4WFHD

Human traak k+ channel in a tl+ bound nonconductive conformation
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
211
structure length
211
Chain Sequence
QIVLTQSPAIMSASPGEKVTMTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPARFSGSGSGTSYSLTISSMEAEDAATYYCQQWSNSPPTFGAGAKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Potassium channel subfamily K member 4
publication title Physical mechanism for gating and mechanosensitivity of the human TRAAK K+ channel.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 211
sequence length 211
chains with identical sequence F
ec nomenclature
pdb deposition date 2014-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhD02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4wfhD01
3MV9B 5F9WC 3BIKB 5LGJA 4P46C 1MJJA 5GGSB 1X5IA 2NY5C 2NY3D 2EYTB 1CD8A 1UJ3A 5JW5A 1MJ7H 3DARA 4YHIA 1MJ7L 3QDJA 4NNXA 3HNVH 3HNVL 2G9HB 3IFPB 1UH4A 1CYGA 3S96B 1YEEL 1ZTXH 2QLVB 1ZTXL 1BZ7A 1RHFA 1QSEA 1MWAH 1MWAL 1OWWA 1A3RL 1SMAA 5HYSB 3KLAB 3QQ4A 4L8SC 5KSUA 5DJXA 5HYJD 5F7YC 1DFBH 5KSBF 1PKQB 1NGYA 3PL6B 1I8IB 2W65B 2IBBA 4M7KH 1ORSB 4M7KL 3RWEA 1JN6A 3NPZB 1JNNH 4PJ8B 5IQ9A 5AG9A 1JNNL 3RWGA 4D0CB 4L8BB 4NQCB 5C70A 1R24B 2EEDA 2F8OA 2FLBT 1DANT 2BP3A 1AHWB 3QRFM 3QT2A 1IBGH 1IBGL 4H8WH 1NUGA 4H8WL 4S1QH 2ZUQC 3QI9D 4PY8I 4P2QB 1TZGH 1NBQA 1TZGL 2A1WH 2A1WL 2YD3A 1EUUA 4PBXA 2H3NA 1ETZB 3LH2H 3NAAH 3LH2L 3NAAL 5D1QB 4OZGF 1QYGH 1BOYA 1QYGL 5C0CB 1GVIA 4LPXA 4QXTB 1SYVB 4MDJA 1BQHA 3SDXB 4FN0A 3HE7B 1KPUA 1YC7A 5HHMB 4OZHA 3LQZB 4EEEA 2BY3A 1U8KB 4WW2A 4JFXB 3D5OF 3CAFA 4PR5A 3IAQA 1TTUA 2NTSP 2RAMA 3B4NA 3MRMB 2DI8A 2HG5A 3U83A 3TVMB 1KPRA 2QSVA 1UCTA 2HT3D 2B2XH 2B2XL 1TIUA 2ZUYA 3T0VA 2F15A 4FXGA 1C08B 5FYJH 1BFSA 4LCUA 2BZDA 1OY3B 5JQHC 4E42B 2GUOB 1MCCA 2CR6A 4R4BA 3T1FA 3IYLW 4AIOA 5E08H 3VXUE 5E08L 2AXGA 3PWPB 4QGYA 2I24N 3LV3A 3H9HA 4RGOH 3WS6A 4RGOL 4RGNB 3MRQB 4RMRA 2ADFH 3ZE2E 2ADFL 3WO3B 3HAEG 3IRPX 3PWVB 2Y23A 4ZFFB 5L2KD 2Q86A 4J2XA 5DJXB 4C56A 3SE4A 3MUZ1 5AG8A 3B9KD 3IAGC 1VFBA 5DRZB 3U0TA 4PRDA 4ENEC 2EC9U 5EU6A 4Y5YA 5DJ8B 5IQ9B 4JFHE 4ZFZB 2R1YB 3V0AC 3PP3K 3RDTA 3U2SA 4ONHA 5EU4B 3MFFA 2VQ1B 4KWUA 3DOSA 2DLFH 4ELME 2DLFL 1T0NA 4QEGA 2YZ1A 2F8XC 4PG9B 4OD2B 1XGQB 1S9KC 1HHKA 4ZQKA 1QFWH 1WQVT 1QFWL 2DL2A 1U8QA 2AEPH 4J6RL 4Y19B 2H45A 2AEPL 3CMGA 4Z7VB 3RTQA 5IB2B 1A4KA 1MHHB 2R0KH 2R0KL 3PP3H 4P4KB 1WICA 2H32B 3ZKXC 4IRSD 3QI9C 3RX8A 3C60D 3H9ZA 2EDRA 2XTJC 3FMGH 3FMGL 3T0DA 5HDBE 5D7LA 5T3ZE 1RZKC 4YO0A 4PB9H 4X7DC 1IM9D 4PB9L 1CFQB 3MNWB 4Y4KB 3U30B 1B4JH 3PWLA 4KXZH 3O3EA 4YLQT 4CDHA 3EKCA 1OD9A 1NMAH 5C0BD 1NMAL 3PDDA 3RX5A 1N5AB 5DQJA 5HHVH 3SEPA 4QXUL 5HHVL 4HKZA 4LEXH 4MXVE 4KJQD 3RHWK 4AEEA 3F12B 1T2JA 5GGVH 1KT2B 1V7NL 2NCMA 3LPGA 5GGVL 2HT3C 4LQ1A 2P8PB 5CCKH 4XNZB 5CCKL 2EZ0C 2A73A 1G0DA 5HHOD 2WINB 4ZD3H 1YMMB 2LFGA 5J8OA 3MBED 3EZJB 4M43H 1HHIB 1KNOB 3DUSA 4G7VH 1UENA 3KPOA 4G7VL 1RY7B 2IADB 3T4AA 4P0DA 5GRJH 5JXED 5GRJL 3F7VA 1OGAB 5F7NC 1BFVH 1OGTA 2EIBA 3RIFK 1BFVL 4MCYB 3U0TB 4FQQB 5HVFB 3FAWA 2PTTA 4BSJA 3QH3A 2NXZB 4AENB 2FATH 2FATL 4E5XA 4RNRB 2NY2C 1NUNB 1LD9A 5DYOB 3B9KC 3S5LB 1QO3A 4LASL 2NX5D 1YPZE 3W0WB 2FIRT 2WUBH 1KB5A 2AK4B 2WUBL 5DJCB 5I1DA 1MVUB 3MX0A 5C2BH 5F3HA 3S34H 2P8MB 4AEIH 3S34L 3G9VA 3K8KA 1TQBC 4OFIA 3DX6A 3AM8A 3T0BA 1A4JA 4TPRL 3VD5A 4Z7OE 2E7CA 1AQKH 1AQKL 3MROB 4AT6B 2HJFA 1SJEA 3P30L 1U8JB 4PJ9B 1A3QA 1FC1A 5DJDB 3VI4F 3GB7A 3LKRA 1FPTH 1YNTB 2EDKA 3RI5K 4L4TE 3O41A 5F7UA 4LK4A 4IRSC 3C60C 3D25B 1NBYB 2BHZA 3PGDB 1MHPH 5EBMA 2ZZUT 1MHPL 5IMOA 4G8FB 1P6FA 4P5TB 3VGAB 4EQ3A 3L3GB 5GS0H 5GS0L 4F15B 2WK2A 3O4OB 4W4OC 4GRWE 1OCWH 4Q6IC 5B39A 1OCWL 3BPOC 3NN8A 2CLZA 3BSZH 3BSZL 1GPOH 1GPOL 2P48B 3HUJE 5F8QC 4FMFA 3LDBC 5EUKB 4I1NB 2DWEB 4WUUB 4MNQB 43C9B 3FZUD 3FOLA 5SX4I 2H8PA 3MJ9A 5BVPL 1F90H 1F90L 4X4XB 2JJTC 5JW4N 2HVJB 4WTXA 2VXQH 3JWDH 3X17A 2VXQL 3JWDL 2A6KB 2Q7YB 2NXYC 3MBEC 1ZMYA 3UTQA 1VSCA 3IDJA 2AV7B 1XF5A 2APBA 4JR9H 5H8DA 4JR9L 3T65A 4U7SA 2HT4C 4LSVH 5JXEC 4LSVL 2ZOLB 4PV8B 3EBAA 7FABH 7FABL 3TA3A 5FF6A 5DHYA 3MLZH 1EH9A 3MLZL 1N5YH 2C7UB 4EI5B 1N5YL 1Z3GH 3GNMH 1Z3GL 3FOMA 3GNML 3V8OA 1OSPL 4Z7WE 4LMQE 4XRCA 1KIPA 2FJGB 5CAYB 3I02B 3DSNA 1DE4A 3O9WA 4FQXD 3WIHA 2GSIA 1XCTB 2X1PA 3WJJC 4OI7A 3DX6B 4HUXB 3DX7A 3O8XC 4GW1A 2FR4A 4WJ5B 1J0JA 5DZOA 3S88L 1BGXH 2R4SH 4NQEA 1GZPB 2R4SL 1ZWIB 2UUDK 5D7IB 4X6CB 1JV5B 4LSUH 4RIRB 4LSUL 3PHOA 1I7UA 2A9MH 2DJ4A 4IEFB 2A9ML 2FJHB 3P11H 3P11L 3MLWH 3MLWL 1FNEA 4XGZA 1LO5A 4CGTA 5I1HH 4MXQC 3ZE1E 3DV6A 2BHYA 4P4RB 4U1SB 2E8ZA 3HMXA 4ZUWA 1MLBA 5IP4A 3PUCA 4IOIB 3E6HA 5HHPA 2IPUG 4NSKA 2NYYC 3VXRE 4E0RB 3MZTA 4LARH 5IVXE 4LARL 5IG7B 4BH8A 1QLRB 4UDUA 2EIZB 3C6LD 4MDIA 4X9GA 2J8OA 3TWCH 3TWCL 3WLWD 4JFDD 4I3SH 4I3SL 2W0LA 4U1MB 1UWXH 4WDIA 3V6FA 1F4YH 1F4YL 3U46B 4NO0A 1KTLB 3MRDB 5TH2B 5C0DA 4V2CB 3MCLH 4G6KH 3WO4C 1FAIH 3MCLL 1I9JH 2JK5A 1FAIL 1I9JL 4G6KL 5BRZD 4AM0B 2DIBA 1LE5A 4WFFD 3RL1A 5I1GH 2IAND 2CGRH 5I1GL 1X6LA 2CKBH 2CKBL 5CBEA 3SGJA 2OQJB 2O5ZH 2O5ZL 4GG6E 1FZKB 4H0IA 1DJSA 3SCMD 4ODXB 5D93C 1JPSH 1JPSL 2V7NA 4G9FA 1I8KB 4LCYB 2KUTA 5HGAB 1OAXH 1R3JB 1ZHNA 1OAXL 4U1JA 1PZUB 1VADA 3HB3D 5CZXD 1S9YA 4HZLB 3DX7B 5EB9A 2AKRB 1YEIL 1UEMA 1CI5A 4P3DB 4MJ5B 5GS1B 4XMKH 4XMKL 2EDHA 1JI1A 1P4BH 4N8VB 4HIXH 1P4BL 4HIXL 5INDA 3OGCA 1AJ7H 1AJ7L 4I0PA 5A16B 5T3XH 4UV4H 5T3XL 4UV4L 2JE8A 3S36L 3B3IA 4GO6B 2F54A 2GSGA 1YECL 3K8MA 1CICB 3NIDE 5F9OH 3P2TA 5F9OL 3DXAE 3RUGA 5I6XB 2X4SA 3E2HB 4ZTOH 2ZSWA 3ARDC 4JVPA 5E4EC 4FTVD 4KK6D 1RVFH 4NSKB 1RVFL 1ONQB 2DQDL 1KB5L 3BD4A 5GHWH 5GHWL 4MMXC 3MJ8B 1CG9B 3DETC 3TNMB 4QCIB 2BVTA 4PRHA 2AQ2A 2DD8L 1IAII 5ANME 3SO5A 3V6FB 3ZE2F 4F7MB 1JGLH 1JGLL 2X09A 3GSUA 3IXTA 3C6LC 1OPGH 4ZYKA 1OPGL 3WLWC 4IBLT 4Y5VB 5IB1A 1UXWB 2N7BA 3MLVH 2NY6C 3MLVL 5ESQA 4JFEE 4ZODA 1CD1B 4RGMB 5TF1H 2YUWA 5FECB 4R7DB 3BZ4B 3PWJA 5HYJE 4ELMF 4P2OB 4CMMA 1LHZA 1KEMH 1WVZA 4PRPA 4YQXH 1KEML 4YQXL 3O6MH 3U4AA 5IB5B 2FBJH 4KKLD 1UZ6E 2V2WA 4ZXBB 3KPSB 2BSSA 3VFGH 3VFGL 3TBYB 3L9RA 3C5SB 3ILQC 1NFDE 1W8NA 3CSYA 1HDMA 2R1WA 3RPKA 4XT1C 5CGTA 5D6DA 3MOQA 2XQYG 4OIAA 3SCMC 1H8NA 2GTZA 3RWJB 1X6NA 1CQKA 3MJ9H 5LAXB 4LEOB 3MJ9L 3ELAT 2QQNH 2QQNL 2YD4A 4HMEA 5HDBF 5DD5H 3LAFA 1L9MA 5DD5L 1Z5LA 4LSPH 4OZ4A 4LSPL 1LE9A 4CKVX 1EFQA 3HB3C 5CZXC 5INDB 3ARRA 2E5EA 5LKNA 2BHUA 1A6WH 2I25N 1A6WL 4PYHA 2PYFA 2JCCE 4ZUUB 3W82A 1IC5H 1NC4D 3QFJB 1IC5L 2VDQL 2EDBA 2E9JA 5CEXA 5D1ZD 1NEZG 2OMBA 3F7PC 3Q5TA 3KPRB 3H9SD 3RUGB 1CL7H 2ZSWB 1CL7L 4P2CG 3JVGA 3ARFB 3S7GA 1JUFB 2N56A 5T5NF 4OCWH 4OCWL 1Y6KR 4R2GC 4JHAH 2VZTA 3PF2A 3QBTB 4JHAL 4LLVA 1OW0A 1A6VH 3V0VA 1A6VL 3DROA 4IDJH 4GMTH 4IDJL 3WIHH 4GMTL 3WIHL 1QNZL 3WUZA 5DO2D 4KK6C 4IS6A 1TCRA 4KGLA 5FGSA 4LQFL 2L4OA 4NJ9H 3DTXA 4KVNH 4NJ9L 4Y2DA 4KVNL 3IDGB 4I48A 1KIRA 4K7PY 1LO3L 5T5NG 1RUKL 3BD5A 4LCCA 4RFNC 4CW1A 4OIBA 4WNQA 5JHLH 4X7EC 1I4FB 1X5AA 1F6LL 3N1FC 4ZFOA 1DVFB 1PZ5B 1EEZA 4S11A 5C8JB 5L2KE 5IW1B 5C0AB 1JZ5A 1YEHH 4PJ7E 1YEHL 3H0TA 1G7LB 1M71B 1RUPH 3H8NA 1RUPL 3BKCH 1LK2B 3BKCL 4XHJD 3HMXH 5DJAA 3HMXL 1CE6B 4Y8DC 2ZSVB 3EDKA 2ZUWA 3TFKD 1P84J 4OF3A 4JZOB 1FJ1B 4XBPA 3MSPA 1HDMB 2YD6A 5CD3B 1IZJA 1UYWH 3KPMA 1MCBA 4KKLC 1UYWL 2GK2A 4EUPH 4Z7OF 3IJHA 4KMTH 2D7NA 2OTUA 2G2RB 4KMTL 4TQEH 1NFKA 4JHZA 1A64A 1RD6A 5D1XA 3VXNA 1S7TB 1BP3B 3KJ6L 4XZUB 1Z5LB 1T7YA 3G5ZB 4GRLD 4JRWA 4MCZA 5DD6B 2Z35B 4Y4FD 3VD3A 5D6CA 3QIUB 3JWNC 3ILPA 2JIXA 2ZG1A 5DD3L 5CEXB 1TVDA 4U3HA 2BVOB 3QXUA 1NLBH 4BUHA 1NLBL 5FM5O 5F3BB 4RDQF 5IWLA 3O45B 2RJMA 3LKSB 3HG1D 1DLHB 2X4NB 3MLXH 2IGFH 2VLJD 3MLXL 4X9FA 2IGFL 3D3VE 4JDZA 4XB8A 1K5NB 4JFPA 5D1ZC 3WXWH 2EE6A 4HLZG 3R8BB 3HUJF 3QO0B 4ZAKA 5A2IH 2XPGB 4LPUA 5C0BE 3TN0A 3FCTA 1SVCP 2X70A 1P6AB 4UT6H 4UT6L 1S9XB 4KJYB 1UZ8A 5EBLB 1QR1B 4V1DD 4GBXD 2XN9D 1OTSD 5HHOE 2FBOJ 3BWAA 5EZOH 4CW1B 4XP4H 5F1NB 3EYVB 4N8CH 3FB5A 3L5JA 3JV4B 4CVXA 4YIQA 4HEPG 4Z0XB 4DCQB 4XC3H 2B1AH 4JCMA 4XC3L 2B1AL 1ODAA 4Q9CA 1MI5B 2GJZA 3IJYB 3H0TB 2ICWB 4YNYB 2ADIB 5C08D 4ZO6A 3WEXA 4ZUTA 3D2UA 4L3CA 1UB6A 5FXCH 2YSSA 2OLDA 4JRYB 2D7PA 1INQA 2P1YA 4M00A 4M5YH 2FD6L 3NMEA 5I75B 4GMSL 3WFCL 3RKPA 3OV6A 4FZEH 2BY0A 4FZEL 3VXMB 2VITB 3VDAA 3IJSA 5F7KC 3JSSA 1A1MB 4BJLA 3WKMH 3WKML 4HS6B 1GHFL 3TFKC 3X3GH 2ZNWA 3KYOB 3X3GL 1VGEH 1UB5A 4HH9A 1VGEL 1AO7E 3OF6D 1J9CT 2GK0A 3JV0A 1N6UA 1RSFA 2PXYD 3ARUA 4NO3A 2MQ3A 1WBZB 1S7VB 5CLWA 1DN0B 1NCCH 5DA4A 1NCCL 3FRUB 4RX4A 1GGIH 5HGBB 3ZE1F 3ECBB 5GS2H 1VEPA 2AI0H 3MRKA 4P9ML 4TVPL 8CGTA 3NCBB 5E8DH 5E8DL 4GRLC 5E6IA 4Y4FC 1WWCA 3TO2A 4Q58C 3QCTH 3QCTL 3IF1B 1WAAA 4AH2A 1FLRH 2Q3ZA 2VNCA 4JM2D 1FLRL 2BOBB 1GC1C 4LGSB 2OSLA 1I8MA 3QAZB 2HLAB 2YKLH 2C3WA 2B5IB 2YKLL 3L95A 4WWKB 4I5BB 4NC1C 3P40A 2OZ4A 2BSTA 1T2XA 2YUXA 1WUNT 3TBWA 3VXSD 4HMCA 5L2JA 4AZ8A 4OTXH 4YHNB 4OTXL 1NGWB 6FABH 3IXAB 1T22A 2E7HA 6FABL 4C4KT 5BJTA 3CGTA 1OT2A 1AD0A 4E41A 1CXIA 2DKMA 2PO6A 2VQTA 1UM5H 1WC7A 1MEXH 1UM5L 3PQYD 4CU6A 1MEXL 3FT4B 4O2CB 4BQ8A 1OTSC 4U7MA 2F58H 1QACA 2F58L 4G7YH 4NT6A 1PKOA 2YRZA 3CFDA 2ZWLT 3BIBX 2C1OB 3UTSB 1UB6B 1VKXA 1E4XI 4CUCA 5DK2A 4X5XB 3ZTJG 3WS3B 1W72H 1W72L 1CCZA 2VWEC 4XCYB 3T0EE 4K94C 2Q7NA 2A77H 4PRIB 2FJFA 2A77L 3F6IA 3L6FA 5FCUL 4OZGA 1V3JA 3SKUD 3QXVA 4MAYA 5FYLH 3QQ9D 3OTTA 5FYLL 3UAJD 2P5WB 3SGKC 1T89A 3OJMB 2VDRH 3NCMA 2VDRL 1PY9A 4BA8A 2B7DT 1JGEB 5HJ3B 3TZVA 2GTWA 3QUXB 1MCNA 3QHTC 4ZFOL 4ZG1A 4X6FB 1WCQA 2C1PA 1FFRA 1HQRB 1YN7A 3ES6B 2PXYC 5GXBB 4L4VB 1J8HD 5GQBA 4K71C 2Q8BH 5C0EB 1QHPA 2Q8BL 2VN4A 4H25A 2FO1A 1DP0A 1RK0B 1LO2H 4CBPA 3HE6B 1A9BB 3RNQB 1F5WA 2YZ8A 3QEQE 5BCAA 3DSFL 3HAEA 4JZJB 1FFNA 5E5MB 1QP1A 3BEWB 4L9LB 2K1MA 3ARGB 4NUJB 4NO2A 3CDGB 3S36X 1AKJB 4XBGB 2IAMB 1ZHKA 5IESH 5IESL 5MP6H 3MCG1 1H5BC 2LQRA 3VI3E 5MP6L 4I18B 2YUVA 3RVXC 1YNKH 3IVKA 4GOSA 4ODHH 1A6AB 4ODHL 4HPOH 4XCNA 2H1PH 1PYWB 3OHXB 2H1PL 4CMHB 4OBRA 4XNYH 4XNYL 4RAVB 4BSVA 2R8SH 2R8SL 5KSBB 3AS0A 2WMPA 5MENA 1DDHA 1S8DA 3MRRB 3OB0K 2O61A 5BRZE 1KJMB 4L3AA 1IFHH 1INDH 2A38A 2IANE 1IFHL 1INDL 3BP5A 5IFJB 4JAMA 3BO8A 5M94B 1D9KA 3PHQB 4P2QD 4HFUL 3W5NA 1F13A 1NFDF 2I07A 1UXSB 4LSSH 4LSSL 4YHZL 1B0RA 4LPWA 5E1AB 5C0CD 4WI2A 1AXSA 2QKIA 3VXQA 5C6PB 2HFFB 1FVDB 2FWOB 2O26U 3MREA 5MERA 2R23B 5I1AB 5MEQB 3SDDB 2JCCF 1DQTA 1FZOA 2F8VA 3HR6A 5J0BA 1CE1H 1CE1L 4OLVH 3QQ9C 4LF3A 4OLVL 3K8LA 2C3VB 1S3KL 3VFPA 1D5BA 3MLPA 4Y4HD 5DJYA 5KVGH 1MPAH 3JXAA 1MPAL 4LLDB 5KVGL 2CSPA 5JPMB 5JOFB 4N0FA 4H25B 4Y16C 3P9LA 3BAEL 3EJZD 3QJFB 4YHLH 3QDJD 1CT8A 2MWCA 3EJJX 5CJOH 5CJOL 3IETB 3KLHD 5E03A 3DVNB 3MO1B 4XNMA 4MA1B 3HS0B 3U6RB 1QSED 3GM8A 3W9DA 1CLYH 2SEBB 3WFHA 1CLYL 5EU7E 2X5PA 5CS7A 2YRLA 4OI8A 2XFXB 3BDYH 1EZVY 3BDYL 1CD9B 4FG6D 3MR9A 5I2IA 1QRKA 4PJ7F 1ZT7A 1M7DA 2W07A 4UQ3A 2BVQA 4YDIH 2EE9A 4YDIL 4AQ1B 4CRPA 1NUFA 1ZT1B 4HG4J 5DFTA 5DI8A 1BOGB 5I8EB 4J1UB 3DRTB 1AY1L 1ITCA 3FO2A 3KHQA 5IQ7L 1A7NH 4KUCF 1A7NL 5KZCB 1AHWC 2AXHA 5JIKA 3RVUC 2OZ4H 3AFLA 2OZ4L 4H0GA 1RJZB 2Z8SA 4P4KD 1H3PH 1H3PL 4Q9BA 4XAWH 4OF8A 3MRLA 8FABB 5D1QC 3WN5B 3SE9H 3PIQB 4F3FA 1DUYB 3SE9L 4WHTB 1K8DB 5JIHA 1D5ZA 4NFDA 5FA3A 4HBCH 1I1CA 1BD2B 5ACMA 1QVOB 2DI9A 1DEEB 1BVLB 1P9MC 5EC1A 1BJ8A 2R1XB 1SJHA 3ZHLA 3GMNB 4MB3A 4HWEH 4HWEL 2BRRH 4PTTA 2BRRL 1FDLH 3RBGA 1FDLL 3CSGA 1RZJH 1HH9B 1RZJL 3P9LB 1IAIM 5SWZA 4N0CD 1IGTA 4WW1B 1G7JB 3OJDB 3MC0A 4QXGH 4Y4HC 4QXGL 5IBTH 3IGAB 4EOWH 4XI5C 5IBTL 4EOWL 1XF3B 3B2UD 2M2DA 4M6NH 3VGEA 4M6NL 1UJ3C 4YDLB 3EJZC 1BF2A 3BN9D 1LP9E 1YYML 1Y6MR 5JW4M 3FFCB 1HOCA 1T20B 4P2RA 4HUVB 1FNSL 4C56D 3ARQA 2N1KA 4RGNC 1Y6NR 4QHUA 3KLHC 1QKZH 4G3YH 5EU6D 1G7HB 2GJ6B 3TH3T 1R5WB 1CU4H 3LS4H 1CU4L 4ZOCA 3LN4A 4UB0H 1T7ZA 3RDTD 4UB0L 4PJIA 1M7DB 5C07B 2BOCA 3HMWH 3HMWL 4O00A 3VD9A 1SY6H 1SY6L 1LWRA 3GJEA 3AGVA 3P4MB 1SJVA 5FOBA 4RFEA 4FQPA 5JIIA 4S0SD 3M17A 2VABB 3G5XB 5BO1H 5BO1L 3RTQD 4JREB 3HAEH 4O58H 5DHXB 3ZDXF 4O58L 1U42A 2BNQB 1DEDA 1QG3A 5A2LH 5DRNA 1T66D 4L5FH 4ZO8A 4XPTH 3P77B 4XPTL 3LB6D 1HILB 4P57A 1ROWA 3S35H 1ITBB 3S35L 5D7LD 5D70H 1QFWM 4G9DB 5D70L 3V4VH 3V4VL 1Q94B 4YE4H 4P4KC 4YE4L 3BVNB 2XKSA 4JRXA 3QFDB 4QRQA 1U8NB 1HHHB 3FQRB 4OFDA 3DIFB 2ED8A 4W68A 1A1NA 2Z91A 1ED3B 1KLUA 1KCRH 1KCRL 4ODTH 1B2WH 3U30C 4ODTL 1B2WL 1T3FA 4LCWB 1EO5A 1K8IB 3SKNB 2VDLH 4PJ5B 2VDLL 5IEKA 2EKJA 1GGBH 3O2VH 3O2VL 4UIKL 5DUPH 5DUPL 4GUPA 2VLJE 4MNQD 4YHPA 5HYQA 5IT2L 1X5YA 1WFNA 1MHCA 4N0CC 2MFNA 5FDYA 1EAPA 5LCVH 5LCVL 4XNZC 2VIRA 4MB4A 5DS8A 2QJDA 3BP7B 5K59E 3T2PA 3O4LA 3BPLC 3B2UC 4KJPD 2ILLA 3GMPB 4PG2A 4QOKA 4GRMB 4X7CC 4CADA 2F5AH 2F5AL 3BN9C 5BOZG 2X4TA 2XN9E 3G5YA 2IPKA 2OTWA 3AUVA 4TTGA 1MY7A 4RAUA 4IDLA 1NFIB 3FB8A 2CXKA 4I2XB 4K3JH 3C5ZB 4K3JL 2J6EH 5GZND 2J6EL 2FB4H 4EI5D 2FB4L 2AJZA 1Z9SA 4HK3J 2NXZC 5IJVA 1SQ2N 4UT9H 4UT9L 3BRFA 5CFHA 3M17B 5E9DE 1KXVC 1TTFA 4K8RD 2PYEB 4PP2A 5IJKA 1PY4A 3D0LB 1AGCB 5C08E 4EI6B 2WQ8A 1FV1A 1TLKA 4WO4B 4OZIA 4M61B 5DC4B 2F74A 4HD9A 4F8TA 3OMZA 4F80A 5EZJA 2NTFB 2B1HH 2B1HL 1QHOA 1X44A 3K4AA 3VD4A 4HWBH 1T66C 4ZUSB 2F53B 4DGYH 3TBVA 4DGYL 3ZKQD 1NPUA 4MZ2A 4OZFB 5JDSA 4QNPE 1XIWB 1WF5A 4LGPB 2HKFH 3GMOB 2HKFL 2ZPKH 3PNWA 3U0PB 3HRZB 5DA0B 3TBSB 2H9GB 2OP4L 4NCC1 4YWGH 2VDNH 3RVTD 2VDNL 5HGGS 4YHOH 1NCTA 4JE4B 3QB7C 3SJVE 1OAYH 1OAYL 4PRAA 4P5TC 2WIIA 3VXUA 4F15C 3O4OC 4P9HC 5IM7B 1MHCB 5DS8B 5E8OB 4PD4K 4MQTB 3GUTB 1RPQA 5BV7B 5C0IB 4QY8B 1WBXB 3VCLB 3VXSE 1P69B 1MVFA 4YC2B 5I0ZA 2DQHH 2DQHL 5F9JB 5TF0A 5EULV 2MCG1 4GQ9H 3W9EB 4PY7B 4GQ9L 5CBAA 4G43A 3F7YA 1BJMA 1IM3A 3I3EA 4X80H 2ICEB 3X11B 4X80L 3NACH 4IRJA 1MCIA 3NACL 4KH2A 2AQ1A 2R39A 3CZFB 4XVSH 4NZJA 3CC5A 4XVSL 4ELMA 4WGWB 4GXVH 5CKGA 3RJDA 1G1CA 5MEPB 3HZVA 3X13B 1YNLH 5D2NA 3VFOA 3O9WD 1YNLL 2VLKB 2ITCB 3NZHL 3WFEH 5GZNC 2ZUVA 3WFEL 2IFFH 1ULVA 2IFFL 4EI5C 3LN9A 4LPYA 4PJBF 4U1LA 5BVJA 4MA3A 4NQED 2F74B 2X89A 4K8RC 1CQYA 1NEZA 3JTTA 3AM8C 1HSBB 2VR5A 1AP2A 1KLGA 1ZLVH 1BJ1H 2ITDA 1Q9LB 4GKSB 2IH1B 2QV2A 5J6GB 1NAKH 1NAKL 4NIKB 2NW3B 2WWMD 3MRPB 1H3XA 5AWNH 5AWNL 4L29B 5DC9B 2Z31B 3KYMA 3FQUA 4UNUA 3RWCA 1K2DA 4DQOL 4JN2A 2D31A 1CN4A 1R3LA 5GRWA 1J8HE 1ZLWK 3SKOA 2CRZA 2DMBA 2CLRB 2VJXA 1DR9A 1URLA 3VXUB 1B88A 1ZA6A 4NKIL 5FV1L 5D96B 3RVTC 4JM4H 4JM4L 2F5BH 4TTDD 2F5BL 3UP1A 3TIEB 2ADJB 3QQ3A 3O6LH 3FN0L 1NKRA 1I1AB 3AMKA 2DQUL 3D9AH 4F7CB 3D9AL 1D3CA 4RISH 4ZS7H 4RISL 4ZS7L 1X9QA 4G43B 2ZNXA 3L3JA 3LEVH 3LEVL 3EDFA 1EHNA 3QEUB 3TT3H 4IRJB 1I75A 4UNTA 1PJ9A 4TNWF 2DLHA 3DGGB 2UVFA 4PREA 4GLRH 1UH3A 2X7LB 2IBZX 1KACB 3KPSD 3FQWA 3MV7A 4PLKC 1CFTA 4Y88A 1HI6B 4G9FD 1Q9WB 3OG6B 4OCSL 4ZMAT 4F37F 4Q0XL 3B5GA 5F8RC 3AS1A 3C87A 4Q74A 4HHAA 3MRGA 4P3WA 3REVB 1XR9B 1U58A 4PJGE 2EO9A 2CJUH 3EJYC 2CJUL 3BQUB 5HTSA 3JTTB 3QQNA 2XA8H 1QFHA 5I17B 2XA8L 4CDGC 2ZCKH 4URTB 2ZCKL 4HGKC 4MQXD 1KULA 1H15A 5HHQB 4H5SA 1DQJA 2C3GA 5GS1C 1UKTA 2F54D 1J05A 1XF2A 1YN6A 3KYKL 3PXJA 2X4PB 4KI5D 4NUGH 4NUGL 4NQXB 5KG9B 1P53A 1MIEH 3ARFD 1MIEL 4U33A 2XKNA 3MFGB 4HIEB 4QYOA 2DYPA 1TZHB 3PDOA 4M9OA 4UIMB 1P1ZB 2FSEB 4QHKJ 4RWYH 1VERA 3C9NB 4RWYL 2OM5A 4OUUB 3O3AB 4Q97A 5DEGA 3E2HC 2Z8RA 1Q0XH 2OS7A 4PRHD 1Q0XL 4UV7H 1RU9H 2NW2A 3KYNA 4QO1A 1RU9L 4UV7L 3HUJA 3S8WA 1KPVB 3ARTA 4GT7A 3WV0A 1EMTH 1LP9F 3QDJE 4U6YB 4RZCB 1VFAA 1A6PA 2B4CH 2B4CL 2DL9A 1IZKA 4JQXC 3QXTA 3U7AA 5DUBA 3UJJH 2BERA 3UJJL 3SY0B 2Y5TA 2VXUL 4PGEA 4ZSOA 4Z7UA 4ZPVB 4TVPD 1NDGB 4TTDC 2OI9B 3MRJA 1D5XB 4JQVA 3CX5K 3NTCH 2C9AA 3NTCL 3OAZK 2OL3B 3RA7H 2FZ3A 3RA7L 3QUYA 4HJJH 4HJJL 4Y5VC 5I1LA 2ZOKB 1LVEA 3QJHA 4XC1H 2R0WH 2R0WL 1A21A 1XR8B 1YPZB 4WENB 5AYQA 2ADGA 5HDLA 3TCLA 3MODH 3MODL 1V3KA 3VH8B 2IEPA 3N85H 4H1LB 3N85L 4N90D 5DEZA 5CP7A 2CDFA 2GCYA 4ZXBC 4HHAB 3CPLB 4RQQA 4QTHB 1RV6X 3MRGB 3OAZH 3TO4A 3B83A 4TOYH 1ACYH 1ACYL 4JGJA 2YR3A 1EDQA 2LVEA 2EIDA 5I8CB 4NN6B 2YRPA 2VMFA 1P7HL 2APFA 1GRWA 4OZHE 1U3JA 1SMOA 5DRXB 3P4OA 5CWSB 5BZDA 4L4TB 2CR3A 2YXFA 5CZVH 2XWJB 5IVOA 3T0XA 3TC9A 5CZVL 5J06A 2GFBA 1QEWB 3BKMH 2W0FB 3BKML 4QYOB 1N3NB 3S35X 3SE8H 3SE8L 3MGOB 4GRWB 4KI5C 3VXRA 2NNAA 1LGVA 5J11B 1GYAA 4QT5B 1UKSA 1M6OA 3ARFC 4OF0A 3VU2A 2Q20A 4Z7NF 3I3DA 4WFEE 3PJSB 1BX2A 5D7JA 1J86A 3AREA 4Y2DD 1T5XB 1O7SA 1JIBA 3J7HA 5DD1H 4NZRL 5DD1L 4HUWB 5GGUA 3HI5H 3HI5L 1XGYH 1CK0H 4G42A 1XGYL 4DZ8A 1CK0L 4PBVC 1AGEA 3ZL4H 5DGRA 3ZL4L 5ITFA 4GAYA 1YEFH 1YEFL 5IEHB 4PRNB 4APQB 1T03H 1T03L 1P4IH 1T0MB 3BRGC 1P4IL 4FQHB 3ZYJA 1B0GA 1R3HB 5ID1B 2Z92A 3PGFH 3BH9A 4M4PA 2FIKA 3WNLA 3BP4B 4MX7A 1DVFC 3QJHB 4D0BB 4D0DB 5J1AB 1E4WH 1E4WL 2LAGB 1F11A 3PABA 1A2YB 3QNYA 3RVVD 4K7FA 3TCLB 4Z7WB 3VXOB 4YAQA 2VERN 3ARPA 4WV1B 1FORH 3CK0H 5IIEA 3CK0L 4N5UA 1AGFB 1HHJA 3IU4H 3ARBA 1FYTA 5D1XD 4M93B 3H6JA 2WLZA 3GBMH 3GBML 4JZNA 3WFBH 3WFBL 3P9MA 2CUMA 2EDDA 4AG4H 4AG4L 5DFVD 43CAA 4OD1L 2JIXD 3HI1A 4BUGA 5BZDB 4PUBH 5GGVY 4PUBL 3VWJB 3X12A 1XZ0A 5D7LE 1MFEH 1MFEL 4PB0L 1IKNA 5ADPH 5ADPL 1EX0A 3QIUC 5CKAA 4L9DA 3MJ6A 4HCRH 4DFHA 1R5IA 3FHQA 2HJLB 3BUYA 5I16A 1I9RH 2GAZA 2GIYA 2YA0A 4ZAKD 3WE6A 1QR4A 3TN0D 5IVXB 5H2BB 1F3RB 2XKUA 1BBJB 5IVZA 2P8LB 4K9EC 3N1PC 5D7JB 4KROD 4PGCA 1OW0C 1OT1A 4N9GB 5E5UB 1JF5A 3FQTB 1IGJA 2APVA 1MCDA 3HZKA 5E2UH 4L8SB 5E2UL 1UKQA 3AAZB 3V4PH 3V4PL 1LEIA 1N26A 1I85A 4HKXA 1BVZA 3G6AA 3MJGX 2V7HA 4JFEA 3K3QA 3QUZA 4HLZH 4ZPTB 2A0LC 5T3XE 3D2UD 2EDYA 4K07A 1CGXA 1CD0A 1REIA 1KTDA 4N5ED 4ONOA 4UNVA 4K3EH 4GG6B 4K3EL 1J88A 2PR4H 3BDXA 3QNZA 4LVOC 2PR4L 1F11B 3ZT5A 2QHRH 2QHRL 5GRUH 1JK8A 2VAJA 4P3CH 4P3CL 3HPLA 1G9MC 4U1HB 1X3DA 2X6MA 1RHHA 2RQ8A 3QG6B 4MJ6B 1NFDA 5E2WH 1I7ZA 5E2WL 4PRID 4X6EB 2VRAA 2I9TB 3BZEB 1I7TB 5I75C 3RVVC 3C8KB 2A2QT 4IIQA 1VPOH 1VPOL 2P45B 4S1RH 4CVZB 4S1RL 3GMQB 4HKJA 4RX4D 5TDOB 3EGSB 2JCCA 3CNKA 1RZIA 3PXHA 2OR7A 3IFNH 2HRPH 3VFNB 3IFNL 2HRPL 2X4QB 2YBRA 5E6ID 1P7QA 3GBNH 3NIFF 3DXAB 3GBNL 5DFVC 3WFZA 5HY9B 1E27A 4Z78B 4XP1L 1TJIH 2UZXB 3LIZL 1KYOJ 1W0WB 4YDJB 3VG0H 1JF1B 3UZVB 3VG0L 1QFUH 1QFUL 3QDMA 4PJDB 2HMID 3WMSA 2CXGA 3STZA 2V5YA 4OQTH 2MHAA 4OD3L 2NY3B 3W81A 5CSZB 3PE9A 4ZAKC 1S7XB 2B5IC 4BFGA 3I75A 5ANMB 4E41D 5HGHA 3O11B 1U3ZA 4G8GA 4U6XA 1BQLH 1I3VA 1FZMB 1BQLL 2W92A 5C92A 1ZHLB 4O9HH 5EZIH 4ZO9A 5EZIL 2V5SA 1AQDB 3N1QC 2E8YA 1LEKA 4X99B 3ZKND 3MYJA 1TENA 3RL2A 4WI7A 6CGTA 5HYJB 4QRTA 3NZ8A 3KWWB 4A6YA 4H26B 4N0YL 2FLRT 3RU8H 1HYSD 2XRAL 3RU8L 3OXSA 5IB4B 2F19H 1TNMA 2DIAA 5ID0B 1EJ6A 1MFDL 2XNAB 4N5EC 1ZVSB 4PJGF 4MAYD 5B38B 1J5OH 3K2MC 4YBLB 1J5OL 2NY4D 3QI9B 1JHLH 2RIKA 3GMMA 5SWSA 4UI2A 4ETQA 3MRIB 3DUHA 3TZVD 3SDCA 1RQ5A 3CXHK 4OGXH 1U91A 3M1BB 4OGXL 5K33A 5IMMB 5CEYA 1BIHA 4EN3A 3RHWF 3R06A 1BZ9A 1T1WA 5LVEA 1KCSH 5EO0A 1KCSL 1GH7A 1QRNE 2Q76B 1XFPA 3BP6B 3VFVA 2VL5A 4DUXA 3ZTJH 3QUXC 1HK6A 3CFEB 5FGCE 4LU5L 1ZGLA 5J12B 1TETL 5GIRB 3D3VA 2FEEL 5FYJU 3TPUA 5LG1A 5I66A 1G0YR 1DUZB 3J8F7 1NAMA 1KJ3H 3STZB 4D9QD 5IV2A 1KJ3L 4Z5RA 3HE6C 1I7RA 4JLRA 3V6OA 2XG5A 5I8OH 5I8OL 2HMIC 4JZJC 5AUMB 4L9LC 1K3ZA 5FB8B 5TGBB 4HZAA 2IAMC 3KXFA 2PW2A 1TZIB 4NM4H 1WSST 3L7FB 1WIUA 4JFOB 4NM4L 5INCA 4HIIA 1NANH 5MEND 1Q8MA 4C4KO 4I18C 4BH7A 1EIBA 5GSRB 5L2KB 1T4KA 3IDNA 1JMZA 1SVZA 3EYSH 3EYSL 4PJ7B 4UTAH 4UTAL 3T77A 3B6SB 3IDIB 1FG2B 4ORGB 2AERT 3I9GH 1D9KD 4FXKA 3I9GL 3ZDZF 2BDNH 4Z76A 3G5VA 1EEYA 5DJZA 1KEGH 3CFBB 1KEGL 4O2EB 3ZKNC 1CGUA 4EXKA 4OKVA 3RI5F 1TQBB 2AXFB 4G9FE 2HVKA 1KIQA 1HYSC 4WFHD 3EYOB 1D6EA 2PTVA 2K3TA 3VG9C 1J0HA 2H26A 2R2HB 4MD4A 1FGVH 1FGVL 3HPJB 4Z95H 1WWWX 4Z95L 2QR0B 4MAYC 4N0UE 2NY4C 2DQFA 3C60B 5F93C 2BY1A 4YPGB 4LCIH 4U0QB 4LCIL 4LDEB 3SQOH 4AEHH 3W39A 3SKMB 1TVHA 5T1LB 3MCKB 1R0AH 3OKKB 3G04A 3GKWH 3Q3GB 1R0AL 3GKWL 4XH2A 3L3KA 5DJ0A 3HZMA 1CFBA 2F54E 1IM9B 4JCLA 1MFCH 5BW7A 4FRWA 1MFCL 2H6PB 4KPHH 1FNGA 4ELKB 4KPHL 4GAGH 4Q6IB 4GAGL 1DQDH 4M7LT 1DQDL 3C5JA 3SGEI 3OB8A 3SBWC 1MCQA 4GKNB 5C0BB 3L5HA 1BLNA 4RFOH 3EOBA 4RFOL 3H2WA 1KXTB 4FFVC 3GSQA 3A6OA 4LLQB 4L3EA 3LZFH 4YFLI 3LZFL 5J1TC 4NQSB 5IF0A 2FYYB 4PRHE 4ZOBA 5HHOB 2YN3A 4GW5A 3QO1A 4UOW0 2X4UB 2EDTA 3FQNB 3MBEB 4HIHA 3Q5YA 4MA1C 4U6HB 4LAQH 4GAJH 4LAQL 2BJMH 4GAJL 2BJML 4KAQH 1G7PA 1GZQB 3UPRA 3VGGA 5C07D 3LEXB 4R4ND 1FO0A 2G5BA 5HBBA 4TVPE 1EA9C 2DICA 5I1CH 5I1CL 4NCC2 5JZ7D 3PGCB 2YA1A 3OAUH 3OAUL 2FEDC 3L3DA 2PW1B 3UEZA 4PRPE 5HHNA 2Y6SD 3CFJB 2VE6A 3QULB 4KKBC 5KSVB 3SDAA 3H7BB 1FN4A 1VDGA 1MH5B 2YD9A 1S5IH 2VUYA 3T0EA 1S5IL 4NNYA 2J12B 4NDMA 3QWOA 3TYFB 1DLFH 1DLFL 4N90E 1AO7B 4XXCC 1R5VB 4EDXB 3GRWH 3LKPA 3GRWL 5C0ND 1F4XH 1F4XL 1H0DA 3KDMB 4ODUB 3BGMB 2W38A 2C4XA 2BMKA 1IJ9A 1GSMA 3R4DA 4XNUH 4XNUL 5DJ0B 5CGMA 5SWZD 4A6YL 4J12A 4LCWD 1KG0A 1F4AA 4X6DE 3HZYA 4UOW1 3ZDYE 1EAJA 5JIPA 1FFQA 4OLUH 4OLUL 4YHKH 4YHKL 2E9BA 1KF9B 3QEQA 5I76B 2G75A 4DGVH 4NQVA 1MFAH 3OL2A 3RIAK 4DGVL 1MFAL 1S7RA 2DQTH 4KHXL 2DQTL 2UZIH 2UZIL 4JJHA 5C09A 3GJFA 1C16B 1Q0YH 1Q0YL 3JV6B 1ERNA 3EOTH 3EOTL 1AGBB 5FK9B 2VISB 1FL6A 4YDLC 5FYLE 2WW8A 1XGPA 3X3FH 3X3FL 4L8CA 1YY8B 4IHOA 2BNRE 4BFIA 3BD3A 1LO4H 2WBJB 3GIVB 1LO4L 1A1OB 2MMXA 2A9NH 2A6DA 4YEEA 2WAHA 4PS4H 3UJTL 2COQA 4PS4L 5FKAB 5J6HB 3MV11 1NLDH 4Y1AA 1BFOA 2JB6A 5K9KB 1J10A 5D93B 4MVBC 3QZWB 2YC1A 4R4NC 1FL5A 1XGRB 1MLCB 3FB6B 5AAWA 1NAML 3VFSA 4KKCD 2HFGH 3DRQA 2HFGL 5JZ7C 2FO4B 4OCNC 4RWHA 2P5EA 2Y6SC 4PJBA 1HH6B 2O5YH 3MXVH 2O5YL 3MXVL 4JREC 4LHUG 1PX4A 2D7MA 4FQXB 5LWYH 5LWYL 3IFOA 3QDGA 3U4EA 4Z8FH 3SGDH 4Z8FL 4TSAH 4TSAL 4JRXD 3FO1A 1WCBB 2BC4A 5DEFA 1I1YB 3LKOA 1A9EA 4HF5H 2FHCA 3VE0B 1C5CH 3QIWA 1C5CL 1U8HB 3L5WB 4DZBA 4XCEA 3L7EB 1KN2H 1KN2L 1NDMB 2C4FU 3VA6A 1N6QH 4F9PA 1N6QL 4Q9RH 4Q9RL 3HZYB 5DSCB 5F7FA 5IMKB 4MSWA 1ZHBB 1L7IH 3OKOA 1L7IL 3UPAA 1F6FB 1EGJA 4H20H 4EQ2A 4KUZH 4JPIB 4H20L 4KUZL 4NC0B 1Y0LA 4IOFD 1RZ8B 5E8NA 3ROOA 2E3VA 4HW6A 5IFAH 5IFAL 2W60B 4HS3A 2J8UF 3O4LD 1TJGL 4YDKH 4YDKL 1K4DB 1U8LB 3Q2CA 4I4WB 3MNZA 4PV9B 2CO7B 5C2UB 1BFTA 4JFDB 1BVKB 3HCVA 1RIHH 4X4ZA 3D0VB 1RIHL 5CHNA 2I5YH 5CINH 2I5YL 5CINL 5DTFA 1A7QL 1MRFH 5BRZB 1CFSB 2AABH 2AABL 5FO9A 1VHPA 2IANB 5TQ2H 3GGWA 3ZKMC 4WWID 5TQ2L 5ALBH 5ALBL 3V7AE 1KELH 1KELL 4QHLA 3BH8B 3C5ZC 4QRUB 3T2OA 1QD0A 5HYEA 4Y5XB 5I9QB 1GAFH 1GL4B 2E9IA 1GAFL 1RIVH 3TV3H 1RIVL 3TV3L 2EKSB 3PP4H 3PP4L 4S1SH 2AJ3B 3OG4B 4S1SL 4UTBL 3MBXH 4BSWA 3MBXL 4OV5A 2MQCA 2H2SC 2JJSA 1PAMA 4NQDA 3W2DH 3W2DL 5D5MF 4K7PX 1H9VA 2XWBB 4WO4C 1UCBH 3T09A 1UCBL 5F97E 3OJ2C 5C7XH 5H94A 4RBPH 5C7XL 4WHCA 5HI4D 3EO1B 2R29H 1T21A 2R29L 1FL3A 5D7SL 1ZA3A 1AIFA 3PV6A 1OAQH 1OAQL 2PF6A 3MYZA 2AGJL 1SJXA 3GSNA 4MJ4A 1BEYH 2MSPA 2PCPB 1BEYL 5C0GA 1KSRA 4G8EA 1DTUA 3L3HA 4F9LC 1XIWC 3MNVB 5M7QA 5GGQH 3EOYG 5GGQL 4U0RB 1WAAE 3VXUD 3HC3H 3HC3L 4HT1H 1U3HA 3RNKA 4HT1L 2MTPA 1HQ4A 2DM3A 2Y36L 3ROOB 1CXKA 1VESA 5JORA 4JANB 4DVBA 1ZSDA 1YJDH 1YEDB 1YJDL 1LP9A 3EYUH 1MAJA 5KVDH 3EYUL 5KVDL 1I1AD 3UC0H 4Z77B 3UC0L 2B39A 1WEJH 1WEJL 3GMRA 3AY4A 2EXWD 4LLWB 3BDBA 3QIBA 3DV4B 1NGZB 1KJ2A 5BV7C 4FQ2L 1II4E 4IRJD 4NBXB 1RK1B 4AIZA 4QHNA 5DQDH 5DQDL 1Q9KB 2GITB 1S9VA 2OK0H 2UYLB 3ULSA 3VGDA 2RR3A 4YC2C 4PG2C 4EUPG 5H35B 1HHGB 4FQ1H 4FQ1L 3EYFB 1U95A 4CJ1A 1KOAA 3GGWB 4UDTB 3BEVB 1BAFH 3FN9A 2J3SA 4HUUB 4JN1L 4PJXA 3SOBH 3SOBL 1QQDA 1KTKE 5F88A 1U8IB 1JPTH 1MUJB 3ZLQC 2YEZB 4UU9A 1JYVA 3QHZH 4KQ3H 4KZDL 3QHZL 4KQ3L 3U4BH 3U4BL 4XWGH 1PGRB 4XWGL 1NCWL 2BVYA 2QADD 4M1DH 4MHHI 4M1DL 4MD5A 2YS4A 3GJFH 5GJSL 4U2ZA 1ZEAH 3K1KC 1ZEAL 4FABH 3MRNA 3RY5A 4FABL 3RWHB 5FV2A 4DN3H 5E94B 4DN3L 1OF2B 1QOKA 4KTDL 3TT1H 4JFFA 3TT1L 4M02A 4LPTA 1OHQA 3WUWB 2HKHL 5CD5D 1YEGH 1A8JH 4LRIA 1ES0B 1RULH 1RULL 4MAUH 4MAUL 3EDEA 3MV8A 5FHBH 2DQGH 5FHBL 2DQGL 2ZP0T 1NBZA 3FB7A 4XXDA 2ORBH 3AU1B 2UWEA 5GRZA 2ICWI 2DOCA 1NC4B 4X5WB 3FT3B 5HI4C 1G6RB 4P48A 3T1WA 5D1ZB 2JELH 4U1NA 5J1SC 3WHXA 3BPCB 1X5XA 3NCYP 5ICXA 4QRPE 1HQ4B 3RGHA 4PJEE 1XH3B 2HH0H 2HH0L 4WTZG 4CN4A 3SQBA 1DSFH 2HFEA 1DSFL 1FVEB 3ESUF 4FFWD 4JQIH 4D9QE 4JQIL 4XWOC 1IEBA 4Y4HA 4HIJB 4TUKH 5D96C 1CLZH 1C5DA 2CDGA 1CLZL 4IMKA 3ARYA 5J7CC 2YPLA 3MRBB 1F58L 5HPMA 1I1AC 1RJYA 1MF2H 1MF2L 1A3LH 3HC0A 1HXMA 1A3LL 3BMWA 2DJUA 2EXWC 3LKQB 5IFHH 1U95B 5IFHL 1DBBH 4DVRL 1NSNH 5MENE 1NSNL 4IRJC 4P5MB 2EDNA 5EN2B 4M8QB 1TVBB 5ICZA 4HJGA 1NC2A 5E9DA 4ONFH 3ETBF 3ZYOA 1EUTA 4MWFA 4ONFL 4TN9A 3MA7A 1RUQL 1EGJH 5LXGH 1EGJL 5LXGL 3LQAH 5DQ9A 3LQAL 1Y18A 4XPBH 3S4SB 1IGIH 4OT1H 4XPAH 4OT1L 1MFBH 2DWDA 3RRQA 1MFBL 4U6VH 5J13B 4U6VL 2DBLH 2DBLL 3MV9E 4R7NB 4LPCA 4W4NA 5EFIB 4NPYB 4KKAD 4KV5F 4WFHE 1U8PB 3AS3A 1MCEA 1OB1A 3NFNB 3TJEH 3TJEL 1XGTB 3S97C 3BQUC 1MWAA 4OCXH 1EVUA 4OCXL 3DPBA 1JTPA 4MGXA 4EVNA 1MCLA 3LSOA 5L8LB 3N50A 1EV2E 4NP4H 4NO5A 4GRLB 2DYPD 3O2WH 3T3ME 3O2WL 1W0YT 4X6DF 4F2MA 5I19H 5JHDA 5HSFA 5I19L 1G84A 4HV8A 2DF3A 5CD5C 3QUKB 2Z93B 4HMDA 5DDHA 4LBEB 5F6HJ 4KJWC 4X7FC 4LLUB 3SJVA 3IS0X 4ISVB 4K55A 3KPQA 1TXKA 3HG1B 4MQ7B 1LO0H 1AGDA 5JNYB 1LO0L 3BW9A 2VLJB 4Z0BH 2I60H 4Z0BL 2I60L 1ND0B 3REWA 2GY5A 4JFYA 3VWKB 2VZVA 1CIUA 3E6FA 4R0LB 2EICA 4PLJD 4NFCA 1F6AA 2J5LB 1G7IA 1JGDA 5DHVB 1KJVB 1JPGA 4KDTC 1EJOL 3GM0A 5LGHH 5LGHL 4V1DB 4GBXB 2XN9B 1RJYB 4OCMC 3QUYD 1GIGH 3GSOA 1GIGL 3IU3A 1Q72H 1Q72L 4D9LL 3SDXE 2MKWA 4LLMA 1WFOA 2OI9C 5D8JH 1A6UH 5ISZA 5D8JL 1A6UL 4KRMB 3RWDB 4AIXA 1CLCA 3OQ3B 2IALA 2EC8A 3EZ8A 3NGBB 2AJYH 2AJYL 3WNKA 1NC2B 5E9DB 2RB8A 1EEUA 5C08B 5EIIB 3TO4D 1OD7A 3QPQD 4X7TA 4KK8C 3G6JF 3QA3A 2A83B 2EEBA 4POZD 2CLVA 2BNUB 3RJQB 4J8RB 2DM7A 5E5RB 3OR7B 3NFPB 1Q9OA 4OV6F 4BZ2H 4BZ2L 1KJ2H 1KJ2L 3GDBA 4GFTB 3V9FA 5DMKA 1PQZB 2ED9A 1XEDA 1A6ZB 3PWPE 3TP4A 2EXYC 2PXYB 4V2BA 1F3JB 1RMFH 4NYLA 1RMFL 3VGBA 2VKXA 3BHBB 5SX4H 1CDIA 1WLHA 4F33A 12E8H 2EYRA 5JA9A 12E8L 1VACA 2P42B 4JHBA 3F6LA 4YHML 1WBYA 3VXRD 1V05A 5C86A 4OJFL 5BZWA 3SJVB 1BIIB 4R3SB 5SWZE 1X5GA 5D7JD 3KPLA 4C57C 3BW9B 5DK0A 4F7PB 1X7QB 5JW3L 2I9LB 1IE5A 4BQCA 1T6VN 4HDIA 4JM2B 4JFYB 5J11C 3E6FB 5KS9F 3D69B 1J8KA 3VXSB 5T1MA 2K7PA 3P4NA 1ZLSL 2CDEB 4KY1H 3ROLB 4KY1L 2P7TB 3ZT7A 4P2RE 4CNIB 4U1KA 1B6UA 3JWOH 1T83A 4JDVA 5F1OB 3JWOL 5KANG 2DLEA 4C54A 3GSOB 2ATPB 1KXQE 5SV4A 3UTTA 4L8DB 4APQC 1IEAB 1OL0A 1VGKB 4JQVC 1WIOA 2X4RA 1HYRC 4PJIE 1EFXA 5IR1A 2DLGA 4JG0L 5JDJA 3QUYC 2FX8H 5JW4Q 3RAJL 5I1JH 5CUSH 5I1JL 3V6ZA 1XF1A 1SEBA 2NLJB 4FQCH 3P9WB 3ARBD 1FYTD 3EFDL 5C0JA 3I6GB 4DK6A 3Q5OA 3TBTB 1D5IH 1D5IL 2LE9A 3F5WA 4P46A 2AV1A 2VH5H 4DFIA 2VH5L 1SYSB 4LLYB 4NN5C 4WV1C 5I1IH 5I1IL 1H3VA 4I3RH 3FO9A 1JL8A 4I3RL 2FGWH 4NNPL 2FGWL 4QWWD 3TCXA 4NRYB 2CUHA 1A6TB 1Q9OB 1G7QA 5ESVA 5DMKB 3D18B 3MUGB 1LQSR 1FAKT 3LRSA 2UZYB 1EZVX 2IH3A 5KSAB 4HKBA 4ZFGH 4HK3N 4G6MH 4ODWA 4ZFGL 4G6ML 3HTLX 3VWJC 2X4OA 4ZS6C 3AB0B 5F89A 5GGSY 5T3ZH 1ORQA 1DBJH 1DBJL 1OGAE 1J8HB 3JTSB 3BKYH 3BKYL 3CLEH 3CLEL 4OM1H 1A02N 2VLRA 4KMLB 1P4LB 1WJ3A 5AZ2H 5CSGA 1IVLA 3LN5A 1KLFA 4PTUB 3VJ6A 4PJAE 4FQLH 1B3JA 5FYKH 5ECJE 5D7JC 3I85A 5FYKL 5T1MB 3TIDB 32C2A 2LU7A 4GXUM 4GS7B 1HXYA 5IUSA 2GHWB 1ZLWH 2HFTA 2ZUXA 5HVWA 3GSRB 3O4LE 4A2LA 4JFED 3QUZD 5EO9B 1Q38A 3OR6B 5BS0A 4QOKE 4WU5A 4HGWB 4PP1D 3MRCB 1DFBL 3ALXA 2OJEA 3VFUA 3AC0A 3IKCA 3OKDA 1FSKB 1HE7A 1S7QA 3LQMA 3NCCB 1OVZA 1V3LA 4NWUH 4NWUL 3KPPB 5JLZB 3U9UB 5F7DA 1IAKB 4P49A 5C9JB 3GSVA 2ATKB 2L7JA 4S1QL 4F7EA 4JY4A 2XICA 4PJGB 4UQ2A 5F21B 1GXEA 1CS6A 1RI8A 1IQDA 5DMIH 4O51B 5DMIL 3H9YA 1B4RA 4OZIE 1YZZA 2EECA 4H1LH 1S7SA 4K3HA 4EBQH 1A7RH 4EBQL 1A7RL 3GHBH 4YXLH 3ULUH 3ULUL 3GHBL 4YXLL 1AD9B 4NRZB 3ULVH 1W0VA 2FH6A 3ULVL 1XCQB 2DIJA 4UUJB 3I6KA 2PNDA 3M45A 2A6JA 3OKEA 1IAIH 1IAIL 2X1OA 3SKJH 1KGCD 3H3BC 4QWWC 3SKJL 3MUHL 3QXDA 1EXUA 5IMLB 2UY6A 3QDMD 4NKOB 1AE6H 2XACC 1AE6L 1FFOA 5HPOA 4IMLB 2GT9B 4Y4HB 4BELD 4CL7A 3UBXG 3HFMH 3HFML 5FYJL 2DM2A 5LGJB 2DBJA 4PJEF 5A3ID 1MJJB 3EFFA 4OI9A 4IJ3B 5CLTA 1UJ3B 1NJ9A 4J3SA 4AJ0A 2VAAA 5JW5B 1QSFA 4YHIB 4KRNA 2E6PA 3ALPA 3QDJB 1KFAH 4YR6A 4KTYA 5CJXC 3VJ6B 1YEKH 2V2TA 1YEKL 3QUMA 1FBIH 3UPCA 4NNXB 1FBIL 1S9WA 5EOCH 3X14A 4H88H 1WWAX 2NY3C 5GRVK 2D0FA 2ZCHH 1BZ7B 2ZCHL 1QSEB 3DUUA 2BSRA 4XMPH 4XMPL 4YZFE 1NCNA 3AXLA 1HEZA 3Q6FA 4J7RA 3QQ4B 3JZ7A 5KSUB 1BREA 1I8LA 1NGYB 5T1KA 1I85C 1OARH 3T8XA 1OARL 3RWEB 3OKDB 1JN6B 4GKZA 3RWGB 3GI9H 4AK1A 3QUZC 1EO7A 3WYRA 1A7PH 4KUCD 1A7PL 1JYNA 4CU7A 2HN7A 3JUZA 4PJHA 5JXAH 5D2NE 3UJIH 5JXAL 1XAUA 3UJIL 1KIUA 4HGMA 5SWSD 4HSQA 4QHMA 1BJ1J 1HZHH 3SDCD 1HZHL 2H3NB 1JZ8A 1HKLH 4OLZH 1HKLL 4MDJB 1BQHB 2BVPA 3WDIA 3DNKA 1KPUB 4YBLC 4OZHB 1BQUA 2A74A 3A6CH 4GG8A 3A6CL 5EORH 3O3BA 5EORL 4WW2B 3IDYB 4PR5B 3VFRA 5T1LD 1PW3A 3CVHH 3CVHL 3T3MF 1CTNA 1S78D 2HG5B 2CKBA 3D3VD 1KPRB 1ZANH 4NQUA 1ZANL 1ZOXA 1B4JL 4C83A 3S37H 3S37L 3AMLA 4YBQD 4ZDHA 4JFZH 4DOHE 3VW3H 4FXGB 4JFZL 5BMFH 2KKQA 3U36A 3BMVA 5I71C 3VW3L 4LCUB 4X8JA 3VRJA 2V5MA 5J12C 4RMTA 3EFFB 4LEXL 2KPNA 3B9KA 35C8H 4R4BB 3T1FB 35C8L 3CX2A 5ETUA 3P0VH 4MLSA 1FLTX 1X5FA 4XP9H 2NY5H 1IILE 5HYSG 2NY5L 2DTMH 2DTML 4ZD3L 2AXGB 3BPLB 4O02H 3KPNA 1CDGA 1P2CA 3H9HB 2IBGA 3LV3B 2GY7B 3WIIH 4M43L 1KTRL 1PEZA 1IARB 1U92A 2Q86B 1PLGH 4C56B 5FM5M 1T0PB 3SDXF 4OLXH 4OLXL 2BVUA 1VFBB 2VR4A 4PRDB 1FNAA 4ACPA 5EU6B 4R96A 4Y5YB 2P46B 4IRSA 3RDTB 3U2SB 3FONA 3HNTH 4ONHB 3HNTL 3MFFB 1PSKH 1PSKL 5EC2A 4LHUA 1T0NB 3FFDA 3MV7E 2V6HA 3D39A 4POYA 5C2BL 1HHKB 4ZQKB 1AO7D 4W4OA 4AEIL 1LNUA 1QZ1A 1U8QB 3RTQB 1A4KB 1I3RA 4X7SH 4X7SL 1BPVA 4XVJH 4XVJL 1OTTD 5ESAA 4LVNB 4P23A 3PV7A 3BESR 4GW4A 3TM6A 1CGTA 1G9NC 2JJTA 1FPTL 4JY6A 5D2LA 5D7LB 1CWVA 2EDFA 3P73A 4YO0B 1Q1JH 3PWLB 1Q1JL 3O3EB 1FFPA 3DBXA 5HVHB 4HWZA 1O5DT 1ZLUK 5JXEA 1I1FA 3BPNB 1S78C 5DQJB 4HKZB 4L3ED 3L3OA 5A2KH 5FUZH 5J89A 4YBQC 5FUZL 2VUOA 2A73B 3NABH 3NABL 1GCFA 1QBBA 2A6IA 2J8UA 1VFUA 5T33H 4KJQC 5T33L 3WJJA 2CK0H 2CK0L 3DUSB 3IDMA 4PGDA 2NX5A 1J0KA 3KPOB 4HUMB 1HIMH 4RMVA 5A1AA 1HIML 3O8XA 3VRIA 3T4AB 1M05A 1C12A 4Z7VF 2XTLA 2WBJD 3DMMA 3F7VB 3CUPA 2J1KA 4ZSOE 4Z7UE 5FDWA 1OGTB 4OBSA 3IAPA 4KTEH 4KTEL 2PTTB 3QH3B 4PJIF 5IW6A 3QDAA 3B5TA 4E5XB 2R0ZH 5LJYH 2R0ZL 3RBSA 1LD9B 3OX8A 3SDAD 4KHTH 4KHTL 3FFDB 1QO3B 3ZT6A 1FNFA 5EU5A 3T0ED 2G5RA 3WIFA 3GHEH 3GHEL 1B9ZA 1KB5B 5FGBC 5I1DB 1PD6A 3EO0A 1EHXA 5MHSD 5H37H 3WL9A 5F3HB 4D3CH 3O6FA 3T08A 4D3CL 2FECI 1RURH 1W8OA 3Q6GH 4U31A 1RURL 3Q6GL 3QUMH 3QUML 1HNGA 5KJRH 2ESVE 4U6TA 1A4JB 5EUOA 5D5MA 2AVGA 3NOIA 3OSKA 1BGXL 1SJEB 2HJFB 3ISWA 5M95B 5CZKA 3GB7B 3LKRB 5C0RH 1QRNA 5C0RL 5L7XH 5L7XL 4S1DD 1S7WA 3O41B 3EHBD 5I1HL 4HJ0D 4NZDA 3OKNA 3VMNA 5EBMB 1RZKH 3QEHA 1RZKL 3QEQD 2OXGA 5IMOB 3LD8C 1N8ZA 2ICES 3G9AB 3UZQA 1E28A 3QCVH 3QCVL 1J12A 2D9QB 2UUDH 5C09D 5B39B 4OFYA 3L3OB 1PG7H 1PG7L 3NN8B 4HX1A 5E6ZA 2CLZB 5C0AE 4PJAF 7CGTA 1K4CA 1WZ1H 1WZ1L 4EUPA 1E4XH 5CMAA 4G6FD 1E4XL 4Q2ZA 3FOLB 1E4KC 2H8PB 4EIGB 2BCKA 3DMMB 3G08A 2Z8WC 3S5LG 1E0OB 3FZUC 3UTQB 3RZCA 4MJIA 4W81A 3IDJB 3OKMA 2CGRL 4QF1A 4Y1AD 5IW6B 5C71A 1XF5B 3T65B 2DMCA 4YH6A 2WBJC 4TUOA 1CBVH 1XGUA 1CBVL 2D7QA 3LHPH 3WLBA 3LHPL 3TA3B 3ARSA 5FF6B 2NY0D 3LKNA 5DHYB 1G9EA 3FOMB 2XWTA 1LEGA 1XF4A 2V17H 2V17L 3ARDA 5IB3A 1CGWA 2WP3O 3FHAA 4XRCB 1KIPB 4B41A 4PBWD 1ZGLM 1DE4B 3O9WB 3CFCH 2GSIB 4LGRB 2HA1A 1T1XA 1FGNH 3QDGD 3GSWA 1FGNL 4OZIF 1FYTE 3T0EC 2QQKH 1KV3A 1FCGA 2ARJA 2QQKL 3JV5A 3Q0HA 4GW1B 4OLWH 4OLWL 5EPMA 2FR4B 5E2TH 5E2TL 2BXZA 4NQEB 5SX5K 2XYCA 4FQXC 4N0UA 4XX1G 3DURA 3QIWD 5SWQA 5B8CA 3MRFA 1CXEA 2MKLC 3PHOB 1I7UB 3WXVH 3WXVL 3GSXA 4OF6A 1FNEB 1IC4H 3C6LA 4XGZB 1IC4L 1LO5B 4QKXB 4LSDA 1SHMA 4K3DH 4K3DL 5FGCB 1NKOA 1T5WA 3DV6B 4WTZA 3MMEA 2KDGA 5EOTA 3TESA 4ZTOL 4ZUWB 1MLBB 3E6HB 5HHPB 3CXDH 3CXDL 1HSAA 2NY1D 4MNHA 2LVCA 4HJ0C 3RX7A 3UZEA 3QRGH 4P5KA 4MJ2A 4WI3A 3QRGL 4BH8B 4W70A 4XPFH 4XPFL 5B3JF 4UDUB 3DGCR 2DKUA 4MDIB 5KN5A 3LPFA 3U79A 4LSTH 2VR9A 4LSTL 2HT2D 1U8OA 2IPTH 2IPTL 5ERWA 2X1QA 4WDIB 3B43A 5L0QB 1T6WA 4YZFF 4NO0B 3EYQD 2Z9TA 4XVUD 4U1IA 5C0DB 2JK5B 1LE5B 3EOAA 4WU7A 3GO1H 3GO1L 3RWIA 5BOPA 3RL1B 3D6GA 1JPFA 5FO7A 4LKXA 2ZCLH 5CBEB 5D7IF 2ZCLL 4X6CF 2Z4QA 5TF1L 4UINH 4UINL 5D7KD 2WZPD 4HUNB 3V5DA 3O6ML 3QWRA 5CJ5A 2FBJL 2EDJA 5ILTH 2R56H 2R56L 2DRUA 2V7NB 4G9FB 2Y7QA 1E6OH 3LRGA 4Y5XC 5I9QC 1E6OL 5KBNC 4R90H 4NQDD 2ARJQ 4R90L 3I2CH 4X0KA 1ZHNB 3I2CL 1OP3K 4U1JB 2NY0C 3DX9A 1VADB 1S9YB 4WTWA 1DBAH 5GSVA 1DBAL 1MY5A 3ZHKA 5GZOD 5JR1H 5JR1L 2E9WA 4FTVA 1MOEA 4NBYB 4Z18A 2YA2A 5D9SA 1OM3H 3V5KA 5SWQB 5B8CB 1NGXA 1JHKH 2VSDA 5E8PA 1ZT4A 1JHKL 4HS8H 1WZLA 3OGCB 4HS8L 1J1XH 1MCKA 1Z9MA 1J1XL 1YQVH 1YQVL 4QRSA 2ID5A 4I0PB 5AD0A 3RGVA 1OP3H 3B3IB 3OAYK 2F54B 2GSGB 4X6DA 3QPXH 3RWFA 3QPXL 5JW4R 2LV4A 2X4SB 2EYSA 2P24A 3VFTA 1IT9H 1KGCE 2BSED 4F9PC 4DW2H 1JFQH 3O3DA 1R3KA 4LMQI 1JFQL 4DW2L 5J3HD 4DKEH 3QDME 4DKEL 1IKFH 3FT2A 5FGRA 3QNXA 4JJ5A 3BN3B 3FTGA 5F1KC 1N64H 1W72A 1N64L 3MLTA 3Q1SH 4TVSa 3Q1SL 4U0RC 4NRXA 1ADQH 1ADQL 3QWQB 3V5HA 4J3OC 4PRHB 1HNFA 2FDBP 2EH8H 3QIBD 2EH8L 1ZS8A 1QFPA 1DQMH 1DQML 3ET9F 3GSUB 4O2FA 4G8GE 4JGMA 2R2EA 3IXTB 4ZYKB 3MGAA 2BNRA 1LK3H 3EOAB 5JHLL 5EU7C 1UWEH 4QRRA 1UWEL 1WT5C 2ZJSH 5DJ2A 4OCLC 2HT2C 2ZJSL 3MRHA 2MQ0A 5IB1B 5ESQB 4I9WE 5TQ0H 2ENSA 5TQ0L 3EYQC 2P5WE 5DRWA 3W11D 2IQAA 3PWJB 1IC7H 3P0GB 4CMMB 5HGDA 2XV6B 4PRPB 5BXFA 1PEWA 1ACZA 3CH1A 2V2WB 2BSSB 1XT5A 3FAXA 3L9RB 1UJTA 1M7IA 4L4VE 4G8IA 4BZYA 1A14H 1T04A 2R15A 1MHEA 1QSVA 3CSYB 4N8VG 2R1WB 3C6SA 1RJLA 2UVEA 5HI5D 4OLYH 4OLYL 3H9SA 3G6JA 4NCDA 1WTGT 4PRBA 5AAMA 2GTZB 5SWSE 4TQEL 4F7TA 3P4LA 1MCWW 2VQUA 1IAOA 5DJ6A 2Q6WA 2WANA 3MV8D 1CDUA 4OZ4B 1NGXB 1LE9B 4LOUD 3TNNA 3OKLA 1H3UA 1UG9A 2EDOA 2WQRA 5GZOC 2KL6A 4XB7A 2PYFB 5K9OA 4YGVA 4NM8H 4NM8L 1NCUA 5BQ7A 1C7SA 5JTWA 2HLFD 4G80A 1WTLA 4LVHB 2Q8AH 2Q8AL 3VFMA 2FL5A 2FX7H 3CCHA 3GMLA 2LABA 3VWKD 4LLVB 1FCCA 3WXWL 3IT8D 2M1KA 4M7ZB 1FVCA 2GJJA 3V0VB 1S7UA 3DROB 1Z9LA 3WSQH 3I6LD 3WSQL 1T1ZA 3T4YA 5ICYA 5KS9A 3V6OE 5J3HC 4IS6B 1A0QH 1TCRB 1A0QL 3DTXB 4Y2DB 4I48B 1KIRB 2V2XA 5FUOH 5FUOL 1I3GH 1I3GL 4LCCB 3BXNA 2R2EB 3KXFE 4Z7UF 5EZOL 4WNQB 3BZFA 4XP4L 5DO2C 4N8CL 5J56B 1FE8H 1LMKA 1FE8L 4AEFA 4ZFOB 1JWUA 1EEZB 5IK3A 4LVOB 2HJKA 4M3JA 3STLA 1NC2D 2IJ0C 5E9DD 1T80A 1C7TA 4G6JH 4G6JL 3RKDD 4QXWA 4JFQA 1DQLH 5DJAB 1DQLL 4KGJA 3HLAA 5FKPA 4Y4FA 5I30H 3W5MA 5ENWA 5I30L 4M5YL 1GGYA 1NCAH 1NCAL 3PWUA 4XBPB 3NCJH 3NIGE 3NCJL 2DMKA 3C6SB 2DQEH 4XHJC 2DQEL 5JPNA 3ZDXE 3BYYA 3KPMB 3IJHB 4M6MH 2OTUB 4M6ML 2DTSA 2UV3A 1G7MA 5D1XB 3VXNB 4EXPX 5J13C 5EU3A 4UZGA 4BM7A 4HFWA 4MCZB 1L9NA 5D6CB 1QA9A 4A2MA 4PJCE 5JHDD 3ILPB 3T3PE 2JIXB 1GGIL 3F58H 3O6KH 2AI0L 3O6KL 3SJVD 1JWMA 4LOUC 1U93A 2FL5B 1JP5A 4JDZB 3K0WA 2YOCA 4JFPB 4MD0A 1X4XA 1WZKA 1YDPA 2HLFC 4XNXH 4XNXL 1QLFA 1FVCB 2R2BA 4ZAKB 3T2NH 3H3KA 3O81A 3T2NL 3TN0B 3FCTB 2X70B 3BGAA 1VFMA 3INUH 5IBUB 1O0VA 4NHCH 4L3EE 2B8OT 4NHCL 1UZ8B 3RZWA 4KROB 3ZSSA 4LKCA 2V2XB 3VWKC 4R0LC 3BFOA 3BWAB 2J5LC 4TNWK 3LEYH 3KHOA 3LEYL 4X4YA 4GKOA 4PFEA 3SGKA 3CFKA 3FB5B 4IMKC 1D5MA 2Z8VC 1PG7X 5ISZD 3MJ7A 2YXMA 4CVXB 1JNLH 2CIKA 1JNLL 4YIQB 2DDQH 4GBXC 2DDQL 1JI2A 1U9KA 2GJZB 1CLOH 3TH4T 4BKLA 3BIAX 4G7YL 5FYJD 2ZUUA 5C3LD 4LDLB 3PWNA 4AQOA 1JHTA 3UDWC 4ZUTB 3WEXB 3D2UB 1VENA 4L3CB 2YSSB 3WHE0 4XNQA 1YMHA 1INQB 5DXWA 3NGBC 4X4MA 1CF8H 4U49A 1CF8L 1UQSA 2VZ1A 4O5LH 4G5ZH 4O5LL 5FA4A 3IJSB 1DQQA 3RKDC 5A2JH 1DN2A 2YPKA 5MHSE 4IM8A 4P59H 3STBA 1UB5B 4HH9B 3THMH 5EBWA 5C0FA 3THML 5KVFH 5KVFL 2GK0B 4CVUA 4U4BA 4NO3B 5KSAD 4WFGD 1H5BA 3DVGA 3C09B 4HQQH 4X98A 1QA9B 4ZUVA 1IL1A 4HQQL 3UBXA 4YDVA 3P0YH 3P0YL 5TJWK 3FFCE 3MRKB 1CZ8H 2CIIA 1CZ8L 1RUMH 1RUML 3ARZA 5D71H 5DD0H 5D71L 5EZLA 2O93L 5E6IB 1F97A 1SY6A 4MHHG 3TO2B 2VN7A 2IG2H 4EKXA 2IG2L 4HC1A 2CH8A 3E3QC 4AH2B 1LO2L 1S5HA 5K9QG 4QRPA 3OXRA 4RSVA 4PJEA 3RVWD 2OSLB 1I8MB 2AEWA 2NQCA 5GJTH 3L95B 1U8MA 5GJTL 5E8EA 2BSTB 3TBWB 4LSQH 4H8WC 4LSQL 5EH1A 4TUJA 5L2JB 1WK0A 5C09E 4MNGA 4JM2C 1T22B 2D7OA 1BWWA 5BJTB 1FHGA 1UVQA 1AD0B 4E41B 1BF8A 3UYPA 4DUVA 1YNKL 2PO6B 3UTTD 4HPOL 3UO1H 1M7XA 1F4WH 1N59A 1WC7B 3D85A 1EFXD 5FUCE 1V8HA 3OWEA 3VXPA 4NT6B 5F1IA 5E00A 2KQMA 3CFDB 3HR5A 1TNNA 4Y1AE 4NKMA 4NHUA 1VKXB 4POUB 5CIPA 5FHAH 5FHAL 4Y16A 1D7FA 3BJ91 5DK2B 3VG9B 3RPIA 1MRDH 3WNNA 3LCYA 1FZJA 2YWZA 3CSBA 2FJFB 3OB0H 3MV9A 2P5EE 3L6FB 3BIKA 4OZGB 4PJBE 5GGSA 4MAYB 2EYTA 1H8SA 2NY4B 5EG6C 4Z6AT 3QDGE 3UYOD 2PETA 3TZVB 2HTLD 2GTWB 2G9HA 3IFPA 2V9TA 3S96A 3UAJC 1MRCH 2C1PB 4M1CD 4DKFH 4DKFL 3KAAA 3N0PB 1YN7B 5KTEH 2UY7A 3ZE0F 5KTEL 2J6EA 5KSAC 3K1DA 3C8DA 2X10A 5HYSA 2QSTA 3KLAA 2VLRD 1R6VA 3AB0C 4KRPD 1PKQA 3PL6A 1I8IA 3MLSH 2W65A 3MLSL 4PJEB 4YHLL 1ORSA 4RA0C 4YJZL 4PJ8A 4D0CA 4L8BA 5FIEA 2QSQA 3HAEB 1FFNB 4NQCA 1R24A 1GC1H 1GC1L 4NO2B 5I73B 1AHWA 2NY7H 1ZHKB 3KLDA 1L4IA 5JO5B 2WSKA 5BS0D 4LNVA 2CO6B 5EIVA 3IVKB 1AR1D 1EPFA 1ETZA 4HWBA 4GS7C 5D1QA 4XCNB 3RQ3A 5IVNA 5C0CA 3ZTNH 4QXTA 3ZTNL 1SYVA 3SDXA 3D85B 3HE7A 4BSVB 1MQ8A 4KQ4H 5MENB 1DDHB 4KQ4L 3LQZA 1S8DB 4OGYH 2O61B 1U8KA 1P9MA 2FNBA 5GS0D 3BP5B 3LMJH 3LMJL 4JAMB 3BO8B 5I74B 2F53E 1D9KB 1KN4H 1KN4L 3MRMA 1FSKC 3VRLF 3MPCA 4JVUA 3TVMA 2I07B 5D7KE 4OIIH 1B0RB 5TE6H 5TE6L 1KCUH 1AXSB 1KCUL 5DURB 2QKIB 2QSCH 3VXQB 1C08A 2QSCL 4N1HB 3CH8A 4E42A 1L6XA 2GUOA 4K94H 3MREB 4K94L 4XAWL 1EVTC 4NQDE 3RFZC 5MERB 1CXHA 5DMJB 1J0ZA 2BXYA 4UAOB 3RIAF 4HBCL 3PWPA 4O4YH 5FM4A 4O4YL 4DEPB 1FZOB 2ICCA 1YEEH 4LF3B 4ENED 1NMCB 3MRQA 3VFPB 1D5BB 5DJYB 3PWVA 4ZFFA 1A3RH 2HTLC 4HPYH 4KK9D 4HPYL 4JO2H 4JO2L 4I3GA 4N0FB 4WFED 4YGAB 5DRZA 1QSFD 4M1CC 1CT8B 5DJ8A 1MCRA 4PY8J 1CDCA 4ZFZA 2R1YA 1JNJA 5EU4A 2VQ1A 4FQIH 4FQIL 4IJ3C 4Y89A 4KRPC 2HAZA 4XNMB 3W9DB 5FEBA 2VLKE 4PG9A 1NL0H 1NL0L 3WFHB 4OD2A 1XGQA 3KPTA 2XTJD 1OLZA 3BI9X 3ORJA 4Y19A 5T1KD 5IB2A 4Z7VA 2VDPH 1QKZL 2VDPL 4G3YL 3NCEB 3LS4L 4NKQB 1MHHA 1P5VA 3MR9B 5I2IB 5EOQH 4P4KA 2H32A 5EOQL 1ZT7B 4UQ3B 2BVQB 2X9WA 2EO1A 1AR1C 3NVQA 3BJLA 4FG6C 5DI8B 3WNMA 1FYHB 4HC1H 1CDYA 4PJXE 4HC1L 3FO2B 1CFQA 3MNWA 3NIGF 4Y4KA 2AK1H 1C1EH 2AK1L 1C1EL 3WKNA 2EZ0D 5GS0C 4FFYH 2JJUA 4FFYL 4W6YB 4B5EA 2WBKA 1N5AA 3BT2H 3BT2L 4L5FL 3DI3B 3MRLB 3CLFH 3F12A 3CLFL 1KT2A 2P8PA 4F3FB 4JFFE 3WJLA 1D5ZB 2WINA 5FA3B 4PJCF 1YMMA 4M3KB 2VKWA 3T3PF 3VXTA 4WW2C 3IDYC 3GBLA 1HHIA 1KNOA 3JWDC 2J88H 5EC1B 3UTOA 3ZYZA 2J88L 3MV8E 1SJHB 2IADA 4NKDA 2OR9H 4PTTB 1KENH 2OR9L 2NY2D 3D48R 1KENL 2UWEE 1OGAA 2AQ3A 3GIZH 1A5FH 1A5FL 3GIZL 4WHYG 3MZGB 4MCYA 5SWZB 1IGTB 4FQQA 3BGFC 3H3PH 5CIPH 3H3PL 3U7WH 4AENA 3U7WL 1HWGB 4U05A 5DK3A 4RNRA 1GGBL 4KK9C 4PJAA 5DYOA 4DJMA 4Z7NE 3S5LA 3LVEA 3WNPA 3W0WA 2VYRE 2AK4A 5DJCA 1HOCB 3I6LE 4WIQA 2DAVA 1MVUA 4P2RB 1QBMH 1QBML 2P8MA 4FNLH 4FNLL 4J6RH 3WS6C 4QHUB 3BWUC 5T3XD 2YPLE 2LU4A 4FFZH 4FFZL 3LN4B 1CDJA 1IEHA 3IDUA 5CILH 3MROA 2FHBA 4PJIB 5CILL 4PJ9A 4AT6A 3SE4C 1U8JA 4LHUD 2BOCB 5DJDA 1I8LC 3D39D 3GJEB 1SEQH 1YNTA 4Y5YC 1F00I 1SEQL 5FOBB 5TE4H 1Z0NA 2YD5A 1NH6A 5TE4L 4RFEB 3GI8H 3D25A 3RDTC 3GI8L 1NBYA 3PGDA 3EIFA 3QCUH 3QCUL 4HH8A 1GOHA 4G8FA 5DRNB 4QXUH 4P5TA 3L3GA 4ORZC 4P23D 1V7NH 2CD0A 4KDWA 4P57B 5FYKE 3RTQC 2AP2A 3TYGH 2HWZH 2Y4SA 2D4FA 3TYGL 2HWZL 1RFDH 5EUKA 1RFDL 2BY2A 2NXYD 4HWBL 2DWEA 4XTRD 4WUUA 4MNQA 4M62H 3VXTB 4LRNH 4LVNC 4M62L 43C9A 4LRNL 4JRXB 4QRQB 3LB6C 2LAAA 1N2RA 4X4XA 2HT4D 4NKDB 2D0HA 1A1NB 3DX8A 2Z91B 2HVJA 4UMGA 1DZBA 1KLUB 2ZPKL 5JHDE 3UTPE 2A6KA 2Q7YA 3E3QE 4M5ZH 4M5ZL 1T3FB 3UCRA 4YWGL 2AV7A 5HVHC 4MA7H 4YHOL 4MA7L 1EK3A 5IEKB 2GQHA 3V6BR 3BPNC 2Y06H 3DYPA 2ZOLA 4PV8A 2Y06L 4GUPB 4PJAB 1I3UA 4YHPB 5HYQB 3DLQR 4LASH 1EAPB 2C7UA 4EI5A 2F9BT 3O8XD 2VIRB 2C5DC 4JKMA 2BRQA 3DMMD 1QTYT 2FJGA 3O4LB 1FC2D 3I02A 3ULUE 4FA8A 2QEJA 4QOKB 1XCTA 4RRPG 1ZAGA 2CKNA 4CADB 1RJCA 2DQCH 4HUXA 3ULVE 2DQCL 2X4TB 4WJ5A 3G5YB 2IPKB 4TPRH 2OTWB 3KYAA 4RAUB 3FB8B 3P30H 4MXQD 5DFWH 1GZPA 1ZWIA 4N1EA 5TE7H 3TA3D 5TE7L 4KJPC 4X6CA 5D7IA 1JV5A 5ISZE 4RIRA 3VDBA 2AJZB 4KVCH 4PLNC 5IJVB 4KVCL 2FJHA 4TNVK 5E4IA 4GXVL 4FMKA 1KYOK 1KUMA 3O6FD 2NYYD 5FYJE 1K9TA 2Q87A 3DO3A 4Y8AA 1NMBH 1OQOA 4PP2B 1NMBL 1CTOA 4P4RA 2MOVA 4U1SA 3UXFA 1FV1B 5D4QA 4IOIA 1UACH 4OZIB 5DR5H 1UACL 5DR5L 3UYRH 4X6BA 3UYRL 4E0RA 5IG7A 1QRND 5EZJB 3MLRH 3MLRL 1NQBA 1QLRA 3M07A 2EIZA 4ZOAA 5L8JB 4ZNEA 2E27H 2YD1A 2E27L 4P23C 3TBVB 5B22A 5BVPH 4U1MA 4KK5D 3I3BA 2H32H 3ARWA 5JDSB 1N2RB 3V95A 3R0NA 3MLYH 3U46A 3MLYL 4WFGE 1JWSA 3DX8B 1KTLA 3MRDA 5TH2A 3PNWB 4AM0A 4XTRC 5E1HB 3NIFE 3LOWA 4OFYD 1JRHI 5ADOH 5ADOL 1U0QA 4YEFA 4PRAB 1FQ9C 2OQJA 4HWUA 4N9OB 2WIIB 1DCLA 4ETYA 1FZKA 4RMWA 1OSPH 4NO0D 4ODXA 3I84A 4KFZC 2IMNA 1JF6A 3O6LL 4NZUH 5FAAA 2P4AB 4NZUL 1I8KA 1F2XK 4LCYA 3RZCD 5HGAA 2D2OA 1R3JA 4MJID 5CBAB 4HZLA 3F7YB 1IM3B 4OF5A 2AKRA 2GEEA 4WI5A 3TT3L 3S88H 2FGZA 3DMMC 4P3DA 4MJ5A 5GS1A 3UTTE 4KZEH 4PGJA 4KZEL 4N8VA 2ZKHH 3CC5B 4HCRA 2ZKHL 4ELMB 3ARDD 5HXMA 3L5IA 5A16A 2C26A 2W0KA 3HZVB 5D2NB 3VFOB 1JYWA 3TA3C 4HBQA 1UWXK 3DETD 1CICA 2XZCH 2P43B 2XZCL 1EEQA 4U1LB 5BVJB 2YD8A 1TQCB 4MA3B 5SV3A 1BQSA 3O6FC 4X6BB 1ONQA 3O9WC 4OZFG 2QADB 1NEZB 4M1GH 4M1GL 1BMGA 3MJ8A 1CG9A 3TNMA 4QCIA 4JQXA 1AP2B 3Q48A 1F3DH 1KLGB 4I0PD 2HP4A 1DANU 2ITDB 5E6YA 4F7MA 1F4HA 1EBPA 2NY6D 4HULB 1JCKA 1JWSB 1J7VR 4DOHB 3ARXA 4G6AD 3KYMB 3FQUB 3RWCB 1K2DB 2W1NA 4Y5VA 4JN2B 2D31B 1R3LB 1UXWA 4KK5C 1RAMA 1CD1A 3V52H 3V52L 3SKOB 1CDBA 1X5HA 2WWMC 4HEME 1CR9H 3ILQD 5FECA 1CR9L 3BZ4A 1YYLH 4R7DA 2XG4A 1YYLL 4P2OA 2VLRE 1ZA6B 1MCOH 4TSBH 1MCOL 5IB5A 4TSBL 3CD4A