3FN0H

Crystal structure of hiv-1 neutralizing human fab z13e1 in complex with a 12-residue peptide containing the z13e1 epitope on gp41
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
221
Chain Sequence
EVQLLESGPGLLKPSETLSLTCTVSGGSMINYYWSWIRQPPGERPQWLGHIIYGGTTKYNPSLESRITISRDISKNQFSLRLNSVTAADTAIYYCARVAIGVSGFLNYYYYMDVWGSGTAVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab Z13e1
publication title A conformational switch in human immunodeficiency virus gp41 revealed by the structures of overlapping epitopes recognized by neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H01
1DN2A 4L8CA 3GUTA 5DVMA 4YPGB 4WV1B 1RJLA 4HUWB 4LPXA 3EJZD 2EYTA 1JPGA 3QDJA 1EV2E 1PZ5B 3MRNA 4KVNL 4QHMA 3UTQA 5CEXA 4R4FH 3F7VA 4N0UE 1DDHA 3A67H 1YN6A 3VFPB 1KCKA 3X11A 1M05A 5IV2A 3U6RB 3V5DB 3EOBA 1HXYA 4OV5B 5D8JL 2J2ZA 3FB6A 4HH9B 3MRKB 3T4YB 1ORQA 1KUMA 4MNHA 5JUEL 1AO7A 1KNOB 2DQGH 3LQZB 5I30L 5GZOC 4U1MA 1EHAA 2VKXA 3T2NL 4KK6D 5E2JA 4M5ZL 3QO0B 4HULB 1ZT4A 5E2VL 5E4EB 2C4FU 3KPOA 3S88L 1JF6A 4WY7H 5HD8D 3HNTH 4BQ8A 2JJWA 4FP8H 4QGTA 4HIEB 1MWAH 1ZSDB 5DJZA 1HHHB 5CP7B 5TQ0L 5IHZA 3KJ4C 1GZQA 4V1DB 4Y1AB 4DUWA 5DD1H 1NEZG 3VXUD 3BDYL 3KPSD 4H5SA 1ZLVK 3S36L 2DB8A 2ZUYA 3NCEB 3QQNA 4HCRA 4MAYC 1DL7L 1LE5A 3EDEA 3WFHA 1BVKB 5GRUH 3VWJB 1FSKC 3BP4A 4NNPL 3QEHA 1U91B 1N64H 5KOMC 2YA2A 1WZLA 4HJ0C 1OTSC 3T0AA 4EDXB 4PJGE 2EDDA 3L9RB 4NN6B 3HAEH 4XPBH 3RX5A 4OT1L 4M03A 3FAWA 4M7KL 1DQQB 1U36A 4JANB 4RAVB 1LEGB 5HY9A 2ADFH 4OAWB 1KLFA 2GITA 2KKQA 4ZO8A 2D4FA 5GGRY 1WFTA 4NQCD 1C8PA 1BVZA 1KN4H 1X9QA 1SJVA 4UOW1 3SKNA 2MNUA 1PKOA 5HYQA 1UA6L 4XNYH 4LLUA 2W9DH 1GAFH 3L3GA 1P2CB 3PWNA 4G5ZH 2QKIB 4Y88A 3LV3B 3MNZB 5GSRA 3T8XB 5KBNC 2VZVA 1WT5C 3F7PC 2VRAA 2W9LA 3TH2T 2ZUQB 3IFNL 1FNHA 3P0VH 3QWOA 4JFED 3ZMRA 1G84A 1FL5B 1ZS8A 5ID1A 1ED3B 3D0LA 4JGJA 1JZ7A 3IFPA 2CUIA 2VISB 4M62L 1CT8A 3KR3H 3LN4B 1QLFB 4L4VB 2L7UA 3AY4C 1RZ8A 4QY8A 4HV8B 3WIHH 1OQOA 3U4BL 1QLEL 4YC2B 5JPNB 1U92B 3DV4A 3SDCB 3OR6B 2BNUB 4WFFD 3QUYA 3UTSA 2V2TB 4WW1A 5L6YH 1FBIL 5IVXB 1I9JL 4LCWB 3I02B 1RUML 5J9PA 4G7YL 4RMVA 3ZHKA 4XXDA 4P5KB 3O6FB 4NO3A 5E00B 4TVPD 1T83A 2AGJH 1Q72H 4HJJL 3KPLB 4CADA 1FVDA 1OAUH 2YD1A 2GTZA 4FQJH 4BFEA 4ONFL 5MENB 3W9DA 3FB5B 3UROR 1LDPH 4ODBD 1TCMA 2DMBA 1Q9OA 4Q6YA 1RULH 3HUJF 3T77B 2MCPH 4ORGA 5B38A 3OXRB 3SE3C 4OCSH 4Y4HC 5I76B 4TTDD 5CEZL 4DKAA 2P8LB 3EYSL 2Z8WC 3P77A 1MJJA 1GRWA 1HSAB 1B2WL 4U1IB 3FFDB 5BRZA 2BHYA 5IWLC 4O2EA 3U0WH 1MCJA 2VLMD 3HNVL 2XN9B 4NKIL 4RMTA 3TIEB 1PDKA 2ZCLL 5ACZA 4HKBB 2MHAB 2WBJA 3NIDE 1R0AL 4YX2L 4KQ4H 5DRWB 3OAYK 5T3XD 4QRRB 1TITA 5I1LB 2EICA 3FOMA 5EN2A 1A47A 3EFDL 4KVCL 3BGFC 3BXNA 3I9GH 2QQNH 1N0LA 4U6XB 1SYSA 5GGVH 3VMPA 4KH2A 3NN8A 4JPVH 2RCSH 3O41A 5C0DB 1QUNA 4KUZH 5TFSH 1FYTA 2BMKB 3X17A 2BY3A 6CGTA 1RVFL 1JE6A 4GQ9H 5CCKH 2J6EL 4U3CA 4RNRA 3PWVA 2EH8L 2VLJA 3MLRL 4XBGA 1A14L 3O8XC 1KF9B 5GXBB 1NGWA 4PB0H 5HHPA 2HMIC 1EFXD 3IRZA 3QQ4B 2BVOB 4N5EC 5GGQH 2CDEA 4Z7VA 4XPFH 4EUPA 1E4WH 5DZOA 1C5DA 5AWNH 1Q9KB 1LK2A 2WSKA 2A1WH 3NMEA 2HKHL 3SDDB 1HYSD 5F7EL 1DR9A 1T6VN 3I6GB 4J23A 1WTGT 4I0CC 4CMHB 2ZPKH 1OB1A 4FG6D 1QO3A 2ID5A 4NWTH 4LSPL 1A2YB 1H3GA 2DQFA 4Y4FD 4XVUC 4E5XB 4LPVA 2HG5B 4YBHA 4LCUB 3PWLA 3OAUL 5TF0A 1P84K 5I19L 5JOFA 3GUTB 1U2HA 2PXYD 5IFHH 4QOKB 3QCUH 4ZFFB 1K3ZA 2VB5A 2AXHA 5E8OB 4HZAA 4WI8A 1KB5B 3MRNB 4ETQA 2PW2B 4XNXH 5CJQL 3F7VB 2OZ4L 4JFZL 2IEPA 2OP4H 1DDHB 3LH2L 3ELAT 5D71H 1N5YL 1FRGL 4ODXA 3WD5L 3GFUA 4IOSD 3ARTA 1M71A 2DQDH 5LJYH 5FA3A 4I5BA 5I73B 5SX4H 1NAMH 4DW2H 3QAZC 3ULUF 3WFDL 4KKAC 3S97C 2CD0A 3MRIB 2YKLL 4NSKA 1ORQB 3JWNC 4MNHB 5I2IB 1FJ1A 3ZE0F 3DSNA 2ORBH 4HF5L 3PDGA 2RAMA 4YUEL 5EZOL 4YHYB 5C8JB 5KVEL 4U1MB 2XZAL 3LS5L 1XIWD 7FABL 3VXMB 1DLFL 5JQHC 4QTHA 5HYJE 4I8DA 1CDIA 4YWGH 1AC0A 1VFOA 1RJZB 2IWGA 3C8KA 1IKFL 3NCJL 4LSSL 4XP6L 1HK6A 2OM5A 4RIRB 1YEIL 1NUGA 3QEQA 4YQXH 4PGEA 4HXBH 3FFCB 1F3RB 4P2OC 2V9QA 3HI5H 4KKLD 5GGVY 5CFHA 4K3EL 3Q48A 4P3CL 5CJBA 1U95A 5CS7A 8FABB 2LVCA 3ARGA 1FGVL 3FO2A 4U1GC 1N6QH 2XQBH 5HVWA 4JHWH 4ZXBC 4AENA 1JRHI 2XQYG 3M8OL 3QO1A 5HY9B 1XGYL 1F00I 2Y06H 1G0XA 1RZKL 2P46B 3LDBC 4WENB 4X98B 1CLZL 1LO4L 3MJ9L 3SKJL 1OARL 3MREA 1P4IH 3T0BA 3ARQA 1KG0B 4LASH 3QFJD 1ZEAH 3MRDB 2X4PB 4IOFC 1NFDE 1MCSA 2F53E 4R9HA 1QZ1A 1A1MB 2FB4H 4OLYL 3ILQD 3O6KH 3C09C 1L7TH 2MKWA 2FHCA 5GSRB 3QB7C 4NOBA 3WEXA 5HPMB 4PLJC 4R90L 4QTIL 1SEQL 1UM5L 5ID1B 3CUPB 2J7LA 3D0LB 4QRUB 5J12B 4CGTA 1DSFL 3H2WA 3IFPB 3KXFD 1UJTA 3O6LL 4IEFB 3FQXB 4DZBA 3TJEL 2P43B 4K9EL 4NQDB 1EGJL 3HPLB 1DBBH 1CDJA 1AGFB 4KPHH 1CTOA 2W65A 2FJFA 5T1LD 5KVFH 4K94H 3B9KA 3IVKA 1NC4B 2IH3A 1WCBA 5F9DC 1T0NA 3I84A 1CQYA 4A2MA 1FZOB 1KCSL 3UTSB 4R7NA 15C8L 2AQ2A 3EHBD 4IDJL 4PJHE 5FECB 4J8RB 4UV4L 4M8VA 4ENEC 3ESUF 5TGBA 5ANMA 5DSCA 4O02H 4MB4A 4U1SA 1UWXH 3GI9H 5J9PB 1BOYA 4JPWH 2W91A 5FO8A 1S7UB 4HH8A 1MFDL 4WI6A 3MC0A 3G6DH 3G5YA 4XMPH 4D94A 3P4NB 3BO8B 4CADB 4G7VL 1FVDB 2CXGA 2AJUH 2GTZB 2OL3L 2C4XA 5HHXH 4P4RB 3VRJA 4OQ1A 1F4XH 3RDTD 1FE8L 1CGSL 3FZUD 1G7QB 4AEHH 3GMOB 3DX9A 2O93L 2HLFC 4NQVA 1C16B 1G9NL 2FEEI 3P77B 3QXWA 2XIDA 2AV1A 4DEPB 2R0KH 4NZUL 4O2EB 1S5IH 5D5MA 1NCWH 1PFCA 3JV0A 3IAGC 1EH9A 2WBJB 5I71B 2E27H 3VXRE 1S7QA 2N7AA 1YECL 4M8QB 4RZCA 5IBTL 5IHLB 1QHPA 3C87A 5JQ6L 2Z91A 2NX5D 4PRPB 1NQBA 5F44A 5GQBA 3FOMB 3AU1A 4LLQA 3VJ6B 2JJSA 2B4CC 1OD7A 1WCQA 5FYKE 3DROB 4UBDD 2H32H 3MGOA 4DN3H 4GJTB 1SYSB 2BCKB 1EUTA 3P11H 3O41B 1RUQL 3Q2CA 1M7DB 5BJTB 1MVFA 2P5EA 1T03H 1WIPA 1FYTB 3QI9B 5E6IC 2VXQL 5B4MD 5D6DA 5K93A 1FYHB 4R6UA 5DFWH 1QSFB 3TWCL 4RNRB 3PWVB 4N0FB 4PBWD 4WHCA 3E2HB 3DUUA 4M93C 4YBQD 5EIQA 1NGWB 5HHPB 1YMMA 3MRGA 3TP4A 3STLB 5D2LE 5HHMD 4DOHE 1JVKA 2NY2B 3ARDB 5A1AA 1FORL 1CFVL 1IBGL 3GJEA 4EBQL 1LMKA 3GHEL 4QLRA 4UQ3A 3BFOA 3BYYA 2ICES 4GG6F 2NY3B 1X3DA 2YD5A 5TDPB 4DVBA 2EDQA 3RWCA 1NDMB 5I1GL 1QKZL 5BO1L 3TNMA 1NGQH 5F93C 3OPZH 3I6KA 2VE6A 2MMXA 1QO3B 3DGCR 1U8QA 2OI9C 1OCWH 1I7UB 2EDNA 4ZAKA 4KZEL 1OF2B 5I18H 3RWFA 3PWLB 3MZTA 1UXSA 3QDHA 4F37K 1T20B 4AEIH 5DF0A 5HGDA 1A1OB 1OAYL 4XNMB 5ENWB 5C0AE 4OB5L 5IESH 1JGLL 5GZOD 4LAQH 4NKMB 4Q9RL 5C7XH 4LARL 3PP4H 3BQUC 4ODXB 5KTEL 5HHOD 1QFUH 1M71B 4WWKB 3K8LA 5FA3B 3BRDA 3IB4A 1BREA 2NY0B 3LS4L 1MHPL 3EO1A 3Q5YA 4I5BB 3B3IA 5E8NA 3MRMA 4M6OL 4J3SA 4OZGE 2VQ1A 4QXTB 4U31A 4Z7UB 1HCFX 4XP4H 3IYLW 3IF1A 1FVEA 1HOCB 4FXKB 4AMKL 3GJFA 2FD6H 4PD4K 1DEEA 2MFNA 1NMBL 3OX8A 1DN0A 4WEUD 3RX8A 4WNQB 4DQOH 4MAYD 2HRLA 4XPAL 4ZNEA 1JI2A 5DUPH 2BVPA 1J1OL 1DUZA 5LQBH 3CU1A 1W72B 3SGKA 2CK0L 3QXDA 3HPJA 1OTSD 4HJ0D 1K8IB 4HIJA 3QULB 2VLRD 1X6LA 3HI6L 2IPTL 3FT2A 3QG6A 4XC3H 1XR8A 5T3ZD 3BP6A 1NMCC 3VD4A 5K9OB 4YNYB 3PL6A 4CNIB 4PGEB 5E24E 1FLRL 1EEUA 3RUGE 1MCWM 3G5ZB 4LOUC 2LU3A 1M4KA 5EPMA 5L0QB 2UWEB 3UJTH 5FYKH 1FL3B 3UDWC 2B2XH 4HWZA 4JQVA 2IGFH 1JHLH 4KI5C 1DQLH 5FUZL 3QIBC 5ALBH 3QPQC 5CBEB 3QO1B 1LQSR 2WIIA 4WV1C 3Q6GH 5F6HJ 1MFEL 5KSVA 1BD2A 4D9LL 5E2TH 4GUPB 4J4PC 3PWJA 1UEYA 1D5MA 3UO1H 2P7TA 3HTLX 2AJYH 4FS0A 3QNXA 4KGJA 3IETA 4WFGD 2N4IA 3V95A 3SDAB 4XNQB 3IJSB 1U3JA 4U1LB 2CRYA 2M1KA 3SJVE 2CKBL 4YHZL 3QUMA 4I4WB 4ALAL 4JLRA 1NBVL 2BSSA 2JB6B 2FSEA 5DHVH 1BF2A 3WUWB 2V5TA 5A16A 4M7LT 3VRLF 5J1AB 1S7SA 1ZLSL 4DZBB 3FMGH 1ZWIA 5C08B 3O3DA 1P53A 1G9MH 3LRGA 5E4EC 1XGRA 3CH8A 1MREH 2EXYD 4LRIA 3WSQL 2FJFB 4YDIH 5EOTA 3B9KB 3IVKB 4QF1A 2HKFL 3C5SA 4MXVE 2IAMC 1JGDB 5LGJA 3RIAF 1NC2B 3FO9B 4I2XE 2R0ZL 2H45A 4WJ5A 4LU5H 5IEHA 5DSCB 3MV7D 4WTZA 4FTVA 4DN4H 1YPZA 4AK1A 2IADA 5AG9A 2Y9RT 5MERA 1RJYA 4Y4HD 4U1HB 4GBXD 4LHUA 2R0WH 3QCTL 1W8NA 4R8WH 3W0WD 4QXGL 3G5YB 1FFPA 3B83A 3PV6B 4JFFD 4XBEL 5C07A 3I85A 1KC5H 1PQZB 5T3XL 1I3RA 1CGTA 2R0LL 5F7UA 3OTTA 3DWTA 5C0CB 4LNRA 2I25N 1CE1L 4JM2A 2CRIA 2GT9B 2EDOA 4ODUB 1E4KC 4YHOL 3NFPB 5D7LE 2O61A 1IQDA 5EUOA 4KHXL 5L2JA 3RWJB 5KS9B 1T66C 5GGSY 2H2SC 4DUXA 3V4UH 3AUVA 4CJ0A 2EC8A 5MEOA 5F89A 4X9HA 4XXCA 2J8UE 2DQUL 2P49B 5FV1L 1H8OA 2E7HA 1A4KB 1U8KB 2OTUA 1AKJA 2ZUQC 5L2KA 5BS0B 1S7QB 4RZCB 1XR9A 4OGXL 3MODH 3TYGL 3FOLB 2K7QA 1IVLA 1OAQH 4PRHB 1LO3H 4YFLI 1RHHB 5INCA 4Y5VA 1UCBL 3O8XD 5C6WH 1RUAL 4JKWA 4X4ME 3C6LB 2HMID 4NN5B 4YC2C 3MGOB 4L3AA 4N5ED 1MWAB 3R8BB 5DURB 2DJUA 3BUTA 1WBYA 1T21B 5JNYA 4J1UB 4NT6A 3MUHL 3QDGA 3UBXG 3WHXB 5JW3H 4IIQC 2NY5H 5D7SH 3QEGH 4F80A 4N5UA 3O6FC 2R2EB 1YMMB 4UB0H 3ES6B 2V2WA 1MCPL 3GSOA 4HLJA 4XVUD 1AHWA 3BHBA 2A73A 2E6JA 32C2B 3GJEB 3HAEB 2G5RA 1EEZA 3UJIH 4PTUA 3CSBA 1TJHL 4XP1H 1X5GA 3VFNB 2UZIL 3RWCB 5DEGA 3NPSB 3TNMB 3D0VA 2R4SL 3GO1H 4L3CB 2F15A 2VE6B 3MV8A 1RMFL 5F6HI 1OLLA 1IGYA 3X14A 2AEPL 5JHDD 4MSWA 3INUH 4OIBA 4OZHE 1V3JA 2CDFB 4HDIB 3F12B 1OOAA 3HZYB 1Q94A 3D25B 3C8DA 4KKAD 2FX9H 2VAAA 3VGEA 1KJVB 1UH3A 5AZ2H 3WBDA 1CU4H 1KJ3L 1QSED 3L3KA 2E6PA 3G04A 4N8VG 5IVNA 1C1EH 3QZWG 1R3HB 2X4QB 3CVHH 3MJ8B 4MZ2A 1EHNA 5F9WC 4LPUA 4CVXB 4NJ9H 3BKCH 2OJEB 3M17A 4EQ3A 3RWDA 4HK3J 3AVEA 2FDBP 5E8NB 5TE6L 1CQKA 2XA8L 5EBMB 3SDXF 2A2QT 1R6VA 1NEZA 3VGAB 4IS6A 3U1SH 3U7AA 1FNEB 2EYRA 2BJMH 3B2VH 1U3HB 3IF1B 1IZJA 3P0YL 3BWAA 4X6DE 3Q1SH 2M8XA 1LK3L 3CPLA 4N0UB 2XRAH 3MLTA 4KY1L 1ADQL 3BKJH 2ESVE 4JDVA 1OM3L 2C3VA 1MQ8A 1N4XL 4LNVA 4OCRH 1A6ZB 1E27B 1MCIA 4AIZA 4P2OD 5D72H 1AR2A 2MKLC 3VDAA 4WEMB 1Q1JL 4D9RD 3ZYZA 1YEDB 3HI1A 3NH7L 1AGCA 1NAKL 4YXHL 1JK8A 5F72S 1UM4L 2F8OA 4ZXBD 4YPJA 5E7FA 4PJ5D 4MB5A 3EYUH 1XR8B 4NO5A 4RAUA 4CMHC 3G6JE 5IVOA 3KWWB 1S78D 3O2WH 5JZ7C 5EPMB 3LHPH 4OIIL 5I6XC 4HUUB 1FFQA 3QQ9C 4WFHE 3D39A 2JCCF 4IOFD 5SWZA 4RRPG 4PJIE 4RISH 2WP3T 2CSPA 4ERSL 3UTTA 3V0WL 4X9GA 4Y2OA 4MZ3A 3K0WA 2VDLL 5J8OA 3TZVA 1J18A 3KLHC 3IETB 1OAKL 4TQEL 4PJGB 1FNGA 5BZWA 4RAHA 3FQUB 4XX1G 5JW4N 5I73C 4JQXC 4NRXB 1A5FH 4PS4H 1FL6A 2BSSB 1KPRB 4UDTB 2GJZA 2E7CA 2VMFA 4HIHB 5HI5C 2X1PA 3AM8C 2VLKA 5E2UL 1I7RB 4OD3L 3KHOA 1NL0H 1QEWB 1PX3A 1EEYA 3HFMH 1ZWIB 5CINH 5C0RL 3X12B 1EO8L 3O3DB 4J6RH 4JFYA 3JV6A 1ZV5A 1RUPL 2WWMC 1AXSA 3F65A 1CXIA 5F9JB 3C5SB 5HDBF 2ICWA 5CGTA 2E5EA 2A6JB 1BF8A 4O2CA 2HTLD 1YNKL 5DJ0B 1HH6B 1IAKA 3JUZA 1YY8B 4JFHE 1E4XI 5EO1B 3TGXA 3CLFL 1ORSA 4JRYD 4MDIB 2IADB 3PGDB 3X3GL 1VPOH 2J8OA 2VDML 5CJXA 4M6ML 5JA8B 2HLFD 2XACC 4MA8L 4PYGA 3RWGB 5C07B 1QRNE 4P23B 2PCPA 1B0RA 1B4JL 3FRPG 2HVJB 3T4AA 4ELMF 1T5WB 5GJSL 1J0KA 1DANU 1GGYA 5JHLL 4N9GA 3KYMB 5EO0B 4LNRB 4Z95H 1F02I 3C08L 4OLXH 4EQ2A 1T2JA 1G7IA 4ZSOE 3MV9A 3TPUB 4R4BA 1IQDB 5EUOB 4NPYA 2OMNA 5D1ZA 5GGTH 3D1MC 3SQOL 5GHWH 2IQAA 3U30B 2QTEA 1CF8H 4HIXH 5B3JE 2ZNXA 1NAMB 2E9JA 5FO7A 1P4BL 2VXUL 1EERB 2D7OA 4G8EA 1KFAL 3PABA 4X7SH 4ODVH 3LPFA 4GRWH 5LGHL 1A6AB 4M61A 1XF2A 2Z8RA 4ZUTA 4KQ3L 5J12C 1I8KA 5E6ID 4LAJH 3H6JA 3P2TA 4MNQD 5ACLA 5INCB 2YC1B 4MHHI 2VDRH 1U3YA 1T5XA 1FGNL 4V2CB 5IVZB 5I17A 4LSQL 3LQMA 3MXWH 1LE9A 3QUYC 1UVQA 1F4WH 4PJDF 4JY5H 3CXHJ 1P7KA 4LCCB 4EN3A 2ZG1A 2X7LA 3FTGB 1J7VR 3T0VA 2ZZUT 4PRIE 1J1XL 3RHWF 2VH5H 3ZE2F 3ESVF 2CO7B 5FA4B 4APQB 3TYFB 1YY9C 4NQED 1F11A 1HKLH 1T83C 4E0RB 4P0DA 3V4PH 4KKBC 1QA9A 1SBBA 3V4VL 5B39B 3MBEA 4GKNA 3MCG1 3ZE1E 3EYVB 3DUHA 1N0XH 5C09E 2JKXA 5DT1H 5GRZA 1H5BA 2H6PB 1QD0A 5FM5O 5DJ8B 3D0VB 3IT8D 5LCVH 3KDMA 3X14B 3BRFA 3WIIH 4MSWB 1VGEH 3WFZA 4DEPC 3VI4E 3QP3A 2A0LC 2EKSA 3DXAD 1OLZA 3RA7L 3F5WB 2EO9A 1QPXA 5L8JB 1D5ZA 1CK0L 5ILTL 2WBJC 4XVJL 3NZ8B 4S1DC 5CIPA 4X0KB 1RFDL 4D0DA 4HWBH 4FNLL 4Z8FL 1FAKT 3LKNB 1HQ4B 3QR2A 2IBZY 2HT4C 4P46A 3BN3B 5T3ZL 1FNSH 1M6OB 3RWDB 4R3SA 1Q0YH 5JW4Q 1DBKL 1JV5A 4NKOB 4LF3A 4F58L 2KPNA 1F58L 3CPLB 3UTPD 1ZHKA 4PJXE 5ICYB 1L4IA 2AK4A 1CVRA 4NM4L 4U2ZA 2NCMA 3OKOA 4JDVB 3KPRA 4U0QB 5E99L 3BE1H 4JQIL 2BERA 2ZOKB 3BGMA 3E2HC 4JPKH 1AGEA 3E3QC 4JO1H 4AIZB 4KJWC 4LOUD 5JOPD 1EO7A 2Y72A 3QUXB 1G6VK 4L4TA 3FT3A 1A6UH 1H9VA 2NY2C 3H3BC 3ARDC 3ZKSD 4LLVA 4JRXA 3NIGE 4KI5D 5D7IA 3TN0A 5B8CA 1AGCB 2A74A 3U36B 3K4ZA 3QPQD 4WRLA 2VC2H 1DEDA 4PV9B 5HYJB 3GMQA 4QRQA 2HWZH 1UB6B 3OKEA 4RAUB 2FIRT 3IXTB 3NPZB 3TA3B 4KWUA 1TNNA 4P49A 1KJ2L 4J4PD 5IK3B 4WUUD 4YR6B 2AKRA 4QGYA 3W2DH 1IZKA 2BNRA 4JPIB 1ND0A 3WHE1 1VSCA 3RI5K 3OJDA 2DAVA 5CLTA 2NY7H 3VRIB 4PG2A 5I66B 2J12B 4HIIA 3HG1E 5FUCC 3QDAA 4U7SA 1ZA3A 2AJ3A 5F6IB 5HJ3A 2R4RH 1AY1L 1P7HL 1QBLH 4HGWB 3P9LB 3GSNL 1RU9H 2DIAA 4X9IA 2IALA 3ROLB 2D7QA 4NM8L 4DK6A 5EOCH 1R5VA 1XGQA 4P99A 3ROOB 1NBZA 1Q0XH 2H32B 1A3RH 3KPPB 4XHJC 4XNUL 2IAMD 2EDXA 4P2QD 3TBSA 3IKCB 3EOTL 5E9DD 3T0EE 4V1DD 4Y1AD 1IT9L 2OL3A 2XTJC 2DTML 4KRNA 2R2BA 4L9LB 1A7PH 1NFDB 2F53B 1JTPA 4L8BA 1LEIA 3RJQB 1QFWI 3VXSE 1AXSB 3EDKA 4LSVH 5I15L 4TULL 3MV01 5D1XA 4O2FA 4X6FA 2ICWB 4DAGH 4MCYB 4O2CB 2J88L 4M02A 2EC9T 5JXAH 2KH2B 1PSKL 4LDLB 4RWHA 1AGBB 1XF3A 1U58B 3S5LA 4NFCA 1FH5L 3KVQA 1WAAF 2OLDA 3W9EB 1GGBL 4P57B 3BI9X 3VXPB 2Q6WA 1R24A 4ZG1A 5L0QC 1YDPA 2QSVA 1QG3A 4H0GA 4RFEB 5EC1B 3WXWL 2APTA 1RURL 1T66D 2H2SD 1HKFA 1B0RB 1R5IA 3ARPA 5GPRA 3HC4L 3QEUA 1FNLA 2OR9H 3T4AB 1HI6A 5MEQA 3MRQB 2FL5A 4JKKA 4AH2B 5IW6B 3BPCB 1KPVB 5E94A 4OM0H 2DQTL 3OF6D 1U8NB 4FQ2L 1G7IB 4GRLD 1UADC 3CVHA 1NGPL 5DHYA 4NPYB 5E56A 2FR4B 5TJWK 4BA8A 2FATL 3SDAC 3BH9A 2WUCL 1O0VA 2QHRH 1BFVH 4UV7L 4OCLC 4DKEH 4L3EA 4U7MA 2CGRL 5C0EA 4ODWA 4C56D 2GUOA 1EAJA 4X6CA 2YZ8A 3ZKXB 4WU5A 2XZCH 4Z77B 3MRCA 3H9SA 3BD4A 4RX4D 1JWMB 3HZMA 5DA0B 3HRZB 4M61B 3BZEB 4ZUTB 3E6HB 1I8KB 1OAXH 4K7FA 4PJAA 2ILLA 1ZTXL 2CIKA 1NFKA 1PKQE 5B3NA 4QRSB 4JJ5B 1KV3A 5C0BE 3L95A 2X4NB 4JKPH 3B9KC 3O6FD 3R1GH 5KVMC 5I17B 1MCHA 3RL2A 3VXRB 5KJRL 4LCYB 5ITFA 2XWBA 3GSXB 1D3CA 1LE9B 4ODSH 4NHUA 5MEND 1ONQA 1HILB 2X89A 3O6ML 2VDQH 4Y4KA 4PJEA 4F3FA 1MNUL 3T3PE 4TSCL 4CW1A 1C08A 1GVIA 1YEJL 1JTOA 4N90D 3HZKA 5KSBA 4XCNB 4M4PA 2A83A 2I5YH 2HVKA 3LQAC 3VFRB 1IGCL 5IROA 3LRSA 5KVGL 2SEBA 2BZDA 2X10A 4JFPA 2JJUA 4FQPA 4RMSA 4LDEB 2NY4B 2EDFA 3KPSA 4M7LL 2XN9D 4HBCL 1H5BB 4EDWH 4NP4H 3DHMA 3RKDC 3NOIA 3DGGB 4FQHA 4KXZH 5D2LB 1DVFB 1TVBA 4ZO6A 3FRUB 4QRRD 1FFNA 2EZ0C 3VFSB 1MAJA 1HEZB 2EKSB 4KTEL 5I8OH 1P1ZA 1LDSA 5DHVB 1SY6L 4XTRC 3ZKMC 2C3XA 1G6RL 5CIPB 1ZK9A 1P4LB 4FMKA 2C7UA 5EH1A 2G75A 4QRPE 2IQ9H 3H3KA 1DTUA 4QRTA 2HT3C 4O9HH 4X80H 4YIQA 1SEBB 4P46B 4U1KB 2JJSC 2QSCL 1YQVH 4XWGL 2HRPH 4PUBH 4BFBD 4BKLA 1UM6L 2Q76B 4JFEA 1IQWH 4HK0B 2YZ1A 5C0AB 3W11C 4D0BA 2EIBA 3CK0H 3OKOB 2EECA 5D6DC 5J13C 3OSKA 4G6ML 3QPXL 2EDEA 3L5XL 3O2VL 1SJEA 1AGEB 1FCCA 1S9XA 3ZLQC 4OZGB 5JZ7D 3CD4A 3MRJA 3EFFA 4WGWB 4KVNH 43C9A 4L4TB 1TTFA 3MJ7A 1P69B 4WO4D 2WWKT 3QQ9D 4KXZI 5K9QI 4WW2A 4LLVB 5LBSL 3S34L 1X5ZA 3TN0B 2WZPD 4MAUH 2A74B 3KYNA 4I18B 1CFTA 5D8JH 1UWXK 1KTKE 5DJ2B 4F7CA 1QSZA 2DLIA 3I2CH 3GMQB 4RGOH 2YXMA 3NPSC 1JP5A 2FCBA 3PIQB 3PGCB 3QDJD 4F7EA 4WGVB 3G5VB 5DD0H 3SKMA 4ETYA 1F8TL 5E7BA 1WV7T 5GGTA 3MLPA 4HEPG 5I30H 1N8ZA 5H2BB 1F4YL 1FIGL 5DRNB 2VXTH 4ZAKC 3QHFL 3ZDYE 4WUKH 4L8SB 1P7QB 2VITB 4M5ZH 3OJDB 5GS2D 4Z7WF 2QR0A 3S88H 5KG9A 1JGVL 3GIVA 1FLTX 2H1PL 1AO7D 1C5CL 1ZA3B 1ZHBB 2R2CA 5HI5D 5AAMA 3S8WA 4LCIL 5B21A 3N50A 4NNYA 4K8RH 4P9ML 3BDYH 3MCLH 3EO9L 3G08A 3S36H 1JNLL 1TXKA 2V9RA 5I1IL 1CBVH 2CIIB 2WWMD 3AXLB 4BQ6A 4U1JA 4WHYG 4PP1C 4GMTL 2DOCA 3MROB 3QG7H 4X6EA 1KSRA 4KI5F 3OAZH 4H1LH 1KCUL 4BSJA 1S9VA 1J0JA 4OT1H 2VZTA 4M7KH 5I8EA 5DD6B 3QJFA 3N9GH 1PW3A 2QADB 3CIQA 1WUNT 3LIZL 3MR9B 5D1XB 4O2FB 3SOBH 1VFAA 2F54E 2DWEA 3V8CA 1I9IH 1REIA 1O7SA 2LAGB 2NZ9C 2BVUA 3LN9A 3IFLL 3OGCA 1CZ8L 5ISZE 3MUGB 1UA6H 2CK2A 5EOQL 3S5LB 1RJCA 2Z93A 4GKZB 3NA9L 3PL6C 1GGTA 1D6EA 2ATPB 2B4CL 3LSOB 1R24B 3RWIB 1MH5A 2NY6D 2L4OA 5CJOH 3P4OA 3IFNH 1BOGA 4JCMA 4JQVC 1UQSB 3D9AH 4I2XB 1R5IB 4ELKA 4OCYL 2A9NL 1LD9B 4CDGC 2EDKA 1AXTH 3QEUB 4GS7C 2FL5B 4DTGH 1IGIL 4CVWA 4EIZC 1HXMA 4Q6IA 3U4BH 3NACH 3JTSA 3L3OB 5IB1A 4Y4FA 4NUJA 3CVHB 5BQ7A 3BUYB 4HGMA 4KJPC 4JAMB 4YAQB 1R3IL 3TT1L 4MA7L 5HYSG 5E0QA 2XWTA 2YPVL 5FYLD 1EBAA 4ODWB 1BLNA 1LNUB 4PBXA 3KPQA 4LLWB 1Q9WA 1NC4D 1QR1B 1IGJB 3TO2A 3UBXA 2FNBA 4HJJH 1YYML 2VN7A 3BN9C 3QUYD 3UTSD 1CXKA 4X5WB 5E6ZA 3BIKA 1PVHA 1VGKB 2APWA 4K7FB 4H0HB 1A9BB 1ACYH 1N7ML 4XB7A 2P48B 2GJ6A 2JELL 5EU6E 3IKKA 1X4YA 3M1BA 4LRIC 2D03L 4YXLL 2J8UB 1YY9D 3OB8A 4E41E 3UYPA 3FKUS 2W38A 1IILE 1EUUA 4MD5B 2XWBB 4NC2B 4LVOB 3PDDA 4GXVL 3S37H 1FAIL 2R56H 3I6LE 1B2WH 4YJZL 4PJEB 4K23L 3U4EB 2YR3A 3HNVH 4NKIH 4CW1B 2FJGB 2CR3A 4M3KB 3QIUA 4OFKA 2IANA 3HZKB 4ZFOL 4PP2B 5H94B 1R0AH 1MJ8L 4C4KO 4FQXA 3P4LA 3BKML 2SEBB 4BZ2L 1A64A 2X9XA 2A0LD 1CLCA 5DRZA 1VA9A 4TPRL 3TBWA 2JB5L 1XCQB 3BPOB 4OF8A 3EFDH 3LKQA 4KVCH 2GCYB 3QZWA 4S1SL 3HUJE 5SWSE 4CDHA 2VQTA 2HTKC 2WBJD 3JXAA 5TQ2H 4S1DD 4FQHB 1IEAB 5EZIH 1IAIM 3WS3A 5DMGC 3HMXH 1RVFH 2ENSA 1D6VL 1N3NA 4PLNC 2J6EH 1NLBL 2HT4D 1N2RA 2EH8H 3MLRH 3RFZC 4XXCC 3MYJA 2W0FB 4KKNA 1EVTC 3H3PL 4G3YL 4EVNB 1RZ7L 1RI8A 3O4LA 1FYTD 3WNOA 2DQCL 4R2GB 3BDXA 1CICB 2HLAA 2N56A 3EYQC 4OZHB 4P4KA 1CG9A 1QSFD 1D9KA 2VLJD 4YIQB 1RZJH 4PR5B 3GDBA 3VFWA 2QEJA 4KJWD 4P2RA 1JMXA 4IRJB 5CHNA 3F7YA 1ZHNA 4HWEL 4BKLB 3ARDD 3PWUB 1W0WA 4PJHF 2ARJB 3KXFA 3A6BL 3QBTB 2PTVA 1F45A 3EGSA 5D9SB 3IAQA 5I19H 2LE9A 4TRPL 1I1AA 5D1QA 1NLDH 4APQC 4GO6B 3WNPA 5A2KH 4RRPA 3DBXA 1MHEB 3QNYB 5CJQH 3QHZL 1MUJA 2OZ4H 4JFZH 1AHWC 3F7QA 4WIQA 2LU7A 3IFOB 1N5YH 1WZKA 2FEEL 1T1WA 2ESVB 2EDBA 3SE8L 4KROC 2EYSB 1FZJA 3DO7A 2YKLH 2EEBA 5ESQA 5IQ9B 1AQKH 1OGAE 4O51A 4YUEH 5EZOH 2CR6A 2YD6A 5EU5B 1N8ZB 4MDJA 5KVEH 2F5BL 2V2XB 3GMMB 4POZC 3WJLA 2W9EL 4PY8J 2NQCA 3RKPA 2H8PB 4J3VA 4IOIA 1N59A 3EOAB 1JJUA 4DGVH 5E8DL 4XHJD 4GRWB 1Y0LB 2XI9A 1CXLA 3G6JB 5ABDE 1KYOJ 1LEKA 2BFVL 5JXEA 4LSSH 2XTJD 3UMTA 4PJIB 4UOJA 4K94C 1KLUA 2PTTB 2XPGB 5C6TH 3ULUE 5CKGA 3L3HB 4A6YL 4PRAA 4LGRB 4QHNB 5TF1L 4X6EB 4H26A 4Q0XH 1QFPA 2YWYA 3ZE0E 3T2PA 4P3CH 1JYVA 4AIXA 2KQNA 2DICA 1D5XA 1N5AB 1S9VB 2DWDA 1FGVH 2Y07L 3HHRB 3UTZA 4IMKC 3DRQA 1NBYB 4OI7A 2D2OA 4KI1A 5EU4B 4G43A 3AMLA 1XGYH 1S7WB 2DLEA 1RZKH 1AJ7L 4GXUM 1CLZH 4HS3A 5L8KB 3MJ9H 3SKJH 1OARH 2ZUXA 3ILPB 1VFAB 4ZO9A 2DWEB 1OW0C 2ADIA 2YD7A 5FCSH 1DQML 2BK8A 1K85A 1CGXA 2G9HA 4ZQKA 4DKFL 1CD1A 2Z93B 4Z0BL 5FM4A 1ZT1B 3LEVL 3U46A 5JW5A 4RFNB 4OZ4B 1MH5B 3TBVA 3FB7B 4R90H 4QTIH 4XCYA 1UM5H 3MLVL 3IGAA 3DX7A 3BW9A 3MFFA 4JO3L 4PY7B 4K3DL 3SDAD 3TH4T 2MPAL 1EXUB 1T1YB 4XAWL 1BP3B 3PQYE 1NCBL 4KRPB 1AH1A 5HVHB 1YA5A 3TZVC 5C0NC 5F6IC 2VJXA 4YFLF 3V7AG 5IB4B 1QRNB 4UV4H 3SDYL 2NNAA 5CILL 2OXHA 2EIEA 3R06A 1FQ9C 1A6TB 2XWTB 2DLGA 4NFDA 1T7ZA 2V6HA 4HPOL 3B9KD 4RA3A 3TO2B 4M6NL 1QFHA 3NFSH 4LSUL 4G7VH 5GISL 3VXUE 3BIKB 2IG2L 5HGGS 1AFVL 1Q38A 3VD7A 1Z6JT 4OQTA 3DHJA 5HHOA 4PJFA 4DKDC 2X1OA 1NGXA 2VXSH 5KSAB 1FE8H 1ZGLB 2Y7QA 1FDLL 1A7BA 1Z5LA 4LVNC 2AW2A 1R5WA 2DQHH 2C1OA 1OSPL 3D85A 2DJSA 1A0QL 4NJAL 2W07A 3I50L 2B5IC 4FZEL 5C2BL 4NZUH 5GRJH 3MLSL 4KGLA 4XCEB 4XVSL 1WTLA 4GAFB 1I4FA 3GK8L 4WDIA 4AM0A 2XY1A 4ZDHB 5J11B 5CJXC 5D7KD 3RUGF 5FKPB 2IANB 3S96A 2IJ0C 3MGTB 1OP3H 1B3JA 3RKDD 1DQDH 4NQCE 3ULUH 3VA6A 5T5NG 4FQXB 4EI5A 4IHOB 5EORH 4Z9KB 1FFOB 3GSQB 4I77H 1JPFA 5D6CA 5HGBA 1U8HA 1ZAGA 2EZ0D 3D2UA 4E42B 5IB3B 1OHQA 2P47B 3TBWB 3TPKA 3TT3L 3R8QA 4KDWA 2DM3A 5ADPH 1G7LA 4HX1A 2MSPA 4XTRD 3LKRA 3ZKMD 4Z7NF 6FABH 3OKNA 4JO2L 1RUQH 2DQJL 2A6KA 5D1ZC 4PGCB 3SY0A 1N3NB 4H20H 2HT3D 2BSRA 4OZIA 1N2RB 3ZYOA 5C09B 4P3DB 1JYNA 4JFDA 4LPYA 4PJCA 3MRFA 1ZVSA 5FYJU 4WFFE 5I1EL 2VWEC 4JRWA 1CD8A 4RGNB 5KW9H 1CFVH 1ROWA 3W11D 3AS3A 2P5ED 4EBQH 3HE7B 4L8DA 3GHEH 3VMNA 4AQOA 1HQRB 1BGXH 2OR7A 1CG9B 1CFSA 2YA0A 3QYCA 1D9KB 5I1AA 1YUHA 3MPCA 5FOBB 5TE7L 1SM3H 3D3VA 3T65A 4X83A 1KJ2A 4NC1C 3PWPA 4TVPE 1YMMD 5MP6L 1HSBB 3HNSL 4UTBH 3OB0H 3RGVB 1W0WB 2YMXH 2X4SB 4KZEH 1H8NA 4M6AA 4F7MB 4EN3C 3V0VA 5HGAA 4CN1A 1NGYA 2DLHA 5DEFB 3OKMB 3OMZA 5JDSB 2DMKA 3BZ4A 5ICXB 5HDQL 4V2BA 1OAYH 4JFOA 1TJGL 4EIGB 1MUJB 2Q3ZA 4GW1B 4OB5H 1EMTL 1JGLH 4R7DA 3GSNA 4IJ3B 3V2AR 4LARH 4ZAKD 3VXTA 2VLME 3MBEC 2AXGA 2YPKB 4GG6E 2NY4C 3HRPA 5DI8B 1FZJB 3DO7B 4M6OH 1H5BC 2A6DA 3WXVH 1IC4H 5JO5B 3CLEH 5F7YC 5EC2B 2APBA 4QHKJ 4O51B 5IIEB 4AMKH 5T3XE 4HPYL 4QHUB 1JPTL 4OJFH 1XGUB 2AI0L 2YPLA 1B88A 1MPAL 1NCAH 4IOIB 1F3JB 1J8HA 3O9WB 4XPAH 3EYFA 4HCRL 1N26A 1J1OH 4Z7VF 4KZDL 1I7TA 2XXCB 4PP1D 1N6UA 1QQDA 1LEKB 2BOBA 2CK0H 2XG4A 5JDJA 1BJMA 2OR8A 4NO0A 4CL7A 3JV4A 4ZODA 3GSVB 2IPTH 4K07A 3OWEA 3GKWH 1LILA 5T1DL 3BEWA 4LDOB 5L7XH 1GPOL 2AEQL 3T0WA 3W5MA 2V7HA 4P46C 1KLUB 1IC5H 1MAML 4QWWC 4FFYL 1LP9A 1K2DA 2PYFB 2P8MB 4MQXC 4JE4B 5HHNA 2NZ9D 3BPLB 4GRMB 2IFGA 5FUZH 5HDOA 3DIFB 3DRQB 3MRRB 2IH1B 4MNGA 1BAFL 4YFDB 3DLQR 3PL6D 4OLUL 1SVCP 3Q3GB 1HYRC 4D9LH 5DZLA 4OSUL 1EVUA 2ZUUA 3FT4A 2X4RB 4NRZA 5F7FA 3TN0C 1WC7A 5B8CC 4U6HA 3X3FL 2ITDA 2YSSB 4I18C 4MA3A 4YHZH 3HCVB 1A9EA 3F62A 4DVRL 5FYLL 5C0IA 4KK9C 4FQIH 4ALAH 1BD2D 4F33A 5TE4L 2X4UA 3PHOA 3HMXA 4MMXC 4TVPH 3IGAB 3DX7B 2VR9A 4GSDH 3N1QC 4KJPD 3BW9B 3MFFB 4NNXB 5T1KB 3U0TA 1ZLSH 3BP7B 1DE4A 4K9EC 4JM4L 2BNQA 2DIJA 4PG2C 2BVQB 1JHTA 5DK2A 3ULSA 1R3LB 3SPVB 3ZTJG 3BN9D 4Y2DB 3W5NA 1CS6A 3BP5A 3VG9C 4MJIE 5DQ9A 4A2LA 1ACZA 3VU2A 4CVZB 1HINH 4LLYA 3REVA 3S3PA 4LP4A 4WFED 3QUKB 4X6DF 4XBEH 1G1CA 2H26B 3VRLE 4POYA 5DJCB 5FV2A 5T3XH 5DK3A 2DS4A 4FTVD 1HHGA 4Y19E 1NPUA 2QADC 3X13A 1CE1H 1TMCB 2FX8H 3WN5A 3DMMB 5D1XC 2C1OB 3D85B 4YHOH 3ZT7A 2GFBB 4YDLC 5C07D 4KHXH 2OYPA 5C0JA 1RZIA 3MNWB 3SQBA 2HH0L 3IDNA 1WLHA 3V6FB 4OBSA 3PHQA 2WNGA 1B9ZA 3FQTB 4AM0B 5FO9A 3VD9A 1KIPB 2DQUH 2HTKD 5GS3A 5C0BB 3S6CA 2NW3B 4N8PA 3ARBB 4EOWH 3T0DA 1C5BH 5CBAA 5E2WH 2MJWA 3QFJE 4OGXH 4HS6A 4EI5B 3CCHA 2R15A 5CUSL 1NSNL 1U8HB 1U8OA 4ONGL 5I0ZA 3DURA 2Y23A 2V7NA 5ICZA 4HX1B 1QR4A 4PRBA 2R2HB 1FIEA 1DBAH 3EJYC 3VDBA 2D7PA 2Z4QA 1AKJD 5L2KD 5KAQG 3OKNB 3RNKB 3IJHA 3K7UA 4KJYB 4R97B 4NFBA 2PUQT 3MRPA 4M4RA 3EYQD 5GRXG 4K71C 1PLGH 4OGZA 1HZHL 3OXSB 5H35B 3GBLA 1BMGA 1I8LA 4ZFZA 4JFDB 5EFIB 1A7QH 4H1LB 3C9NA 5J56B 5CWSB 2VIRB 4LHQB 1S7RA 1PYWB 1B0GB 2Y36L 5C0GB 2GSIB 4N0YL 3QDGD 5CSZB 1OAZL 3ALWA 4OF5A 1J9CT 5I1AB 1UACL 1YUHB 2UZIH 3IDYB 2MOVA 3TBTB 3RPIA 3PWPB 1RMFH 1PZUB 3MLWL 2GIYA 4Y16A 4LVOC 3K2UL 1T0MA 4JVPA 1YEKL 4Y4KC 5D5MF 4QRPB 1DZBA 3T2QA 5DVLA 3GGWB 1J11A 1UZ6F 4KROD 1QLRB 2AEWA 2XKNB 3CFEB 4JZJA 3MV8D 4IRSA 2HT2D 1S3KH 4JFOB 2JIXB 4XP9L 4HUVA 4POZD 5IROC 4GG8B 4G6KL 4YXKL 2VZSA 2NLJA 4Z7OF 4N8CH 4L5FL 5FGCE 2AXGB 1MY5A 4Z5RA 4JRYA 2P5WA 1AI1L 3DUSA 4YDVA 1JZ4A 2XA8H 3MJGX 3AAZA 4ONHA 4G8FA 2NXZB 3P0YH 1MEXL 1W72L 3K80A 1LK3H 2NX5E 1YZZA 4KY1H 4WHTA 1ADQH 1FO0H 5KZCB 4U0RC 3QXTA 2FIKA 2VLLB 1A6WL 1HHKA 4Y5XB 2FO1A 4XWOC 1WQVT 1BEYL 2VDOL 1IJ9A 1KIQB 4OKVB 2EDWA 4UINL 2VR4A 1I7TB 5D2NE 2DRUA 1Q1JH 4AEFA 1BZ7B 2ATKA 2BOBB 4FABH 4NO0B 4ZMAT 2ZSVA 3HLAB 1A22B 3NH7H 4R2GC 4YXHH 1CICC 3RY6C 4XBPA 1JZ8A 4ODTL 4YDJA 5L88L 4XI5C 5F1NB 2MQ0A 4OBRA 3GKZA 4PLOB 4LSRL 2BOCB 4S11A 2E7MA 3B8SA 4MQTB 4FHBD 5HHME 3SDXE 2JF1A 2K1MA 4UDUA 4HKJB 2D4DA 5HHNB 3ZDZE 1KELL 3B6SA 2R23A 1BHGA 3ABZA 4ERSH 1K5NB 3BEVB 4UUJA 3TNNB 1OSZA 1EEQA 4ZUUA 3V0WH 3WUWG 5HYJD 4JREB 1JWSA 1A3LL 5DD5L 1SJHB 2HFGL 2DKSA 1IGFL 5IB5A 3GSUA 4Z78A 5DJXA 4G42A 3QUZB 4WW2C 3D39D 1OAKH 2PETA 3L3IA 4TQEH 2C1PB 5SWZD 1WC7B 4CU7A 1ZA6A 3ZKQD 2ITDB 1V7MH 1Q9LA 4MA3B 4O5LH 3DX6B 1CIDA 3UTTD 1BM3L 4LKCB 3QDMA 5HHVL 1V8HA 1KJMB 3MACL 4WI7A 4MYWB 4XH2B 5C0IB 4C59B 1M1SA 1IAOA 4I0PA 3GMPA 4C83B 3PHOB 5JR1H 1GL4B 3TZVD 5C0ND 4LFHG 3NFNB 2F54B 1IAIL 2AV7B 5JLZA 3BWUC 4GW5A 4ZTOL 5KSUA 2JCCE 1K6QL 4G8GA 2K7PA 4XCCL 3VW3H 2WMPA 2YXFA 1D7FA 2XNAA 2BNQB 4FFVC 1YEEL 1RUPH 5I1DB 3MUY1 2D7TH 1T0PB 5DK2B 4RQQB 4J2XA 1IEBB 4HG4J 2VLKD 3O3BA 4NZTL 5FM5M 3LRHA 1YNKH 4Y5YA 3LQAL 1AGDB 5F7HA 2PW1B 3ALXA 3L6FB 3IS0X 4Z7QF 3RWEA 1I8MA 1IKNA 4CAGA 1NDGB 3BQUA 4HQQL 4MJ6A 2Z31A 2APXA 3QXVA 5AUMB 1RK1B 3IS1X 5BCAA 5DQ9B 3X3GH 2Y6SC 3BPNB 3G5XA 4ZFOA 5D96B 3MNVA 4Q97A 4LLYB 3REVB 4R4FL 5CEZD 3ZSTA 4MA8H 3MMEA 3A67L 2VLRE 4PTTA 2FLRT 1C7TA 1CE6A 5GJSH 3F8UB 5JHLH 5TH2B 1YQ2A 2ZKHH 3V79C 2WV3A 4HUNB 1KCVL 4UIMB 5F8RC 4X4YA 5DJDA 2CLZB 1D5BB 3MA9L 1I85A 5FGBA 5HDBE 1GZPB 3CDFA 1RUKL 4LSTH 1A7OH 3WL9A 1UT9A 4KK8C 2DD8L 5A2JH 2C3WA 1KULA 1L6ZA 3HC3L 3PHQB 2PR4H 3NGBB 5BMFL 1V7NL 4KUCD 5EU6B 4J3WA 5GJTL 5T1MB 4WY7L 4X6BB 1KFAH 1T1ZA 3TIDA 4RFNC 4YBLB 2XZQL 2ICEA 4E41B 2R1YA 5CBAB 4WFGE 4F57L 3UDWA 3KLAB 1BIIA 4KQ3H 5D1ZD 4I3GA 1IM9A 3ZL4H 5IM7B 3VFTA 5DD1L 4ZFGH 2R29H 1ZLWH 3QIBA 3DURB 4ELME 4YPGA 3P9MB 2V5MA 5LXGL 3HAEG 2HAZA 3QIWB 4KRPC 2X2YA 1FGNH 4WI4A 1VDGA 2Z4QB 5D93B 1N64L 5HVHC 4LSQH 1PZ5A 4PGBB 4PB9H 3RWHB 3SE9L 3M45A 4BUHA 1BWMA 4TUOA 3BT2H 3MRPB 4XPBL 3RVXC 1YPZF 1I8IB 4CBPA 4PJ8B 3U6RA 3V5DA 3C2AL 4AL8H 4HH9A 3MRKA 1J1XH 2ADFL 3T4YA 2P8PB 1QFWL 3HUJB 5SWSB 2X44D 2X4OB 4ZOEA 3LQZA 1KN4L 1CFNB 1HHJB 1RZGB 2P4AB 1P5UA 2Q20A 3H9YA 3MV7E 5J1TC 4EN3D 2W9DL 3DVGA 2DI7A 4JM2F 3QO0A 3VXQB 4NO2B 4KC3B 3W0WE 5FYKD 2E3VA 5J6GB 3O2DH 3OAZK 5I74C 4JFFE 4HIEA 1ZSDA 1HHHA 1ETZB 1RIVL 5CP7A 1INEL 3KR3L 1UKTA 2YD4A 3WIFB 3MBED 3CX5J 3LMJH 4PJDE 3VXNB 2NY4D 1DBMH 3ARFB 12E8L 4AQ1B 1EDQA 3RBGA 3QIUC 4HKXB 3CSYA 1KGCD 1BVKA 3VWJA 3ZE2E 4XVJH 2RIKA 2BVEA 3UC0L 4FQXC 2DYPA 2E7BA 1CWVA 3VG0H 1RFDH 5L6YL 4FNLH 1BQSA 3L9RA 1TNMA 2NLJB 5K9JH 2F8XC 5DVKA 4AG4L 1DQQA 4JANA 4RAVA 5DMKB 5F3HA 1LEGA 2DTSA 3DYOA 4MJ2A 4OAWA 1YC7A 2V5YA 4G8FB 1F58H 1E4KA 2PO6A 1HDMA 3VMOA 1SQ2N 2ZJSH 1LDPL 2M2DA 4MQSB 5ERWB 3LB6C 1HHKB 4TUJB 4JQIH 2NTFB 4P46D 3V6OA 2MCPL 1INDH 1P2CA 2C4FT 2HP4A 2QKIA 2BRRL 3LV3A 3MNZA 4OCSL 1GOHA 2ATKB 1OGAB 4RGNC 1FL5A 1MFCH 4DGIH 3HE7C 1U8MB 2AK4D 2VISA 3U0WL 4P4KC 3KPRD 1D9KC 1QLFA 3CXDL 4L4VA 4HV8A 4GFTB 4HJGA 5JPNA 1U92A 4L4TD 4UDUB 1V05A 3SDCA 3OR6A 4X99B 4KAQL 4JRXD 2BNUA 3AFLA 3NCCB 4G9DB 2V2TA 3TN0D 4YHML 5E8EB 3TFKC 5IVXA 4GAYB 5BZDA 4LCWA 4MXWL 1I1AC 2A77L 3I02A 4G6JL 5D1QC 3U9PL 2NXYC 3I9GL 2QQNL 3H9HB 5IB5B 5DJYB 4P5KA 4JPVL 5JHDE 3K3QA 4Z78B 5DO2C 1AY1H 4G42B 4KUZL 5TFSL 4KJQC 3KPLA 1KCLA 4IJ3C 2BNRD 4HUXA 1OP5H 2YD8A 4NM8H 2V5RA 1ZA6B 3FB5A 4TYUA 5CCKL 1Q9LB 2FYYB 2DDQL 3U7YH 4JN1H 2AK1L 2PN5A 5GS1B 1QSEE 3D18B 1UWGH 4LEXH 1IL1B 3OXRA 1IAOB 4I0PB 3FQWB 4YHKL 1CDUA 1XEDA 5AWNL 5JLZB 2P8LA 1M7IA 2OCFD 2X41A 1IT9H 4OGYL 5KSUB 1I1YA 1HSAA 2DTMH 4PPTA 1YJDC 4G8GB 4PGZA 4U1IA 4FQQB 4RA0C 3TIEA 2ZPKL 3H42H 5BVPH 1VENA 4HKBA 5I15H 4TULH 4JG1H 2MHAA 3CFDB 1QBBA 1VHPA 3NCMA 1UKSA 3O3BB 4PG9A 3WFEH 2J88H 5DRWA 3DECA 4QRRA 1PSKH 1I9EA 5EBLB 1FH5H 3GMNB 5IMKB 1F6FB 2QADD 5GS0C 1GIGL 1R3JB 7CGTA 1H3TA 3PQYB 4Q9QH 3RX7A 4D9RE 5D1XD 4U6XA 3BVNB 3WXWH 4GH7B 5C0DA 4PTTB 5MHSE 2BMKA 2AXJA 4PJ5E 4BELD 1KPUB 1CE6B 3MRLB 3FO1B 2DQDL 4C57C 4BYHA 1S7TA 3AGVA 5CP3A 4JY4B 3UPAA 3DPBA 4X4YB 2AQ3A 1T2XA 4OUOA 4FQ2H 2ORBL 2KQMA 3REWB 2BSED 2BVOA 1Y18B 1U3ZA 1U93B 2F58H 1Q9KA 3SDDA 1L9NA 2WUCH 2DF3A 4UV7H 2CGRH 4I9WD 4NQSA 3JWOH 1E28B 1WAAE 3I6GA 4Y19A 4YWGL 3EJYD 1XAUA 5E8PB 3I3DA 2KL6A 1RIUL 4DCQB 4U6VL 1A2YA 5IGXH 4JO4H 3DTXA 4PJ7A 4E5XA 2HG5A 3NCFB 4LCUA 5DRXB 3V5KB 1WIUA 4L3ED 3MV11 3C2SA 5EU3B 5I8KH 4GAGH 4X8JB 4UTAL 4FQ1L 4QOKA 4ZFFA 5E8OA 5B39G 2I9LB 1A6PA 3H9SD 3GHBL 1KB5A 3GRWA 4NQCB 2PW2A 2CMRH 4TUOB 3O6MH 5FYJH 1MNUH 4JHWL 2MCG1 5JPMB 4UZGA 4W6YB 4MD4A 3U79A 2J4WL 5IFAL 4JQXA 5JIPA 2Y06L 1YEJH 1OTTC 2BC4B 3MRIA 1JZ3A 4UAOC 1AP2A 1BZ9B 1HCVA 5I2IA 4NC0B 1B6DA 2IMNA 2W60B 4BFIB 2B1HH 3AM8A 5C8JA 1R3KB 3RL1A 2X89D 4Y4KD 4OLWL 4PBVC 3VXMA 4KUCF 4M7LH 3O6KL 1PG7H 3DVGB 3P40A 5HVFB 1L7TL 1IGML 4LRNH 4HKZB 4EXPX 1UZ8B 4YHPB 1H0DB 1UENA 1RJZA 3SBWC 4CN4A 5F70A 1L9MA 2FHFA 3MRHB 4KPHL 5KVFL 4RIRA 4OIAA 4F8QA 1SY6H 4K94L 3CSYB 3FFCA 3O0RL 4BJLA 4NN7C 3ARRA 4DJMA 4EI5C 2DYPB 3FONB 8FABA 2I9TB 1J5OL 2VAJA 1MJ7H 1NKOA 3GI9L 4WHDA 2E7LA 4XWOD 1WWWX 3RVWC 5F3HB 5C2UB 5DUBB 3GBNL 1ZGLM 4HHAB 1NMAL 4XWGH 3MCKB 4X98A 4XNZB 5BV7B 2BY2A 3MBXH 1KG0A 1HDMB 2PO6B 2AJUL 4K8RC 4G8IB 5IEKB 1ZOXA 4R2GD 4MNQE 1XF5A 2D3VA 2D9QB 3MRDA 4XI5D 2X4PA 4F7TB 3TV3L 1A1MA 3QPXH 4GG6B 3L5XH 3O2VH 4S1QL 4R0LB 4I1NB 5DS8B 5HPMA 4H25B 2OJZH 3I75B 1JNJA 3CUPA 3S34H 4QRUA 4NRYB 1RY7B 3FQXA 1E6JH 5FAAA 2VDPL 4O58L 4NQDA 1T7VA 3HPLA 1MLCB 4P59L 1AGFA 1HNGA 3K81A 4NQEE 4JGMA 5GRWA 2XG5A 2E27L 4HJGB 1K4DB 1NC4A 1KYOK 3CU7A 4M7JH 5HYIA 1F8TH 1VCAA 5T5FH 4PLKC 1F4YH 1FZOA 2VDKH 3OKYA 3QHFH 5FECA 4J8RA 4Z0XB 3D87B 2ESVD 1DLHB 5BZDB 3HA0A 1JGVH 3F58H 3SE4A 1EFXB 2H1PH 1S7UA 1VACA 1U41A 1T03L 1ZANH 4QO1A 1G0DA 3P4NA 4MS8C 3BO8A 5J89A 4HUXB 3DXAE 4G6AC 4P4RA 4FFVD 1BJ8A 2HYMA 2QQLL 2YUZA 1OP3K 4GMTH 1VEMA 4NQTA 1G7QA 3GMOA 2NXZC 5FDWB 1KCUH 1C16A 2Q3AA 1M7IB 5A2FA 3PNWA 1WZMA 1I1YB 1B0WA 4L1HA 4NZRL 3TESA 3CNKA 2PXYB 4JHAL 3HB3C 4Z7WE 3LKPB 3QCVL 2RQ8A 2Y6SD 2APFA 5HDLA 3IDJB 3LIZH 5LWYL 2CRZA 5DJ6B 5D7IF 1X44A 1OCWL 5HTSA 3UTPE 4M8QA 4PG9B 2G5BB 1S7VB 3IFLH 1CZ8H 4PRPA 3PE9A 4G80B 1W0VA 1QYGL 3NA9H 3VJ6A 5JOPE 4K3JH 3O2DA 3SN6N 4AEIL 1XH3A 3DROA 4N1CA 4ZPVA 2BCKA 4ZYKA 4JJHA 4KI5E 1F13A 5C7XL 4ZTPL 1M7DA 4KK8D 5A43C 1XIWB 5BJTA 3PP4L 4OCYH 2A9NH 3QI9A 1QFUL 2FRGP 1KTDB 1S7TB 1QSFA 4JREC 1IGIH 4N0FA 4MJIB 4JKLA 4G6FD 4PGJA 4LLDB 4BSWA 4WUUE 43CAB 3OB0K 3STLA 3QUZC 3ARDA 3RVUC 4UT7L 3J8F7 4DQOL 5AZEL 4HC1A 3N06B 4NQSB 5TDPA 4Y19B 1NDMA 4KRPD 3QFDB 5LQBL 2R1XB 2YRZA 1YYMH 2K9UA 3ARVA 3Q0HA 4UT9L 1FO0B 1I7UA 3RVXD 4HFUL 3DTXB 4PJ7B 1OF2A 4GW4B 4WCYH 1MCQA 2JELH 4NIKB 4L29B 1L0QA 1J0HA 2GK0B 4Q2ZB 1A6VL 2D03H 3ETBF 4YXLH 1T20A 1YEFL 3UJTL 4P2QE 5FYKL 1A1OA 2B2XL 1GCFA 4XNMA 5E9DE 5ENWA 4V1DE 3QFJB 4Y1AE 2IGFL 1JHLL 1UGNA 4NKMA 1DQLL 2PYEA 5BVJB 2D0GA 2QSQA 5ALBL 4K23H 1RZJC 1WEJL 25C8L 2GJ6D 4MD4B 3GSRA 4WWKA 1JRHH 3NABL 3Q6GL 2AAVA 3Q5TA 1CR9L 4QXTA 5D96C 1AP2B 4Z7UA 4ZS6C 4NZDA 4FXKA 1HOCA 5DJAA 4X5XB 1C7SA 3BKMH 2WBWB 3OR7B 4BZ2H 3OHXB 5DEZA 3V7MA 3RL1B 4TPRH 2A6IA 3E8UL 1VFMA 1FP5A 2WLYA 4NBYB 4WNQA 5I1KH 1J88A 2W1NA 3QIUD 5T1LB 4S1SH 3WFCH 2IAND 3CDCA 3U0PB 4RDQG 3WN5C 4FQXD 1BBDL 1W72A 1HH9B 4D9QD 1K8IA 3FMGL 3QULA 3HE6A 2LV4A 4X6CF 3NGBC 3GI8L 1JFQL 4YDIL 5K9OA 4YNYA 4CNIA 3MA7A 3G5ZA 2P24B 5HXMA 2UWEA 4HLZH 4G3YH 1X5AA 4PJAF 5IFJB 1FL3A 5IT2H 4FXGB 5DMIH 4DN4L 4C56E 1BQLL 2CRMA 4CMMB 4PJBA 5CBEA 2M26A 3RDTB 1J86A 3QIWC 1K8DA 3LPGA 4OCWH 4HFWB 1ODAA 5D93C 3BX7C 4GUPA 4HWEH 4RGND 2XYCA 3HE7D 3O4LD 1U8JA 1XF5B 2ZSWB 5IOPB 4P4KD 1MRCL 3SDAA 4XNQA 3IJSA 1D9KD 1XGPB 5KSBF 5FGCB 4U1LA 5ALCH 4I4WA 1I8LC 2CDGA 3W82A 4B7IA 4P2RD 4JFXB 2JB6A 4XZUB 3QHZH 2Q8BL 3WUWA 5MENE 5J6HA 3S35L 2NX5B 4NKDB 1XZ0A 5ID0B 5J1AA 1KT2B 3TFKD 3C8HA 3V7AE 4KHTH 5C08A 3SE8H 3OKDB 1I1AD 5D1QD 2NXYD 5IMMA 1DP0A 1OGTB 1MFAH 5D2NB 5J0BA 5DO2D 4FA8A 1YMHB 1JGDA 3MODL 4KJQD 4Y16C 3CH1B 2F5BH 1NC2A 3FO9A 2LFGA 1LO3L 4XAKD 2XN9E 5F1KC 3ARFC 2HJKA 4JN2B 5E8DH 3TC9A 3T09A 2P1YA 3T1WA 3RTQA 3BSZH 2FH8A 2JTDA 4JZJC 1WZ1L 1S9WB 4U1HA 2ADJB 3GNML 4IRSC 1VACB 4S1RL 3SDXB 2BFVH 1XT5A 2KDGA 4OLEA 3PV6A 4QYOA 4UMGA 3FB8B 4LVHB 5JW3L 1WBZB 4YHNB 1PQZA 3S4SB 1I1RA 3QNZB 3QEGL 4A6YH 5DFVC 5C0CA 5TF1H 4G9FA 4UB0L 1A1NA 2GT9A 4ODUA 3S5LG 1HHIB 2FJHB 3NFPA 5JXED 2HJFB 1UWEL 3UJIL 1VEOA 1I7ZB 3RWJA 2Y07H 3PNWB 5KS9A 4RGMB 4XPTH 4LSDA 2HJLB 3SGEI 1X7QB 5GS0D 4ZO7A 1AJ7H 3STBA 3GO1L 4K55A 1A3QA 4WW2F 1A4KA 1U8KA 4OLVH 1CN4A 5BS0A 2DBLH 4LK4A 4NGHL 1J8KA 1RZFL 3FOLA 4PRHA 5DD3L 1KN2H 1RHHA 1W0VB 3RRQA 3LEVH 3S36X 2X09A 5K9KB 2DKMA 2WAHA 1XH3B 3C6LA 2Z35A 4F2MB 5DZNA 1MWAA 4ZPVB 1TIUA 4ZYKB 4GKSB 1C12B 1T21A 5CMAB 4J1UA 4JO3H 5AD0B 2F8VA 3CVHL 1RIHL 3W81A 2EE2A 4NJ9L 3BKYL 3WHXA 3DNKA 4XAWH 2HFFA 1NCCH 3QDJE 1L0XA 3ULUC 1ZLUH 4BSWB 3U1SL 1AD9B 3B2VL 3LKOB 1T4KA 2R2EA 2KBGA 3BIAX 3ES6A 3Q1SL 1IE5A 32C2A 3HAEA 3SDYH 2VLRB 3KPNB 3ME0A 5CILH 5FK9A 5KN5B 4OCRL 3WCYA 1MI5A 2B20A 3G6AB 3VFNA 4HPOH 4OTXH 5T33H 1CDHA 2PKDA 1AO7E 1JGEB 4I0PC 2RHEA 1MCRA 4L3CA 1GGCH 5C86A 1B90A 3WLWC 2CDFA 4HDIA 2BDNH 4DFIA 3F12A 3MUJA 4FZ8L 3HZYA 1KENL 3D25A 1OTTD 3U82B 1IM3A 1FDLH 3EJZC 1KJVA 3LHPL 3GM0A 1LO2L 1OSPH 3IAPA 3MLUH 4BK4A 1JZ2A 1S5HB 4NJAH 2OK0H 4Y5YC 1MHHB 1R3HA 2X4QA 3RIAK 3HKFA 2PYEB 4RISL 3Q6FA 5C2BH 3MJ8A 1IKNC 4XVSH 3BJLA 4CVXA 3RIFF 5IW1B 5CKAA 2Z31C 3GSRB 2ENYA 2OJEA 3GK8H 4ELMB 3WIHA 5FCUL 5EO9B 2JE8A 2I27N 5EBMA 3D85D 4UT6L 2FHBA 1EO5A 1FNEA 5IJKA 1U3HA 3HC0A 1TETL 5IB2A 5DJAB 3MSPA 2I07B 3RY4A 1JGUH 2UYLB 4N0UA 2VDNH 4UIKL 1QOKA 2A6IB 4MQ7B 3B4NA 3R4DA 4WEBH 1IC1A 3SGDI 1A6ZA 1E27A 3VI3E 5E03A 3STZB 1I85C 5FGBC 5DLML 4JO2H 1T7XA 4EI5D 5J7CC 1NL0L 3R0NA 1YEDA 2X9WA 3D2UD 3HFML 3HE6B 5CINL 3S37X 1SBSH 3LKSB 5IMLA 4J6RL 2A9MH 2AP2A 3RVWD 3KPMB 4Y4HB 4GBXB 3MA7B 4OLZH 3KWWA 3GBMH 5JMRA 5I1EH 3VD3A 4JFFB 1KEMH 4K8RD 4HUUA 1BZQK 1CLOL 5DQJB 5FYLE 4YK4C 1OPGH 4PJBB 4JFDD 4JEGB 2FGWL 1K8DB 2F19L 3GEWB 4U33A 4Z7NE 3UTSE 5MP6H 2VKWA 1U8JB 3TLRA 4KMQA 3UPRA 1T6WA 4PJGA 2AJSH 1YNTB 3CC5A 3FQUA 5GS2H 3D3VD 4PREB 4NRXA 3BGFB 2CDGB 4NQXB 4Z95L 2XKUA 3PWPD 5CD3B 1MRDL 4OLXL 1KLGB 1TJGH 1KPRA 1PG7W 3MOAL 4M1GH 4UDTA 4PLKD 1EMTH 4HIHA 5J6HB 5GGTL 3GMRB 1I7RA 1G7HB 1XZ0B 1CD9B 1CF8L 1QEWA 4QRPD 4MLSA 1YEGL 5I1CL 5E1AB 4PJ9A 3X12A 5FEBA 4OI9A 5IMMB 1JHKL 5GGRB 2IPUK 5DR5H 4YGVA 4P3WA 2AXFB 1AE6L 2C26A 3MLXH 2W0KA 5F9JA 3B9VA 2NW2B 2XV6B 4EJ1C 1G9EA 4MS8D 4XP5L 2A6JA 1JPTH 4Z6AT 1HWHB 5BRZE 5DJ0A 1HH6A 3C5JA 2AI0H 1MQKL 3H7LA 1YY8A 4BQCA 1MPAH 4G6AD 1F90H 5B22A 5EO1A 4MDIA 1Y6MR 2HJKB 4Y7MA 3PGDA 4HCRH 2COQA 4KZDH 3RTQB 3VWJC 1XCTB 4DK3A 3U7WL 2NXZD 2C5DC 3B9EA 3T3MF 4IMLB 4QYOB 3RWGA 1F4WL 5TDNB 4P23A 2Q86B 5KZCD 5FOJA 4JY5L 2YPLD 4NN6C 1TZGL 3QSKB 2HVJA 4K2UL 1J8HD 1T5WA 3HB3D 1GPOH 5EA0H 3WO3B 5CLWA 2XOTA 5JTWA 4HXAH 1MAMH 3KYMA 4FFYH 5EO0A 1MJUL 1Z2KA 4HS8H 4G9FB 1HKLL 4TTDC 1UEMA 2HN7B 1A1NB 4XNZC 5BV7C 5JHDB 2RFXB 1FYTE 3TPUA 5CJ5A 2PO6C 4NO0D 4OGAC 3MRBA 1ZLWK 2QJDA 1UXWB 1JWUB 5D70H 2VLJE 1N0XL 1BAFH 5DT1L 2ZCHL 5A2IH 1NAMA 2QQQA 3QAZB 1MLBA 2QQKH 3V6OC 1CDGA 1QSEB 4JZNA 1MSPA 4Z7VE 5GGUB 5IHBA 4OSUH 5E08H 1RPQA 3ZT5A 1A6AA 2DN7A 1SHMA 3X3FH 1II4E 1E6OL 2F5AL 4K3HA 4OV6F 3NCYS 4NZJA 2YC1A 1QBML 4P2YA 5DMYA 2DLTA 2Z35B 5IVZA 5ESAB 4CU6A 2GSGB 2DM2A 4HG4K 3QUZD 3SDCC 1NJ9B 3RVUD 3PHSA 5FF6B 1ZVYA 2H9GA 4H0IA 4GMSH 5DK0B 4LCCA 4FQLH 3FTGA 4S0SD 2HFFB 2DLFL 5FUCE 3RBSA 5FIEA 4F7PB 3WDJA 1S9YA 5FA4A 4APQA 4UQ2B 3TYFA 3LEXB 4DZ8A 1T4KB 3VFGL 5F1IB 4E0RA 4XGZA 4U1GB 5FK9B 4UNUA 2O5YL 4PJ5B 5B39A 3BE1L 2FWOA 2BNQD 3EYVA 1MI5B 4JPKL 1MFNA 2AS5M 2CLVB 3CFBB 3LDBB 2H6PA 3N0PB 4ORZC 1MELA 4B50A 5DJ8A 2E9WA 1A6UL 1BBJB 3FN0L 1ITBB 2XTJE 5AG8A 4RCAA 2O5ZH 2VC2L 3CSGA 2HWZL 3C09B 3AS1A 4D8PA 2BXZA 1A7NH 3KJ6L 4MGXA 1S8DB 5IG7B 1PAMA 3F5WA 3IDXL 3W39A 1IM3B 2DL2A 1QTYT 5I16B 3NZ8A 4ZS6D 3MLYH 5INDB 1BFTA 4X0KA 3B5TA 2DM7A 3Q6FB 3VFUA 3LKNA 3LN5B 3SKOA 3BYTA 1HQ4A 1IFHL 2NY7L 2Y1VA 3QEQE 4M43L 1WVZA 3GSWA 4JG0H 1M6OA 2OSLB 2J5LB 3AREA 4LIQE 5H37G 4NKOA 3WDHA 2VSDA 4F9PC 3HC0B 1QBLL 5IB2B 1JYWA 5GIRB 3ZDZF 2WW8A 3VE0A 1NSNH 1T7WA 3WJJA 5ICYA 5TDOA 5EOCL 4IMKA 3MXVL 2H3NB 1Z0MA 2ZOKA 2WQ8A 1A3RL 3QUXA 4EUPH 5IR1B 2CXKA 1OW0A 3FO0H 2IFFH 3I6LD 3NAAL 4FN0A 4LL9A 3SDDC 3U36A 5IMLB 1HZHH 4LLAA 4KTYA 4LQFH 4PV9A 3T2OA 5HYJA 1UB6A 3IXTA 3TA3A 3S98A 1TCRA 5IK3A 1RQ5A 5IKCB 2IMMA 4YR6A 1OP5K 4ZS7L 2EEAA 4N0YH 4PJFF 4JPIA 3CX5K 5JXAL 1OAZH 1T3FB 1Z9SA 1E4XH 1ZT7B 3MO1A 1DBJL 4J3OC 3WKMH 3QXAB 2PF6A 3VRIA 1TQBB 3V8OA 2JK5B 5I66A 3PP3H 3MLWH 3PGFL 4PLJD 4YE4L 3OKKB 3N1FC 1H3PH 5ANME 3ECBA 4HGWA 5KOVC 3P9LA 3UPRB 1QP1A 1YEKH 3ROLA 2OR9L 2R9HC 4NBXB 2LAAA 3CC5B 1BFOB 3ILQC 4OF0A 1Z3GH 3ROOA 1AXIB 2XFXB 5CD5C 2H32A 2YEZB 2D7NA 4BSVB 1A4JB 2YK1L 4OM0L 3RHWK 3KPPA 4Y16D 1HIMH 3MTRA 2EE6A 5E6IB 4YHYC 4K7PX 5IQ7H 3IKCA 4G6KH 3CFKB 4PGDA 4ENED 4ISVB 3ARFD 4DKEL 1YJDL 3BRGC 4L9LA 4PJ9B 4UNTA 1NFDA 2F53A 3EJJX 1AI1H 5D7KE 2OTPA 1EJOH 4JB9L 5C92A 2XZCL 4YGVB 1AD0B 4ZUWB 4IRSD 5F7MC 1NANI 4HAFA 4MCYA 3C5JB 4OZIF 4AJ0A 5D5ME 2ZUTA 1AGBA 1U58A 4PJCF 1UZ6E 2P5WD 1KEGL 3V9FA 4JKPL 3W9EA 2VDOH 4UINH 5FKAA 5DFVD 5GS0L 2CUMA 4P57A 5IF0B 4NQEB 3VXPA 1VADA 1NCNA 5CSGA 2E9BA 2NPLX 4KMTL 4LIQH 4ODSL 4RFEA 4Y8AA 5EC1A 3GB7A 3L7EA 4U3HA 3KNBB 3PUCA 5DQDH 4PJHA 4Z7OE 1MCFA 2E8YA 2WM0A 2E7LC 3EUUA 2OTWB 3MRQA 2FBOJ 4LSRH 5FB8B 2MQ3A 4HZLB 3FZUC 4AH2A 2APVA 4M5YL 5IW6A 3IU4H 3NCYP 5F8QC 3BPCA 4CRPA 2I5YL 3J7HA 1KPVA 5IBUB 3JVGA 1U8NA 2P5EE 2YUVA 4OD2B 5L9DH 2XWJB 4KKCC 1KELH 4MD0B 4MWFB 4POUB 2FR4A 1EHLL 3MRBB 5HGHB 1T1XB 3DXAB 4I3SH 3QH3B 1P6FA 4MX7A 1MLBB 1A3LH 4TVSa 2HFGH 3V5HB 3OQ3B 1YMME 4JZNB 4NDMB 4NP4L 3EO0B 4Z77A 1MFBL 4YDKL 2LTQB 2YA1A 1JWMA 3HRZA 3BZEA 3E6HA 3HZVB 5I8OL 4E9LA 1I3GH 4M1DH 4Y0GA 2OX5A 3MACH 4RMUA 4Z7WB 4QRSA 5I1JL 3KAAA 4JJ5A 3ULUD 4B41A 2OQJB 2X4NA 4PYHA 2WUBL 1X5HA 3T1FB 5D7JA 4UILH 5GGSA 1BJ1J 4JHBA 3VXRA 4LCYA 3GSXA 2H9GB 4ZTOH 3JBG7 1LO0H 2IQ9L 1RHFA 1DFBH 1HILA 4XCCH 2E9IA 4XVTH 4X80L 4QCIA 2YBRB 3QDMD 1YEEH 4H8WH 1JN6B 1QRKA 2GAZB 3CFJA 3BIBX 3P73B 4I0PD 3SE4C 5J06A 1S9YB 2HRPL 3L3JB 4XCNA 4DZ8B 4NZTH 1IQWL 4W4NA 3VFRA 4XGZB 3CK0L 4W81A 4LVHC 4G8GD 4HQQH 4OZFH 2FWOB 4ZPTB 4OQTL 1CYGA 1LP9F 1J1PL 5F21B 4EZMA 1L7IH 4WUUB 3ULVC 1FN4B 4XCFH 3DGGA 5D2LA 5HSFA 4MAUL 1DVFA 3FRUA 4RGMC 3BQUD 3VFSA 2RBLA 1HEZA 1JNNH 2Z31D 2BVTA 2G60H 3I2CL 4RGOL 4ZNEE 1NFIB 1KCVH 4D8PB 4TNWF 3ARXA 1WK0A 3P4MB 3PQYD 5F88B 5DHVA 3W39B 1GXEA 5DD0L 1UB5B 4QXUH 3MA9H 1SYVA 3THML 1YN7B 5I71C 1T89A 1RUKH 2ED7A 5DYOB 3UYOD 1IAII 5F3BB 1P4LA 2VXTL 2DD8H 1HE7A 4WUKL 3SCMB 4Z7QE 3VFUB 4CVUA 3HC3H 3SKOB 3TO4B 3DVNB 5BMFH 2EDLA 1V7NH 1SEBA 1PEWA 5GJTH 3GSWB 4U1KA 1WJ3A 1QPPA 2IAMB 3AREB 2XZQH 4F8TA 1SMAA 3L5IA 3OGOE 1GC1C 5EZJA 4P2QB 4F57H 3ZO0A 2Q76A 5E9DB 5C0AA 4HK0A 4MJ5B 4K8RL 3VE0B 3MCLL 3QI9C 2CJUH 3U48A 5TDOB 4H1LG 4WTWA 1CBVL 1XF4B 5EB9A 2VUOA 5LXGH 1W2KT 1BD2E 3KGRA 5D4QA 3JWDC 2YN3A 1QNZL 3UYRL 4OZGA 1EIBA 3QG7L 4J12A 2CLRB 5F7DB 1PD6A 3SE9H 4AT6A 1OT2A 3BD3A 1BJ1H 1IM9D 5E5MA 1UJ3A 5SV3A 4IM8A 3QIBD 4I18A 5DJ2A 3C2AH 3N9GL 3NTCL 2WBKA 2NY3C 4TSAL 4A6YB 2VYRE 4P9HC 5FM8A 1LO5B 2WANA 4XRCB 1QFWH 3V6ZA 3PIQA 3U2SB 3MZGB 2WWKO 3PGCA 3SOBL 1TCRB 3G5VA 3WLBB 4GQPH 1I9IL 2EKJA 2PTUA 2CUHA 5H2BA 4TNVF 3TBYB 2IC2A 5DRNA 2VXVL 1G7JA 4L8SA 1P7QA 4XB8A 2VITA 1NCDH 3MO1B 3VWKA 3QRFM 3CVIL 1S7XA 4X9BA 5CJOL 5AYUL 5CZVL 3RUGA 2FECI 4WFEE 4GRLB 3RNQB 3O11B 1ZHBA 1YC8A 2EIZB 3D9AL 1RIVH 1INEH 3ECBB 2X5PA 5IHUL 3FCTB 4FTVE 1AXTL 1YPZE 1VFUA 2DM4A 4D0CB 2BSTB 1KTLB 12E8H 4C56B 4DTGL 4WWKC 2NY0C 2CIIA 4S2SB 3AXLA 5FHAH 3NACL 4LLMB 3IU3B 5C07E 3MROA 3UC0H 2BXYA 4W68A 3GJFH 4PGDB 4KK5C 3KYKL 4IIQB 2Q1EA 1AR1C 4AG4H 1KXTB 1FZKA 5DD6A 2EXYC 5A2LH 3SJVA 3PJSB 4HWNA 1CLYL 1BX2B 4OFYA 3VWJD 4I48A 3U83A 1GGUA 2EEDA 3IDGB 1FNAA 1OT1A 1FPTL 1KB9J 5EUOE 3MR9A 5JORA 5SV4A 3UZEA 1V5JA 2DYPD 4C54A 1ACYL 3HE6C 4W70A 3MUGA 2X1QA 2I24N 1BQHA 4U6YB 2AJVL 4GKZA 5FKAB 3N85H 5GRVK 2BRRH 1MCOH 4GBXC 2ATPA 3LSOA 4LBEB 5L2KE 3RWIA 1TJIL 1VADB 3ARWA 2GQHA 5EU7C 4UU9A 2PO6D 4OGAD 3S37L 2R56L 3GB7B 3L7EB 1UQSA 1ULVA 4I2XA 2XKSA 3GIZH 4PJHB 1LD9A 4PV8A 4FMFA 4ZOCA 4JR9H 3O3AB 3CXDH 4Z76B 2NY1B 5DWUH 2DMCA 3L3OA 3O3EB 4JDTH 3TVMA 4NYLB 4P5TA 4KAQH 3QDGE 3BUYA 5F9WB 4YHMH 3ZTNL 1ERNA 4TOYL 4JAMA 4YAQA 1A21A 3UCRA 4IDLA 3H0TA 1WWBX 4MXWH 2A77H 4G6JH 4MX7B 3U9PH 3QUMH 4L4VD 1LNUA 2Q7NA 5TQ2L 4LLWA 1QR1A 1IGJA 4PFEA 3GM8A 5EZIL 3BESR 3SDCD 3HMXL 2MQCA 3JTTA 5CGYC 1YYLL 5D7LA 4X5WA 3SHSA 3K1KC 1VGKA 5DXWA 1A9BA 2LVEA 2DDQH 2KZWA 5ADOL 2AK1H 4LCWD 1ZXQA 4FQCL 3MV8E 1I9RH 1JPST 1T2QL 2J8UA 4R26L 4S0TD 1JYXA 1AIFB 1AQDA 4YHKH 4XPGL 5D7JB 5GGSB 1NUDA 4MD5A 3K2MC 2HFEB 3RVVC 4ZUSB 4OGYH 3H7BB 3JWOC 1RZJL 3U4EA 4QCIB 2FJGA 2VERN 3CFJB 3RTQC 4X4MA 4PP2A 3NA4A 5I6XB 5H94A 1NGZB 4KTDL 4WO4B 3JV5A 4QKXB 4LEOB 4M48H 4BH8A 3O81A 3OZ9H 3QWRA 2UY7A 1UYWL 4L8CB 1P9MA 1XCQA 1GIGH 1NLDL 1RJLB 2EYTB 1JPGB 2GCYA 3QDJB 4QHMB 5DHXB 3UTQB 3DVFA 5CEXB 4YEFA 3DV6A 1YN6B 1IEAA 3IDIA 4DOHB 2Y5TA 3X11B 1M05B 5IV2B 5DFTA 3EOBB 1HXYB 3FB6B 4FFZL 3CMOH 2FX7H 2E6QA 1AQKL 1PBYA 2W0FA 1AO7B 3NIFF 1SYVB 4M00A 2VNCA 2C9AA 4M1CC 4EVNA 1CICA 3RY6A 4OZHA 1ZT4B 5M95B 2LQRA 4DGVL 4MJID 2ZCKL 3KPOB 3KPTA 4PR5A 4L4JA 3LZFH 3C6LC 3HR5A 4NN5C 3V52L 1RIUH 4IRJA 4U6VH 5EZJB 1TVHA 5DJZB 5LGKA 3D39E 2PNDA 5IHZB 3C6SA 5SWZE 4LP5A 3DI3B 1GZQB 3PWUA 3SDDD 5K59F 2ARJA 1CGYA 4H5SB 3UTTE 4B5EA 3CFCH 5D9SA 3KYOA 1LE5B 3E1F1 4UTAH 3WFHB 2VSCA 5C6TL 4Y19D 4FQ1H 2X40A 4R4NC 3DJ9A 3BP4B 4BH7A 3QEHB 4X7TA 3GHBH 4Q0XL 1D5IL 1MHEA 4AT6B 3QNYA 4OM1L 4X6DA 5E5MB 3IXAA 3IFOA 3WDIA 1ZVHA 1UJ3B 2W0PA 4OUUA 2ESVA 5SX4I 2J4WH 5IFAH 2VZOA 3EAKA 2EYSA 4QOKD 1S78C 5SX5H 2GITB 2NY6B 3UEZA 3V6ZB 5IQ9A 2VLKE 5JUEH 4U49A 1KTRL 3OKLA 5EU5A 3SKNB 3KLHD 3GMMA 2V2XA 1IRAY 2R9HD 4OLWH 5C70A 3T2NH 1G7JB 4LLUB 5HYQB 2H8PA 3L3GB 3PWNB 3VWKB 1F4AA 5E2VH 2CPCA 1S7XB 4HGKC 3EOAA 5CD5D 1IGMH 4H88L 5CEZE 1MCEA 3QWOB 1Y0LA 2B1AL 3RUGB 3G6JA 3RZWA 1ZS8B 3H8NA 2DQIL 5TQ0H 1CT8B 3KLSA 2EDYA 3VXMD 1Z9LA 4PJIA 1RZ8B 4QY8B 1EZVX 1NKRA 1DL7H 4JKMA 2PTTA 2XPGA 3EDDA 2J5LC 3DV4B 3L3HA 1FHGA 4NNPH 3O0RH 4QHNA 2ICWJ 3VGAC 1FG2A 3CDGA 3E6FA 5IJKC 3QUYB 1U3HC 3AROA 4WW1B 5F9AC 3O4OB 1J5OH 1JIBA 1N5AA 2QSTA 5EG6C 1NBYA 3WUZA 1FZKB 2GHWB 4X7DC 5EU4A 4XXDB 3SJVB 3GBNH 2XZZA 1S7WA 4GAJL 2NYYC 1NMAH 4NO3B 3D5OF 4I48B 3FFCD 3MV9E 3NFSL 4TSBL 3MQIA 5JORB 4LKXA 3BZDA 3ILPA 2HTLC 2YS4A 3W9DB 1GOFA 5F9OL