3EAKA

Nbbcii10 humanized (fgla mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NbBCII10-FGLA
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 28
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eakA00
5B3NA 4GT7A 3PWPE 4OD2B 3QDAA 1CVSC 2Q7NA 5DSCA 3TV3L 3U30B 4ONHA 2OL3L 2C3VA 3CZJA 3THMH 4MD4A 3QULB 3BWUC 1YEKL 4KY1L 3F7QA 2NX5A 3AMLA 3OKLB 4GOSA 1JNJA 3PWPD 4NKOA 1CXLA 2ATKB 1A0QL 1CQKA 3C6SB 4PTTB 3SE9L 3EDEA 3OKKA 1T1ZB 2MSPA 3VWKA 2JCCA 2OJEB 3RWIB 5IKCB 3SGKA 1KIQB 1EZVX 2R1WA 2ICWA 5GIRA 3KVQA 4RGOL 3NA9L 2GUOA 5FECA 3CFEA 4RWHA 2CD0A 2VQUA 1F3RB 3IJHA 5KS9B 4WU5B 4PBXA 1A6UL 5EU6E 5I76A 4PRHE 2PW2B 1MCKA 5DEZA 2ICES 5C0FB 1H0DA 5FA4A 4D94A 4WWKC 1EBAA 3IXAB 1EPFA 1P9MC 5IHZA 5BMFH 4NFDA 3K7UA 4PJCF 5EU6D 2X40A 3LRSA 4Z8FH 3HC4H 4KK6C 1XIWC 5DD6B 1HEZA 3CPLB 3U0PB 1I8KB 4O58L 5JXEC 1MNUL 4RA0C 4H1LB 1CGYA 3D0LA 4MQSB 1T5WA 1JFQL 5ICXB 3RZCA 4JN2B 3H3PH 4KQ4H 2FECL 2HP4A 3D48R 2GHWB 3BKJL 5T3XL 3D9AH 4MGXA 1JYXA 1KJMA 3BIKB 3QIBC 3FFDA 3ILPA 1ZLUK 2W9LA 1DBBL 2DQCH 3CK0H 3NFPB 1WJ3A 3OAUH 3HE7C 2HT3C 4FFYL 3QUZC 3BIBX 1FBIL 5J9PA 1KCVL 1FP5A 1F5WA 4ZS7L 4X6BA 1CFTA 4NRYB 1JZ6A 1Q9LB 3CDGA 3INUL 1QBLH 3ZMRA 2D4FA 4FZ8L 4TUKL 2XQBL 1MQ8A 1UA6H 3GMNB 4IJ3C 4TRPL 3OXRB 1F6FB 3O6FB 1ZLVH 1VGEL 4BFIB 1MH5A 3QI9A 1P2CA 3U9UA 4X6DA 4Z77A 5IR1A 3VFTA 1S7VA 3BPCB 2OI9B 5T33H 1W72A 4J6RL 3VXMB 1YY8A 5F7EL 4IRSC 3MREB 4R26L 1KN2H 5J6GA 2LVCA 4YGVB 3TM6A 4FMKA 2R0KH 5ALCL 1N59A 3EAKA 4YK4B 2GK0B 3MLPA 3H0TB 3JTSB 3SGDH 2HJLA 2FJFA 3IDIA 3HG1E 1CXFA 1Z3GH 3T0AA 1U3HD 1RIUL 5L9DL 4XCFL 4UV4L 1HHJA 3MLWH 1A7OL 1VPOH 4LCCB 3MRDA 4D0CA 1EVUA 4EDWH 3LY6A 2ESVA 3HG1D 5CWSA 1C12A 4P99A 4P4KD 4ELME 1KB5B 5DUBA 3D85D 4S1SH 1ZA3B 3AAZB 1R5WA 2AABL 1FC2D 4LASL 1PEZA 4AMKL 4Y4FD 1FZJB 5CZVL 5L8LB 1Y6MR 4ZS6D 3A67H 3FO1A 4XVJL 3HRZB 4M02A 4HJ0D 4LLVB 3EYUH 3X14B 4PJGE 3TBTB 2C4XA 3OKDA 2BSSA 2CK2A 2XWJA 3D69A 3MLXH 4RFEA 3WS6C 3ZKXC 1AIFB 3FL7A 3MSPA 3MV8B 5EORH 5E95B 5D2NB 1GOFA 1M7IA 4U6HA 4YGAB 5F7YC 1S9XB 3B83A 3VXQA 1NC2B 2W65B 5CUSL 4YO0B 5CFHA 2G5BA 1JPTL 4KROC 4HUXA 2ZUVA 5IOPB 4MDJB 4K8RD 1ZVHA 3BGAA 3GMMB 5ERWB 4M5YH 4S10A 1W72H 1WZ1L 1VSCA 2WWMD 4G7YH 4WW2B 1AO7E 4PRBA 2Y36L 3EYFA 1CR9L 1AE6L 4ZUVB 3X12A 4NQXB 1IKFH 1WWBX 4JG0H 5D93C 1NFKA 5HDQH 3DSFL 5C0AB 3G04A 2B1AH 1AO7D 4BJLA 4NM8H 2YMXH 1WFOA 3C60B 4PJFF 4A2MA 5DRZB 5DD0L 3CH1A 4ONGL 3O3EA 5FO8B 4ALAH 2CKBA 3HMWH 5JPMA 2QR0A 2Y23A 4Y4HD 4MCZB 5E70A 3QUKB 3GO1H 3GSVA 3HNSL 1X5ZA 4M1GL 3N85L 2A6JB 2EIZA 4UOW0 1E6OH 3O2VH 4X5LA 3B3IA 3WXVL 1Q0XH 3X3GL 3MBEA 4FFVD 1XGYH 4RFOL 4JDVA 1A1MA 2EIEA 1MUJB 1XGTB 4O4YL 4HXAL 3EIFA 4P57A 4BSVA 4LCYB 5T1MB 1G9NH 3DECA 1L7IL 5GPRA 4Q0XH 1QLEL 2XPGB 3C5ZD 4G6KL 2HFEB 4YZFF 4AM0B 4PRIA 5JIKA 4TVPL 1SJEA 5L6YL 1LHZA 1XF1A 3MNWB 5GJSH 3S3SA 1VFBA 3C8KA 5DLMH 35C8L 4M1CD 3W9EA 1RIHH 4JKKA 2I60L 2GT9A 2WUCH 3MA9H 1CDGA 3QJHA 1DN2A 1A9BB 3OR6A 5DJ6B 5IQ7H 5AD0B 2P4AB 2P24A 4JY5H 4HS8H 1J86A 2OXGA 5D7JC 4LPUA 1SYVB 3VRIA 3WKMH 5EOCJ 4FNLL 3BEWA 1CD9B 1RZKC 3FO2A 4IOFC 1PQZB 1BREA 1ZGLP 5DWUL 2BNRA 1LEKB 1E4KA 2YA2A 1YEDA 5GGTA 5SWSA 3ARDC 4ZPTA 3WFHB 1V7ML 2CXKA 3K8LA 5KVDL 1JV5B 3OL2A 1H3TA 3RTQA 4E5XA 1BF2A 1FRGH 4QRRB 2PO6B 5DK0A 5BVPL 3LEYL 3UBXG 1J1OH 5DJXA 2E8ZA 4NQEB 5GJTL 1OTUC 3JWOC 4X5XA 3FT3B 1C16A 5IP4A 2OTUA 1KTLA 4GRLD 5A2FA 2CKBH 5CJQL 5ILTH 1D5XB 5FYJE 3VW3L 3CH8A 1X7QA 1CYGA 4WHDA 3BUTA 2FJHB 3NZ8B 3TJHD 3D0VB 5C0CE 1B88A 1F4YH 1UB5B 4F8TA 4ZOEA 3DI2B 5E5RB 4Z78B 3PWPB 1TETH 1LO2H 5FYJD 4DAGH 2A77H 3ELAT 3IDYB 3DTXB 2XWTB 4OLVL 3VFVB 4NM4H 2WWKO 3LS4L 3VGGA 5C0CD 5DD1L 5FIEA 1KV3A 3SE4C 4L4VE 3LS5L 4LSSH 4QRQA 5HPMA 2DLGA 2IMNA 2HTKC 1QFWI 4N0CD 4J3TA 3RIAF 1G6RA 3FN3A 5D5MA 4LU5L 2IANA 1J18A 4L4VD 4G6AC 4PV9A 5B38B 2AJXH 5BRZE 5FV2A 3CX5K 2DLTA 4FABH 3BD5A 5FDYA 4X6CF 4X4XB 5D9SA 3KPRE 1IGJA 3ZE1F 5GS0L 3RGVA 5BRZD 4F7TB 4J4PD 4RZCB 5GGTH 2QQNL 3GBML 4LLYA 3ZSSA 3AFLA 1YJDC 3VMNA 4LLDB 5L7XH 4OCMC 3LRGA 4HFUL 1JHTA 3CVHB 3L7EA 4D8PB 3S35H 2A0LD 3PWNA 3L9RB 3P4OB 2AQ1A 3I9GL 3BP6B 3BXNA 2K7PA 3FQNA 1MCRA 3IF1A 3THML 3P4LA 2DQUH 1UZ8B 4RMWA 4IMLB 1CD1A 1XMWA 1P7HL 4YBHA 1GSMA 3MQIA 1M7DA 2V9TA 5IM7A 3I02B 5F96H 4JQVA 3TC9A 6FABL 3U6RA 2X4UB 4QHMB 4PR5B 2YUWA 1ND0B 2AJ3A 2BY2A 4KU1A 5MEOA 2VLKD 4OI7A 1QR4A 3QPQC 3UPRA 4PJCA 1SJXA 1JP5A 5F44A 3NAAH 4JPKH 3TCLB 4LLUB 1FZMA 3QDJE 1IVLA 4CMMB 4PS4H 4LL9A 5INCA 1CIDA 4UILH 4HIEB 1G6RH 5GXBB 1VEPA 2L0DA 4NNXB 1JN6A 3QDJD 1U95A 2VDNH 1DR9A 1QQDB 3K4ZA 1D9KC 4L8DB 2J8UF 3HR5B 1U3HB 3MGAA 4JQIH 1K8IB 4XTRD 3RVXD 3VFWB 5AUMA 4H25B 2A6IA 3D9AL 4MVBD 3HG1B 5CP7A 4WEMB 5AG9A 4P4KB 5I6XB 2COQA 4PRAB 1EEZB 2EXYD 1QP1A 4F9PC 4KQ3L 1RJZA 2DQCL 3CK0L 5L2JB 2VUOA 1H8OA 4QY8B 4Y4FB 3OZ9H 3BZDA 5FOBA 5DJ2A 2OTPA 3JVGA 3V4PH 1OW0A 4RMTA 5C6PB 2ITDB 4ELMB 4ODXA 2PTTB 4KK5C 3DBXA 3BHBA 2FJGA 4PJ5A 5BV7C 1QBLL 1H3WM 1JNLH 4C59B 3VXRB 4J3XA 4KH2A 4NN7C 3CC5B 4GXUN 1ORSA 3VGEA 4X99B 4LSRL 1M05A 1FZKA 1S5HA 3SQBA 2FL5B 3MRQB 4YXHH 4JM2F 3DWTA 2NY5C 2VSDA 5CLTA 4HCRA 4JEGB 5CEZH 5T33L 4JZJA 4U7SA 1MREH 2B8OT 1AP2A 2VZUA 2Q86A 1DZBA 1FNGB 2LU4A 2Z8VC 1KN2L 4Z76B 1PY9A 2RJMA 2R0KL 1T1YA 5FDWA 4NQSB 2O5ZH 4PJ8C 3D39E 2FGWH 3ZL4L 3D6GA 3UTZB 3T8XB 2D7TH 1FLTX 1Z3GL 2R2HB 4P4RA 3MLWL 5DJCA 1I3UA 1VPOL 1OAQL 2V9QA 3NTCH 1LDPH 4K3DH 4UTBH 1QFWH 3ULVC 3T0BA 3D39D 2CDFA 1AO7B 3NOIA 3BOVA 4S1SL 4P5TC 4LF3A 4S1DD 1H3GA 1X5GA 4IOIA 1XH3A 4FFWD 3RVUD 5KSBE 2B2XH 3O2DA 2WZPD 4PJIE 1CLOH 2PW1A 1Q72H 4X98B 2LU7A 3HC3H 3A67L 1QHPA 2OSLB 4LMQI 5JUEH 1EEUA 4Y4HB 3C2SA 2RCSH 3EYUL 5HGBB 1ZVSB 3ARTA 4F7PB 4QRPE 1IQDA 4YR6B 3MLXL 5DGRA 4UQ2A 2XT1B 4RAHA 5EORL 2QSCH 4XB8A 2QQQA 4R9HA 2GCYA 4Z7UB 4QRPD 2FX8H 4MQXD 1Z0MA 4P2QE 1YPZE 2ED9A 3ARGA 1T66C 1XFPA 2XZAH 5HHNA 3OJMB 5JZ7C 3MOQA 5BW7A 5B3JE 3WSQH 3AVEA 2CR6A 5DRNB 5F6HJ 2HJKB 2MFNA 2DI8A 1LQSR 2VDQH 3CFIC 1W0VA 4HCRH 2I9TB 4M5YL 1NEZB 4ZTOL 5KOMC 4JB9H 4P2QD 4G7YL 5C07E 5F7WC 3PWUA 2X4NA 3HTLX 1BHGA 1L9MA 3QG6A 4PJFA 2YS4A 3VXTB 5CAYB 3QUYB 1IKFL 4JG0L 1ZT1B 3K4AA 3RDTD 5BOPA 2EIDA 4A6YA 2B1AL 1JRHH 5BZDA 4ZUUB 3SKOA 2OP4H 1YY9C 1UYWH 1INEH 5JLZA 1CFSA 4KJPC 2YMXL 1D7FA 1QR1A 5E94A 3MFGB 3V79C 3KPPB 5B39G 4J8RB 2ZUQC 4HUMB 4HC1A 1QG3A 4QCIB 3OKYA 3B6SB 3D25B 5TF1H 3T4AB 4ALAL 3HMWL 3FHAA 4ODWA 3QQNA 4D0DA 2AGJH 5HHPB 4JFEA 3VWJB 4N0UE 1T03H 4N5UA 4LHUB 3A6OA 3O2DH 1MRCL 4PJHE 1E6OL 2XKSA 1Q0XL 1ZT4B 1XGYL 4GRLB 5B4MC 5FB8B 1MCLA 3O9WD 4WWKA 2D7PA 4KI5E 1P9MA 1JK8A 1EZVY 2YXFA 1G9NL 5ESAB 3EOAA 4Q0XL 5CJ5A 1U36A 3ARFD 2NTSP 4XPBH 1XIWA 1KB9K 1WC7B 4R4FH 4KI5D 5KZCD 2BNUA 5JXEA 1FORH 4Z7WE 4E41A 3MFFA 3RWCB 2P49B 5C0CB 3N1FC 1RIHL 4NKMA 5J13B 1QD0A 2WUCL 3MA9L 4KGLA 1IGTA 4PJAA 3S37H 3AU1A 3F65A 5IQ7L 4G6JH 4HWEH 4JY5L 4HS8L 1A4KB 5LVEA 3QIBA 1OM3L 4MXVE 5ANMB 1NAMB 5BJTB 3WKML 4L4VB 1DTUA 2HWZL 3HE7A 5LXGH 3MJ9A 4PGCA 3QUZA 4DN4H 4ZO9A 2MNUA 4U1JA 5E2WH 3KPQB 3B2UD 1EXUA 1KIRA 5EA0H 3B43A 3PG2A 4HX1B 3TN0B 5I8CB 4A6YH 1FRGL 4W6XB 5BRZB 1MHPH 3E3QC 4OV6F 1OWRM 1J1OL 3Q3GB 5DJYB 4JO3H 1A22B 5DEFB 4PV8B 4HWZB 4HC1H 4PY7A 4XNUL 4Y5YB 1PKQE 2YC1A 3QQ3B 4HKXA 5FO7A 4KVCH 2CKBL 4P3DB 5ILTL 1U8IA 4R97C 4IRSA 5DJ0A 2X2YA 2E9JA 1FVEB 3QT2A 2DL2A 3BKMH 3QZWG 5LBSL 3VFUB 5BCAA 5C0EA 1CBVH 1F4YL 1QRNA 1ITCA 1EBPA 1HHGA 1CICD 3M17B 1ACYH 3RKPA 1NANI 1TETL 1LO2L 4DAGL 5F1SA 3VI3F 2C1OA 3VD7A 1PYWA 4U1HB 4LSSL 3RHWK 3KPSE 2VLKB 3QUXC 1GZQB 1T6VN 3RUGA 5T3XE 3GSQA 1S7UA 2Z92A 1UQSB 4JFOA 4YPGB 3NCBB 1Z9LA 3KPSD 4KZDH 3UPAA 4ETQB 2VXSH 5IB2A 1XF3B 2AJXL 2XFXB 5GS2H 5T3XD 2DJUA 4F7CB 1Q38A 1TCRA 5I8KH 3ULVF 1UCBH 4PP2B 1GGCH 4FP8H 4P23C 4FABL 2BXZA 5HDBF 3QDJB 3F8UB 3PWJA 2VDRH 5HTSA 4LLQB 3MJ9H 5GGRA 2EC9U 4YFEA 3G6AA 3WS6A 1DVFC 5H2BA 1XR8A 4BK4A 5GGTL 4PJ7E 1JHKH 1PLGL 3UTSE 5L7XL 5JORB 1FE8H 3CD4A 4DGVH 3TESA 5ETUA 1DCLA 4Z18A 3V0VA 3MROB 2EE3A 3S35L 5E2TH 1WZKA 4DGYH 4UU9A 4NWTH 3I3BA 1LO0H 1YEFL 5J06A 3PHSA 3P0VH 4X9FA 3UP1A 5CD5D 3UTSD 1FN4B 4YBLC 2DQUL 2PYFB 2WLYA 1MHCB 1JUFA 4QYOB 2LU3A 3K8KA 2WP3T 1A7QH 2PXYD 4MMXC 4XAWH 5DJ8A 3KYNA 4F2MB 2W91A 3QCVH 4AH2A 3I6KA 5F96L 3BZEB 1NJ9B 4S0TD 4P2OC 3ZE0E 1J8HA 4LHJB 4EQ2A 4ZFGH 3WNNA 2ZG3A 4MNGE 3HPJA 3I75B 1UJTA 1AHWB 2AP2A 3MGTB 5KSVA 5EOCH 4JFFB 1Q9KA 3QFDA 3SDCD 2Y07H 3TBWA 5I73B 1NFDF 3KXFA 1ZLUH 3NAAL 4JPKL 4KDWA 5F9OH 4HLZH 5F9WB 4NJ9H 2R29H 5IQ9B 4GW5B 2J8UA 4PS4L 2D31B 2D3VA 4UILL 4YX2H 1KUMA 3QXTA 4K7PX 5F89B 4DZBA 5EUKA 1G6RL 5JOPE 3TBSB 2VDNL 2ZCLH 3REWB 3MNVA 1BVLB 3L95A 4NKDB 2PYEB 4KMLB 4L9DA 3BO8A 1J1PH 3DHJA 3HCVB 4OGZA 5ISZB 5JOPD 5EUOE 3BX7C 3KNBA 4JQIL 4UINH 2Y06L 4ZOBA 4XHJD 3C6LC 4Y8DC 4U05A 5MENA 2XNAB 4ONOA 5AAMA 4HIHB 3UBXA 5HI3C 2R23A 1EAPB 4CVZB 2A74A 2KDGA 3JV4A 3V4PL 3WLWC 4JM2A 2JE8A 5C08E 2FSEB 2VXTH 1J12A 1WFUA 4LEXL 5KSBB 4PJIB 4XPGH 1JNLL 5D7JA 4LLAA 4HS3A 5C08D 1K8DA 4GH7B 4YXHL 3BP5B 4L9LB 5D6CA 1ZAGA 3SDYH 3WBDA 4PJEA 4QRPB 3OKEA 5E2VH 4PRDB 1RULL 5CEZL 5CGYC 3LVEA 3ARDA 4Z7VE 1MREL 1T4KB 4I0PD 2OYPA 1JWUB 2VWEC 4J3OC 4BH8A 1LE9B 2E8YA 4LKCA 4BSWA 2CO7B 1A9EB 4M43H 2ED7A 4P2QB 2FGWL 3MRLA 2V7HA 1S7XA 1BX2A 3RWEA 1CL7H 2D7TL 1IGCH 4RBPK 1KT2B 1TQBC 4CN1A 3NTCL 1LDPL 5ID0B 3HLAA 4K3DL 3RDTB 4UTBL 4QT5A 4HG4K 1QFWL 3M07A 5EIIA 5MEQA 4JO4H 4HGWA 1EEYA 3VFNA 1CU4L 4OCWL 5I8EB 2G2RA 4NUJB 4FN0A 2B2XL 3DX8A 4KRLB 2DTMH 3P9WB 3V6ZA 1CLOL 3GJFB 3NIFE 3HC3L 3BJ91 1OHQA 4PGEA 2BMKB 3SE4A 3MCLH 1T0MA 5JUEL 1K9TA 4JCLA 4OFPA 4TVPD 3MACH 2Z35A 5LGHH 2OCFD 2V5SA 1CFVH 2W0LA 5J1SC 1A2YA 3ECBA 3QQ9D 2B4CL 2BSRB 2QSCL 3S5LG 3O9WB 5JA9A 4N0UB 3V5DB 5I1LA 3WHE0 3NIDF 2FX8L 4PJHB 2YKLH 1M1SA 4GG8B 4PRNB 3UJJH 4CL7A 1NGWB 3ARFB 2XZAL 1QKZL 2DLEA 5JHDE 4EBQH 3AS1A 3MRCB 5KZCB 1EV2E 5MERA 3WSQL 2H9GA 2B20A 3NIGF 5C6TH 2Q8BH 4HCRL 2VDQL 2J1KA 4ONFL 5FO9A 2KUTA 2WUBH 2AXFB 5DQ9B 3NPSC 5I1JH 3QDGB 5FM5M 3SPVA 2CRYA 3BZ4B 5JHDD 1P6AB 1AJ7H 4S2SB 3M1BA 1W8NA 4Z7WB 5E9DA 1S9YB 5LGKA 2B5IB 3MJ7A 2PF6A 1J88A 5EO1B 4IMKA 1CGWA 1BQSA 3OGOE 3JWOH 2R0ZH 1FSKB 4K55A 2OP4L 1UYWL 3BFOA 5DTFB 5HY9A 2JELH 2W60B 4RGMB 5HI4D 1J0KA 1NGZA 2P5WE 4AEEA 2DIAA 4Q2ZB 1GOGA 5TF1L 2OL3B 5T3ZH 1OF2A 5M7QA 1AGDB 2AGJL 3P30H 3ALXA 5F7KC 3GHEH 3R4DA 1T03L 2P5WD 3LDBC 3GBNH 3O2DL 2WBJA 4G8EB 1NKOA 4JKWA 3QCUL 3IDNA 4X7EC 3STBA 3DSNA 3TH3T 2IBZY 1D5BA 1U8QB 3T4YA 4UDTA 4CW1A 5K9QG 2FR4A 3CU7A 4G8GE 5H37G 1CICB 4OV5B 4XPBL 4MZ3A 4MA8L 4R4FL 2BVEA 1D9KA 1S9VB 4I18B 4HH9A 2AXGA 3STLA 4YHYC 1W8OA 1INDL 4G8GD 4MZ2A 1C1EH 4FZEH 5GGSB 2IBBA 1Z6JT 4Y19A 3K1DA 4BSJA 4TPRH 5C92A 2CRIA 2BVTA 1U8HB 5T5FL 4CNIB 5FYJU 2C5DC 5GS0D 3QFJA 4LBEB 3DXAA 4JFDA 4EXKA 1U3ZA 3U0WH 1QFUH 3DVFA 3KPSB 3HC0B 4FTVA 1YJDH 4GJTB 4DKEH 5LXGL 1JNNH 4HUVA 4GQ9H 5E2WL 1KNOA 1F2QA 2XTLA 3CGTA 5HHOA 5IMKA 5K93A 2KZWA 5D7IA 5EA0L 4XNZB 4LSVL 4A6YL 1NGYB 5AEAA 4G6FD 1MHPL 2BVQA 3KYOB 4M3KB 3R8QA 2Y72A 4V1DA 4FOMA 4G8FA 4JO3L 1PW3A 2NY7H 4HJGA 2AJVH 1PX4A 4HC1L 1G0XA 2Y5TA 1XZ0B 1SVZA 1ULVA 4KVCL 1WBXB 5A2KH 4NPYB 3IXTB 4WUUA 4PJ7B 4J3WA 3UTSB 4X9IA 1CBVL 3ARVA 4XRCB 4IS6B 3VGFA 4RSVA 1BZ9B 1RJLB 2P8LB 4PG9A 2PXYB 2NXZD 4PJDE 1A3LH 4PJ8A 3NFNB 5C0DB 4NFBA 1OWWA 4K3GA 4S1RL 3VDCA 3MA7B 4CVWA 1MFBH 1WAAF 4L4TA 3CFKB 4UDUB 1N26A 1R6VA 2HTLD 1E27B 3SDCB 3UJTH 3EJZD 3QWOB 2PUQT 3QNYA 3FQWB 1A14H 3IKCA 4P5TA 5C0NC 4KFZC 3O3BA 2PTUA 1KTDB 4KZDL 2XKNA 1ED3B 1OL0A 5DK2A 3ULSB 5I8KL 2YUVA 5IB4A 1GGCL 4FP8L 1TENA 1URLA 1NCWH 1FNLA 3GGWB 2VKXA 2VDRL 5E00B 4POZD 1U6AH 4U1MB 1RZFH 3MJ9L 2WBKA 1OGAA 3GMRA 1TZGH 4KWUA 1F4XH 4QRUA 1DANU 3ARBB 3FZUC 1JHKL 1NCDH 3SE8H 4TYUA 2ATPA 3SO3C 4AIXA 1TQCB 2YRZA 3V7AG 5B39A 2IEPA 4K3EH 1FE8L 5BV7H 4HIXH 4DJMA 4MLIA 4H0IA 5E2TL 2HG5B 4NWTL 3FQRB 1LO0L 3MRJA 1B0RA 5EUOB 3VXOB 4M4RA 1MCJA 3HZMB 5HVGB 3P0VL 3DIFB 3BD3A 2J12B 1DUYB 2NY5H 2P43B 4PJ9D 4ENED 3MJ8A 1A7QL 1S7SB 3QIWC 3L5JA 4XAWL 1NFDA 3QCVL 4GXUM 4S1QH 5C0BB 5JW4Q 1I85C 5HD8D 2QHRH 1JYNA 4ZFGL 3JTTB 3W82A 5CJBA 3CMOH 1FJ1B 3QA3A 1WZLA 5EOCL 1FIEA 4BYHA 4UQ3A 2Y07L 2A38A 4I3GA 4TUJA 3EDJA 1OD9A 4LP5A 4Y5VC 5EU3B 4NJ9L 1FG2A 3MUY1 5T1KD 2VJXA 1DQQB 3BKCH 4J1UB 4QF1A 1D6EA 3ULVH 4JHBA 4YX2L 5HPOA 5E8PB 2E6PA 4CDHA 1F58H 5EN2B 1P4LB 1CFNA 4RX4A 3IFOA 4Z7VB 2ZCLL 1WBZA 3E0GA 4JFXB 3RZCD 4ZAKD 5EBLA 1J1PL 2ZWLT 4JDZB 1UB6A 2BVOA 3RY5A 4PYGA 3VFOB 3LD8B 1RU9H 1Y0LA 2W0KA 2BVYA 3EUUA 1NLBH 1B2WH 4DEPB 5I74C 2R39A 2W92A 5T1LD 3PABB 3BUYB 3MRNA 2FEEI 1MRDH 2AK4E 4ZUTB 3QEQE 2FEDC 4AIZB 4O00A 2HKHH 3A6BH 1LNUA 4HZLB 3ZHLA 1S7TB 4HW6A 3T77B 1RZ8B 2C1PA 1F4HA 2AK4D 4LNRA 4OAWB 3O45A 1BLNB 2FBOJ 3QEQD 4XPGL 1EGJA 3QZWA 3W11C 3VRLE 2V2XB 1YNTA 4M9PA 1S8DA 5HHQB 1HHKB 3CSYA 4F7EA 4UT7H 2APWA 1MFCH 3SDYL 5E2VL 4KKBD 3WNLA 5EZJB 4P46B 1TJIH 2D7NA 3QEUB 4G9DB 1JGEB 4YUEL 4DVRH 4ZFZB 1VACA 1HHIB 4TSAH 4UBDC 4FS0A 1U8OB 1FZOB 3GI8L 3NN8B 2HT4D 1GPOH 3QNZA 4HK0A 2BJMH 1T1XB 2AW2A 2XZCH 4M43L 4J12A 4ORGB 4KTEL 1KLGA 2VLJA 3KJ6H 3L5XL 5JDJA 3EOBB 2CIIB 5JHDB 1CL7L 4MJ6A 4KTDH 1IGCL 4URTB 5MI0B 5FYKL 1LGVA 2NY3C 1T80A 1I3RB 3LKRA 2YN3A 2V2TB 2WANA 2ZUWA 1S3KL 4LVNB 4NSKA 4AY0A 1K2DA 1JJUA 1G7LB 2R4RH 3U7WH 5EDXA 4JO4L 3QR2A 3FO9A 1CF8H 3LIZH 4LLWB 1KIPB 1CZ8H 4QLRA 4I0CC 2F74B 4OTXH 2Z31C 5DRXB 2ADFL 4G3YH 2DTML 2E7BA 4GRMB 4N8VB 5BQ7B 2H3NA 1J1XH 3MCLL 3IFNH 3H7BA 3MZGB 3QUXA 3U46A 5ALBH 3MACL 2YPVH 5JO5B 2P5WB 3QQ4B 5LGHL 1CDYA 5KG9A 1RZGB 1B6UA 4XVUC 2OQJB 3Q0HA 3QG7H 2P5EA 2LAGB 1EGJH 1R0AH 4DWHA 4P23A 3L3DB 4AENA 4N68A 2P8MB 1EIBA 4G9FE 1RZKL 3I3DA 1F4WH 3BDYH 4JO2H 5JR1H 1MCWM 2DM2A 4MDIA 1QVOA 2NPLX 5CILH 3HKFA 4L3EE 3V6OC 5C6TL 4R3SB 2Q8BL 5JOEA 1DVFA 3T0EC 2PKDA 5HGDB 3MXWH 2WUBL 1J5OH 5I1JL 2QSQA 4G8GB 2Q6WA 2X09A 4G9FD 3P9LA 1AJ7L 5C9KA 1Y18B 1TZIB 3FQTB 5D1XB 1V3KA 4L5FH 4L3ED 5ECJE 2D0HA 5EFIB 1A4JA 3FCTA 4U3HA 3SDXF 3CLFL 3JWOL 2R0ZL 2FWOB 3L3HA 4NQCE 3MMEA 2F9BT 2JELL 4LGPB 2QEJA 3X11B 3ALPA 1JE6A 1YECH 4L1HA 4U1KA 3H9HB 5E8OB 4U7MA 4P2OA 4FQQB 1G7QB 5T3ZL 4G6FB 5FEBA 4NQCD 2NTFA 1AGEA 3BEVA 2FHCA 3GHEL 2EKSA 4XMLH 2D4DA 5DMKA 2V17H 4RQQA 1IT9H 1MI5A 2EH8H 4LCUB 4UIKH 4I13B 4RAUB 4YWGH 4NJAH 4TSBH 5JW5A 2VMFA 2X1WL 1DN0A 4WU7A 1QUNA 4LAJH 4NRZA 1I7RA 1JPGA 3QO0B 1CS6A 3Q1SH 3MRRB 5IVOA 4WI3A 4C56B 3TNNB 1LEGA 5JTWA 4W4NA 4IRJC 2UY7A 1TPXC 1HH6B 1ZHNB 3IDMA 2ZSWA 4PJDB 3CXDH 3C6LA 3HNVH 4TSCH 3O3AB 4HBQA 4TPRL 1S9WA 5GZOC 4LVHB 1P5VA 5GRUH 3FN0H 5D96B 5EBWA 1G7HA 3K2UH 1A1OB 2DI7A 4GS7C 2F8XC 3RPIA 9CGTA 2RFXA 3GHBH 5CSGA 1QFUL 3U0WL 4DKAA 5E4EB 3F7VA 1YJDL 3R1GH 4JVPA 4HUWB 1JNNL 4XPAH 4DKEL 3PQYB 4GQ9L 1ZWIB 5EBMB 3C9NB 4V2BA 5IF0B 1UZ6F 2WINB 1IEBA 1A7RH 1PG7L 3BP7B 4LOUD 4CADA 5IB3B 1K4DA 5IEKA 3MOAH 3UTPE 5EC2A 2FDBP 5GGUB 1GGIH 2AEIT 2A83B 3FB7B 2YK1H 1E0OB 3RNQB 1W0WA 5CZXD 5DSCB 1QZ1A 2NY7L 2AJVL 4KK8D 5DHYA 4ONHB 2C3VB 3UTPD 4MD4B 1IEHA 2GY5A 1Z0NA 3WDHA 1WAAA 1A6ZB 2NY6D 4M8QB 2NX5B 1IGMH 1BFTA 1X5XA 5JW4N 4OM0H 4N8CH 4PJ9B 1BVKB 4YHLH 2DMCA 3EFFA 3F7PC 1MJ7H 2QADC 3T65A 1MFBL 1HILA 5I0ZA 2ICWB 4WHTB 5GIRB 5FECB 1SY6A 3SOBL 4OCNC 3STZB 4LSPL 3IJHB 2YN5A 2DD8H 5C9JB 1CFBA 5I76B 2MQCA 3UJTL 3PDDA 2BSED 2XQYK 1EO5A 4JFZH 1OAKL 5FA4B 1N64L 3KLHD 4JHAH 5IHZB 1GH7A 5T1KB 2FBJH 4Q6IB 2VB5A 4KHTH 3LRSB 4ZOAA 5F1IA 1HEZB 2I07A 2ZZUT 2ZCKH 1IGIH 1NCWL 2MPAH 1S5IL 1T5WB 5F3BA 3RZCB 3MBXH 1U6AL 4ZAKB 1RZFL 2DTSA 3TPUA 5CSZA 1F4XL 3HFMH 2LQRA 3SE8L 1NCDL 3I2CH 5I1AB 1WIUA 1HSBA 3ILPB 3RKDC 4K3EL 2XKUA 5BV7L 2EEBA 5TDOB 4JRWA 5E5UB 5L88H 1YC8A 5J9PB 2NZ9D 5C86A 2FRGP 2FB4H 2NY5L 4X6BB 2NW3A 2Z8SA 4LPTA 2W1NA 3CDGB 2A6KA 3CFBA 3OV6A 4S1QL 5IB1A 2RR3A 1DEEA 3QEQB 2QHRL 1ZHKA 4UOJA 1ONQA 1P2CB 3U9UB 2X44D 3CMOL 4LGRB 4X6DB 4Z77B 5IR1B 3VFTB 1S7VB 1FNSH 4Y7MA 3HI1A 4JFYB 3RVWC 1OPGL 4M62H 1YY8B 4MA7H 2BNQA 3ZDZE 1OB1A 1SY6H 3OF6A 4F3FA 2HVJA 2YSSA 3BKCL 2NR6D 5J6GB 2AV7A 5C2BH 1N59B 3SKJH 3O6KH 1F58L 2FJFB 3IDIB 4LVOC 3CCHB 4PGJA 5B8CC 4I48A 4YFLF 1HHJB 4PJBA 5EU5B 2QBWA 4D0CB 3UX9B 5IV2A 1B0WA 1IFHH 2ESVB 5D4QA 1DQTA 2XQYG 1Q1JH 5FUZH 2NXYD 2Q7YA 1RU9L 4LIQE 4PLKD 5DUBB 3RL2A 3WHXA 3MO1A 1R5WB 1NLBL 1G84A 1B2WL 4PJ5E 3PGDA 1MRDL 4I3SH 4DK6A 1T21A 1VADA 3FO1B 3WD5H 4FQ1H 3UO1H 3VE0A 3KYAA 4GRWF 2HKHL 3A6BL 1HNFA 1U2CA 1C08A 5DMGC 1OAUH 4PJ5D 3BP4B 2CUMA 3OKDB 4KZEH 4TTDC 2BSSB 2EE6A 2XWJB 2XOTA 4RFEB 3BISA 3SJVE 1YMHA 3NCMA 4AG4L 1M7IB 3KJ4C 3E1F1 1Q9WA 1XR9A 3BDXA 5I2IB 3VXQB 5L0QB 2HFGH 4UT7L 1KCSH 1MFCL 3HZYA 1KCRH 1NH6A 4M61A 4IM8A 4P3CH 3DX9A 1TJIL 2EDKA 4YHML 2EYRA 2WK2A 3DUUA 2XY2A 4DVRL 3H3KA 3UAJC 3G5ZA 1EHLH 1NC4D 4TSAL 4OT1H 3N06B 4XPFH 1BFSA 1OP5K 4OD1H 4KRNA 1GPOL 1RIVH 4PRBB 1B0GA 3EYFB 2BJML 3QHTC 4R4NC 2XZCL 1WCQA 3DURB 3KJ6L 3TO2A 1U2HA 3P4MA 5D2LE 4KTDL 4KUZH 2NQCA 4X7TA 2CRZA 3S8WA 1YEJL 3Q2CA 4OGYH 2R4RL 3GDBA 1CF8L 3LIZL 1CZ8L 3CH1B 5TQ0H 4RWYH 2MHAA 3RNKA 4OTXL 3BT2H 1IILE 4G3YL 2CKBB 3C09B 3N0PB 3KG5A 2QR0B 2YD3A 1FH5H 4GW1A 5D7LA 4OLYL 1J1XL 4HKBB 3VGAB 4NQCB 4P49A 3IFNL 4AQ1B 2QJDA 2EDWA 3B3IB 4EN3C 3MBEB 1A1MB 4GAYA 4GG6F 4JANB 1SJHA 3O6FC 4X5WB 2VITB 1R3JA 2NYYC 4IDLA 1S7WA 3QG7L 4P57B 4H1LG 4DTGL 5EOTA 4HUUB 3B9KD 2OI9C 3FMGH 3KWWA 4GKSA 1SJEB 2VO5A 5C0JA 1EGJL 1FVDA 5EC1A 1VFBB 3C8KB 3U0TA 4M6AA 3ZSTA 1MF2H 3W9EB 5I1KH 3VFRA 4JO2L 3TA3D 1F4WL 3BDYL 4NC2B 4PG2C 3U36B 4BZYA 2GT9B 4D9LH 5JR1L 3QXWA 4YK4C 5CILL 3SDXA 4Z5RA 5F3HB 2UYLA 3MXWL 1P7QA 3OXSA 1J5OL 4NN5B 3VRIB 3ILQD 3JWNC 2DYPD 4OZGE 3RP1A 3VJ6B 3QP3A 4K94C 4NN6B 4L5FL 5FA3A 4ODSL 1IQWH 3DMMD 3MYZA 4EUPA 1CE6A 5BS0A 2I26N 1L6ZA 2JKXA 3S36X 5SWSB 4ZPVA 4P5KA 5LCVH 4M6NH 3DV4A 4JFEE 2VXQH 4AT6B 3QIWA 3RTQB 3DOSA 5SX4I 2MCPH 3GSRA 5DXWA 2Y9RT 5DK0B 1TVBA 1I85A 3ESUF 4OZIE 5DJXB 4JFED 4L8BA 5DGQA 2F53A 4X5XB 4XPHL 1OT1A 4LMQE 3TP4A 3KS0H 1QEWA 4K71C 4U49A 1UKSA 4Y5VA 2VZ1A 3HUJF 1X7QB 2V17L 1UWXK 3BQUD 3UROR 1SEQH 2ERJB 3TH4T 4UIKL 5CJ8A 2NY6B 4NJAL 1PX3A 2QQKH 3GMQA 4NO3A 4TSBL 2CDEB 3B2VH 1PBYA 1I9EA 1ITBB 4PJAE 3ZTJG 4LCWA 2VLMD 4ZSOE 2C4FU 1T5XA 3ES6A 5JXED 4HK3N 3Q1SL 4JREC 2PCPB 1BOYA 1OAYH 4PB0H 5DYOA 4MNQE 3OB0K 3RX8A 3MLUH 5HPMB 4PLJC 4N0FA 3GSWA 1G6RB 4WCYH 1S9KC 5D5MB 4ODUB 3CXDL 5IW1B 5J1AA 3HNVL 1BFVL 2IANB 4GKZA 4MNQD 1WISA 5CGTA 1ETZA 4AEIH 2HT3D 5J89A 1TNNA 4PV9B 1D5MA 3QUZD 1RSFA 1FYTA 1LE5B 3PHQA 3T2NH 4O02H 5H94A 3R1GL 4XPAL 2HRLA 5D71H 4HPYL 1AD0A 1KPVA 5D9SB 3BWAA 1IGJB 4EUPH 1A7RL 5I17B 1E4XI 5DHXB 3LQZA 4MAYD 4D0BA 3MOAL 1YEIH 5E99H 2XRAH 1GGIL 2BDNH 1QRNE 1R24A 2YK1L 1JHTB 3L7EB 3U79A 2CH8A 3BH8B 3ET9F 3PWNB 4MA1B 3BXNB 3FQNB 4IRSD 4FMFA 2XV6B 3MZTA 3EKCA 3I3EA 3SCMD 1QRND 1CD1B 1CXHA 3HRPA 4AK1A 1M7DB 4OM0L 4N8CL 5IM7B 4CU7A 4Y4KD 3RUGE 4U2ZA 4JRYA 3QISA 5L2KA 1DQMH 4HULB 4KHXH 3ULUE 1MJ7L 2AJ3B 2IAMC 3PGFH 2VNCA 3WYRA 1HN1A 3IETB 3O11B 1FGNL 43CAA 1KN4H 3RX5A 3LSOA 5AYUH 3ULUD 32C2A 4JFZL 3J8F7 3K81A 4OQ1A 1KG0A 2Z31A 3CXHK 3QDHA 1OP3K 3SHSA 3DROA 3BZFA 2ZCKL 2HVKA 1IGIL 3P73B 3L5WA 2MPAL 5DUPH 1CGTA 5IMOB 5FCUH 1V5JA 1ZOXA 3VRJB 1T3FB 5DMIH 5AUMB 5EU7E 5IIEA 3OX8A 2EDHA 3HFML 2A6IB 5GRWA 1BWMA 4X4YA 3I2CL 5CP7B 3O3DB 2VISA 3FQUB 4ZXBC 2NXYB 1SEBB 1EK3A 4Z7OE 1R3LA 3MJ6A 5HGGS 2P45B 1KC5H 5FOBB 2XI9A 3WN5B 5L88L 4N9GA 3ZDXF 4E42A 3GRWA 1ZT7A 2FB4L 2XG4A 3BVNA 4ODXB 1WLHA 3BHBB 1JZ7A 2FJGB 3V6OA 1WZMA 4PJ5B 3T0EA 1E6JH 4E0RA 2ZOKA 2Z93A 1U8JB 4LRNH 3VGHA 5I71B 3JV6A 4L8SC 1ORSB 4XBPB 3UTOA 4ZFOL 3ZDYE 1M05B 4EOWH 1S5HB 3I50H 4HD9A 5FYKE 4YHNA 5JIPA 4RGNB 5ADPH 1IM9D 3TBYA 1JF6A 4XP4H 1FNSL 1FO0A 5KSUA 3LV3A 4JZJB 4M62L 4DFIA 4KJWD 2UUDH 2GQHA 4U31A 1AP2B 1P4IH 2Q86B 4TUOA 3RRQA 5IFAH 1MLBA 4MNHB 1SY6L 2CRMA 5FYKD 4RNRA 2VL4A 2BRQA 1R5VA 3ARWA 4YLQT 5C2BL 1T1YB 5FDWB 3SKJL 2D2OA 4MD5B 1NC4B 3O6KL 2L7UA 3IFPB 4AJ0A 3TNMA 3SBWC 1U8LB 1T89C 5DS8A 1N4XL 4P4RB 1SM3H 5DJCB 4B50A 2GSGA 2Q76A 1F02I 1IFHL 3LKNB 2CDFB 5CD3A 3KLAA 2IF7A 5FUZL 4ZNEE 4OZFA 4LF3B 1Q94A 1N6QL 3R0NA 4IOIB 3MLRH 3T1FA 1MHEA 2PW1B 4IRZH 2FLRT 4I3SL 1NCBL 3QCTH 4D2NA 4PRPE 2QKIA 3WD5L 4FQ1L 3UO1L 1E28A 5B21A 2P48B 15C8L 4IRJA 1I1FA 4HIJA 5B38G 4PJEE 5IMLA 1RY7B 5D7JD 4KZEL 4PY8I 2CMRH 3SGEH 1E4XH 3PWVA 3GRWH 4PRPD 5C09A 3DX6A 1L0YA 4P2RA 1H3UA 1X5KA 5K9OB 2W38A 3ARDD 3IU3A 3B9KB 2R0LH 4TULL 2HFGL 1KCSL 1KCRL 2VAAA 3ARGB 1LO5A 4U1NA 1J05A 1LWRA 1RQ5A 5HHNB 5IVXE 5I15H 4P3CL 3KGRA 3B9EA 3MV7E 3J7HA 1FO0H 1HXYA 1W0VB 1MJUH 2HFTA 3ARED 4FRWA 1EHLL 4OT1L 4XPFL 4OD1L 3PWUB 1RIVL 5I1GH 2X4NB 3CNKA 3QG6B 4BFEA 5EO0A 2J6EA 3TYGH 3MV7D 1U9KA 1U3HC 3P9MA 4KUZL 4Y2DD 3NABH 1LEIA 5J57B 1X4ZA 2G9HA 4A6YB 5BZDB 3SKOB 2NZIA 3MUGA 2P44B 4OGYL 5JLZB 1CFSB 4YHOH 5DEGB 4LKXB 2NY2D 1R3HA 1QR1B 5E94B 1MRFH 4NNYA 4OZGB 1U42A 3QAZC 2I5YH 5TQ0L 4Y4FC 4RWYL 4GG6A 5DJAB 3BT2L 3V5HB 3O6LH 4ZS6C 5KVEH 1MY5A 2ZCHH 3KPNA 4OZFH 4ODWB 4D0DB 5EG6C 2OK0H 4JFEB 1FH5L 3R06A 4HJ0C 1OSZA 5HYJE 3WDJA 4Z7NE 4R90L 1LVEA 4M1DH 3K3QA 2FD6L 3GSUA 4LP4A 4G6AD 1JK8B 4HS6A 2I9LA 3D18A 1MCNA 1HKLL 3ZT5A 5HYJD 3FONA 2DLFH 3FMGL 2DQGH 1DLFH 4LSUL 1D5ZA 2EICA 1KTKE 4OCXH 5FUOH 1YYML 3BPNC 2A6DB 4E41B 5I1KL 3CXHJ 4NKMB 3ARSA 3TVMD 4D9LL 1KJ2A 1HK6A 3MUHL 1F6LL 4FQXD 4PJAB 4X4ZA 3AU1B 2WWMC 4I5BA 4ZSOB 3GMOA 3NGBC 1FFRA 1FL3A 1HDMA 3T09A 3QIBB 3NZHH 5EIQA 2Y6SC 2VZSA 3PL6D 2FECI 2Q87A 5I66A 4MNQB 2IALA 3QDME 4NOBA 1ZANH 2H6PA 3HE7B 2LVEA 2R0WH 1IQWL 3QUZB 1RUAH 4U1JB 1CGUA 2V5RA 4XVTL 4XWGL 4M6NL 2BCKA 1KIRB 2FLBT 1I1YA 4OJFH 2GKIA 3QDMD 4FQCH 2YPKA 1JPFA 4KKAD 3HUJA 5F88A 5M95B 5IVNA 1NCCH 3OGCB 2MQ0A 4MAYB 4Y4HC 2ZKHH 5J6HA 3BPOB 4LFHD 4PY7B 2H8PA 2YC1B 4ZUWA 5AG8A 4HKXB 5FO7B 4FFVC 5JW4M 1BBJA 4IRSB 1HQRA 1SEQL 2IQAA 5DJ0B 4NO0D 5C0EB 1JI2A 3SCMB 1YMME 1L0XA 2QQKL 3IDUA 1QRNB 4FXLA 3B2VL 4YE4L 4WHCA 3OAYH 3BW9B 3C5ZC 1CDCA 4RA3A 1VKXA 4DOHE 2DL9A 1KPRA 4Y4KB 2OR8A 3FFCA 1AXTH 1UM5H 1I1CA 1K5NA 5B8CA 3KHQA 1XF5A 3FOMA 1PYWB 1YMMD 2GY7B 1AC6A 5BO1H 3MLUL 6CGTA 3DGCR 4K3HA 1RVFH 1KEMH 1RZ7L 5JIHA 3IS0X 3RUGB 4OF6A 3GSQB 4WCYL 2QSVA 4YJZL 5HHOE 1S7UB 3CVIH 4JFOB 1VEOA 2WMPA 1KJ2H 5D7IE 1NBZB 4AEIL 4AL8H 3C8DA 2AKRB 5IB2B 3QULA 2QTEA 3P77B 1G6VK 3TYFA 5E5MA 5KVGH 1TCRB 4MXWL 3T2NL 5HHOD 3QH3A 4QHUA 3QWQB 1I7UB 2VZTA 4FQHB 3PWJB 2ATKA 5JXAL 4LNVA 2VZOA 1VFAA 4LRIC 2DDQH 4PTTA 1KJ3L 3O4LE 1XGUB 3G6AB 1A3RH 1XR8B 2OJEA 3RWIA 5IKCA 4XB7A 1YEIL 4KXZI 1ZSDB 3IDJB 5A16A 2XRAL 2BDNL 2WIIA 1RHHA 5ETUB 1HI6A 3O4LD 2X4SB 1NEZG 2PW2A 2X5PA 4FXGA 4NO5A 2CDGA 4PD4J 3MOBH 4BA8A 2VN7A 4KROB 3IXAA 1JUFB 5ITBH 3TJHC 1U91A 3KAAA 2VABA 4AH2B 4A2LA 1BZ7A 3MV01 5DD6A 2GSIB 2YUZA 3CPLA 3HS0A 4H1LA 1QFHA 1WV7T 2DLIA 5KSVB 4ZODA 4JN2A 3PGFL 3QFDB 4GKNA 3GKZA 2Y7QA 4OZHE 4U6YA 3TBWB 1KN4L 4KRPC 4N0CC 1IM9B 4PPTA 5JW3H 4P5TD 1NMBL 2VN4A 5AYUL 2NLJB 1A6VL 3RBSA 3EO1B 4LHUG 2KPNA 1DE4A 4X9GA 2XXCB 4DZBB 4WHYG 3IAQA 4GKOA 5EUKB 4JRXE 3GFUA 2XICA 3O4OC 4GBXD 4NRYA 1RK1A 4M48H 1Q9LA 4XZUB 3MNVB 1EHNA 4ZD3H 5DUPL 3BO8B 4EN3A 2GJZA 4KRMB 4JRXD 3GMNA 5FCUL 2E7LC 4J4PC 3KNBB 3WFEH 3O6FA 5DMIL 4BFIA 1OLLA 4OFYD 4ELMF 2XN9E 3GIZH 4Y5YC 1AR1D 2A0LC 1A64A 5JZ7D 4LGSB 3VXMA 4OCSH 5FXCH 2KQNA 1KC5L 2JF1A 1SVCP 3L5IA 2G60H 3JV4B 4P9MH 1NUDA 2XN9D 3GMLA 4NC0B 4YGVA 4R2GD 5E7FA 4PG2A 1I8LC 4PJGF 3AB0B 3W5NA 2ZOLA 2AAVA 5DD5H 4QXTB 5D7JB 4HS3B 4LRNL 2A73A 4P59H 4PRPB 3K74B 4LCCA 5IW6A 3BGMA 5KS9E 2IPUK 4EOWL 3I50L 4R96B 5ADPL 3FHQA 4PJEB 4XP4L 3OKEB 2KKQA 2W9EH 4H1LH 3ARDB 2J4WH 1Z5LA 1WBYB 3OTTA 2P47B 1ZA3A 1P4IL 1HWGB 2E27H 5IFAL 3IDXH 4GUPA 1FZJA 2VR9A 4BSWB 4N90E 4H26A 3AREB 3CAFA 3SEPA 3MRLB 2Y4SA 4NT6B 3SN6N 3LPGA 5IVXB 2V7HB 1TTGA 3DGGA 1BX2B 3RWEB 3AXLB 3FT2A 1NMCC 3MV7B 1SM3L 3OB8A 5B4MD 3KR3H 4N90D 1KXQE 1CN4A 1AIFA 4QT5B 2AV1B 4HK3J 3RVXC 1JGUL 3MV8A 4XTRC 4Y2DB 5EIIB 1UXWA 5MEQB 3BRDA 4HGWB 4RMQA 5H35A 4CRPA 4ODHH 4LDEB 1S9XA 1MFDH 3ETBF 1NFIB 1MHHB 1I8IB 1NC2A 2W65A 2ZSVA 2K1MA 3QRGH 2EXYC 4YO0A 3MLRL 3DX8B 4IRZL 3K46A 5IOPA 2LE9A 1JTTA 3G5XA 1TMCB 1TVDA 1ZHLB 5BVJB 3B9AA 2Q8AL 3S4SB 2Z35B 3PP3K 4WEBH 1S78D 3EHBD 3WNOA 2CMRL 5TFSH 1E4XL 1A2YB 5L8JB 2V2WA 1VESA 3SKMB 2BY0A 4GAGL 1AHWC 3QEGL 5SWZE 2NY0C 3GK8H 1CDBA 3U7YH 3E3QE 1P6FA 3FQXA 3BE1H 5F72S 5FM8A 2VLJE 2YUXA 4I4WA 4UAOC 5SWZD 5I15L 4K94H 3LB6D 3LKSB 3W2DH 4HFWB 4BQ8A 3EDDA 1DQLH 2H9GB 4JG1H 3PGCB 1FO0L 1MJUL 5IK3A 2GJ6A 3MV9A 1U58A 3MRFA 3AS2A 2VLJD 3I84A 3SPVB 3QIUC 3QUKA 5F1NB 5GISH 1F3JA 3TYGL 3BMVA 2IPUG 2QQLH 3HZVA 4NDMA 5E9DB 5E08H 3PL6B 4XC1H 2HRPH 3NABL 1MUJA 4HMDA 3IRPX 5T1MA 2FCBA 2XPGA 3VXPA 2HFEA 2I5YL 4FFWC 3GIVA 2ZPKH 1UXSB 2V5YA 3O6LL 5KVEL 2ZCHL 2IAMA 5HVHC 2OK0L 1KYOJ 4NIKB 3DV6B 3HPLB 3GJFK 2HJFB 3MRMB 3S34H 1SYVA 3C8HA 2GJJA 4M1DL 4W68A 3P11H 1KCUH 1YZZA 3S96B 1D5BB 2P5ED 3T4YB 4XCYA 4UDTB 4CW1B 2FR4B 2DLFL 4P23D 2DQGL 4MQXC 4ODBD 4U1SA 5GS1B 5CCKH 4OBRA 3WFHA 3L7FB 1BVZA 1G0DA 1JV5A 1ROWA 1IL1A 4OCXL 5FUOL 2Y1VA 1NBYB 1A7NH 4HH9B 4Y8AA 5FGCE 1KIUA 1DVFD 2I27N 2W07A 2AXGB 1YMMB 3STLB 2YPLA 4Y19B 5J56B 4DOHB 3RY6C 5C0AE 4ZXBA 4GLRH 3QEHB 3QFJB 1EEQA 4U3XA 3DXAB 1MCIA 1ZANL 4ODVH 4JJ5A 2R0WL 5FGRA 4HUVB 1FAIH 1RUAL 4XCEB 5C0AD 1UG9A 2J6EL 4MJIA 4Z78A 5EZOH 5HHOB 5IMKB 4UUJA 3PWPA 4WTXA 5D7IB 1MAJA 2OMNA 4OJFL 5BV7B 3JZ7A 3QNXA 4P2OD 3WNPA 1KPUB 4HLJA 2APTA 1DBMH 4NN7B 5DFWH 1ZLSH 4L8SA 4OI8A 1WWAX 2ZKHL 4G8FB 5I1CH 2X4PB 4PIRF 5KAQG 4CJ1A 2ITCA 4R0LB 2Y5TB 2AEPH 3O4LB 1V3LA 4BQCA 2WIMA 4WUUB 5E6YA 1NDMA 3O9WC 5CSBA 1ZEAH 3U4BH 1N2RA 1MIEH 4ORZC 1QO3A 5DT1H 3VMOA 4P0DA 4PG9B 4H20H 1FFQA 5EU6A 4PRHA 2ICWI 4WDIA 4X4XA 4XCNB 3IFLL 3SBWA 1AXTL 3F5WB 1T89A 4L4TB 4KI5C 5E1AB 3EO0A 4G8IB 3O2WL 3O0RH 4RZCA 3RWGA 5J12C 3SGDI 5BO1L 2F54E 3C6LD 5AWNH 1RVFL 3VA2C 4UIMB 3TH2T 4WO4D 4NBYB 2LFGA 3TO4C 4P5TB 3CVIL 4D8PA 5I9QC 3E6FA 1TFHA 3O3BB 2AQ2A 3UTQA 1KJ2L 3BP6A 4AL8L 2XKNB 2F54D 2VL5A 4QRSA 5F1KC 5E8DH 5DK2B 4IMLA 3WLWD 4Z9KB 2M8XA 4GBXB 4RGMC 5TE6H 4FQPA 4PGBA 3RX7A 4OLUH 4WWID 2DI9A 5C0GA 4OKDA 2DDQL 1I1RA 1KCLA 1OGAB 4NQEE 3GMRB 4XX1E 3I6GB 4Q7DA 3EYOA 1QLFA 1BQUA 1A3RL 4JRXB 3MCKB 2ATPB 2VWEE 2PO6D 4EDXA 1X6NA 2DICA 1U3YA 4P48A 3WE6A 1NLDH 2X9YA 3MRJB 3LKOB 3MOBL 1WCBA 4Y0GA 3RWJA 5ITBL 2FYYB 3K0WA 1U8PA 2XN9B 4R2GB 4NNXA 1NFDB 3FB6A 4U0RC 2HT2D 1KELH 1U3HA 3AMKA 3QA3B 5DRWB 3MNZA 3VH8B 8FABA 1K8IA 4UQ3B 5LAXA 1T7ZA 3N9GL 3MLTB 2FIRT 3HG1A 5JW3L 2VDPH 4X8JA 4FQLL 4JPVL 3EGSA 2WAHA 3D85A 4PRAA 3RIFF 2O5XH 2E6JA 1D6EB 1MCQA 5HYSA 4CDGC 5L2JA 1VERA 4Y4FA 3F7YA 4CU6A 1TXKA 1REIA 2G5RA 3H9YA 4ELMA 1YA5A 3NACH 1WBZB 4LQ1A 4HJJL 3MRBA 4ZD3L 3V52H 4YDKH 1FPTH 3N1MC 1UB6B 3CC5A 1H3PH 5FYKU 3TWCH 2DKMA 3WFEL 1WFTA 4X99A 4XXDA 1A1NA 2UVEA 4P5MA 5I1IH 4PJGA 1XF2B 3GIZL 5SWQA 5FCSH 1L4IA 3AY4C 3F7RA 3QHZH 4QRTA 5KSBF 1FHGA 4PJIF 4OCSL 4MJ4A 2GTZB 1FNGA 2G60L 5CD5C 3GMPB 1AGFB 4M5ZH 4Z76A 4HIIA 4BZ2H 1A6PA 4YHKH 1OARH 2C1PB 2PXYC 3CFJA 3TEUA 4NQSA 4PY8J 3UTZA 5DD5L 3QZWB 3T8XA 4BFBD 1F6AA 3QJFA 4P59L 5BXFA 3GSOA 1YNTB 4YQXH 5KAQF 5DMJB 1KBGH 4WGWB 3CSYB 4F7EB 1GGBH 3SDCC 4JDTH 1AO7A 2LTQC 1G0YR 4GMTH 2W9EL 2F15A 1YPZF 2J4WL 4I3RL 1GYAA 1IE5A 5TE4H 4PJBE 5SWZB 5B3JF 2AJUH 3IDXL 1VACB 2R2BA 1A6AB 5DJDB 5IBTL 3DVNB 4JO1H 2H1PH 3QNZB 4PTUB 1MCFA 2OSLA 3V0AC 5JNYA 5HYQB 2N1KA 1KLGB 1MLCB 2VLJB 4Y4HA 4KDTC 5HGBA 2EC9T 1ZVSA 3PXHA 1AR2A 2HAZA 3C2AL 4MJ6B 4LPYA 3L3KA 3L1OL 4YR6A 3SKNB 1FL6A 1OTTD 3C5SA 1TJHH 1X4YA 1UH3A 3KR3L 1EHAA 5I8OH 3UJIL 1MOEA 4NSKB 4R97B 3ZE2E 1TQCC 4ZFFA 4XHJC 1K6QL 3FO9B 3N50A 1U92B 1ZTXH 4ODHL 3KPOB 2AK1L 1FGVH 5IWLC 1E4WH 3C5ZA 3QRGL 1AY1H 3S3PA 5D70L 1YNLH 3DVGA 2H3NB 4OUOA 3WIFA 3SDAD 2HJKA 3H7BB 4BKLB 3RL1A 1NEZA 3QUXB 2H2PC 4XBEH 5ITFA 2PR4H 1SBSL 3VXRE 4PJHF 4YXLH 1LK3L 3WEXA 4XI5C 5KG9B 4YHIA 2J88H 5TFSL 4X4MA 2DF3A 4KI5F 4X9HA 3TZVC 3GK8L 5D1QC 3VXRD 3U7YL 4ZUUA 2P5EB 4O2FA 3BE1L 1AXIB 3GKWH 4P23B 4AENB 2APFA 3C08H 5K59E 1RZIB 2IPKB 4J8RA 4ESKA 4K94L 4Z7WF 4I0PC 2PNDA 4LRIA 3W2DL 1QVOB 1IAIM 1DQLL 4QCIA 3GSXA 4JG1L 3B6SA 3D25A 5AZ2H 1DVFB 3VD5A 5HHPA 2PTVA 4ZYKA 5GISL 1RUQH 1FFNA 3L3OA 3P9LB 1WIPA 4I2XA 5E08L 2QQLL 1ZT4A 4JN1H 1H3XA 1BFOA 2B0SH 5FGCB 4XC1L 4DZ8A 4QO1A 2HRPL 3FCTB 2ADIA 3LD8C 4G6MH 1I8MA 5D7LE 4CN6A 3MMEB 5ESAA 4DEPC 2QSTA 4XHQA 4HEME 3D87B 1GCFA 1D6VH 1UM4H 4U1KB 4BH7A 2ZPKL 4NZUL 1JWSA 1KFAL 2EZ0C 4P2OB 1LO3H 5D7LD 4Z0XB 4X8XA 5GRJH 2EDJA 3RWCA 2UV3A 2NTFB 5HYIA 1F45A 3MRGA 3VI4E 4H0HB 4CVUA 4IIQB 4U1LB 4WFED 2E7MA 3EFDL 4BZ1L 5DMKB 1T2QH 4C57C 1A4KA 4RQQB 3CLEH 3F12B 3LKQA 4MB5A 1JTOA 4H8WC 3HB3D 3S34L 4DVBA 5BJTA 1NAMA 3TFKD 4Z7UE 1EDQA 3P11L 1MEXH 4L4VA 3HZKA 1HXMB 1KCUL 5JW5B 1DN0B 4WU7B 3QQ9C 3SDXE 1OAZH 4NRZB 1I7RB 5GRYA 1GC1C 1Y6KR 1YN7B 4U6VH 3FAXA 4PFEA 1FNHA 3V8OA 1FCCA 2VKWA 1Q9OB 3N1GC 1BZQK 1LEGB 1A7NL 3OPZH 4NUGH 4RISL 5TGBA 4FA8A 4QHKJ 4X7CC 3S36H 1W0YT 1A6WH 4MSWB 1MAMH 4WENB 1AI1H 4MHHI 3OQ3B 4J4PA 3ZYJA 2E7LA 2IFFL 3C6LB 1S9WB 5DEFA 4JM2C 3KPRA 2BX5A 4YDJA 4HWZA 4WO4B 1BOGA 3AM8C 5MI0C 2ZG2A 4Y5YA 5EBWB 3QQ3A 4P3DA 3RPIB 2DKUA 4MLSA 4U6XB 3WFDH 5AYQA 2F54B 3NCFB 3QUYD 2DN7A 4OKVB 3VFUA 1N3NB 1FAIL 5CS7A 4WHYH 2BXYA 4YDLC 3ZKMD 1I8LA 3WJJC 2ILLA 5HI4C 1HINH 1IEBB 1IAOB 5I75C 3IJSA 1FG9C 5IEKB 2OR9H 1PD6A 4POUB 1EO7A 2NNAA 4PJ7F 3GI9H 1DBML 1ZLSL 1QYGH 1U8MA 4U1HA 4LEOB 3LEVH 3SO5A 3OJVC 3MYJA 5I1CL 3IVKA 5FYJH 5DHYB 5KVFH 2AEPL 3VWJD 3MLVL 3MGOA 4LHUD 3WS3A 1UQSA 4CU8A 4ZFOB 4L3AA 1ZEAL 3HAEA 3SE3C 3U4BL 1MIEL 1P5UA 2EDQA 5DT1L 2I24N 5GGRY 2MJWA 4HT1L 3WNKA 1NAMH 1ERNA 4BK5A 5J11C 2VE6A 3EFFB 1P7KB 3K80A 2BHYA 3ZE0F 4LLQA 3PDGA 3U48A 4HWUA 1WK0A 1U8NB 5A2JH 3O0RL 5AWNL 4UZGA 5ANME 4N8VG 4WIQA 3TCXA 1UADC 3MROA 5CEYA 5F8QC 4XNQA 3QPXH 3ZLQC 4XP9H 1EFXA 1C5DA 2JK5B 2BVPA 5F1IB 3IU4H 2PYFA 5EH1A 2KL6A 5SV4A 4GXVH 2H41A 2NCMA 1ORQA 2YD6A 1KENH 3Q5YA 5TE6L 3VGBA 4F2MA 2X42A 5F3BB 4K9EL 3RU8L 1NJ9A 5CSZB 5EUOF 2XIDA 2JJUA 1JYWA 2C26A 4XVSH 3TN0D 2YD4A 1AHWA 2O26U 4QTHA 3WV0A 2XTJE 3UTTE 1OD7A 1A5FH 1B4JH 1BMGA 3HI6H 5DQDL 4ZTPH 1LD9B 1TTFA 3FO0H 1NLDL 4KK9C 5IQ9A 4GW5A 3T1WA 2D31A 2XTJD 3P0GB 4UBDD 3UTTD 3W39A 3HE6D 2NW3B 4OIIH 3RY4A 4KJQD 4DK3A 3WLBA 4IMKC 4QXGH 3PP4H 2A6KB 3NPSB 3CFBB 5ID1B 2NXZC 2HN7A 3VFMA 3QIUA 5IB1B 3REWA 1GVIA 4YC2C 4EXPX 4WFGD 2VLKE 1ZHKB 3HAEH 1KELL 4Y1AE 4X80H 1ZLVK 1ONQB 2D0FA 3LH2H 4HMCA 2HTLC 1UEMA 2GFBA 1DSFH 3IB4A 5KSAD 1L9NA 4B41A 5GGVH 3D39A 3EJZC 4Z7VF 2BNQB 4Y1AD 4F33A 1OB1B 4F3FB 5E4IA 2HVJB 2Z31D 1YDPA 2YSSB 2O5XL 2AV7B 1JRHI 2WBJC 1EAPA 4CVZA 5E4EC 5ENWB 2VSCA 1RK0A 4CVXA 3PIQA 4JHWH 1R3KA 1CQYA 5BMFL 4I48B 3NACL 1QBBA 4TOYH 4PJBB 5KSBA 4PJIA 3V52L 3HC4L 4Z8FL 5IV2B 4YDKL 1FPTL 3DRTA 1H3PL 2VQTA 3TWCL 3RL2B 3BP5A 3MO1B 3ZKNC 4YHPA 3V6OE 5I1IL 3MRIB 3C5JB 3H3PL 4OIBA 2AJZA 4KQ4L 2M2DA 4QRPA 4PRDA 3QHZL 1BJMA 1XGRB 1VADB 1AGCA 3NIFF 1DQJA 4C83A 1JWUA 3UZEA 4M5ZL 4RMVA 5A40E 2KQMA 4BZ2L 4PJ9C 1H9VA 1DDHB 4ENEC 4OLWH 3SDAB 4YHKL 1OARL 2ZG1A 3OAUL 4WNQB 5HI5C 4P2QA 4O5LH 1YPZA 1JF1A 3RY6A 4JFFE 1YMHB 5HD8C 5C1MB 4NQUA 5HGHA 1XR9B 1KBGL 4GAFB 5LG1A 1GGBL 1UA6L 5IESH 1N5AB 4JDTL 5C07A 1PDKA 3H42H 3HZYB 4M61B 3ROOA 1KOAA 4JFFD 4O2CA 4GMTL 5KW9H 1KF9B 1PZ5A 2N56A 3DX9B 2JJSC 2EYRB 5TE4L 4Y88A 4YBQD 1H5BC 3PDOA 2BFVH 2AJUL 4PJXE 4OF7A 4JO1L 2H1PL 1RUKH 2D0GA 4RRPG 2PYEE 4FQJH 5GGQH 2CUHA 5ISZE 3TO2B 4OLXH 1DANT 5F70A 4JY6A 4X7TB 3B8SA 3FB5A 1TJHL 5E56A 5DUMH 5BZWA 1ZLWH 4NQDA 2PYED 3VU2A 5I8OL 2ENSA 1WT5C 2BSRA 3O9WA 5ISZD 1J10A 3GUTA 1ZTXL 1QA9B 3ZT6A 4PJHA 1FGVL 4EDWL 1B4RA 2MHAB 1JTPA 1NGWA 5C09E 1AY1L 1YNLL 3OKMA 4L29A 5D7LB 4GW1B 1LILA 2VQ1A 1MCPH 5FYLE 4XBEL 1PJ9A 2AXFA 2PR4L 1FFOB 1MCBA 4QHNA 5C09D 4YXLL 4GAYB 4ZO8A 3QXVA 1SJHB 2J88L 3QB7C 4L3CB 1R3JB 3TO4A 2NY1D 1B90A 1S7WB 1VENA 3L3GB 5FYLD 4YAQA 5EOTB 3KWWB 5HYFA 1DEDA 4NBXB 5EC1B 2AJYH 3U0TB 4YEEA 3GKWL 3Q5OA 4P2YA 2CLRA 3L3JA 3FT4A 3C08L 2HLFD 2LABA 4UOW1 3SDXB 1VGKB 5GRVL 3O8XC 4Z5RB 5JOFB 2UYLB 2HLAB 1ZHBB 1P7QB 3OJ2C 3OXSB 3TLRA 3SO3B 3CX5J 5DDHA 4GSDH 1XCTB 2DMKA 3G5VA 2HA1A 2JB6A 2IADA 1RUQL 1QNZH 5HGAB 1W72L 4G8EA 2B0SL 4FG6C 5FA3B 4EUPB 1T22B 4Q9BA 4YH6A 1IAIH 5EZLA 3EYQD 4G6ML 4MA3B 1TVHA 4P5KB 1VCAA 1WITA 5HDQL 1CVRA 2DLHA 5I19H 1PKQA 3JWDC 1UM4L 4OV5A 2X7LA 3GSRB 2J5LC 4NM8L 1S9VA 1LO3L 4RAVA 5GRJL 4AEHH 2ZNWA 2Z8RA 1QEWB 3DLQR 4EJ1C 5EOQH 5GGSA 1T2QL 1F2XK 2R1XB 4UB0H 3GO1L 1FFPA 3PV6A 4NO3B 3O2VL 2IC2A 5IHBA 3HC0A 5HBBA 4LCWB 3WO4C 4PJDF 2VLRE 1DBKH 3ES6B 5FM4A 4U6VL 1T7YA 3DO7A 4WW1B 3BRFA 5DYOB 1P1ZB 3OPZL 4NUGL 1W2KT 4NKIH 3QDGE 5GJSL 1A6WL 3ARPA 4N0FB 1AI1L 1RPQA 2VLRD 3GSWB 3JUZA 5DLML 1DL7H 3X17A 3PJSA 5CINH 5J1AB 1OVZA 5GZNC 4MWFB 4NZTH 2IWGA 1ETZB 1LK2B 1I75A 3QDGD 3C87A 3AY4A 1D5MB 1CE1H 1WBXA 4NPYA 1UWEH 4PJ7A 3PHQB 3WFDL 5H94B 3UTSA 4XRCA 7CGTA 4IS6A 4G80A 4JFPB 1KPVB 4RFNC 4AZ8A 4OUUA 3V4UH 1RJLA 3BWAB 2P8LA 2PXYA 3IAPA 1QFPA 2DQJH 2FZ3A 3MA7A 4OF8A 3LQZB 2HFFB 5TF0A 2OR9L 4N5ED 4D0BB 4KGJA 3GI9L 3VGAC 3V9FA 1QYGL 1R24B 3RVWD 3EO9H 3LEVL 4I1NB 1E27A 3SDCA 3OJDB 3QWOA 4RCAA 4MD0B 1CG9A 3VXNB 5KVFL 4U7KA 2V7NB 5D7SH 2AXJA 3QWRD 1QSEE 4MNGA 4FXKA 2MWCA 2AERT 2XTJB 3UTTB 4J3SA 3HE6B 1QSED 4MQ7A 3LZFH 2D9CA 2XXMB 2J8HA 3GGWA 4KDTA 3VDBA 1HKFA 5E00A 1BQHB 4K23H 1JCKA 2NY3B 3BKJH 43CAB 2A77L 5T3XH 4NM4L 5KSAB 4NN5C 1CL7I 3H6JA 32C2B 1OQXA 5GRZA 5IWLA 4K3JH 4Y1AB 3LEXB 4ZO7A 3QPXL 1KG0B 1HCFX 2HG5A 2Z31B 1FBIH 4X6CA 1KCVH 4XP9L 5EUOA 3UDWC 3HZMA 2L4OA 4M00A 3DROB 4GXVL 4TTDD 1I3VA 3WUWB 3F62A 4TRPH 1JIBA 4LOUC 5DF0A 4KV5E 3E6HA 3OX8B 1BIIB 4R8WH 1FJ1A 3UBXI 4X4YB 5F21B 2D03H 3TZVA 1OT2A 5D1QA 5C08A 2B1HH 1A5FL 3DPBA 3OR7B 1B4JL 3HI6L 5CZXC 4ZTPL 4PLOB 5ABDE 1HOCA 1EERB 1MCOH 3FO0L 5EPMA 4N9GB 4E42B 1DQQA 2BSTA 2NY6C 4J1UA 3UAJD 1ZT7B 4I0PA 5ALCH 5CKGA 3BVNB 1LO4H 4QGYA 1PSKH 3T0EB 1P4LA 4QXGL 3PP4L 3WFCH 4E0RB 1S7RB 2JJTC 5DZOA 2ZOKB 4Z7VA 2Z93B 5L9DH 1RIUH 3JV6B 3FTGA 3SDDC 3VRLF 2H26A 1EJOH 5FOJA 4YHNB 1V05A 4JDZA 4YIQB 1U41A 3TBYB 1DSFL 1FO0B 4UT6H 3LV3B 1PFCA 3V5KA 2R2EB 1M71A 2ICEB 3MRHA 5GGVL 3V6FB 2YBRA 1S7QA 3G6DH 4HWNA 4TUOB 1MLBB 2FH6A 1BJ8A 4XWOD 4JJHA 4RNRB 3KLHC 1AQDB 1ZS8B 1V8HA 1C7TA 5CZVH 5IHLB 1N0XH 1R5VB 1UWGH 3GM0A 1DQDH 2R9HC 2NW2B 5EBGA 3TNMB 2V9RA 4EN3D 1ES0A 2FO4A 2A9MH 4KKCD 1P84K 5DS8B 5K9JH 4YDVA 1RZJC 3ZYZA 1BLNA 3EDFA 4PJXB 4X83A 2NYYD 2GSGB 2Q76B 5CD3B 2V2XA 3KLAB 1CFQA 3S9DB 3O81A 4F9LC 1HHKA 4OZFB 3RQ3A 1Q94B 4YFDB 5CUSH 1R3IH 1I7ZA 3ARBD 4LARH 2A9NH 3T1FB 5EZJA 2C7UA 3QEUA 3VMPA 2Q1EA 4NRXA 3DUHA 2X1QA 4N1HB 2QKIB 2UY6A 2NZ9C 4BQ6A 1E28B 4ZFZA 3CUPA 1HHIA 4UMGA 3PXJA 1U8OA 1FZOA 2RGSA 1I1FB 5C0BE 1K3ZA 5IMLB 3FJTA 3OZ9L 4ORGA 3RJQB 3PWVB 4O5LL 5TJWK 2CIKB 5C09B 4HDIB 3DX6B 4MX7B 4WV1B 1HNGA 4DFHA 5DI8A 3AM8A 4JM4H 1KB9J 4TNVK 4P2RB 2NY1B 2V5TA 3G6JE 4GS7B 1CLZH 5C0BD 3IU3B 5CMAB 3QO1A 5E03A 5IESL 2E3VA 2FHBA 3H42L 1C8PA 2VAAB 1CXKA 1LO5B 4HHAB 2X89D 3WJJA 3V0WH 2WW8A 3D2UD 2BFVL 2CSPA 3OKNA 1HXYB 3RWHA 4PGDB 4GRMA 4N8VA 1BJ1J 5I18H 4R7NA 5E6ZA 1RUKL 3HNSH 3IJYA 2FX7H 1J0IA 5EO0B 5GGQL 3WJLC 2CLVB 4RFOH 3IDGA 4OLXL 4NQVA 3P9MB 3JSSA 1DUZA 4JPIA 2O5ZL 4POYA 2G9HB 2X1PA 4O4YH 5DUML 2OQJA 3MUGB 4DUVA 2NXYC 2X4TB 4G6KH 3SE3A 3HNTH 3OAZK 1LP9E 4NNYB 4NFCA 2H32B 4HWBA 2DQDH 4H8WH 3VD9A 3WN5C 4GG6B 1JBJA 1SQ2N 5IEHB 2ARJA 2P8MA 1EJ6A 3KPNB 1KACB 1YN6A 2VDOH 5EU4A 5F6HI 2B4CC 4G43B 3R06B 4PLJD 4TVPE 1GC1H 1MCPL 5HGDA 4GQPH 1OSZB 1Q72L 2MKLC 1BAFH 3GSUB 4FNLH 4YHZH 1TZIA 2RCSL 1SHMA 2I9LB 2DWDA 1QSFA 5C8JA 1F13A 2QHLA 3MV9E 5DFVC 4IHOA 1IEAA 4HZAA 4QOKE 5KVDH 3RVVC 1D5ZB 1UENA 3M45A 3S7GA 3EJJX 3X11A 1EUUA 1GHFH 3U2SA 1HYSC 4XT1C 4NC1E 3MV9D 3H9HA 4P46D 1KJ2B 4WJ5B 5BVPH 5E8OA 2ZUXA 5LQBH 4ELKA 4FQQA 4QOKD 4UTAH 5GJTH 2P46B 4I5BB 4XXCC 2VLRB 1FL3B 4GSDL 2DOCA 1RJYA 3CDYA 3V2AR 5I66B 2O61A 3KPMB 3B5TA 4JB9L 2H6PB 2X6MA 1PG7X 5J3HD 3ZT7A 1IAIL 4F7MA 2G75B 4O51B 2BCKB 3VXSA 1I1YB 2YPKB 1JPFB 3QO0A 4OLVH 5I19L 1JRHL 1UT9A 5F88B 3MRRA 2IAMD 5DD1H 1INEL 3D1MC 4JY4B 5TQ2H 1MCHA 4AEHL 4HWBH 2X10A 4KC3B 2H8PB 1A02N 2EDYA 2EYSA 2ADGB 5EOQL 4PJDA 3DARA 4OCRH 4LLMA 1BQLH 1BBJB 1HQRB 2IQAB 3RHWF 4UB0L 4NYLB 1NCAH 4U3CA 4QNPE 4U1GC 5DA4A 5DVKA 3B9KC 1U93B 2QLVB 2L7JA 5EBMA 1KPRB 1MQKH 4LVOB 5IF0A 1DBKL 3FFCB 1XF4B 1QSEB 1K5NB 5B8CB 3I6LD 3FOMB 3MR9A 1UJ3C 5IB3A 3TA3C 2BOCB 4NKIL 4HKZB 1UC6A 5FKPA 3OKOA 3IKKA 1DL7L 4ZXBD 2A83A 1MFNA 1FORL 5CINL 1PAMA 3RNQA 4NZTL 3HI5H 3ILQC 3I9GH 1T83C 1JYVA 2Z0BA 4F8QA 1FL5B 3S37L 1H15A 1CE1L 4G6JL 3TYFB 4DCQA 4HWEL 4RRPA 5E5MB 1A6ZA 1UWEL 3DMMC 4M8QA 4MJID 1TJGH 3JV5A 3U4EA 5D1XD 1G1CA 3QH3B 1WFNA 4QHUB 4PJ9A 1BVKA 3V4UL 1VFAB 2N4IA 2APXA 3H9SE 6FABH 2DQJL 2OLDA 1G9EA 4DN4L 4ISVA 1KLUA 4WHTA 5A16B 3T3ME 3KJ4B 2WIIB 1RHHB 3STZA 3H9SD 1HI6B 3OHXB 3EO9L 2GAZA 2MQ3A 5C9JA 4NO2B 2YD7A 4FXGB 4NO5B 2CDGB 4OSUH 1RUMH 4Y16C 1A47A 1B3JA 5D7SL 2ZNXA 3BQUC 5HHVH 5KANI 2JJSA 1I9RH 5T1KA 4Q6IA 1H5BA 1JNHA 1U91B 1M7XA 2R4SH 4PRHD 1TNMA 1IRAY 1NGXA 2VABB 2XZZA 1BZ7B 4KTYA 4PP1D 4C56E 1G7MA 3BN9D 8CGTA 3BKML 3HS0B 3LZFL 4M93B 1JZ5A 2Z4QA 1IC1A 1BP3B 4FFZH 1ACYL 4JZOA 4ZAKA 4K23L 4NBZB 4GKNB 5HJ3B 1G1YA 3RIAK 2Y7QB 1YUHA 4U6YB 4C56D 5ACLA 2BY1A 1WT5A 3CDFA 4MS8C 5I1AA 5IVZB 3ZDZF 5F93C 1RI8A 4KQ3H 5TDOA 4K3JL 1PZUB 1DE4B 5T1LA 2NY4D 3PQYE 2AEWA 3FRPG 3T0XA 3G08A 1NDGA 2BK8A 1KJVA 3TJEH 4F37K 1I7TA 4HG4J 1RK1B 1ZMYA 2VXSL 3PQYD 4EN3B 2GJZB 2AK4A 1RURH 1UCBL 3KPLA 3QEQA 4MAYC 4LSRH 3EJYC 4EI6A 4XMPH 2XACC 1CWVA 3BPOC 4R8WL 2BOBA 4TNVF 2ZUYA 2D03L 4V2CB 1E4JA 4JFYA 2B1HL 4APQD 5F7DB 1F90H 2NX5E 4FHBD 1MCOL 2X4QB 2YWYA 4DGVL 3SCMC 3GMLB 1QFWM 3K2MC 2X4OA 2C4FT 1LO4L 1FNFA 2CGRH 4DGYL 3TF7C 3O8XA 2NX5D 2ZOLB 1PSKL 2JCCE 3ROLA 3ZL4H 4Y4KC 3BPLC 3CCHA 3WFCL 5DURD 2GW5A 3Q6FA 3RA7H 5FHAH 4LPWA 2A73B 3FRUA 2P7TA 1RD6A 5EU5A 1OAQH 5IW6B 3BGMB 1EJOL 5TDNA 3VWKD 1G7JA 1I1AC 2C3XA 2YHGA 1GGTA 4UT6L 4C4KO 1Z5LB 3G6DL 3ULUC 1MIMH 2KH2B 1FV1B 3D5OF 1CLYH 4GUPB 4R4BB 3G6JB 1N0XL 5IJVB 1UWGL 3DUSA 2ICCA 1DQDL 3D2UB 2CLZB 4H26B 5F9OL 4XNMA 1C5CH 2R29L 5K9KA 3BP4A 3DGGB 4JQXC 4OQTA 4K71B 3U82B 2R69H 2A9ML 3FT2B 5K9JL 5D2LF 3ABZA 3TT3H 1N8ZA 4D3CH 1UXWB 5H35B 4HLZG 5C71A 3RZWA 5I2IA 4NZDA 2ZSVB 5MHSE 4R6UA 1R3IL 5CBEA 4NHUA 5F7MC 4UINL 4LARL 2A9NL 3T04D 1FDLH 4JREB 5EU7C 4M03A 4RIRA 5MEPA 4LHQB 3G5XB 2DQFA 3VD4A 4ZTOH 3RGHA 5MHSD 1IAMA 1LP9B 1GJIA 1MCDA 4DN3H 2Y6SD 1ACZA 3DURA 2V2WB 4X6DE 2CPCA 2SEBA 3BGFC 4G9FA 4JM4L 1GXEA 3KDMB 2VXTL 1RMFH 1CLZL 1JI1A 4L3EA 3AC0A 3FQXB 4KKLD 3QI9D 1UFUA 1T20B 4KJWC 4I4WB 4I9WE 4ZG1A 1SMAA 3FB8A 3V0WL 5IG7A 5IK3B 2GJ6B 1BM3H 1U58B 3MRFB 3MV9B 5ESQA 1N6VA 4MB3A 3PF2A 5I18L 4QOKB 1F3JB 4HKBA 2WQRA 4NQCA 2FX7L 4I9WD 1MRCH 3JWDH 4EI5C 3REVB 3HZVB 4NDMB 4OZGF 2ESVE 2CKNA 4LSQH 3WHE1 4JANA 4X5WA 2EXWD 2EDOA 2VITA 4OQTH 1G7PB 2EYTA 4HUUA 4M7ZC 3VXPB 1I9IH 2ESVD 4XBGB 3HNTL 5F97E 4X7SH 2DQDL 3MX0A 3GIVB 4H8WL 3L3IB 4X4ME 4OZIF 2VLLA 4YXKH 2IAMB 3U36A 4XNYH 2VDOL 2DAVA 3MPCA 3AB0C 3FOLA 1GC1L 5F3HA 2LV4A 4X6FB 4R7DA 4YEFA 1OM3H 4NHCH 1BAFL 3VJ6A 4YHZL 2HWZH 5F7LB 4Y5XC 3VGDA 1NMAH 1WWWX 4XCYB 1VFUA 3UDWA 1CFVL 4HUNB 4PJAF 4U1SB 43C9A 1IGYA 4AT6A 1IL1B 1OTSC 4I2XE 5F9JB 1GHFL 5FF6A 2YKLL 2YPLB 4TTGA 4CUCA 4HV8A 3AREC 5LQBL 3UJJL 4UTAL 4HPOH 4EBQL 4ZXBB 4XNUH 1WTLA 4M7KH 2RAMA 3OSKA 3DRQB 4D9RE 4GAJH 1JL8A 4Y2DC 4JJ5B 3D3VA 1N5YH 2B39A 5LBSH 3LN5A 4MJIB 4WRLA 2CDEA 2NY2C 4UUJB 5KN5A 4JPWH 5K33A 3TBVB 4NP4H 4D9RD 3QNXB 2JJTA 3MV11 2IG2H 2OX5A 4XH2A 2PCPA 3ARRA 4XAKE 5CLWA 4XPTH 3HMXA 4Z95H 2V5MA 4L8SB 1K4CA 3SDDA 5L8KB 5TQ2L 2J2ZA 3GJEB 5E6IC 1JVKA 1QSVA 4HWBL 4JKMA 1JWMB 3GNMH 4KRPD 1XGPB 2ITCB 3H9SB 4ODUA 4LCIH 4XAKD 5IW1A 4OCRL 3DETD 4WI6A 1BQLL 4XP6H 3KPTA 3DO3A 5I16A 1NUNB 5ACZB 3P30L 2XWBB 3MBED 4MCYA 1NDMB 4PRIE 1N2RB 1NCAL 1EA9C 3GBNL 4G5ZH 1QO3B 1TITA 2R1YB 1MVUA 1LE5A 3KYMA 2K9UA 3RVTD 1DLHA 5EU6B 3RUGF 4PRHB 1BJ1H 4WDIB 5DR5H 1DBAH 1MQKL 4F37F 2GIYA 4O9HH 4PRID 3ULUF 4HEPG 4HKJA 3EO0B 1SYSB 3VCLA 5FUCE 2AI0H 3RWGB 5I17A 3TVMC 2JIXA 1PLGH 1QBAA 4FQXC 2D7MA 4JGUA 5ICYA 3KPRD 5IROC 5IBLD 3EYVA 4F9LA 4NZRH 3E6FB 3ZHKA 1HH9B 3BH8A 3HI5L 3PL6C 2X70A 3T3PE 3UTQB 2BNRE 4K7PY 1AGBA 1YEFH 2B7DT 3SY0A 3UCRA 1C1EL 1BEYH 1T7WA 4FZEL 3EOYG 5SWSE 5FV1L 2VL5B 4WEUD 4QRSB 3S4SG 2NY4B 4F57H 3LKPB 5INDB 4UNVA 1TJGL 1MJJA 4PGBB 2BNRD 3ZTNH 5C0GB 3GZKA 5SWSD 3LPWA 1WEJH 1ZKAA 1OY3B 4KKAC 3EYOB 5H8DA 1QLFB 1IMHC 5C3LD 3RTQD 3S88H 2IBZX 5HSFA 5C7XH 3EYSH 1UVQA 4EEEA 3IETA 3O11A 4KUCD 4EDXB 5C3TA 2IH3A 5DO2C 4ACPA 5TDPA 4Z7OF 2DQHH 1FLRH 1XCQA 3WE6B 2P42B 4APQB 3HMXH 4OSUL 1RUML 1WCBB 4U6TA 5HHVL 1YEGH 3RWJB 1I9RL 1OAXH 1U8PB 2JTDA 1IKNC 2R4SL 5GS1C 1HWHB 4MJ5A 5K9QI 1A6TA 3FB6B 5I1HH 3P73A 5DURB 4OD3H 4NKOB 3WJLA 5TH2A 5IMOA 3ZDYF 4FFZL 5D1ZC 5D5ME 3MNZB 8FABB 3VRJA 1T1WA 2Y06H 1T3FA 1A3LL 3OKKB 3QXDA 5LAXB 2IANE 5ICZA 3VWKB 4KI1A 2JCCB 3S5LA 2DIBA 1FNEA 3O3DA 3FQUA 2R1WB 4X8JB 4CGTA 2GUOB 3EGSB 3D85B 3CFEB 1RZJH 1SEBA 1EFXD 4AYFA 3QAZB 3MUJA 5HYSB 4LFHG