3FN0H

Crystal structure of hiv-1 neutralizing human fab z13e1 in complex with a 12-residue peptide containing the z13e1 epitope on gp41
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
221
Chain Sequence
EVQLLESGPGLLKPSETLSLTCTVSGGSMINYYWSWIRQPPGERPQWLGHIIYGGTTKYNPSLESRITISRDISKNQFSLRLNSVTAADTAIYYCARVAIGVSGFLNYYYYMDVWGSGTAVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Z13e1
publication title A conformational switch in human immunodeficiency virus gp41 revealed by the structures of overlapping epitopes recognized by neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 39
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H01
3GHBH 3CUPB 4MJ5A 4WI4A 4EI6A 4UV7L 5L2JB 4HK3N 3CFEB 5BJTB 1S78D 4P3CL 5TQ0L 4G9DA 3U7AA 2DQGH 1SBSL 5BMFH 1RFDL 3RI5F 4CW1B 5C8JB 3L3GA 3G5XB 4PJGE 2KH2B 1S8DA 5GIRB 4YHLH 3G5ZA 4XP5H 3CDCA 2VLRE 1NEZG 1P5VA 1HXMA 2Q8BL 3QA3B 1RK0A 4EXPX 3GNMH 1J1XL 1NMCB 4Q74A 2ZNXA 3BEWB 3VWJC 1AE6H 3KS0H 2P8MA 1OAKL 3VDBA 3O6KL 1TPXC 4LLDB 4ZPVA 4HS8H 2RQ8A 3NCJL 1ETZB 3CH1B 4PS4H 4L5FL 4RMQA 3SDDA 1UKTA 2VXUH 3BE1H 4JCLA 1CG9A 2IPTH 3ARQA 3QIBC 5IG7A 1ZA3B 1IRAY 3VD9A 4ERSL 1IKFL 5F1IB 1Z5LA 2AAVA 2N56A 4X8XA 4YDVA 3RTQC 4GLRI 3RDTA 5FAAA 2FRGP 3I84A 1RU9L 3BAEH 1DTUA 1KJ2B 3MOQA 4MA7L 3P9LB 2BDNL 3U36A 1EERB 5DVOA 5E94A 5EA0H 5FO7A 5IB4B 3KYOB 3QCUH 1WZMA 4ZAKC 3HE6A 2LE9A 1RZFL 3O81A 4ORGB 4KROD 2DQTL 32C2B 3EJYC 4HC1L 3AC0A 5DMIH 4N90D 4Y5VB 3HG1A 5D2LF 4NQTA 1ND0A 1EO8L 3B2VL 4LLVB 4PRPE 2BRRL 1F3DJ 2B5IB 2D7QA 1EV2E 3BUYA 4N0CD 5TE4L 3WE6B 4P23B 5HPMA 4GAYB 4EBQH 5D7JC 1XF2B 4DUXA 4XPBL 4GMTL 4E0RA 2YMXH 3KLHD 3DX9B 1S9YB 1T20A 2PCPA 1AKJA 3DIFA 1U8PB 3PWUA 4JFED 1YC7A 2C1OB 2DQDL 1FDLH 4OCNC 2JCCF 5TH2A 4NPYA 4PJEE 1HI6A 1WICA 1DQJB 4QT5A 4UQ3B 3DYOA 4DKFH 5ID0B 1S7RB 4H26A 1P53A 4KDTC 4LAQH 4WTWA 4ZUUB 2VDRL 2UZYB 3CD4A 4TOYH 1FAKT 1L7TL 3ZDZF 3WDJA 3RDTC 1KB5L 2IBZY 1EDQA 3E2HB 4YZFF 5IFHL 5DK0B 3UAJC 2VR4A 3SEPA 3K4ZA 3HE6C 1G7IA 2OQJA 3WFDL 1B0RA 4AIZA 1IQWL 3QXAB 2K1MA 3BD3A 3GMOA 4WU7B 3SKMA 4HIEB 3RZCB 4RWYH 3WLBB 4NQCB 4M1GH 3H7BB 1MCPH 4L29A 4YPGA 4XT1C 3IXTB 4XRCA 3UTPD 5DFTA 3UDWC 3PGDB 3V5HB 1P7QB 5JIIA 2EDEA 1NGPL 2F5AH 1YEKH 1EUTA 1QPPA 5ICZB 5I17B 3UJJL 3K2UH 1U3HB 2VO5A 3T2QA 4XC3L 4P0DA 3MRCB 3HNVL 4HXBH 5B38B 5I1IL 1JZ6A 1UXSA 3HHRB 4H1LA 4HBCL 4MXQC 4L1DA 1XF4A 4FRWA 3EFDH 1BD2D 2H32A 1ZVSB 1KCSL 2X4NA 3IAPA 5AYQA 4RGMB 3O4LD 2VLJA 2G60H 2HN7A 4IMLB 3B5GA 5KTEL 5FUZH 2H1PL 2H9GB 3A67L 4YHKL 4I0PB 3W5MA 4L3EE 3KPOB 1MY7A 3NH7H 4Z0BH 3V4VH 2C3WA 3QDHA 4IEFB 3HRPA 3O2DH 4YNYB 4RAVA 4OLXH 5HYQA 2VITA 3PWPA 1YC8A 3ZHLA 2G75B 4W4OA 1A1NA 3DVIA 2ZCLH 1G9NL 5DSCA 4J6RH 4NFBA 2HG5A 4IRZH 1DQDL 2BOBB 5E9DE 4LPYA 2I9LB 4OQTA 3MXVH 1N26A 4NZUL 1A6ZB 4JFHE 1AJ7H 1C1EH 2IAMB 5A16B 3SDXB 4Z7UB 5IMOB 3U79A 3QXWA 2Y6SC 3QHFH 1RJLB 1X5JA 3SE4C 1L0XA 4P48A 4AEIL 4F33B 3D3VA 4J3VA 4FA8A 3QEHB 3EYOB 4WHYG 1CXHA 2XWJA 1IGJB 4KI5D 1FH5H 4BZ2H 1ZTXH 3PWLA 5GGVY 1Q72L 2EE9A 3LKOA 2APXA 3QXDB 3VD5A 3QDJE 1GOFA 4OTXH 2C4FT 1UCBH 3JVGA 3R0MA 4NUJA 5IMLB 43C9B 4QXTB 1MJ8L 4LHQB 1XT5A 5DQJA 2R2HB 3B9DA 3RGVB 1MF2H 4U2YA 1N6QH 3MRGA 1G7LA 4DN3L 3ZT5A 1KACB 3LMJL 4MCYB 2QKIB 1Q8MA 5C0JA 4M7ZC 4U6XB 4XBPA 1BMGA 4BSWA 2HTKC 1U8JA 3QO1A 3H6JA 1HH9A 2C1PA 3BP5B 3T2NH 2ZUQC 4W6XB 1YPZB 1NAMB 3QRFM 1MQKH 5T1KB 1VACA 4M93B 1QVOA 5GJTL 3NTCL 4NQEA 4XMKH 1CCZA 3FOLA 3O9WD 4PYHA 3ZDZE 5BXFA 5TE7H 1PKQE 3H8NA 5IEHA 2ENYA 4KVCL 1X5IA 3U6RA 4EUPA 3M45A 2BVOB 1FV1B 3FO2A 4OZFG 5ELIA 4XNQA 4APQB 2ZUYA 2Q3AA 1CXEA 1V3LA 1NUDA 4QOKA 2A1WH 1T7XA 5D1QB 4XPFL 4FQJL 1CFSB 2CJUH 1OD9A 2HT2C 3WJJA 4NYLB 4PYGA 3JVGC 5E4EB 1UYWH 3WIFB 4RGND 1C7TA 5EU6A 3QRGH 1K6QL 2R69L 4R26L 3ALXA 5AYUL 3EJJX 2P8LB 4U1MB 2DMBA 3ARDB 4J1UA 2UUDH 4XI5D 1S7UB 4UT7H 5LQBH 3FZUD 1TNMA 4I0PC 2B20A 3TN0B 4ZFFB 2AQ2A 3PHQA 1FC2D 2GJ6B 2F53D 3QUXB 3W0WB 2QV2A 3BWUC 1RIUL 5ESQA 2DTSA 3C6SA 4YXKL 4R2GD 3PV6A 1DVFD 2APBA 3DX7A 1OAQH 2RCSH 5TDNB 4MXWH 4BZ1H 5T5NG 2YPLB 2CDEA 1TCMA 4LCCA 3GUTB 1YEHH 5DZNA 1DBKL 4V1DE 4S1SL 1LEKA 4Y4KB 4F37F 2GSGB 1FZMA 5EN2B 1PG7W 1CDYA 1CFTB 2PW2A 1BZ7A 4CJ1A 3EIFA 4JFQB 1OCWL 4JO2L 5D71H 3WJJC 3BP4A 2YD6A 4DN4L 1IC4H 1LO3H 5T1DH 1T0MA 4G6FB 5KS9B 4HF5H 1PSKL 1F4YH 3VD7A 2P24A 3VXSE 1NCTA 1NEZB 3UTSD 3ZL4H 3H42H 4IIQB 3TBYA 4NRXB 4YHOL 3PE9A 1W8NA 1MFEL 2AJ3A 3MLWH 2EYTB 2W0LA 1QZ1A 3HC4L 4LIQL 4X0KB 1JTTA 1AIFA 5JOPE 4G8FB 4ZFZB 4NQDA 1K3ZA 4BQCA 4NOBA 3MJ9A 3QDMD 1DFBL 1NJ9A 1JBJA 3A6CH 1MPAL 4X8JB 1CE6B 4PR5B 4S1QH 2AK4A 4Y4HD 5CHNB 5FA3A 3KJ4C 3BGFB 1VGKB 3UPCA 2GSIB 5CJXA 2XKNA 1J87A 5D7IE 3KPTA 1JZ3A 4NNPH 3OB0H 5C0AA 3NZ8B 4NIKB 4R90L 1FGVL 2HJLB 4HWBL 3PP4H 3U2SA 1CIUA 5IVXA 4JFXA 1OT1A 1GPOL 2GFBB 4OLVH 5SWZA 5LJYH 5F96L 1MFCL 5DVMA 5D2NB 1EO5A 1DQQA 4E42A 1FN4A 4NJ9L 4APQC 1A64A 5KVEH 5ILTH 1I4FA 3CU7A 1A5FL 1J7VR 2FBJL 3VFOB 3FB5B 1VCAA 4IM8A 5CINH 5C0BA 4D3CH 4CRPA 5C0RH 2OK0L 1JPGB 3QUKA 1NUFA 3VWJD 4EZMA 1WBXB 1YMME 2E7LA 5E4EC 4XMLH 3KR3H 4Z7WF 3DURA 2XZQH 3BGMA 3REVA 3KPLA 5HVHB 1KN4L 5I1GL 4XPTH 3GEWB 3ARDC 4NC1E 4NM8L 4ZTOH 5GRYA 3KPRE 3QIBD 4DGIL 4Q2ZA 1CLOL 5I71B 4M6ML 2BP3A 4X9GA 5JDSB 4LLAA 2B0SH 3QWOB 5ID1A 2A6KA 4OCSL 3MGOB 5GSVB 3EYUL 5IVZA 3T77B 4A6YH 5TPWH 4KKAD 1OD7A 3OF6A 2CXGA 4ETQB 5F89A 3FO1B 3PL6A 2FJFB 3FT4A 3LS5H 2AJYH 1YNLL 3BGAA 4YFLI 4ZAKD 3FB6A 1I1YA 2X4SB 1A6VL 5DURB 3DUSB 3WIIH 5L2KB 1KT2B 3DSNA 2CMRL 1G9ML 3EJYD 5D8JH 5I18H 2CIIA 4JRYE 3GMPA 2EECA 3MV7D 2R0WH 4UQ2A 5I8KH 4OZGF 3MV9D 4LARH 5DEZA 43CAB 2GCYB 2V2WA 5DJXB 1O7VA 3R1GL 1HKLL 5ISZB 3AS3A 5DUML 1TXKA 1A4KB 3PHOB 1YMHA 4XPHL 5BS0E 3D1MC 5D7JD 4JO1H 3TT3L 2BHZA 4KY1H 1XGQB 5IHZA 2EO1A 3OKKB 3TJEL 3BPCA 4WJ5A 4X6CE 5EBMB 3DSFH 3T08A 1JWSB 3RGHA 4L9DA 3OKDB 3F58H 3CU1A 3KJ6L 4NN6B 1YYLH 2NW2A 3TBVB 3SE9L 3KYNB 4E9LA 3ZHKA 3U0WH 4MZ2A 1N6VA 3RDTD 2CLVB 4PIRF 5FGBA 3OAZH 3MBEB 4IDJL 1YZZA 3ZHDA 4DKDC 3UBXA 4XAKE 5DR5H 4DVRH 3MOAH 3UAJD 1A22B 2VL5B 3QJFB 1GAFL 2HT3C 4OIIL 3HE6D 2WINB 2UYLB 4G6KL 2FEDC 5HHOB 2QSCH 5EBWB 1FVDB 5FYJH 4XNUH 1X5FA 3V7AE 4J23A 4P3DA 2IH3A 4JJ5B 5L88H 1FVCB 2QQLH 3HG1D 5AG8A 3BSZL 3T0EA 1F3RB 1IBGL 1MWAH 4GW5B 5DI8B 3U4BH 1OP5K 2RAMA 5CBAA 2VLKA 4HZAA 2J4WH 2DWDB 4ZUVB 3INUL 4YDJA 1WZLA 4DK3A 1A7NH 5F88B 1QRND 1MIMH 1IGIH 4WGWB 2XXMB 4WUUB 2BVPA 3S36H 1QLFA 5LVEA 3EYFB 5EORH 3UTZA 1AKJD 2XT1B 4FQLH 4MXQD 2K9UA 2WMPA 3S6CA 3BH8B 2CUHA 2BVQB 1KCUL 4G8EA 4G80B 1UM5H 2AV7B 1VFBB 3LRSA 3E6FB 2WV3A 2W65B 2XA8H 1FZJB 1KJ2H 4L8CA 4KUZL 2RIKA 5SWSA 3GMQB 4QXUL 5E03A 2NTFA 5I71C 4ZPTA 4GKOA 1UADC 4QHNA 5DQ9B 4P2OA 3N1PC 4HGKC 3BJLA 3V5DA 1GXEA 4JM2C 5ACZA 4K2UL 4PRIA 4Z7WE 3T65B 4HJGA 4JGMA 4K55A 4YHIA 2VH5H 2XZCL 2MHAB 4PY7B 3IFPA 5C09A 2ATKA 3F7YA 5IQ9B 1QEWB 3T0EC 2EZ0C 1FBIL 3C08H 6CGTA 1BFVL 5C0FB 1ZWIA 4NFCA 4U0RB 2ZPKH 4JM4L 2BSRA 3ARUA 4LDLB 2QQNL 3CLEH 2Y6SD 3STLA 4U6YA 4PV8A 1HHKA 1DN0A 3N0PB 4JFOA 1IGCL 3MRDA 4E41E 1MAKA 1NPUA 3AU1B 3RIAK 3EDEA 1YEGL 1R5WB 2VR5A 5FDWB 1KCVL 4MDIB 2FX8L 3OTTA 1OGAB 5DJ8B 4ODHL 3ARPA 4NZRH 1GGCH 1B9ZA 1UB6B 4OZFB 4XCEA 5C0CA 3G6JE 4BSVB 1P69B 3MJ6A 3BT2L 4MS8C 3EO0B 2E27L 1MFBH 3ETBF 4L3AA 1AGEA 3I9GL 3NVQA 4LPXA 2VISA 2EDQA 2E7CA 3ARWA 3BIKB 4S10A 5K59F 4FQIL 4NN6C 3OKNB 1G7PB 3ZT7A 1WZKA 3C6LC 1XGRA 3KYMB 3FTGA 3F7PC 1LK3H 2L7JA 4O9HH 2E7HA 4NT6B 1G7JA 1JF1B 5LCVL 1E6OL 1ZHKB 2HTKD 1NCBL 4DGVL 4W68A 3PWPD 3MV8A 4CVZB 5F1SA 1F90H 5MEPA 4MA3A 2EDLA 1ZOXA 2FIKA 5CEYB 3AB0B 3RL2B 3RPKA 4GKSA 4KMLB 3N9GH 2V2XB 1DQLH 3W2DH 1U91A 1RUMH 4F58H 2XFXB 3IKCA 2NW3A 5BVPL 2O5YL 3VXPB 4AZ8A 2IQ9L 3MLTB 4UINH 1VADB 3EZ8A 4JR9L 2UY6A 4MJ6B 1E4XL 5M94B 4R96B 1CXKA 5BCAA 2BK8A 1TJHH 4NCC1 4KJWC 3ZDYF 5EU5A 3GM0A 4PRAA 3JV4A 2X6MA 5JORB 1T04B 3BFOA 3U1SH 3SGKA 1NBVL 4RQQB 3MZGB 4DZ8A 1IGML 2EDHA 4XXDA 5C0IA 4G8IB 2HA1A 2VMFA 1FIGL 4RCAA 2CKBA 4OGXL 5HYJE 4KZDH 3IFLL 3MRBA 5GS0H 1I7TA 1PY9A 3E6HA 2E6QA 2C3XA 4F3FB 4I0PD 1BZ9B 1FNGA 1XR9B 5B39A 3CFKB 3TWCH 2LQRA 2LVCA 4JN2A 1R3IH 4R97C 5T3ZE 5F8QC 3SDAA 4NHCL 4QWWC 3DROA 3NPSB 3V6OC 1LEIA 3H7LA 2DYPB 3STBA 3DYPA 2PR4H 4MNQE 5INDB 4NQED 4RMVA 3V9FA 1Z3GL 2CIKB 4HDIA 5DA0B 3OWEA 1N8ZB 1AD0A 1M05A 1B2WH 4WI2A 1D3CA 2E6JA 2RBLA 5IT2H 5IBTL 2ZG2A 1F4HA 1J0JA 3MCLL 1MJJB 2IADA 2R56L 4QOKD 5SWQB 5AZEH 5E1AB 5MENB 2GT9B 3UO1H 3L95B 2DJUA 1GYAA 1U8IA 4Z7OE 5I76A 3CSGA 2CRZA 4CN1A 1RIVL 5EU6D 3U46A 2FX9H 4OB5H 1OP9A 3WFBL 1T2QL 5JW3H 4AG4L 3HN3A 4JO3L 3PXHA 4LLMB 3BDYL 4UDTA 1H3UA 3WFCH 3S3SA 2UVEA 2YK1H 4HV8A 1YEFL 1B0WA 4ZG1A 3P0YL 4LASH 5I30L 4ZOCA 2R23B 2XPGB 3ESUF 3E8UH 4H88L 3TV3H 1NAMH 4XMPL 3LKQA 6FABH 5D93C 3RUGF 5L7XH 3ALWA 1B90A 1T1ZA 1E27A 4J8RA 3VXMA 4OFDA 3SDAC 3QDGB 4UBDC 3U0PB 4PRDB 3OKLA 1T3FA 2R1YB 4UT9L 4L4TB 3U4AA 1H15A 2ED8A 1AP2A 4DVBB 3MCKA 5K59E 4IJ3B 3WIHL 4HUVB 4OQTL 1KC5H 4IRJA 4L8SA 2ZG1A 1MCRA 1FFNB 5KSAB 5EOTB 2ICEB 3LKSA 5E8NB 3I3EA 4JREB 2V5RA 1WF5A 1IAKB 1FRGH 5DXWA 3ZDXF 5A3IC 3BP7B 4APQD 4PJAE 3V6FB 2DLIA 3UTQB 5J57B 1JNJA 3O0RL 3CZJA 3F6LA 1CR9L 5EUOA 2CGRL 5LBSL 3F5WA 2WWMC 3U82B 5INCB 2VDLL 4JFZH 5IFJB 4OJFL 4WIQA 4JY6B 1H5BB 1MCOL 1RZJH 4U3XA 4WHDA 4WI9A 5HGBB 2IBBA 5CCKH 4POZC 1CIDA 4OD2A 2G9HA 3CFDB 4UIKH 3MLXL 1K8IA 1YDPA 1A7PL 3FQRA 4LOUD 1PLGH 3PDGA 3L3DB 3MUGB 3ARDD 3ARXA 1QO3A 4HFWB 2ZUUA 1W0WB 4NQDD 5FUOH 4GO6B 2OR7A 1QYGH 1ADQH 4PPTA 4Q6YA 1BX2B 2NY3C 3LIZH 2AK4D 4PGEB 4O00A 1H3PH 4WTZA 4TUOB 5CJ5A 4G7YL 4NUGL 1G1CA 3OXSB 4GXVL 4N1CA 3BKYL 5C0AD 4BQ8A 3BHBB 1FYTA 1S7WB 4DWHA 3DUHA 3H0TA 1OPGL 2XOTA 4M7KL 4Z7VB 2Q7NA 4Y5YA 1I7ZB 5SWZD 1SEBB 3HUJA 2YPLD 3K4AA 1UH4A 3S34H 1FNEA 1M6OB 1EEYB 1H3WM 3ZYZA 1OT2A 1PZ5A 3X3FH 4P2CG 5FYLH 1EXUB 5C0BD 4JZJB 4MNGB 2OSLA 4EUPG 4M6OL 2AJSH 2OI9B 1OQXA 2J88H 3QQ3A 2E6PA 4XNXL 1F4WH 4XBGB 5H2BA 5E2WH 4UV4L 4Z7UE 4QRUA 4J3WA 4UUJB 2H26A 2W0KA 3CSBA 2Y23A 3QI9C 1PD6A 4PJ8B 1D5ZB 1T5XB 3CVIH 1S9VB 3C8KB 4O58H 3STZA 2VAAA 3RX7A 1T5WB 4DAGL 4JPIA 4X6DA 1MEXL 4R3SB 4XWGH 5JA8B 4QHUB 3JWDC 3MOBH 4ODWA 4MX7B 2HT3D 5FO8A 5FB8B 2D7NA 1NLDH 2FEDD 4PJIF 4Z18A 4X6BA 5DD1H 4OLWH 3ULSB 5LWYL 4KU1A 1FE8L 4U1IB 5ENWB 1P7KA 1XF3B 4IJ3C 4WFGD 1SJXA 4Y5YC 4BFIA 5SX4I 4LLQA 2BNRA 4JVPA 4OT1H 1RURL 1DP0A 5IMMB 3IDGA 4GSDL 4M48H 4U1LB 3VFRB 1RZFH 3ZE2F 1QSFB 3LEVL 4M03A 1RUPL 1BOGB 4JFFD 4OFYA 1QKZL 5IEKB 3OJDB 5LXGL 3AAZA 4WCYH 3T09A 3T1FA 3FONB 1UJTA 5JZ7C 3H9SE 2A73B 1D6VH 5CJOH 2Z31A 5J8OA 4QNPF 1PDKA 4N9OB 3CSYA 4UIMA 1KNOB 3ZDXE 1KF9B 1OLZA 4JFDD 3SDCB 2UWEE 3DX6B 3EGSA 1N64L 3KXFB 1QBAA 2CRMA 2WP3O 3HRZB 4G5ZH 4KK5C 3BH9A 2CR6A 4NJAH 1LP9E 4P9HH 4PJGA 3MJ9L 4JM2D 4K23L 4GRMB 2DL9A 3GHEL 3MLZH 1F02I 3P4NA 1RJCA 4MCZA 2XTJC 3MMEB 4FXGA 5J13C 5F7UA 3SDDB 1WCQA 4KVNL 3T0ED 4X4XB 2EZ0D 2SEBB 3G04B 3SGJA 1A9BA 5DRWB 2VLKD 4XP9H 4G7VH 5DQDH 2PW1B 4HXAL 4G6AC 5FYKD 3PGFH 2GJ6E 3TO4B 5CP7B 3Q6GL 4BZYA 5E94B 3MRQB 2JIXA 2V9RA 4MWFB 1ORSA 1ITCA 2OMNA 1KENH 4WY7L 1KEML 5H94B 2OJZL 4BFGA 2VIRA 4IOFC 2OI9C 1PG7X 5BVJB 4NC2B 4BUGA 2Z93A 3HNSH 4TSCL 4X6FB 4LQFH 4MS8D 4OD1H 4LSVL 4ZFGH 3RWIB 5GJSH 3D39A 2YPKA 5GSRA 4XC3H 2RJMA 1YQ2A 2MCG1 3BUYB 3D0VA 3C6LD 5I1KL 1RK1A 1DUYB 4PJ8C 4P2OD 4YC2C 1G7HA 2AXHA 2XA3A 3AREC 1QTYT 1GH7A 4JG0H 3CFCL 5EOCJ 1GGIL 5KS9E 2PCPB 3PIQB 1CS6A 4WU5B 1S5HA 3BPNC 3CZFA 4IDLA 3V4UH 4MB3A 5TF0A 2GTZA 1JWMB 4UZGA 4QRPE 5C09D 4F2MB 4Q9CA 2X89A 3NABH 1MLBA 1M1SA 1ZEAL 3SGJC 2NY7H 2W38A 4ZQKA 5KOVC 4PJ7A 5BRZA 4OCMC 3S5LA 2X4RA 2YKLL 5FKPB 1UKQA 3ZO0A 1I85A 4NO3A 1DQDH 5KAQG 1LO4L 1RVFH 4MD5B 2C3HA 4KJWD 4WHYH 2XYCA 3IDXL 4C83A 5C0CD 5E2UL 2ADFL 3G6AA 2VC2L 2ZOLB 3QFJE 1NFDA 4L29B 3TNNA 4LLUA 4NN7B 5TFSH 1JUFA 3VGEA 3LH2H 1BLNA 1JHKL 4QTHB 4Q58C 2BNUA 2LAGB 1INQB 2P5EB 4XPGH 3SDCC 1OGTA 3NIFE 5GRUL 2YD5A 1Q38A 3GSNB 1OL0A 2VDPL 4HPYH 1I8MB 3D9AL 3PGCA 3UYOD 1KLFA 4GMSH 4Z7NE 3A6OA 4I4WA 4MB5A 4QNPE 2FL5B 4X99A 5KW9L 2VLJB 3UPAA 3L5WB 1HSBB 3KPSA 4MD4B 5DTFB 2EXWC 4MB4A 2EIZB 1RUAL 3U7YH 1BEYH 1MRCL 4LSRH 4WDIA 5D6CB 2WIIA 4UTAH 4HJJH 5EH1A 2ZCKH 3VCLA 4NZTL 4OCYH 5DRZB 5FYKL 1UWXK 3FQXB 5IQ7L 4N0UB 4OZFH 3TLRA 5BV7L 3VW3L 4I3SL 4AEEA 3B6SB 3HNTH 2VE6A 1T1XB 1OB1B 3P4LA 3MRPB 3ABZA 4EQ3A 2HG5B 4LP5A 2X05A 2J8UF 4F7MA 4GRWE 3RWGB 5EZLB 4YEFA 2VZUA 2AEPL 4FQHA 2YUWA 1MH5A 5DJ0A 3RKDC 3P11H 2W9DH 4NKDB 5T1MA 4CNIB 5JNYA 1JV5B 2VDKH 3VXRB 2ESVE 4YGAB 3UJTH 1E0OB 4L8BA 1CLCA 4ZD3H 2A6DB 1Q9KB 4LKCB 7CGTA 3ZKQD 5IFAH 4PJHA 1ES0B 3SPVB 3BRDA 1X7QA 4CU6A 1KEGL 3EBAA 1K6QH 5DD6B 3IDUA 5E8EA 5BZWA 3SDAD 4K3EH 1XH3A 1IAMA 5GHWL 2NQCA 3WLWC 5K9QI 3MNWA 5D2LA 3KYAA 4G3YH 3LV3A 5T5FL 5T3XH 1QOKA 4NWUL 2XNAB 3MREA 3IS0X 2FECI 1PG7H 4JVUA 3QHZL 4NKOB 4H5SB 5C0JB 4FQ2H 4FG6C 4S1RL 1UXWB 5EU3A 4BSWB 5JIPA 3O4OC 3QO1B 4KFZC 3VGHA 4NO2B 4GS7B 1CFBA 1VA9A 4NRZB 5DLMH 4JAMB 3VXNA 3LQZB 2J6EA 5HHOE 3IT8D 4ODTL 1C5DB 2VZOA 5GGTH 2WWMD 35C8H 1RULH 4NKIL 1A02N 2JCCA 3DNKA 4UOW0 2XZAH 1IM9A 2FWOA 4K8RD 4RDQF 4K3DH 3D5OF 4HFUH 4POZD 4JRWA 5AZ2H 5C6TH 2R1WA 5FK9B 3HZYB 5E6IA 4EUPB 5IW6B 4G6JL 1BWMA 1UA6L 1P4LA 5I1HL 4XNMA 5IESL 4FFYL 1QD0A 5D4QA 4NNYB 1KLGA 3VXMD 4LPTA 3MFFB 4CGTA 4HEME 1K8DA 4FZ8H 2O5XL 2BSSA 5JIHA 2BOCA 5IIEB 2NY3D 4MA8H 4KPHL 1EX0A 3H9ZA 4WV1B 5ADOH 1U8HB 4YQXH 4N90E 3CPLA 2NX5D 3HC4H 5E5MB 4Z77A 4X9FA 3KHQA 4PJFB 5FOBA 2Q7YB 1N3NA 3HAEG 3RFZC 2ED7A 1FNAA 3QUMA 2PUQT 4X7TA 3SOBL 2X7LA 4YWGL 3UZQA 3F7VB 3SKNA 4O02H 4L9LB 4JHAH 1MUJA 5I15H 1UKSA 5DMYA 3MRMB 3T3MF 4R0LA 4WI6A 5DDHA 3CCHB 5CBEB 3PDOB 5C08B 2OXHA 3Q3GB 2LAAA 3D18A 3IDIA 1D5IL 4FP8L 4JFEE 3QDAA 5FDYA 3CFBB 2A9MH 1OVZA 4ZOAA 2QQKL 1HDMA 4PREA 3OKMA 4KV5F 1OWWA 1CWVA 4U6HB 3VWKA 4QLRA 4NJ9H 1R3LA 4AT6A 5M95B 5E6IC 2R39A 1NGXA 2CKBL 1A5FH 1ZHBA 4RNRB 2AERT 1R5IA 4HKXA 5E2TL 4J3OC 1FZMB 1MCIA 3MUHL 1IE5A 1E28A 2D0GA 2NZ9C 3JWDH 3QI9D 1NCWL 4JKLA 1U8MB 3RHWK 3BP4B 2J8UE 1OGAE 3B8SA 1U58A 1S7XA 1T0MB 3QDGD 1CFNB 4OZIE 3B5HA 4QF1A 3FRUB 3SQOL 1FFPA 5I1GH 5I6XB 2HMID 2P24B 2GUOA 3ES6B 5B39G 1CLOH 1FYTD 4PJBF 3SY0A 3TBYB 3UTPE 1UWGH 3D25A 3QEQB 2HP4A 1LK2B 4Y1AB 4XNYL 1JGLH 5CD3A 4R0LC 1NGWB 1CT8A 5IF0A 4HLJA 1AGCA 4OGAC 4M61B 3P30H 2PXYA 1A3LH 4YIQA 5ITFA 1NJ9B 1JF5A 3MR9A 4OLEA 2FZ3A 5E99H 1BD2E 5FA3B 3DECA 5CKAA 5DJ6B 1JPST 1D6EB 3O4LE 2XKNB 4I2XB 2FSEA 3V6ZA 3WV0A 5JZ7D 2PYFA 1K2DA 2DLHA 4K7FB 2HTLC 2QADD 4OLYH 1MVUB 1YEJH 3CLFH 1HKLH 4U0QB 3U2SB 4HUWA 4K8RL 4JFXB 3GMRA 1YA5A 3AFLA 4PTUB 1KN2H 2BVEA 4X9HA 1YNTB 1PX3A 4JDTL 2OR9L 4YHPA 4O2EA 4DOHB 5CAYB 1L9NA 1FZKA 3RWDB 1PFCA 4JLRA 4KK5D 4Q0XL 3FQUB 1ZA6B 4LSQL 3FRPG 3E0GA 1J0HA 1TENA 1JI2A 1DQMH 3MLVL 4KHXL 3SE9H 3LAFA 2XTJD 4DGYL 3IYLW 4G6ML 2P4AB 1DLFL 3TVMA 3KPLB 5DK3A 4IOSD 2BNRD 3VRJA 2FBOJ 1GZPA 4Q2ZB 4RBPH 1TQCC 3MRIA 4OIIH 1QA9B 4L9LC 5DC9B 2I5YL 3LZFH 5ID1B 3CFJB 4DEPC 1OAXH 3LY6A 3W5NA 1Q0XL 3M1BB 4KI5E 1KTDB 1A6AA 4LPVA 1OM3H 5HHPA 4PLKC 4PJDF 4OFYD 3PL6B 5F89B 4XAWH 1IBGH 2NPLX 3ARVA 5DHYB 4PJXA 3RKPA 4X4MA 4IOFD 1MJ7H 1F42A 5ETUA 5GGUA 4CMHB 2Z31D 1T0PB 1YYMH 4PRBA 3GMPB 2ZJSL 3R4DA 5D7LB 1BJ1H 4FQCH 4LIQE 4UQ2B 4X5WB 2KZWA 1CFQA 3T3ME 1HKFA 5EDXA 1HE7A 2BY0A 4QRRA 3X13B 3HC0A 3JWOC 2I60H 5F21B 4N8CL 1YEDB 2VDOH 4F7CB 4O51A 4WGVB 2Y07H 1YMHB 1JWUA 3GJEA 3QIUB 4ZDHB 3ARED 4KK9D 4HIHA 5HD8C 5EC1A 1XGTB 1H0DA 2Z91B 4QY8A 1MI5A 1Z6JT 2DDQL 5L9DL 2FEEL 4XP4H 3OZ9H 2ARWA 5F7YC 1FL3B 2CQVA 3RI5K 4HZLA 1GL4B 3GMLB 2IPUK 1IC5L 2DQUL 4GH7B 4L8DB 1ZLVK 1AR1C 3NA9L 4R4NC 1X5YA 4UDUA 2WZPD 4PRNA 3V0VB 5HHQB 1KJVA 2LV4A 4ZFOA 3QNXA 4JHWL 5IV2B 1IAOB 5MEQA 4PUBL 2F54B 5BQ7A 4FABH 4ALAH 1NGQL 5J12B 4R6UA 4QCIB 2LU4A 3C5JB 4HKZA 5DT1L 4PJBE 4RGNE 5HHVH 3NFPB 3AMLA 4G8GA 3CVHA 4XP1L 3SJVA 3IRPX 2MKWA 1JHLH 2IEPA 5DO2C 1IGCH 1WCBB 1QLRB 3D39D 3CH8A 5CBAB 3MX0A 4XX1E 1A6WH 3OB8A 4YDKH 3GGWB 1KBGL 4OLZH 4P2QB 4HG4J 2F53E 3UX9B 3UTTB 4XH2B 4FQXA 1RUQL 2BVPB 4OKVA 2VWEE 1P4BL 3HZKB 3LQAC 3BT2H 4B7IA 1U36A 5DK2A 3BKCL 4GBXA 5GGSA 4DKEH 4ONOA 2OZ4A 5IBUG 1HIML 2O5ZL 1BQLH 4XVJL 3RNKA 2YPVH 1CGTA 1DSFL 2X89D 5DEGB 5TDOA 2ZG3A 4X6EA 2Y06L 1ZHLA 2GK2A 1ONQA 5J56B 2IANB 4UAOC 2EXWD 5DS8B 3HLAA 5JPNA 4AEFA 2CDGA 5BRZD 3FJTA 5BZDB 5L6YH 5E00A 1MHEA 2N7BA 3NCFB 4BK4A 2B4CL 4YHMH 2J12B 1MRDL 3CAFA 1KYOJ 5MP6L 4N0FB 2BXZA 4PRIB 2AJUL 3VJ6B 1W0YT 2BNQB 3ARYA 4YGVA 1U95B 3GSVA 3NN8A 2G5BA 4WW2C 1UJ3A 3GSWA 4P5MA 3UTSE 3MODL 3UXFA 2ERJB 4EDXB 2E8YA 3QULA 1ZWIB 3RKDD 5B3NA 4JR9H 4NBYB 4F7TA 2YSSB 4OZHE 5B8CA 1IGFH 2MSPA 2W60A 2BSRB 2OTUB 4ZO8A 1DBBL 1LQSR 5J9PA 1DN0B 1M7IA 2DQHL 4PJDE 3TT1L 1KIQB 4U1GB 3CC5A 5C0GB 2PF6A 2VDML 5FGCE 1IGMH 4MJIA 3VG9C 4PGDB 5I66B 4S2SA 1A3RH 4FHBD 2JJSC 3DMMA 4KH2A 2AJXL 1KPVA 1MFAH 4K9EH 4NO0B 2DOCA 1T22A 3M17A 3F6IA 3EYSH 3WHE0 2V7NB 2JB5H 3GM8A 3KPSD 3VXUA 2P7TB 4HGMA 3O8XA 2WSKA 5E56A 1DUZB 4OZGA 3D2UA 3QUZA 4MNHA 3FQNB 3H3PL 4EN3B 3O6FA 2JB6B 4RAHA 1DE4B 4Z78B 5KVFH 1DEEB 5DYOA 2VQTA 3WS3A 1P9MC 1TZIB 5DMKB 1VEOA 4TSAH 3HAEB 3TBWB 4LMQE 1IC7L 1WBZB 4M43H 5J12C 5SX5H 2Q3ZA 3OGCA 1UJ3C 3VD4A 4LNRB 2QSQA 1YJDC 5CIPA 4ONGL 1EFXB 2YN5A 4JZNB 3AY4A 3GSQB 4QEGA 2ICES 4KQ3H 3PG2A 2E8ZA 1FLRL 3KHOA 1V3KA 4CJ0A 5J6GA 4WFHD 4MD0B 3GSNH 4GAJL 1WJ3A 3TESA 1AC0A 1I8KB 5DEFA 3O2VL 1NBZA 5E8PB 1FVEB 4F7PA 3IXAB 3BVNA 2QSVA 4G43B 5GXBB 5D7KE 4ONFH 5MI0C 3WFBH 2JK5A 1RZKC 3C2AL 5I8EA 3BMVA 4PGBA 4P2RB 3DMMC 1U6AL 2W92A 3BDYH 2ORBL 1GGBL 4PJ5D 1UFUA 3IAQA 3VD3A 4DZ8B 5CUSL 4XXDB 2WM0A 3GK8L 5C0IB 4O5LL 2X4UB 4GT7A 4O4YH 5HGGS 1S3KH 1S9XA 2I07B 1JTOA 5CJQH 5CSZA 3BP6A 5IJKA 3GZKA 1FAIH 3I3BA 3MRBB 4LCWD 3WXVL 1LE9A 2ADGA 4OGZA 2Z92A 3IU4L 5EZJB 1FNGB 1N59A 5F9WB 3A6BH 2CO7B 5B39B 4I48A 4HUXB 1GZQB 4JN2B 4XCCH 4Y2DA 4PTTA 4OQTH 4DUVA 1A3QA 3AY4C 2ZKHL 1IJ9A 1F4AA 2XG4A 4JVWA 1IM9D 4A2LA 5D1XA 3T1WA 2QBWA 3KYKL 2ERJC 3IU3A 4N8VB 1QSEB 1JL8A 1CD1B 1TMCB 2R0ZL 3D69B 5E6ID 3QIWC 4HGWA 1AO7D 3F12A 1I8IA 5AAMA 3VE0A 2P5WB 2AK1L 4JPWH 3WEXA 1CN4A 2IADB 5TE6L 3C60A 4BQ9A 2NZ9D 4OJFH 1MFNA 3FO9B 1NCUA 4JY5H 2VB5A 1UM4H 4U6TA 4YBQD 4ZYKB 1W0VA 4LPCA 4KJQC 2DLTA 2YS4A 4HUUB 1ULVA 2A74B 3U46B 2OS7A 5D7SH 3HG1E 2YD8A 4RFOL 5DRNB 3VXTB 1LO5A 1WT5A 1VGEH 1CGWA 1QP1A 5IWLA 3BUTA 3L7FB 3MRHA 5DRXA 3CXDL 1NCNA 4LPWA 3RL1A 3L3HA 2J3SA 1AD9A 4H20H 1S9WB 1NFKA 1QRNE 4QHMA 3O41A 4OGAD 1NSNL 2XWTA 1T1ZB 4JY4A 4N5EC 2AGJL 4XCNA 2V5TA 3ULVC 3BKYH 5F7MC 4EVNA 4ELMA 1T3FB 3R8BB 4ZTPH 4ZSOE 4OGYH 2G2RB 5D1XC 1G9EA 4ISVB 4EUPH 3VWKD 2HTLD 1HHIA 4HK0A 4L8SB 5E6YA 4HIXH 1RY7B 1G0YR 2P43B 1N5YL 2FJGA 4N0YL 4MQTB 4U1JB 1BIHA 2E9BA 3JTSA 1B6UA 5F7DA 4OF8A 4RSVA 3SDXF 4Y19B 1JPSH 5FFLA 5JXAL 1QFPA 1U92B 5KG9A 5DJAB 1JZ2A 1F97A 3GI9L 5C07B 1F8TL 4HWZB 3HMWH 3EJZC 5EO0B 3RIAF 2VXQH 4PB0H 3IFOB 4TQEH 1WT5C 1J1PH 4Y7MA 5F6IC 1JHTA 2X4QA 4HHAB 5IWLC 4F37K 1J8HA 5D5MB 2ZWLT 2IBZX 3QG6A 1KIPB 5EFIB 5KSUA 3QFDB 3LKRA 3BO8A 3ZT6A 1MCDA 2LABA 5JW4M 1SYVB 1KJ3L 3VDAA 3L6FA 2OTWA 5F9WC 1TLKA 5D96B 4YXHL 4NKQB 4HPOH 2PXYD 3EFFB 3FFDB 3QNYA 4RFNC 1K4DB 1QQDA 2EDTA 2HVKB 4MVBC 5IW1A 2J6EL 2J8HA 1P2CB 4FMKA 4EQ2A 3BEVA 2I9TA 4DZBB 5C0EB 1F00I 3ILQC 1RURH 3JWOH 5MHSD 4DQOL 1YPZF 3I6LD 3KPMA 4HBQA 1A6UL 1J5OL 3NFSH 3U9PH 1YEEH 5T33L 2NLJB 4OV5B 3I85A 4I5BA 4LKXB 3HMXH 1G6RA 2EDXA 1K5NB 1D5BA 3P9WB 4R4BB 2VDNL 5KSBA 3FOMB 4MQ7A 3MJGX 3PWPE 5GRVK 3RVTD 1BQHG 4R4FL 3FCTB 3RU8H 2DRUA 5HD8D 1JI1A 4JANB 4GRLA 4L4VA 3BDXA 2PYEB 4NHUA 1Y0LB 4EEEA 1OY3B 4PRHB 4HCRH 2NY5L 5DZLA 3TVMD 5T1LA 2C7UB 1AHWB 5HYSG 3QUML 5IBUB 2D03H 2R4RL 1OHQA 5LGJA 3D3VE 4NOFA 1AR1D 4GUPB 2I24N 4R4ND 1AY1L 1CGVA 2AJZB 5E08L 5JO5A 3HI5L 4AEHL 1PVHA 4ZUWA 1V7ML 3G9VA 1UQSA 4JKPL 2HFGL 1AXSB 2QQQA 5GRJL 3O11A 1T66D 5E2VH 4HS6A 1LNUB 4BH8A 1S7TB 4OLUL 3SGDI 3X11A 3O3AA 5DO2D 3DXAA 3QG7L 4QRRD 3LQAH 1I3GH 5IVXF 4PJCB 4NQVA 3PHSA 4LSSL 3WSQH 4WO4A 1HH6B 5HDQH 3AXLA 3RUGA 3B9KB 1T03H 2WAHA 1YQVH 2RFXA 5DWUH 2PKDA 2APFA 2X9WA 4NQEE 4YR6B 4CVXA 1RUKL 1MI5D 1T6VN 3DX8A 1SM3L 1NC4B 1HHHB 1R3KB 1X5LA 1YN6A 4XXCC 3BZEA 4LL9A 3LN9A 2A6JA 2APWA 3PQYA 5FV2A 2Y36H 2HVJB 3IETB 1IFHH 2UZIL 4MHHI 4HX1A 2DTMH 2YA0A 4CL7A 4QOKE 3EGSB 3IGAA 1GGIH 3V52H 2NY6C 3NCYS 5JQ6L 3VXOB 3MPCA 1HHJB 3GIVB 4M1CC 2DQJH 3TA3B 1RZ7L 3WFEH 2D0HA 2IALB 4LNVA 4PJGB 1VKXB 3HR5A 5HGHA 2F8XC 1ZEAH 2R2EB 2DQFA 2VLRB 4XBEH 5EU6E 3KWWA 2GK0A 1BFOA 4MCZB 4G8GD 1WZ1L 3RWFA 3UJIL 2Q76B 3SJVD 5DC0A 4X4YB 1NC2A 5C3TA 5IB2A 3W9EB 5K93A 1FORL 4KTDH 3FQWB 1CL7L 3BQUA 3ZLQC 1Q0YL 4J7RA 4NO5B 1WEJH 1WLHA 4ZS6C 2MPAL 3R0NA 2AKRA 3WN5B 1XZ0B 4XCYB 4B50A 3TCLB 4ENEC 3SKOA 1A9EB 2BJMH 4LHUD 1VFAB 2JIXB 2O61A 5CEZD 3MRRB 4GBXD 1SY6H 2VXVL 1H3XA 3RY5A 1FFQA 4F8TA 1C5BL 1JHKH 3C8DA 1EGJA 4NGHL 3TZVB 4MYWB 3ULUC 2XZZA 3V0WL 2ZOKB 4UU9A 1I3UA 1AHWC 4G9FA 3ZKXB 1IKNC 2R2BB 4JRXA 5JHDA 1RK1B 3TIEA 2VABA 4P2YA 3BKJL 4PRPB 1F5WA 4HW6A 1P6AB 4RZCA 1KELL 2DL2A 3NZHL 1DLHA 4M6NL 4NNXA 2EEBA 3CZFB 4AJ0A 1D9KA 1MRCH 3PNWB 4XVTL 4JM2F 5EWIL 1JMXA 5IB3A 2WBKA 3TCXA 1KCRL 1CZ8H 4IS6A 3RBGA 5ANMA 4OCXL 4B0MM 2HLFC 4PJEB 1HNFA 2X4TB 4HKJA 5JOEA 3K0WA 3RVVC 3DV6A 3RPIA 2WBJA 5GS1A 4XZUB 4NQDE 1YECL 1Z0MA 4C54A 5DJYA 2GAZA 3G5YB 4NO3B 5A40E 1DANU 2D9CA 1ED3A 2FGWL 4MJID 4P4KB 5I74C 5DUBA 2AK4E 5DJDA 1JRHH 5C70A 3B9KC 3LDBC 1PY4A 2Z9TA 3UTTD 1M71A 4QYOB 3DMMD 4PJIA 3G08A 1LO0L 5C0AE 2YXMA 4TSBL 5EOQH 1IGYA 3HCVA 4TTDC 1J12A 2IPKA 4GW4A 3TH3T 1EJOH 2CUMA 1OAYL 3VXUD 5IVXE 3TNNB 1E4JA 5SWZE 3O8XD 1DJSA 3D2UD 5ALBH 3WKML 4BKLB 5J0BA 5DFVC 5F44A 3QPQC 1TCRA 5KVDL 2NXYB 1T4KB 2PTTA 2DIBA 3TA3C 5C0BE 3FT2A 5HSFA 1EHXA 1BF8A 3PGCB 4M8VA 2A0LC 5C2UB 1NFIA 1I9IL 1D9KC 2GI7A 4NP4L 1OF2A 4LLWB 3AROA 5GGVH 5IVOA 4X99B 5JLZB 5ICYB 5H8DA 3S35L 4YHYB 3CVHL 4XB7A 3OSKA 1F3DH 1RHHB 1S7VA 4HEPG 2WNGA 1KGCD 2LTQC 3RX8A 2D31A 3QIWD 1KG0B 1BM3L 2DLGA 4ODTH 2HWZL 4ONHA 4NZJA 4L3EB 4P46A 1R3JA 4M7JL 3RWHB 2EYRB 3QXUA 4LCUA 1KJMB 3EW3B 2V5SA 3V7AG 3UC0L 3QZWA 3DVFA 1OTUC 3TFKC 4URTB 2R29H 5CEZL 5FEBA 4Q9RL 4LRNL 2OZ4L 4KJQD 4X5XA 4IRSA 4YXLH 4WFGE 2EIBA 4HMCA 1QNZL 5BOPA 2VZSA 5JOFA 3IF1A 5E9DB 2YA2A 1Q94A 5BW7A 1NGZA 3S97C 5CWSA 1EEZB 3ULVH 3GBML 3HAEH 2VAJA 4HS3A 3MLSL 3ZKXC 3LEYL 2CLZA 3L3KB 4WHTA 1F4XH 2VKWA 5FA4B 4WTXA 3BX7C 4PGZA 4L3CA 1U8QB 4JFFE 4N5ED 2H2SD 4GG8A 4OFPA 1XIWA 2FATH 5EU4A 4B7LA 2CH8A 4ZOBA 1AXTH 4OD3H 4LU5H 1HZHH 1KCKA 4MAUL 4LCYA 1YJDL 1MHHA 5D1XD 1E4WL 1BP3B 3QDJB 4JFDE 3WL9B 3QYCA 4PJ9B 3CDGB 4QRTA 2BSTB 1I3RA 3L5XH 3C60D 4P46C 4R7DA 1MIEL 3RZWA 4DTGH 2DLEA 1JPFA 3B83A 5ERWA 4P4KC 2GTWA 3GJFA 4OCLC 3B3IA 3AS0A 1RZKL 4IRSC 4QXGL 3S37L 3EJZD 2EYSA 4OBRA 1IAIH 4N0RA 4NWTL 3T0EE 1VEMA 2FWOB 1T1YA 3MA7B 1C16A 1BQHB 1J05A 3B8YA 4FN0A 2VLKE 4KK8D 2R8SL 4LF3A 1MHPL 3REWB 3HPJB 4AENA 4MGXA 5FYKE 1PKQB 1IM3A 4YAQB 1IT9L 3DV4A 2GY7B 1X5KA 2YRLA 1HHGA 1B4JH 4WW1A 2MQCA 5FYJU 5I9QB 1BBJB 5I1LA 3VFNA 2BOCB 5HYSB 2OP4H 3K81A 5CJBA 1HSAB 4MVBD 3W9DB 3WNMA 2ICWA 4Y16B 1FL6B 1TETH 3MUY1 3U4EA 2VLLA 4EJ1C 4YHYC 2BMKB 4LMQI 3K80A 4Z8FH 2A83B 4CVWA 4M02A 2VDQH 2J8OA 3ILPB 5I1CL 5SWSE 1DBAH 1A21A 2JJUA 1TTUA 2DWEB 1GGUA 3BMWA 4ZS7H 4CDHA 2X42A 4J3XA 4HIIA 3NAAL 3GKWH 4KTEH 4IMKA 3GSXA 1T7ZA 3AS1A 1NCAL 2AI0L 3IDIB 2VN7A 2Z35B 4W4NA 3EO9L 5C09E 1JF6A 1XGUB 3KPPA 3RA7L 4C56A 4AT6B 4JDTH 2OR9H 1J8HD 1C12A 5J11B 4HD9A 12E8L 2W9EH 4XCFH 3HPLA 2HFEA 1XGYL 4N8PA 5F9JB 1OTTC 3S96B 3MLYH 4V1DB 1U8NB 1IEBB 3RVUC 1PGRB 5LGHH 4XGZB 1FCGA 4Y2OA 1SBBA 4OSUL 1HINL 1TVHB 1U58B 2X9YA 3U9UA 5C0CE 4N1HB 1NQBA 4D9QD 5KSVB 4RIRA 4OM0H 4LVNB 5CSGA 1W2KT 1FG2B 3UTOA 5ADPH 4ODUA 3OKEB 3MGTA 1NMBH 2Y5TB 1F11A 5FCUH 4BH7A 4K7PL 3MRNA 1MHCB 2IG2H 3VXSB 1Q0XH 3G6DH 2DM2A 3E1F1 5H35B 4CN6A 1IEAA 1ZE3C 3BW9B 5CEXB 5IF0B 3JSSA 3VFMB 4LBEB 3ARBB 2XRAL 3MV8E 4KRMB 3OX8A 4GQPH 5CILH 3DPBA 2R4SH 3MXWH 1ZS8A 2ZJSH 2FH6A 4MSWA 2FGZA 4GRLD 1MCBA 3QQ4A 3TIDA 5K9KA 4L4VD 4LAJH 4Q6IA 4KQ4L 3LD8B 4YX2L 1MCQA 4H0IA 5T1LD 1EAJA 3GMRB 5D7IB 5EBGA 1CLYL 2X41A 1OSZA 4X7DC 1HWHB 3TO2B 3VGFA 1ACYL 2Z4QB 4O2EB 2IQAA 3L1OL 1S7QA 2NY6D 2V2TA 4M7LL 4M1CD 5I9QC 1JN6B 4DW2L 2FJHA 3GRWH 2XICA 1ZT1A 1E4XI 4YE4H 3MRKB 5FM5O 2VXSL 1IL1B 2DI7A 3L5IA 3QPXL 4LSPL 3QCTH 5JMRA 5IOPB 3JTTA 4FS0A 4Y16C 1EEQA 4U1SA 3HKFA 3O2DA 4JG1L 4D0BB 1YMMB 5F7KC 3FO0L 2VZTA 1Z9OA 5JUEL 5HDLA 3DXAD 3VG0L 3O3DA 4PUBH 3VRJB 4GQ9L 1GZPB 1NGQH 15C8L 1B0GA 3HUJF 3VFVA 4ZS6D 5GPRA 1NDMB 1ZLUK 2Q8AL 1K85A 4ENED 3KPRB 2HRPH 5DJZB 1CGSL 1LD9A 2A9NH 5AD0B 1ZSDB 3GI8H 1SJEA 5I1EL 3FT3B 1G7MA 3GMMB 1A1MB 4LCIL 3CK0L 2DQEL 4RMWA 1JJUA 2D7TL 4NKMB 3WFHA 5GS2H 1IGTA 2FO4B 1BAFL 4Y4FB 1F58L 3FB8B 5KZCB 1U8OA 1RQ5A 1I7RA 3PQYD 1K4CA 3ULUD 3L9RB 4Z5RA 3S3PA 3R06A 3K46A 1FJ1A 2YD2A 2Y1VA 4JRYB 1N5AA 1LMKA 1AQKH 4LFHD 1NKRA 2HT4C 1YY8A 3RRQA 1S5IH 3LN5A 3VGAB 5EC1B 4X6DF 5BS0B 2CPCA 3O3BA 4LVNC 5EUKA 1ACZA 4KJYA 4X80L 4D0CB 4S1DD 4WUKL 1EFQA 1QSVA 4PG2A 3U30B 3WUWG 3DO7A 1MCKA 1SVCP 4X6CB 3O9WA 3MUJA 5E8DH 2HLFD 3BQUD 2A6IB 3GBNL 4UDUB 3RVVD 3ME0A 1KJVB 3HE7B 4HIJA 4ZFOB 1CE1L 1G6RL 3VXME 3HB3D 4N9GB 1JYWA 1A7OL 4JPKL 5K9OB 1AQDB 2BCKA 2W0FB 5I8OL 5J1SC 3OXRA 3MYJA 4Z0XB 5F1KC 1BBDL 1N7MH 1TZGL 3KLDA 3LD8C 2XWBA 4AIXA 5GISL 1A7QH 3ARTA 1WWCA 4DFIA 3P77B 2H6PB 1CF8L 4QRQA 4AK1A 4G9FD 5FGSA 2Q6WA 4JRXD 5DFVD 4ZODA 5JHDD 1HILA 3QPQD 5CLTA 2KQNA 1YUHB 5D1ZA 5EUOE 3I2CH 4HQQH 3TA3D 1DBJL 3ESVF 2QLVB 1VPOL 2A0LD 2ADJA 3WNOA 1D9KD 3MRFA 5DD3H 2Q20A 1U8LB 3NACH 3RHWF 1OAZL 1W72B 4KXZH 5TDOB 2YOCA 1CU4H 1DVFA 5ALCL 2R1XA 3MRJA 5I19H 3IDYC 5IBLD 2R0KH 5GGRY 3TYFA 4FZEL 5JPNB 4AM0A 5FO9A 4HWEL 1FL5A 2WBJD 2EE3A 4F9PA 2BFVH 5IJVA 1NAKL 4U2ZA 3VFWB 4GW1B 4IHOA 4AH2A 4ONGH 5DD5L 2V9QA 2L7UA 2F74A 2CRIA 3TFKD 5I1JH 1S7SB 2H3NB 4AL8H 1P84K 4BQ6A 2FR4A 4P5MB 3CMOH 1PAMA 2C9AA 1FYTE 1M7XA 4Z7WB 4RRPA 4BFBD 3MROB 1EHLL 2OL3B 4Y4FC 4TVPD 3HUJE 4ZUTA 2IGFH 1QFWL 3RWJB 2V7HA 4Q9QL 3ULUL 2NYYC 1X6NA 5DD0H 2HJKA 3CDFA 5JDJA 5ITBL 3HI6L 1X5ZA 2RHEA 3QXTA 3MJ7B 3P4OA 4I77L 3V5KB 1AGDB 4I8DA 1JGEA 5IB5B 3KLAB 1N4XL 5I8CB 1MREH 5AWNL 1Z0NA 1QFHA 4E41B 2FO1A 3QDMA 2Y7QB 4KMTL 3VGAC 3X14A 1JVKA 3Q6FA 4RA3A 4M62L 2ZZUT 3DVGA 1HOCA 3VFUA 4A6YB 3G6JB 3K2MC 4KAQH 5AUMB 3U30C 3ROLB 1N2RA 4YBHA 2AJVH 1T1WB 3LKPB 4R8WL 3LSOB 3O6FB 3I50L 1DBML 1CI5A 3CGTA 3L3JB 3QEUB 4PJ7F 3HE7C 4X6DE 4P46D 4FFWC 1NMAL 3FFCA 2VXTL 3FHAA 2O26U 1EMTL 1QR4A 3O45A 1I9JH 3TBSA 1PYWA 1I1AB 4IRSD 4F57L 4P9ML 3I75B 4OCWL 1D5XB 2F8OA 1EGJL 5F1NA 3W11C 2GJZA 1NFDF 3GSRA 2BNRE 2YHGA 3SCMB 2F58H 5EO1B 1UACH 3IJHA 5IR1B 3OKOB 5HI4D 3OPZH 1QBML 4FFZL 1AI1L 1C08A 3ZTNL 1N0XL 3IJSA 4EDWL 4OUUA 2CK0H 1FFOB 4EI5C 1LDSA 2JK5B 5I8EB 1CICA 4P5TA 3RTQA 1RZGB 3W82A 4FXKB 8FABB 2Y72A 4AMKL 1XIWD 1I9RH 4YO0B 3AGVA 4WNQA 3CXDH 1QUNA 2NXZD 2PETA 1ZHNA 2B1HL 4ZAKA 2DKUA 5EBLB 4KZEH 3X12B 4K71B 2X70A 4ODXB 2WBWB 2MQ3A 1NSNH 2EH7H 2DQCH 2WK2A 4LEOB 2AGJH 3G5VB 2ADGB 3MV7A 5I75B 1J8KA 2Z92B 3KNBA 5HYJB 2YBRA 3LKNB 3C5ZC 3MV9A 3KPNA 1R0AH 4ZXBA 3BKML 2ITCB 2B2XL 1MWAB 2X4PA 2F19L 4PTTB 5J3HC 1RI8A 1ORQA 3O6MH 2XKUA 5D7JA 2VJXA 2A77L 2DICA 4I3RH 1UB5A 2XACC 5HDBE 1N5YH 4NQXB 5DJ2A 2DBLH 5CZVL 1JNNH 2ILLA 4MNQB 3BDBA 2VQ1A 3NIDF 1VB9A 4OI9A 2AABL 4XNZB 4HGWB 4TVPL 2C4XA 3QNZA 2LVEA 2BHUA 1F6AA 3EOYG 4ELKB 1EBPA 4KDTA 4M8QA 3JV6B 1YNKL 1OTTD 1CQYA 2DD8H 2DQIL 1CICC 4C59B 4P5TC 4UNUA 3CIQA 5FYKU 1KB9K 1RZ8A 1W0VB 3OAUH 5L8KB 4PJHF 1TQBB 4HH8A 4TPRL 3ECBB 5GGQH 5DUPH 3THML 5KN5B 3MLUH 1NL0H 3QO0B 1FPTL 3HS0B 4JPVL 5J6HB 2JLLA 4F9LA 1KPRB 3ARGC 3D39E 3DBXA 3QUYB 5FHAL 3EZJB 4O2FA 5KJRL 4UT6H 1A0QH 1KFAL 1A2YB 3CUPA 3RL1B 2X4OB 1MQ8A 4QKXB 4ZXBC 1FO0B 4JQIH 3UDWA 4CKVX 5L2JA 3Q1SL 5EIQA 3CFEA 3O41B 5BJTA 2XWTB 2YC1B 2IFFL 1FNSH 1Q9OA 4TUKL 4CW1A 5C8JA 4EVNB 3G5XA 1QRNA 2JKXA 5GIRA 4KRPD 4MXVF 5E5RB 2YXFA 2WQ8A 2M1KA 5TQ2L 2HH0L 4JQVC 3QA3A 4C56D 1U8KB 4LDEB 4W6WB 4MLSA 4ZSOA 4LLDA 1TTFA 1UWEH 1ZGLB 4PJ7E 5BRZE 1ETZA 3CH1A 3I6KB 2FJGB 5EPMB 5E5UB 3D85B 4JCMA 5EZIL 1BHGA 2X1OA 1MNUL 3H3KA 2DIJA 2V5YA 4OZ4B 3MJ8B 4LGPB 2R0LH 3MLRL 5F1IA 4D9LH 1JFQH 4PJAB 3C5SB 3ZMRA 1NFDE 4F9LC 1KJ2A 2P47B 3P9LA 3C9NB 4U6VL 1RMFL 2X4QB 4TULH 5IB4A 1IEHA 2EDFA 5EU7C 2YRZA 4ORGA 3QG6B 4K71C 3P0VH 4ODSH 1G0XA 1RIHL 4Y5VA 4M5ZH 1LDPH 1T21B 5I75C 4OI7A 4XPAL 4LLVA 3SE4A 1JGUH 3WUWB 3GHBL 4E5XB 2B1AH 2XQYG 1QQDB 4OLUH 3WE6A 5SX4H 3T0DA 5HVFB 4GAYA 1RJYB 3UBXI 1HNGA 2DQGL 3MC0A 5BMFL 1YEIH 1NMCC 3KPSE 3DX9A 4U1KB 1S9YA 4YHLL 3NA4A 5C9KA 4XP5L 4D9RD 3TBTA 1JNLH 4FXLA 5I0ZA 2XN9D 2C1OA 3RWCB 2P8PB 3GNML 1DQJA 1FZOB 4UQ3A 1L9MA 5ID0A 1VERA 5F7EH 3PWNB 1A7BA 1TJIH 4HS8L 4ZUUA 3N85L 3L3OB 1RUKH 3IS1X 3MRLB 3BI9X 4MQ7B 2UUDK 3VFPB 2HKFH 4CMMB 4PS4L 4XP6H 5FIEA 2HT4D 5F97E 2VXUL 5J06A 2EH8H 2EDRA 2NY4B 1OAUL 3BE1L 2R9HC 1IARB 5DK0A 3Q5TA 2IPTL 3NIDE 4J3UA 2FD6H 3L5HA 5FKAB 4WFHE 3WIHA 3WD5H 1EAPB 1NBYA 1JRHI 1RZ7H 3BAEL 3QXAA 4Y5VC 4WU7A 4HIEA 3RZCA 1I7UB 5EA0L 5LGJB 3VI3F 3WLBA 4NQCA 3QCUL 3H7BA 3HZVB 2YD1A 4PJHE 3ZZ1A 3IXTA 4NM4H 4PB9H 3DETD 3IJYB 2JF1A 2PTVA 3WKNA 3VFSB 3O3UN 2B5IC 3V5HA 1P7QA 5E8OB 4P23C 4K94C 1MOEA 3K1KC 4R7NB 5ICZA 4D8PB 5C86A 1GC1H 1U3HA 2MOVA 2HFFA 3EYVB 3MRCA 9CGTA 3IRZA 5B38A 5D2LE 5E1HB 2X44D 1P5UA 1R3HA 1ZVSA 4EBQL 2BRQA 5DMJB 3VU2A 2YMXL 4IMLA 4JO4H 5IHUH 2JJTA 4Y5XB 4GG6F 1U3ZA 2CDFA 2H9GA 1CFVH 4I0PA 5GGRA 2DLFL 3SO3B 1JE6A 1FDLL 4ZUSB 3ZKSD 3KPOA 3E2HC 1WQVT 3EDDA 4X7EC 4DKFL 1QLEH 4MAYB 5CZXD 2H41A 4YNYA 2JCCE 4TOYL 3KDMB 2PO6B 3TNMB 1HN1A 5A2FA 2G75A 4U05A 1EHAA 1AO7E 4Y0GA 5KVMC 3H9SB 2BOBA 3RZCC 4I3GA 2I9LA 1T2JA 3NZHH 4YZFE 3OB0K 3P4MB 4MDJB 1A6ZA 1NANI 2IAMA 3SDXA 5EIIB 4LSTH 5IMOA 3TM6A 2D0FA 4M1DH 2UWEB 2BY1A 5DGQA 4RAUB 4MHHG 4WHCA 5HGHB 1Q1JH 4M1GL 3RIFK 1MCPL 4F33A 1U3HC 1VFMA 5JR1H 1J11A 3QEHA 1T2XA 1TJGH 1LP9B 3EYOA 5SV3A 1SEQH 1IGJA 3KLSA 2F5AL 3DRQB 4PJXF 1UH2A 3QXDA 5JTWA 4RGMC 1T7VA 4HXBL 5IMLA 2NYYD 1XR8B 2JJTC 4P59H 43C9A 2AKRB 4HK3J 4QXTA 2R2HA 3RGVA 3SKOB 2EO9A 3BPOB 2P45B 5D1ZD 3VGGA 2G60L 4I1NB 5IB1B 4MCYA 2QKIA 3X17A 1JP5A 1AGFA 4JGJA 4U33A 5GS0C 3BZFB 2JELH 3ZTJG 2NY4C 1NKOA 3BP5A 3NH7L 2X2YA 3QEGH 4Z0BL 3V4VL 4PD4K 1YPZA 1NAMA 3O2DL 3PP3H 1UENA 2JJVA 4OLXL 1TDQA 2IAMC 4PBXA 2ZCLL 1I9IH 4UB0H 4KKBD 4J6RL 4IRZL 2E3VA 4RDQG 1IAII 4FFWD 1OSPH 2BVOA 1FV1A 1XF1A 4APQA 1DLHB 2NR6C 1FNLA 2UV3A 3V4PH 5F8RC 1AJ7L 4NNXB 5D1QA 1CVRA 3QHFL 5IB3B 2NY0B 4RISH 5FV1L 1AGBB 2CR3A 2ADIB 2HWZH 4LLYB 4NYLA 3DUUB 4WW2F 2YZ8A 4QRPB 3T3PF 1CGXA 4JN1L 4Z7QF 3W11D 3WIFA 1FH5L 3DV6B 5KAQF 4BZ2L 3RGVC 3SBWA 4EIGB 5GS1B 1ZTXL 1I1FB 2P8LA 4U1MA 1EJ6A 4OAWB 4Y5XC 3ARDA 4L1HA 4IBLT 1ED3B 1UCBL 4I18B 1S7UA 5CZKA 3QB7C 4KTYA 2CLRB 2VNCA 1W72H 2DB8A 3TN0A 4ZFFA 4B41A 4EI5D 5ACLA 1M71B 4PG9B 1MF2L 4QRSB 1N6QL 3OAZK 4MAYC 3NCBB 7FABL 3QUXA 3LHPH 4XC1H 3W0WA 3K8MA 5MHSE 3BWAB 3H9YA 4XVUC 2IPKB 3I6LE 3CXHJ 2ATPA 1JZ7A 4M93C 5FHBH 4ETYA 5B4MC 4GG6E 1QFUH 1J1OH 3C8HA 3QFJB 3T2NL 2QR0A 1BFTA 4PP1C 5IROC 2ZUWA 3M8OH 5TDNA 5C7XH 1TCRB 4XTRC 3T0WA 3WHXB 1MQKL 5C0DA 2ZCHL 2YPLA 2ENSA 3C5ZD 1FCCA 2QHRH 1XCTB 4XMKL 3VMNA 3FT2B 2GSGA 3FFCD 1R5VB 5EN2A 5TE7L 1NFIB 5D1QC 5JW4R 1CFTA 5J3HD 1PBYA 1M7DB 4JFQA 2OL3H 4H8WC 4X98B 1MCNA 3I02A 2GQHA 4PV9A 1V7NH 1X4XA 1INDH 3GMNB 1MIEH 2H2PC 1BWWA 5TGBB 3SBWC 2CJUL 3U7WH 3FKUS 1NEZA 3P9MB 4IIQA 5ICXB 4NRXA 1RZJC 5EOCH 3S88H 1UYWL 3ARFB 2AEQH 2EYTA 1ZLSH 4FTVD 3TN0C 1QBLH 3QRGL 4UNVA 1CICD 2BERA 4P5TD 3RTQD 3OR7B 4X0KA 4G8FA 3QUXC 4ZFZA 2VZ1A 4X5XB 1KSRA 4PJXE 4X4ME 5DVKA 1T6WA 1DDHB 4ODVL 4UT7L 5LQBL 5HHMD 3TYGH 1GOHA 4PR5A 4X8JA 4V2CB 1NBQA 4XX1G 1A7RH 1EK3A 1VGKA 4QRRE 3ARGD 1DL7H 1UGNA 2GSIA 4GRWB 4WI3A 4WWKB 3MACH 3VXQB 3L3IB 4YUEH 2VLME 5CWSB 3NZ8A 2OCFD 4UI2A 2ESVB 1KB5B 2NTSP 5GRWA 5C9JB 4ZXBD 5IMKB 4Y4KC 2NY1B 2GFBA 5D2NA 3BN9C 1OAQL 2RCSL 4OKDA 4MXWL 3KPQB 2BY2A 4BZ1L 3QQ9C 1MI5E 1YEHL 4JFFA 3FB5A 1XF5A 3UYRH 1MHHB 1WC7B 1JPGA 25C8H 4GKNB 1KOAA 4UTBL 3C87A 1WBXA 2FEEI 5K9JH 1QACA 5D71L 4IIQC 1FC1A 1IC4L 1LO3L 4JFDA 3RAJH 4HF5L 1J18A 1F4YL 2FIRT 3P73A 2HJFB 4I18C 3SDYH 4NCC2 5DGRA 3GJFB 3ZL4L 3H42L 4ZMAT 3S4SG 5JDSA 5KVGH 3QWOA 4G8GE 3MGOA 5GSVA 3FMGH 4W70A 3SJVE 3IDJB 3T3PE 4JM2A 3T77A 1CTOA 3BGFC 1SQ2N 3QCVH 3FO1A 2FJFA 1MRFL 4LSUH 2X4SA 4P57A 3DUSA 5L2KA 1KT2A 3A6CL 1B3JA 5IKCB 4S1QL 2WW8A 3DV4B 4OSUH 5F9OH 2R15A 4Y8AA 4PLJC 3OJ2C 5FYJD 2AXFB 5D2NC 5T3ZH 5CEZE 5C92A 2Z8RA 4NNPL 1WGOA 1ZT4B 2P42B 43CAA 2GCYA 1PJ9A 5DJXA 3PP4L 1X5XA 1MAMH 5ISZA 4OLVL 1TVDA 3PHOA 4YDIH 3ULVF 2X1QA 2HKHH 4KROB 1ZGLP 5BO1H 1XGQA 5ILTL 5KVEL 1LO2H 3OKKA 4CADB 5HI3C 3D0LA 3OGOE 5EBMA 1NCDH 2MNUA 2FECL 3MV01 4JFPB 4ZO9A 5CINL 4D3CL 5HVHC 1JWSA 5C0RL 3OKDA 5J1AB 1O5DT 2ZUXA 3TBVA 3ARFC 3C6LA 5E24E 4YX2H 3KYNA 2XZQL 5HHXH 2CLVA 2DMCA 3EOBB 3MBEA 1E6JH 4D2NA 4M5YH 4XPTL 2R9HD 4ZTOL 1CK0H 4WWID 2VL5A 3QJFA 3O2WH 3LEXB 3K8KA 4JFEB 3WS6A 1BVKB 5C2BH 1C12B 2UYLA 2B0SL 1KLUB 3L1OH 4P9HC 4YBLB 5EBWA 1FVDA 1FO0H 5D6DC 2ZSVA 3SKJH 2AV1B 4NQUA 4WWKC 5TPWL 4DW2H 4K94H 4JJ5A 4KKNA 1FVCA 3PJSA 3LS5L 2AJYL 4MJIE 3QPXH 3Q0HA 4NSKA 3WIIL 1BREA 4OIBA 4UILH 2DWDA 4PGCA 1MJUL 5D8JL 5I18L 4P23D 4ZO6A 2R0WL 3DGGB 3N06B 1P1ZB 4ELMF 4LRIA 5I8KL 2J8UB 4WUUA 1RD6A 4LVOB 2W9LA 4LARL 3VXUE 2P44B 5JW5B 3EYFA 5KANI 3F62A 4OZIB 1F11B 4DJMA 4OZGE 2COQA 3SE8L 1T0NA 1HCFX 2BVQA 2EKSB 3BXNB 3V7MA 3OHXB 4JO1L 4P5KB 4G80A 4LEXH 4TRPH 1P4IH 2AV7A 1VFBA 3BYTA 4NDMB 1S78C 5JHLL 3E6FA 3DTXB 3CK0H 2W65A 4KXZI 5DHVB 3DSFL 4QHLB 3OX8B 4Z95H 1FZJA 3DRTB 3GMQA 3MBEC 3F58L 5F9AC 1A4JB 3L7EB 3NFNB 1YYLL 3MBXH 4LGSB 4GJTB 3GSOB 1D5MB 3WS6C 1BD2B 3V6OA 3T65A 1EEUA 1A14H 3DVNB 1WSST 1KGCE 3O4LB 1SJHB 1QR1A 2ARJB 2MHAA 3DO3A 4PY7A 5DR5L 4DVRL 1TVBB 3MOAL 1OSZB 3RZCD 5IQ9A 1ZVHA 4HKBA 4NQCD 4O2CB 4G42B 2FB4H 3FB7A 2MCPH 3B2UC 5FYJL 5DZOA 1NLBH 1P7QD 5L88L 4RMTA 4KHTH 2QQLL 4X5LA 4B53A 1ZT1B 2GY5A 1IQDA 3W39B 2AXGB 4LRIC 2ED9A 1U3HD 3AU1A 5B21A 2DIAA 2J4WL 1R5WA 2HT2D 1G9NC 3T4AB 2WUBL 2D4DA 4MDIA 5DJ8A 4WENB 1UB6A 4BJLA 4OFIA 3VFTA 1MIML 1IGIL 3S36L 4BSVA 4JKMA 1ZT7B 1WAAF 3EO0A 5EORL 5J7CC 4FQLL 3BIKA 1M4KA 5FXCH 4CU7A 3OKNA 1G7PA 2IF7A 1BBDH 4N0CC 2M26A 5KSBF 5JW4Q 5HYIA 4CU8A 3KYMA 1UM5L 2W0PA 4OQ1A 4NQSA 3RWEA 5IP4A 4NT6A 4FMFA 5GS0D 1ZHKA 3UYPA 4F7EB 3O6LH 2XA8L 5HHNB 5LAXA 1KJ2L 4YFLF 3GB7A 4AQOA 4CVZA 5L0QB 3IAGC 1LE5A 1U8OB 4JGUA 1JK8A 2Z8SA 5CEYA 3RL2A 1H3GA 2V2XA 4GKZB 3EOAA 1G84A 4BYHA 4U0RC 2IAMD 1H8SA 1YN7B 2VH5L 5FECB 4M4RA 2XFXA 3VXPA 1EZVY 3C08L 2NR6D 1ERNA 4MJ6A 1OLLA 2ZPKL 1ZXQA 3CLEL 3TPUB 1T04A 3SQBA 3EKCA 4RQQA 1CXFA 4G8IA 4H1LG 5GGTA 3GSUA 3HC3H 5CMAA 3RGVD 4NZRL 3BISA 4ELME 1ZLWK 4F3FA 1MFBL 1BVLB 3UPRB 1BZ9A 3CX5J 1XR9A 3CFKA 1SYSB 5FOJA 1QFWH 1AFVH 1JYVA 4MAYD 1KXVC 4PJBB 1MFDL 4P4RB 4XVUD 4RGNB 1LK3L 5T1KD 4O9HL 2DYPA 3AB0C 3RY4A 2NX5A 5DJCB 4F15B 4ZNEA 5B4MD 1VESA 3I6GB 5INDA 3H2WA 4GXUM 2FYYB 2G5RA 3ULUF 2CIKA 2Q6WB 3WNLA 1F90L 1N8ZA 4PP1D 4HULB 4XTRD 4U3HA 4H8WH 1NCCL 2VR9A 4JDZB 3N9GL 1DQLL 2RGSA 4KGJA 3W2DL 3T2PA 3N1QC 2F53B 1MJJA 3VFGH 5SWQA 5D1QD 5E1AA 1RUML 5MENA 3LN4B 4AY0A 4F58L 2VKXA 5D9SB 2EKJA 2GT9A 4R2GB 1J8HE 5GS3A 2ZUTA 3L95A 2GITB 3I50H 1DVFB 4UINL 2R1XB 1FYHB 3MRJB 4HT1H 3I3DA 2H2PD 2ZNWA 1A8JH 3IFNH 4OCRH 4YHZH 1TJHL 3DLQR 1CDBA 4LLMA 1OQOA 3U1SL 4AH2B 3FN3A 4XVSL 3QI9A 1U93B 5IGXH 3ZDYE 3NBNA 2OJEA 4OUOA 5HVGB 3EAKA 3RQ3A 3TN0D 5F3BB 2R23A 2XPGA 4B5EA 4D9QE 4FOMA 2GJ6D 2H8PB 3QUXD 4KI5C 3W0WD 2X10A 5GS0L 3QDGA 2P1YA 3NPSC 4I0KA 3U0PA 5E7BA 1QBMH 4IOIB 4PRDA 1AI1H 1WAAE 4MA1B 1JPTL 1N0XH 5L0QC 1W8OA 4L4TA 3TWCL 1INEH 3UTSB 3PWVB 3MNVB 5DFWH 4DVBA 3S4SB 1R3IL 2D7MA 3WMSA 5MERB 4HUVA 2ZUSA 1HEZA 4F80A 5KSBE 3EDFA 4OZHB 1GIGL 3AS2A 2J7LA 2YEZB 2PR4L 4FNLH 1FFNA 4Y4KD 5KSAA 5GZOC 3GIZH 1TZHB 5E8NA 4PJDB 1ZANH 3BN9D 1IAKA 3J7HA 1B2WL 4L4VE 5FGCB 3BP7A 3QQ9D 5IT2L 4Y4HB 3UTQA 2QL1A 4UV7H 5LKNA 2MTPA 5TQ0H 4P3CH 1MELA 1SBSH 2AXJA 1RFDH 4RFEB 4G6FD 5CLWA 5IFJA 4H25B 5FYLD 2YD7A 2EC9U 2ZP0T 4JY6A 1H5BA 3UO1L 5HGBA 2Q8BH 1DEDA 3VMOA 3S8WA 1ZLWH 3CFDA 5HGAB 1RHFA 1J1XH 2FX9L 4OB5L 3PWJB 1OAKH 3O6KH 3L3DA 4EIZC 5JW3L 5CZVH 3NCJH 4HFWA 3SO5A 4S0TD 3O45B 3WFCL 1G7QB 5HY9B 3SE3A 1W0WA 2YK1L 4L5FH 2AABH 1H3VA 4JKKA 2EXYC 4LASL 1WFTA 2YD3A 3VWJB 3RNQB 5TF1L 1TPXB 3E8UL 3TV3L 4PGEA 2UZXB 3DXAE 1NAML 1SHMA 5MEOA 1YNKH 4ERSH 1IKFH 3GSRB 4TUOA 5L7XL 4F15C 2W07A 1RZIA 3OXSA 2F9BT 3LRGA 3BHBA 1RU9H 1S7WA 4MA7H 2BDNH 1X9QA 3RUGE 3QIBB 1OW0C 3PABB 5KSAC 3V79C 4PLJD 2HLAB 1KIRB 3IJSB 3VRIB 1I7ZA 2M2DA 1HQ4B 1SEBA 4JREC 4JFYB 2DQTH 4AQ1B 1KC5L 4HC1H 1M6OA 3BZ4B 1EEYA 5JPMB 1KFAH 3FQTA 4ZAKB 3T8XB 1EO8H 3B2VH 4J12A 4JZJA 4MNGA 2ZSWA 3ULUE 3PQYE 2BRRH 1H5BC 3BN3B 4LGRB 4MJ5B 3WO4B 5TE4H 4EI6B 3MV7B 1MCEA 4XBGA 4G9DB 4XPBH 4GMTH 2VUYA 4K3HA 4JFZL 1DANT 1EBAA 4UUJA 3L3GB 4DFHA 1S8DB 4PJEF 4WFED 2X4PB 3BIBX 1RZJL 3G5ZB 1KUMA 1PEWA 1RSFA 5CCKL 3SE3C 1HXMB 4PJ8A 1D5ZA 1T5XA 2DQDH 2N7AA 1S9VA 1RK0B 3AREA 1XCQA 4UIKL 3C8KA 5D7JB 1T5WA 4GRWH 2P8MB 4L4JA 4TNVK 4ZPVB 2VDRH 4QHUA 4U7MA 1L7TH 4MX7A 4MA1C 5FUOL 1KB5H 5DURD 3EYQC 5L2KD 1CDHA 3ULSA 1AXIB 5IFHH 3LIZL 1FFRA 4U1IA 2OM5A 5ENWA 1CG9B 5IG7B 1XF3A 3PF2A 1H3PL 2IMMA 2M8XA 3IB4A 1CL7I 1Z5LB 4YDVB 3RDTB 3ZYIA 3WFDH 1IQWH 5IMMA 4JQXA 4U1LA 3VFRA 3U36B 1QSFA 5ISZD 5FO7B 2K7QA 3SGEI 3HE6B 2GEEA 2X1WL 4JZJC 1BOGA 2WP3T 1FHGA 5IEKA 4O2FB 3FONA 1NGPH 3HG1B 4G9FE 3X3FL 4EOWL 1OP3K 1ND0B 5FYLL 5TDPA 2A73A 3K1DA 4JRXE 5JHDE 3UJJH 4ESKA 1HQRA 3FHQA 1PQZA 3HNVH 3GJFH 2AJSL 5I1IH 4HBCH 1KNOA 2JE8A 2J88L 5HPMB 3SDCA 1Q9OB 1F4WL 1KCSH 3DX6A 2NNAA 4LPUA 1QRNB 5E2WL 3KXFA 4E0RB 3MBED 5A43C 3HRZA 2FLRT 1T20B 1U3JA 1AKJB 3DIFB 5KTEH 1L7IL 3PWUB 2H1PH 2X40A 5ANME 3A67H 4YHKH 3CVIL 4GRMA 4ZSOB 5HHOD 2IJ0C 4NPYB 5TH2B 1HI6B 4O58L 3D48R 4QT5B 3N85H 4LP4A 4H26B 3MMEA 3BZDA 4XWGL 5D72L 3FAXA 1TTGA 3MA9L 3MOBL 4X4XA 1OAUH 1T89C 2SEBA 5EG6C 3G04A 1NLDL 2EIEA 3B2UD 5DRWA 3ZKMC 5DD1L 3DGCR 4OLWL 1G9NH 4JQXC 2C3VA 4XWOC 2PW1A 4PJIE 5ESAA 3TO4A 1G7IB 2OQJB 4KKAC 4WUUD 4NZUH 5CP7A 4YHNA 4OT1L 1B0RB 4AIZB 3MRQA 4M48L 4MWFA 1JZ8A 4TVPE 3GMOB 3SKMB 5H94A 2XY1A 4YPGB 4AEIH 3WO4C 5BVJA 2CO6B 1F2XK 2DF3A 1C7SA 4KKCC 4XRCB 3ZE2E 4X6FA 1RV6X 2FHFA 4WCYL 3RWIA 1FG9C 3SGDH 1Q72H 5JW4N 1D6VL 5CJOL 1WIPA 4KC3B 1DUYA 3HI1A 3NMEA 1X44A 1UXSB 4H1LB 5HTSA 3ZYJA 1XF4B 1MJ8H 2H32B 4QWWD 5DA4A 2X4NB 2YUZA 4WVRA 2DM3A 3PIQA 4KGLA 4DN3H 4WU5A 1OOAA 3TBTB 2HN7B 3LMJH 4G5ZL 4NJAL 3UBXG 2DLFH 1JWMA 1JZ5A 3SDDC 4P9HL 4F2MA 3FAWA 4U7SA 2VOTA 5HVWA 3MLZL 1BF2A 1Y6NR 4H0GA 4J2XA 5GGSY 2DMKA 1MVFA 4ZNCD 3MLPA 5GJTH 4RAVB 4M7ZB 3Q48A 5FKPA 3TO4C 3NTCH 5HYQB 2VITB 1FNFA 3PWPB 1CD9B 1EHNA 2ZUQB 4XP9L 1A1NB 1HYSC 1G6VK 5DSCB 4G7VL 4M9OA 4KVCH 4MD5A 5DQDL 1BZQK 1OP3H 2NCMA 3QAZB 3PGFL 1OGAD 1NBYB 2CSPA 1OWRM 1BJMA 3S98A 5F6HJ 1U3YA 2ZOLA 5DHVH 4XPFH 4FQJH 1WITA 3CX2A 1KENL 5HYFA 8CGTA 3D3VB 4QTHA 3ROOA 3HNSL 1INQA 2P5EA 2R2CA 4LQFL 5J89A 2VSCA 2XWJB 4OD1L 4R26H 2R69H 3GSNA 5GJSL 4ZFGL 4LDOB 3WDHA 2HFFB 4JHZA 4UBDD 3PWLB 5AYUH 4U7KA 1I8MA 1TNNA 3LKOB 3BPLB 4PJ5A 4NUJB 3ZTJH 1R3HB 1QG3A 2FL5A 4NCDA 3VMPA 5DQJB 4JG0L 4F8QA 3L5WA 3MRGB 1R24A 1G7LB 1HSBA 4LCWA 1CVSC 4K9EC 4MD4A 5DTFA 1RIUH 2CDFB 2EIZA 3V4UL 5GGRB 5D6CA 4YXKH 4XBPB 3NABL 1CDUA 1U8JB 1HH9B 5A3ID 5T3XD 5DRZA 2NY7L 2C1PB 3V8CA 3FQXA 5I2IA 4N0UA 3D6GA 3QP3A 2W59A 1VACB 1QVOB 1Z9MA 3B6SA 1DBKH 4NQEB 4S1SH 1T1XA 3FOLB 5E6ZA 1OB1A 5BXFB 3MRPA 5HXMA 3RWGA 5EZLA 1RVFL 4JDVA 5IEHB 1NDGA 2V17L 3U6RB 4NN7C 1AO7A 1GGYA 1OCWH 4NKDA 4JO2H 4CNIA 5F9DC 3FO2B 1JV5A 4XNQB 3VXRA 4DN4H 2MJWA 3K3QA 4QOKB 2A6DA 1Q9KA 2F5BL 1PSKH 4LKCA 3RY6A 1MLCA 2E9IA 5TFSL 2YZ1A 4JN1H 1ES0A 3LH2L 3SPVA 4YHOH 5DD6A 1AR2A 1MFEH 4XPGL 5EU6B 4BFEA 3EO1A 1J10A 1UZ8A 2DYPD 3OL2A 4LIQH 4HPYL 1KTLA 2EDYA 4GMSL 4J1UB 5KBNC 1DFBH 5CD5C 1MPAH 2XNAA 5D7IF 7FABH 3K74B 5HI5C 4NKOA 3PHQB 4H5SA 5GZOD 4RBPK 3RP1A 1AGFB 4C55A 1MCSA 1UXWA 4OFKA 5ESQB 5MEND 4C56E 4NO2A 1BEYL 2VL4A 3C6SB 1FGVH 4LSRL 4HWBH 4R90H 5EB9A 4NRZA 2X5PA 4UTAL 4HJJL 2XI9A 4W4OC 4JAMA 2Z0BA 3KJ4B 1GPOH 2ZCKL 3LQZA 3PV6B 4OCYL 5F96H 1C5DA 1MFCH 4M6AA 3DX7B 3QAZC 2ZCHH 1KCLA 3KVQA 3G9AB 2CDEB 4LCCB 1UG9A 3HNTL 2FBJH 1LEKB 5FK9A 3HZYA 2OK0H 5IW6A 2PW2B 1BZ7B 3RY6C 3P11L 2W9DL 2VDKL 4WI5A 3MO1A 4NNYA 4K7PY 3UJTL 1U42A 3MFFA 3V95A 1KN4H 2V5MA 4ZD3L 2I27N 1MCWW 2EXYD 2WLZA 3BPLC 5IIEA 1KV3A 4NM8H 2E5EA 4WV1A 4DGIH 4L4TD 5IFAL 4M6MH 1U8HA 3KGRA 4CN4A 3ARZA 5E5MA 2AJ3B 4OCSH 3EYUH 4K3EL 4PJFA 1IMHC 5F6HI 2Q7YA 5CP3A 1AIFB 5KSAD 3E3QC 4ODVH 1YNLH 3F7VA 4NQDB 4L9LA 1A6VH 4G3YL 3N1FC 3MRMA 2CMRH 3JWNC 5T3XL 4GS7C 1G9MH 2AK4B 3CCHA 1PG7L 3PDOA 5CBEA 5C08A 1V5JA 3Q3GA 5LGKA 2ATPB 4FQ2L 1XGPA 4D9RE 2XN9E 5C0AB 3JXAA 3CFBA 3R1GH 3U48A 5DLML 2QR0B 5IVXB 4U49A 5DUMH 4U6HA 5SWZB 4GG6A 4XPHH 5GGTL 5C0DB 1DQQB 4S11A 4E42B 3TT3H 4X6CF 35C8L 3DWTA 1RULL 1FN4B 3T0AA 4RNRA 5FUCE 4TUJA 3TJEH 5ABDE 2XZAL 5I0DA 1I4FB 4K3DL 3ALPA 4HFUL 1SVZA 5AZ2L 5F72S 4UTBH 5C6TL 5C0BB 1U8MA 2CXKA 3QUKB 1JYXA 4WEBL 3HMXA 3KJ6H 3I02B 4WV1C 4PV9B 1CFNA 3DURB 3FRUA 3BGMB 3REVB 3ES6A 4FZ8L 1VDGA 3EYQD 3C2SA 4IDJH 2OLDA 3LPGA 4MA8L 1MY5A 5ADOL 4MQXC 1GAFH 4YQXL 3QEQA 4G6KH 1LK2A 3S36X 4G6AD 4HCRA 4Y1AA 1Q9LA 2Z8VC 2A6KB 1J0IA 5IVZB 1NGWA 2YWZA 3S3JA 1MRFH 2JTDA 4M61A 3BSZH 3FT4B 4O02L 3FB6B 1I1YB 4JHAL 5ACMA 5I15L 1FSKB 5DJ6A 3INUH 1D6EA 4I2XA