3FN0H

Crystal structure of hiv-1 neutralizing human fab z13e1 in complex with a 12-residue peptide containing the z13e1 epitope on gp41
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
225
structure length
221
Chain Sequence
EVQLLESGPGLLKPSETLSLTCTVSGGSMINYYWSWIRQPPGERPQWLGHIIYGGTTKYNPSLESRITISRDISKNQFSLRLNSVTAADTAIYYCARVAIGVSGFLNYYYYMDVWGSGTAVTVSSASTKGPSVFPLAPSSKGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A conformational switch in human immunodeficiency virus gp41 revealed by the structures of overlapping epitopes recognized by neutralizing antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab Z13e1
total genus 39
structure length 221
sequence length 225
ec nomenclature
pdb deposition date 2008-12-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fn0H01
3E1F1 3H0TB 5BQ7B 5I1KL 3MUZ1 5CZVH 4HS6B 4HUUA 3WNKA 3UC0H 1CR9H 2UZIL 3RVWD 1G1CA 4EBQH 4CVXB 4DZBB 1A4JA 4JPVH 3TGXA 1PFCA 1YYLH 3U7WH 3WFBL 3O3BA 4RBPH 1BQUA 2HFEA 3OZ9H 5C3LD 4M6AA 5HYSA 1ACYH 2JJTA 5B39B 2VQTA 3B4NA 2BY2A 2VLRB 5CSGA 1OP5H 4G6AD 1L9MA 5EZJA 3N85H 2V5SA 1RZIB 3OMZA 1N6QH 4TVPD 1L0YA 3RVVD 4X4ZA 2LAAA 1HHGA 3SDAA 3QIWB 4O02H 2UY7A 1U2HA 3ES6B 2GAZA 4KJPC 4QRPA 4YDVB 4Z7OF 1G7JB 4PJ5E 4M62H 5AAMA 1CFNB 4NP4H 1NBVH 1HHJB 3JBG7 5GS0L 3LN9A 3BD5A 4JFHD 4L8CB 2BX5A 3LPGA 5H8DA 1ZE3C 3ALWA 1D9KD 2XG5A 1EBAA 1JF6A 5DJ8A 5DA0B 3HMWH 4IMKA 3H3KA 2ICWB 1UVQA 4QHKI 4TNVK 3FT4A 4WW1B 1F45A 5JMOC 2P7TA 1MREH 5T33L 1JNJA 3QIWC 4KZDH 4OGZA 2CUHA 2KBGA 5ABDE 4ZYKB 3V0VA 3BGAA 2BSRB 2ZJSL 1FRGL 2EKSB 4BH8B 4MDIA 4LQ1A 4N0UB 2XFXA 5DQ9A 4DFIA 3WJJC 1F2XK 1KJ3H 2IFFH 4XMKH 3WNNA 3V6OC 3VXMA 3KJ6L 3Q6GH 1RJYA 5JTWA 5ISZB 1DJSA 3ZTJG 3BSZL 3QIUC 4WHTA 2OMNA 1QO3A 3WHXA 4LLYB 4ODSL 5D6CA 5KN5A 5SWSA 3TA3D 1UG9A 4G9FE 4N9OB 2NY0D 4OM1H 2YPVL 3D69A 1FGVL 4B7IA 2NY3C 5D2LB 1VGKA 4EDXB 1U8KB 1NCAL 1S3KL 2Z0BA 1OP9A 4JM2B 5F7DA 5HHOB 4G3YH 5SWZD 2ITDB 4TSCL 3FB6B 3TFKD 1WVZA 4MA8L 1E6OL 3N1FC 5DD0H 4NKIH 1KYOK 2GK0B 3LDBC 5I17A 1J1OH 1MF2L 1NBZA 5JXAL 2LU7A 3NGBB 1V7NH 1XF1A 2FO4A 2WIMA 5FEBA 2AGJL 2AK4A 1U8QA 1NAML 4OLVH 5EB9A 3SBWC 3FB7A 2XY1A 4PRNA 2WLZA 4LCYA 4TTDD 2RHEA 3O3AB 2ARJQ 3S3PA 3SOBH 5D96C 4P5TA 1GC1C 5FO8B 1UWEH 1RIHH 1EFXD 1XGTB 4FTVA 5K93A 5T3XD 3KJ4C 5J1AA 2KH2B 4OFVA 3OKOA 1ORQA 1H8NA 5IW6B 2CO7B 4MAYD 2AERT 4JQVA 5D7SL 3MR9A 3RJDA 2V9TA 2EIEA 3K8LA 4OZHA 4FZEL 4HH9A 4P2QD 2C1OA 1J0HA 3MXVL 2AKRB 1OARL 1NJ9A 4G8GA 4WV1A 2Q3ZA 2VDML 1T5WA 1KG0A 2BSED 1SVCP 2OJZL 3DV6A 4XCYA 4R6UA 1KBGH 1FL5B 1A7QH 3FB8A 2OYPA 4L8SB 4KKCD 1MRFH 1TTGA 5DUPL 1LEKB 5DFTA 5JDJA 3MUY1 4NWUH 1NBYA 3W9DB 4C83B 5DUML 5FOBA 4MDJB 1JFQL 1I8MB 2JIXB 1ZMYA 4QKXB 2B4CH 3PWVA 2H3NA 1Y6NR 1DP0A 3VG0L 3CX5J 1JZ3A 5IR1A 5DRNB 3NPZB 2DD8L 4UT7L 4P23C 4JJHA 3VXUB 4RQQB 4Z7WB 1OLLA 1RMFL 5D7LD 3SDDB 3O4OC 3PF2A 1NFDE 3ARBC 4WI2A 3G5ZB 1S9WA 5TDPB 4PLNC 3MRNA 2CJUL 3NIDE 2YZ1A 4KV5E 1ITCA 5I8OL 3WDJA 1SHMA 3TN0C 3RY6A 2UWEA 1YEEH 1I7TA 3I2CL 2VXUH 5EH1A 4PS4L 2P24A 4QHMB 4UDTA 1CU4L 5F9OH 3X11A 4IRJA 3UEZA 2GJZA 2Q8AL 3MRNB 3IU4L 2CUIA 3MRFB 3Q1SH 4PJIE 4OAWA 4Y4KC 3HE7B 2EYSA 4U3HA 1JN6A 3PV6A 1HQ4A 4XPTL 5I19L 1RSFA 5TE6H 3R8BB 4ZUSB 3S88H 5IVNA 2LE9A 2J8UA 1WZ1H 4WY7L 3ZTJH 3M1BA 4QRTB 1JV5B 3CMOH 3QZWA 5AG8A 1A0QL 3V0VB 3T09A 1JNHA 3QHZL 2R2HA 1MLCA 5FKAA 5FFLA 1R5IA 1BPVA 3FN0L 5ANMA 4WUUA 3X13B 2GUOA 4D8PA 2R1XA 1AGEB 1JPTH 1NLDL 4GW4B 4P5MB 3WLBA 5EBWA 1F3DH 1A14L 1LK3H 3MOBH 4OLWH 2GTZA 1G7MB 1GZPB 4KRPC 4PRDB 3OKNB 4XT1C 4JZNB 1MQKL 1VEPA 3BP6B 2AEWA 4HWBA 2GT9A 1FFQA 3NIDF 1VENA 2Z8WC 2FNBA 2W0KA 4DUVA 1I7ZA 1RURL 2HN7B 1IC4H 2RB8A 4WHYH 4ZAKA 3VMOA 1F3JB 5ACLA 4JFED 3BYYA 2CLVB 5DF0A 4DGYH 2HG5A 5E24E 4RBPK 1HXYB 3O3AA 5J9PB 5TFSH 4BQ6A 1MHCA 4Y1AE 1RVFL 3QXWA 5E95B 3RGVD 4WO4C 1ZGLP 1INQB 4F2MA 3SKOB 3PNWA 1F6AB 4LNRB 2VDLH 4ZXBB 3BKML 1N0XL 1Q9WB 3CFBB 3QIBA 5JPMA 5CIPA 5ALBL 3TPKA 1NGXA 3MNZA 2X4PB 1RUKH 3WL9A 1H3GA 4HS3A 1OPGH 2ZPKL 3LRHA 4HMCA 4I48A 4OCNC 3WE6A 1FLRH 4F7TA 4YC2C 1HNGA 4OM1L 3TN0D 1RUPL 3PDOB 2XZCL 2CPCA 4NIKB 4KK5C 4WGWB 1U95A 3P11H 3GJFB 5IVZA 2WIIA 5DEGA 2DI8A 4XGZA 1IZKA 4MJ4A 4GBXD 3H7BB 4NN7C 1AGBB 2YUWA 1GCFA 1C16A 2PR4H 5DJ0B 3ARWA 4HPYL 1NEZA 1CDYA 1XCQB 1KGCE 5F70A 4TUKL 3LRGA 1QSZA 4JFDE 1TJGH 1KEGH 3FB8B 4NZTH 3SCMD 3SKNA 3MRQB 4XP9L 4XBEH 2IADB 4DKFH 3QHFH 5F88B 3TBSB 3OAYK 2EZ0C 4P3CL 1TCRA 2JCCE 2ADGB 2H3NB 1NGYA 1RIUL 3PWVB 1MCCA 1AR1C 1NLBH 2Z35A 4QRRD 3KPMB 3BKYL 5A16A 1AO7A 4PB0L 5L88L 1EJOL 5T5FH 4DQOL 4QYOB 3EKCA 2F5BL 2YN3A 4XPGH 4XNMA 4MJIA 1BEYH 1D5BA 3UBXG 4NQTA 3NFNB 1LO2L 1T66D 1YNLL 1XCTB 1U36A 4UZGA 4NKDB 1CS6A 5IVOA 4YXHH 1T83C 4XPBL 3VDBA 4FQ2H 4UNVA 4OM0H 4LCUB 3DBXA 2NLJA 1FFPB 4ZOBA 1YNTA 3REVB 2BSRA 5LQBL 1MRFL 1CXLA 4WJ5A 2IAND 4C58B 2IH3B 5DWUH 1P4BL 1MCWW 4M43H 1BD2A 2ARJA 4PLJD 2GJZB 1ADQA 3I6KB 1EAJA 2I60H 4EI5B 3SGKC 1A7NH 2CLZB 5KSUA 3F7PC 2RGSA 1KCUL 2HRLA 5CILL 3BKCH 4G8FA 2I9TA 3VH8G 3GGWA 5CCKL 4GRWE 1BQLH 4V1DE 5TDOA 4J3SA 1UJ3C 5DYOA 3MLYL 3WDIA 5E6IC 5KSBB 5E1AA 3QBTB 5EO9A 4PRID 4JCMA 3ZKND 3GSVA 5D7KE 5AUMA 3T3PE 3FRUA 3HZYA 5EU3B 3KPRB 4DWHA 2GUOB 1FJ1B 1PKOA 4H8WH 4U2ZA 2Z92B 3I2CH 1DQTA 3GBNH 5HPMB 2HRPL 1EEZB 2DLGA 1FE8L 1T1XA 4KU1A 4XHJD 3RPIA 5C0IA 3NMEA 4NJ9L 1BJ8A 4R7DA 3BP6A 5CINL 3QR2A 1FJ1A 1NAKL 1HE7A 2Z8VC 3GB7A 3WXWL 4MNQE 5F3HA 2XN9E 1MCPL 5HJ3A 3BRDA 2W9LA 1D9KB 3CMOL 4NNYA 1S5IL 4FQPA 1I3GL 1XIWC 1OQXA 2KDGA 1BBJA 1MHCB 4QNPF 4N8CH 3VGGA 1X7QA 1I3UA 3SKJH 5CMAA 3SE8L 4Z5RA 3QUMB 4KVNL 1F6LL 3HPLB 1XGRA 3C8KB 1KELH 4KWUA 1FIGL 3GZKA 3BWAA 2G75B 1Q9WA 1BBJB 3IDYC 2HP4A 2FECI 4OZ4B 1G0DA 2Y6SD 4MAUL 3LEYH 4TUOB 5DJ6B 5I1GH 4FQQA 3BMWA 2YUVA 3NA9L 1JZ2A 5IF0B 5D1QB 1A7OL 3V6BR 3VE0A 4Y2DD 4J6RH 4LLUA 3SE4C 4FQLL 3PL6B 3O6KL 1FYTA 5E8EB 4DGYL 3G6JE 2EDHA 4F33A 3UP1A 2ZSWB 4G42B 4YIQB 3P73A 3MNWB 1FCGA 4PJDF 4NRXA 4Q6IA 4O2FA 4HWZA 4JZOB 4LVOB 5C09A 4U0RC 3VD3A 1IEAB 1XIWA 2DLTA 3IKCB 4HKJA 3SDCA 4LU5H 2NPLX 4K8RH 4CKVX 1YEGH 2LAGB 5C2BL 4M7LL 1CIDA 1MI5A 3QQNA 2LFGA 3CVHH 4H88H 1DSFL 2PO6A 4WIQA 3IVKB 1UA6L 2XA3A 1FVDB 1YN6B 1SMAA 1B0RA 1OD7A 2F15A 2GITA 3RNQA 1YPZB 4BQ9A 4Z7WE 4I18A 5EWIL 2XZZA 4JM4H 1SEBB 2AXGA 3WLWD 1DL7L 4K7PX 3KLDA 1OM3H 4K3GA 4AENA 5TGBB 4MVBC 4HLZG 1VB9A 4POYA 1QBBA 2CLZA 4I3SH 4X6DE 5IQ7L 2MOVA 1Q9LB 1W72A 2EKSA 4BH8A 2FJHA 3NOIA 5ACZB 2OK0H 3OXSB 3VWJA 2FJFB 5ICXB 4JKKA 4WU5B 4OD3H 2WBJB 4LKCB 5FECA 5D5MA 4R96B 3HNVL 1J0KA 1OCWL 5B8CA 3F62A 4HUWA 3U0TB 3GSUB 4JN1H 1CE1H 5T1MB 4FQ1L 3VA2C 2X89D 1OTSD 2B4CC 3O4LE 3EYSL 4RAVA 5SWZA 1CWVA 3UZEA 4WEUD 4X5XA 5D7JA 4MD0B 1T2JA 3MGTB 2C3VB 3D3VE 4FFZH 4EIGB 3KYNB 5TH2A 5F7EL 2C1PA 3AREA 3DXAE 5TE4H 5GS1B 3Q6FA 1M7DA 4WWKA 5SWZB 2AEIT 2BNQE 3DVNA 5CZXC 1X6LA 3E6FB 3O6FC 1CYGA 2YS4A 4WFHE 4CADA 4HHAB 2R2EA 3PJSA 4PP1D 2A38A 4RX4A 2ITDA 2ZKHH 2X40A 2OM5A 5D7IE 3TNMB 2EDDA 4YXHL 5C9JB 1SJVA 1TVBA 1R3KB 4HK3J 4DTGH 2QQLL 3F7RA 2L7UA 5FCUH 3H42L 3RNKA 2W60A 2VDQL 5KVFH 5IFJB 2DN7A 4QCIB 1ES0B 1CZ8L 2NXZD 3MYZA 3O4OB 1JNNL 3BZFA 1U8LB 5FM8A 3V5DB 1V3LA 1KN4H 3O6FB 1CK0L 5D1ZD 2VWEC 1KPRB 4NUGL 5EZIL 3AFLA 5DFVD 1CGVA 1ORQB 3X12B 1DUZB 3WE6B 3HZVB 4F7TB 4X6CF 3TYGH 1AHWB 3GSQB 1MHPL 2E7HA 5JW4R 5I71C 1I3RA 5A2FA 5EULV 4KROB 4V1DD 1YEIH 1YEJL 3ALPA 3IDNA 1NCWL 4FZ8H 2QBWA 1MFEL 4ZUUA 5I9QC 4J3TA 2HRPH 3CVHA 4OQTL 3MV8D 3MNVA 2B0SL 3DX6B 5IMOB 3UAJD 3D0VB 4MDJA 2UWEB 2C5DC 1HWHB 4XBGB 4N1HB 5K9JH 1UYWL 1EFXB 2ITCB 1IAMA 5H2BA 1OF2B 2NXYC 2OCFD 1U2CA 3G08A 3SDDA 5D2NE 2HFEB 4PUBH 3KYOB 2V7NA 2VRAA 4ONFL 2DQDH 1ZLSH 1I3GH 1QSFB 2BHZA 4G5ZH 3DSFH 1FSKC 1PX4A 3G08B 3FO9A 2YXMA 2AXHA 5CS7A 1DLFH 4S0SD 4Z7UE 2VUYA 4P3WA 4M6OL 4R90L 5C0DA 4KRNA 3WEXA 1DANU 3LRSB 3SBWA 3KPQA 4P2RD 3TO4A 3BPNC 5HYJA 1JMXA 3QDGA 4OCWL 5J1SC 5JNYA 1F58L 1KIPA 1WQVT 2BSSA 3P9MB 4OI9A 3HE6A 5T1MA 1S5HA 3UTTE 1DQDH 2ORBH 5FGCE 2A9NL 4ZUSA 3RU8L 5IW1A 4WV1C 3R0NA 4MSWA 1CT8B 2YD2A 1IL1B 1MLBB 3DETC 5D7IF 5D71L 5SX4H 5FOJA 3NCBB 4YFLF 1JVKA 4UU9B 4KKAC 4Z95L 1WITA 1MHHA 4YHYB 4ODXA 5HPOA 2AV7B 3N85L 1BIHA 4JPWL 5EC1A 1HEZA 1BMGA 4MJIE 5F9WB 4OZHF 4N8PA 2FBJL 3V9FA 4LU5L 3D69B 5K59E 5DEZA 1SY6H 1S9YA 4WI6A 1AC6A 1DSFH 2HLAA 2IBBA 3DX8A 3TPUA 4ODXB 3H9HB 2RCSH 3KR3H 4NNPH 1IM9A 3C60A 2A6KB 3V4UH 3AU1B 4K9EH 3N9GH 3ARBA 3B9KB 3FZUC 4ZAKB 5CGYC 4QRSA 4NPYA 3RGHA 2HTLD 5HTSA 4UOW0 5T5NF 3CFKB 3PJSB 3QDMD 3ARBB 5BW7A 3QFDB 5TF1H 2C9AA 1BQHA 4EDXA 2GSIA 5D9SB 4H5SB 1NCDL 3O6MH 1QNZL 5I8CA 4BSWB 4H0HB 3EGSA 1HSBB 2HFFB 1N2RA 3OHXB 5BS0A 5AZ2H 4G9FD 1S9XB 1ZV5A 3MJGX 4NZRH 1H3VA 2PNDA 5HHME 3IDJA 1XAUA 3TBYB 1LEGA 1CDHA 3BUYB 4XMKL 1QSEE 4Y4KB 1L7IH 4OF3A 4ZO8A 3BZ4A 3BSZH 3HMXH 5C6TL 1JI1A 2B1HL 3VD7A 1K4CB 4P46B 3BRGC 4RMRA 3DXAD 4LLWA 4QF1B 2FR4A 2ICEB 4U1GC 5ACMA 1VESA 3BQUD 3BYTA 3NZ8B 3VFOA 5JLZA 3QO1A 3V7AE 1KB9J 3GJEA 1MCHA 1NCAH 3LH2H 4ZQKB 4HFUH 4LLUB 2BDNL 5HHXH 1U93B 4DAGH 5F89A 1QLEL 1JZ7A 3QP3A 4R26H 1ZA3A 1NDMA 3MTRA 5JR1L 3L1OL 2ICES 1F3RB 5JLZB 3RWGB 1IC7L 1KIRB 1IEBA 3NTCH 5C0AD 2BRRH 5DD3H 1NGPL 2HT2D 3EYUL 4K55A 4JGMA 3TIDB 3EJYD 5E6IB 1J1XL 3WIIH 1SJEB 2NXYD 1JF1B 3MJ8B 1BD2D 4XC1L 3RNQB 3BAEH 4U6YA 3IAQA 1CXEA 1NL0H 1YPZA 2ZCHL 4OCRH 3MLTA 2NTSP 3ECBB 4PRBA 4YAQA 1T89A 4X4ME 1D5XA 4H8WC 2XPGB 1WIPA 5JIHA 5DT1H 3PWUB 4HF5H 3QRGL 3AB0B 3B2VH 1I75A 1BFSA 3ZE0E 2AVGA 2WP3T 4P3DB 2P5WB 1TVHA 4PJEB 5D2LF 5B38A 1ZSDB 5FYLE 1YYML 2BCKB 1OSPH 4P4KA 4NKQB 3OGCB 1VHPA 1OGAB 2AV7A 1JNLH 2OQJB 5C0NC 3WFCH 1UADC 3BP7B 1KJ2B 1A3RL 1XH3B 4HEME 1U8PA 4P59L 2EE2A 1WFTA 3PE9A 4S1SH 4IHOB 1AGEA 2EECA 1A5FH 3PGDA 2DQDL 1ZLSL 4S11A 5DMKA 2Y07H 1DQJB 4JDTH 2ADJA 4BZ2H 3HRPA 1ZGLA 1N4XH 5MENB 4Z7UF 1BGXH 5IEHB 3OKDA 4PJFF 4FQCH 1YECH 2A0LC 1T3FB 4N5ED 1WTGT 1NMAH 4YBLC 4WW2F 2BOBB 4JB9H 4I0PA 4Q6YA 1T1XB 5C0IB 1G7QA 4PTUB 3TPUB 3F12B 4ELKB 3RVTD 1F58H 4PP1C 3O2DA 3IF1B 1R3HA 2A9NH 3ULVF 1M1SA 2CDEB 2PW2B 1G7MA 1GZPA 4PRDA 5HJ3B 1ES0A 4LVOC 4AMKL 4F7CB 4KHTH 4NC1C 5CZXD 4EUPA 3B6SB 4FQJL 4PJGB 5F1IB 4CVWA 3JUYA 3EDDA 3W2DL 3U83A 5KTEH 1WZ1L 4WY7H 4D9LH 1MFDH 3M17A 5GSVA 4ONHA 5CUSH 4ZPVB 2IF7A 4YEEA 4Y1AB 1F4XL 2FBJH 4YO0B 2BZDA 5DD5L 1GH7A 4BJLA 4L9LA 1FNHA 5LGKA 1LP9B 1QLFA 1BIIB 2NZ9C 5C09D 1F4HA 2R39A 4IRSC 5EPMB 3B9VA 3QISA 4XCNA 4XP4L 5HI4D 1KIRA 1U92A 3ALXA 3O2VH 4UBDC 5E2VH 2HAZA 1BF8A 3ZKSD 4G6ML 3C2AH 1NGXB 1JIBA 3MNZB 1JGVL 3O0RH 3WJLA 2GIYA 1K4DA 5JOFA 1P7KA 2NY3D 4RNRA 2A6DB 4I18B 3TEUA 3VI4F 4XNYH 3FB5A 2VDPL 3DMMD 2P8PB 3QCUH 2H26B 4OB5L 3QUXB 2J8HA 1I1AC 2FD6H 1QVOA 6FABH 3GSOA 4YXKL 1RFDH 1DBKH 3CSGA 4QXGH 3T0EC 2FJFA 2X4OB 2AJZB 3GSXB 4JO2L 1FNFA 1AGCA 3ARDA 3QDAA 1P4LA 3QFJE 1T21B 3UXFA 4HUWB 3OKKA 4YHMH 1Y6KR 1RK1A 1AY1H 4EXKA 3K1DA 1XF3B 1WEJL 2O5ZL 1RK0B 5EO1A 4ZFGH 1EZVX 4K23L 1IGMH 1INEH 1IQWH 1OB1B 4Q74A 5EUOF 3DROA 1QZ1A 5K33A 3VXMB 5DURB 3LKPB 4PJHE 1D9KC 2BFVL 2C1PB 4JFOB 3C09C 1JZ8A 2IAMB 3H9SE 2ZUQB 5IOPB 4HFUL 5GRUL 4NQVB 4PJBA 1KFAL 1ZT7A 4JO1L 1CFTA 1J11A 5FA4B 3V95A 2ZUUA 4LLAA 1DR9A 3TVMD 1SYSA 1A02N 3GMRA 2PR4L 4LLVB 4BZ1H 5FM5O 1DN0A 1E4WH 5DD3L 1K9TA 4OZGB 3MLZH 4X5WA 5DJXA 3AREB 4LHUA 3DPBA 1PG7W 1IAIM 4X98B 4EUPH 4EN3C 4FTVD 3RVXC 2VLKB 1GC1H 3RUGB 2LVCA 2D7QA 3QQ9C 4Z76A 1IGFH 4G8GD 1MFAH 3MRHA 2WP3O 4M6NH 5ENWA 4KXZH 4YX2H 4RFOH 4NQDA 2X44D 3WUWG 1V3MA 4PJIF 1PBYA 2PYEA 1EHNA 1LE5B 2R29H 5IHUL 5CGTA 1WBXA 4AH2B 1HIMH 2EDEA 3KPSA 4C59B 1ZT1B 4PJAF 1OAQH 2NY2D 5DQJA 5INCA 1E4XH 3RP1A 1G6RL 1UCBL 4HQQL 4HGMA 4MJ6B 2IPTL 4LK4A 2I60L 5C0FB 4S1SL 5EG6C 1BIIA 4HUNB 4YR6B 5MEND 5D7LA 4EI6B 2D7TL 2HTKD 4L8DB 4XC3H 4KDWA 3L3JA 2DQFB 4Y4HD 1BZQK 4JDZA 4ZUTA 3MBXH 1YECL 4X7EC 3BPLB 4OFKA 5E8DL 1A6TB 4Z7VB 4GQPH 4PJXA 4O58H 3T0XA 1ZLUK 1PJ9A 3K1KC 3V5KA 4Z77B 1K8IB 1OTTC 3KWWA 2ATPB 3Q5TA 4MYWB 4JN2A 2GJ6E 2P48B 4Y19B 3ARXA 4PG2C 5D8JL 2OJEA 5DC0A 4JPVL 1NANH 1JWUA 5J6HB 3TJHC 2EDTA 2MTPA 3PGCA 5DJZA 4R9HA 2BP3A 3EJZC 1P4LB 1QKZH 2H32H 1LP9E 4I1NB 4YHKL 4OZIA 3I3DA 3L5JA 4ZUVB 2VLRD 3C6SA 1RZJC 1S7SB 5HDBF 1UM5L 4JQIL 1FO0L 1S7QB 4KY1H 3SDCB 5MP6L 1J0ZA 4NO3B 3MRCA 1A2YA 4XCEB 1U8OA 4HIJB 3MLRH 1JGDB 1MUJA 1MHHB 1EX0A 4M4RA 4MNQB 3VRJB 5JNYB 4G6JL 2VN4A 4GBXC 5GS0H 5ETUA 1A64A 5GISL 1BZ7B 4KQ3H 1S7UB 4P9MH 3U30C 5D4QA 2EXYC 3ULVE 2DB8A 3FT3B 4LCWA 3VXSA 3X13A 4G6MH 5EOCL 1OB1A 1DN0B 1CXFA 3PWLA 4Z7NF 3LEYL 2MPAL 4JFEA 5JQ6L 4EKXA 4KK5D 1FL3B 5IBUG 4PR5A 1OY3B 1JHLH 1A7OH 4P5TC 1KTRL 3RTQD 1Y0LA 2XZQL 3D48R 4PJ5A 5CJ5A 2FGWL 1A6VL 3HI6H 1ERNA 4OB5H 1G6RB 4HJ0C 1O5DT 2FEDD 3OXRB 5I8EA 1XMWA 3P3YA 2OSLA 4PBXA 1YPZE 4R2GB 1RFDL 3KLHD 1QLRA 2HKHL 4P23B 3L95B 5IVXF 2MKWA 5JO5B 5TH2B 3TNNA 4O4YH 4ZS7H 5GS1C 2FIKB 5KOMC 4AK1A 5F97E 1FPTH 4YK4B 4ERSL 4CJ0A 4QTIL 4LSQH 1KIQB 3RGVC 4HWEH 5C07D 3Q6GL 4HIXL 1S9VA 3MJ6A 2HJFA 2MQ3A 2A6IB 4JFZH 3WSQL 2FH8A 1R5WA 1KEMH 5C0AB 5LAXA 3RVUD 1J9CT 5E8PB 5GGQL 2QADB 4BQCA 5L7XH 4Y4KA 3G6DL 5K9KB 1PW3A 1U41A 5HHQA 4F7EA 3CK0L 4I2XE 2IQ9L 2IBZY 3BO8A 4YDKH 5EWIH 2NY1D 4PPTA 1FZOA 4KMTH 4I48B 3HS0A 1B2WL 2QSQA 1X5YA 1AKJA 1WSST 4QY8A 4XI5D 4NZUL 4G3YL 4PFEA 4F15B 5T1KD 4YEFA 5CEZH 1A21A 3L3GB 1HQRA 3WN5B 1WJ3A 3UDWA 1JPFB 2APFA 4Y5VC 3CU7A 2FX8L 3FRPA 2GCYB 4JREB 3A6CL 3RY6C 3RZWA 5E6YA 2WK2A 4FQ1H 3MA9L 1VPOH 5M95B 5CFHA 4UB0H 2P5WD 1T2QL 1B4JH 4NC2B 5SWQA 3Q3GB 4LPCA 4F80A 1MAJA 1GC1L 3TBTB 4I8DA 2Z8RA 5D7LB 1GL4B 5I9QB 1MIML 3V0AC 3TA3B 1MEXL 3O6FA 2ESVB 1RPQA 3ELAT 4TSAH 4ZFZB 4NRZA 4XNZC 1S7RA 2PXYD 4YX2L 2BXZA 4FZEH 5I1EL 1OARH 1FN4A 3FCTB 4JREC 3D25B 5T5NG 1M6OB 2YRZA 3LSOB 5FYKH 1N6VA 1JP5A 3R4DA 4MLIA 1C8PA 4ZO6A 1OW0C 5IWLC 4ELME 1OAQL 1F8TH 2QQLH 2X4OA 3MRQA 3C87A 4Q9QH 3MR9B 4PJEE 4DKEL 5FB8A 4P46D 2VMFA 1CFBA 1G7JA 2YRPA 4GRWH 4HQQH 2JIXD 4UBDD 5HDOA 2W07A 5DUMH 2NX5B 1RUQL 5A3ID 1WCQA 2GQHA 1AE6L 4PV8A 2WUBL 2EO1A 1CK0H 1XFPA 4MWFB 3VXNB 3U4EA 3WEXB 4LAJH 2XPGA 1TITA 1FL6A 4S1RL 2HH0H 4PV9B 3FKUS 2DKUA 3G6JA 4U33A 2DQCL 4NKOB 5HVGB 2CJUH 1NDGB 5CP7B 5DQDH 4HWBL 3SDXB 2OI9C 4K7PH 1OGAE 1YMMA 2VXVL 4WTZG 4DEPC 3HUJE 3B83A 1WT5C 4OSUH 3MPCA 4OKVA 1KNOB 3LS4L 3TT3L 4Q9RL 2DMCA 1SYVB 3H8NA 3SDAD 5DLMH 3KYMB 5EUKB 2X6MA 5DJXB 1RHHA 5L2KB 5GRJH 3VW3L 1AXTL 1S9YB 1BVZA 3CDGA 4OCXH 1HN1A 5D6CB 5KN5B 5MHSE 4TOYH 1G6RA 4NCDA 3EFFA 3L3KA 1G9MH 3F5WA 2P46B 4D0DA 4KI5D 2B8OT 3MLRL 5ID1A 4QRSB 4BFEA 4PGDA 4BFBD 4X4XB 5B8CC 2J8UB 2LU3A 4GQ9H 3NFSH 4K8RD 1H5BB 4Y5YB 1XF4A 2DMBA 1D6EB 3IDIB 2D7NA 4OLZH 1A47A 4X80L 4PJHF 4OLWL 4R90H 2P4AB 25C8H 4P9ML 3HPJB 3MACH 1BFOA 3IGAB 3UAJC 1CXIA 3QUXC 2QHRL 4RRPG 4CAGA 3B5GA 2YA1A 3PIQB 1G84A 5JQ6H 4XB7A 5ITFA 4KK9C 1JYXA 1X4YA 5KS9E 5C0CE 5DTFB 2XQBH 2W1NA 2XZQH 3RU8H 4X9BA 2C26A 1K4DB 2X1QA 2X1PA 3IXTB 4PLJC 1GOFA 5K9OB 7FABH 3PIQA 1YEDB 1A4JB 2EDXA 5TFSL 1DQLH 3VXSE 2EO9A 3T4YB 3W0WD 3TA3A 3U1SL 3S96A 2LTQC 3FT2B 4OLYH 4HV8A 3SDAC 5L2JB 5DC9B 5GZOD 3KXFB 4R8WL 1S7TB 2ENYA 4RGOL 4JO3H 1V3JA 3BKMH 4OZHB 3JWDH 4KJWD 4KTEL 4Q6IB 3VFRA 5JPNA 3RWEA 3UTTA 2NYYC 4J4PA 2OLDA 3R8QA 3QDME 3NIGE 3DMMB 3K8MA 4OCLC 2QKIA 2BY1A 3VFPA 3V4UL 1YY9C 2X4UB 3O4LB 1BBDH 3CK0H 1MI5B 1AGBA 5DGRA 4AQ1B 4NGHL 5JPNB 3P11L 3RWEB 5KAQF 4XNQB 4OBRA 1KSRA 2BNUA 3FRPG 4PRAA 3FQNA 2KL6A 5JW5B 2LVEA 3TIDA 4PJ9C 5E6IA 5HHMD 3FJTA 1ZWIA 2BVQB 5CEZL 2GJ6B 5CWSB 1LE9B 4QRPE 5J13C 4O2FB 1LGVA 4JRYA 1CFTB 5FA4A 1Q9LA 5E4IA 1BREA 4MA3B 4OGYH 4HXAH 2GAZB 1ZT4B 3VFSB 2VDRH 1TTUA 4K71C 3V5HB 4Z7UB 1T2QH 4FNLL 1IRAY 4ZXBD 1KB5B 3IDMA 1W0VB 3U9UA 4EZMA 3V0WL 3VRIB 3AB0C 3RWCA 4AY0A 3NFNA 2K7PA 4X5XB 4UIKH 5F9JA 1T04B 2B1AH 4IIQA 4IM8A 5E8NB 3PXHA 2CLRA 1XGPB 3KYMA 5EUKA 4LCUA 5KJRL 4AEFA 1F90L 4NM8H 2VXTH 4HUKB 4LKCA 1YEFL 5D5MB 3S4SB 4CDHA 5CEXB 2EEAA 3K74B 2GSGA 4Y7MA 2MHAA 1T2XA 1KLUB 1T5XB 1FZMA 3LD8C 4UQ2A 4OM0L 5BS0E 2ED9A 5IMLB 2QQNL 5E2WL 1CDGA 2H8PB 4ACPA 4H0GA 4JY6A 3IJSA 1Y6MR 4DZ8A 4NQXA 3MV9D 3O6LH 3QRFM 2Y1VA 1PEZA 1WAAA 2NTFB 1PX3A 1CLYH 3ETBF 5AEAA 1CDBA 3QUYB 2ZUYA 3VXQB 2BRRL 1OHQA 2HVJA 1QFWH 2NZ9D 1AQKL 1T7VA 4LSUH 5C0RH 1DQML 2H8PA 4FXGB 1YQVL 3KPNA 5I15H 4G7VL 3QNXB 4MAYB 5TQ2H 5C0GB 3UJIL 4XNUL 4UUJA 3KS0H 1EEYA 4O2CA 1U8HB 2CMRH 1EGJH 2X42A 3BT2L 5K9KA 1FGNL 3KYKH 4EI5A 3A0OA 3CDFA 3L3JB 3T4AA 5EC2A 1CICB 2EICA 5DD6B 1I8IA 1X5FA 4ZFOA 1A9EA 4K7PL 2DYPD 4U3XA 4LCCC 5KG9B 5CIPH 3UTQA 4Z8FL 4JRWA 4AJ0A 3WN5A 4RMTA 4WFEE 4NJ9H 1QFPA 4OD1L 1Q9OA 4PJXE 4PJGF 2H2SD 2YD3A 3L5XL 4MJ5A 1ZGLM 1QFUH 3LHPL 3EHBD 4D0BA 5CIPB 4XHJC 1NMCB 1A6WH 3JWNC 4UTAL 1A6TA 2ILLA 4KTDL 4LAQH 2A83B 1I7RA 3KHOA 1NGQH 4JDTL 4KKLC 1MPAL 3ZE1E 5BW7C 5HXMA 4P48A 1BJ1J 1OW0A 1GGBH 2RBLA 2FYYB 2Z9TA 3CAFA 2NY2B 2YN5A 4H26B 1QQDA 1TTFA 5FUCC 1AR1D 4WW2B 3UJJL 1M71B 1I3VA 4HWUA 4PRHD 4U6TA 5T1LD 3STLB 4L9LB 5EU6D 4R3SB 1KCKA 3AGVA 2XQBL 3RGVA 4HJJL 3WFBH 4N0FB 2HFTA 3K7UA 1A1MB 3QEHA 5C0BE 4HFWB 4P2OB 3ZSTA 4X4MA 4XCEA 2RJMA 3FO2B 3PP4H 1FRGH 3EYVB 3QG7L 5D1XA 4IRJB 1YA5A 3D3VB 2NW3A 3HCVA 4CMHC 1PZ5B 4WW2C 2IFFL 1MHEA 3DROB 1JPGA 1OTUD 3KJ6H 5IB5A 4G9FA 4KTEH 2P8LB 5L9DH 3DGCR 2Z4QB 4Z0BH 2NY4C 2QJDA 1F42A 4AIZB 3IJYA 3ORJA 1CLCA 4U49A 2CKBH 5CJ8A 3MRDB 5JOPE 4RGMC 4NFCA 3QEQB 2YPVH 5FYJU 4OUOA 5E00A 4HIIB 2IPUG 5E99L 1UGNA 2H2PC 1OM3L 3O2VL 5DRWA 4NHCH 3RY5A 2IH3A 5HGHB 3PDDA 1F5WA 2DL9A 1T0MB 1CLZL 2V2WB 3T77A 1Z3GL 2PTTB 1U8KA 5E2TL 2YBRB 4LF3B 2GTZB 1MRDL 2FIKA 3DV4B 4WUUE 3HC0A 3MBEA 4XH2B 3HNVH 4OZGF 2Y7QA 5KVDL 4P4RB 1AIFA 3G5YA 4X6FB 3RDTB 1IAKA 6FABL 5HVHC 5DYOB 5GRVL 4NFBA 3KYNA 1A9BA 1QYGL 4JE4B 2VN7A 3GMRB 4RISH 2VDNL 3GSNB 4WHTB 3KLSA 4WU7A 2AEPH 4H5SA 3MRIB 2F53D 3HE6C 3FO0H 3QI9A 2YUZA 3JV6A 4KRPD 4HHAA 4N90E 3B9KA 4K23H 4U6XB 1P2CA 5EA0H 5DZNA 3N1MC 1J05B 2PCPB 1K6QL 4AM0A 2B1AL 1PG7X 2HYMA 5EUOB 2V5RA 3MRIA 3TZVC 2VLKA 3KPSB 3SE9H 3MROA 4U1IB 2N7BA 4JAMB 2HTLC 5FO8A 1JRHI 3HRZA 4KAQH 2IQAA 2DQUL 3P30H 4MXVF 5E0QA 3TWCH 4PJFB 4HIEB 4BFIA 3B9AA 4JO1H 1IGIH 4OUUA 1MOEA 4LQFH 3I3EA 1HXYA 4XWOD 4DTGL 1ZVSB 3F6IA 5I66B 4JAMA 1EO8L 2R0WH 5ID0A 5GZND 2R1YB 2OTUB 1XZ0B 3S37H 1X44A 4YDIL 5JXAH 3MQIA 4ZUWB 2ESVD 3MLZL 3JVGC 1MVUA 3C8KA 3MRMA 3RWGA 3OR7A 3O81A 3ULUE 2VDOL 2X4PA 1UZ6F 5J06A 3RWDA 3X14B 1TPXC 1RMFH 2FSEA 4M6ML 4GXUM 5CBEA 2JIXA 3B9KC 1S78D 4NZDA 3O9WB 4R2GC 4YHIB 1FNEA 1A3LH 4KK8D 2E3VA 4MXQC 1U8LA 4QXWA 4U1LA 2AP2A 5EBMA 2DLIA 3U7YH 2BXYA 4UNTA 2FYYA 4DN4H 2DQIH 1QR1B 4MD4B 2R0KH 2C3WA 3NCEB 4YK4C 1LO5A 4PJGE 3VWKB 1JWSB 5K9QI 5LGHH 2LQRA 3GEWB 5L0QB 1EMTL 2B0SH 5IIEA 5JORA 2FWOB 1J5OH 4KUZL 1FAKT 5FOBB 3UTPE 1A7QL 4J3UA 1UYWH 4RWHA 3OAZH 4NWTL 5TE6L 2X41A 2V17L 3CFCH 4JFQA 4J8RA 3D85D 3ESUF 2PXYB 1JL8A 5IMOA 5BMFH 4PUBL 1U8MB 4JVWA 3K2UL 1ND0A 3IS0X 1N5YL 4LHQB 1A0QH 3L3HB 3DGGA 4NQEA 2IANE 2V5YA 4XBGA 1I1AD 2HA1A 1X5KA 2XFXB 5DQ9B 1AO7B 4M4PA 3GSWA 4MQSB 4AEHL 3HG1A 3MXWL 4LASL 2IBGA 1PQZA 1U3YA 3T65A 1A14H 1LK3L 5T1LB 1TETH 4LP5A 1P84K 4Y89A 3VDAA 5FYJL 4GSDH 4HH8A 4X4XA 4HDIB 3J8F7 3O41B 1MQKH 4S10A 1YDPB 1T3FA 2OQJA 1WWWX 4X6DF 1DQDL 2ORBL 5D7KD 1SBBA 4JZNA 4APQC 5F1NB 4J3VA 2MWCA 5HYJB 1U8IB 5HGAA 2BOCB 3N1QC 3BW9A 4KK9D 3D3VD 1DBBH 5AG9A 5IMMA 1RVFH 4Y4FB 5LGJA 2A9ML 1GIGL 3JV0A 3QEUB 3FB6A 2W91A 4CN4A 4PBWD 3RPIB 5ANMB 5AD0B 2PYEE 1CT8A 2X4RA 4GKSA 3CFEB 4HKBB 1ZTXL 1N0XH 4PJEF 4Y8AA 5FUOH 3KPPA 2EE6A 5HGBB 2ZNWA 3WNLA 3HZMB 3QEGH 3QEUA 4WWKC 5EU3A 4K3JL 3BDBA 2RCSL 3M17B 5GSVB 1MNUL 4ONHB 4FTVE 3VI3E 3D9AL 2X4RB 3V79C 1S7WB 4FQHB 4JHZA 3CIQA 4KQ3L 2DQJL 3LB6C 4OD2B 5IJKC 1UCTA 3DMMA 1D3CA 2F8OA 3QUMH 1I1FA 1G1YA 1KOAA 4YNYA 1UH2A 4JJ5A 2L0DA 4JFDA 1JHLL 1OSZA 2AKRA 2KZ1B 5IVZB 5C07E 5L2JA 3LMJL 3UPRA 1MJ8H 5FF6B 4HBQA 2HLFC 3C6LC 1ED3B 3MRLB 4QTHB 3U4BL 2GJ6A 3GRWA 1JTTA 1LE9A 3BZ4B 5E6ID 5BRZD 1OSZB 4Z5RB 1J8HB 4X6BA 1QBAA 5ADPL 1QPXA 4OI7A 2CUMA 3FO0L 1YEKH 3SKNB 2BHYA 3MOAL 5GS2D 3R1GH 3SDXE 4XP6H 1Y18B 4U31A 1EV2E 2PO6C 2D31A 5EA0L 1OTSC 1LO0H 4JFZL 2FB4L 4DGVH 3E8UH 3KDMB 4JRYE 1K6QH 5HHMB 4M5ZH 5A2IH 1KEML 3L6FA 5J7CC 5T5FL 2B20A 2H32A 5GGQH 3BH8A 1NGYB 1YUHA 3TBTA 1BEYL 4HKJB 5CWSA 3U6RA 4PGEA 2Y72A 5IB2B 1E6JH 2DQUH 4PBVC 3EOBB 1ZHBA 2BDNH 4JKLA 3IVKA 1NPUA 3IDGA 4PY7A 1ZK9A 4HBCL 4W81A 4LQFL 5CHNB 3MNWA 1VGEH 4F9PC 1IGTB 3EO0A 3GMQB 3BKJH 3TESA 1GGUA 1Z0NA 3ARVA 2EC9U 4GH7B 1DVFC 4P4KD 4TSBH 2NMSA 1KLFA 4AL8H 2Z4QA 1R3IL 2P8MA 3QHFL 3ULSB 4DK3A 1TZGL 3I3BA 4IRSB 1A4KB 1JZ6A 3UBXI 3MV7E 2A6JB 3HLAA 2DIJA 4PV8B 5FGSA 2YD4A 5GGVY 1BFTA 5DEFB 3GIVA 3MLWL 2I9LA 2YD1A 3A6OA 3C5SA 3BGMB 2XA8H 1IL1A 3BQUB 3VXOB 4QWWD 3UTSD 1PQZB 4JY5L 4I13B 1IVLA 4NDMA 5D70L 1J1PH 4GXVH 2VISB 1EO5A 4Y5XA 5F93C 3RL2B 2ZUXA 3VWJB 5DS8B 4LCIH 3SDDD 1CE6B 3VFMA 3HC4H 1P7QA 4H20L 4XPBH 2F9BT 2DF3A 2ARWA 1T89C 2CGRL 3F7QA 4RAVB 3NBNA 3WXWH 3OAUL 1Q0YL 3V7AG 4RFNC 4MD5B 1HH6A 1A7NL 3QI9B 4LOUD 1RD6A 2PTUA 5FYKD 4L9DA 3BP5A 3T2NL 5EC2B 1TJIH 3QWOA 1T83A 2AS5M 5BQ7A 1PD6A 1DLHB 5DXWA 5ICZB 4I2XB 5JUEH 4N5UA 3QDGE 4O00A 3S7GA 3TIEA 4GKSB 4OCYL 4EI6A 2W38A 1FIGH 1I1FB 1KXVC 4WHCA 4TVPE 4QHKJ 5IVXB 4Y2OA 4XXCA 2IQAB 1BQHB 3DX7B 1LD9B 5E2UH 1A7PH 4HWBH 4IRJD 4L8SC 2A0LD 4H26A 5T3XL 3UC0L 5I1GL 5I0DA 4U6VH 4HLZH 1M05A 3FAXA 4RFEB 1YYLL 3QDJB 4OKDA 4OJFH 2UUDK 4J6RL 4ISVB 4R4FL 4FQLH 3BGFB 4KI5E 1LILA 4TUOA 4OQ1A 4EDWH 3OZ9L 5FYLD 1NAKH 3AXLA 3MV8E 3GO1L 5FM5M 3P4MB 1JRHH 5ADOL 1VADB 4TYUA 1OL0A 1FYTB 5B39G 4B7LA 1PDKA 3QUMA 3IXTA 1TZHB 1F11B 1RJZA 1G9ML 2FATL 3HUJA 3PHQA 1CDUA 3TBVB 4IOIA 3LKRA 4M7LH 4LVEA 4GLRI 4N8CL 4ZQKA 2ATPA 4L4VA 1NBYB 2BC4B 2X7LB 3ZKXC 3VI3F 4F7MB 1JGDA 5EZOL 3DUSB 5JW3L 1PZUB 3IFLH 4PJ9B 3BDXA 3GM0A 1WV7T 4L4JA 5DHXB 43CAB 1UC6A 4GOSA 1L0XA 3MRKB 3TN0A 2XV6B 5C08B 2V2XB 4MX7B 3FO2A 4NQCB 4C56B 1QFHA 2WNGA 3WUWB 5HBBA 4LDLB 4FHBD 5DRXA 3LRSA 2ZNXA 1F4WL 2SEBA 3L3OA 4N8VA 3EOBA 4GBXA 5IHBA 1OTUC 4POZD 1VKXB 2AQ2A 3HE6B 1B3JA 3HNTL 2EDRA 5GJSL 4QHLA 4H25B 1BHGA 1KJMB 5SX5H 2ADFL 4O51A 3IXAA 2BY3A 3ZDXF 2VQ1B 3B9DA 5IB4B 4FN0A 5FUZL 3MOAH 2DTSA 3KXFE 4Y5XB 2N1KA 3KPRE 4K8RL 1INEL 3O41A 3ZTNL 3CVHL 3PWLB 2R9HD 5CP3H 3T8XA 3W11D 3HAEG 2HTKC 4DVRH 3LD8B 1AKJD 3FHQA 1TQCC 4TNVF 1HSAA 3BEVB 2A6JA 1R0AL 1M7DB 5B38G 3C9NA 3OXSA 3RWCB 1S3KH 1DL7H 5EBGA 5IW1B 1UACH 2FZ3B 4DKDC 5INDA 1WBZB 2E9IA 1XGUB 2CK0L 4M03A 2R4RL 4AZ8A 3BW9B 2G60H 3PGDB 2E6JA 2QSCL 2I27N 4HC1H 5HHOD 5JO5A 2DIBA 4TSCH 3BEVA 4MAYC 1UT9A 1OCWH 4JGJA 5DMYA 4TQEL 1OAYH 4UV4L 5GRWA 2VZSA 5GRXG 2HJFB 1KN4L 2EDQA 3CSYA 1VFMA 1CICC 5C0AA 3FTGB 3OB0K 2N4IA 3IRZA 1H15A 4FFZL 4U4BA 4UQ3A 4GS7C 5BVJB 3I6LD 3BP5B 3KLAB 2HT3D 1UWEL 4UI2A 1L6XA 3MLWH 2OS7A 3B2UC 4KK6C 3T3ME 5EU7E 2XG4A 2F5AH 2OL3B 2R0LH 5DUBB 5D70H 3STZB 5DJDB 4JPKH 5E08L 4HUVA 5BVJA 2R2BB 4JVPA 1I1YA 1I1AB 3NCYP 1FVEA 5E4EB 3ZT5A 1EPFA 4U1JB 3MRMB 2OXGA 3LPFA 2VXSL 1RZKL 1KENH 3VFGH 4HUVB 4FS0A 4NHUA 3GK8H 3WLWC 3OKEB 4IDJL 5J6GB 2O61A 3DETD 3ARED 4KJQD 2A1WL 4KKBC 2MCG1 4YHIA 2D7TH 2JCCB 3BJLA 1CD1B 5DQJB 1YJDH 4XP5H 5EBMB 5MEQB 1JGUL 3M07A 1P4IL 1UKQA 5JUEL 3B3IB 2CMRL 5KVGH 4KJPD 5E8DH 5LG1A 4R0LC 4AEIL 5H35A 4PRHA 2I25N 3DGGB 2AJXH 5EIIB 1MHPH 4JRXA 3ZMRA 2UVEA 2YPLE 3TJEH 4MVBD 2CXGA 5E2UL 1NCTA 5CJQL 3WS6A 3VXUA 4IIQC 5I73B 4PGZA 4P5TD 1KYOJ 2VLLA 1KT2B 1OGTA 1H3PH 4P2QB 3V4VL 1MFEH 4HJ0D 4XPHH 1MCOH 1IGTA 1S7SA 3DUSA 1ZEAL 4GMTH 5IT2H 5EZJB 1G9EA 4NQEB 4FABL 3L5XH 2OJEB 1QD0A 3LHPH 4QOKB 2ID5A 4P23D 1MCDA 4K94L 3OG6B 2P42B 1FVDA 2NNAA 4U6YB 3DOSA 2FATH 1EUUA 2R9HC 3VU2A 3C60D 1G9NC 3OR6B 2CKBA 1XIWD 4NQVA 4OF5A 2GT9B 3GDBA 3KR3L 1T0PB 4NNPL 3UPCA 4ODUA 1N8ZA 4F58H 4RGNB 4YDJA 1NLDH 5C0BD 2OL3L 5DRZA 5GISH 3VH8A 4WDIA 3F8UB 4LCWE 3G6AB 2G2RA 3GSRA 3QAZB 4PY8I 2X4QB 1RZ7L 5GGRA 5C08D 2IMMA 4XWGL 5EOCH 5IEHA 3W5NA 4OCSH 4HUXA 4Y4FD 4YFLI 3DECA 1P7QB 4ALAH 3RZCA 3SJVA 2VE6B 1RU9L 3ULUC 3MSPA 4GAYB 4LHUB 4Z7NE 2IPKB 3DSNA 5F8RC 3PP4L 3SJVB 3MFGB 4O9HH 3QXDA 3C08H 3QIUB 4U7SA 5ID1B 3SGJA 5FM4A 1T4KA 5IQ9B 1HI6B 2WWKT 1J05A 1Z5LB 1RUML 2GK0A 4P2YA 5LAXB 1XF4B 4HWEL 4GKNA 2CDGB 2W0LA 3OKYA 4ZNEA 1I4FA 1FG2B 35C8H 2AK4B 2NY3B 2XRAH 1SY6L 4YGAB 1RUKL 3WUZA 4WU7B 4E41D 3PNWB 1N0LA 3O3UN 2JJTC 1HHIB 1G7PB 3MMEB 4RZCB 3G6JF 4G8EA 4ETQB 1KACB 5INCB 3UTTB 3L3GA 4BUGA 2NW2A 2W60B 4PREB 2EDBA 5FF6A 1W8NA 4F7CA 2CK0H 1GGYA 2EDKA 1NKOA 1NH6A 4R26L 2H1PL 4OI8A 4TVPH 5DJ2B 3TT1H 1Z3GH 3JXAA 1CGUA 4URTB 1QFWI 1KPRA 3ULUL 3IDGB 3LIZH 1S9XA 3VFUA 4APQD 2GFBB 4P5KA 4U1KA 5DSCB 4TQEH 2QHLA 4CMMA 3QPQC 4TUKH 1BWMA 3DIFB 3GUTA 5GGSY 1VPOL 4HMEA 1C16B 2PYFA 3ME0A 1AI1H 1DUYA 2VITA 5AZ2L 1CCZA 2FHFA 3QUXA 3UTZB 5D6DC 1GOGA 3VFPB 2ZCHH 3QUZD 1CFQA 1L7IL 5EPMA 2AQ1A 4PIRF 1JUFA 1IGJA 5JXEA 2AJYL 2NXZB 1NCCH 3BN3B 4PY7B 3TN0B 2ZOKA 3NZHL 5CP3A 2V2XA 1TCRB 4MX7A 4NQCA 4XXDA 5I18L 4JO4H 4MNHA 3NACH 4GG6F 5I1EH 1RIVL 4DN3H 1IGJB 4KKBD 2DYPA 4ELMA 1AQDB 4XP1L 1IGIL 4BZYA 5JIPA 4M93B 4JKMA 5KS9F 5KAQG 1I7UB 2VXSH 5JR1H 3L1OH 3X3FH 2EZ0D 2P24B 3B8SA 4Z7UA 5JZ7C 5IJKA 3CUPA 3MRBA 5D1ZA 2J7LA 5IFAL 1IAOA 1AGDA 1YC7A 1NGPH 5C7XH 3MV8B 2HJLB 4EI5D 4Y2DC 5TE7H 1CDJA 1UQSA 4OTXL 3NPSC 4XP5L 4IDLA 5F7HA 3N0PB 3BQUA 5EDXA 4AEIH 3ZDZE 1PYWB 2XZAL 4XC1H 2CDFA 4NJAH 2HJLA 4QRRB 2YMXL 2EYTA 43C9B 3D6GA 2VZ3A 2XTJE 1I85C 4L3ED 3RY4A 2NY7H 3EJYC 3CPLB 5BOZG 1D5IH 4PRIB 1KXTB 4PG9B 1FL6B 1MCOL 2FX7L 1FE8H 3VXQA 2VZVA 3F12A 4LMQE 4Z7QE 4Y2DB 5D2LE 3MJ7B 1ACYL 5DLML 2R1WB 2YC1B 2XWJB 4ZO7A 2DTML 3CXHJ 5GRJL 4HC1A 4YUEL 3SQOH 4OCXL 5HGDB 3U48A 4AT6B 2XWBA 1N6QL 5D6DA 3VGHA 1H5BA 4Y5YA 1ETZB 1JHKH 4HS8H 2XWJA 3TZVD 3JSSA 3CFJA 4PJ7E 1NFDF 4LSVL 3DO7A 2H9GB 2PTVA 4X5LA 3SE8H 4KQ4H 4AEHH 5BV7C 4L5FL 1TFHA 5EOQL 4GW1A 1INQA 4QY8B 4F2MB 1F6AA 5KG9A 4K2UL 4X80H 3G04A 4Y19E 3HE6D 2E7LC 3C2AL 1IM9D 4C4KO 4X7FC 2Y5TA 3RAJL 3DIFA 3GUTB 3BD3A 5KSVB 5E1HB 4PJDE 43CAA 5HDBE 4TNWK 1CFSB 4R0LA 4X8JB 3T1WA 2GJ6D 1RZIA 2DWDB 1BWWA 5E5UB 3IDJB 3T2QA 1GGIL 3W0WB 2VL5B 3JVGA 1DBKL 4QXGL 1UZ6E 3C08L 4Q2ZA 1R5VA 1LEIB 5F7LB 2PO6B 4GMSH 4HKZA 4IOFD 3VDCA 1JJUA 3QDMB 4D9LL 1WEJH 4RA0C 5EIIA 5CUSL 2DQGL 1FFOA 5GIRA 3VFOB 4DUXA 1HDMA 4YHLH 4NO3A 1ZLVK 4AG4H 4ODSH 5JA9A 5EU4B 3O4LD 2Q87A 1OT2A 2BFVH 3L5IA 3LKSA 4QRPB 1MCLA 4JM4L 4TN9A 4XP4H 2W9EL 2W0FB 4P2OA 3MRDA 1FP5A 8CGTA 1PKQA 2H1PH 5IQ7H 2WWMC 4NYLB 2QSVA 3T0EB 4L8BA 2VQ1A 3VXNA 5TGBA 3LIZL 1J1OL 1MF2H 3PHSA 4PRPA 2M8XA 4LVHC 5IHLB 1TVDA 5IESH 1R24B 1T7XA 4GKZA 4UIMA 2OXHA 5JA8B 5B8CB 4FNLH 3EO1B 2CK2A 4M1GL 4RAUB 3L7FA 1QRNB 3KJ4B 1QOKA 4YDJB 3T1FB 3EHBC 1MSPA 4P3DA 5B38B 3N1PC 1IGML 3FT3A 3VXSB 1NCCL 1ADQH 2C4XA 5T1KB 1DQQA 2IC2A 4NSKB 3MRGA 1MFAL 4J3OC 5FYLH 3O45A 4JO4L 2AABL 2B7DT 1MI5D 2IG2L 1ZS8B 5D7SH 1F90H 4NM8L 4HULB 2E27H 4YBHA 4Z0XB 3QXVA 1IAIL 4XAWL 5EOTB 5DK2B 3UBXA 1UWXK 4Y16C 3MV9B 3HR5B 2Z92A 2GY7B 4YPGA 1VGEL 2P5ED 1ETZA 3RWIA 1E4XI 4M00A 2PYEB 2J88H 4MCYA 3H42H 5DS8A 1YQ2A 4BZ1L 5KVFL 1Z5LA 2E8ZA 3S35L 3S4SA 3ARGC 5IEKA 4R7NA 1QSED 3PWNB 2B4CL 3SDDC 1I3RB 4JGUA 2E9JA 2QQKH 4LIQH 3UJIH 1R3IH 4W6XB 4DK6A 5HSFA 1HYSD 1NEZG 3H9SD 4HJGA 2JCCA 4M9OA 2ED8A 3V5DA 4NNYB 3H3PL 3QQ4A 4RDQG 2HFFA 5C0CD 1NKRA 3BPOB 3UTQB 5L8LB 5JOEA 1YEIL 3LV3B 3BOVA 1VFAA 1A8JH 2N7AA 3S5LG 4V1DB 1LP9A 1FL5A 4M6NL 3B2UD 5J12C 1DBAH 4OGXH 3U0WL 1R5VB 1LEIA 4A6YB 4LCIL 1MQ8A 3HI1B 1VEMA 3IU4H 3MLXL 4RGNE 4HUUB 5JOFB 4OD1H 1B9ZA 1IT9L 5JW4M 5IK3B 5CGYD 1FFOB 4XPTH 5IUSA 5SX5K 2DJUA 2P43B 3ARGA 4YUEH 4E5XA 1A6WL 4U0RB 4LEXH 3WD5H 4HXBL 3PL6A 1S7XA 1X5IA 2H6PA 2OP4H 1QLFB 1SM3H 1EFXA 2YPLB 2IMNA 3ARDB 3JWDC 4EIZC 1NCBL 3QG6A 4HEPG 4NUJB 3MRRA 4GRWB 1XF3A 4C56A 1RJZB 1UJ3B 1U91B 4R3SA 1I7RB 1VFOA 2OTWB 3S3JA 4ETYA 3RIAF 4XRCB 3MRJA 3TO2A 5DHVB 1ORSB 2DJSA 2XTJB 4IMLA 4JFXB 3KVQA 1XF5B 1XR8A 3LQZA 3D87B 3HE7A 1QVOB 1SVZA 4LSSH 5C0BA 4YWGH 2GK2A 4UIMB 5HI3C 3PGFH 4X7SH 5DDHB 2DBLH 4AENB 1CGWA 5MENE 3PWUA 5DJ8B 4RMWA 3LQZB 2D03H 4E41B 5ESQB 2J8UE 1A2YB 1PAMA 2L7JA 4GAYA 4OLXH 2YOCA 3VFWB 3MYJA 4G43B 5D93B 4OLEA 1UM5H 4KY1L 3S37X 4HUMB 1D5MB 4O4YL 4ZS7L 4YDVA 4ODVL 5I76B 3JV4A 3OJ2C 3OB0H 3KAAA 4ZFOL 2EYSB 1CFNA 1KTDB 4CW1A 1D7FA 3G6AA 2J1KA 43C9A 2FL5B 4G43A 5GGRY 5IOPA 2VC2L 2CKBL 3IB4A 3I02A 1Q0XH 4IHOA 1PZ5A 5IKCA 4K9EL 1C5DA 5EZOH 3LY6A 2F53A 3MV9E 1PG7H 3HAEH 3RWJA 2WBJC 4JPIA 5IROA 5DJYA 4L29B 1CLZH 4J4PD 5HGAB 1ROWA 3HC3L 4PY8J 3MLVL 1LNUA 3SKMA 3X17A 4PRHE 3KG5A 5E2TH 1QA9A 5GPRA 1BX2A 4N0UA 1I85A 1JHTB 3IAGC 4K94C 4KI1A 1GHFL 3O6ML 4UMGA 3TVMA 4PJCF 2ATKB 1VACB 2J5LB 3O3DB 2IGFH 3UROR 1FNSH 3EOTL 4XXCC 2D4FA 4GRLC 3EZJB 1HCFX 1G9NL 5E03A 2NY2C 1PKQE 5BV7L 5I8CB 4GW1B 4L3AA 1I9RH 4LBEA 3VXSD 3AS2A 3I6GA 3P4OB 4HIXH 5DUBA 3STZA 1IMHC 1MIMH 3GJEB 3CLEL 1C12A 1LK2B 1NLBL 1UKTA 3HFML 3P4LA 5I30H 1ADQL 2WIIB 3BKYH 3UTZA 4ESKA 1FZOB 4PB9H 3OKMB 1FNGA 4U1NA 4WFED 1X5HA 1R3JB 4Z7VA 1WGOA 3S98A 4APQB 4OQTA 5CD3B 1LO2H 1YNLH 1EVUA 5BOPA 2AJUH 1K3ZA 2XXMB 3P40A 5JOPD 2J12B 4KMTL 2GFBA 2ZOKB 3PG2A 3NN8A 4X6CB 3TH3T 3LKOB 1ED3A 4Y4FC 4ZSOE 4WI5A 4YR6A 2QSCH 4HC1L 2ERJB 1QP1A 3MUGB 3MA7A 3DHMA 1XF2A 1P4BH 1HZHL 1XGQA 5TDNB 2NY0B 3QDMA 5C92A 2IH1B 3VCLA 2FX8H 5J4MA 2F58L 1EXUB 1QACA 2VLJB 1UEMA 3BE1L 4FQXD 1HH9A 5FDWA 5LXGL 1K8IA 3MA7B 1XF2B 4L9LC 4NN5B 4RWYH 3VXPA 3EOAB 3R06B 4ODWB 4Q58C 3BD4A 3MLYH 2HH0L 1I8MA 5I16B 3H3PH 1GZQA 5D72H 1SJEA 1T21A 4WI3A 5DQDL 1DVFA 5FYJD 4LPVA 1W2KT 5IROC 4DN4L 2F5AL 5IBTL 2C3XA 4PLKD 5ESQA 2V9RA 5B3JF 1RULH 2HT2C 5I8KH 1IE5A 5EU5A 1D5MA 4X4YA 2QEJA 3QUZB 3CDYA 2HVKA 2VISA 2ICWA 3RL2A 5BO1H 1GGCH 3VFSA 1AGFA 1UZ8A 3DVGA 5DJAA 3BESR 2ICWJ 3TCLB 4LEXL 5HI5D 4Y4HA 4X99B 1FZMB 5BV7B 2G5BB 1DBJL 4RGMB 3G5XA 1MLBA 2YPLD 4NQEE 3LPWA 4NRYA 1TENA 4KUCD 1S5IH 5FHBH 4IRZL 1B0GB 4WJ5B 4WDIB 5IVXE 1YJDL 3EW3B 4KDTA 3DVGB 1NSNH 3IDYB 1CL7I 3BHBB 5KVGL 3QDGB 4X5WB 4LLDA 1LNUB 2VERN 4JB9L 1UM4H 1CDCA 3GMPB 4HWNA 3ULVL 3DV4A 4LLYA 2VR9A 1NBQA 3X3GL 2QHRH 3B6SA 4PYGA 2IANA 4LHJB 4XPHL 4U6HA 2BOCA 1VACA 5E1AB 5T3ZD 1E4KA 4X9IA 2G2RB 2ADIA 2HJKB 3GSRB 3DO3A 4AMKH 4GMTL 3REWA 4M7JL 5F9WC 5FGRA 1M05B 4RFEA 4FQJH 3SKMB 4FABH 1DBBL 4IS6B 4U6HB 4XI5C 3KPNB 3W39A 2YRLA 4J3XA 3L9RB 4H1LB 1TPXB 3NABH 1E27B 1I9IH 1WTLA 1WT5A 3OX8A 4YH6A 1IM9B 3V2AR 3GBLA 4MZ2A 1CLOL 1A7BA 4NCC1 4O02L 4N0UE 4GW4A 5C2UB 4Q0XH 4X7CC 3HS0B 3I85A 3IYLW 4GAFB 1LQSR 4I9WE 3GRWL 4OV6F 4PGCA 3CFEA 3GIZL 1U8NB 1J8KA 1GXEA 1OD9A 1I4FB 4GRMA 5E2VL 4UNUA 2H26A 3V4PL 2CH8A 3S34L 4O5LL 4HS3B 1F3JA 4FRWA 4U1KB 1MFBL 5DO2D 2VL5A 5DSCA 3BPCB 1ZVYA 1TQBC 5HHPB 3VG9B 4QTHA 4APQA 1JTOA 4S2SA 2CD0A 3HMXA 4D0BB 3W9EA 4BSJA 3AMLA 1N2RB 3OHXA 1K5NB 5BS0B 5ICYA 1LDSA 3SO3C 1KC5H 4QWWC 1M6OA 3QUKB 1QHOA 4JN1L 2A74A 3QUXD 4OGYL 4P57B 1FNSL 3ZE1F 5HHPA 2VDRL 4A2MA 3ROLA 1BECA 3ULUF 3F58L 4KI5F 1KJ3L 1G6VK 2Q7NA 4GBXB 1XGQB 1HNFA 4CNIB 1AY1L 4K8RC 1LDPL 1ULVA 1UJ3A 1NUFA 4CVZB 3CLEH 1OAXH 4HSQA 2GHWB 4M9PA 1YY8A 5E6ZA 4UIKL 5I30L 1IQWL 3TO2B 1ZHBB 4W4OA 3MRCB 3MRKA 3LSOA 4XNQA 3V52H 1OWWA 3NCYS 5T3XE 32C2B 2ZKHL 3GMNA 3L5WB 5IJVA 3B5TA 3G6JB 1J7VR 4AIZA 3CDCA 5F96H 1UEYA 5GRUH 3VRJA 3I9GL 1BQSA 4OZGE 4N9GA 5HYFA 4XNXL 3ZYZA 4F8TA 1KJMA 1Z6JT 3WO4C 5A2KH 2BVPA 1NGWB 1T66C 2VO5A 3U9PL 2D0FA 5DD0L 1AQKH 2VLJD 1V7NL 3T1FA 4U1HB 5DI8A 1BD2E 2VR4A 2ZUVA 1J8HD 4WWKB 5I71B 2FBOJ 3K8KA 4JFYB 1DZBA 4Y4HB 4X7DC 1FGNH 2O5XH 5DVOA 3HUJF 3PXJA 3SOBL 4JHAL 4LMQI 1D5BB 5ESAB 4GT7A 5MENA 3VXMD 5DURD 1XGUA 4XPFH 3TO4C 3UZQA 3VFMB 3CX2A 4D8PB 4YPJA 1CTNA 3VWJD 5IMLA 4I0KA 4JRYD 5FO7B 5F71A 1ITBB 4OQTH 5LCVL 3HC0B 3A6BH 3MBEB 4XH2A 4Y8DC 4AM0B 1JBJA 3BIAX 4Q9CA 12E8H 1MCQA 4XP1H 1A1OB 4GW5B 5J56B 5IV2A 3ZKMD 5DFVC 5BO1L 1Q9KA 4LRIA 5F6IB 3K0WA 3RVXD 5MERA 1TLKA 1A22B 4RCAA 3UDWC 1G6RH 1UCBH 3DTXA 2FJGB 4OIIH 3TZVA 5DZOA 5IFAH 4FFVC 1UH4A 2VR5A 1PSKH 5LBSL 2DLHA 4I0PD 1QBLL 2MQCA 5KSBE 5J11B 4CVUA 3RIFF 5DVMA 4EQ3A 4JRXD 4G7VH 5TQ2L 4G5ZL 1MCIA 4DVBB 1NANI 5EZLA 4MB4A 3BPNB 4LDEB 2A83A 2XZAH 4E0RA 3ULUD 4O58L 3DLQR 4TVSa 4L8DA 3PDGA 1U8QB 4HH9B 1BZ9B 3IFPA 3HI1A 4YHOH 4FXKB 3AM8C 3NN8B 3RBGA 5I75B 4JQVC 3BEWB 5K9OA 4S1QL 1Q9OB 2VXUL 4HJJH 4OJFL 4UAOC 3FOLA 3VXRD 1BZ9A 3D39B 5DR5H 3NIFF 4YHKH 3JV5A 3W9DA 4EDWL 1U8JB 5D71H 4NBZB 4ZUUB 4JR9L 1I1RA 4IOSD 2WW8A 1KF9B 2H41A 2A6DA 3FN9A 3MX0A 4JQIH 2EEDA 1JRHL 1X5AA 3FOLB 3K46A 4YFDB 4XBPB 2AJ3A 3BIBX 4MS8C 4QOKE 4G6KH 4Y16A 4BH7A 3RTQA 1KN2H 3W0WA 3BZDA 1U91A 5TDPA 3BJ91 4QRRE 4MQXC 4HCRH 2WV3A 5CJOL 1U9KA 4X0KB 3WFHA 5ESVB 1E28A 4C83A 1PLGL 5FKPA 5EOQH 4QEGA 4CNIA 2BVEA 3OL2A 3FQNB 3GRWH 1S5HB 2J6EA 1F2QA 1G7LB 3WCYA 1C08B 1BAFL 3ESVF 1I8KB 1Z0MA 3GSWB 3S34H 5F7YC 5A1AA 4MXWH 1GRWA 2FHBA 3WNPA 5D7IA 4M1CD 4P2OC 4F33B 5TPWL 3ARDD 1ONQA 1AGFB 5GGRB 1L6ZA 2XNAB 1XCTA 4GRLB 2YR3A 1JF5A 3V5HA 1NMBL 1BJ1H 1YMHB 3GKWH 5DVLA 4PJBB 3GI8L 1XEDA 1QNZH 1FFNA 1YPZF 1YZZA 4JG1H 5LWYL 2YEZB 5J12B 3HLAB 2L4OA 1KGCD 4R2GD 4WU5A 2MMXA 1Q94A 4B5EA 4N0YH 5CEZD 1FPTL 4CU7A 1T80A 3AU1A 3TV3H 1IEHA 2IWGA 5T1LA 5D2LA 4GKZB 2W65A 2J3SA 4FFYH 4KJYB 2ZUQC 4JLRA 4Z0BL 5F6HI 4AG4L 3S36X 1AKJB 3RVVC 4X98A 3EFFB 2VE6A 3L3KB 3G6DH 4PJ9D 5IB3A 4LGRB 4YDKL 1DE4B 5LKNA 4LKXA 1BLNB 3P30L 5GGUB 4XVUD 3ZL4L 3QUYA 3AROA 5HHXL 2FO4B 1A7RH 3A67H 1GVIA 2LTQB 3C6LD 1EO8H 3BRFA 2DRUA 3G9VA 3ZHKA 4NPYB 4HIEA 4BFIB 1QUNA 2XTJC 3E6HA 3EYUH 2QV2A 1RI8A 4QXTA 3OJMB 4UV4H 5IV2B 1MIEH 4WUKL 4JFDB 4MA7H 3WIIL 3FQUB 1N3NB 1L7TH 3KLAA 2VDNH 3RNKB 5DD6A 3BPLC 4O2EA 3VCLB 3C5JA 2PCPA 5I1HL 3P77A 5C0EA 1QFWM 3QO1B 2HFGH 4CVXA 4DZBA 1FC2D 4I4WA 4L3CA 1X6NA 3QNYB 4S0TD 2QADD 3BGFC 5C07A 2A73B 4ODWA 3CMGA 5I2IA 3DYMA 3QIBD 5DJ2A 3QRGH 1AHWA 3SY0B 3O11B 1YYMH 5JPMB 5DJ0A 1EMTH 5LCVH 2X05A 1C5CH 5GGSA 4BK5A 3UPRB 2R1YA 4MA1B 3QH3B 2A74B 1KCRH 2MSPA 5JXEC 3WFCL 3UTSA 3SDCC 5EU5B 3W5MA 3ROLB 3FCTA 3U4EB 5J6HA 2E7LA 2DYPB 1I1YB 4P59H 4HIHB 4POZC 5BZDA 4NM4L 3BN9C 4XAKD 2ED7A 1A5FL 1W8OA 2GYSA 2Y5EA 3WO3B 2NX5D 2WUBH 4L8CA 3OTTA 1S7QA 2KQMA 3KPMA 1JGUH 3I50L 4JZJA 5IG7A 4LASH 1XGYL 2JK5A 5D2NB 4EN3B 1IQDA 2P5WA 1CD0A 2V7NB 1ZSDA 4MLSA 3ZHLA 2Q86A 1JWSA 4YHOL 3IJYB 3U7YL 1VKXA 5KVMC 1KLGB 4UT9H 5GGTH 1I7UA 4ZD3L 3MLTB 3EYVA 4OSUL 3GMPA 4HCRA 3VFWA 3LS4H 3RHWF 1B6DA 3MRBB 3PP3H 2X4NB 5IT2L 4DGIH 1PGRB 4JR9H 5EU7C 4GAJH 1IT9H 1KT2A 1TVHB 4PJEA 1KB9K 1OVZA 3KS0J 1SYVA 1IJ9A 1EJ6A 3ARQA 2WINB 1RAMA 4JFHE 2XKNB 4TOYL 4J23A 2KUTA 3SDYL 5LGJB 2ICWI 2AI0H 3MYJB 3TNNB 4A2LA 1CGSL 1QEWA 4RIRB 2I07A 1AXIB 4IJ3B 3CX5K 5DMIH 3QEQE 4OFIA 1DBML 2OL3H 4BYHA 1ZGLB 1INDL 1T03L 5D96B 2QL1A 1QSFE 3NH7L 3O2WH 3OPZH 1JGVH 3SO3B 4UV7H 3QUML 4KVCH 4LRNH 1E0OB 3FQXA 4U1MB 2D3VA 2CIKA 3WNOA 3PGFL 5BZWB 3MODH 9CGTA 4NNXA 2Z91A 5IQ9A 4XVJL 1TZIA 4KZDL 4FFWD 7FABL 5L2KD 2DQTL 2X2YA 3C8HA 2D03L 4UINL 2D4DA 3TVMC 1A1NB 5EFIB 2A9MH 3PWPD 1HYSC 1TNNA 4M7KH 1RUMH 3DYPA 2GSIB 5ALCL 3U46A 3O4LA 3TV3L 1HINL 5FO9B 1HHIA 5GRVK 1SJHA 1G7PA 4Q9BA 3OR7B 2UY6A 5C2BH 2YPKB 3ULVC 4H88L 2AJVH 3RWHA 1UA6H 4X6CA 4PJAA 3ROOB 3LKOA 4F3FA 1P84J 3WIHH 1BBDL 1JGEA 4GKNB 5FO9A 1Z9LA 3WO4B 3ZKNC 1SJHB 1SBSL 5I66A 3UZVB 1JWMA 4G9DB 3S35X 3ZL4H 1F3DJ 1U0QA 1O7SA 4HIHA 3N1GC 2HKFH 1XZ0A 3BH8B 2BRQA 2YD5A 4TVPL 3P73B 1NAMB 4XMLL 3TM6A 4PGJA 5CLTA 1YNKL 2KZWA 3CH1B 4W70A 1G7IB 2VUOA 4NKIL 1MFNA 4U3CA 3DUHA 1MJ8L 1U93A 1WIOA 3OF6A 1F11A 4XGZB 4POUB 4HG4K 2AGJH 5BXFB 1JYVA 4ZTOL 2V6HA 2ESVA 2JJWA 3PQYA 5C6WH 4MGXA 1MJJB 5HYQB 1OTTD 1VERA 3RL1B 1G7LA 4NOFA 5T3ZH 5KZCD 3GJFK 4YHPB 3MLUH 3T0AA 1FNAA 5H37G 3HFMH 3EFDL 4I3GA 3UO1L 3E8UL 5T1DH 1WICA 5E7FA 1RJLB 1EFQA 3H9SA 1KCLA 3RTQC 5KJRH 3ILPB 3ARZA 3UTTD 3NACL 3QO0B 5F6IC 4G9FB 2VXTL 4EJ1C 2D7OA 5C0DB 4WENB 4JANA 4YDLB 1E6JL 1YEFH 3OJDB 4QOKA 5FB8B 2Z35B 2Y6SC 4LLMA 2OJZH 1HIML 5CBAA 4RMQA 1WWBX 1KCRL 3M1BB 4QRTA 2BNQD 3FQTB 1F97A 1K2DA 1G0XA 4JY4B 1T20A 1NCNA 1H8SA 1F4YL 3HI5H 5CJXA 3DXAB 3SCMC 3EJZD 8FABA 3RHWK 1T0MA 5J0BA 4KKLD 2AV1A 4LSUL 1Q9KB 2F8XC 2F58H 3LQAL 1FFPA 1TQBB 3REVA 1G9MC 1TJIL 3VXUD 5IMMB 4Z76B 5C86A 3FRUB 3HZYB 2HVJB 1NDGA 5CP7A 5D1ZB 1XGYH 4YDLC 4DEPB 4OCYH 4EVNB 4P99A 1FSKB 3QYCA 2ADJB 2DM4A 3FFCD 3VD4A 3KPOA 2I07B 4LL9A 5T3XH 5A2LH 4G80B 2XA8L 3CZFB 5KW9H 2HMIC 1KULA 4WWKD 4ZD3H 5DHYB 4NOBA 2FX7H 4L4TE 4PS4H 1P2CB 3BI9X 4KPHL 3ZDZF 5J1TC 1WZKA 4I0PB 4R4FH 1UH3A 3QWRD 5DJCB 2J8UF 2VOTA 4DGIL 3LEXB 4BSVA 1CTOA 5JHDB 4K07A 2WQRA 5K9JL 2VAAB 4ZODA 4CBPA 4HK0A 5C0ND 4DVBA 4P9HH 1R3LA 2BHUA 5I74B 3C5JB 4XVUC 5D9SA 1FIEA 3MJ9L 3SDXF 4HLJA 4WO4A 4PJXB 3EYFA 3TIEB 5FHBL 3S97C 1DTUA 3T2NH 1MPAH 3GSNH 5EFIA 4OD2A 3L9RA 3OKEA 2R23A 3SJVE 2VKXA 4NC1E 4AIOA 2DDQL 4A6YA 4LLQB 2JTDA 3MZTA 3UTPD 5B39A 3IAPA 4M3JA 4JRXB 1C1EL 2ITCA 1RURH 4M5YH 5ECJE 3ARGB 2GTWA 2FGWH 3SCMA 4XVJH 1U95B 4QXUH 2BNRD 3TH4T 3EDEA 5KOVC 4RAHA 4HIJA 1IKNA 1V3KA 2E7MA 4M1CC 4P2OD 4KGLA 1QSFA 2DKSA 4QNPE 3CVHB 4LFHD 5KSVA 3HHRB 3VA6A 5CEYB 4N8VB 5ADOH 1E28B 5EO0A 3NABL 3DUUA 2EIZA 5GSRA 4YQXL 4EI5C 1GOHA 3RFZC 3BZEB 2YEZA 1FV1B 4F7MA 2Z31B 3CXDH 4K9EC 5JZ7D 1WK0A 1VCAA 1T7ZA 1JPGB 4JZOA 3UX9B 1ZHLA 4ZPTA 5L7XL 4I3RH 1U8OB 1Q72L 2W65B 2M1KA 1BVLB 1R0AH 2P8LA 2XZCH 5JW3H 3P0VL 3WHXB 3ECBA 3SKUD 4PJFE 4JFDD 4NHCL 1N7ML 3CVIL 4ODTH 5E9DB 5IGXH 3B9KD 3L3OB 4QRQB 1JGLL 1LO3H 3V6FB 5IKCB 3T0ED 3FL7A 2JJSC 5DI8B 4OZFG 3NPSB 2MKLC 4XVTH 1MRDH 2BCKA 1RZKC 4UTBL 3JTSA 3HAEB 3ARSA 2RAMA 4MZ3A 4OLUL 2MHAB 3L7FB 5IESL 1QRNA 3HNTH 1KCVL 1A4KA 4LARH 5GS1A 4ENEC 3BISA 4OZFB 1T20B 4ZTOH 3BH9B 3F58H 4PGBA 4XWOC 4NZRL 3RVTC 4PJ8A 1B4JL 4G6AC 3IDUA 4PRIA 5E8NA 5BCAA 3VH8B 4TPRH 2YWZA 2X9WA 1K8DA 4GG8A 3SPVA 1BFVH 4Z0XA 3EFDH 3S36H 1CXKA 5A2JH 4N1EA 5C8JB 3RZCB 1KLUA 3CGTA 5F7KC 4M61B 2YD7A 3SE9L 5JHDA 4NQSA 2FX9H 3DRTB 5ID0B 4FFVD 4FTVB 4KAQL 4MCYB 4N1CA 4E41E 1JHTA 1UACL 1FH5L 1EGJA 4LLVA 3THMH 3ZDYE 5JXED 4FQ2L 5E94A 4G80A 1R3JA 3IETB 1GGTA 4M61A 4N8VG 3VGEA 5ELIA 3DX9B 2J88L 1A6UL 2WUCL 1KPUA 4YGVA 1F4YH 3HI5L 3UBXB 5J13B 3RIFK 2R0ZL 4ISVA 3S37L 2AK4E 3BFOA 3C5ZA 4M7ZC 1A6AA 3LQAH 3IETA 1AE6H 3P4NB 4Y19D 3QFDA 2FIRT 4K3HA 2E7CA 3T4AB 5DC4B 3DX7A 4FXKA 4P5KB 2FJGA 4CMMB 4PJAB 5C09E 4F3FB 4R7NB 3MRLA 1A6PA 1NL0L 4OCRL 1A3LL 2Q6WA 2R2CA 1NFKA 5IIEB 1HH9B 5FDWB 3LVEA 5CJQH 2Q8BL 1I1AA 3BIKA 3IJHB 4L8SA 3MFFB 3JZ7A 3PV7A 3A6BL 4CU6A 4X83A 3GNML 4NRZB 5HGGS 3RIAK 4OZ4A 1JNLL 2WWMD 2FR4B 4X6DA 4PYHA 2UYLA 3RUGF 5D1QA 4DJMA 4OF6A 1FQ9C 4HXBH 1WWAX 2E8YA 5BMFL 5HYQA 4L3EB 2VTFA 1PSKL 1YJDC 1U3HD 3TLRA 3D85B 2Q3AA 1X9QA 5EORL 4P2CG 1M71A 3BQUC 5H2BB 2OTWA 3MXWH 1KIPB 3P9MA 3WHE0 5I73C 1MHEB 3MCG1 2PUQT 2XT1B 2AJXL 4XNMB 3SGEI 1X5ZA 1ONQB 2IEPA 2P8MB 2R1XB 4KFZC 4AYFA 4ZOEA 3EDFA 3V4VH 4S1QH 5DD1H 3RI5K 1CR9L 3W82A 2K7QA 4QHLB 1HSAB 3C6SB 4RFNB 4YWGL 1ZEAH 4HDIA 5D1XB 2D2OA 2P45B 1ZHNA 5DMGC 4NFDA 3ZDYF 2X89A 4QXUL 4LDOB 5EN2B 1I7ZB 1FCCA 4CW1B 5A43C 2EDWA 4OLXL 2UUDH 2PKDA 2APXA 3NCCB 3QDJE 1D5ZA 4NO5A 2Z31D 3G5YB 2UVFA 5I1CH 4E41A 5ETUB 5EO9B 4D3CH 4HCRL 3VJ6B 3RA7H 4JPIB 4PGBB 1QRNE 2VC2H 3G9AB 3FTGA 4NO5B 1WBZA 1Q0XL 4HKBA 5DFWH 4WTXA 1AHWC 5E9DD 1L4IA 1BAFH 4U05A 1EAPA 2DL2A 1RZ7H 5IGXL 4Z9KB 3MLVH 3TT1L 2BOBA 1IM3A 4OIAA 2M26A 2ATKA 5GGVL 2VDPH 3FONB 5KANI 2B2XH 4BFGA 1ZLWK 1R3LB 5KZCB 3FQWB 1MREL 5T33H 1P69B 3P2TA 4JM2A 3GI8H 1HHKB 4BQBA 4HJGB 2PN5A 4LBEB 3BDYL 3WMSA 1IM3B 2JJVA 4WFGE 1KPVB 4WFHD 3CFJB 1FG2A 2JLLA 1J12A 2VIRA 4XX1G 2O61B 3HPLA 3NIGF 1MFCL 1JPST 5I2IB 5H37H 5C08E 3WDHA 5J8OA 3RZCD 4LSTL 4Y0GA 4XMPL 5FV1L 2FB4H 4F9PA 3V8OA 4JDZB 4ZUTB 2UZYB 4PRAB 4M1DL 3NZHH 4YHZH 4PJXF 4ZPVA 3BUYA 3NA4A 5I1DB 4YE4L 4BM7A 2UYLB 4BA8A 1BOGB 2HWZL 1RIVH 4U1LB 4E5XB 3SCMB 5ILTL 4QYOA 3QUKA 1JI2A 5TDNA 2X7LA 2VJXA 1JPFA 4ZFZA 2QKIB 2COQA 3H9ZA 5DGQA 2R8SH 5FCUL 3O2DL 3TYFB 3BKJL 4MA8H 2W0FA 4WEBL 4WV1B 2YD9A 5SWZE 5JHDE 3FFCB 5D2NA 4TSBL 1FV1A 5TE7L 3CXHK 1NAMH 4OLVL 2P5EA 5ERWA 1OF2A 1WUNT 1AI1L 1MH5B 3GMLA 3C5SB 5LXGH 4QT5A 1TQCB 4YHYC 1EGJL 5I1HH 4KKCC 2H2PD 2YD8A 3MV7A 1QSEA 1BVLA 1LO5B 2EE9A 2A2QT 1EXUA 2HFGL 1N64L 3NCJL 4G8FB 4D9QE 3C2SA 4WTWA 2YKLL 3BVNA 4WVRA 1REIA 4XX1E 4MCZB 2VLKE 5HD8D 4K3DL 4RFOL 3RJQB 3VRLF 1WAAF 4JCLA 2R56H 2WBJA 2X4QA 1SEQL 2X70B 4ZAKC 1DQQB 3R0MA 5IBLC 5I76A 2UWEE 3HAEA 3HC4L 3TCLA 3T8XB 3IDXH 4X99A 4TRPL 1OAUH 2YWYA 5DHYA 3LKNA 1GGCL 4G8GE 2N56A 1E4XL 3DJ9A 4TUJA 3HG1D 4OKVB 4PJIA 4P4KB 5ISZE 4PJ7A 1OOAA 1A1OA 5IB1B 3JWOC 4PP2B 2CIIA 4HAGA 5C7XL 3QB7C 3HR5A 5F7FA 3IKKA 4LAQL 4I5BB 1HKLL 1JHKL 4HS8L 5EORH 5IVXA 1K8DB 4P23A 2MNUA 2CKNA 5ESAA 5CKGA 2EXWD 2QADC 1YEHL 4QHNB 4NSKA 2OR9L 3ARGD 1QFOA 3RKDD 5GS0D 5IB1A 3ZE0F 3PL6D 1ZS8A 2FEEI 3C09B 2IAMC 5GS2H 4M8QB 2R2HB 5DJCA 2YUXA 3BMVA 1NC4D 4GW5A 1XGRB 3IS1X 1JMZA 1H0DA 3VD5A 3C60B 3U30B 3G5VB 4PJGA 5D8JH 5A40E 1I1CA 2VSCA 4C56D 3MOQA 1AXSB 5DK0B 3QFJB 5L2KA 2Z93A 2NY0C 4ZNEE 1VFAB 1AP2B 5DJ6A 3P9LB 4I77H 3MLSL 4JFPA 4P0DA 3TBVA 2DTMH 2P5WE 3QFJA 4NNXB 4PTTA 2CDEA 2YSSB 1CDIA 1I9IL 3WNMA 1NCUA 2CLVA 3P0YH 5F21B 1X5JA 3Q5OA 4XB8A 2OMBA 2XTJD 3GSQA 1QR4A 1I9JL 4FQHA 3V5KB 4D3CL 3IFPB 1U8NA 5L9DL 4XCCH 4HWZB 3F6LA 5MI0C 2VLRE 4LSVH 2AJSH 1CGSH 2J8OA 5DMIL 3K4DA 4CRPA 2I5YH 3QIUD 3H7LA 5HYJE 1DBMH 1NDMB 3WFEL 3ES6A 5JQHC 4IOIB 3MOBL 5E99H 4WHYG 2BERA 3JTTB 2DM2A 3V4PH 4KMLB 4O5LH 3GKZA 7CGTA 5HVFB 1ZAGA 4K7PY 4MHHG 1JZ4A 1QQDB 4O51B 5GGVH 2D9QB 5H94B 4AEEA 3JTTA 2YXFA 1RUAH 3HI6L 2XQYG 3HZKA 3S6CA 2WAHA 3NCMA 2BSTB 3S5LB 1GGIH 4LGSB 5D7LE 5FUCE 5D5ME 3WS3B 1MCFA 4TNWF 5KSAD 4CVZA 3TYFA 2MCPH 4R96A 5H94A 5I1IL 4M7KL 5DA4A 1DEEA 2AAVA 5CGMA 1NEZB 3QCVH 4QTIH 3ZO0A 3O3EB 2IAMA 5E56A 4LRIC 15C8H 1OAXL 3PWJ