1W6LA

3d structure of cota incubated with cucl2
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
509
structure length
503
Chain Sequence
TLEKFVDALPIPDTLKPVQQSKEKTYYEVTMEECTHQLHRDLPPTRLWGYNGLFPGPTIEVKRNENVYVKWMNNLPSTHFLPIDHTIHEEPEVKTVVHLHGGVTPDDSDGYPEAWFSKDFEQTGPYFKREVYHYPNQQRGAILWYHDHAMALTRLNVYAGLVGAYIIHDPKEKRLKLPSDEYDVPLLITDRTINEDGSLFYPSAPENPSPSLPNPSIVPAFCGETILVNGKVWPYLEVEPRKYRFRVINASNTRTYNLSLDNGGDFIQIGSDGGLLPRSVKLNSFSLAPAERYDIIIDFTAYEGESIILANSAGCGGDVNPETDANIMQFRVTKPLAQKDESRKPKYLASYPSVQHERIQNIRTLKLAGTQDEYGRPVLLLNNKRWHDPVTETPKVGTTEIWSIINPTRGTHPIHLHLVSFRVLDRRPFDIARYQESGELSYTGPAVPPPPSEKGWKDTIQAHAGEVLRIAATFGPYSGRYVWHCHILEHEDYDMMRPMDITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPORE COAT PROTEIN A
publication title Dioxygen Reduction by Multi-Copper Oxidases; a Structural Perspective.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidase
total genus 143
structure length 503
sequence length 509
ec nomenclature
pdb deposition date 2004-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07731 Cu-oxidase_2 Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA03
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1w6lA02
5FC9A 1AZUA 2PPAA 1L9TA 2IDTA 4E9SA 1AG0A 4K9JA 1KCWA 2XV2A 1ZPUA 3T6XA 3X1EA 3OM3B 4UANA 4YVNA 2PLTA 4E9VA 1OE1A 2EIMB 4WKXA 4YSRA 3H56A 3PAUA 4BK5C 2N0MA 1NDTA 3CVDA 4BXVA 2EILB 3QJTB 3SBRA 3NJMA 3QPKA 4A2EA 1A3ZA 4HAKA 1OCZB 1AZNA 1KDIA 1SDDB 2IWKA 1JZIA 4CSZA 1F56A 1KBVA 3TA4D 2E86A 2FT8A 2XVBA 3FYIB 4G7RB 1CUOA 4E9XA 1KV7A 2IWEA 2GHZA 1JZHA 1W6WA 1TKWA 2XWZA 3FPXA 5D4HA 2XU9A 4DPAX 2W8CA 2BZ7A 3FU7A 3NT0A 5B1BB 1NIFA 3T6ZA 1GR7A 3OMIB 3CDZA 1AZCA 1V10A 3RYMA 3V9EA 5B7MA 2XX0A 2IH8A 3FU7B 2HX9A 1GS6X 2HLEB 1DZ0A 1NIDA 1N68A 3CDZB 4AKQA 1PLCA 4NB7A 3S3BB 2AANA 1ASOA 1PMYA 1GS7A 4AI7A 2A3TA 2EINB 1X9UA 2BHFA 4KO9A 4BWUA 1KCBA 1PNCA 2I85A 2Y1AA 3PXLA 4KOCA 1IBZA 4P5SA 3TBBA 4YSUA 3UGEA 2PP7A 1NZRA 1BQ5A 4CSPA 1SFHA 4AKOA 3H4FA 1XB8A 2BW5A 4MFHA 5I5IA 3EHBB 5IY5B 1FFTB 1BXAA 1MZZA 1NWOA 3NJFA 4YSQA 1IC0A 1NINA 1AACA 2PPDA 4AX3A 3DTUB 4YSOA 5PCYA 2UXFA 2B08A 4HALA 1BEXA 2RACA 1XB6A 3ABKB 1QLEB 3QJRB 2AZUA 1PNDA 2HXAA 4DP5X 3X1FA 4GY4A 4UF7C 1M56B 4HIPA 1KDJA 1M9WA 1JZJA 5I5JA 2DWTA 5B1AB 3NJHA 2IAAC 1PCSA 4NERA 4F7KA 5AKRA 3FT0A 3AG3B 2YAQA 2ZWNA 2MRYA 1CYXA 3CZUB 2TSBA 1TEFA 1SFDA 3EH5B 3PAVA 5E9NA 4DP1X 1AS7A 3N2JA 3ERXA 2J55A 1HFUA 4G7SB 1FWXA 1JXDA 4YVUA 1ID2A 2GB2A 1ZIAA 4M4RB 1JVOA 5PAZA 5I28A 2GBAA 3BQVA 3PLYA 3WNIA 1L9RA 3PAZA 1WA2X 4RH4A 3EH3B 1NIBA 2HRGA 3FU8A 3IE9A 2BP0B 4PAZA 2IWFA 2VMJA 1BYOA 1R1CA 4BDVA 1OCRB 1BQRA 4YSTA 3TBCA 3GYRA 1AG6A 3NJJA 3X1BA 4G72B 1GS8A 2J57A 4HZ1A 4KNSA 3WI9A 2W88A 4BDVB 3UAAA 1JOIA 2ZOOA 4G71B 2OV0A 5I5MA 3S8FB 2FT7A 2X87A 1ETJA 3OQRA 1MDAA 2IH9A 2UX7A 3ABMB 3AZUA 2CALA 1E65A 2UXTA 1AZRA 1OE3A 1SDDA 1MG2C 1JVLA 2XXGA 2BP8A 3JT2A 1MG3C 1PZAA 4KOBA 1QHQA 2R7EA 2YAEA 4YL4A 1RZPA 5I6KA 3FSWA 3T6VA 1AANA 2GC4C 2FT6A 1WAEA 2BP8B 4E9YA 1SJMA 2WSDA 1V55B 5B1KA 1JZFA 3X1GA 2R7EB 4KNUA 1PLBA 1IUZA 1W8EA 4AZUA 2HRHA 3SBQA 1L9OA 4WTQA 4E9WA 1NWPA 1HAWA 3AY2A 4DP7X 3ASOB 2PPEA 5TK2A 5TK4A 1SF5A 2GIMA 4FAAB 2PPCA 1J9TA 4L0PB 4E9TA 5I6OA 2LLNA 3QJQB 3X2QB 2BWDA 3FU9A 4A2DA 2XLLA 4QLWA 2BWIA 2FQDA 2IDUA 5LDUA 2XV3A 4DP6X 2CBPA 4HHGA 2AVFA 4W1TA 1FA4A 5I6MA 2YXVA 3T71A 1J9RA 2JFCA 1AQ8A 3DKHA 1L9SA 2EIJB 3FSVA 3NJGA 1A4BA 2PCYA 1OF0A 3NP4A 2B3IA 2PCFA 7PAZA 1A65A 4BXSV 2AFNA 2PP9A 1PZBA 3NJLA 1VLXA 4GYBA 3JTBA 3EH4B 1GY2A 1JZEA 1WS7A 1TEGA 1MZYA 3NJKA 4HCFA 3ABGA 4BWWA 4E9RA 2ZXWB 2OJ1A 2VW4A 3NSDA 5D4IA 1ZDSA 4YSCA 3NJIA 1ZV2A 4NAJA 2HX7A 2UXVA 2VSMB 2ZONA 3GDCA 1URIA 3S3DB 3ASNB 2YAMA 4Q89A 2Q9OA 1UATA 3ZBMA 1GW0A 8PAZA 2UX6A 3WNJA 1E5YA 1XB3A 1JERA 3CVBA 4PCYA 1PY0A 1BYPA 3AG2B 4DPBX 3C75A 4A68A 5B7EA 1AS8A 1BQKA 1E30A 1TU2A 3UACA 1NPNA 2XUWA 2TSAA 1NIAA 3DIVA 2VM4A 3NP3A 3TASA 2YARA 3T6WA 2YAFA 3NSYA 2BP0A 2DY2A 4A2FA 2IDSA 3FS9A 9PCYA 5I6LA 1IBYA 2VN3A 2YXWA 4W9ZA 1GY1A 3HEIB 1OOWA 3NYKA 1WS8A 3MBWB 5D4JA 1M57B 3AG1B 1SHWA 2VM3A 2I7SA 3AW5A 4GP8B 1NTDA 3U25A 2UXGA 3FQYA 1PLAA 4E9QA 4YSDA 2EIKB 4TXVB 5AFAA 1OV8A 1J9SA 2FQGA 1AOZA 3ZIYA 3PCYA 1GSKA 1NIEA 3TU6A 3QJVB 3D12B 1EHKB 3QJSB 4HCIA 2AZAA 5I26A 1ET8A 3L45A 1ADWA 2DWSA 4F2EA 1AR1B 4P5RA 4DP8X 3S3CB 1NPJA 4KO5A 2MTAA 1E5ZA 2YQBA 1PZCA 2XXFA 3SQRA 1HAUA 4N4YB 2FJSA 1B3IA 1RZQA 2WO2B 4KO6A 1ZDQA 3MX0B 3G5WA 2FWLB 1QNIA 1SHXA 6PCYA 6PAZA 4DP9X 2BW4A 2Q5BA 2H5UA 2FTAA 3FPYA 5I6PA 3HB3B 3WKQA 2FQEA 4ZK8A 1L9QA 2BO0A 1XMEB 2H47C 1SNRA 2HZHA 3IN0A 4A2HA 3UADA 4GP5B 3FQ2A 1E67A 3FSAA 5EHFA 3UABA 5B7FA 1I53A 1A8ZA 4A67A 1AZBA 1AAJA 1N70A 4N8UA 1ZIBA 4DP0X 2DYRB 3BVDB 2PP8A 4DPCX 1OCCB 2H3XC 2GC7C 2YAPA 2CUAA 3V9CA 4F2FA 2QDVA 3H4HA 3OMNB 1L9PA 2QDWA 3PPSA 2BZCA 5B3SB 1CC3A 3CVCA 5B1JC 2YAHA 3NSCA 3NSFA 4YSEA 1KBWA 2CJ3A 2X88A 1RKRA 5B1JA 1J5CA 4G70B 1T5KA 3FQ1A 4JHUA 2J56A 2QPEB 3ZX1A 2VW6A 2WO3B 2FQFA 1W6LA 3T9WA 2JXMA 7PCYA 1CYWA 3AG4B 4HCGA 2OCCB 5AZUA 3WG7B 1CURA 1A4CA 4HHWA 4JHVA 1X9RA 2JKWA 3SBPA 4GXFA 1J9QA 3UAEA 3CG8A 4GP4B 5ANHA 4G7QB 1J5DA 3OMAB 3X1NA 3KW8A 1ILUA 3ZDWA 4KO7A 3S8GB 3ABLB 1OCOB 3EF4A 1KYAA 1EZLA 1A4AA 3NJNA 1ET5A 5F7AA 5I6NA 1PAZA 1WA0X 1IKOP 1KGYE 2XYBA 1NICA 2HX8A 4YSSA 1BAWA 2YAOA 2VW7A 4BWTA 2NRDA 3WKPA 2GSMB 1ASPA 4DP2X 4KNTA 4AKPA 1BXUA 1AIZA 4Q8BA 4ENZA 1GYCA 4EF3A 2J5WA 2I7OA 1V54B 2DV6A 2Y69B 1ILSA 3IN2A 1DYZA 3KW7A 3QJUB 5F7BA 3N55A 2GI0A 4A66A 1SF3A 2FNWA 3OD3A 2VSKB 1WA1X 1ET7A 1JZGA 3IEAA 2CAKA 1PF3A 2PPFA 2QT6A 1YLBB 4DP4X 2IDQA 3GXUB 1RCYA 2P80D 4QKTA 1AS6A 3FSZA 1JXGA 4JKNA 1OE2A 2XX1A 2DYSB 2XV0A 1JXFA 3QQXA 3IBOA 4UAHA 3FYEB 4M3HA 5A7EA 2IDFA 1ASQA 4FA7B 3WIAA 2QPDB 4A2GA 2P80A 2CCWA 4YSPA 4X4KA 4YSAA 1BXVA
chains in the Genus database with same CATH superfamily
2Y7LA 3MLRL 3GSNB 2QSQA 3SPIA 1AZUA 5TQ0L 1KJMA 1KPVA 3UPCA 5DMYA 5I66B 1QWHA 4GG8B 4UANA 3O0RL 4FFVC 1DUYA 5IEHB 5D1ZI 4PJ7B 1L5GA 5C7XH 1R24B 3Q9QA 4UIKH 3L81A 4X42A 4WTWA 5HY9B 5IFHH 1KULA 3JUZA 8FABB 3SJVB 1IU1A 3FO9A 3Q48A 5DYFA 2JKNA 3ULVH 1I82A 4PP1D 2GTZA 4AW7A 1J7VR 3X17A 1BA9A 1HILA 2FK9A 2BCMA 3HBGA 5E2WH 5HXMA 2RR3A 2R59A 4M1CD 2IWEA 1QBMH 2F8XC 2XWRA 4BUHA 5I2IA 1BJ8A 5CD3B 3WSQH 1JHKL 1SLUA 2AKRA 3KLAB 4KUCF 1GR7A 4LQ1A 3CHRA 1GCYA 1H8OA 2F1AA 3MRPA 3A4DA 1GS6X 3QZLA 2ARJB 4UTAL 2HT3D 4UM8A 4AE0A 1QFWH 3AWEA 2ZUQC 5HDBE 2WLKA 4X7TB 3CSYB 4PRNB 3FN3A 3MKGA 2A3TA 2CGZA 4KV5F 4ZUTB 5CEXA 3QUYD 1BJ1H 1JIBA 4HJUA 4KOCA 2FWOA 4P04A 3P2DA 1RV6X 4L3FA 4ZW8A 5I1KH 3EFFA 5IBTL 2BIIA 4L4VE 3SDAC 4HGWA 4QAWA 1RZFL 4AKOA 1JRHH 1CS6A 3D4GA 4X98B 3FB7B 2FVNA 3VWKB 5D9SB 4EI0A 2PXYC 3QIWD 5IY5B 1TFHA 1WBXA 3PWVA 5J9PA 1NWOA 1MCOH 4JFPB 3GHEH 3QDGA 3NAAL 4NQCB 1V3MA 2LFGA 1ODUA 5D7SL 1N8ZB 1S9XB 5H37G 4AL8C 4IKLA 3T0WA 1XX9C 4TQIA 1C16A 3L7EA 2H41A 3MRFB 3P2BA 5DWUH 3TNNA 4ABUA 4F58L 4PWFA 5E9DA 1CD9B 4ILDA 4ZSOB 3CPLA 2LVEA 4GY4A 4HUXB 1P9MA 1P2CA 1C9SA 1LL1A 2NUTB 4KHTH 5JW4R 5TQ0H 1X5AA 2D7OA 3CN3A 3N40P 4WI2A 1IFRA 4N90D 2VUKA 1E9OB 3WMSA 3V6OA 5AKRA 2BNQD 2LVCA 3FJTA 3FQRA 2NXZD 4NEHB 3SYCA 1R3KA 1FCCA 4FLHA 3HN5A 4Y5XB 3FTSA 4JKLA 2NW3A 4LLQB 4AM0A 4JRLA 1BLNA 1A1OA 3LD8B 4WO4C 2OJEA 1CXKA 3KCWA 5DEGB 1FO0L 2Y5QA 2O5ZL 2LTQB 2G3XA 4M4RB 4CU7A 5JOFB 3P73A 5ADOL 4CN6A 1A9EA 4QTHB 1GC1L 4GRLA 1A21A 2J1WA 5K33A 4JO4H 5DJXB 1I7UB 4UIMA 4DIXA 5HHXH 4ELMB 3FQ4A 5CCJA 1UC6A 3LZLA 2HVBA 5D96B 1FJ1A 4XVTL 1BOGB 1KNOA 1GA2A 1UG9A 3MV11 5EIVA 2QFPA 1JCKA 1JI2A 2QMKA 3GYRA 4PGEA 3S5LA 2EDFA 5CU5A 4UTAH 1WTGT 4TNFA 5I66A 3CCHA 3OKEA 4JFFB 5C09A 1CU4H 2FT7A 2I5YL 4RETB 1INEH 5I15L 2IH9A 3D2UD 2OTWB 5HY9A 8FABA 4UOJA 1WBZB 3ARDD 3MGTB 4KH9A 2VZUA 1HWGB 4Y2NA 1ECZA 3PIQB 4K23L 3TVMD 5GRXG 1CI3M 1IBFA 4J3XA 2VDMB 4JFDA 5EBMB 2J88H 4LPVA 1HC1A 3P4NA 5E2VH 4G6JH 4GEIA 1UWFA 4LVOB 5I8EA 3CIAA 5B1KA 3ARGC 5CD3A 4AITA 3BLKA 1K4DB 4HJJH 1I1CA 4F37K 3H1ZA 4K5MA 4FDWA 2X4PB 1N59B 2OP4L 3OAZK 2MFNA 2ZAHA 2NY4B 2FX9L 5DLML 4EOWH 2HN7B 2LU7A 2APFA 4YMPA 5H8DA 1XTLA 3QUZA 3VU1A 4B9CA 4LMQE 3ASOB 2PPEA 3HC0B 5T3ZD 5AD0A 3CSYA 4FX5A 4JO3H 4M93B 1J8KA 2P47B 5D7IB 5KVGH 1O9ZA 3F64A 5AKSA 3BPOB 1JZDC 5AW9B 4M1GL 6FABL 4ZMWA 4HHGA 2QZQA 4HXAH 4FTVE 3ARXA 4JDVA 4X98A 3D0AA 3S36H 4YBLB 1I3GL 3LX9A 3VWKA 2GJJA 3AXLB 4M5YH 1MJUH 3ECWA 1A3QA 3HI6H 3ISYA 1LO2L 3VRJA 3FRPG 4LGPB 5FOBB 3PWLB 3MNVB 4JFPA 4N8VG 1P84K 1A65A 1FO0H 3EG9B 4Z7QF 3ZMRA 1FYTD 1MW1A 3UP1A 3UTSA 1N8ZA 1G1OA 1RD6A 4KJWD 4N0YH 2ADIA 1U3JA 4MAYB 3NJKA 3MRFA 3BP7B 5I1HH 4ZAKD 1LHZA 3BHBB 4LAQH 1OSPH 2XJLA 4ZXBB 3AT9A 4OZIE 4HOXA 5LCVH 3L3OB 4YNYB 3RL2A 4HLJA 2G75B 4M6NL 2VDQB 4QTIL 1F3DH 4BE6A 3W2DL 1E28A 2PCXA 5JW4M 2VDRB 2EDTA 5C6PB 1JERA 3TT1H 1RUAL 2VDPL 4Y5XA 2IAMD 1C8PA 4LLQA 2D3VA 5JIHA 3UFIA 3MV7A 4ODTL 4ORGB 4FERA 4RCAA 1HEZA 5LCVA 4KX9A 5C0ND 2B4CL 1WH0A 5HDBB 4PS4L 1GSMA 4HKBB 5JOFA 1UZ6E 1BVZA 2WP3T 4DJMA 2DW5A 4A6YH 4ABQA 2V5MA 4MDIB 2A9MH 5DJXA 3I6SA 3LQZA 3TT3L 4XNYL 5JIMA 5HSFA 3MUGB 4X5LA 4PJEA 2QTVA 4L4VB 4NC0B 3UBFA 5JPMC 4FQJH 3KPSA 4W6XB 3QPQD 3DPDA 4F5CE 2NYZA 3MRNA 1YAZA 3N06B 4HDIB 1MFUA 2XQYA 4PLJC 4A6YA 2N1KA 1NTDA 5AYUL 3HNTL 1E6JH 3BKJL 3FULA 1DQQB 4XMWA 5BRPA 4OLUL 2MHAB 5D7JC 5I18H 2PCPB 4GSDH 3X12A 4O51A 2APSA 1J9SA 2FQGA 2OTWA 5B1CA 1PBYA 3U1SH 5KTEH 4M1GH 6FABH 3B1UA 3VE0B 2XQBH 3W5MA 2J8UE 1WBZA 3MGTA 5DO8A 3RWDB 3PIQA 3DVFA 2DLIA 1C5CH 1P6AB 2W9DL 5ERWA 4E42B 4P5RA 5EBMA 4GIOA 2MWCA 1LO2H 4BFEA 5FLUA 3N1QC 1ROWA 3DA0A 3BKCL 4QXUL 1D6EA 1DBAL 1E5ZA 4JO1H 4N8CL 4QXGH 4B95C 5BVJB 4CL7A 4NZ8A 3RJQB 1E5UI 2HTKC 1UJ3B 2A4EA 1WZ1L 1B3IA 2C9VA 3QH3B 5T1MA 2X4PA 4HMCA 4TQPA 1Q1PA 4EN3D 3N40F 5DURB 3DSFH 4HUUB 4W9EC 1ZGLA 4Q9CA 2UWEE 2G9KA 1KPRB 5GS0D 3EJQA 5DHDA 3T77B 3IGLA 1KEGL 5MEQB 3FB8B 1N5YL 3O6FC 1JSYA 4FZ8H 2CHNA 1NAKH 1EAJA 4XCYA 4B9ZA 4M6NH 4LCUB 1NGPH 1SVBA 2AVGA 4LOVA 5EHFA 2V5SA 5EU4A 1ZRUA 5EWIL 1A8ZA 2J6WA 3ROLA 1DQLH 1AGBB 1P5UB 2H6OA 5ISZD 5CINL 2JB5L 1MRCH 3TBTA 2X1XR 2X2HA 3G6AA 3AXLA 4Z76A 3DX0A 4JY6B 1OCCB 1QFHA 2Z65C 4NN7C 2X89D 2DMCA 3R8BB 1XGPB 3VXUA 1H3VA 4PRAB 3EO9H 3OMNB 1YEIL 2JLPA 4H25A 1ROCA 4FA6A 1YEFL 4MS8D 3WJJA 3F58L 2B4CH 4C54A 2WQRA 4GOSA 4EI6B 3NSFA 4CVWA 1NFKA 4CVZB 4Z3GA 2X88A 5A1AA 2WD0A 3KPRA 1HCYA 4JUTA 1OALA 4NZDA 4R6UA 2WMPA 3MZTA 3BHBA 3SKJH 3UDWC 2AV7B 1TLKA 2Y3AA 1SLWA 1JYXA 3O41A 1FNGA 2BVQB 1KTJA 3L3OA 4YNYA 5AB0A 3KCPA 4EIUA 4N90E 1UA3A 5CIPH 3EXJA 2G75A 2BNQE 3HI1A 4EDXA 1G7QB 5E8OB 4ZFZA 4I18B 3C5ZC 4FG6D 3WE1A 5F3BB 1RZGB 4LCIL 4OLUH 5GZOD 3B2UC 1LQSR 4WW2A 3TOPA 2FBJH 1WCQA 2FECL 5LNDA 3QO0B 4MGXA 4JREB 2AITA 4IKNA 4ORGA 4HKZB 4Y2DA 3AADB 2YXFA 5IHZB 5BV7C 3S3PA 2W9DH 3JWNH 1F2QA 4R97B 3RKDC 5FHBH 2R2EB 4QXUH 2NY1D 2VW7A 4BH7A 2FYVA 3EFDL 4F9PC 3NTCL 3RJOA 4Z18A 4FTVB 1BZ9B 2CLRA 2VQ4A 4PJ8B 3ECBA 4G8EA 4IRZL 3D3VD 4S2SB 4DVBA 2ALWA 2R4SH 5J3HC 4RESB 3HAEG 2KZWA 2KQMA 4GBXB 1T1ZB 3ZW3A 3QI9B 5EIQA 4L3CB 1JZ6A 4OIIH 2YMTA 1DEEB 3DPBA 4XO9A 4HPOL 3TO2B 2P3YA 1RFDH 2Z7WA 5J13C 1AJ7L 1OTUD 5EEYA 1Z1WA 1T1YB 4I1NB 2P80D 4NNYB 4XMTA 1I7ZB 1UKQA 4OZIB 5DK0B 2H9GA 1FDLH 4G7YL 2DQ6A 3CC1A 5BVJA 4BFIB 1UJ3A 1EH9A 1QUNB 1OP9A 1RVFL 3W11C 4CW1A 2Q20A 3GRWL 1DQML 2R4RL 3ARBC 4OGQC 3W9EB 3GF8A 4Z7VA 3ARZA 3I6KB 3MGAA 1YPZF 1LDPH 1E5BA 1YEGL 3EOAB 4YHYB 5GGUB 1SUHA 4DGYL 1EAPB 5T3ZE 1L9TA 2L4OA 1A6UH 4WNSA 3Q2VA 3FO0L 4I88A 1IGMH 3QFJD 2OMUB 1TVHA 2XZAL 3UAFA 1WAAA 4LCUA 1X5FA 2K3HA 1NDTA 1AGBA 1GOFA 1TTRA 4XWGH 3ZGIA 5K9QI 2EH8L 2IWKA 3A6BH 1DN0A 4FFWC 4YPGA 1KBVA 3KPLB 1NUGA 1WICA 1B4LA 2IBBA 1HKFA 3BKMH 4XMVA 3ARSA 3UEQA 4E9XA 1FYTE 2CBQA 5I6XB 3HHRB 4NIKB 4MQ7B 4KZ0A 1GYVA 2P8LB 2DKSA 1J11A 4QEGA 1BW8A 5C08D 5E9AA 4PY8I 3RWHB 5FPIA 2WTPA 5B7MA 1XGUB 1BJMA 3FUMA 2J8UB 5FDWB 2YGOA 5EOQL 4CMMA 3GRGA 1OM3H 4LXFA 2OZ4H 2K7PA 3OR7B 5FUZH 3HPJB 4AG4H 1OLLA 3SSGA 2A6KA 2V7NB 4KVCL 4ISVA 1N4XH 3DIDA 5FKPB 5KS9F 2JK5A 4U1NA 3PXLA 3ZMEA 2OR7A 1AHMA 3BESR 4B7LA 2BXZA 5DD3L 4IYKA 1HYSC 5DMIL 2FD6H 3DDGA 4YHZL 5FX3A 1NCHA 3HZMB 2OZ4A 3VFNA 3MJ7B 4EO5A 1NDMA 2UWEB 2XG5B 5AOLA 3EJRA 3MRHB 4QY8A 4LDOB 2HG5B 1G5AA 1AACA 3OG4B 2FO1A 2R2EA 3QUYB 2F19H 4G7YH 2ED9A 3EJYD 3CHQA 3RUGF 3ZT7A 1CG9A 3CHSA 3HG1E 3II3A 5C0IB 1P9MC 2ZUXA 3GRWH 3HCVB 3STBA 3R7QA 2EZ0D 3QUML 1UKSA 4JRXD 3OAUL 3RHWK 5ABDE 1JZJA 3QIWB 4IRSC 4NO3B 2QHRH 3WFEL 2VZVA 1S4IA 2XVKA 4P4KD 3V6OC 2Z1PA 4GAYB 1W0VA 5J6GA 1RZJL 2EC8A 3UEZA 4D3CL 1T1ZA 5DT1H 3Q06A 2WZ6A 4M61B 3M86A 3RE0A 4FFYH 3TX4A 3DBSA 2MRYA 2WYIA 3AQDA 1FNFA 1AI1L 4QOKD 3L9YA 1DEEA 1NUFA 2ITCA 4LHQB 5JPNB 1GTFA 5T3XH 1UZ8A 3GSVA 1INQA 3ERXA 1EHLL 3P77B 1TZ8A 4H0IA 1JXDA 1ZWIB 2Q7YA 2VITB 3G5VB 3H42H 4GRLC 5AW0B 4C59B 1Q0EA 4N3UA 4ONGL 2GBAA 1RZ7H 1UD3A 4FFYA 1EA9C 2BNQB 1QUNA 1T7ZA 2NW2B 1BQLL 2NXZB 1VFBB 1ETB1 1KTBA 2BP0B 3JWOL 1QTYT 5MERA 1ZHLB 3C5XA 3PUUA 2NQCA 2YD0A 3DETD 2GI7A 1ND0B 4YS4A 5IVXE 2GUYA 4K73A 3F7RA 3HUJF 1EO5A 4I77H 4BDVA 4JFTA 3GS0A 3V7AG 1BLIA 4WTZA 4X6DE 2OMUA 1YNTB 3IMTA 4P57B 1TJIH 1ZHKB 2YJQA 1M7XA 4HIJA 7CGTA 2XG4A 5ISZE 1F45A 2JIXA 5EU7E 3ABMB 2OK0H 2AJUH 4OCXL 3RDTD 3NH7L 3QO1A 4Y4KD 1THAA 4H2AA 1JVLA 2QQKL 4QRQB 3FF8A 4F5CA 5BOJA 5SX4I 3RLSA 1JPTL 5L4JA 4LLWB 3DWTA 4I4WA 4W4NA 1USZA 1G9NL 3MFFB 2Y5EA 4MQ7A 3QUKA 1U2HA 3TLRA 2VR8A 5D5ME 2J72A 3U79A 4XP9L 5DMGD 1O5PA 2ZT9C 2ZPKH 3D2UB 5KOMC 3A6CH 3VFGL 5D71L 1BBDH 1CLYL 1VF5C 3ENEA 3QUMH 3BDYL 3TVMB 3OR7A 3ZN6A 3LQAL 3MRBB 2V7NA 3J27A 3NCJH 3X2QB 4RWHA 4JDEB 4D3CH 2IDUA 1WAPA 2BY0A 4DCQA 1UA6L 3VWKC 5JW4Q 3KYNB 1XH2A 4JANA 5IMOA 1YY8A 4N6QA 1JGIA 3GBLA 1QLFA 4YC2C 5HDQH 3IDNB 3LKQB 3O3EB 2VLKE 3ARFA 3LKOA 3LMJL 4OCNC 3R06B 2IADA 3AM8A 4WI7A 1GZPA 3QNYB 1M6UA 2PCFA 1Y18B 3EYUH 4YE0A 3LIZH 5D8JH 3TIEB 4E0RB 3DYOA 1Q9LB 2JKXA 5IG7B 1RUPH 4PYHA 2KMWA 4M4PA 1VLXA 1AO7E 5T1DL 5B39B 2QADC 3FQWA 2LU5A 4XBGA 4AMXA 1BQLH 4EIZC 1I7TB 3HCVA 3CK0L 4ZFFA 2VW4A 2B1HL 4NPKA 1XR9A 4NWTL 4GO8A 1KPUB 3D3VE 3SE8H 3OHXB 4NNPL 1AKJD 4NFBA 1FNAA 3RURA 3LIZA 1CR9L 1HZHH 4NZUL 4JG0L 1R0AL 4HJIA 4JM4L 1FYTB 3H3PH 1DVZA 2VC2B 5DJ8B 5CSGA 5D1QD 3LHPH 2TAAA 4IOSA 4Y5XC 5F96H 1BIHA 4PREB 3LD8C 4P3CL 4ZAKB 3RPIA 3WHXB 1PY0A 4XCEB 3NH7H 2LTQC 2EDNA 4HS6B 4X6CE 2QQKH 4JQIL 4TV3A 4LEEA 4FKKA 3AQYA 1JPTH 4G43B 3BWAB 4J8RB 2ITDA 4XNBA 2IQAB 3VB8A 1COBA 3U7AA 2AGJH 4AK1A 1UQSA 3GXMA 1MRDH 2WHVA 3I9GL 2E3VA 1KEML 1FH5L 3RRQA 4AQZA 4ZFOL 2NW2A 4U6YB 3LRSA 4AVHA 2BP0A 3KJ6L 2MSPA 3MCG1 1N6VA 4XMLL 3UCQA 1T66D 4DF9A 5C0GB 2WTOA 1ND0A 1U3HD 2CA3A 4NCC1 5EZJB 2P5WA 3AWFA 1VADB 5ECGA 4Z7NF 3BDYH 2FHCA 3QFJE 3TO4B 3BSZL 4ZG1A 1FAIH 3N85L 5F89A 1ZHKA 4XB7A 1T20A 1ZJBA 2AQSA 4HP5A 3L4ZA 1AOZA 5DD5H 2OMTB 3GI9L 1LXMA 4NSKB 4UV7H 2H8PB 3HG1B 1SXBA 4F7PB 3DHPA 2COVD 4OSUL 1NMCB 3C8DA 2A0LC 3MV01 4QRQA 5ACLA 3B9VA 1ES0B 1UFUA 2IWGA 4NDMA 4QHLA 4JCLA 2WNXA 5KANI 4LVOC 1A7NH 2OL3B 5KSAD 4Y2LA 5BJTB 3IJHA 1BQHA 1OAUH 3SQRA 4TNVK 5J1SC 1JGDA 3DO3A 4TUOB 4MAZA 4XPHH 3WY2A 1OAJA 5ICYA 3HB3C 3AY4A 4YHPA 5C08E 4AH2B 4YDMA 3TFBA 1YMHB 2EVHA 4JJ5B 2BVYA 1F8TL 1MJ7H 1S7SA 4N2NA 4EJ1C 2F68X 1KB3A 3DVNB 3VG9B 1A6WH 1PD1A 5GGSB 3GTVA 4ZW7A 3ETSA 5TE6H 3T4YB 3SDDA 4V1DD 5J6SA 1C08B 4GXVL 5C07A 2NY2D 2DMKA 1SY6H 3LRHA 1CB4A 4K94L 4MNQD 1T4KB 2ZG3A 4JG0H 4GP5B 3ESNA 1Z0MA 3LXUX 3DBXA 3FSAA 4RQQB 1I53A 4AGOA 2VKWA 5HGBB 1C12B 4EN3B 2N56A 3DRQB 1JK8A 4LHUD 4LT7A 2DYRB 4UTCA 4FMVA 1K4CA 5IVXB 1N19A 4MMXB 5E8NB 1II4E 2HFFB 3WJJC 2VL4A 3R06A 3TBVB 3V9CA 2X05A 1PQZB 3L5XH 4JQIH 4WFGE 1IFHL 3TIEA 3T8VA 3LEYH 4X6DB 4EQ3A 2YAHA 1KTDB 3JBG7 1CXIA 3KPOB 2XKSA 3I9GH 1FLRL 3CFCL 4ZXBC 5ISZB 3ZX1A 4XMLH 2YA0A 3DV4B 3MYZA 5C0EB 4OIBA 4JRXE 1T2QH 3L3OC 1Z9SB 2N7BA 3GXDA 3QT2A 4JE4B 2EDHA 2E6JA 2FEEL 4IBTA 3WY1A 2X1WL 4LRIA 2OM5A 1BIIA 3KLQA 4WW2C 5DJ8A 3N85H 5D5MB 2F5AL 3SBWA 3IPBA 4FXKA 4QOKE 2IDCA 1J9QA 4L5FE 4EEEA 1T6VN 4H13C 5AVUB 4Y2DC 2X0UA 1OOAA 2YPKB 2V9QA 4HJEA 1OSEA 1EVTC 3CMOL 2DPKA 4IU2B 5L4IA 4OI9A 4RBPK 4OGAC 4G43A 3BWAA 2EYSB 2IQAA 3S96A 3C6EA 5IF0B 3WXWL 4DW2H 2IPTH 2A7BA 3FZUD 3QS2A 5IOKA 2CZNA 4H8WH 3B2XA 2W9EL 2NY0B 3LZQA 5JR1L 1VAHA 3MA9L 1ASPA 2DQIL 1YY9C 4KMTL 3H9SD 4GAFB 4X8JB 2CM5A 5EZJA 15C8H 2J5WA 1WV7T 1TQBB 5IKCA 1KG0B 2JTYA 4XX5A 3DYMA 3L3JA 2VLKB 3TO4A 2ZSWA 2R2HB 1ZGLP 7TAAA 3LRKA 3LPPA 1SJHA 2NY1B 2P8MB 5HYSB 4OZ4B 3Q44A 3SCMD 4DESA 2OMTA 1I8LA 5BW7A 1AO7B 1MCWM 2H8PA 2WOYA 2WIMA 3HG1A 5DQDL 1PF3A 3P9LB 4QUOA 3FTYA 4N2FA 1EMTL 3QQ9C 4M8QA 1U3NA 4JQXA 3CSPA 1UUNA 3D3VB 4OKVB 5EU6A 4X9FA 3NQKA 4DERA 2OL3A 2PMZA 2E6PA 3G7TA 1UJ3C 2DYSB 4NC2B 3QQXA 4Z23A 5BJTA 3VXRD 3RTQD 4AQ1B 4QHKI 2R1WA 4G5AA 4POUB 2DQJH 4UNTA 3WLWD 4OV5A 1I3RA 2WZAA 4HF5L 2O6EA 1IGJB 4PU2A 2WIIB 1FLRH 4J3VA 1KFGA 1M2VB 2W60B 1U6AH 4LKCB 3CFCH 1MCLA 4UMSA 2LQRA 1I8IB 1OTSC 1E4XI 3DVNA 5GGSA 1OKEA 4X6CB 2C9AA 5FC9A 1C08A 3BI9X 3IE4A 3SOBL 1EFXD 2PTTA 3BIAX 1MRFL 3LS5H 2BS71 2CHZA 4RQQA 1R3HB 4FGMA 2Q8BL 4X9HA 4WWPA 1C12A 4MBRA 1MI5A 1ZMYA 3F6LA 4WWKA 5DK2B 5I1EL 2R0WL 3MODH 5DRWA 2F15A 2DQDL 1MIEL 4U1KB 1N5AA 1ZA6B 2V17H 3TBVA 3CFTA 4N1CA 4ALAL 3QFJB 1X7QA 1OTTD 2RD0A 1DVTA 3PXHA 4WHYG 3UERA 3FB6A 3I50L 4OD1H 4DPAX 1G84A 4M6MH 3HG0A 5LG6A 5ISZA 2HH0H 3MA9H 4X6BA 1NBZA 3DV4A 4JGMA 5ACZB 5C0EA 3P1VA 1U91A 3FU7B 1NIDA 1QX1A 4YDVA 5LN4A 1JGVH 3EHBD 4HQQL 4E68A 4ZTOL 3N50A 2AANA 2Z64C 4KGLA 2DLHA 2BFGA 1DANT 3NZHL 2BHFA 3E0GA 4LSPL 4UB0H 5D1QE 3FBKA 3B2MA 4YSUA 3QCTL 4FG2A 4IJTA 4JREC 1N64H 5C08B 3GUTA 2VDNL 1AXSB 3KWUA 4G9FD 4OJFL 3L4UA 5DJ2B 5DQDH 5JW3H 1JTTA 3FT9A 3P9MB 3CV5A 4G8IB 2UVFA 4ADJA 2YBRA 4ZMNA 4XP5H 3LTVA 3AS3A 4JE0A 2YOCA 5GRZA 3WLBA 2F58H 3GLZA 1J0JA 1W16A 2B08A 3SE6A 4N2HA 2RACA 3MYJB 4HIXH 5DC9B 5H4ZA 2HMIC 1XGZA 1IGFH 4PJ8C 4LK4A 1UYWL 4GKLA 4FQ1L 2HB0A 4K3HA 1UVQB 2B15A 5J3HD 1U8MB 3ARED 2M26A 1KG0A 1YEHL 2F8OA 4HOWA 3HNSH 1E8XA 4L8SB 4IIQA 5I5JA 2VLKA 2G2RB 1XAKA 4GBXC 5B1AB 1DCLA 1MREL 1SVCP 1ZT1A 4HLZG 3EYVB 1W72L 2FGWH 4OZ4A 3VSTA 5I1AA 3WFBH 1AO7A 4NENB 3UTZB 5A3ID 5I0VA 5C0DA 2NYYC 5JORB 3P9LA 1WZMA 4GAAA 2PR4H 3FCTA 4W81A 2FLBT 3HC4H 4JRXB 4LF3A 3N2JA 3RWEB 3P4OB 2C3GA 1G7MB 3GLDA 5FYKL 3T3ME 3CDCA 2J55A 2DQDH 4P4KB 4K7FB 1C7SA 1ZIAA 2YSSA 1JVOA 4AQ1A 3OHMB 4ELMF 5DRNB 3IDIA 4KVPA 4PJEF 4D0CA 2CH8A 3I50H 4QOKB 2KS0A 2R8SL 2Z4QB 1DTUA 3ALPA 1MEXH 3TONA 5F9WB 3RAJL 5L2JB 5BRQA 5E99L 3GJFH 4PYGA 3ZKNC 3L9RA 2OW6A 4XPGH 1ZV9A 5B38B 3H7BB 1RAMA 3QE5A 3WFZA 2AP2A 4V1DE 4Y4FD 4N2DA 3FDWA 3MVSA 5KBPA 1TO4A 1ZOXA 3TEUA 4MNQE 4KXDA 3S8FB 4HU8A 1KXHA 3PNWB 3BGFB 5ADPL 2H32B 3NZHH 5IOPB 3E7JA 1WFUA 1MDAA 1UZGA 5EO9A 3OKDA 4NO0D 1T2JA 5C6TL 5CFHA 1J10A 4EAEA 1SYVA 2IGFL 3GJFA 1JYWA 5DK2A 1L7IL 1G94A 3KDMB 3ZTCC 3VD2A 2RBLA 4ODUB 4BFRA 4Q9QH 3MDJA 5E6ID 5J57B 1JPFA 5I6KA 3NEOA 5SWQA 4Y9EA 1NDGB 2ODHA 5A6IA 2AJYL 4HETA 5EBWB 2VAJA 3RG1C 3ELAT 2DEWX 3KM2A 1JWSA 3IGAB 1TVBB 3GLAA 4PRBB 1W8EA 4KKAC 5DJ6A 5ACZA 3RDTB 2OXHB 5MEPA 3LN5B 4AYFA 2D31A 3OR6B 4Y4KB 4WTQA 4E9WA 4FQ1H 4DETA 1MFBH 4NHUA 2OFQA 5D7IF 3FH8A 5EUOE 3H55A 2FL5A 1F6AA 5CEZL 1M53A 2EYRB 1YUKB 5K9OA 3S9DB 1OARL 5F8RC 3II2A 3JTTB 2APBA 2LLNA 4PVMA 1KWGA 2XLLA 3OGCB 3MRRA 1W72H 2BHZA 3FO2A 3O6MH 2ZD0A 4IEFB 4X50A 5D6CA 3G08A 3SE9L 3T3PF 3ARFC 3NRQA 5DJ2A 3AM8C 4U1IA 3CGTA 2OJZL 2VR6A 1E42A 3IXAB 1HINH 4PBWD 2EDXA 3FSVA 5F1NA 3UGXA 3ZY7A 1RZ8B 5TPWH 1UB5B 2F54D 2VKXA 2WAHA 1MW3A 1BZ7A 3BUDA 3VXSD 2GQHA 1N6QL 1LWHA 43C9A 4UT7L 3OAYK 1ZLWK 1FE8L 4NQXB 4L23A 4ZQKB 4CC0A 4QRFA 4AJYV 3K46A 3RAJH 4H8VA 3OG6B 5E1HB 4L8SA 4P5TD 4Q0XL 5TTRA 3L4XA 5DZJA 1TEYA 5T5FL 2QSTA 5KYXB 3E1F1 1DVQA 1JD9A 1X5ZA 3OLDA 4LIQL 4JNXA 2YKKA 4YOKA 5C0BD 2VQUA 4WW2F 2OMYB 4IGBD 4JGJA 4GFXA 4QRUB 3U4EB 2GABA 3HE7D 3VXOB 2IJ0C 3EDFA 5JORA 4RA0C 3B2PA 3CFKB 3CVBA 5C6TH 3ZR6A 3KR3H 3LH2H 3P4OA 1IM3D 1AKJB 4J1UB 3ZTJG 3CU1A 3VXRE 3ZHKA 1NPNA 4LARL 4Z8FH 2CRIA 1T04B 5DJDA 4HFWB 5GHWH 2APVA 3QJZA 4NT6B 2AJYH 1JHTB 2YAFA 2YN5A 5D1QB 3KS0J 4QT5B 1P1ZB 35C8L 1W0WB 1ZVSB 2AXGA 3RTLA 5L2JA 5FUOL 4U7MA 4MJIE 1FQ9C 1RIVH 2B1AH 2WXIA 1A1MB 3H7BA 4QHUB 5E5UB 3TM6A 5C8JA 2E7CA 4OCRL 5KYYB 3O2VL 1K5NA 4M9OA 5C0RL 4HG4J 3GXIA 3Q8FA 4HCRH 5GSVB 3PNWA 5IW3A 4G59C 4AUYA 5B8CB 1OARH 1Q0YL 1I9RH 1NJ9A 5C0CE 5IOPA 4HT1H 4PJFA 4TXVB 2PTVA 3OJ2C 2VJXA 4KTDL 5FA3A 1EXHA 3L5HA 1EJOL 4G6ML 2OXGB 2K1MA 2Z92B 1KGIA 1U3HB 2RH0A 1EHKB 3VYOA 5MEOA 3KDMA 4HEPA 4P59H 2OJZH 3P30L 1FF5A 4WK0B 4ZS7L 4HCRA 1C1EL 1G1KA 1S46A 2ZG1A 4ZS6D 1NPJA 3AY4C 1CGWA 2ZNWA 1NBQA 4PG9B 3DX7A 3QEGL 4YBHA 5DK3A 2XXFA 1ICTA 4Z7VF 1B2WH 2WV3A 3S98A 3U36B 3BUTA 5FCUL 5IT2H 5HGDB 3REVA 5KVEL 3CXFA 4HD9A 1I9IH 4IOFD 3LN5A 3F62A 1SHXA 1JK9A 3L4VA 3VAEA 3SDDC 4NJ9L 2BW4A 1YEKH 4M48H 1FC1A 3L3DA 4U1HA 3T3MB 1FPTH 3KD4A 2EYRA 4WLCA 1EDYA 1WAAF 4ENED 2WBJD 4IBWA 4AQOA 2LU4A 3B2VH 4G42B 4RAVB 4LIQH 4Y4HA 2Q6WB 2E76C 1QKZL 2V2XA 3FQ2A 3NCYS 4MA8H 1JZ4A 5IIEB 1KN4H 3L3IA 2QV2A 3QXDB 1JF6A 4G9FE 4IEFA 2ED8A 4FLQA 3CMGA 3HMXL 3LS4H 5BZXA 4P2QD 4WUKH 5ABAA 1EPFA 2MPAH 4OF7A 3KHQA 5I0ZA 3WJMA 1AD9B 3STLA 4J12A 4LEBA 1CFTB 1J86A 1VJSA 3O2DL 4V1DB 1L9PA 4OFYD 4OJYA 2NY5C 1U41A 2NY2B 4GUPA 4R0LB 3KWWB 4MNQB 1RUQL 4BKLA 1RSFA 5IQNA 4NQXA 1AD0A 2E7HA 2YUVA 1KB9J 4HW6A 5ALBL 1IKFL 3JZYA 4LPYA 4LHUB 4MD4A 3M1BB 3D4ZA 2NDGA 5FUOH 3CH1A 4N2AA 5L7XL 4WEBL 4ZMVA 1WRFA 1CYWA 4LRIC 4KJWC 4OCRH 3ZVVA 4ZFGL 3SBWC 3FTUA 1Y07A 4NM8L 4FXKC 2OMYA 3UH8A 5E2TH 3WUWG 4D8PB 4QHKJ 4HPHA 1E27B 4ZAKC 2FR4A 4KJPD 1HHGB 4XAKD 3VXOA 3L4CA 3CFKA 5F7KC 5GGQL 2X4UA 5ANHA 2HJLB 1J5DA 3HTLX 3UIYA 1YUHA 4K8RL 4MJ2A 1AKJA 2BVTA 3D6GA 2P5PA 2EEBA 5EUOB 1OCOB 4LGSB 1IKOP 1G7IB 5J1TC 4HFWA 3UYRL 4NT6A 1T4WA 1TZAA 1Q94B 4EIBA 5HYQB 3WKPA 3K71A 1LK2A 4QT5A 4AKPA 3QRBA 1ZVSA 2O5NA 3NZSA 4BFFA 1PIGA 4OBRA 3LNGA 4PI2A 2NX5D 2C9UA 4JN2B 5D7LA 3LKNA 4LRNL 3TO4C 1CFNA 1QFUL 1UT1A 1NQBA 3HC2A 1Z9MA 4GQ9L 1OEZW 4OCSH 1DYZA 3JT0A 1XF5B 2ZWSA 1XV8A 4HH8A 3QJUB 5DUMH 1I8LC 3TBSA 5BW7C 4OJAA 1ED3A 2I24N 4M43L 2HUEA 3U6RB 2EKJA 1U58B 2L7JA 3IT8D 2CO4A 1ZLVK 1U8HB 5KUMA 1NMCC 2A83A 2NUPA 5ITBL 2OXGA 2R2BB 1LMIA 4DO5A 5K59E 4ONHA 4OZIF 2P8PA 2F18A 1HQ4A 2OW7A 2HFEB 2VDOL 3SDCA 1MFVA 1KIQB 2FSDA 4H88H 1ONQB 4ZMQA 1AQDB 2WKGA 3RIFK 4F80A 1TZGH 1P4IL 2APTA 2A73B 2VSCA 1MHPL 5FO9A 3T08A 4UAHA 3SCMB 1AHWB 3BXNB 3PWJA 1ZLUH 1RUQH 1TSHA 2I32A 4KK5C 4CADB 3PL6A 4JKKA 4U1JB 2ZOWA 3ZKQD 1IKFH 1K8DB 4L8DA 2ZWKA 1L3WA 4GKZA 3BO8A 4NZRL 2GJZB 1UZ6F 4XMZA 1R5IB 1EBAA 4LSUL 2BS8A 3RTQB 1OO2A 4JUSA 1KBBA 3WIHL 5L6YH 4S0TD 3V5HA 3SODB 3SYQA 2BPBA 1V8HA 4WWKC 1DLHB 4ZOEA 2VDLH 1RI8A 3CQFA 1KDIA 1SDDB 4O02L 4IMLA 3NFSL 4H26A 4MJIB 5CGYC 4Z95H 1GXEA 4XN4A 4X7FC 1KTLB 3QZWB 1JZ2A 2F54E 4FJYA 5JNYA 4PJBE 1QG3A 1EFXB 5E24E 1IAIL 1SOKA 3VFOB 3VXSE 2BVPB 3KWWA 3OQ3B 1W6WA 2F7QA 3MNZA 2Q3ZA 2C5DC 1GW6A 2XN1A 5C0CB 5I1GH 5EDSA 2GSGB 1F6LL 2J8UF 1TYRA 2BOLA 2WGXA 2ALAA 1MFEL 3UYPB 1HEJC 3QNFA 4W68A 1KCUH 3T4AB 3VXTA 1QFUH 3GD1C 5JHBA 4KRMB 1ASOA 5CJOL 5C0BE 2LLGA 3MNWA 4ZTPH 4BWUA 1KCBA 4L37A 4NRXB 2I85A 1E27A 4TQHA 4BYHA 4F15C 2VDPB 3PGDB 2LV4A 3ABZA 3SE4A 2QLYA 3WL9B 4HUKB 1S2EA 2CJTA 3HZ3A 5LVEA 2FBRA 1T0MA 1OK8A 3GM8A 1BWWA 3FU0A 4JZJA 2FSEA 2HJLA 4R4BB 5AL0A 4QXTB 1XB8A 5I5IA 4KJQD 3EHBB 4FXGB 5EUOA 5C0AB 4MSWB 2JB6B 2NY0C 5I17B 1IC0A 4O4YL 1NINA 1KFAH 3VQ2C 2CO7A 4LP8A 1UACH 4BK8A 4Y16B 2H1LM 3WJLA 3SQBB 5IW6B 3MRCA 1A7PL 1XB6A 4S0SD 5GGRY 4G9FB 1QLEB 3CZJA 3H6JA 1MWOA 3OXSB 2P5EE 4IIQC 4HHAB 1PNDA 2SEBA 3NUKA 4JN2A 4IU3B 2EVFA 1LQBC 2VLRA 3L4WA 3ULAB 3B9EA 2E4TA 2BIPA 1X3DA 1YEDA 1SDAB 3VUAA 2P45B 2RALA 1OPGL 2VWEE 1OQOA 2NY1C 1XF5A 2BSED 4UINL 3ZZSA 4P49A 3DTXB 4BFGA 5ICZA 2WB1A 4JS7A 4OD2B 5J6HA 5LAXB 1QVOB 5IQMA 3NRPA 3AG3B 1JGLL 3U6RA 4NZJA 2YAQA 2K45A 4LL1A 4DEPC 1GPOH 3S48A 4MNHB 4EI5D 25C8H 1XF4A 3W38A 3AREB 4U1GB 2VUYA 1MAML 2N0KA 2EUXA 2W38A 5GJTL 4AQ1C 4PRDB 3DJRA 3ZE2E 2V7HA 4HUVA 2ZKYA 3LH9A 1ZTXH 3MN8A 1RZKL 3BQVA 1WZAA 3UPAA 4NP9A 4DVRL 1XVSA 3RVWD 1FRGH 5AG8A 1XH3B 4UAOB 3UBXG 2XWJA 5CM1A 3EH2A 1OTUC 1PZDA 3IE9A 4NYLB 2C1PB 4C47A 2CLZB 4HKJA 1BYOA 4YEFA 4U1JA 1R1CA 4PVLA 4HEME 4MKTA 4YXLL 4LQFL 3ME0A 1R17A 1NCAL 5ELIA 4JO2L 4YSTA 3X1BA 1DQKA 1YNTF 1WBYB 2ZXGA 4WDIB 4WY7L 3IMWA 2FDBP 1P4UA 4HZ1A 5IB5A 1QI4A 3EYFA 3MLZL 1A9VA 3KNBB 1QWUA 3DOSB 1U8JB 5FGBC 3RTQA 2HCZX 3QIUA 3VI4B 4JKPH 2XJKA 1WWCA 4L0YA 3MNMA 5BZDA 4WQOA 5G5DB 2WJ5A 2GFBA 4U33A 1SOXA 3FNKA 3QWOB 3AZUA 4P2QE 4DKTA 3FCBA 2IGTA 5IROA 1T03L 1SDDA 4MJIA 3HR5B 4NJAH 1UTDA 1KTLA 3QZWA 1QEXA 4Y4FB 4RFOL 1N0XL 1NL0L 1J5HA 4I48B 5TE7L 5KW9L 1KCVL 2DJMA 2BVPA 2BP8B 2CNZA 3VFRA 1E4WH 5C0CA 5L4MA 2WSPA 4OJEH 2GSGA 1RP8A 1TYJA 4NO0B 3EOBB 1XXFC 3VM7A 5CJQH 2AJSH 3NFPA 1ZE3H 1FUNA 3HZVB 4GPVA 4QRTB 4HWZB 5E08H 1BQSA 1N18A 4JFOB 3VTTA 2BP3A 2QMJA 3HS9A 2F5BH 4GFTB 4H8HA 4DP7X 3NZUA 5E6IB 4MASA 5FAAA 5L9DL 4AIXA 2D03L 1KIRB 2DQCH 5CLWA 1BREA 3PWUB 3FMGL 2AAVA 1PDKA 3VRLE 4DT2A 4R5VA 2GJRA 4HJ0D 3VD9A 3LB6D 4XAKE 1SJEA 4PUBL 4YDKL 3THML 4B96A 1EGJH 3SKOB 4XXCA 1Q0XH 2AXFB 4QRPD 1S7TB 3MU3A 3DXAD 1U8LA 4QXTA 4ATWA 1U8NB 1UWEH 1J9RA 3OX8B 5IHUH 4H44C 2IQ9L 3SPVA 3X13B 2ICWB 2E7BA 3CVHH 4NQED 5C0AA 4GI8A 4LE8A 2XBDA 3IXTB 5GJTH 1OT4A 4UV4H 1PZBA 4ZUUB 4YDLB 3WFHA 4GYBA 4Y16A 4J3OG 1HE8A 3V4LA 1WS7A 2KHAA 2E8YA 1ACZA 2WXPA 1O6VA 4L8SC 4PWGA 3KM1A 4HHAA 2R1YB 4A7UA 4YX2H 3CVHA 4YXLH 4MDRA 4G6KL 4G1MA 5IESL 4J6RH 1MY5A 3RY5A 2F54B 5AW5B 4M8UA 4PJBB 4LVHC 1HHKB 1H6EA 1IBGL 1P4BH 2DQEL 3ARTA 5LAXA 1SBSL 3VXSB 3IMRA 1MCWW 3IGUA 3CSBA 4XCFL 2Z93A 2J12B 5DYOB 4OGYL 2R9HD 2D2OA 3WNJA 3K81A 4M6AA 3MUUA 4LLMB 4CBPA 4DKFH 4WFED 4F7MA 5F8QC 2DKUA 4O2FB 3RIAK 3ZPDA 1T03H 4P5TB 1O5DT 2RB8A 1KGCD 1JTPA 1GYWA 1J1PL 5FO7B 3ECQA 1GHFH 5EF2A 4HWBL 1E30A 5BVPL 1L6ZA 1WGVA 3W0WD 2DYPA 5C0BB 3PY9A 4XGZB 5KW9H 4IGBB 3G5XA 3QQ4B 1VGKB 3V4PL 3ULUE 4OLVH 1NGWB 1CD1B 3MXWL 5F9WC 4DH2A 1NCCH 3FN0H 2CLZA 1UD4A 1AGEB 1KB5L 2V9UA 3FS9A 3RWIB 4LL9A 2CBOA 3A3YB 4W9ZA 1G6RH 2HPTA 1JS4A 3L3HA 1IM3B 3ZTEA 1WBYA 2EE3A 2XWCA 3ZHFA 4LKXA 2VM3A 2EEFA 3BGFC 1NFDE 1VFAB 2V33A 2WNGA 3W9DB 3HW7A 5DZOA 3VI4A 5CP3A 4N86A 2HLAA 4QYOA 4OQTL 3EGSB 3TJHC 3FMGH 3BP6A 4OF0A 2MOGA 1G6RA 3VGAC 4AVIA 1GSKA 4PUBH 4YDKH 5CCKL 1S7XB 4TULH 5CR1A 2DL2A 2Z7UA 1F5WA 3Q1SH 4OQ1A 4Q4IA 2P5EB 2GJ6D 4X7EC 5DZPA 3U9WA 3V6BR 3QHZL 5FYJH 3TURA 4ERSL 4Y4FA 2WQUA 1I8AA 5FFOA 4YDJA 1R4XA 3BUBA 2WWOA 1NCDL 1BWMA 5J4MA 5ESVA 4KJYA 3L16A 3PU7A 3L5IA 1FN4A 4PGBB 3K2IA 1AY1L 3GO1L 2ORBL 3RDTC 5INDB 1NMBL 1ECYA 5EIIA 2DQTH 4OFDA 2IVFC 1X5KA 2BSDA 3N1FC 4HWZA 2QPSA 4ODVH 4YHKH 1Z5LB 3LSOB 3FFCD 3V6FB 5IFJA 4CNIB 1ZSDA 3L6FA 5F21B 2BS9A 5IGXL 1FGVL 4P2OA 4JX0A 4PSRA 1S9WB 4Y4HC 3KPQA 1BJ1J 1THCA 3ZE2B 2CR3A 4B60A 3PWUA 1IV8A 1IBGH 2DQEH 3GSOB 3HI5L 1I8KA 5DVPA 4V11A 1GZQB 2AXFA 5F1IA 3MREB 3GBNL 1IEAB 2WPGA 4MB5A 2WGNB 3VXME 2ITEA 1L6XA 4DHLA 4MA7L 3TIDB 3X13A 1MVYA 1REIA 5B21A 2YEVB 1QSEA 3IXTA 5DJZA 4AGNA 3AAZA 4OLEA 2QDWA 5L4FA 4P4RB 4KNQA 3TXAA 3MLTB 4HWBH 3SE3A 4J27A 2WZPA 1XCXA 4TVPH 1EV2E 4ANUA 2HA1A 2X4RB 2Z31A 3GIZL 5L8KB 4QGYA 3U7YL 5JHDD 5FYKD 4R26L 3N9GL 3D4CA 1MPAL 2R1YA 1T89A 4AYBA 4B53A 3MRQB 2LFEA 3IDGB 2XTLA 3KE0A 3OZ9L 2JXMA 1CVRA 1I1AA 2NTFB 3GXTA 4RFNB 5ACMA 1PX3A 3U82B 7PCYA 3KLHC 1SEBB 4XAWH 2GBUA 2FB4L 1P1VA 2OSLB 1ETA1 4JFSA 2BDNL 4LPTA 3VXSA 1U8OB 2VDKL 2FHFA 2XWTB 1VFMA 1MLBA 2X53A 3H9YA 1XSIA 4LLMA 4N5ED 3E2HB 1YN7B 4RGND 1R46A 4IQHA 1X9QA 4O2FA 4WWOA 5I73C 5CEYB 5LWYH 1ULVA 1CXLA 5EULV 2Y7QB 3O6LL 3IB4A 4JL2A 5D1QC 1DVYA 1MFMA 2YLKA 3B5TA 3JV4B 1AKPA 2I9LA 2P52A 1VGKA 2BWQA 3QQ3B 4FXLA 4MZRA 2Z3FA 1HKLL 2VXVL 3FOLA 3G9VA 5F3HB 1TNNA 1AY1H 3GO1H 4WJKB 1CGSL 4WUUD 2FIRT 1JN6B 4DZ8B 1EEZB 2DD8L 4PMFA 1SOSA 5AB2A 2UZPA 3FFDA 1MWAH 4XP6L 1NLBL 2ZUUA 3SYAA 1SEQL 3MUZ1 3VYNA 2ZG2A 1EZVY 1FGVH 2OBGA 5JOPD 2C1OB 1U3HC 4GW5A 4XBPA 1RIHH 4DWHA 2BSCA 4Q97A 4KROD 1S7XA 2BP5M 1MWAA 3SDCC 1UUSA 3TN0D 1JZ8A 2OMZB 1QHOA 5CEZD 1S3RA 3F12B 2P5EA 3L5JA 3MGOB 3GBNH 4M8VA 2XPGA 3RBGA 3Q2NA 4DP4X 3OKOB 5K39B 3RNQA 1TFPA 4Z3JA 1VZGA 1YNKL 1X6NA 3CFBA 3VGGA 4KRPC 4NKIH 5K9KB 5KUKA 3R19A 5HDWA 2J3SA 4FP8H 4KI5C 3PL6C 4DN4H 1ASQA 4GKNB 3GIZH 1LWJA 4R26H 3V6FA 4OT1L 2HFGH 4E5XG 3TFKD 1F18A 1LWRA 3P4MB 2X9ZA 1KJ3H 5GRUH 2E75C 1S9WA 1LYQA 2VXTL 1XL4A 3C9NB 1BZ8A 4K15A 5AW8B 1DSFH 3BEVA 5D1ZA 4OI7A 1GKEA 2PLTA 3F7PC 3GSOA 3DO4A 2KBGA 4N6RA 4EQ2A 3CVDA 3HA0A 2PWEA 4QRPE 1FZKB 3PQYA 3VFMB 3DXAE 3PV7A 1IEAA 4YQXL 5I8KH 4R7DB 1YO4A 3MUJA 4NQEE 1SN0A 2NY2C 2LLLA 1OW0C 4TF4A 4R0LC 3NABL 4XMKH 3GMLB 3UAJD 4P4RA 1NFDB 4HC1H 4OZGA 2ZKWA 1X5HA 1WC7B 2H2SC 3BVNB 2X4RA 4UQIM 4B9JA 3K2KA 3QZNA 2EDBA 3Q0HA 3T6ZA 5IREA 1X7TA 2VXVH 3SKMA 1SRDA 4ODSH 1JBJA 3CN4A 3D87B 3IDXL 4Y2OB 3QISA 5D2LA 2HX9A 2CKNA 3KDPB 1M1SA 4G8GA 3V0DA 1QHPA 3S3BB 3MRGB 4HC1A 3I3EA 3SE4C 3VX1A 3SZ6A 1G4MA 1H9VA 5EA0H 4KK6D 2EDYA 2Q2LA 1VDGA 3FCUB 4G7VH 4APQB 3UGEA 5F1SA 4M7JH 3P0VH 4WI6A 2M83A 5HPMB 2D9QB 2W07B 1SQMA 4C4KO 3EGXA 1U2YA 2E0PA 5CEYA 1T1WB 3GI8L 3WKML 1FL5B 4Y5VB 3HC3L 4TVSa 4Q58C 2CIKA 1DVFD 5FGRA 3GZOA 2IBGA 2CCVA 3IAQA 2XDHA 4A2LA 2WCSA 3QJXA 3WJLC 2NDFA 3MCLL 4MLSA 4QHMB 1XMWA 4WENB 4ZOBA 3WS6A 1BEXA 2RQEA 5E8DH 3OSKA 1U3ZA 4D94A 1EEZA 3L3KB 4ZPVB 4LCCB 3IJSB 4UF7C 3VXMB 4Y9BA 2X09A 3FTXA 1H3XA 4HIHA 4ODHH 3RFZA 4BZ2H 1H3UA 1S7WA 2IAAC 2XC8A 2XFXA 3IDJB 3T1WA 1L4IA 3NCFB 5DFAA 5H37H 2UZYB 4X5XB 1QBAA 5CWSA 4CGTA 4PMEA 5AAMA 2LHAA 4BZ2A 1A6TB 4U6TA 1GGBH 2N1TE 2XZCL 4YQXH 3RA7L 3FRPB 5DRXA 1FVDA 3EFOB 2ZXAA 4ANVA 4PTTB 4N8VB 4MD0A 2GSIB 1J5IA 1ID2A 3D18B 3MXVL 3NABH 4YDIH 1I8MA 1OWRM 1BPVA 2P44B 3BP4A 3GSXB 5H37A 2ADGB 4POZD 4QI3A 5I1JH 3NDZE 4XE5B 1X4YA 2C4XA 4RFEA 4L4JA 4YZFE 4NZFA 1AGCA 4D9LL 2V3DA 3IDXH 3UZVB 2GEQA 2H1PL 2E7LA 4H20H 3DK0A 2C4FU 3RTQC 2YD8A 1F4WL 3AB0C 4PBVC 3QIUC 4AXWA 1WSST 2ISDA 3DX6B 4XVSL 3TJPA 4PJFF 1EO8L 4LNRB 4M00A 4KKCC 2GG1A 2WVSA 3E8UL 2X87A 3MOBL 3NCMA 5GRWA 2ZWZA 5DO2D 1KYUA 3OQRA 4HZLA 4JM2A 5EUKB 3VCLA 3QZBA 5IROC 2F1BA 1ZLSH 1MHEB 4L8BA 4ONFH 5F9OH 2JI1A 1ETZB 4HOMA 4HIEB 1IO4C 1A9BA 3GI8H 1HIML 1AP2B 1RZPA 2CHDA 2CDGB 3CC5A 4MZIA 3KWXA 4NBXB 4X8CA 5GJSH 3TV3H 3WIIL 4G1EB 3W37A 5B39G 1WAEA 4HGMA 1SJMA 1E9QA 3QDHA 4UMGA 3P40A 3TF4A 4GRMA 2PYEA 5JHDE 1S6NA 1F1GA 5FYKE 3QDJA 4K8RD 4EXPX 2CM6A 2DIAA 5HI3C 2N7AA 4YR6B 1P7KB 1RPQA 5EBLA 2IOMA 3KGSA 3BZ4A 1TJGL 1FNEA 3VWJA 1Z9LA 4M1DL 3IJYB 2BHUA 3UIZA 3MRGA 3VRIB 1DLFL 5LGHL 1N10A 4H1LG 1ZE3C 5KYUA 3DO7B 4XXCC 5EZPA 5L2KD 3U0WH 1F4XH 4PTUA 2BWIA 2XWBA 4CA4A 4RNRB 5EZIH 4CN4A 3F01A 1AFVL 4APQA 4CKVX 3L9EA 1E4HA 4K9EL 3EHBC 2W07A 2VXUL 3GGWA 4FXGC 3KGRA 2PYFA 5LBGA 5F93C 1OHZA 2L8AA 3U30B 4NKQB 4QRSB 3TH3T 1NBVL 3QEHB 4KRNA 4QXWA 2F53D 7PAZA 4K7PH 4Y16C 2QV4A 4OB5H 1OGAD 4YXKL 2I60H 3GMNA 3MXVH 2JI3A 3WAKA 3QUXD 3NJLA 4P23A 4WUUE 5C9JA 2FIKB 4U3CA 4QRPB 4BWWA 3ES6A 4E9RA 4KAQH 3DXAB 4LCCA 3ZE0E 4AENB 3VXMA 3NACH 4KTEL 5E00B 3LXBA 1A7BA 3EAKA 3KPTA 3LKSB 4NQEB 1M7IA 1S7UA 1F4WH 5JOPE 2A2QT 1G7PB 3B9AA 3CLEL 1V7ML 5FFGA 4XVSH 3T0EE 2MNWA 5CN2A 3ASNB 4S1SL 2UY7A 3H6AA 1J5OH 4XVJH 2FJHA 1YEEL 2OKMA 5AQ0A 4X5XA 5JXEA 1OAXL 1JGUL 3E6HA 3OAWA 4J2QA 5CEZE 1QYGH 1HH6A 1PAMA 1RMFL 3DIFB 3BYTA 2J73A 4FZEL 4LU5H 5F9JB 2YKLH 1FYHB 5FB8B 3QNXA 4DPBX 3FRPA 3EFOA 1PYWA 4PTTA 2PWDA 3M1OA 1P5VA 3L1EA 1AQMA 1OCWL 1IC5H 2DRUA 3LCYA 5A3IC 1DVUA 1JDDA 2VM4A 4BSJA 1G6VK 3VW3L 4NP4L 4CDHA 1MLCB 2ICCA 3V4VL 2AJVL 3PYCA 5KBNC 2EVIA 1BVLB 1GY1A 4FN0A 1OOWA 1IQWL 2DH2A 4LCYB 1QPXA 3DX8A 3NIGB 4HUCA 3DUUB 4MNGE 3EYQD 5BZWB 5DVOA 4M3KB 3RVUD 2DICA 1GJIA 1DLFH 3RGHA 1S3KL 2YQGA 4JFZL 4FEIA 1NC4D 3J2PA 4XOCA 3IBEA 5EU5B 4WU7B 4GINA 5AZ2H 3DVGB 5EUKA 1MCQA 3WV0A 2WVVB 4LSSL 1EHLH 3TU6A 3WO3B 5JA8B 4Y4FC 1BF8A 1UEYA 2VXUH 4HIEA 1CFSB 1G0YR 5E1AA 3OB8A 4YK4B 5GS3A 4XN7A 4N2LA 5C9KA 3W5NA 4ZX4A 1DJGA 3OKNB 4L48A 5F7DB 5SWSD 2VJ0A 3MX0A 4P05A 4OW6A 3FRUB 5DVKA 4KI5F 3SGKC 4S1DC 4H4NA 4JCWA 1U33A 1RJYB 3BH8B 1J88A 5H35A 3QHTC 3QXAA 3WFDL 5E6IC 4P2OC 2EE9A 1CLOH 5G4MA 2H5UA 4J4PA 1FORH 1QW9A 5EO1B 4OZFH 2NR6D 4PW9A 5FW7A 1XL6A 1SXCA 3HAEB 5CUSL 2VDNB 3IN0A 3U7WL 3DOIA 2X44D 2HJFB 3H9HA 4WI3A 3FCGA 4RNRA 3DMMA 3IJEB 1JTOA 4HYTB 4QGTA 5EFIA 1SXAA 1F58H 3MA7B 4L0ZA 2ADFL 1B2YA 4DP0X 4EZLA 1D9KD 4UT6L 4NPYB 3Q6GL 1EEYA 2D4DA 4DPCX 4W9FC 2G3NA 2J8HA 4JKMA 4XOAA 2HVKB 3SE3C 2EIDA 4M6OH 1E50A 3NCBB 4HU2A 5TDNB 2WBKA 5L88H 1OL0A 3GS7A 4DGIH 2Z31C 5CSZB 5CAYB 4KKLD 3LZFH 5EZLB 3ROOB 4XI5C 2XTJD 3TWYA 1AGDA 4RMVA 4NN5C 4U6VL 5BRZD 2FIKA 3DHMA 5AEAA 1SM3H 2A6IB 2XIBA 4ZYKB 2QKIA 5F0PB 1I1AC 5GZND 4PJHA 1XTMA 4OF5A 5KVDL 1IQWH 2A9NH 1RU9L 1J18A 1NBYB 1LP9A 4UZGA 3O3DB 1LDSA 5KVEE 2H2PD 1NEZG 2OQJA 3B9KA 3GXPA 5CCGE 1KYOK 3OKMB 1CMOA 3TC9A 4GXFA 5JHDB 3RZCD 4X4ZA 3LKRB 5EUOF 2BJMH 3D0LA 1EXUB 4GP4B 5EO0A 5I74B 5LGJB 1A7RH 2GKIA 2MCG1 5DVLA 5IQ7H 3CSGA 4FQCL 3F04A 3WKNA 2Y7MA 1EZLA 1IL1A 2F7IA 3HS0A 4PV8B 4ZDHB 5EG6C 2VZ3A 5ENWA 3KLDA 5I6NA 1KGYE 1TQWA 3QPXH 3IAPA 2P46B 2HX8A 4XO3A 2W81C 4XWOC 3D39D 5D1XA 5C7ZA 1DFBL 3GKWL 3U9PH 1Z66A 5HHVH 1BVLA 4Q8BA 4OCWL 2PW2A 2Y69B 4QHPA 2C7UB 2XRAH 4O9HL 3M17A 3DUUA 3R18A 4DUXA 4N9GB 2EH7L 4QIRA 5EU5A 4YHOL 1SJVA 3K91A 4X5QA 1IAKB 3U7WH 1QNZL 3NVQA 1YECH 4PJIE 4BHUI 2VXQH 4BZ1H 3NBNA 3D85A 4WUUB 1ACCA 4AEIH 4ZUVB 5I1IH 1CDJA 3P02A 1FGNL 2CUMA 4IM8A 2R29H 3QC6X 5D4QA 1CFSA 3ZE0B 2E9IA 5M95B 2VWEC 4YZWA 1W80A 3GBML 5FUCE 2RQ8A 3FSZA 4X4MA 1HH9B 1OE2A 5F7DA 3PDOB 1YVLA 2IG2L 3RL1A 5IB4A 3T0EB 2OI9B 2VXQA 1USQA 4QKXB 4BZ1A 3BPLB 1JPST 5HVWA 2KERA 4FRWA 3RVTC 3GJFK 4AGQA 3BZFA 2AEPL 3P0YL 4KROB 4PJGA 1E40A 2R29A 3WE6A 1BD2B 4F7EA 4YUEL 4MMZB 4FQQB 1JWUB 4HBCH 4W4OC 3BIBX 4ZD3H 1NGYB 5D1ZC 2YQ2A 3OGOE 5F0LB 5KVDH 5E7FA 2XA8H 2XV2A 4PJXE 3T6XA 5L2KE 1A8JH 5A2FA 4JFUA 4R2GD 4TNWF 3RILA 3RGVB 1DBBL 3CFQA 4WKXA 4F1SA 2Z6FA 1FSKC 3MA7A 3QJTB 4U1MA 4KXBA 5D72L 1W15A 2O6DA 2JH2A 4ENEC 1DUZB 4X8GA 1A4KB 2F53E 3CZEA 3BCFA 2Z35B 4UU9B 4MNGB 2BY1A 4O58L 1OGAE 1KZYA 3REWB 1UH2A 1OAYH 4YE4H 2XWZA 4TUJB 4PW3A 1OAZH 5IBUG 3RWJA 3MRIB 1UH3A 1AZCA 3AQXA 1W0YT 2A6IA 3SGDH 1DFBH 4RFNC 5MEND 3MAWA 3ML8A 4OCWH 2GPZA 5E5RB 5HJGA 5TQ2L 2YGPA 4AGLA 4JDZB 4GIAA 4O9HH 4WSJA 2DBLH 2FH6A 3MPCA 1IMHC 4P5SA 4WV1B 3E2HC 1IBZA 5IVOA 3U48A 2QQNH 4ZMLA 5C97A 3V52L 3LKRA 2K6YA 2FZ3B 2FEDD 4PR5B 2HT4D 2BNRD 5LGJA 1PJWA 1SFHA 3GK8H 4HWEL 5CD5C 3H4FA 4NHCH 5DMJB 4JO5A 3JWOC 4JAMB 1UWGL 1MCHA 4UT9L 4PRHD 4FQIH 5I9QC 2V0AA 1FFRA 1HSAA 1QWNA 2ZUTA 3DTUB 2J4WH 2RAMA 1JFHA 3JXAA 2ZCHL 4HALA 2OSWA 4N1HB 1XFPA 1BVOA 3V0EA 4LFHD 1U8IB 2BCKB 4K5NA 3EH1A 3TBYB 3IU3B 4LSVH 1J0IA 1M56B 3I6LD 1HN1A 4WW1B 2VR5A 2CJUH 1IQDB 4V2BA 1DVFB 4DN3L 3TH4T 4JK0D 2A1WL 3S0PA 1TT6A 4XMPL 1KIUA 4OGXL 2EYTA 2Y4SA 1C7TA 4R4NC 4KZEH 3QWNA 5BMFL 4I5BB 2ODIA 3F85A 5GIRB 3OWRA 3HS8A 3VTAA 3HE6A 1A7QH 3GSRA 4W9LC 1FIGH 1XGYH 3PV6B 1QBLH 3FN9A 4RGOH 5AVSB 4YHLH 4LASH 5D72H 5DS8B 4ETYA 2WINB 1DO6A 1HH9A 5SWSE 1DJYA 4JFEA 3EOTL 2WLIA 3E9UA 3PDOA 4RIRA 2WWMD 3FUFA 1ERNA 4FEMA 4MHHI 4O58H 3T0EA 1MUJB 1I4FB 2O30A 3FCSA 4HIIA 4AJ0A 5B3JE 4OJCA 2BRRL 1NIBA 3P3YA 3FUKA 2ARWA 3HG4A 1KGXA 1BD2A 4XMUA 3MACH 1UHVA 3ZUCA 5IR1A 4IW4C 4YHIA 1AG6A 3KBPA 5SX4H 3VI4F 4NGHL 3IVKB 2W88A 2BMKB 3KYMB 5DHYA 3O11B 3ULUC 1D5XB 3HRZB 3K74B 5F7HA 1RULH 2RTTA 1ETJA 4N0FB 1VRSA 3RGVA 2P48B 4G6AD 4Z3IA 3DUHA 5C0FB 1CGUA 1HJCA 2CRYA 4LL4A 1IM9D 4RGMC 4OV6F 1DUZA 4PRID 4HA1A 4RMTA 1AQKL 2GT9B 4HVBA 3II1A 5AVVB 3SHSA 4C83B 2F61A 2YAEA 1VZIA 2N01B 4GMSL 4Z1PA 3OF6D 3BRFA 2FHBA 4OF8A 1VSCA 1JZFA 2XTJE 5HDLA 4NS0A 5K59F 3V7MA 5BRZE 4PJIB 1Q72H 1SHMA 2YD3A 2AS5M 1XXDC 2AQQA 3MLVH 3VWJC 1RJCA 2WNWA 3V0WL 1NWPA 1I3VA 1UASA 5AOJA 2CLVA 1BDYA 3BD3A 4JDZA 1W91A 2J71A 2YMXL 3GHBL 4KX8A 1OF2B 2DQUL 1J9TA 3PFQA 5CZRA 5HJ3A 4APQC 4MXQD 2EEXA 3QJQB 3FU9A 3AU1B 4WV1A 4IBUA 4QLWA 1DQVA 2YRLA 3KYAA 4LPWA 1A7OL 3B7SA 3GSWB 2FZ3A 4PR5A 1QRNA 2DLFH 4XNMB 2B2XH 2KH2B 2YXVA 2KZKA 2ZYIA 1OB0A 4JAMA 1JJUA 5FIEA 1QFWM 1OF0A 4X7DC 5CHNA 4AIOA 3KXFD 1QR1B 4G8AC 4JPVL 4O2CB 4P23C 1AGFB 3EOTH 4PJXB 3A67H 2EC9U 1CICA 2B39A 2ZXEB 3D39E 32C2B 4LSQH 3RX9A 3VFWA 5L2KB 5KAQF 4LCCC 1J87A 3H3KA 4LSTL 4ZX5A 1LNUB 1UCBH 2EVGA 3EJJX 1WJ3A 2G5BA 2R2CA 1UGKA 1CPUA 3FO1B 4YLCA 2Z1KA 3N6YA 4POYA 1DVFA 5HPOA 5JIIA 4L2LA 1XF3B 2F53B 1OAQH 1T0PB 5DSCB 5IVNA 2L3BA 5DMKA 2ZONA 3DV6B 1DDHB 5F7WC 5GS1A 1OGAB 4JFQB 2P7TB 3ZL4H 1Z2KA 3VD7A 1XDTT 3QUXB 3Q6FA 2K3TA 1BFVH 2W0FB 3AU0A 5GIRA 4EUPH 1IGCH 2VDOB 3K4AA 1Q9KA 4G8FB 1UFGA 4OY9A 1CCZA 4QMEA 1MJ8H 2AERT 4NWUL 5DS8A 2ED6A 2OPCA 2V2WA 3MLXH 2D3JA 1H5BA 4JVUA 1JPEA 2EIZB 4E41D 3S4SA 3KPMA 5J7CC 2RHEA 4XH2A 2DIEA 2HT2D 3IK2A 4D8OA 4GMSH 3VJ6A 1JHLH 4EUPA 4IBQA 1YSOA 1E6OL 1DJWA 3NN8A 3D50A 3DYPA 4WHCA 1SXSA 3BWSA 4PRPB 2QJDA 3HIZA 5F88B 1TTAA 3WNLA 1OWWA 2CRMA 2AV1B 2FAUA 5E8PB 3RKPA 4FQXD 2ZP0T 1FNHA 3FT4B 2IPUK 3IVKA 4HK3N 4GSQA 3K1KC 3RVWC 3O11A 5I8CB 5GGRB 1D5XA 3G5YA 5GGTL 4PJ5A 2ATKA 2OX5A 5JLZB 5CZVL 1C5BL 1FZJA 1P7QD 3HMXA 3FQYA 4WJ5A 1A0QL 4XPBH 3LEVH 4YSDA 1OP3H 4AL8L 5KWYC 4RRPA 5KSVA 4O02B 5DJCB 2DTML 5FV1L 1NBCA 2ZJSH 2IALA 1A7OH 2UZIL 3VD0A 5IMMB 2YD4A 3QORA 1PG7H 4S1QH 5I26A 2AJZA 3CIQA 1OHQA 3DJZA 4N25A 2DWSA 4C83A 3K2MC 2W65B 4DP8X 4YLQT 1ZLUK 5T8IA 2OMXB 1NC2D 1O6SB 3O4LD 1K3ZA 4PJ9D 1SPDA 1NC4B 2VNCA 1BBJB 2OMVB 1N7MH 1E2VA 3ZHNA 5AG9A 4PJIA 4IKJA 4ZT1A 4KO6A 3RWGA 4PCKA 3N91A 4J4PC 5MENE 1BX2B 1KTCA 1TQVA 3ZE2F 1WIPA 1WFOA 2FTAA 4HUWB 4UTBL 1UB6A 2HTLD 1L9QA 3SQOH 4DKDC 3ZRFC 2FJGB 2HSIA 5SWSB 3IFLH 3TBWB 4YO0B 2BVUA 3DMMC 5IW1B 3SDXE 1TOXA 4XR8C 1E67A 1LE5B 2WLLB 4NX0A 4R4FH 5KSBE 1XF2B 4Q9BA 3SKNB 2BNRE 2BSRA 1JV5B 3B7UX 4PCSA 1AAJA 5EH1A 3CZGA 4I0PA 1PY9A 1E4XL 1ZSHA 3GS4A 3NEEA 3BUPA 4EKJA 3HBZA 1F13A 4OZGF 4PRHE 2CUAA 5CBEA 4KKQA 1XD1A 3INUH 3L7FA 4HJ0C 1QR1A 4PJXA 4Y89A 4YAQA 3HFFA 3MV9A 1RZIB 1MVFA 2IEPA 2QKIC 1PD0A 5D2LF 5KG9B 3G6JA 1S8DB 3QA3A 2H6PB 1PX8A 1T5KA 4WU5A 1D9KB 3FO1A 3I6LE 2QZ5A 1IILE 2F9BT 3T2LA 1CE6B 5AB9A 4XTRD 2ZOLB 4NXKA 4S1RH 5J12B 4F3FA 1LE9A 2EUVA 4U3SA 3WG7B 4ZQTA 3BAYA 1Q38A 3F7VA 3EBHA 4X5WB 3CFDA 1MQKL 5ALCH 5F7FA 2JKRM 2Z7ZA 1F86A 3RX8A 1XD0A 2HLFC 3MLPA 5HVFB 2XTJB 5FYJU 5LN8A 3QIBB 3OV6A 5BRZB 4LP4A 4RMUA 3UAEA 2XACC 1HT6A 4DTGL 2RGSA 4MD5B 4HFUL 3HS0C 3EXLA 1RK0B 4EIGB 3FQNA 2VLJD 2VRQA 1LO3L 1U8CA 3B3IB 3MBED 3QDMA 1PKQE 1A4AA 4JKWA 4Q56A 5CILH 1IX2A 3IFNH 5FYLL 5D1XC 3HKFA 5DHEA 2CDEB 3X3FH 1QI3A 3RZCB 2DEXX 4PRPA 3FT2A 2E6QA 3A24A 2AV1A 5E8PA 3US1A 3EO1B 3ZK0A 5TGBB 3FT4A 1OSZB 3K3QA 3U9UB 3D69A 2J44A 1PG7W 5DDHB 5KYWB 1HHJA 3EZJB 3SY0A 1ZXKA 3S97C 1XGQA 1DQDL 2FJFA 1K6QH 2XIDA 5GGRA 2O5XL 3DNKA 3BQUD 4UILL 2G2PA 2R83A 4NQDB 5BCAA 3D39B 5I8OH 5DJCA 2YFNA 2AK1L 1QSVA 4YK4C 3WXVL 2AJ3A 3IU4L 4FABH 4PRIE 2X6CA 1XWVA 4GXUM 4Y19E 1RCYA 4B9FA 4AQEB 2M8XA 3GMQB 1WG3A 1E7UA 4GUCA 5LAPA 3LXAA 3A4EA 1JPSL 1V27A 1MHHB 1BBJA 2WUCH 5EU3B 4NKDB 1ZT7B 1RHHA 1A6VL 4WAFA 4D7PA 4YEEA 5JHLL 5DD0H 5F1KC 4JJOA 4LLUA 1A6AA 3H7LA 4HJGA 4YSPA 4BD4A 1ZVNA 1FZOB 4XP4H 1T0NB 2WWKO 2OCFD 5AAWC 2DQHH 1G9HA 3C5SA 5FS5A 2FUTA 1ZGLM 1CIUA 2FJGA 3V0HA 3ULUF 4GAJL 3HLAA 3IFPA 4Z77A 3BEWB 5IW1A 1XH0A 4MTMA 3H2WA 4OUUB 3HJEA 2KT6A 5E70A 5E23A 4XPAH 1WIUA 2QPFA 1PZ5A 1UOLA 5LBSA 5EOTB 1MFAL 2Q7AA 4LLAA 3ZKSD 2MKWA 3QPKA 1ACYH 3IMUA 4DTGH 1NFDF 1GGYA 1U92A 1WDAA 3FH5A 4ZO7A 3R4RA 3I74A 5DJ0A 5ESAB 3UTTA 3ZYIA 1QA9A 3TJEH 4O2EB 3V55A 3KXFE 4L4TD 1CUOA 1J0HA 2IBZY 3NA9L 4L2YA 2ZP8A 2HKAA 3PGCB 3JWDH 1AMYA 4R2GB 4Y7OC 2XU9A 1CE1H 3BUYB 5B1BB 3C09B 2H6PA 1PSKH 4FMKA 4F2MA 4NQQA 3RYMA 2YPLD 4KVNL 4MJ6B 4KWUA 4KZDL 2XN0A 4TOYL 4Y7MA 5AZEL 2DIBA 4EN2A 1U8KA 1AR2A 2ZOLA 5CMAB 1G7LA 3AQZA 1CXHA 5ITFB 5C2BH 3MJ9H 1WUNT 2PETA 3LXCA 4B3VA 4PJAE 3LDBC 2NSMA 5HHNA 1DQDH 2Z91A 3LEXB 2ICEA 1NCWL 2CDFB 3JWNG 1XZWA 2ZUYA 5AOIA 4I2XA 1GCFA 3QIBA 5I74C 3O9WD 1MXGA 4LSRH 5AB1A 4JN1H 3EUDA 1VKXA 3DX2A 4UBDC 5A2CA 2HKHH 1DZBA 2PN5A 4CRPA 2H26B 5CKGA 4H5SB 1UXSA 5MENB 4MXWL 4M62L 3BAJA 1NAML 1RK0A 1PX4A 4FQHB 1PKOA 4E41E 2G5RA 1I75A 3B3IA 3MJ9A 4W70A 1R75A 5F7LB 5BO1L 1Y0LB 2MKLC 3L17A 3V4PB 4B50A 4YSQA 3GMOA 3IDYB 4L3ED 4PGDA 3S35H 1KB5B 1B0IA 2CDEA 4YSOA 3SDXB 1JPSH 3C60B 3GTNA 2EKSB 3GMMA 2BSSB 4IBSA 4MQXD 3WN5B 5FO8A 3RZCA 3BKYL 4PB0L 5KVFL 3MOQA 4YDNA 2IAND 4FXTA 2O61B 4FFTA 2AMUA 4B9IA 5IQOA 5I0DA 4RMBA 2BNRB 3EO1A 3NFNB 4X6FB 4XP1H 2GCYA 4WEUD 5JHLH 1I1RA 4BJLA 4L8CA 3K1DA 3OXRB 3OPZL 4GO9A 3ZRSA 1IBBA 1RLBA 2ZX8A 4Y1AA 1ML0A 4DUVA 5FF6A 5F7UA 5T1KB 3MLWL 1B3JA 1BFSA 4PRHB 4OZHE 1ORSB 2Y6SC 2VR3A 1QQDB 1PGRB 1FHNA 2X3BA 4J39A 3MROB 2RFXB 4NQDA 4MJJA 3Q8BA 3D39A 5FHAH 2F7RA 3PGFL 3HE6C 2HRPH 3KJ4B 4HPYL 4D9RE 5GRJL 2K6WA 5E94A 2R56L 4Z7UA 5CGTA 3O45B 5HHMD 4R5XA 1PEZA 2EDQA 1S7VB 3VH8G 5DJYA 4AQEA 3T0EC 5BS0A 3TEXA 3P11H 1MHCB 4NNXA 2NSXA 1M1XA 3BPLC 4MJ5B 1TU2B 3O4LE 3T09A 3ZSTA 4JZNB 1Z3GL 2VR9A 5ANMA 2B77A 3DUSA 4HLZH 5EU3A 1ZT7A 3I2CH 4BKTC 3ZKXC 2VXSL 3TCTA 5LGKA 4F57L 4GRWE 3CHXA 2CGRL 1TYEB 4IK7A 1OCRB 2GY5A 4XHJC 3MJGX 3WD5H 2OMBA 1D2OA 2F74B 4BZYA 5BV7L 1JUFA 4FI7A 1JNNL 3RGVC 5DQJB 4Y1TA 1DBJL 3FHQA 2CO1A 1NH6A 3L3GA 4LPXA 1QAWA 4FG4A 3SGEH 4KDVA 1XHHA 5I75B 2DQMA 5AUMB 1R33A 1Z9NA 1E5CA 1YAIA 3BZDA 3K6SB 5ID0B 1JPGA 5I19L 4MWFB 2EVJA 4S11A 5ESAA 5CKAA 1HWWA 3JT2A 1F41A 4L1TA 1NAMH 1SUJA 1IZKA 1Z0NA 3KLKA 4O2EA 1U93B 5TFSL 4KUCD 1UXWB 2GTWA 1O7DC 3X14A 4AYDC 2NNRA 2NY3D 1V55B 5CGMA 5E6YA 1X5MA 4UM9D 1A3RH 3NIFE 4Z5RB 1J8HD 2XKNB 4PB0H 4WK2B 5F7EL 3ET9F 1YMMB 1IM9B 5EC2B 5I16A 4MCMA 4PRIB 3AY2A 1A1NA 3KGTA 2VDKB 4Y19B 1ZD6A 3PWPA 3TA3A 4WV1C 1QO3A 2PPCA 3MLWH 3QFDB 4ICWA 4K3EL 5EZOH 3WNNA 5JIDA 2B0SL 1HHHB 3LEXA 3K5SA 2CDFA 2ZICA 3R1GL 1X5YA 4AV5A 4CAGA 2L0DA 4PB9L 1GIGH 1ZKAA 5CCHE 4I1PA 1K2DB 1ZPLA 4JG5A 2I9TB