EA 3NJFA 3ETBJ 1CICD 3CNKA 1R3JA 2CDGB 3TCLB 1BP3B 4LLUB 3V7AG 4XN7A 1FL6B 1S7WA 5J12B 3DURB 3RTQA 3ZKND 5BVPL 4TOYL 2BSBA 1J5IA 1UD3A 1W6WA 4NNPH 1T20A 2E86A 4Z7QE 1ZXQA 3MRMA 5JA9A 4FG0A 1DSFL 2IBZY 2W9DH 1NCDL 3BX7C 2F2HA 3EZ8A 5J5EA 4D3CH 1F4WH 1DFBH 3KAAA 3BPCB 4LHUD 3BVWA 5E08H 4FXGC 2ENPA 4WWPA 4LQFH 5DI8A 1N70A 1FN4B 1BAFH 1K2DA 1IT9H 3VTTA 3L5XL 3RZCB 1WUNT 2I24N 5KOVC 4EDWL 3PGFL 4L23A 2JCCE 4CC0A 3PWNA 1KJVB 5LO7A 1WT5A 2UWEA 2WBJC 5CJ5A 2ZCKL 4N5EC 3BC9A 1BQLH 4FFVD 4MVBD 4F7MA 1BFOA 1MJ7L 4QRRE 1IB5A 2ZWSA 1CD9B 5SWZD 3MAWA 1DN0A 4OGYL 3DO3A 3DMMD 5HPMA 2ADJA 3BVNA 2LFGA 2ZKHH 3QO0A 5DK0B 3WY2A 5FKPB 4WUUB 5CCHE 4U1KB 3DI3B 3O11A 2W07B 1SXSA 4XRCB 4LSDA 1CFSB 1VPOL 4MX7A 4N8VA 4AW7A 1DLHB 4L37A 4P23D 4P2RE 1MQ8A 3O6ML 2BNQB 2FSEB 5K1VA 4P46C 4YHNB 3IAPA 3BN9D 3GSRB 3ARSA 2NXYD 5ALCL 3OR7A 1A6WL 3NABH 1N9PA 4O5LL 4J27A 3P3RA 5EORL 4PYGA 2AMUA 2B1AL 4F27A 5J11C 4MA8H 4JM0A 4GKNB 4Y16D 2ICES 5SX5K 4FQXC 4JKLA 4UQEA 2E9IA 2CXGA 1YEDA 2FB4L 3IFNL 4GAGL 5C6TH 4XPTL 3LIZL 3BAEH 4U0RB 1QFWM 4L29A 4OFIA 3JWDH 3UERA 1B0WA 5C0JA 1M6OB 5C0ND 1ZLSL 3EYQC 4CADA 3ABGA 3OHXB 1RZJC 4L9LA 4PJXE 4CUCA 4PHXA 4PVNA 4NKIH 1ZT7B 2JH2A 2NR6D 1IAIM 1JWMA 1U8HB 2E74C 3J07A 3MOBH 1KB5A 3QDMA 3DHJA 5EPMA 2YZ1A 4ZAKB 2WZ0A 2P5EB 1N4XL 3WENA 3HBQA 3MZTA 3EYOA 2ICEB 1P4LA 3PL6D 5E6UB 5HHMD 5BJTB 3A22A 2ED7A 5IT2L 1WFNA 1BG1A 1MOEA 3FQWA 5EZLB 3NQKA 3WTSA 4J6RL 3LD8C 2R27A 2EDEA 2P5WD 3JZYA 4ZO8A 3UPRA 1L0XA 3QEQE 1MI5B 3KLQA 2VQTA 1FLRH 3QIWA 4EKXA 4UQ3A 1U95A 5I8EB 2EC9T 3MUUA 4Z7WA 1ZHNB 4V1DB 3CCHA 2JK5B 4JPIB 5E03A 2WINA 3F84A 3LHPH 3MRJA 4FI6A 4BM7A 3HHSB 1KNOA 4AYBA 5DK2A 4XP9L 4RMBA 1MUJB 3MLWL 1J1PH 1WTLA 3HOGA 4YNYB 3FH8A 2JQMA 1GYUA 4U7KA 3WLWD 3GGWB 5EO9A 1H6EA 1S78C 1I1FB 1T4WA 3OAZK 1P6WA 2VDPH 2KI6A 4U1NB 4YVNA 3EADA 5E6SB 1IBYA 4XAWL 5IHUH 5GGTH 3V0AC 1E9QA 3ARBD 4PLJC 1NLBH 5HP5A 3ZE0B 1AIZA 2Q7YA 3ZO0A 1NCOA 5FYKH 2FYYB 1ORQB 3U9UA 4RCAA 1N18A 3C09C 1PZ2A 3T6ZA 5D7JD 4NENA 5ISZA 4PJCE 1D5ZB 2WXKA 2UX7A 4PV9B 2CSPA 1I1AD 4CU8A 3T6VA 3ILEA 4G1EB 3TONA 3QI9D 3VACA 1CG9B 3V5KA 5D2LF 4M93C 1X9LA 3GSNL 2XN0A 3EOBB 3ZE1E 3V7AE 5D1ZB 4RMVA 1T5WA 3EDKA 3IBEA 3NIDE 4KNTA 2VR8A 5KSVB 4B6ZA 1U8MA 3JV5A 3ZX1A 3L7FA 3QUYA 4FP8H 3OGCA 1BPVA 3A3YB 4FKEA 32C2B 2X2YA 3ARGB 2GT9B 5D5ME 4QOKE 4HXBH 2ICCA 2AJUL 3HZMA 3SKJL 5B7FA 1M4KA 1RUAL 1IEBA 5IHLB 1AMXA 3HVDA 3HZYB 5HI4C 1JGVL 5HHXL 1E7VA 5AKTA 2XTJB 1UKSA 3QJHA 4XMUA 5B39B 3KDPB 3ZUNC 1MCLA 5IFJB 2VZUA 1CXHA 3PAYA 3P4OB 4Y5VB 1DJZA 5JORA 5JPNC 1WBXA 2GTZB 3LEXB 4MCZB 3Q6GH 4UM9B 2AI0H 3QDHA 3N50A 3LCYA 5CD3A 1KF9B 1BQUA 5HHPA 3OAUH 1BA9A 2W0KA 5AYUL 1FBIH 3VFUB 2WUCL 2FECL 3PYCA 3VXMD 1F4YH 4UINL 1C16A 4B9GA 2VXUH 5CGBA 3LS4L 1ZWIB 4Z3TA 3MACL 1Q9OB 1D6EB 4JFED 4WTZG 3Q1SL 1QI4A 4HT1H 1OAZH 5ITFB 1C5CL 2BOCB 1RJYB 2DQCL 4HC1L 1B9KA 4WEEA 4HJJL 4WI5A 3R06A 1GTFA 5I76A 5IMKB 4ODTH 4PLKD 4P2QB 1RVFL 1KMGA 3S3SA 2CHZA 3VSTA 1OT1A 2BNRD 3WGUB 5BS0E 2J25A 3ZUCA 3S5YA 1JHLH 1HOCB 3MHZA 4IS6B 1X5LA 5EZIH 5JHAA 2BY2A 3QORB 4ZFQA 4B27A 1MWAB 1YMHA 3RGVA 4IDLA 1EAOA 3CK0L 3TH3T 4FGMA 2B0SH 3K8MA 3DX8B 3QWRA 2ZKWA 2HP4A 5FYKD 1G9NH 4A6YA 1KEGL 3FYIB 3RTQC 4NCDA 4F37K 4IBTA 2R9HC 1RH8A 3B1TA 4U6HA 4G80B 1K5WA 4IBVA 2IWEA 4NQDB 5IMLA 3OLDA 2R2HB 3MV9A 3IDJB 2NT1A 3MLXL 4AL8H 3O0RH 1EERB 1IZJA 2PF6A 2GW5A 3BUDA 1V05A 5I1IL 4JO3L 3X11B 4TVSa 3ARDB 1CVRA 4M8UA 3UTSD 5M94B 4ZXBA 1TJIL 1YO4A 4Z0BH 4YLQT 3KPNA 1QRND 4B9IA 4Q6YA 3WO3B 2V9UA 2VDOL 1NGQL 3AY4A 4HEPA 5HJ3A 3WHE0 3EG9B 5JYLA 5FW7A 5H2BA 4WCYH 1QEWB 1SEQH 4L05A 2H3NA 2O72A 2Y7MA 1WT5C 2NY0B 2CZNA 4IRJA 4L3AA 5J6GA 3KS0J 1RL1A 1R24B 4FHJA 1HHKB 4TLKA 3HW7A 3T0EB 4BSJA 3QUGA 2X89D 1NDMA 4GBXD 1S5HA 4BQ8A 2BCMA 4PG2C 4RMRA 3VDAA 2FD6L 2IOIA 3KWWA 2PP8A 4N0YL 4OF8A 5IQ9A 3VDCA 1BZDA 3WJLA 5D7KD 4M6NL 2X5PA 1R3LA 3ARED 5FA3A 3TX4A 1T0NA 3FW6A 1GXEA 3CZFA 4DEPB 3OVUB 3JVFC 5DQDH 5E00A 2VMEA 5B1AB 2R8SL 4MDRA 1QYGH 1F42A 1E3FA 5BMFH 1JNLH 3L1FA 2F54B 3LRGA 1NAMB 1J87A 4NQCA 1MVYA 5C3IA 1CDHA 3HBGA 5AVWB 3SQOH 2B14A 1E8WA 4M8QB 4KX8A 2H8PA 1A3LH 4HXAL 3UBXI 3NAAH 2UUDH 2O5XL 3DXAA 2IPUG 2JJVA 3TXAA 3F64A 1LMKA 2OSLB 5E2UH 3WIFB 3MREB 1IARB 3D0VB 3DETC 4JHVA 1KXQE 1ONQB 2GHZA 5F44A 4O2CB 4G9FB 2Y07L 3ZTEA 1MREL 3APNA 4JQVA 2B7DT 4PRDB 1V7NH 5DZVA 3T8XA 4LCWE 4Z77B 1E5BA 1CGXA 2D4DA 4DQOL 3CHOA 5C08B 2ZIDA 4X5LA 4H13C 4OLUH 1X5XA 5L4IA 3M17A 1HSBB 5BRZA 4TTGA 1BEYH 4F7TB 2HLEB 4YFLI 3DV6B 4X6DA 1E6JH 3GKWH 1BWMA 4OKVB 3WJJA 1A8JH 4HOMA 4GW4A 2IG2H 1UZ6E 1S7TB 2QJDA 3BGFB 4XCCL 2CDFB 1LP9E 2D3LA 2C9QA 3CSPA 3MXWH 1Z32X 5GS0H 1RERA 1NMAL 3IFLL 1KN2L 2YN5A 5AOJA 5KYXB 4I0PA 1EXUA 2VAAB 2IBZX 3D2TA 3GIVB 2NUTA 3SGKA 3BKJH 3NZ8B 4M1GH 5C07E 1MXDA 4G8GA 1M53A 4U7MA 5AB2A 2JIXD 2XNAB 1ID2A 3QA3A 3GBLA 5IP4A 3O3EB 4KITB 1U21A 4N6RA 4TULL 5MEOB 3QHZH 5F89B 1N59B 3FBQA 1WUZA 3GHEH 4CC1A 2V7NB 5IIEB 5CMAB 4YC2C 5D55A 4ZQTA 6FABH 3ESOA 1YJDL 3AG4B 4A39A 1GGYA 5JHBA 1HN1A 3LNGA 2IAND 1SN2A 2VR3A 1ZPUA 4BSWB 4GRWB 3MNWA 5IG7B 5EEVA 2ED8A 5ALBH 3BDYH 5SWSB 3IDGB 2SEBA 3X1NA 3AXHA 5FA4B 3EO1A 4OGAD 3R7QA 3ZZ1A 2AJYL 3KVDD 4HU2A 5FOBB 2YRPA 1NWPA 2C4FT 5I0YA 3QUZD 5B38B 1AHWA 1JTPA 2E46A 2AKRA 4LU5L 1SLVA 1MCQA 2LT9A 2NLJB 3IMBA 1CICB 4O2EA 3T6WA 3T8VA 4X5XA 3H9ZA 5FOJA 3JV4B 5MP6H 3WXWL 2Q3XA 2VDNL 4WI7A 1T7WA 4D7BA 3NFSH 3FO0H 3RYMA 3LTVA 1AZZC 3T4YA 2R51A 3CGTA 1PZ5B 3DX7A 3GMOB 5IB5B 4X5QA 3NG5A 4AYDC 3X3GH 4J8RB 2A1WL 5BZWA 3AWFA 2CGRH 3GJEB 1QSEE 2DWXA 2VQ1B 4HCFA 4RGOH 2AERT 4FABH 1Z1WA 2VTFA 4OFKA 3QPQD 4QXGH 5CEZE 2X2HA 4JFUA 3R0NA 1A6UL 4GEIA 4YDVA 3WSQL 2XZZA 2QT6A 1SY6H 1ZANL 3O3BA 4FCAA 4AUJA 1OKEA 2ADFL 3II1A 1VAHA 3D50A 2XHNA 3A47A 1P9MA 4ZW5A 5A40E 4O9HH 3LKNB 5FYJU 3QG6B 1HZLA 1Y7VA 4RMTA 3I50H 4OIFA 1Z6JT 3SPVA 1EMTL 1TEGA 4LPXA 3TIEA 2GJZB 1Q0XL 3D69A 5BXFB 2HLAB 1N3NA 4HA1A 4LVNC 3H9SD 3E1ZA 5SWZB 5IFAH 1Z9NA 2IH3B 3LN4A 1TTRA 3S3DB 2B59B 2JLLA 3KDMA 3FU3A 3L3DA 4HGMA 4UTCA 4O02A 1AC6A 2OS7A 5ID1A 1G9ML 2Z93A 4FA6A 5GS0D 5FYJL 1X3DA 4AMXA 4WO4D 4JJ5A 1HNFA 4G7QB 1DN2A 1MH5B 4PJ8B 5EBWA 1EANA 3CFQA 5J13C 2WGNB 1JV5A 1YC7A 2PMZA 4L8BA 4P23B 4WHTA 3B34A 3DROA 4R4ND 5JQIB 1X7SA 1XF5B 2R0KH 4S1DC 4YO0A 2NXYB 5J89A 3WAJA 5J1TC 2J1WA 2LVCA 2P5PA 2HRLA 1FO0H 4HCRA 4WI0B 5D1XA 1MCJA 3VXUE 3CPLA 4P2OA 2F8XC 4Y4FA 1YHPA 5I1DA 1OY3B 5F3FA 3KPMB 1F18A 1YAZA 5CBAA 4GXUN 1NL0L 4Y16B 3RGVC 4U6TA 3AU1B 1ZIAA 2VLJE 3NJKA 4AEFA 4YX2H 5C0RH 3QZBA 5DJ6B 5F96H 3COOA 4UQDA 5ADPL 1BD2B 1TVHB 1KGIA 1KT2A 1IMHC 4FLRA 2PWDA 2GCYB 3PXHA 3IWVA 4FTVD 3BZFA 5EU7E 2V2WB 1G94A 1U93A 4OLEA 4ZUWB 4MAYC 1PX8A 2OSYA 2G3NA 3Q9QA 1HHGB 5AVZB 1A7PL 4NM4L 2FK9A 2L0DA 4AQAA 4K9JA 3VFNA 5LWYH 4NN5B 4ZXBC 4JG1H 3EFOA 1AGEA 3EGXB 4BA0A 3GRWA 3P2BA 4PY7B 4K9EH 4N2AA 4TL4A 5IK3B 3ROLB 2K4WA 2CRZA 4KJQD 5JOPE 2OP4H 4QT5B 5ESVA 2YXVA 3WFZA 3AY4C 3PL6B 4LAQH 3OMZA 3BVXA 5CJQH 3NIFE 5CINL 1NC4D 3GPSA 2N1KA 1SBSL 4MAUH 4HEME 4IRJC 2UZXA 2YKKA 3NA4A 1AO7E 1INQA 5K9JH 2AV1A 4FFYA 5HHQA 2R39A 3KE0A 4AJYV 1DE4A 1RZ8A 2P5WB 4XX5A 3RHWK 3GT6A 5LDUA 1DSYA 2Q20A 5F88B 5GSVA 4NFCA 3TA3A 1ODUA 1BFTA 1VFBA 3BGMB 3TBSB 1QVOB 2BP8A 3WEAA 5D1ZI 1LD9B 1SXAA 1ECZA 3FFCA 3K81A 5LLIC 3LKPB 4PBWD 3GSXB 2OI9C 5G4MA 3WV0A 3QFGA 2BFGA 1YNLH 1YPZE 3WJLC 3BP7B 4ABVA 5ICZB 2F19H 1CL7I 1FI8C 3SD5A 3ZYZA 3X14B 5IHWA 1YEFH 3E2HC 3FUHA 2NX5A 1E90A 2OYPA 1ZVHA 3JWNH 8CGTA 4KDVA 4G6ML 2FHFA 3C60A 4YHZH 3FCUB 3ARBB 3H3BC 4YDMA 3M1BB 1KJ2L 3VFRA 5HVWA 1TETH 2LAGB 2VXSL 1UXWB 4LKXA 4KZDH 5I9QB 4H4NA 3IGAB 1ET7A 4YHKH 5D7JB 1GC1C 1RK1B 1ACCA 2DJUA 4LKCA 1A6PA 2XA8L 3MGTA 4JCWA 3NSXA 3NRPA 2V7HA 1I1AB 2OTUA 1DQQA 1PFOA 2EE6A 4EUPH 1BF2A 1F4XL 1T66D 2BW4A 2F7IA 4NUMA 1HHHA 5T1LD 2D7QA 1JVLA 3L3GB 3ZTDC 2Y36H 1VGKB 1AH1A 2J88H 4NHUA 1VB9A 3CZEA 4KPHH 4PRIA 1CI5A 5A6MA 5JDJA 1OAKH 3BLKA 4D9LL 4HISA 4YHLH 1MCOL 2BIIA 2BNUA 2IQAB 5F9WB 4FMFA 5E1AA 4C4KO 3VFMA 3ASOB 2AJXL 2D7NA 2MCPL 2UY7B 2CBOA 4KC3B 4XZUA 3HJ0A 5HJDA 4AGOA 4PTUB 5JXED 3KLLA 4KNQA 1MVUA 3LN5B 2IFFL 2OJ1A 3QK0A 4TNGA 2X4UA 4DGIH 3WJJC 5DJCB 4BHUA 3QHTC 1AE6H 3KCWA 4HKJB 4KXBA 4XHJC 3LIZA 3BH8B 4TTDC 4AH2B 3HUJA 2GBTA 4Z3HA 4YHYB 2PABA 1TZIB 2F08A 2WKOA 3MNVB 1ASOA 4JQXA 4NDMB 2E7LC 1A1OA 3SGKC 4F8NA 2ENJA 2VMDA 3E7JA 5DVKA 4P5MA 2OM5A 2VDQH 1I8LA 2UZPA 4YPGB 3DPDA 3QR2A 3HCVB 2MCG1 4HQQH 5D1QE 5CEYA 3OKMA 2ADGB 1LEGB 2D73A 4A68A 4XPAH 1NCJA 2FTAA 3EZJB 4DGWC 4WIQA 3FCTA 4B5ZA 5AZEH 2J8OA 1RUMH 2A0LD 4OCWH 4B5EA 5KN5A 2B2XH 5FV2A 2DDQL 1OV8A 5HHOE 3TP4A 3V55A 3ARFA 3B2VH 1VLXA 2OR9L 4ZUSB 3IF1B 3RI5K 3VFSB 4LVOB 1G1KA 3WD5L 1EUUA 1OIOA 1ZLWH 2BNRB 2ZONA 3PHAA 5E94B 1XQ4A 2Q2LA 4NJAL 1LK2A 1QNZH 4JLRB 3WFDL 3ECWA 1PZAA 3V6ZB 1UC6A 1FNSH 3FQNA 5C0EA 1ZK5A 3SDDB 3QDJE 4MA1B 1S9KC 5KS9A 2JB6A 4K5NA 1BSIA 4HD5A 4TNWK 1YNTF 1BBDH 4QWWC 2HT2D 4OZ4A 1X4ZA 3D09A 3U30C 4YS4A 3EO9L 5T5FL 3QJRB 4CL7A 1HZHH 2FYVA 3GINA 3CH1A 1TQCB 4HUXA 2EEDA 4JY6A 2A9NL 3UTSB 1IC7L 1YYCA 4L4VD 2XZAL 1M2OA 4QO1A 2AC0A 1P6FA 5CAYB 3BKYL 3HKZA 3I02B 4L1TA 4U1LA 3ERXA 4NUJB 1ZV2A 5C0GA 1P4BH 4OJAA 4JZNA 4IRZH 3OZKA 4PQXA 2DLFL 2X44D 1KLUA 2VN3A 1F11B 1ZA3A 2AJVL 1U8PA 1A6ZB 3L3OA 1JD9A 1KYUA 3O9WC 1ACYL 1LDPH 3EFDL 3MJ8A 3KWXA 1YNTB 3RDTA 3BUYA 2H1LM 1QWUA 3GSNA 3ILQC 4Z3JA 4GBXB 1MW0A 3TCTA 2ZP8A 2NW2A 1BBJB 1NMBL 2FJHB 2N1TE 3QEHA 4Q74A 1G4RA 3SGDH 2N3JA 5BV7B 5IR1A 5HYSA 4QGTA 3SEPA 5IB3B 3G6JF 3RIAK 1QFWL 1P7KB 1T80A 1TMCB 3FONB 3AREB 5JIPA 2LOEA 3WBDA 1IBFA 5F6HJ 1EDHA 5CZVH 4PJ9D 3CZKA 1JF1B 1B0GB 3FUEA 4HHGA 4PREB 2X2UA 2J43A 3IJYB 4MS8D 5D1XC 4U3SA 3U1SH 4B96A 1RZ7L 5E5UB 1B0RB 3ALXA 3U4EA 4P2OC 1A66A 1LWHA 1JUFB 4Y4FC 4Z5RB 1JPSL 3O6KL 3EYUL 5ESQA 1M71B 2C1OB 3WTXA 4MCNA 3P30H 4GI6A 3NCWA 4MLIA 3H2QA 3DNKA 1A25A 3MRLA 2WLLB 3FQXA 3S36H 1TEFA 1G7IB 1G7JB 3JV6A 1FFOB 2PYFA 4HCIA 2RQ8A 3EOYG 4XNQA 1NDGA 3G6JB 1NC2A 2XY1A 2IBBA 3QDGD 4YGVA 3RUGA 1U8CB 4PJ7B 4K73A 4KKRA 3TESA 1ILSA 4XNMB 4HC1A 4PMFA 1VFUA 1XR8B 1G0DA 4L0YA 1RMFH 1DVFA 1HL4A 4P59H 1G7PB 1T83A 2ZOUA 2XQYK 4GG6A 3RWIA 3QEGL 3O2VH 4HWNA 1XF3B 3P54A 3QCTH 4Y7OC 5DRNA 3FUNA 4G1MB 4JAMA 4PVMA 5DJYA 4QRPA 1A3RH 4DUXA 2WYTA 2YPVL 2EIBA 3OZ9L 4G42B 4PJDB 1RZJH 1CE1H 1PG7L 2AJSL 1MHHA 1J5CA 1YY8B 4JANA 1CGSH 1F0LA 3OG4B 4CW1A 2HH0L 1II4E 2E59A 3TJHC 1WYJA 4RIRA 3IPEA 1CLVA 1HQ4B 4FZEH 4HKBA 4M00A 4EQ3A 3CU1A 4ODUA 2ODIA 3E8UL 1SXCA 3UJTL 2QFRA 5HYJA 5DQ9B 5DGQA 4OQTA 3RWJB 4JO1H 3WKML 4QRTB 5TD4A 2JIXB 4HGKC 2P8PA 4Z23A 3MOAL 1K4DB 2GYSA 4HG4K 2Y1YA 5C09E 5E24E 4AVJA 1SOSA 1D7DA 3LIUA 1H5BB 2HKFL 5E1IA 2IANB 3MR9A 3A0OA 3TL5A 5KTEL 4NUGH 2WZPD 4IKIA 1A9EB 3L7EA 4KROC 2JJWA 2FGZA 1JF5A 2X88A 3RNKA 4R3SA 3OPZL 3HZVB 3DVGA 4XVTL 3QUZB 3ATEA 4V2BA 1H8NA 4XWOD 5C9JA 5E2VL 4XNAA 5KBNC 2EE9A 1XF4B 2DMBA 4BH7A 3TYFB 1FC2D 1RZPA 2VSCA 3LPOA 3UTQA 1T4KB 1L0YA 3UCRA 3T4AB 3A67H 3AG3B 3LH2H 4UF7C 5IVXF 1FH5H 4PCTA 1BEXA 4OQ1A 6PCYA 1ZT4A 4I3GA 4K71B 3WGVB 4DN3H 5IB1B 3WS3B 5DS8B 5DT1L 1VIWA 4BBWA 3OV6A 3ZT5A 4WI4A 2YGQA 3RA7L 1QI3A 3VXOB 3SCMA 4F9LC 1GCYA 4YSAA 5LVEA 4MLSA 4ISVB 5JNYA 4MNQB 1JCKA 3CV5A 3VGFA 4OCYH 1HIML 2CWRA 3LKOB 2Y4SA 3ULSA 4NNXA 4AIOA 3CXDL 3H7BA 4TQ8A 5D7EA 5TE4H 1I9RH 2FGWH 3JWOL 3N5AA 3K1KC 4AUUA 1O5PA 4FQXD 5CEZL 2VISB 5FECA 2DQDL 3L2LA 4JR9L 1BZ7A 5C0AE 1LO4L 3CFBA 3GFUA 3W56A 3APFA 4FDWA 2Z35A 2Y06H 4XNBA 1KYAA 3FCBA 4JQXC 4UZSA 3EYQD 3H9SB 4LEXL 1BWWA 5FYLE 1BM3H 4PJHF 3G3LA 1CT8B 4L8CB 1VA9A 4OLXL 4GIOA 5LHDA 5EDSA 1I8LC 2O4EA 4XC1H 1YRKA 3Q5TA 3VRIA 2ZP0T 4BWTA 1S3RA 2X7LB 1X6LA 1SRDA 3D4GA 2N56A 3U9PL 1T89A 4LCCB 5I19H 5I1GH 5KW9H 1HXMB 1ZDQA 2BHUA 2PP7A 4R90H 3O4LA 3AAZB 5DJ8A 3T04D 2AXGA 2XWRA 4MFHA 5EEXA 5AVXB 5BZDB 4OUUB 3UAJD 1JTOA 1P1ZB 1Z5LB 2IPKA 4RGMB 4W9KC 3MJ7B 1S7RB 1AXTL 2CJUL 5ERWB 1DLFH 3OXSA 4QRSB 1C08B 4M5ZL 2P42B 2J8UF 2ZOLA 1NCCH 3KXFA 3JV0A 4DO4A 4PJHB 4YFEA 4X98B 2WXNA 2XWJA 3IS1X 3ZZQA 2HKHL 4MXVF 4Z7OE 3KMDA 3P0GB 4F24A 2WYZA 5TTRA 1R4XA 3FJTA 3AWGA 3QXAB 2CO4A 4XAKD 5JXAH 4V11A 4PGJA 1G6RB 4HHAA 3F7VA 5FX3A 2DYPA 1GGBH 3KH4A 5DMYA 2VL5A 5DHEA 2DQFA 3CFKB 4KKBC 4AIZB 4MSWB 4CKQA 1QSFD 1JK9B 1FYTA 5BO1H 3ZKXB 5KVFH 5DUML 3LQZB 1UWEL 1U91A 1D5RA 3TYGH 3WHE1 2ROYA 5LUMA 2HVKB 4HUKB 4IK6A 2CBMA 4WUKH 4OTXL 1RJZB 4NQVB 1LK3L 1ZHLA 4O4YL 4KOBA 2DQHL 1B88A 2AVFA 3SB3A 4M6OL 3T77B 2J8UB 4Z95H 2E7DA 1Z3GH 4BSVA 1EEZA 2B1HL 2Y2YA 2COVD 4MCYA 4P3DB 2WNWA 3K80A 2XV2A 4FKHA 3ZHFA 2MSPA 2XN9D 4MMZC 2EDHA 2P52A 4IK7A 1NC4B 1V55B 3C6LA 3ET9F 4CNIB 5HGGS 1WS7A 3QJUB 2YSSA 1RIUH 4X6FA 4JZJB 4TSAL 3L3OC 4WKZB 2CRMA 5ANMA 3RVTD 3GNMH 3TEUA 3T0XA 1JGEB 3U7YH 4HIHA 5J6SA 5F9OH 1KEML 4JDEA 4LLAA 1QHQA 2D7PA 4MNGA 4DTGH 4A04A 1QFHA 4XMPH 4DOHB 1N0XL 2FZ3B 1BXVA 3CZNA 4MJHA 1R3HB 4QTHA 5HDOA 3VFVA 2K6WA 5IHBA 3VU1A 5K9OA 4U1HB 5KJ7E 1EAJA 2P24A 5EIIB 3KYKH 5AVQB 4U49A 2XIIA 1PJ9A 4XP4H 3M1CA 3N85L 4X4YB 4OJFH 1XGTA 4POZC 2NQCA 3TPKA 2WO3B 4HUUB 3V4PL 4R0LA 2EUXA 2Z0BA 4J3TA 4MB5A 4XNUH 3KLKA 3Q0HA 3K91A 1S7UB 4NZTH 2NNXA 5CCKH 4WJ5A 2CQVA 2ZKYA 1FO0B 1K8IB 1OQXA 4CSSA 2UY6B 4K7PL 2YQ2A 1QHOA 2EDNA 3HVNA 1INEH 4PR5A 1PCSA 3WN6A 2VIRB 2C4FU 1BQRA 3SPGA 3V5HA 3N1FC 4TQIA 1ES0A 5ES4B 1SLXA 3AWEA 4Z6AT 4PVBA 1ZJBA 3S6CA 2Z1KA 3CHQA 3SDXE 3LQMA 4IBUA 4OD3L 4BZYA 3C5SA 2Q8BH 5L2KA 4GQ9L 1W2KT 1ZLDA 5AOZA 5MERB 4B95C 2FSDA 3FAWA 5K9QI 2XPGA 5AKRA 1MAML 3BKCH 4L8SA 3MA9H 3UZQB 1DVFC 4XO8A 2ZXBA 1T83C 3KL5A 1GGCL 1XBDA 3FDWA 1OHQA 1PBYA 3W57A 1ACZA 1B4JL 1EEYA 1T7VA 4UZUA 4DGYL 2X4RB 4LEOA 4XC3H 4EO5A 1AHKA 1VENA 5CJBA 3PFUA 3NDYE 1IKFL 3AITA 1MIEH 4X9FA 4M6AA 4BFIA 1L6XA 4DP8X 4YSDA 4NSKA 5EA0H 2YJQA 1V7MH 4KFZC 3BT2H 1ZSHA 3B6SB 3MLYL 5E7BA 2YK1L 3LKQA 4OZHE 4ELME 3RTQD 4KHTL 4FYTA 4F33A 3TFKC 2W60B 1JYNA 3BD3A 3ARWA 2B4CH 1OOAA 1KB5H 4A67A 3LXCA 5IROC 3PAZA 3ABMB 4S1RL 1QFUH 1WWWX 5T1MA 3DK2A 4KHXL 5KSAA 4OBRA 2WJ5A 2HT3C 4RLDA 3ZLQC 2OX5B 3C2AL 4Y2OB 3L9YA 3HG1E 3UTTA 4QNPF 1ZEAH 5JHDE 2A6KB 4GUPA 4L0PB 3FB7B 3SDYL 2IDFA 4G6FD 1OARL 3QNXA 4PD4K 3L95A 2R56H 3DJTA 3PU7A 5T1DL 3F7YA 3SHSA 1PAZA 3C5JA 2AABH 3B56A 1ZHKA 4KV5E 3T6QC 4RRPA 2Z91B 2YRZA 5FUCE 3DARA 3S98A 1CF8L 4RFOH 5DC9B 3DLQR 2XWDA 4HIQA 3GXDA 4DP4X 3UJIL 4AVIA 2DD8H 1NMCC 4HIEA 3KPRE 3QEQA 5TPWH 2VLMD 3KPPA 1IGJB 4N25A 2BIMA 4E5XA 4JKMA 5CUSH 1QBLH 4AYEC 4M61A 2F1BA 2FJGA 3QDAA 4IEFA 1WCBB 3SCMC 2JWYA 4EUPB 5AOIA 2BSDA 1C5DA 3LN9A 2BS9A 3M1OA 4LLDA 5KYUA 4DNLA 1UTDA 2W0FA 3CVDA 3L4WA 1FC1A 3PQYA 1E27A 3A6OA 1N64H 2YD3A 3D85A 2QTEA 5E4AA 1DQJB 4N8CH 1KJMA 4L0ZA 1A6VL 3MRDB 4WHYG 4EE2A 4HK3J 4KOCA 1UVQB 3ULVC 1T21A 2YGVA 1MN4A 1MFEH 4PG9A 4NC2B 4XNYH 4UILL 1BQHB 3UJJH 3U46A 1MRDL 3D48R 3HLAB 3I3BA 3BLPX 3QXDA 5CIPB 4FQLH 1DTUA 3LQAC 1QPXA 2IWFA 1DEEA 5JIHA 3QC6X 2WW8A 1YEKH 3QIUA 2GTQA 1IQWH 3BZEA 1UOWA 1UEMA 2X0WA 2ZYSA 5CD5D 1LO2H 5FFGA 5GRVK 5J57B 1KCBA 1T0MA 4H5SA 3K3QA 4NQTA 2G5BB 2GK0B 4N0UE 3UO8B 1E50A 4B97A 5AW0B 1OE3A 3QDMD 5FO7A 2ARWA 1WHPA 3P2DA 1I85C 1Y6NR 3MCLL 1SLWA 2HMIC 1XGRA 2B39A 3F3HA 4FD0A 2WLZA 3LPWA 2ENSA 3IRZA 1UA6L 4PJ9B 3U7WH 2F7PA 2AK4E 5C7ZA 4HULB 1CGVA 1OD7A 1PQZB 3SE8H 7FABH 1NUNB 1ZLVK 3QEUA 3CFCL 1KGYE 5F7WC 3D0AA 2KMWA 1ZGLM 4PRPA 1AQMA 1EZSA 4W9IC 5DRXA 4UNVA 3QIWD 3IM1A 4LE8A 4ZK8A 3UTZB 1W0WB 5DZLA 1AR1B 1M7DA 4UQ9A 5JQ6L 4HPOL 5FGBA 2NY1C 2W9EL 5FUOL 1S4IA 3GS0A 1A3ZA 3IN2A 4ATWA 4Y2DA 1OGAA 4ZX4A 4JK0D 2JI2A 2YMOA 3E38A 1HXYA 3IDUA 2UZIH 1CFQB 1F8TL 4AEHL 3QDGB 1CIDA 3RWCA 2A7BA 2DYRB 3HNVL 3KLAB 1ETZA 1T3FB 2WBWB 1CJYA 1CD8A 2A74B 4XO3A 2K3HA 1E4HA 4LHJB 5F1OB 2NY5L 3UIZA 4K7FA 1WHOA 5J1AA 4A2GA 1H3PL 3QNZB 2V37A 3ZQWA 4PJFF 1NEPA 1ZTXH 4B0MM 2ESVE 1DBBH 5DDHB 2XV0A 4R8WL 2CO1A 4S1QL 2Y69B 2ZX8A 4OT1L 3F7KA 3LRLA 4NQUA 5DHXB 4A6YH 4ETYA 1BGXL 4PRAB 4L5FH 5ISZD 3C6LC 1OT2A 3DVNB 1SN5A 3BW9B 3KWUA 1M3IA 4MA3B 4U3CA 2F58H 4JMNA 4AV0A 2KDYA 5IJKA 4H2CA 4FULA 1H19A 5JIDA 1PY9A 5JIMA 1RULH 4ANVA 1HH9A 5FF6B 4HUMB 3DHPA 4N1CA 3K1DA 2BJMH 3NJLA 5E9DA 4LPTA 5EC2B 3DV4A 4PRNA 3U4AA 4KDTA 2DQIH 4TPRH 1TU2B 3QUYD 5ITBL 3MBXH 5ABAA 4KO5A 1TCMA 2E3VA 3FB6B 4YR6A 2F61A 3P3YA 4FXGB 1CE6A 5DJZA 1I9EA 3B3IA 2P8MB 3MYJA 2EIMB 5B1JA 1OP5K 2A4EA 5DO2D 1AOHA 3G5WA 3L6FA 5EEYA 1FNGB 3SQBA 2CHDA 1I3GH 4R0LC 1ZVSB 3IKCB 4KI5C 3WUZA 3TBTA 3F5WA 2FQFA 5KYNA 1BAGA 2PCPB 3GIZL 3W9EB 2WBJB 4ONOA 3LZNA 5HDLA 1F5WA 4CBPA 5EZPA 5DK3A 2DQJL 5CSGA 1IGYA 3ZMNA 3N41B 1G9MC 4XVJL 5DC2A 1IM9D 1X5MA 1ZRUA 2XBDA 3N9GL 1UACL 4HETA 3V8OA 3U2SA 1CXLA 1OSYA 1XMEB 4P5RA 2ZAGA 4B50A 2FX9H 2NNAB 5JR1H 3LKRB 4P57A 5B8CA 1QTSA 2JKXA 4WJG3 3KJ6H 4X6EB 2AJ3B 1TF4A 2OQJA 1FA4A 1A4JA 1JV2B 2YUZA 3N1GC 4L8SC 4S1DD 3V0WL 3MRQB 1AI1H 2W65A 2PKDA 5E8DL 3SYCA 2WIIB 2XA3A 2L7JA 4DZBB 2DLGA 1GC1H 1YN7B 3NDZE 4UIKL 3SZKC 1HYSC 2H2SC 3F7RA 4LCYA 4H8WC 3EJYC 3K5SA 5GZNA 4UOQA 2O6DA 4WU5B