3EAKA

Nbbcii10 humanized (fgla mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords NbBCII10-FGLA
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
total genus 28
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eakA00
1A47A 4I13B 3PV7A 3MV7E 4K9EL 4O5LH 1W0VB 1V3KA 4V1DD 4YHZH 4LCIL 3V6BR 4PYGA 5FGBC 1G7MB 1HQRA 3GM8A 2P24B 5JHDD 4NNYA 1OPGL 3QDGD 3FZUC 1AD0B 5FUCC 4NT6B 2H2PC 3P0YL 3H42H 4GAJL 4HH9B 5ANMB 1CGWA 1BQSA 4X83A 4W4NA 3TVMB 3FRUA 3IAPA 4LVOC 2VL4A 2EE3A 3HC4L 2P1YA 4KXZH 2XTJB 5H8DA 3V6OA 2QR0B 1OTSC 4WI2A 1M6OB 5FGRA 2IG2H 3U7YL 2VC2L 3ARSA 4Q9QL 2GSGB 1LD9B 1MHEA 3RJDA 2VLKD 3F12A 4JKWA 4XX1E 5IB3B 3MV7B 4KROD 3ARDC 2MHAB 4OV5B 4N0YL 3RIFK 2I60L 1CIUA 4NBZB 4ALAH 4X9FA 2Z8SA 5B38A 5SWZD 3TN0B 5D7JA 1R3HB 3QT2A 5C3TA 4WW1A 4J1UA 5F9WC 2AQ1A 4OZIE 1FE8H 3KNBA 3SHSA 4WENB 3MUJA 5GGQL 1A8JH 2X1PA 5EOQH 2Y07L 1AGBB 2O5ZL 4NP4L 1UQSA 4G42A 1KACB 3GI8L 4KJWD 4OF8A 4OIBA 5D7LD 2JKXA 3EOYG 2VDNH 5I1AB 3VFMB 3MZGB 5I1KH 3RVVD 5EH1A 3JTSA 1ORQA 5KTEH 3O3DB 2PW2B 5D8JH 1LEGB 3HZVB 4E0RB 2OM5A 3CFJB 4LEOB 2XXCB 5E70A 4OZIB 4L8SA 4N9OB 4J3SA 1FO0L 3U46A 1XH3B 3PQYD 2BY1A 4GRLA 5HHPA 3MNWB 6CGTA 1S9YA 2HH0H 1OT2A 2DBLH 5C08E 3X11B 4ZUTB 3PWNA 4GLRI 5HI4D 3O3AA 4FQXA 4YDJB 3LEYH 4P2OD 4KY1H 5HYEA 3PV6B 4PJDE 3TGXA 3MJ9A 4KGJA 3TH2T 3RZCC 3BMVA 3DRTA 4OD2B 4ERSH 1EA9C 4F7EB 4R0LA 3DO3A 3MA7A 1GGCH 4YHZL 5HGBB 2DQFA 1T7VA 4KTYA 2GY5A 1I85A 4L8BA 1XF4B 3EDDA 4YHIB 4RFOH 3MBEA 5I74B 3H42L 1IGYA 3N1QC 1DL7H 4H1LB 5HJ3B 5AZEL 4LQFL 5C08B 5C2BL 3BN9C 2GQHA 2D9CA 1ZV5A 3HCVB 1U8JB 4GW5B 2IG2L 3QXDA 5JPNB 4H8WH 4PJDB 2QTEA 4Q7DA 3ZKMD 5TFSH 5INDA 4GG8B 2AK4E 2W9DL 1BX2B 1A3QA 2W0PA 1S9WB 3KPQB 4P3DA 4PJCF 4YWGH 1QO3A 2M2DA 2PR4L 2XPGA 4FZEL 3MXVH 5EOQL 3S36X 4PRID 3QO1A 3HI1A 3P2TA 3S36H 4DKAA 5IJVA 1JZ8A 1ZGLP 3RUGF 5A2IH 3VXNB 4R7NA 4ZDHB 4QHNB 3UTZB 2XZCH 3DVIA 2DLFL 1UZ8A 5I1KL 5SX4I 4KTEL 5LXGL 2Q6WA 5KTEL 1BJMA 3MROA 3QEHA 4DVRL 1IM9A 3WDJA 1SM3H 1UWXK 5LBSH 4EI5B 1DDHA 3RTQB 4J4PA 1XGQB 3TIDA 1MCWM 2DBLL 1UKTA 4IIQC 4M61B 1JZ5A 2ZUXA 4Y16D 1BOGA 5F8QC 1V5JA 3T1FB 3LVEA 3OXSB 4HJJH 1A4KA 2I25N 1AP2B 2F54E 2VXUH 3OAZH 3P73A 4APQC 2AEIT 4EUPH 4ERSL 2FBJH 1J86A 3VJ6B 4LRNL 2AP2A 4HIIB 4JZJC 1TPXC 3RWJB 5DHVA 3C08L 1U8PB 3O6MH 4TTGA 2F8VA 4RFOL 3GBNH 1HH9A 1P4IL 4N90D 3DX6A 1RJYA 1VGKB 1DL7L 2ARWA 1AJ7L 2BNRA 3DYPA 3FAXA 3EO0B 5TPWL 5D93B 4GAYA 3RIAK 5IB4A 5IKCA 2NY6D 4ODXB 1PD6A 2N56A 4X6BA 4M5ZH 3O6FC 2JLLA 2B5IB 1UJ3B 3IDGA 4GJTB 3DO7B 1G0XA 1XR9B 4MB3A 4RAVB 5DMKA 5CBEB 1FSKC 5DD6A 2D0GA 5FYKL 5JUEH 1VACA 4LLVB 3VXRD 3QDJA 3MUGA 3UZEA 5C0AA 5F21B 3RWEA 5BZWB 3S36L 4UQ3A 2COQA 4KMTH 2C3VA 3IKCB 4K8RH 2O93L 2BVEA 1S7QB 5SWQB 2UWEE 3WO4B 4PLJC 1MCFA 4WIQA 4Z9KB 1JYXA 2VAJA 3E6HA 3EAKA 1R0AH 3GKWL 2WIIB 1GJIA 2A73B 5GGTA 1SM3L 5B38G 4O58H 2NW3B 5J57B 1G6RB 1QUNA 3SE8L 3W39B 2GYSA 2NW2A 3MLTA 5TDOA 1WISA 3VWKC 3K1KC 4ZOCA 2HP4A 1EHNA 4UAOB 2JJTA 2OL3A 1ZLVH 3SY0B 3O8XC 5TF1H 4N8VA 2C3HA 4I2XB 1MCPL 2DJUA 2W07A 4JQXA 2VXUL 2DJ4A 2WWKO 4XXDB 1R5WB 2DQHH 1A4JA 4QXTA 3VH8A 2FBJL 1CFQB 4WWKC 3S3SA 4KAQH 3UYPA 5IHLB 4YHOL 5D70H 3MA9H 3LQAH 3KPSB 3ORJA 4ELKB 3GBNL 2APWA 4PLKC 4LU5L 3ARPA 1H5BA 3U6RA 4K2UH 4WEUD 4MA3A 2R1XA 4GUPA 3OSKA 3O9WC 5KOMC 3Q6FA 3MRIB 1WFOA 4M5ZL 1MFAH 3T3MF 1T03L 5CSZA 4NO3A 3REVA 1EHXA 4MGXA 4AEIL 3HE6D 3ARGB 1A6WL 4CADB 4KRMB 2DQEH 3CGTA 3I3EA 5C8JB 3L7FB 5JUEL 4UT6H 1DUZB 2CKBB 1UCTA 5E1HB 2V5YA 5F97E 3O2VH 1CGSL 2NY3B 3SBWC 1EX0A 3SDYH 4WI3A 1HHIB 3RVWC 4Z7UF 4IOFC 5JPMB 1D9KC 5CZVL 4X5WA 2K1MA 4K8RL 5KS9E 4LQ1A 3C5ZB 1KPRB 5EN2B 3X3FL 1YJDC 3FFDA 3MMEA 3PL6D 1FYTA 1AE6H 2ZCLH 3HUJE 3GB7A 1I1AB 1XGUA 4WO4D 3QI9C 2V2TB 2GTZB 1MJ7H 3HC3H 4NUGL 4Y5XB 3R06B 1A1MA 4PBXA 5JW4R 4O58L 1UEYA 2VTFA 2G5BA 5FO7B 3WN5A 1ES0B 1FBIH 3QXUA 4P23C 4EXKA 1PLGH 3RY4A 5CJXA 2EH8H 2J8UB 3H9ZA 1H3VA 3OKKB 3WEXA 1TQCB 3JWDH 4L1HA 2B2XH 5EU7C 3ZSSA 4J3WA 5EU6D 4ZOEA 2CSPA 4D8PB 4U3XA 5I66A 3R0MA 3U36B 5IROC 1MCBA 3HUJB 3JZ7A 1X5AA 4Q6YA 2DQHL 1W0VA 2ID5A 3ZDXE 3JV5A 3BPOC 5D70L 3MA9L 4ZPTB 3I02B 3LQAL 1SBSH 2IAMD 2VLLB 3FQXB 5JMOC 3QUZC 4L3EB 4HWZB 4NT6A 2BVOA 1LHZA 4K2UL 3FCTB 1QBAA 4ZUWB 4G7YL 2YZ8A 3RGVD 4OSUH 3K2MC 2QR0A 5EIIA 3MJ8A 4RMSA 1M6OA 1VFAA 4Z0BL 3DOSA 1E28B 4OIAA 2WBKA 2B20A 2MHAA 4JG1H 4TYUA 2NYYC 3U0TB 3TN0A 3JWOC 3MRRA 3VXUD 5DZNA 1VPOL 4XMLH 2WZPD 4OM1H 3SE3A 3SDYL 4ZOBA 1J05A 3MRHB 5K9JL 3O3BB 3KG5A 5FYKE 3IRZA 3NIGE 4OJFH 2H26B 3ILPB 5GS0C 5I1AA 4PD4K 4AQOA 2ZCLL 2PO6D 1NGQH 2K3TA 3GSXB 3BZFB 1MJ7L 2Y9RT 3VI4F 5HGGS 1LEGA 4ZFOB 4CUCA 1R5IB 4LEOA 4QRRB 2IALA 3D85B 5E6YA 3SDXE 5JIKA 1T66C 4BFGA 3G08B 4KRPC 1XH3A 1PLGL 4ONFL 4XCFH 3MNWA 3KYAA 5IVOA 3UPAA 5L0QB 4RFNB 1J11A 4RMQA 1XR8A 4U31A 3QDAA 3O4LE 1ZHKB 1RD6A 3X11A 2R23B 2NY2D 4KTDH 1Q72L 4ZUTA 3PV6A 4HZLB 4S1DD 4OCYH 2IBZY 3CFKB 3N06B 4OD2A 3O11B 1MCQA 3RX5A 1MHHB 5HGBA 4NC1C 2OP4L 1SBSL 1EH9A 3SDXB 5DD1H 1XF4A 4Y5YC 3STZB 5J56B 2MCG1 3VXPA 2E7HA 2F53A 1KXTB 3O2DL 2PYEE 5FB8B 1OHQA 2R0KH 1NEZA 4H1LA 3GEWB 3CMOH 5HJ3A 1RU9H 3U1SH 3ZE1F 3O4LB 3PWLB 1CCZA 4OSUL 4N8VG 3G9VA 3HCVA 5C3LD 4FG6C 5JPNA 1X9QA 5TE6L 5ACLA 4XGZB 2HKHL 4UI2A 4GG8A 2EYTB 4OZFB 1AC6A 1TCRA 4Y5VB 2X4QB 1S9WA 3FQRB 3KPQA 1YEIH 2P44B 4LCCC 2P5WB 3QNXA 4M48H 3DJ9A 2GITB 5JQ6H 4WJ5A 4OM1L 4KZDH 1N59A 2PYEB 3NPSB 2ATPA 3OB0H 4YZFE 4BH8B 4JFHD 1I7UA 1A6ZB 1EAJA 2FEEI 1GZPA 2W38A 2KQMA 4M43H 3V9FA 4MXQC 3VXNA 2F58H 4ZDHA 3UTZA 1IBGH 1UJTA 4YX2H 4HDIA 3UBXB 3DUHA 1CICC 4OT1L 4OCMC 1ONQA 4QWWD 1DUYB 4JO2L 1PG7W 1QLFB 4XCFL 3RTQA 1FGNL 1OGAD 4OGAC 3C6LB 5D1ZB 3DYMA 4M61A 1H3PL 1SVZA 3OXSA 5L2KE 1N26A 2IBZX 1J9CT 1KPVB 4OCYL 2EXYC 4X7SL 4QYOB 4OZGF 4WTWA 1IGFH 1EXUA 1JNLH 1PYWB 4L3CB 3VJ6A 1KB5L 4GAGH 1MLCB 3C8KB 4U6TA 5C7XL 4PRHD 3RWJA 3KYOA 4O2EB 2DMCA 3P77A 1PSKL 3MFFA 3WDIA 5EORL 4CBPA 2P8LB 3ARBD 5F1IA 1FFRA 2AJZB 2BK8A 1X4XA 3S5LA 3CMOL 3EO0A 4HX1A 1RJLB 1RHFA 4YHYC 4YNYB 3W2DH 3EBAA 1TZHB 2DLTA 4F8QA 3L7EB 2DQGH 5L2KB 4XBGB 1VADB 3ULVL 2X70B 4M4RA 2QSTA 4QTHB 4RAVA 4WUUB 1JHTA 1YEIL 1A1OA 3TZVC 4M48L 3V5KB 1WUNT 3HLAB 1JPGB 1WVZA 4P5KB 1NFKA 4JO3H 4DVBA 5BZWA 4M7JH 2EC9T 2FIRT 4X9BA 4FP8L 3UROR 4M00A 1DR9A 4X6FB 3IKCA 3UJJH 1PKQB 1NFDB 1S7QA 5BZDA 3PABB 1IBGL 1NFIB 2Z0BA 1YEEH 4OCWL 5GGRY 5DGQA 3QIUC 1PEZA 2V7NB 2ZUYA 3L5WB 4LLMB 2VN4A 5FHAH 4TUKL 4JG0H 5IMMB 3B9DA 4M6NH 3MV01 3FT2B 1G6RA 5I75B 2AK1H 5DI8B 5I8KL 1KF9B 3ZTJG 4HMCA 4PP1D 4YFEA 1JHKL 3T04D 3MBXH 4LSPH 4I2XA 1DQLH 3CFBB 3DRQA 4KK6C 5E8OB 1CXLA 2HT2C 5L8LB 1W72L 1R5WA 4GRWF 1B2WH 1IGFL 2Z31A 2R2EB 1CFQA 4GAGL 4J3UA 5C09D 1LP9F 5GGSB 2A83B 1MJJA 3KPSA 1SEQH 1HILB 5HHME 4WW2F 4JPVH 3WKNA 3T0VA 4H88L 3PWJA 1NCDH 4X6DF 2VLRE 3HE7B 1RSFA 3D0VB 4F9PA 3W2DL 3BGMB 5C0EB 2DQGL 1VEPA 5JXED 4YXKH 2X41A 3LB6C 5MHSE 3ARGA 1ND0A 1MCNA 5CZXC 1RHHB 4MJ4A 3UZVB 4PJCA 4LARH 4XHJD 1S7WA 2FL5A 1Y18B 4MDJB 1DUZA 2PETA 5I1LA 2XN9A 3RL2B 2CIIA 3L3IB 4JO3L 3VFPB 1F3JB 4IHOA 4AEHH 4M7JL 4CGTA 4X9GA 1NEZG 4H1LG 2XKUA 3IS1X 3TC9A 3UJJL 1CBVH 3TA3A 3C5ZA 1KPRA 4M5YH 1U2CA 5BV7H 5CJQL 3D39D 1YEEL 1DP0A 2CRIA 3V6OC 3GSVA 2R29H 5KAQG 3R06A 4M6NL 4DFIA 1OAQL 3K0WA 1MEXL 1AQKL 5JOFB 5FO7A 4Q2ZB 1F4WH 3ZZ1A 1ES0A 2AK1L 1IKNC 4E42A 2J8UA 1MIEH 1D6VH 4NQUA 5CLTA 3OKKA 2ZG3A 5D7JC 2E7LA 4JFQA 1K5NA 3GSNB 3FO9B 1AH1A 4LSPL 1HNFA 2RGSA 2DOCA 3U36A 4LFHG 4L5FH 4QHKI 4IRJB 2P48B 3UTPD 5J89A 1I9RH 2NZ9D 4BFIB 5FKPA 5C0CA 4N0CC 4DKFH 4WFFD 4ZPTA 3I02A 1ADQL 2CKNA 2VLLA 3FQXA 4JPVL 2G9HB 4L3EA 3DX7B 3QHZL 4HWZA 5CJOH 4RDQG 5C0DB 1P7QD 3FCTA 4XNMB 4ZUWA 1F2QA 1QHOA 5I1EH 3H9SB 4L8SC 4GG6B 4YO0B 4YXKL 4GRLC 3LN4B 1NUDA 2YHGA 2YKLH 4ETQB 2EH7H 3KJ4C 5T1LA 3CDYA 1KFAL 3BZEA 4LASH 4G7VL 2V5SA 4F57H 1TQBB 3RQ3A 2ZUVA 4QLRA 3UX9B 3GIZH 4LARL 2JELH 1FVDB 3L5HA 3NFNB 5F3BA 2VDPH 3U0TA 3T3PE 1BZ7A 4M62H 2NXYD 4R0LC 3ULVE 3NBNA 3G6JF 5CGYD 3T4AB 4EZMA 3V0VB 3S5LG 1I85C 2EDXA 4ETYA 4PJIE 3G5VA 3MBEC 4Y4KB 1K4CB 1UB5B 4NFCA 4JFED 4OF7A 4FFVD 5BV7L 2HT3D 2EICA 5MI0B 3LKNB 5FUZL 1WSST 4EKXA 5GGVH 3BZFA 3EHBD 3BSZH 4ZFOA 3LD8B 3ME0A 4R2GB 3PGCB 3CFEB 1AGDB 1R5IA 3Q5OA 4HF5L 1F4WL 2APTA 4JFFD 4MNQA 4QRRA 3KYKH 4FZ8L 5ACZB 3G08A 1B6DA 1KJVA 5HYJE 3B9KD 4WRLA 1MIEL 1D6VL 3ULUC 1RPQA 2HMIC 3SDCD 4ELMB 1KTDB 4QXUH 2KDGA 4X6EA 1E4XI 4NM8L 4HZLA 1U6AL 4A6YB 3RDTD 2UUDH 5J11C 5T33L 1I9RL 2IADB 3O11A 2VKXA 2GJ6D 3MCG1 4OD1H 4N8PA 4DKFL 2JCCF 2IEPA 3FJTA 4Z7OF 1T1XA 3MV9D 3STZA 4M6AA 1QBBA 5CJOL 5HYJB 2J5LB 3RWFA 1UACH 2WANA 4NNPH 5FB8A 1QRND 4C4KO 2NY1B 3EYUH 4K23L 5I1EL 3PWLA 3CU7A 1V7NL 2HA1A 4R8WH 5CIPH 4NZJA 2YKLL 4Z7WE 1QFPA 3I85A 2XOTA 3S9DB 4Q9BA 5HHOE 4XGZA 2CLZB 3NCCB 2EYTA 1NMBL 4OZFA 3GIZL 1GPOL 3FQRA 2VDPL 1QSFD 2P5WA 1J1PH 1B0GB 4U2ZA 2HJFB 2ATKB 1K4DB 5T3ZE 4BH8A 2Y1VA 4UDUA 1W72B 5IJKA 4X7FC 2W0LA 2A0LD 4MXWL 1A6PA 1AO7E 3GMOB 5ETUB 1F4AA 3D18A 2C7UA 2LU3A 3JV0A 5GGVL 3VXMD 2W65B 5ADOH 1MAMH 3OGOE 3UBXA 4JKPH 3BSZL 1JZ7A 5BRZD 3KJ6L 5FGSA 4MCYA 1DUYA 1QSVA 5GRWA 1OW0A 1H3UA 1LEKA 4D9LH 1QLFA 3K46A 4L9LA 4JLRB 3HMXH 1WCQA 4MMXC 1QLRB 3IGAB 4NHUB 1RUQH 4GAFB 3DX8B 5D1ZA 5BS0B 4DWHA 1AO7B 3L9RA 5DWUL 1U91B 1F45A 1NEUA 2RIKA 3RGHA 5LVEA 3C8HA 1KPVA 2J12B 3FKUS 4PRPD 1BIIA 3KLHD 3D3VD 4N1HB 1RUPH 5E9DD 4L3CA 3MLSH 4OD1L 5H37H 3WIHH 4JM2D 1EHAA 4XPTH 1MLCA 3C8KA 1EGJH 4X6CE 1S7XB 3QR2A 3BJLA 1MQ8A 4O2EA 2CH8A 3A6BL 1AKJD 1QBLH 2IJ0C 4J12A 4GO6B 3CLEL 1RZJC 4Z0XA 5HDQH 3D25B 4R4NC 5FV2A 1RJLA 1T22B 4R8WL 1J0ZA 4YNYA 2Y5TA 4Y4HB 3L7EA 2JB5H 3SGDH 2JJTC 3F7VA 4XBGA 2BNQA 2X70A 5D1XD 4GT7A 2R4SL 1I3VA 2W1NA 5I8EA 4QTHA 1IGIL 1X5LA 4JFDD 1NCBL 4WUUA 4JQXC 4KK5D 1AI1L 1WZ1H 2B4CH 2FJHB 5JOEA 1MREH 2FCBA 2EDHA 4MJID 3V5KA 4D3CH 4OZIF 5F72S 3HLAA 4NQCD 3SDDB 3TO4B 1A6UH 4ENEC 4P5KA 3SOBH 4LSVH 3VRJB 3NCYS 2O5YH 3FN0H 1F11B 4XPFH 3LIZL 4X6FA 4EVNB 4H25B 1PKQA 1NFDA 3PABA 5BVPH 1H5BC 2RCSH 1G7IB 4POZC 4BYHA 1MAML 1MJ8L 1S7TB 4JKPL 5BVJB 1O5DT 1Q38A 4I48B 3UTQB 4KFZC 3N9GL 3WHE1 2VJXA 3SGJA 2ZUSA 1HH6B 5J6HB 4XPHH 5C07A 3D1MC 4KQ3L 3FO2A 5GRYA 1LEIA 5F1SA 5GS2D 4M03A 3EIFA 1WC7B 5K9OB 1QVOB 5IVZA 1EBAA 4PJDF 4NUJB 1J7VR 3EOBA 5E94B 3VXSB 4NKIL 2ITCB 5IT2L 2XNAA 3WIHL 3QIBB 1EGJL 4WGWB 5GGSA 5L2JB 1OSZA 4NO5A 3WFEH 4E41A 2D7MA 1QBLL 1JI1A 4O4YL 5EUOE 5C6TL 5GGRB 4RQQB 3QEQD 5HDQL 2OJZH 5CD5D 3HE7A 1MCLA 2Q3ZA 3T0EA 4FABH 3WN5C 4L4TD 3JSSA 5C0EA 1T7ZA 3GZKA 5CJXC 1JZ2A 4BELD 3OPZH 4HUVB 5J3HD 5I1GH 4R26H 1FH5H 1GOGA 5EPMB 3BZ4B 2Q8AL 5B21A 3ROOA 3K7UA 1A6VL 2H2SC 4MDJA 1MCOL 5CJ5A 2GUOB 5CKGA 1ZVSA 2EDQA 3HI6H 4FOMA 3RL2A 1A6UL 4LSVL 5D6CB 1RZKH 3RY6C 4XVUC 3KPRD 2P47B 1K3ZA 1EEQA 2O5YL 1CD8A 1FHGA 3FN0L 3NPZB 2NY5L 3V6FB 3RZCD 3VRIA 2DQTL 5E08L 1K2DB 5KSAD 2RCSL 4W6XB 5JTWA 3LKSA 2CIKB 5EC2A 4AL8H 4OZFG 4RGMB 1OWRM 1F3DH 2BC4A 3VG0H 3BN9D 2FSEB 4DFHA 3QWQB 4JREB 2A6IB 4XPHL 2RB8A 1H3GA 2YBRB 1G1CA 3RKDC 3V6ZA 5IVXE 3TN0C 4URTB 2VR4A 5DQ9B 3PDDA 3GSNA 1TIUA 3HRZB 4HPYH 2E6JA 3SE3C 3PHOA 4U0RB 4ZAKA 1MPAH 3O3UN 4RISH 4UMGA 5D71L 4FQLH 1I8IB 1RK1A 2HVKB 1FNSH 4NWTH 1MHPH 4BFIA 2EEAA 5FGCB 4PJGE 5DVMA 1IGMH 1G9ML 2JJSA 4JFYB 1JTPA 4YHKH 2DJSA 3LKPA 5LQBL 2IAND 3CD4A 5FYJD 1OTUD 5C0DA 5IVXB 3K4DA 1J1XH 4XNMA 3RVUD 3H9SA 3O6LH 4GG6A 2A77H 3LN4A 1DQJB 2H32H 5EA0H 5MP6H 1XGRB 3OPZL 1DVFD 2PYFB 2X40A 4LCWE 1FH5L 1BFSA 1LQSR 4M4PA 4Q6IB 3OKMB 4I1NB 2PXYD 3QQ4A 3TBSB 2E6PA 4BZ2H 4PJGB 1YMMB 3NFNA 4GW4B 1A21A 1P6FA 1BFOA 1U8HA 1RZKL 2PNDA 3GSWB 1FJ1B 1XCQB 3WFCH 2QSQA 3W0WD 3B43A 4E9LA 1RMFH 4CMHB 2UWEF 1GZQA 5FOBB 4Y4KA 4G6MH 1UB5A 4YHPA 1N7MH 3QYCA 4LCWB 3WYRA 3LKNA 1SJEB 5E6ID 4WUKH 2WNGA 4AL8L 3GJEA 1OAKH 2ZCHL 5F96L 2IC2A 4JFHE 4DOHE 1CF8H 3CFEA 3V4VH 2HRLA 4WV1B 3O6FD 1ACYH 5F9OL 5CBAB 2FWOB 1XCTB 3X17A 2VLME 4ELMA 1KTDA 1B0RB 4Y89A 5T1MA 1PQZB 1MPAL 4A6YA 2MKLC 1UVQB 2YPVL 4FQLL 4FTVE 1A7BA 3P0VL 1FNSL 1TDQA 1MHPL 4NWTL 5E1AB 3FOLB 3QUKB 1IGML 4JRYB 4DOHB 5BW7A 4Y19A 4YHKL 4K94L 1FPTL 3CZJA 5GIRA 2E9BA 2CUIA 1Z3GL 2HKFH 4XWGL 2Q7YB 2RQ8A 4ISVA 1W8NA 4D94A 2VKWA 4PG9B 4R96A 2A77L 4M7ZB 3RTQC 5MP6L 2J6EL 1EAPB 1INQB 1BD2D 4PS4H 1NC4A 3ULSA 4Y1AD 4LCYB 4PRHE 3C60B 2CLZA 1CLOL 1TMCB 2HLFD 4KV5E 3MOAL 3WLWC 4LHUA 4CAGA 4PJXA 4IRSA 4JFPB 3GO1H 5JIPA 1NMAL 2ATKA 1K4DA 4JFXA 3WFCL 2AJXL 4G6JH 1EV2E 1MCWW 2PW1A 5KS9F 3CH8A 5DUBB 5I1JH 2ZSWB 4V2CB 5D2LE 5ETUA 1JGLH 1N7ML 4GQ9H 3HUJF 4Y2DA 5D93C 4FQJH 2QADB 4HGWB 4WUKL 1A7PH 1NDGB 3UTTE 1U8OB 4C55A 3RVXD 3GBMH 1HHJA 1CDJA 2B5IC 2OI9B 5BQ7B 1CF8L 1DBJL 3V4VL 1MJUH 2ED8A 4JLRA 4LPYA 1J5OH 2X4PB 3NMEA 1GGBH 4NHUA 5BS0A 3DX8A 3T0DA 2NY4C 1MUJB 3I6LE 5D2LB 3CPLA 4RNRB 1ZHNA 4N9GA 1AHWB 4PJEE 4ZXBA 2F8XC 3L6FA 2HTLC 5L9DH 4EDXA 3WO4C 1YDPB 4XNYL 5ITFB 5CD3B 3MCKB 1D9KD 5HGAB 1S7XA 1WV7T 3CDCA 1DN0A 3AS3A 3EO1B 2LTQB 5D9SB 2RFXB 4XTRC 4Z78B 1AXTH 1X3DA 3C5SB 3L5JA 3I75B 1CWVA 3QI9D 4PR5B 4AT6B 4Y4HA 4NO0D 4OTXH 3LN5A 4PJEB 3WBDA 1X5KA 3MX0A 1FNFA 2FYYB 2FECL 5J1AB 3QJFB 3EDEA 2ERJC 2FJHA 4XP5H 4NM4H 3GO1L 1IC4L 3SDDA 2Y36L 2Z31C 1FNLA 3E3QC 2MNUA 3HG1E 4G6JL 4PYHA 2ZKHH 4YPGA 3X13B 4XBPB 1F11A 2QQKH 1EFXD 1ZE3C 3BDYL 3BKCH 3NIGF 3WFZA 5I1JL 4EVNA 2VISB 1VGEH 3GMPB 5C0GB 4GQ9L 3SJVE 3EYVA 1F6FB 4FQJL 4S1SH 2CXGA 3QDHA 2BVPB 1NUGA 5FAAA 4F9PC 1A7PL 5BVJA 3LHPH 2LU7A 4OB5L 3I3DA 2XQYG 4I0CC 4I48A 1ZANH 3PP4L 1OB1B 1BAFL 1KGCE 1FFOB 2VL5B 3ARGC 5E2TL 2IF7A 6FABH 1CQKA 4BZYA 2D7TL 3UJTL 1HH6A 3HG1B 5ESQA 1MJUL 1PX4A 4UINL 5HD8C 5SWSB 1J5OL 1YYLL 2BY3A 4GXUN 2YPLD 1IE5A 1GGBL 3BPCB 2YZ1A 1F13A 1YMHB 4KXZI 5EO1B 5GS2H 2NYYD 3SJVB 2DL9A 1NCTA 2Z92B 4G9FD 4YLQT 3VXSA 2JJWA 1FL6B 3MODL 4NO2B 5I9QB 4HW6A 3ZYJA 3TA3C 2VZUA 3C5ZC 5L9DL 2ITCA 3FHAA 3QIBA 5KW9H 4FMKA 4QHUB 4I18B 4RMTA 3MC0A 5CHNB 3BQUD 3CH1B 1TZGH 2LFGA 4I5BB 4PJAB 3IDYB 3RFZC 4NN5B 1AXTL 4Y5XC 2R69H 4RQQA 1N0XL 2B8OT 4O2CB 4PJ9B 3GUTA 1TCMA 1OTTC 4Y4FD 5F6IB 1WT5A 4S2SA 4RSVA 5E5RB 3SO5A 1JJUA 2NNAB 3UTPE 3LQZB 4EBQL 3CVHH 2WUCH 2HWZL 3BZ4A 1FZMB 1YY8B 5F7KC 5GS3A 3QUXB 1RIVH 1GRWA 3U83A 4Z95L 4Z6AT 2DRUA 2I27N 4X4YB 1T1YB 3OGCB 1DLHB 2GUOA 4HD9A 4NM4L 4K3DH 1H8SA 2BNUB 3AREB 2OTUB 4PGCB 2QQKL 3BKCL 5HVGB 3V6FA 2F5AL 3BESR 1UM5H 1VGEL 1K2DA 5DEGB 3FFCA 5IP4A 3EFDL 1NLDH 4GQPH 2V9QA 4BJLA 3KWWB 3CC5A 4NYLA 3LHPL 3HNTH 3ESVF 2ZWLT 1A7QH 3OJDB 3BN3B 1CD1B 4LHUG 2M8XA 3PJSA 6FABL 3TJEH 1GOHA 3V7AE 2B1HH 2A6IA 5F3HA 3NA4A 3SCMB 5DD5H 4XP4H 1DQMH 3JXAA 4JFEE 4HUKB 5EOTB 5DDHB 5J12C 4X98B 5DQ9A 2NPLX 1DBKL 3PWPA 4F7PB 1MVUA 3HRZA 4DKEH 4QHLA 4GBXB 3EO9L 1RULL 4YH6A 4CKVX 1T83A 4JHAH 3BT2H 2ICEB 1CG9B 3K74B 4I77L 5C1MB 3GHBH 3B2VH 4U49A 1NGXB 5D72L 1Q8MA 5DK0B 2CLRB 4MD0A 5KW9L 4I0PB 2DD8H 4HIJB 4GW1B 4JFYA 2YD7A 3BVNB 4MB4A 2Y06H 5CMAB 5I18H 1B4JH 4JFZL 4ZTOL 5MENB 5FYJH 3EYQD 1DANT 2DWEA 5TQ2L 4DUXA 1IMHC 1V8HA 3QG6A 5KVEL 3CVHL 2PYFA 2XY1A 5LWYL 4Q6IA 3WD5L 3MLUL 1X4ZA 3RRQA 3MV9E 1UXSB 5I15L 3TFKD 5E2VL 1YMMA 4JRWA 3QIWB 5M7QA 1CGVA 4K3DL 1FLRL 2PTUA 1FJ1A 1JNHB 5L6YL 4H20H 3ARWA 4F2MB 1OGTB 5DFWH 5FOBA 2BVQB 1JV5B 2NR6C 1I3RB 3K8MA 1SJEA 4HC1H 4CVZB 2Y25A 3EYSH 4NKOB 3WMSA 1W2KT 5E2WH 1S8DB 3S98A 1BBJB 4JRXE 4U1IA 3TJEL 9CGTA 2B1HL 2RJMA 3QHFH 2UZIH 4WV1A 1DQQA 4XP4L 4YFLF 2Y7QA 1DQML 1INEH 4WHYH 4HFWA 4QXWA 5EFIB 2BX5A 4HBQA 2AV7A 3R0NA 4NJAL 3VI3F 1B0RA 1G84A 4J2XA 1PQZA 5IJKC 2ZOKB 5KSBB 4C56B 2BVYA 3B2VL 2BOBB 1YEHL 3P9LA 4BZ1H 1SYSB 5E1AA 3FOLA 1UWEH 1BF2A 2DD8L 3OZ9H 3QUKA 4JRYA 1S78C 1CN4A 5F7WC 1AXIB 4FQIL 3VD5A 1CD0A 4XHQA 2DYPB 3DGGB 3QJHA 2NX5D 3MRFB 2Y06L 2Q7YA 3LKOA 1ZOXA 1XMWA 4FNLL 1OW0C 3BKJL 3QIUD 5FYJL 5CEYB 4PRPE 4M9OA 2Q76B 4PG9A 3QZWB 3OAUH 4L9LC 4GMSH 1EAPA 1INQA 5E9DE 4AMKH 4L8CB 3SO3C 4NRYB 3V52H 3JV6B 4N5ED 5D1ZC 5C0JB 1TVHB 4LCYA 4X7TA 3J7HA 3MACH 4LLAA 1H3TA 4JFPA 2I26N 3IDJA 2VSCA 4HJGA 4KK6D 1XIWA 4H20L 1M7DA 2HT2D 2NY0C 2MCPH 3RNQA 2Q8BL 2ZSWA 1QSEE 3KXFB 3VW3H 4MSWA 1EEZB 4PLNC 1JZ4A 3MV8E 3DV4B 1YEKH 3NIDE 4XNXH 4KH2A 4HC1L 4MAYD 3MREB 1NDGA 4NQCE 4E5XA 1YA5A 3RU8H 4QEGA 4RGOL 5E2WL 4WI9A 3BKYH 5JW4N 3ALWA 8CGTA 2UZIL 2W0KA 3VE0B 1T5XA 1U8MB 3WUZA 2X4PA 3CXDL 3LB6D 4LL9A 5JXAH 3B2UD 1N6VA 3VMPA 1MUJA 2BMKB 4RNRA 1A3RL 3MV8B 5FUCE 2V5TA 2A6JB 2XA3A 5GJSL 1CDUA 3Q5YA 2ZUQB 3GSOB 5DRNB 3AVEA 5B4MD 1CVSC 1UWEL 5CD3A 4PV8B 1SY6L 5HGAA 3HR5B 3Q1SH 5EBWB 3S35X 1QNZH 4HWNA 3S35H 3NFPB 2RFXA 3QFDB 4MA1C 2BRRH 3TM6A 4P99A 3C5SA 2BCKB 4F8TA 4Q58C 5I75C 3I75A 3SGJC 1YJDH 1MSPA 1P53A 4GMSL 4OFPA 2P7TB 3L3DA 3VA2C 3VFRB 4FFWD 1F58L 3V52L 4P9HH 3Q6GH 4EEEA 2FYYA 4N0UB 5CP7A 5J1AA 1VDGA 3QNZA 4UT9L 4K3EH 1WTLA 3T3PF 3VDBA 3QEQE 3NCEB 3ULVF 5AEAA 3ARDB 3QAZB 4L4VE 5JNYA 3VGEA 2A9NH 3AM8A 2MCPL 4PJIF 4TPRL 5IHUL 2Z91B 2ZPKL 1J0HA 1MVFA 3M45A 3GMPA 2FJGB 3VW3L 5KJRH 3R8BB 4XAWH 1J8HA 3HE7C 4XNXL 1YQ2A 3T0EC 2BVPA 3O41B 1CK0H 5GRXG 5F7NC 2VLJE 3MO1A 3I9GH 1FQ9C 1FFOA 3BRFA 3BKYL 4M7KL 3VD9A 5DJCB 5HVWA 4L4VB 2E6QA 1KIQA 5SWSA 4WU5B 5E6ZA 4LNRB 1GGYA 4FRWA 2X5PA 3BPCA 25C8L 1FRGH 1YMHA 2CJUL 5EBMA 3HFML 1L0QA 4JKMA 3T8XB 5DVOA 3U4BH 2Z92A 3V0WL 2DM7A 3QXAB 3X14B 1FL6A 1JK8A 4NO2A 2VLJB 4NKMA 3MRLB 4HQQH 5IIEB 4UBDC 4Y8DC 3UCRA 1AGCA 1K8DB 2X4NB 4LNVA 4MAUH 4QHUA 4P4KA 5D1QB 4I18A 5FO8B 5CHNA 3MBED 2FZ3B 4K7FA 4PJAA 1IILE 5EU3B 2WK2A 4U7SA 5LAXB 4ZUSA 5GSRB 2D31B 4NHCH 3ETBF 4JEGB 2P5ED 2ILLA 3NZHH 1XT5A 1BFVH 1YJDL 3U0PA 1HYSC 3LRSB 3QA3B 4BQ6A 1WTGT 4Z7WF 2ED7A 2NNAA 3DXAD 3LQZA 3P9MB 4U1NA 4P9HL 4QCIA 4WCYH 1JGDB 1P69B 1RQ5A 3K8LA 3Q6GL 4LVNC 1E4KA 5MEQB 1RFDH 3REWB 4K3EL 4JVUA 4X4YA 4ZAKC 3OGCA 5FYJE 2H8PA 2HMID 1DLHA 4JHWH 4M6MH 1KEGH 2QQNH 1AGFA 3AREA 5DJZB 3UAJC 2OTUA 3NCBB 4RBPH 4HKJB 5F9AC 2Y6SD 4UTBL 4WU7A 4PGCA 5GRJH 43CAA 2DTSA 2JJSC 3BH8A 4OLWH 2VUOA 1ZXQA 5DEGA 1MRCH 1NGZA 5KJRL 1QEWB 4TNVF 5SWZB 4XAWL 5KSVB 3UTSB 5HYQA 1CS6A 1S9XB 3G9AB 3ALXA 4R4FH 4DN4H 2XZAH 3AB0C 3HMWL 1VERA 3BEWB 3SGKA 1NH6A 1ROWA 1TQBC 2EDTA 3B5GA 5EOTA 3OAYH 3GSRB 5FDWA 2RAMA 5IBUG 2EO9A 2W91A 4LSRL 4KK9C 2OTPA 1KXQE 2EIDA 4GBXA 4IMLB 5FDYA 2IMMA 4CVXA 1CXHA 4KJPC 5ECJE 2VWEC 5HI5D 3KYMB 3U4BL 4RX4D 1M1SA 2ICEA 4IIQB 1P84J 2R2HB 1NGXA 2MQCA 1M4KA 5FK9A 3JWOL 3QPQC 3PQYB 4Y4KC 2CLRA 2DMKA 4X6CF 4X8JB 2DKUA 4HQQL 4I0PA 5KOVC 5MI0C 4HIJA 2YUXA 2AXGB 3BP5B 4GW1A 1B0WA 4JPKL 5ESVB 4OCXH 2XZQH 1T04B 4NHCL 4RWHA 2AEWA 4R2GC 3NZHL 1J18A 2CK2A 1TPXB 4OLZH 5CMAA 5GS0L 1BFVL 5MENA 2VMFA 5C0BD 3VGFA 3QRFM 5C0IB 1E4JA 1LO4H 3IDMA 4JQVA 1A1NB 5CGMA 4TOYL 5DD3H 1RFDL 4MQXC 4PTUB 2X4RB 3ESUF 3LPFA 3QIWA 4JHWL 4OAWB 3QDJD 1KEGL 2QQNL 3F7YB 3P11L 1JNHA 3J8F7 4HEME 4HHAB 4OLWL 5BW7C 4DKDC 2EDBA 4JJ5B 2BVQA 1JV5A 3G6DL 2PCPA 1JPST 1I3RA 4XMPL 4UB0L 2VERN 2V2WB 4M6OH 5FF6B 3U7WL 2NY1C 5K33A 4AG4H 1GHFH 4CVZA 2MOVA 5DGRA 5EBLB 4NJ9H 4DN4L 4DK6A 1S8DA 1SVCP 4YPJA 3VFNA 1FORH 4HAGA 5I8OH 3SPVB 4JR9H 1UCBH 3TYGH 1FP5A 4ZO6A 4IRSC 5EFIA 5T1KA 5I17B 5IEHB 1Q94B 2HT4C 3V4UL 4XNZB 3RBSA 4CDHA 3GRWH 3GMQB 4OKVA 4J7RA 5GS1B 5KSBA 3FB7B 4C56A 3JTTB 1EK3A 1OP3K 4Y2DC 1OM3H 2YA1A 5E03A 1D5IL 2HFEB 4DGVL 5EUOF 5B22A 1U3HB 4P9ML 3ZL4L 3TESA 1MNUH 4EUPA 3DGGA 4WWKB 1UZ6E 1BM3H 4POZD 4OLZL 4IM8A 2C9AA 5DK3A 1OP5K 5CEYA 4QRUA 3QQ9C 4ZOAA 3F62A 1TZIB 1A9BB 1RUKL 1QD0A 1CLYH 4NRYA 3JV6A 5C0JA 3O9WB 5F7MC 3C9NB 4PGZA 1F4YL 3MLVL 4N8CL 3FOMB 4LF3B 5HY9B 3Q3GB 2HJKB 4ZXBC 4XPBL 1ZS8B 3G5ZB 3OKEB 3WIIL 3GJFB 2DM4A 1YNKL 2GFBB 3KXFA 1Z9SA 4JY5H 1FYTD 1JHLH 1P5VA 4QRPE 1QFUL 5EU7E 4AG4L 1GHFL 2R0LH 4Y4HC 3CXHJ 1M71B 4NJ9L 4ONGH 5DMIH 3SDAB 4QY8B 5J4MA 4LCUB 4WHDA 5I8OL 2XA8L 3QUYB 3M17A 1JGUL 4M3JA 5IVXF 1U8MA 3HNSL 1UCBL 4UZGA 5C0RH 4UTAH 2OMNA 3SDDC 3WKMH 4MHHI 4PJ5B 1XGPB 2BMKA 5ICXB 5EIQA 4G9DB 3T65B 3GRWL 2A6JA 3BIAX 4Z5RB 2B0SH 2UYLB 4YBQC 2YUWA 5HSFA 3RKPA 1OM3L 3I2CL 2OR7A 3HR5A 3I6GB 4LSTH 1DFBL 4C83B 5EBWA 2A9MH 1MNUL 2HFGH 3NFPA 2OK0H 5LCVH 1BM3L 2BCKA 3TVMD 2Z4QA 5EU5B 2XTJD 4G9FE 5F88B 2HG5B 3QUZB 1RZIA 2P7TA 2ADIB 1JUFB 1BOYA 4QXGL 3VFRA 1CL7H 4TUOA 4OD3L 1F6AB 3MV7D 4ZPVB 4J6RH 4N0UA 1HWGB 1UH3A 3TN0D 1HHGB 2WBJB 3EZJB 4M9PA 4OZ4A 4XP1L 1NKRA 5E99L 3MRNA 3QIBC 2CMRH 3HE6B 2CDFB 3VCLB 2Z91A 1CD9B 1IAMA 3K1DA 3RWIB 4OZHB 5TGBA 3HS0B 4IRZH 3LH2L 1KLGA 2I24N 4NQTA 1KCRH 1JHLL 4M1DH 4MQ7B 4MD5B 4KKBC 1MWAH 4LDLB 1WT5C 3O41A 2C26A 4RFEA 1N2RA 4NOBA 1ZAGA 5FXCH 1CT8A 1L6XA 3VWJA 4ONGL 5DO2D 1Q9LB 4XMKH 1FNAA 1HE7A 1QYGH 4O2FB 3FO0L 1GGTA 4HIHA 3CCHB 1SMAA 5DJCA 2H9GB 2FO4B 1HHKA 3LSOA 3PL6B 1QBMH 3ARYA 1I1YB 5D7KE 4JM4L 4NC1E 4LNRA 2O61B 1YECL 3QFJE 3WKML 3DROB 1W8OA 3HC0B 1UM4H 2FH8A 2DMBA 3QXAA 3X14A 2C4FT 4HXBH 5D5MB 3MJ9H 3MRLA 3WFBH 2I9LB 3MNVA 4B0MM 5D1QA 4LSTL 1N8ZA 5EU6B 5FO8A 4WNQB 3ARFB 3KS0J 3R1GH 5IQ7H 2A9ML 3S8WA 1U8LB 2OK0L 5AD0B 5EO0B 3DMMB 5LAXA 3B6SA 5GSRA 1JPFA 2AJYL 2D31A 1A02N 5D7IA 3MYZA 2ADFH 3QNYB 5C08D 3QFJB 3QA3A 1J12A 5E4EB 5ALCH 3EOAA 1U8QB 4V1DA 4KVNL 5JHDA 1ZHLB 2DTMH 3QDGA 5AYUH 1F4XL 4JQIH 1OARH 2ZSVA 4J6RL 3UYRH 4KV5F 1JGVH 5ISZE 5HPMB 1T83C 3QCUH 2H3NA 4GRWH 4U0RC 1LK2B 1DZBA 1BWMA 4TSAL 1CFBA 1MCEA 1CE6B 5DJZA 1ULVA 4EUPG 2CMRL 4FS0A 1CFNB 2YPKB 2VIRB 1KB9K 3FQTB 2VLKA 3FN9A 3DX9B 5D2LF 5DSCB 1BBDH 3VXQB 2HN7A 1QEWA 1KCRL 4Y7MA 1WJ3A 3HA0A 5SWZA 5IBLC 4HK0B 3VXUB 5KSVA 5TDNB 4N5UA 4PJHB 5CWSA 3KLAB 3UTSA 4XAKE 1JMZA 2OTWA 4XC3L 5SX5H 2FHFA 5ISZB 3O4OC 3L95B 4OFYD 1S9XA 4LAQH 1RVFL 4JVWA 1QYGL 1X4YA 3VFGH 1BMGA 2I9TB 3BEWA 5ALBH 4Q6IC 5D7LA 2BHUA 4EI5D 2YXMA 3RTQD 1CICB 4AH2A 3OAZK 1WAAE 1V3MA 1U58B 4ZSOB 3F6LA 2K7QA 4IMLA 1RZFH 1JN6B 3NA9H 4G8EB 5I0ZA 4KZEL 3S3JA 4ZG1A 4XC1L 4CMHC 2AJVH 2BVTA 1UYWH 2CPCA 3PQYA 4XWOD 3MJ9L 1KIPB 2MMXA 4X8JA 1YEFH 1I8KB 1PGRB 1VFMA 3GMNB 4HS3B 3CJJA 1OLLA 3AY4A 1AIFB 1R3IH 5ESVA 1KN4L 1T04A 5F9JA 4P2OA 3ARZA 2VXTH 4M1CC 3FQUA 1JRHH 4UNVA 3QWRD 3ZSTA 1CE1L 1N3NB 1QSZA 2F19H 2GY7B 2VYRE 4WV1C 4JHBA 5TF0A 4JGUA 2EEBA 2DTML 4PJ7B 3BEVB 4YHYB 4HS6A 5B3JE 1A1NA 4JQIL 2VXQH 1FZOB 1LO5B 1JGVL 4PTUA 1SJHB 2X4RA 4QHMB 5CIPB 5IFHL 2NX5E 2FX8H 1C5BH 1N6QL 2FD6L 2AJ3B 3IFPA 4Z7VE 3ULUL 3P3YA 2XICA 1BVKA 4XNQA 1UKSA 4ZYKA 3TZVB 2FX7L 1BBDL 3RWCB 2HTLD 3C5JA 3UO1H 4JJ5A 4ZMAT 5GXBB 1BLNA 1ZMYA 2EIZB 3H3BC 1CLCA 5EC1A 4CNIB 4P3CL 1VCAA 4PG2A 1YPZB 4I4WA 3QDMB 4M7ZC 3WS3B 4PRIA 3ES6B 5EBLA 3V5DA 1GGIH 3VFGL 3ILQC 4B7IA 4O02L 4Z7VB 1RZJH 2WP3O 3T2PA 5DHXB 5FM8A 3SPVA 1TVBB 4MJ6B 4EQ2A 1MIMH 5L88H 4X4XB 4NZRL 1Q9OB 5I17A 5IEHA 5K59E 2CXKA 1ZA6A 1DJSA 1KPUA 5SV4A 1XIWC 1MH5B 3H0TB 3DIFB 4HZAA 1FCGA 3WJLA 3WFDL 5GS1A 3FB7A 3JTTA 1UYWL 1MCDA 4QOKB 3WXVH 4C58B 1XF5B 4XVSH 1OGAB 4LMQI 2BY2A 3IJSA 1B9ZA 2HFEA 3G04B 3WUWB 1G9EA 1U3HA 1AQDB 1FGVL 1MLBB 5L7XH 2OI9C 1TETL 3DUSB 1GYAA 4OF0A 3HPJB 1C1EH 4YEFA 1V05A 4MB5A 1FAKT 1F3DJ 3PXHA 1HQ4B 1TZIA 1E4WH 2IBGA 1NCWL 1Q0YH 2BHZA 4K7PY 2VXQL 4KJYB 4Q0XL 3QUMB 1E27B 3OQ3B 1FNHA 2FX8L 2H41A 1HK6A 3FOMA 4LF3A 5HY9A 1OQXA 3Q3GA 4P0DA 2HJKA 4LVHC 5KSUB 1ZS8A 3G5ZA 3V6OE 2O5XH 3JBG7 1MI5B 2NY3D 3DETC 1FYHB 4HGKC 3OKEA 1NBYB 3NH7L 4LBEB 2LTQC 2GFBA 2HFTA 3UO1L 3ZDYE 4MNHB 4P5TD 3QG7L 4OF6A 3VXRA 4B7LA 1MELA 1RY7B 2VDKL 1FZJB 5FA3A 1I1AD 4NNYB 4KKAD 4P2RB 2Q87A 1YY9D 2VE6B 5E8DH 4YJZL 3SDAA 4CL7A 1OTTD 3FRUB 3PF2A 1RZJL 3TF7C 4X7CC 3QUYA 5TH2A 1Z9MA 1T0NB 1MIML 4FFZL 1WFTA 2OL3L 3OKNA 3F12B 4U1JB 4F15B 5F7HA 4PJ5A 3IYLW 4M8VA 3U9UB 3BX7C 4G9DA 3AM8C 3T65A 5IV2A 1CGXA 4P2QB 5D7JB 4Z5RA 4WW1B 2UYLA 3WXVL 5F6HJ 1CZ8H 1IKFL 4X9HA 2D03H 4XVSL 3UPCA 3MUZ1 1UQSB 1OCWH 2PF6A 5B8CB 4L3ED 4XB8A 1I9IL 4LGPB 5GJTH 3KPNB 4OUUA 4ZTPH 1V7MH 2J4WH 5EU5A 1C1EL 2Z93B 3L3GA 5CILL 5T5NF 4NPYB 2HG5A 1LO3H 5EZOH 4G3YH 2EKSB 2ADIA 4K7PX 2FO1A 1E4WL 3ROLA 4K7PH 2KKQA 4L8SB 1XF3A 2WQ8A 1T3FA 1WLHA 4GRLB 2EDFA 5HHPB 1JBJA 4V2BA 4DW2L 1HHGA 3BKMH 2WBJA 4NKDB 2P46B 4MLSA 4OM0L 1D7FA 3LEVH 3O3AB 4FQXB 1T20B 4NBXB 4ZNEA 3HE6A 2CDFA 4P4KC 4I18C 3N85H 4OZHA 3NCYP 3RWHB 1JP5A 2EE9A 3RVTC 2VR5A 4ZUVB 3RX7A 3IDYC 4YGAB 3ZTJH 5J1SC 4NN5C 1NCUA 1MFCH 4L9DA 5I6XB 5F9DC 5FEBA 4MQ7A 4EIZC 1VB9A 4WFGE 3ULUE 5F6IC 2OXHA 4G80A 2GSIB 4KUZL 1KNOB 2DLIA 5T3XL 3OG6B 4O2FA 1X7QB 4QRRD 3D85D 4S1QH 1E4KC 4FXLA 5DC4B 5ILTH 3CCHA 1JYVA 4YUEL 1CGYA 3C09B 2BSSB 1ZT1B 2FO4A 3PL6A 1D3CA 2YN5A 3D39B 2FEDC 3FQWB 5AAWA 4PUBH 5L8KB 1R6VA 5FYKD 2AJUH 2DLGA 2OYPA 1ZTXH 3AREC 1R3LB 3DROA 1UH2A 1RURH 4UIKH 4P3DB 4HIXH 5JR1L 2XPGB 5EOCL 5DQDL 1G0DA 4MZ3A 3BP7B 1RK0A 1LE9A 5D5MA 2D03L 3M1BB 1FDLH 4DZ8B 5IB2A 5E00B 4R90H 3ZTNH 1OCWL 5EU6A 4LDOB 4WNQA 3ARFA 3VFTB 1OAUH 3WNNA 4U1HB 5I0DA 5EO0A 5F6HI 3U0WL 3BAEH 1EBPA 3O4LD 1JZ6A 1V7ML 3QNYA 3CSPA 2QQLL 3SGKC 2XXMB 4H1LH 4JY4A 2Q6WB 1U8QA 4FN0A 4G3YL 2X09A 4JM2F 3MROB 2LVEA 2WLZA 4U4BA 1IM9B 4K7PL 2IAMA 1ZHLA 2P43B 4HBCH 4GBXC 5DJYB 4ODBD 2HYMA 3ALPA 2BNRE 2P5WD 3BKML 2H32B 4XCCH 3RGVA 4R6UA 4NRXA 2PYED 7FABL 3GHEH 4I0PC 2DI7A 1CFNA 1A4KB 2YPKA 4DTGH 3FQTA 4PJFB 1DSFH 3DX9A 2V17H 1KCSH 1RIUL 1MFCL 1BVLB 3NIDF 2EZ0D 1GAFL 3CAFA 2V7HA 4HK0A 5CEZD 1S78D 2FBOJ 3VXUA 3QEUB 5DHVB 1WFNA 3QDJE 4PJHA 4CJ0A 5C0AE 2DIAA 1I3GH 3DX6B 2K7PA 3L95A 2BNRB 3PWVB 5DUPH 3IXTA 3QQNA 3TPUA 5HBBA 2I9TA 3G6AA 1C5CL 5TDPA 4LDEB 3TLRA 5D7SH 4X6BB 2IBBA 1T6VN 2PO6A 3QIWC 5ENWA 3C6LD 4ZSOA 1MQKH 4CN4A 4H8WC 1S7RB 5IEKB 4XCYB 2WWMC 2EECA 1RURL 1FAIH 1JN6A 3PDOA 4OQTA 4UIKL 4G8EA 2ARJQ 4HCRA 4JFFB 4KPHL 5LJYH 2JIXB 5CINH 4W4OA 5C0AB 1WGOA 4HG4J 3Q0HA 3TBVA 1KIPA 2WUBH 2FECI 1I8KA 3GMNA 3ZTNL 4YQXH 1AIFA 1OAUL 5J9PA 4X9IA 2OR9L 5IFAH 1HKFA 1R5VB 3E1F1 4GS7B 3BAEL 3RDTB 3TCLB 1CGUA 2W0FA 1N3NA 2X4TA 3E6HB 1A7OH 1OSPH 5L2KD 1JF6A 1G9NH 3B5HA 1P84K 4PJ7A 3BEVA 1C8PA 2YSSA 1FZOA 3MLTB 2NW2B 2MPAH 1LO5A 1T7XA 5TDOB 4QHMA 5CIPA 5JOPD 3UPRB 4TSBH 1KC5L 3MLYH 2AJ3A 2AXJA 1KBGL 2MWCA 4DTGL 1FL3A 2V17L 3RWCA 3H9YA 1AD9B 1QSFB 5F7LB 1D6EA 3D0LA 2EIZA 4LCIH 4KK8C 1MFDH 1EJOH 1WCBA 4BK4A 4LKXA 3BRDA 1QA9A 1YPZA 4LPWA 4CVWA 3QDMA 3WS3A 4MHHG 3ES6A 4QTIL 3P0YH 4GAJH 4UQ2A 3NAAH 4MA3B 2R1XB 5A16A 4LOUC 1N5AA 1ETZA 3Q6FB 4EI6B 3HC4H 2KL6A 1G6RH 1S9VB 4FQQA 4OBSA 2CRZA 4MJ6A 3REVB 3U7YH 2D0HA 1FYTE 4X4XA 1KENL 4XI5C 2J8HA 5T3XE 3BJ91 1FAIL 2DL2A 4N0YH 3H0TA 4N68A 2I60H 1G7QB 1N5YL 4KVCH 1QPXA 3HMXA 4PB0L 4QOKA 3V8CA 5GZOD 2EDKA 5GGQH 2Y07H 1KLUB 1OGAA 2O5ZH 3GM0A 5C71A 4NP4H 1I1FB 1R24A 4QRQB 4PJBB 3WUWA 3G04A 3CX2A 4X5WB 2VDRL 5SV3A 3LKRA 5IFAL 2OS7A 4XVJH 1A22B 3FFDB 3HE7D 5EDXA 3DUSA 3N0PB 3WIHA 3VXOB 3DSFL 2EXWD 1EGJA 3BP6A 1ZEAL 1TITA 4KC3B 4NGHH 4TVSa 1RIHL 1U2HA 3MOBH 3WN5B 3OX8A 3VMOA 1ZWIA 4KJYA 1FO0H 3QUMA 2G5RA 4UIMB 5CFHA 4TSBL 4B53A 3WEXB 3MLYL 1F5WA 5HHMD 1ZKAA 5KSUA 2ZUQC 2CKBH 1MI5A 5EU4B 5I66B 5DRWB 2OSLA 1N0LA 1NBYA 3KDMA 4NWUL 5BCAA 4H5SB 4LBEA 5C86A 1UADC 3IRPX 4MNHA 4CU8A 4G5ZL 5MHSD 1YEDA 4M1GL 1MFDL 1EJOL 1FZJA 3EKCA 4P2RA 1CI5A 2VE6A 3CLFH 2BVOB 4GMTH 4YHML 2VZ3A 3NAAL 4F58H 5AZEH 1HYSD 1YNTA 4LQFH 3L3HA 5C2BH 5IQ9A 1G6RL 4Z7QE 5EIIB 1HXMB 3MJ8B 1T0NA 3U4EA 1LILA 1VFAB 4UT7L 3FONA 1H15B 4P2CG 4U1JA 1EHLL 3QAZC 2W9DH 3U9UA 4FMFA 4KVCL 3DVGA 1U8KB 4IRJD 3MRRB 4P2QA 2DQDL 2PR4H 2VXSL 3MLZH 3BGFC 2AJSH 4FQCL 1U42A 4FZEH 3CXHK 5CAYB 4P59H 4G8IA 2DIBA 2DICA 3L3KA 4TULL 4PP2A 1J05B 5DEZA 5B8CA 4HK3J 4XVJL 5IG7A 3KPNA 3MGOA 2DLFH 1EUTA 5LKNA 1UT9A 3H9SD 2Z93A 3LV3B 4NPYA 4NGHL 3W5MA 4KTEH 5LXGH 5C09A 1HIMH 4B5EA 2EKSA 4AIZB 4HXAL 2WMPA 3MOBL 4U1KB 4DVRH 3SE9L 2IALB 1MCSA 1RI8A 4HV8A 2F53E 3NVQA 1JNJA 4ZQKA 4A2MA 2VDQH 1XR8B 4NKDA 1DQDL 3JWDC 5DQJA 5JXEA 2CKBL 1IAIM 3IJHB 4I3RL 4YAQB 3QEGH 1R3JA 1T20A 1A0QH 5GRVL 5D1QC 3VDCA 3FT4A 2YEZB 4LLUB 3RWHA 4BSVB 3QPQD 1QFWI 4Y4KD 4ZUVA 4NN6B 3OKYA 1ZLUH 4OFIA 2DF3A 4LRNH 3T08A 2ZCKH 1WFUA 4EN3B 3C08H 4R9HA 2GSIA 3VXPB 1P4IH 3CLFL 3KPRB 2F53B 1KNOA 5ELIA 4GMTL 3DARA 4KDVA 1NEZB 1AJ7H 3B4NA 4R2GD 4TTDD 5TPWH 4F58L 1X7QA 5JA9A 4TVPL 2ZNWA 1P2CA 3ULVD 3IF1A 2BSSA 5CZKA 3BW9A 1ZT1A 3D39A 4X5XA 3FQWA 5HDLA 5KG9B 2UUDK 2CRYA 3JV4A 3BE1H 3E2HC 1R3LA 4MQXD 1TCRB 4ESKA 4Z8FL 2A74B 5FYKH 1Y0LB 3PGFH 4TQEH 3QNXB 1TNMA 4L1DA 3MLZL 4LPCA 2AJSL 4KROC 2Y4SA 3BP7A 4P59L 4WJ5B 3IDNB 1N59B 3M1BA 4DZ8A 2ATPB 1I7UB 3BDBA 5E00A 2ENSA 3WSQL 1GZPB 1II4E 1NGPH 3THMH 3TYFB 3VFTA 1UZ6F 5HYJD 4U1HA 2ZOLB 1NCNA 2UVFA 4EDWL 4ZS6D 2NY1D 2ZNXA 2ZUWA 2DN7A 4HDIB 4CU6A 2XFXB 4KJWC 2G2RA 1FC1A 2Q3AA 3GKWH 1HIML 2CK0H 1ONQB 3MYJA 2N7BA 3T4YA 3SE8H 2GEEA 5E2UH 2IQ9H 2IANB 2NXZD 5DJYA 4YDIH 2IGFH 2VDQL 2H32A 2J3SA 4RWYL 1OAXL 3WUWG 4U1MA 1OD9A 4LGSB 3QEGL 5IBTL 1A0QL 1MCPH 1DVFB 3K2UH 4IS6A 3M8OH 2A6DB 4OFVA 5H37G 1NBQA 4PJFA 5CSBA 3AY4C 1HOCA 5I1HL 1EXUB 2EDDA 4P2OC 3FQNA 1BVLA 5HHOD 4K71C 1GH7A 2ZCKL 4YHOH 4HUWA 5IOPA 3KYOB 3QEUA 2CR3A 5DA4A 5A2JH 3P77B 3MFFB 3SEPA 5F1IB 4NBYB 3W0WB 4LU5H 5D6DA 3PWVA 4M7LH 3S5LB 4HX1B 4R4BB 4ZFOL 5T3ZD 4TUJB 3VD7A 4U6YB 1NC2D 2GHWB 1T03H 5DS8B 4AEIH 3BE1L 1A6WH 1S7RA 4QNPE 1AO7D 5IEKA 4XCYA 4XH2A 2D7PA 1JHTB 1A1OB 4JFFA 3PGFL 2VQ1A 2VDOL 4TQEL 2JIXA 2NY4B 2X4SB 3DVNB 4DVBB 1PKOA 1CGSH 3ZT6A 5F1OB 5CZVH 1NGPL 3THML 4PG2C 3L5IA 5GGSY 4I2XE 5BZDB 1J1OL 2EDWA 1D5MB 1R5VA 4NC2B 4DQOH 3X3FH 3JUZA 3RDTA 3TCLA 2E9JA 1IL1A 1CYGA 4Y4HD 2GJ6A 1VSCA 2CK0L 3E3QE 4NUGH 3RHWF 5J1TC 5E2UL 2IQ9L 3KPSE 1U92B 4YDIL 3VGDA 2IGFL 1QRNA 4XNZC 3UPRA 4M93B 3WJLC 4ODHL 5GS1C 1JGEB 3SDDD 3TO4D 1LK3L 1TTFA 5IW3A 3MLWH 3VFUA 1HSBB 3DRQB 3K2UL 2ERJB 3M8OL 4OCNC 2GAZB 4Y1AB 4XCEB 4K07A 1U3HC 2NLJA 2Z31B 5JW3L 4LPXA 1EJ6A 1AD9A 1QSFA 4PJCE 1MF2L 1MJJB 4U1GB 2XN9E 5CEZL 3QHTC 4O00A 4M7LL 3PWJB 5EULV 4G7YH 4EI6A 2X4OB 1S9VA 1UXWA 3VXMA 4Z0BH 1ND0B 2OQJB 4DN3H 3CSYA 1W0WB 5BRZA 4L8DB 4PJCB 4TVPE 1G7QA 4FFYL 4FXGB 3NOIA 1S7WB 2FL5B 2UVEA 2B7DT 3VXSD 5I1LB 1CLZL 2XN9B 5A2LH 1VPOH 2CIIB 2J88L 5DC9B 2XKSA 2LVCA 2EDNA 4IHOB 3QIBD 2DI9A 3RWGB 1KLUA 2FEEL 1P7KA 2IQAA 2J8UE 1I1FA 5TE7H 4QRQA 2X42A 4PJBA 1QFHA 3RUGB 5K9JH 1NPUA 3TA3B 4YHLL 4ODVL 3SDAC 4DQOL 2BOCB 4P48A 5C70A 1IQWL 3VXOA 1G0YR 3MLXL 3D3VA 2CRMA 3GSVB 3QUYC 2X10A 3BUYA 4JM2A 2J2ZA 1IEAB 5C0CE 4B50A 3W5NA 3BOVA 1URLA 4KDTA 1AKJA 4G8GB 3RJQB 4E42B 1AFVH 3EJYD 4L3EE 4ONFH 4UIMA 4PJ8B 4NQXA 1CFSA 4XPAL 4JFQB 1K5NB 5JDSA 2X05A 3TNNA 3PHSA 1Q72H 3MLWL 1C7TA 5EU4A 5DURB 5DRWA 2EE2A 2F5BL 3OR7A 5D1XA 2FR4A 4G43A 1LO0H 4H5SA 5J6GB 4HUNB 3OKLB 5ICYB 4JFDA 4ODTL 5FV1L 4NQVB 5I30H 4BQBA 5FKPB 4MJIA 4RMVA 5C0CB 2OP4H 1SHMA 2FIKB 4UILL 3O2DH 1T2QL 1L6ZA 2YC1B 1KULA 3FT3A 1WAAF 1HXMA 5TE6H 1SBBA 1I1CA 5T1LB 2WBJC 3IETB 1K3IA 5GISL 1H15A 2BZDA 2HKHH 3BZEB 4DN3L 5JZ7D 2QKIB 2KH2B 1PZUB 5I2IB 3HE6C 5F3BB 1U8KA 5J12B 4HSQA 2X7LB 1BZ7B 4MNQE 4QRRE 1MRDH 3CVIL 1CIDA 2YPLB 4L29B 1UENA 5TE7L 3ZDZE 4LSQL 4WY7L 2A1WL 3G5VB 3P4NB 4HIEB 1GCFA 1WWWX 3D9AH 4KKCD 5IBLD 4NDMA 3U9PH 4GXUM 2FB4H 3LV3A 2QSVA 2XRAH 2R4RL 3PL6C 4OT1H 5E5MA 4AIZA 1P1ZA 4U1KA 5B3JF 2GT9A 3OJMB 4JO2H 4NIKB 5DR5H 4MNQB 1EO7A 5I76A 4MZ2A 1AFVL 1KJVB 1HSAA 1U3YA 1FGNH 4S1RL 2F74A 3PG2A 4L4TA 5EG6C 3KPPB 3WLBB 1H3PH 3IJHA 4YAQA 4X6EB 5BO1L 1LO0L 2WQRA 4X7SH 2YEZA 3ARFC 4LLUA 4BSVA 5IMKB 4O9HH 5T5NG 1F8TL 3DMMC 5ITBL 5I30L 1KB5H 4LCWD 3EYOA 1IGCL 3L1OH 5C7XH 2P5WE 1P4LA 1T1XB 4EN3A 4KI5C 5E4EC 1PSKH 3ARXA 5EORH 5DFTA 3KPRA 2A38A 1BREA 3RWFB 2HTKC 1NUNB 1RUAH 2ED9A 4XRCA 4HKZB 3OTTA 5KSAA 2P8MB 2IPTL 3KPLB 3RAJL 2IFFH 3ULVH 1YN7A 5KG9A 5K59F 5CEZE 1F02I 1Q9KB 3ZHLA 2R9HD 4LPVA 3U79A 3GSNL 2A74A 1Y0LA 4ZUUA 5IMOB 5GRUH 1IC5L 5TQ0L 4A6YH 1MRDL 2FHBA 3IDNA 2YD8A 3RZWA 2BFVL 3ZT7A 1QR1B 4UDUB 4JRYD 3PHQA 4FP8H 2YD2A 3TYFA 3D9AL 1ZK9A 2ZOLA 4HFUL 4ZS7H 2VLMD 3D18B 1RUMH 2C7UB 3U9PL 3CFCH 4OCWH 2XFXA 3DYOA 3IXAB 2FB4L 2UY6A 2XRAL 3UMTA 4RMWA 4TUKH 4U7KA 4MCYB 1BFTA 3EJZD 4BH7A 5DR5L 1IEBA 4FTVD 3C60D 3LY6A 1LEKB 2IANA 3TEUA 4RGNB 1ZSDB 4L9LB 5I8KH 3SO3B 1HN1A 2X44D 4W4OC 1E4XH 1JHKH 5D2NB 3A6CL 3L9RB 3LDBB 4UV4L 1AY1H 2EDOA 3WHXA 1DVFA 1IT9H 3VD3A 2AEPL 2A6DA 2BNQE 3ZDYF 3MGTB 4QRSA 1W72H 2PXYA 4O9HL 1BIIB 4XXCA 3CK0H 4WUUE 4S1DC 3MXWL 1A6AA 4ZODA 3L1OL 3DTXA 2NY0B 3HKFA 5JOPE 2QADD 2VITA 1GOFA 1ZLWK 1FIGL 3NIFE 4DEPB 4U1SA 4H88H 3W0WA 1RUAL 5CP3H 4Z0XB 1E6JH 2QL1A 4R4BA 3TWCH 4TUJA 2ICES 2Y5TB 1UM6H 4U6YA 1PKQE 1JF1A 1NFDE 4HC1A 3O3EB 2IFFL 3F7VB 5DS8A 5T3ZH 2BNQB 4O51B 4X5LA 3ECBA 5E6IA 5HGDB 3QSKB 5I8EB 3P0GB 1EZVY 5DJDA 3CMGA 5EB9A 5J7CC 1T0MA 1RZGB 2Q20A 5GRUL 3UTTD 2Z8WC 2Z8VC 2X4SA 3TBWB 3VRLE 4A6YL 3DVNA 2K9UA 5IFJB 3DETD 4OLEA 5C07E 3HPLB 4MDIA 4NQEB 2XKNB 3NCJL 2AXHA 1JZ3A 4PRAB 1D5MA 4ZS7L 1RUML 3KAAA 2E9WA 5CJQH 3CFCL 5KVFH 3I6LD 2EC9U 4MNGB 1D5XB 5HYSA 3SKOB 4C54A 3OR6B 4MA1B 1OAQH 1MEXH 1AQKH 1U92A 4HG4K 2CR6A 3QH3A 4E41E 5C07B 3FO2B 1LEIB 2JJUA 2VZVA 3ZE1E 1JGEA 3T0EE 1ZGLB 1E4XL 4PV9B 5IVZB 1AY1L 1BD2A 1HSBA 3VGHA 1IT9L 3EOBB 1OY3B 1WZLA 2GAZA 4Y1AA 4HS8L 2MQ3A 4XCEA 3CK0L 1FVCA 1FV1B 3WO3B 2XNAB 4ONOA 4YFDB 3ULUF 3BH9B 2W92A 3U30C 1ADQH 1OSZB 4NO5B 3T2NH 5CUSL 5GPRA 4E41B 2XWTA 2AQ3A 3QHZH 5DYOB 4HWBH 2BJML 1E6JL 1NCCH 3T0EB 4CDGC 3TWCL 3D6GA 4NQSB 1UM6L 3HG1D 2X4OA 5SWSD 5T3ZL 2PTTA 5HDBE 1AC0A 2OQJA 1KFAH 2QV2A 1T7YA 1W0WA 2JB6B 4G7VH 2GK0A 3ROOB 4L8DA 3SJVD 4FXGA 1KIUA 1ZVSB 1CL7I 2B4CC 3MRQB 4DGYL 4P3WA 4BSWB 2CO7B 1KCVH 2AVGA 3RWGA 5I16A 1KGCD 4HKBB 1MOEA 2OZ4H 4CMMA 2MQ0A 3RUGA 1KYOK 3VRIB 2ZG1A 3VXTB 4YDKH 3QCVH 5JW4M 4PJ9D 4M8QB 2BOCA 1HINH 2UY7A 5KVFL 3LKSB 3QPXH 5EC2B 4YC2C 1ZVYA 5FUZH 3N1MC 2YD5A 2BC4B 1IEAA 5K9KB 5E95B 4HF5H 1FG2A 1HCVA 3QUXD 1D5ZB 2BDNH 4FZ8H 4G8GA 4F15C 4MLIA 1GXEA 3H8NA 2FEDD 3V6ZB 4PJ8A 3DPBA 4LEXH 1YN6B 2XIDA 4LVNB 1I7ZB 3ARED 3H9SE 1PG7X 1DQTA 4GG6E 3PHOB 4BQ8A 4NM8H 4ZAKB 1FL5B 1U6AH 3UYOD 4OZGB 5J6GA 3OKLA 5B8CC 5T33H 5ICYA 1T5WA 5E8EA 4H26B 1RK1B 4NQVA 2Z8RA 1IARB 3T2NL 3LKPB 1RV6X 2FIKA 5F8RC 1Q1JH 4ORZC 1GC1H 4HWBL 1NCCL 1EFXA 5HHXH 2VWEE 4K23H 4Z76A 1KJ2B 2YC1A 1QKZH 3DBXB 1V7NH 5DJ8B 3SCMD 4D0BB 3FB6A 2YD1A 3AFLA 43C9A 4F37F 4QT5A 3AB0B 3T0WA 3IETA 3QQ3B 2QKIA 3QQ4B 5I2IA 3D2UB 5JXEC 4XZUB 1EVTC 1NMBH 4FQXC 1GPOH 4QGTA 5IESH 2IWGA 2X7LA 1SYVA 1BFOB 1EMTL 1U8HB 3BYYA 1KCVL 4XT1C 3EFFA 4I0PD 4XHJC 2YPLA 2OZ4L 4L29A 5I6XC 2VO5A 1S7VB 4MXWH 4ELME 1YNLL 1GZQB 3P4NA 4HIEA 4YDKL 3QCVL 5HI3C 3NCFB 4YHPB 1JTTA 1JWUA 1HINL 4LHQB 5MERA 3QPXL 2VH5L 5LGHH 1XF1A 3GJEB 1DBML 1EIBA 2DKSA 3C09C 5F1KC 3TPKA 3KJ6H 1BECA 5F89B 5JW5B 4TRPH 2W59A 3BQUA 3IFLH 4RAHA 4WHYG 4Y19E 2BDNL 1HHHB 1VENA 1A7RH 3F65A 3C2AH 1NSNL 3QIWD 4LEXL 4G8FA 4Y4FA 4I0KA 4PPTA 2ORBH 3KPPA 1EO5A 2WWMD 1T21B 5HGHA 5E7FA 3WLBA 1PG7L 5DWUH 2ENYA 5T1MB 3TO2B 4LIQH 4NCC1 4N0RA 2WWKT 3AXLB 5IMKA 4U3CA 5HYSG 1WWCA 1XEDA 3B9AA 1L0XA 1LP9B 2R56L 4F7CB 3BIKB 1T1WA 4IMKA 4PJXE 4Y19B 4WW2B 1G7HA 3K80A 3A6BH 5GIRB 4YXHH 1Q1JL 2RHEA 1GC1L 2FX9H 1PY4A 4KHTH 3CLEH 3DV6B 2A2QT 4X6DB 3G5YA 5HHXL 4HKZA 4YK4C 4ISVB 1QKZL 4R96B 4LSSH 2P8MA 4KMQA 3KPLA 4J4PC 1IM3B 2KBGA 1NC4B 3ULSB 1JRHI 3T2QA 2R4SH 1Q9KA 1IGIH 1NCBH 1AI1H 5IESL 4LHUB 4C56D 4PJXB 4IRSB 4BUGA 5IMOA 1C16B 1V3LA 4JFXB 5LGKA 1QR1A 2PW1B 4Z7UA 1NBVH 4JRXD 2NXYC 4U1LA 3LIZH 5BS0E 4X0KB 2DYPD 1AGEB 4WI8A 5D6DC 4Y2DB 4A2LA 5LGHL 3EDKA 1GIGL 3IXAA 1WBZA 1MJ8H 4LSDA 2R15A 2HT3C 3WCYA 1HHJB 1FNGB 1ORSB 4TRPL 3N9GH 3MNZA 3IFLL 5EZIL 3MR9B 4J3XA 1A7RL 3MCLL 4HUUA 1ZSDA 2FDBP 2CGRL 3C2AL 4KQ3H 4ZFGL 1OAYL 2BSTB 3LQMA 3WS6A 2ORBL 1LO2H 4XI5D 5D2NA 2ZJSH 3CPLB 2DDQH 5E8PA 4LIQL 3NN8A 1ZHBB 1ZHNB 3TBYB 4N9GB 5DJXA 1QRKA 3MGTA 4AQ1B 1CXFA 3I50H 4ZXBB 3L6FB 4NKIH 4EDXB 5IT2H 4GS7C 5DMGD 3RDTC 1WK0A 1DN0B 2VN7A 4PRNA 4YXHL 4NNXA 4Y2OA 5F7EH 2FX9L 4O4YH 4OGXL 5C6TH 5I1IH 4KHTL 1U9KA 5K9QI 1U8IA 4Z7QF 4LSSL 3O3EA 1QR4A 5JLZB 4O51A 1KELL 3LN5B 5DVKA 5HGDA 1MHCA 1QSED 2Q8AH 5FYJU 1P4BH 3MV8D 1XF2A 1A6VH 5DUMH 4CJ1A 1MCOH 2EDRA 1RZGA 3BMWA 4C59B 3TBWA 3P30H 3HR6A 5IFJA 3G6JB 5EUKA 4GKSA 1SMOA 3HPLA 4YPGB 1NBVL 4NQEA 2FJFB 2XKNA 1NMCC 4W70A 2NY5H 3IJYB 4ODWA 1L4IA 1NGYB 5D96B 2DQTH 5E08H 4P57B 4PRAA 3IVKB 3EYVB 2A0LC 2BRQA 3VDAA 1XZ0A 3VXSE 5MEPA 1TJIH 4MNGA 1D5XA 3FZUD 3PP3H 3NFSL 3SKOA 3OR6A 1A5FH 2H2PD 3ISWA 3D69B 5GGUA 5M94B 2ESVB 3I3BA 4GKZA 1OTSD 5ESQB 2UV3A 3LEXB 3RI5F 3V7MA 1ZGLA 1LO2L 3ARDD 2ZJSL 4PV9A 2DM3A 2DDQL 3MRDA 2YUVA 5A40E 5KZCB 3FB5A 4HH8A 2Q1EA 4ZO9A 3VFSA 4Q9RH 3I50L 4MA8L 4WEBH 5D71H 1FV1A 3P4OA 5KAQF 1VKXB 2E3VA 1TENA 3BH9A 2JCCB 2I07B 1YUHA 1G9MH 3KLHC 4LK4A 5F7EL 5LQBH 3QWOB 1KG0A 5I1IL 5DYOA 3GUTB 2AI0L 5ID1B 4IDLA 4KDTC 4S2SB 4NQSA 4L4VD 5E0QA 3FFCE 3L3JB 2R0ZL 5IF0A 4MAYA 2NQCA 3LPGA 5A43C 1P4BL 5HDOA 2JB6A 3EJJX 4JN2B 4M02A 5DUML 4CU7A 5D1XC 1J8KA 1UEMA 2F8OA 5T1DH 3P30L 3MRQA 2VLJD 1M05B 3MSPA 4BSWA 4RDQF 4KK5C 2DKMA 4HKBA 5IR1B 2R0WH 1S3KL 2YD4A 3PWPE 3FTGB 3VXTA 4PGDA 3FFCB 3AMLA 4LP5A 4HAFA 3HZYB 3SGEH 4M8QA 4WI7A 1DBBH 3ZT5A 3CC5B 4NYLB 1TJIL 1OF2A 1A5FL 1ED3A 1CDHA 3GBLA 2ZCHH 3ZKNC 5F96H 5FGCE 5K9KA 4NQDB 3PJSB 2DQJH 5IK3A 2FGZA 3K81A 4RIRA 1D5ZA 4RBPK 5F3HB 1ZA3A 1KJMB 1G6VK 1FNEA 2LAGB 5F9OH 5DRZA 1EVUA 3FHQA 1YN6A 1U8NA 3PWPB 1I7ZA 1MAKA 1MVUB 5DMYA 4QHLB 1NAMB 5E4IA 4Y88A 4R3SB 3RX8A 2VQTA 1FL5A 4Q9RL 3OKOA 2CUMA 4OZGA 3L5XL 4WEBL 1IKNA 2YPVH 4OFDA 4H26A 3P0VH 4MD0B 5EWIH 3WE6B 1YMME 4OCLC 4YEEA 2WM0A 3UTSD 4U6VL 4K94H 1X5YA 1FPTH 4LIQE 3W9EB 4NRZA 2F9BT 2R2BB 3OAYK 1Z3GH 2DQCH 4XWGH 1KJ2A 3DBXA 2DWEB 1MWAA 5DJ8A 4D0BA 3O4OB 2J6EH 2AABH 3QG6B 4MS8C 5CD5C 4QNPF 5MEOB 1JMXA 3IAGC 3QQ3A 1J87A 3MUY1 2N4IA 3D2UA 2I5YL 4OIIL 4D9QE 4XZUA 2AGJH 1CLOH 3UJIL 5J3HC 5KVDL 3MOAH 3VFWB 5T1DL 3CZFA 2C1OB 3GGWA 4NN6C 4P4RB 3U82B 1NMAH 2QLVB 4U6HB 2AJXH 1BQLL 1FLTX 1QQDB 4APQD 2R0WL 4LP4A 3B83A 1S7VA 4EN3C 1X5FA 4J3OC 3UP1A 3N1GC 1GVIA 5FO9B 1DBBL 5H94A 4O5LL 5KSAC 2GJJA 4X4MA 5EO9B 3H7LA 1N64H 5F89A 5JW5A 5H35B 3EOTH 4JRYE 2DQJL 4U1IB 1DBJH 1A2YA 1HHHA 3GSUB 4F9LA 1DQQB 4DUWA 4GRMA 2Y7QB 3TBTB 2P5EA 2VABB 4HFWB 2AV7B 3OBAA 2YWZA 2XG4A 2APBA 1J0IA 1T21A 3DXAA 5TE4H 4JDZA 4LGRB 3TO2A 4HEPG 2BHYA 3AXLA 4JY6B 4MQSB 3HNVH 5IVNA 3P9LB 4ALAL 1HXYA 5ERWB 5DJ6A 5EWIL 3F6IA 1LP9A 4XNYH 1KV3A 4F7CA 3BIKA 1FE8L 3B9EA 3MRPA 4KI1A 2X1WL 4WW2A 4L4JA 1A64A 3QJHB 2DQCL 4PLJD 3DV6A 3HZKA 4D0CA 4X6DA 4KU1A 3LKOB 5M95B 4FHBD 2VDNL 3GI9H 1OTUC 2AABL 1JF5A 3BRGC 1IM3A 3MUHL 3LRHA 3PIQB 3RVUC 3WJJA 1OQOA 1PDKA 2AK4B 3KPOB 3GMLA 4UOW0 5D8JL 4X7TB 3SE4A 2AGJL 3VWKD 4QRTA 1DVFC 3C8DA 2WLYA 3O8XD 2PXYC 3DURB 3U7AA 1IC4H 4XXCC 5H2BA 1C16A 2Y36H 3STBA 3IDJB 2GI7A 4HJGB 2J8UF 1XIWB 2HH0L 1M7DB 4HULB 3RNQB 5IBUB 3GKZA 1U3HD 3BDYH 4X0KA 1AGEA 3LEYL 4KY1L 4WWKD 1CR9H 1UB6B 4MSWB 4MX7A 4OF5A 3SQBA 1TLKA 4RX4A 3O45B 3BYTA 2NCMA 4PLKD 1GGCL 4LLDB 5DTFB 4OB5H 4E5XB 1N64L 1FNGA 1ORSA 3PP4H 3EOTL 1QFWM 1BAFH 3GK8H 5E6IC 3LMJH 3O9WD 5E2TH 3MR9A 2D7TH 1ZLWH 3UJTH 1JFQH 1T5XB 4UINH 5GSVB 1YYLH 2BSTA 3CIQA 1ZT4A 2E7BA 3WXWH 5TE4L 5C0BA 1I8MA 2F54B 4H8WL 4UUJB 2EDLA 32C2B 5TFSL 1ZHBA 3TBYA 2FRGP 4UDTB 3UC0H 1HWHB 3HNVL 2JK5B 4LVHB 3ZDXF 3MODH 4YWGL 3NZ8B 4P46B 1JVKA 3RVWD 4IOFD 3LPWA 3MXVL 1DE4A 3SN6N 1IAOA 3SDAD 1VFUA 1I75A 1N0XH 3DWTA 2VZOA 1LE5A 4N1CA 4R7DA 3QUYD 4X8XA 3GI9L 2XZCL 1ITBB 3OB8A 3BO8B 5IW1A 4EBQH 3MRBB 3L3DB 4M93C 5I1CH 5JLZA 1J8HE 2HWZH 5HHNB 1H3WM 4R97B 4PJ5D 2YUZA 2PKDA 4P23D 5CP7B 3QNZB 4Z95H 4QRPD 5LBSL 5FKAB 5C0FB 2HLFC 3B3IB 3G6JA 5JNYB 5F71A 3ZDZF 5SWSE 1H0DB 3KYNB 2ZZUT 2FJFA 3IJYA 4U1GC 2F5AH 2UWEB 4HJJL 4MMZC 5I71B 1NGYA 1CR9L 3OKDB 4P57A 1LDSA 1VHPA 3IVKA 1J8HB 2HFFA 3EFDH 3PWUB 4ORGB 2AXFB 3BWAB 5ACMA 3QUZD 3MRCB 4HPOH 1IAIH 3MO1B 4C57C 3MLRH 3D69A 4Q97A 3O6ML 3GK8L 3SDXF 2BY0A 3LMJL 1J0JA 3GNMH 3RVXC 2ESVA 1JFQL 4PJAE 4YGVA 1KIQB 1A9EB 3JUYA 2WBJD 3LEXA 1J0YA 3WXWL 1DBKH 5IW6B 3BPLC 3EO9H 5EBMB 1IAKA 1RULH 1FO0B 3UC0L 4I77H 3TV3H 2P49B 1JK8B 1G7PB 4NKMB 5D72H 1YYMH 1VKXA 3QXVA 3UZQA 1FN4A 2CLVB 4OI9A 2AERT 1AGCB 2JCCA 2I07A 1P9MA 4P4KB 1YQVH 5JIHA 4K7FB 2NMSA 3QWOA 5GS0D 8FABB 4ZUSB 4C4KT 4KMTL 5ID1A 4YHNB 1S9KC 3U0PB 4JFZH 1KB9J 4ZTOH 3T09A 4P5TB 5TQ2H 2L0DA 3L3JA 3W9DB 4PJ8C 5I1CL 2KUTA 2OR8A 5KVEH 2E7LC 4U1NB 4QCIB 5JORB 5LWYH 1I8LA 1R0AL 3WD5H 3MLUH 1T66D 2HRPH 4P9HC 4KRPD 2GCYB 5I15H 4JN2A 5E2VH 2C3XA 2H8PB 1LDPH 3DHMA 4IJ3B 4WFHE 1LNUB 3I84A 1FLRH 1M05A 1AGFB 4J8RB 4YZFF 3QRGH 5IR1A 5L6YH 5BOPA 4WU7B 43CAB 3BH8B 5TF1L 4AK1A 5KS9B 2V2XA 3ARFD 3MJ7A 5BXFB 1Z5LA 1CFVH 3R8QA 3FTGA 3DMMD 1NGZB 3WNOA 5D7KD 3LKQB 1P7HL 3HZYA 4Z18A 3QFJD 5DVNA 4KI5D 1KN2H 5HYQB 2DQIH 4HPOL 1IAIL 4KAQL 3RY6A 3MLRL 2HTKD 1G7MA 2P24A 4NQDA 5CEXB 3GNML 1AD0A 1WWAX 3T2OA 1NUFA 4HH9A 5ANMA 1KJMA 4FG6D 3MRGB 3TVMA 4XP9H 5FDWB 4NJAH 1MFAL 2LAAA 5MENE 1RAMA 1NAMA 2O26U 5DLMH 3QULB 4R3SA 2H45A 4CVXB 1IC1A 2D7NA 2GSGA 1LD9A 2DQEL 5IB3A 3MV7A 3DI2B 5SX5K 4JPIB 3TV3L 4OV5A 1YEHH 5FK9B 1YYML 4UT6L 3VU2A 1R3HA 1S5HB 3WE6A 3NIFF 1YQVL 4HLZH 1KTLB 3O2VL 4KKNA 4XP6H 1AGBA 4FQIH 4MXQD 3W9EA 5ISZD 4Q9CA 4PY8J 4AYFA 3RPKA 2EKJA 2R2BA 4OF3A 5BJTB 3SQOH 1X5XA 1R3KB 3BQUC 4FNLH 3BKJH 1NFDF 1HZHH 1CICD 3VFMA 4Z7NE 1AE6L 1OL0A 2D9QB 5AZ2H 4H0IA 3IDMB 4Y4FC 5MEOA 2YA0A 3AS1A 2YA2A 3HC3L 2HRPL