3EAKA

Nbbcii10 humanized (fgla mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NbBCII10-FGLA
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 28
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eakA00
3FT4A 2XQBL 3UBXA 3GBMH 4PJ7B 1HSAB 3H42H 1DUZA 1QR1A 2CPCA 4ISVA 5IR1A 1JPTH 1PX3A 5EU5B 1FFOA 4QKXB 1QACA 4ODXA 3C5ZC 4PP2B 4OIIH 1CBVL 2X9YA 2XZAH 1F02I 1Y0LB 2GKIA 4MA7H 5EIVA 4OQ1A 3HR6A 3VW3L 1VACB 1EMTL 3ALPA 3TVMA 1BFVH 2WV3A 5CZKA 1BMGA 4G9FB 1F4YH 1FH5L 4I0PD 3Q5YA 5HYJA 1Q9OB 2Y72A 4PRIA 1CDYA 1ZANH 4P9HH 4U1JB 4YPGB 1OAYL 3QNZA 4U1NA 4JRYE 3QJFA 3MV9A 4C56E 3WL9B 3GZKA 3MV7B 2I26N 5TDNA 5IOPA 3L7FA 4AMKH 4KTYA 1P4BH 4DEPC 3BWUC 5E1AA 3RIFF 1L0XA 3MOAL 3RWEB 2NQCA 3KPLA 4UZGA 4LNRB 3AS1A 2BC4A 4ONFL 1N6QH 5AZEH 3S88H 4GAYA 1K5NA 2DQJH 1KSRA 1BEYH 4P46A 4XBPA 3ZE0F 4JM2A 1UGNA 1KCSL 5CD5D 4M1GH 2FWOA 5E8NA 1F4XH 1YN6A 4G43A 4HWNA 5GGQL 5D72L 4NSKB 4M7KH 4X5LA 3F6LA 1EFXB 1ZHLB 2FSEB 5TE7H 4L8BB 4L8CB 1ACZA 2FBOJ 4HFUL 3U4AA 5ICZA 4AEFA 1NGQL 4N68A 1KPVA 2G60L 2VDNL 4KHTH 3GJEA 2ESVB 3VXSB 1MY7A 2LV4A 4IRJD 1H8SA 1N0LA 3U79A 1OGAD 5SWZD 1RZ7H 3UPRA 3U6RA 1BM3H 3ARFD 4WO4C 3QIWC 1KIPA 3TIDB 2YD8A 2DIAA 2R4RL 2DWDB 5F9OL 3UJIL 3MRIA 1NGPH 4RX4A 4P2QE 2AVGA 3BH8B 4NQXB 4JRXB 4Z7UA 4S10A 1J1PL 4QHKI 3WHXA 5LGHH 4LKXB 4RMUA 5KSBB 4XTRD 3K8MA 3TO4A 1E28A 3O3AB 4F7EB 4MJID 1BJ1J 5LAXB 3WUWG 4GQ9H 1NAKL 3QUXC 3VG9C 4RFEA 1RULL 3KLAB 3OKEB 1Q38A 2AK4E 5FKAA 4PGEB 1AR2A 3VXNA 3T0DA 3WXWH 2UZYB 5HPMB 4DGVL 5IWLC 4TQEH 3EYOB 1T2XA 3NTCH 1DLFH 4YWGL 1A7QL 1AXSA 4D8PB 5JUEL 3ARGD 4Y16A 2CGRH 1TJHL 4ZAKB 2ZUTA 2X7LA 2GJZA 3TJEH 1U6AH 3WDHA 1UACH 1S9YA 4XP9H 3LCYA 2GCYA 2DWEA 1OW0C 1KNOB 5MP6L 4TOYL 3QPQC 3QNYA 5I8OH 3LKNA 3O6FA 1U8MA 3DVFA 5DRZB 5IT2H 2VDMH 4KK6C 1RIUH 1E6JH 1AO7D 3I6GB 4LF3B 3T2OA 5ABDE 1EXUB 3PJSB 1I4FA 1I7RA 1HHKA 3MRPB 1HHHA 3KG5A 3CVHL 4X99B 3U46B 1NQBA 2BRRL 4EDWL 1V3MA 4J23A 3CLEH 5KS9B 4NQCB 1A47A 4JDZB 5EU3A 1XGPB 3KWWB 1WSST 3EJZC 2CIKA 4R2GC 4P5KA 3O0RH 4KQ4L 3RAJL 3ROLA 5HI5C 1QYGL 2QSTA 4ZXBD 1YEIL 4QHNB 3OKKA 1IFHH 1IZKA 1NJ9B 5HDQH 1T04A 2D7NA 3EDJA 4GRLD 4ONGH 1OAZL 3IJSA 5ELIA 3UYPA 4RWHA 1SVZA 5AWNL 4JHBA 5IB2A 1OT2A 3GGWB 4NZUL 4GKNA 2DBLL 4JFDE 2BNRE 5SX5H 1OOAA 1KTLA 1OSPH 1VPOL 2P1YA 3SJVE 2HKFL 1MQ8A 1WIPA 1TITA 1HSBA 3E8UH 4Z7WF 1P6FA 1XGQA 3RBGA 4YO0B 2R1WB 3GMNA 5DRXA 1U3HD 5K9QI 5C6PB 4LPWA 2IEPA 2QSCH 3TCXA 2QQLH 2VERN 2GITB 4MD5B 1BVLA 1B0GB 1EEZA 1R5VA 3O6KH 1MWAH 4LCWA 4G7VH 5IFHL 3O8XC 5D1XB 5EPMB 3TCLB 4HCRH 5BO1L 3HZVB 4OBSA 2Z4QB 4S1SH 2FHFA 4ZUVB 4OFYD 4UAOC 5CKAA 5DZNA 5EO9B 4NWUL 2IPUG 2A6KB 3X3FH 4MJ5A 5MENB 3EAKA 3QUML 3V6OA 4PRAA 3K4ZA 3HI5H 2WUCH 3VCLA 4DGYL 2WBJC 5ISZD 3QDMD 1RJYB 4LCYB 3Q6GL 3CC5B 1A6TA 4M61B 1PKOA 4M43L 4H1LB 1DE4A 4LCCC 5EU6E 3SDAD 1G9ML 3PXJA 3IVKB 1HQRA 3CMOL 2WIIA 2AV1B 4MD4B 4WTZA 1P69B 4OLVL 4NT6B 3CK0H 4HD9A 3TN0C 2PTTB 2FRGP 1BQHG 3U4BL 3RVTD 5TE4H 4LHUA 2ITCA 4WI8A 4ETYA 3EDEA 4V1DE 2V2WA 4RRPG 5D1ZC 1PLGL 4UT7L 3T4YB 2VNCA 1KB5H 5EZJB 4DQOH 4HT1L 5HGGS 3IFLL 3U2SB 3MFGB 1VESA 2BSTB 2D31B 1V3JA 1QHOA 1UB5A 3X12A 4DZ8B 5E2TH 1F6FB 4JFHD 5CSZA 4OCSH 2PR4L 2VXQH 1TXKA 1RZFH 4UV4L 4Y4FA 3SDXA 4ZNEE 2CH8A 4UOW1 3STZA 4F9PA 3NIGE 4JR9H 2E27H 4PRDA 2AKRA 3HMXL 1VFBB 2Y25A 5EC2B 1L9NA 4XHQA 2ICEB 1ZSDA 3U0TA 5DJ8A 5BJTB 5DHYB 2A9NH 4IOIB 4OM1L 3DXAD 1KPUB 3ULVH 4OTXL 1RUKH 3RI5K 3BT2H 1T4KB 4IS6A 2PXYC 5ESQA 3RX8A 3DVNB 3FOLA 5HXMA 2OLDA 5JR1H 4KJQC 3VGGA 2YPVH 2D0GA 2VMFA 1V7NL 3SPVB 5IQ7H 4QOKE 3LKPB 1D5XA 3TWCH 1LILA 5ITBH 3DYMA 3QI9B 5KN5A 2YRLA 2L0DA 3HAEA 1OHQA 1L9MA 2IH1A 1U8HB 5BVJA 3QO0A 4MAYB 4JPKL 4KV5E 4G3YH 4PRNB 5C0CA 1S5IL 3ZE2F 3IDNB 1OSZA 2ADFL 2F74B 4K55A 5E8DH 1JZ5A 5CSBA 3NIFE 4P5TD 3TPUB 1G7QB 5DUPL 4GXVL 3HE7B 1I7TB 5JW5A 1HKFA 2H8PA 1YNTA 3F62A 1T03H 4U1IA 3WNOA 3C5ZA 2FR4B 3E2HB 2ZUXA 4AH2A 1NMBH 1UC6A 1NKOA 2O5YH 2AJYH 5MEQA 4UINL 3DNKA 1UCBL 4XVTH 1F00I 1VADA 4JFEA 4KTDL 1QBML 3KHQA 3PHSA 3MLUH 2I07A 1W8OA 4HKZB 3EYUL 4M7JH 4YHOH 2A1WH 4L1DA 1DSFH 1SY6H 1EEUA 4NZJA 4YGAB 4E42B 4XVJL 4Z0XB 1MIMH 4GAJL 4JFQB 1AGBA 1IC7L 1RURL 1TZGL 1RUPH 3MRDB 4LAJH 1H15B 2C26A 4P23C 4XMPH 5EBWB 1MHCB 4CMMB 3EDKA 5E08L 3MLRL 1MHHA 3QFJB 4K7PH 2NX5E 1NGWA 1LD9B 4MCYB 3T3PF 1A7NL 3LH2L 1S7VB 2HH0H 4R96B 3SOBL 2PYEA 4O9HL 3U36A 3MX0A 2X4RA 3QRGH 4RAVB 2CLRB 2ZSVA 5L2KD 4NPYB 43C9B 1KTDB 1SEBA 4H0GA 2IH3A 3NZ8B 4CUCA 2WLYA 5HHNB 4FQXD 4NUGL 2VR5A 2M8XA 1JGVH 4KI5F 9CGTA 3S34H 1HNGA 4BSVB 4O58L 2Z35A 4UNVA 1CFQA 3HR5A 2P8PB 3PG2A 3VWKD 4C56D 3DOSA 1G84A 4MD0A 2DQCL 2VTFA 3QCVH 3KYKH 1V5JA 4MSWA 4P59L 1P4IL 3B9KA 2K9UA 3D25B 4G8FB 1MRDL 1QSEA 4XP5H 3K74B 5DJYA 2VE6A 3IT8D 3KYOA 3QIWA 4Y4KD 2BFVH 4ZFGH 2XFXA 3A67L 3MRNB 1GSMA 1FLTX 5IB1A 2DLTA 1KIRB 3UZQA 1FGNH 4FFWC 4KMTH 1H3PL 5I73B 3ZHLA 2X4SA 4NP4L 3VE0B 5SWQB 2GTZA 4CDHA 4XAKD 4QHMB 4JO2L 4WW2B 5J13B 1HYSD 3MFFB 1FJ1B 2Q6WA 2XWJB 2UZIH 3CX5J 2VXUH 5JA9A 1UJ3B 3QUXA 4D0CB 4TVPE 3PQYA 3MOQA 3GHEL 2D7PA 4XX1G 2X4TB 1CTOA 1MCOL 4K3JL 5AUMA 3WV0A 1CD1A 1CICD 5EFIB 3NA9L 3ZYOA 5FUOH 3HMWL 4F3FB 2W0FB 3WLWC 3IFPA 2YD6A 4M3JA 4HXBL 1T20B 1YMMB 4ODWB 4RA0C 2FECL 3IETB 5A43C 4UV7H 1EA9C 3OG4B 5HGHB 1QLEH 3QH3A 1J8HB 1EEQA 4LMQI 2BHZA 4XPFL 1OW0A 4YDKH 5FYLD 4AEIH 4R97C 2VLKE 5CGMA 4P0DA 1SJEA 5CHNB 1L7TL 4E41B 1EERB 4JE4B 1XIWD 3QPXL 3UTOA 3IJYA 3DETC 3TBSA 2V17H 5KZCB 3VXOA 4HZAA 2AK4D 3ARDA 3MRFB 1RIVH 4U0QB 1NBZB 1N64H 3D0LB 3TNMA 1J05A 2G5RA 4YC2B 1JMZA 3RWCA 3CFEA 5KS9F 4OQTH 1KTRL 1S78D 2HT2D 3LB6C 1CGYA 4LLAA 2Z92A 1B2WH 1YNKH 3ZDZE 1JGUL 1QLFA 3BE1L 4KK5C 3BISA 3MCLH 4PJXF 3GMLB 2VIRA 4IRSB 1GH7A 1QSFB 4MMZC 3BZFB 4QRPE 5DJAB 1RZJH 2VDQL 1BD2A 1GZPB 3CIQA 4HDIB 1AGDB 4G8GE 4ORGB 4X6CE 1RD6A 3KXFB 3BPCB 3RJQB 1S7XB 1U58A 1VGEL 3QEGL 3WFBH 3S5LG 5KVFH 4BH8A 4QLRA 3BJ91 4Y19B 1EV2E 5T1DL 3F12B 1S3KH 5L7XH 5KSUA 3MV8A 4S11A 4ZAKC 4NO0D 1F3RB 5IHZB 2QBWA 4CVWA 3BZEA 3CFDA 2R69H 5I2IB 1D9KB 5DQDH 2AXJA 2WK2A 4KRPC 4BQ9A 1IC4H 5FYJL 1FIEA 4F37F 3O8XA 3GB7B 1X6NA 2VQUA 3SDCA 1DBJL 1QKZH 2P24A 1YEEL 3V4UH 4M6NL 1NGYB 1YEDB 1VB9A 1OTUD 5HGBB 4LP4A 5DYOA 4ALAH 1WFTA 3PNWA 2YRPA 5AD0B 2BNRD 3SGEI 1DUYB 4WW1A 4JFXA 4DK6A 4ZTOL 5C0RH 1FFPB 3SKOB 3SJVD 3WIHH 5I66B 1I1CA 4NQVB 1HINL 2JB5L 3DHMA 1KYOJ 1C1EH 4BFGA 4BH7B 4AIZA 3MRGB 3TN0A 1QRNA 1UKTA 4I3SH 4X7TA 4LQFH 3D39D 3JV6B 4AENB 5CJ5A 3W81A 3LDBB 3MA7A 5D1ZA 3UTQB 5IUSA 1CVRA 5DHVA 1XH3B 5TF0A 1VCAA 4MXWH 3P0YH 3PGDA 2ICCA 2XOTA 3CDFA 4Z7WA 3T1FA 1CXHA 1HH9A 4HUXB 3VGFA 1NL0H 2HKHL 4WDIB 1PSKH 3RDTC 4ZMAT 3BEVA 4QO1A 3U4EB 3C8KA 4PGCA 3GMQB 4PJGE 4XPGH 5DS8A 3PV6B 4ODSH 2CKBA 3EFFA 2I5YH 3O9WD 1BOGA 1WWBX 1CLZL 1MJUL 5D1XC 1QBBA 5I0DA 5F44A 3DX8A 4HWZB 1XGUB 1WISA 3AM8A 4NDMB 2A77L 2E8ZA 5E6IB 5D7IE 2I25N 1JPFB 1NCAL 1SJHA 1M71B 3ZKSD 3ZLQC 5TF1L 1J1OL 3FN3A 1KLGA 5DVKA 4YHZH 1R3LB 3EHBC 2VKWA 4YDJB 4YH6A 4I9WD 4S1RL 4B7IA 4EKXA 3VMNA 2F53E 1PG7H 3BN9D 43CAA 2VXSL 1VEMA 1WZ1L 3KLSA 2NYYC 4FFVC 5EG6C 4EUPA 5GGSY 4P9HC 2BVPB 4PRPA 1YQVH 4M1DH 3AXLA 1QHPA 3D0VB 2XA8H 4K71C 3BP7A 5DWUL 3VI4F 2OK0L 3Q48A 4JCMA 3UTSD 1EJOH 2NY4B 1OF2B 3M1BB 3PHQB 5JIHA 3WFEH 1TFHA 1OP3H 2ZP0T 4PJDB 2DYPB 3BIAX 5CD3A 4HUVB 3GSWB 2ARJA 1C08B 3DRQA 2ZKHH 3O81A 4OZFH 5F93C 2XT1B 3LD8B 4KKAD 5IEKB 4RGMB 3ILQC 2B5IC 5D72H 2MNUA 3JV4A 5E8EB 3WNKA 4KQ3L 5CBAB 3G6AB 4ZTPL 3MBED 4Y1AB 1REIA 5F21B 2ZOLB 4EN3D 1H3TA 4JZOB 3BDYH 4HIEB 4BZ2L 1G1CA 4P23A 1JI1A 5CBEA 1WK0A 5EO1A 3ETBF 4OCNC 1PEZA 2VLRA 1HZHL 4OLYL 3GIVB 5F9OH 3N9GL 2IPUK 2EE2A 4S1DC 3FMGL 3LV3B 4HSQA 3MGTA 5EULV 3IKKA 4PJ8C 1T5XB 5DGRA 1RY7B 2VDRH 3PWPB 2Z31B 4OZGB 4GOSA 4PRHB 4MAYC 1W0WB 4Y2DC 2P46B 2H32H 5C07E 4FTVD 4U1MA 2D7OA 3O4LE 1RULH 4Y5XB 5HYEA 4JANB 5J12B 3K46A 3GNMH 4GJTB 4XWGL 3HCVA 2N1KA 1JPGB 1HXYA 3D3VE 3GMMB 4DGVH 3E2HC 4PP2A 2R8SL 4KJPC 3TESA 2XQYG 2VZUA 2WM0A 2NX5D 4MNGE 2Q86B 5F7HA 3UCRA 3L3DA 3MLZL 3N85H 1TIUA 1RUML 3P0VL 5JUEH 2EDOA 1BQLH 3VRJB 4YLQT 3W9EB 4J12A 5C0AB 2ZSWB 1A6AB 3HPLA 3OHXA 4F33A 4ELKA 4CU6A 1LNUA 3BPOB 1OM3L 4ZS6D 4KAQL 4MDJB 5HVWA 1KJMB 2DKSA 5MP6H 4Q0XL 3WL9A 4O4YH 3F58H 1XF4B 5I15H 3CSYB 5F8RC 3F7RA 1QLRB 3VXTA 2X4PA 3RNKB 4I18B 2GT9A 5L6YL 1VEPA 1X5HA 4YHLL 3A0OA 1N0XH 2E6QA 4LEXL 5JOFB 1NUFA 4OSUH 5ALCL 4NKOB 1D6VL 5LBSL 3V6FB 1ZLSL 5F96L 1XGYH 3VFTA 3RBSA 4LSPL 1FSKB 2LU7A 5D6CA 1T1ZB 4KQ4H 4C55A 2X4QA 2ZUQC 3RAJH 1G0XA 2F19L 2ERJC 4NWTH 4PJBB 3TLRA 5CCKH 4L8BA 2SEBB 3OKNB 4HJGB 4X0KB 1Z6JT 4LSQL 1KN4H 3CFJB 2NXZB 1ZE3C 1J5OL 4HLJA 4KRMB 3VXSA 3QEQB 3IU3A 5BS0A 4TVPD 1VPOH 2H9GB 4HW6A 3LMJH 2ADJB 5DUBB 1BIHA 1ZLVH 4FMKA 2I9TB 4LLUA 4NQXA 4KKBD 4XPBL 5DK0B 1TZHB 4F8TA 5TH2B 1UA6H 4NQSB 1BFOA 1NC2B 3TYGL 4NQEE 2Y6SC 3QT2A 4TRPH 4JREC 1CU4L 4LAQL 2EIDA 5D7LD 4ELMF 3IDXL 5JQ6L 4F7EA 1G0YR 2AAVA 5E9DA 1JUFB 1P7QB 4R90L 4XCCH 5FYLL 3B5GA 1UJ3C 4J8RB 1UWEL 3QUMH 4ZODA 5GPRA 4IDJH 4P4KC 3P4MA 2Y5TA 4GMSL 1KG0A 2WWMD 3ULVF 5T1LA 2PCPB 3LOWA 2J8UE 2KDGA 3FO2B 4HS8L 1DANU 3BHBB 4JO4L 1R3KB 4D8PA 3NN8A 4M43H 4EQ2A 1HDMB 1F42A 1QTYT 1PFCA 3JTSB 5EBGA 4XGZA 4DWHA 1HWGB 3BPLB 4I48A 5LCVH 1MH5B 4Y89A 2XV6B 3BZDA 2R39A 4BQ6A 1BIIB 3MNZB 3QQNA 4RQQA 4AQ1B 5F7EL 4NZTH 4WFHE 4FRWA 3UTTB 1VFAB 2GFBB 1KT2B 2OL3A 5FYKE 3GI9L 4DKDC 4QRPD 4U6HA 3OGCA 4ZPTB 3WHE1 4NC1E 4XB7A 1EXUA 4G8GD 3EUUA 3BKJL 4QYOB 4BSWB 1CT8A 1FVDA 1MFDL 5FCUL 2CLZB 2MQCA 3ZTNL 2DQUL 1D6EB 1I1RA 3MLYL 5CJ8A 4MNHA 3NZHL 5FA3A 3GM0A 5B4MD 4DAGL 4JDZA 4OZHE 3OXSB 1XGPA 3OPZL 1KN2L 2AEQH 4CVUA 4UV4H 3PDOA 5E8OA 3ROOB 1FPTH 2A6IB 1HK6A 4PJXA 1CLYL 1FO0L 1JHTB 2H2SC 2VSCA 4IRSC 1GZQB 4JPWH 4OCYH 4YBQC 3RGVA 4X7DC 1L7IL 5D7KD 4CJ1A 3LKQB 4MNQA 5EDXA 1U95A 4OGZA 4PIRF 4WUKH 1T3FA 5T3XD 4X6DA 2YN5A 4NCC2 4LLQB 5GZNC 2H2PD 3KHOA 1AH1A 2V7HB 1I7UA 4PUBL 3T0EA 5AEAA 1NGXB 3IYLW 2ZPKL 5ERWB 3L1OL 3RDTA 3BESR 2IANE 4A2MA 3QZWG 3CJJA 3WFDH 3ZDXE 3WNLA 5IB3B 5IIEA 4QRRB 1FGVH 2APXA 1BECA 5CIPB 4WI3A 4HWBL 4PJ7E 1INEH 3GUTA 4I13B 3N50A 5DUPH 3A6BH 3SGKA 3U9PH 5F6IC 3THML 5HYQB 1KUMA 2Z4QA 2CJUL 5IBLD 5EO9A 3MZGB 1FL3B 4TTGA 4NN6B 3MRQB 4NFDA 1HCFX 3C6SA 4UINH 1UCBH 4KTDH 1QBMH 5GGVY 1W72L 5T3ZE 2OJEA 3EYUH 3BUTA 4JFFB 2GHWB 2EYRB 3LN5A 4G9FE 3U7YH 3K2UH 4G6KH 1E4KC 2IFGA 4BFBD 4Z6AT 5DJ2B 2LVEA 1LDSA 2B8OT 1JK8B 4XXCC 2QEJA 1TZGH 4Z76B 3R06A 4CN6A 3KDMB 3PABB 5C6TH 1U93B 3MV7E 1HHJA 5FFLA 3LZFL 3P77B 1VKXA 5EWIL 1JNLL 2D7MA 4L8SB 4NUJB 1JHLL 1KPRB 1JTTA 3Q3GB 4JVPA 4XNZC 1EEYB 3V2AR 1IGTB 4QNPF 4X4ME 2IPTH 5EZJA 2R2CA 3CVHB 3SOBH 3RWJB 1T66D 1KJ3L 1WC7B 4L9LB 3ZYIA 3CZJA 5K93A 3GRWL 4L29B 3SDDA 1Q9WB 1ORQA 5I16A 3RPIA 3QUYB 2D31A 3B3IB 3NMEA 3TH4T 3LEXB 3L3JB 2C4FT 2IBGA 2X41A 3PIQB 4XVSH 3BPNC 4JKMA 3UZVB 2A74B 1ND0B 4KK9D 4RFOH 4K23L 5C09A 5D93B 1JZ7A 5EC2A 4R7NA 3NCJL 4P59H 1BVKA 3CDYA 3QQ9D 3GKWL 2Q8AL 1MRDH 1I7ZA 1FG9C 3VXMA 1QEWB 4NQDB 2YC1B 1ED3A 2ESVE 1B90A 1JYWA 2DBJA 1I1AC 3MA9L 4X9IA 2FX8H 4JO3H 3A67H 1WFUA 4M1CD 3CVIL 3EYVB 3VXUD 5F89A 4TUKL 4X9BA 3MMEA 2HP4A 4GUPB 2UY6A 4FS0A 4APQD 4PJ8A 3LPWA 4HH9A 4UT9L 4ODTH 2PO6D 4JRXE 1R5WB 1ORSA 1PAMA 5BRZB 3ZT6A 3TO2B 1YYML 4MAYA 3GSVA 4Y2DA 3C9NB 5KSBE 1GIGL 1HH6A 3IDNA 3G5VA 2P5EB 3IJHA 1FBIL 2XYCA 3LIZL 3ZYJA 3IS0X 4Y5VB 3HNVH 1T0NA 4UT6H 1YC7A 3FB7B 1I7TA 1UXSA 3V4PL 4XMLH 4K3JH 5I1EL 1YPZE 3PWUA 1XZ0B 5C0EB 4QT5A 1XFPA 3KPRE 1QPXA 3UYOD 3LD8C 2YD2A 2HAZA 1PYWB 1KB9K 3MPCA 3RUGF 4JKPL 3EZ8A 4RGMC 4D3CL 1BZ9B 3PGFH 3T04D 1UWXH 4CN4A 5IJKC 3GKZA 3O3DB 2GK0B 1NCCL 3GJFK 2YD3A 3OR7B 4XPFH 3FN9A 4Q9QH 2FJFB 4Z0XA 4HULB 4ZD3L 4JFQA 4OD2A 4GAGL 5GISH 3VA2C 3C6LA 5DJ6A 4PBXA 4J3UA 5GRWA 5BV7H 1K2DB 4KVCL 2P7TA 1MHCA 3IFNL 5C07D 3TH3T 3CH8A 1A6ZA 3HZKB 3ARUA 4ESKA 3QFJA 4O2CB 3TBWA 3MRMA 3O4LD 3BQUD 2BCKB 1GC1L 4HXAL 3E6HB 3HUJE 5GSRB 4OD3L 2E7MA 2X1OA 4HUKB 3D3VD 4L4VA 1I3RA 4EXKA 3D85D 4NM8H 4XMKH 4NQCE 1T22A 5IBTH 1KTDA 2NY3D 2Z31C 2AGJL 3BKCL 5TDOB 4EDXB 4HUMB 4DVRH 5D5MB 1AGCA 2EZ0D 1AKJB 3WIIL 1D5ZB 4Y5XC 1RZJC 4FG6D 4P48A 5J12C 1VGEH 2D4FA 2YR3A 3RWDB 4XI5D 2A73B 2GTWA 3GSOA 2Q7NA 1FVCA 3RNQB 1E27A 3FZUD 2FLBT 3RZCB 1T1YB 1OP5H 1Q72L 3AMKA 2X4UB 4TSCH 3L3OB 5DRNA 3TNNA 3V5DB 1U8LB 2BNQD 2J88L 3SO5A 1CE1L 1RK1A 1KIRA 5D2LF 1MPAH 4GRWE 3MOBH 4QTIL 4WHYG 1GRWA 1U41A 1K8IB 3QSKB 32C2B 4O51B 3PV7A 5FYJH 2NMSA 3HKFA 3QDHA 1WBZB 3W0WB 4JM4H 3VFNB 1PKQB 5BCAA 2YBRA 1MWAA 4I18C 4HCRA 3MREB 3S4SG 4QRUA 1G7IB 3QIUD 5MENE 1EJ6A 1U9KA 4P4KA 4HFWB 4U1HA 4ODHL 1FL5A 4LIQL 5A3ID 1FC2D 3V0VB 3B83A 3Q1SL 4TVPL 4F3FA 3OQ3B 2NY2B 1F2XK 4H5SA 1LEKB 3IAGC 5SV4A 4JQVC 2Z8VC 3ARED 3FQTA 3MRBB 1KC5L 3GMRA 5H37H 2WQRA 5DEGA 3RVWC 5FM8A 5DTFB 4PJCE 2O5ZL 4NQED 5IM7A 1GXEA 5EIIA 2UVEA 2QHRH 2NXZC 5MERB 3FQUA 1NDGB 2FHBA 4F2MB 5C2UB 1HIML 3GMOA 4ZSOB 3AS0A 3H9HA 3SQOH 2Q8BL 1KB5A 3DX6B 4F57H 1A1OA 2VQ1A 5BVPH 1SBBA 3RI5F 3RL1A 3T3MF 5C0JB 2HKHH 4JFYA 1K9TA 4FXKB 1C5DB 1MEXL 1UYWH 2ADIB 4HWUA 4PJHB 5C2BH 4KJWC 2XQYK 1YEJH 2AEIT 3DLQR 3VA6A 4JDVB 4U05A 3D69A 4HK3J 3RJDA 4I0PB 3FAXA 4ELMA 1CLZH 1F6AA 3F5WA 5EO0A 3T0VA 3TT3L 4QHLB 4PJEB 4N5UA 5HYJE 1YDPB 1JP5A 5HGAB 1RZ8B 1QSFA 4PRIE 5JPMB 3ULUE 5H94B 3BZFA 1ODAA 4UU9B 2A77H 4HK0A 4KKLD 5C0ND 5CMAB 4P2RD 1NCAH 2XIDA 2YPKA 3MV9E 4WNQA 2CXGA 3TPKA 1MFCH 5D2NC 4R4FH 1C5CH 2V5TA 4S1RH 3KPSA 4CNIA 1A22B 4U3XA 3BZ4A 4KDTA 5ANMA 2I24N 1WZ1H 1XR8B 1EAJA 1S7WA 5IESH 4K94L 4CJ0A 4FQJL 3BPLC 4HS6A 4JB9H 5CSGA 5EOQH 2OK0H 1R3JB 2QKIA 3LS5L 4XPTL 1U36A 3MJ9L 2FZ3A 3FB8B 3EKCA 1JGDA 2G75A 4Z7QF 4U31A 1NCWL 1T7XA 5D7JD 1DBKH 5KSAD 3S8WA 1NEZG 1NLBL 4IRJB 1OGAB 5SWZB 4GW1A 2UUDH 5KJRL 3ARFB 2OTPA 1LO0H 3SE3C 2VR4A 2DB8A 3VJ6B 4I3RH 1Z5LA 2IF7A 4DN3L 1DUYA 3MC0A 3SKMB 4JHWL 5BXFA 3AU1A 1ZHBA 4KQ3H 4EIZC 1E4KA 5C08D 3VRIA 3OAYH 4Y8DC 4K8RH 2XRAL 4LSVL 2RHEA 3MROB 4OZIE 4NQVA 4XXCA 4BSJA 4PBVC 1SY6A 4JKLA 3M17A 3HTLX 1V7ML 4BZ2H 4ONOA 4OF6A 5FK9B 4LCUA 4P2OD 4PV9B 3SCMB 3JV6A 1F8TL 4MJIB 1YZZA 4J4PC 2EDFA 3FO0H 5GGUA 4L5FH 1TVHA 5MHSE 4NN5B 1JGLH 5C71A 4I2XA 3VFRA 4PGDA 1MCIA 4N9OB 1OPGL 2ATPA 3KPQA 1MF2H 3MLSH 5DD0H 5GS1B 5GHWL 3MLXH 1BPVA 1NBVL 4UB0H 4E9LA 3ARGB 4G9FD 3QJHA 2GAZB 4CDGC 4U6VL 2AXFA 3QNXB 2DM2A 2EYSB 4J3XA 4YDVB 5I19H 1T21A 3RWFB 1FNGA 4HIJA 5LWYH 5D4QA 5B39A 4H88H 3WN5C 1HOCA 4R4ND 4U6TA 4NN6C 1JNJA 1I1AA 5J57B 1AO7B 4N0YH 5FHBL 3P0VH 4LSSL 4Z7OE 3LRGA 4CVZB 1LO5B 3LS4H 3QHFH 1Z9SA 2AJUL 3H9SA 5C0IA 2BVUA 4KAQH 4IMKC 1Y6NR 4D9LH 2R2EB 1AR1C 5EC1A 3OAZK 3FO1B 1DQLL 3PWLB 5DQ9B 4IOFD 2W0LA 3VD7A 1I8MA 4HK3N 3FRPA 1MFAH 2KZ1B 2DTML 4F7CB 2NW3B 5HHXH 1OGTB 4ZXBB 4NQTA 3IDMA 1UKSA 3M1BA 1AXTH 2M26A 4OUUB 4Y0GA 4GRLB 5DLMH 4U7SA 3X14B 3D87B 2FYYB 4Z95H 3V79C 1CCZA 1YECL 1DVFC 1MREH 4K3DL 5ALCH 2YOCA 4Q9RL 2FO4A 2Z91A 5LBSH 3GSWA 1FFNA 2YEZB 1JBJA 1ZLSH 4XCEB 3JUYA 4L3CB 5F7WC 2UWEB 3I50H 1CIDA 1UH2A 1KCLA 3RTQC 1GYAA 1IILE 1YN7A 5DJXA 4YDLB 1YMME 2F19H 5JHDD 5ADPH 3QEUB 2F54A 4JG1H 4EBQH 4IRZL 4U3HA 3MRJB 3QCUL 1CGWA 2EH8L 1PZUB 3BXNB 1JWSA 1SM3L 1S9XA 3G6AA 1J8HE 1A64A 1U3HB 5F3HB 1KACB 3K7UA 4LSQH 3WS3B 2ZOLA 5D93C 3SGDH 4HPYL 4PJ5A 4HIEA 3QUZD 4M48L 4X80H 3BP6B 4AY0A 1YNLL 1DANT 4UBDC 1RK0B 2W0KA 1MHPL 4WJ5A 4E41E 4LCWE 3WNNA 4YFEA 2EIZA 2EDKA 3A6OA 5JIIA 4LRIC 3GIVA 1CGTA 2R0ZH 2A6DA 3B8YA 4EI5A 2OR8A 4I4WB 1H0DA 5FHAL 1YC8A 3KPRD 4OGAD 3UAJC 1A1NB 2J3SA 3TYGH 5ISZB 3BD3A 3GJFH 4YR6B 3QDMB 4OQTA 2IBBA 5SWSA 5JIPA 1GVIA 1MCWW 5D71L 5B38A 2V5MA 3SDAB 2BVOB 1W2KT 4NOBA 1I8LC 5EN2B 3C60C 4MDIB 1MCWM 5D5MF 2R0KL 2R1YA 3VFWB 2ORBH 3WE6B 3V5HA 5LJYH 3N1PC 2JCCF 5K9KB 1NFDB 1OAQH 3E6FB 5SX4I 3DUUA 4U6YB 4OLZL 2AERT 4U2ZA 4Y88A 2NY5L 3RUGA 3TIEB 5IVXA 4G9DA 1MFBL 1A6PA 3GSNL 2YD4A 3CXHJ 3VWJD 1V05A 4Y19E 3HC0A 4JGMA 5C0AA 4UQ3A 5JOEA 2ZCLH 3QIBD 2IAMC 1IC5L 1A4JB 5I8KH 5JIKA 4RSVA 1YQ2A 3G6JF 1PZ5B 4UIKL 4DKAA 4XP1H 4PPTA 3VRLE 4X6BB 1F3JB 4JAMA 2F15A 3T09A 4HKXB 4X9GA 1JWUB 1NAML 1IGFL 1XF2B 4HIHB 3UZEA 4G6ML 1MFDH 5FCUH 1XF1A 4AG4L 4R7DB 1BZ7B 3DXAB 1I8IB 5K9OB 2X5PA 4ZUUA 1BAFL 2W9DH 5F72S 3SO3B 3KVQA 2QR0B 3FT2A 1QNZL 2Z93B 5GRYA 1BLNA 1BQSA 3L5XH 3O2WH 4JQVA 1QSZA 4ZFFB 4NBXB 3LKOA 5F1OB 5EZLB 5DJCA 4FABL 4YJZL 5HJ3B 3WBDA 4DW2L 3WIHA 3T4AA 5HHOA 4AZ8A 1YJDL 2BSSB 1L7IH 2SEBA 5I1AB 1GPOH 4XCYB 4RGND 1M6OB 1FYTA 3GI8L 3WD5L 1FV1B 2A83A 2FJGB 4P5TB 2C3XA 5IB4A 1LDPL 1HN1A 4JZJA 1E6OL 1OAXL 3S36X 2BJML 4U7MA 1GHFL 3RZCC 4ZYKB 5I1LA 5JW4Q 5HHQB 4I1NB 5E0QA 1RUAH 2O26U 2CUMA 5D2LA 2H26B 4ORZC 3I6KB 4XZUA 1JRHH 2VAJA 1N26A 4YXLH 4I77L 2I9TA 2DTSA 3CZFA 1AC0A 3MLVL 5IW6B 4FZEL 3VDCA 3PP3K 2OZ4H 1WIOA 2XN9A 3PGCA 3MJ8B 3B2UD 1A6UL 1B6UA 5ICXA 3G5YA 4PJEF 5DD5H 2VDOH 5FA4A 4J8RA 3HPJA 2AEPH 4RZCA 4Y4HC 2EO1A 1U8IB 5D2NA 1HWHB 5DJZA 4WU5B 5T5FL 3X13A 3ZKMD 1IKNC 3FRUB 4X5XA 3GBNH 3FO2A 3NFNB 4Q58C 4U1SA 3S5LB 4OM0L 5JDSA 2Q7YA 4LK4A 5JLZA 3BW9B 5L2KB 1KIQA 1MAKA 3JTSA 3D18A 1MVUB 5IEHB 4OD1L 1JCKA 3I02A 3R4DA 4M6OL 3LZFH 4FQXB 1QFPA 5GRXG 3TVMD 1JNLH 1IGYA 4RFNB 4N8CL 4LPXA 4OLWL 3O2DH 5HYJD 2JTDA 5ENWB 2B4CL 4HMEA 3VWKB 4PRID 3BKYL 4C56B 3HNSL 4YHIA 3TBTB 4H26B 4K2UH 4OT1H 5CS7A 1GGCL 5GS2H 1T0PB 2DJSA 3GMPB 4WEBL 1N7ML 4PJDE 2YPLA 3MV9D 4XPHL 3QA3A 1K4DA 1T2JA 4KC3B 5FYKL 2CSPA 3TP4A 1OT1A 4LEOA 4Y4KB 5TGBA 3SE3A 4OZFA 4KKCC 4QTHA 2Y06H 5JZ7D 1CD8A 25C8H 3I9GL 2QQNL 4XPAL 1IQWL 4I0PC 3WNMA 1IEAA 3ROOA 5A2IH 1BBJB 1B3JA 3UJJL 3RQ3A 1D5MB 4PB0H 3JVGA 5DD3L 4KVNL 3UX9B 4JJ5A 4P46D 3MA9H 1N6UA 3SY0A 3NCMA 4YNYB 1M4KA 4ONHB 3QO1B 4K9EL 5B3JE 1SYVB 2J7LA 3QAZB 4LLQA 5IMLB 4OCXL 5GZOD 4UNUA 2FX7L 4M5ZL 1RJLA 1LK2A 3AAZB 3OMZA 3PQYE 4PJAF 5C6WH 2A38A 3I84A 1P6AB 1CR9H 2G2RB 5ERWA 4ENED 5INDA 5CEYB 4UILL 2JJVA 1UENA 4UTAH 4QRRA 3PWPE 1GIGH 1LEIA 1OAUL 1FBIH 4AEEA 3MRKB 4ZUSA 3LIZH 4FQ1L 2H32A 2VZ3A 1A6VL 3BX7C 3NPZB 4P99A 4JQIL 2VDLL 1I3GH 1BQUA 4WFGE 5FECB 5I1EH 4LLYA 3FCTA 3V5KB 3LN4B 1FNEB 2MQ3A 3WN5A 4S1QL 1ZLWK 1JWMB 1J1XL 4A6YL 4HMDA 1DJSA 1XIWB 2BRQA 4UDTB 4NGHL 3ARFC 5MHSD 4NNXA 4DTGH 3TO4D 1T5WB 2AK4B 3ZO0A 3M8OH 4JFFA 1NDMA 5GGRY 3D9AH 1EBPA 4IMKA 4XCNB 4ZUTA 4ZFOA 5IKCA 4ZD3H 4HMCA 3D48R 4P5MA 3BWAA 3DURB 4H1LG 5BOZG 5I1DB 2ICWI 2VZOA 3ARWA 2HLFD 4EQ3A 1VGKB 2HT3D 1U93A 5I71B 3TH2T 5DJ0B 2HFEB 3IFNH 2E9JA 2CRZA 2DL2A 5CJQL 1ACYL 1XGTA 1ULVA 5BV7C 2V7NB 4Y16D 1CFNB 4X7EC 3UBXG 3DSFL 1GC1H 4HXAH 4M9OA 2BXZA 4XNUL 1EEYA 2J8OA 1IAIH 1G9NL 4NJ9L 2O61B 3VH8G 4LASH 4NN5C 1TQCB 1XCTA 1TCRB 1DVFA 1F58L 4GG6B 2ADGB 1IAIM 1NKRA 5F1SA 1IT9H 3UMTA 1P4LB 5IHUL 2VABA 5GS1C 2RCSL 3TFKD 3RTQA 3QUKB 4LSTL 3BKCH 4KUCF 3OAZH 2HJFA 3ARGC 1JPSH 4NO0B 3PIQA 1FO0B 3E3QE 2A74A 4PJBE 2NNAA 2YA2A 2D2OA 4I3GA 5BZDB 2XZZA 1NC4A 3FQWB 5DRWB 3ZKXB 3LRHA 4YE4L 4ODBD 5F6HJ 1CLOH 3P9WB 3E1F1 4D9RE 4G8EB 3T0XA 1Z3GL 3FO9B 2W65B 5J6HB 1EUTA 5MEOB 1QPPA 4KTEH 1X5IA 1Q72H 4FQCL 5GGTL 3EJYD 2VLME 4NNYA 4LMQE 3BUYA 4W6YB 1G7MB 3B9EA 1A7RH 2R0WL 3FOMA 1P84J 3EYSH 4U1LB 3RFZC 4IDLA 2BNRB 1CL7H 1A3LL 2HRPH 2IALA 4PREB 5D9SB 1VERA 1LP9F 3Q5OA 4NRXB 4IHOA 4RMTA 4FXLA 3SJVB 3EW3B 2Y4SA 3OAUL 4G6JL 1P2CA 4B5EA 4X98B 1U8KB 1KJ2H 2WIMA 3U0PA 4C59B 3JWDL 1U8NB 3C60A 2D9CA 1ETZB 5I76B 5C8JA 4ZXBC 5J8OA 2IADA 4R26L 3P30L 1N3NA 1CN4A 3MYJA 4MXVF 1CFTB 3FB7A 5C1MB 3F7QA 3D39B 1I3VA 4YHPB 3QDJA 4ODHH 1NFDF 1MLBA 3QUMA 1F90L 4LCWD 4MGXA 1W72B 2DS4A 2ITDB 4Q6IC 4BKLA 1IM9A 3C5SB 1PYWA 1NCDL 4LFHG 5K59F 2KQMA 3UJTL 4YDLC 4XP4L 1TENA 2IAMA 4PFEA 3BDXA 2OP4L 1HILB 2EICA 1H3GA 2ED9A 3NAAL 4LSRL 2FIRT 1XCQB 2O5ZH 2GJ6A 4IIQB 4M4PA 1U3HC 3TJHD 1S7UA 1DBBL 1K3ZA 1BJMA 1O5DT 1U8JA 3AVEA 3O9WB 3QBTB 5DFVD 1XR9B 1MHEA 3UTTE 1CWVA 2NY0D 3HZKA 5C0GB 5CJXA 3OKOB 1LO2H 2VISB 1MEXH 3T0AA 4AT6B 1PJ9A 3FAWA 4O00A 4GW5A 5JW3H 1FVEB 1G6RL 5GSVB 3LKSB 5BMFL 4LHUD 2RQ8A 4DJMA 1U2CA 3ILPB 5GS0H 2NW2B 3QXAA 3TBVB 1J88A 1HNFA 3HG1A 5E2UL 1TTFA 4HLZG 1KXQE 4GKZB 4MB4A 1BJ1H 5D5MA 3MTRA 3HMXA 4HAGA 4JGUA 3VGAC 2OMBA 4O02L 1MJ7L 1TDQA 2JCCA 2P45B 5J89A 3NGBC 4PRPE 4MVBC 1Q0XH 3MRCA 4WI5A 3UTSB 5CAYB 5T1KA 3IXTB 2A73A 4Y4FD 1A6WL 3W2DL 1PVHA 5JXEA 3P73B 4YFDB 5H8DA 2JELH 3TV3H 5F1NB 4C57C 5CP7A 5EUOF 1N5AA 2HTKD 4XC3H 4KZDL 3K81A 5FO9A 5IW1B 3T2PA 3G6JA 3V52L 5CFHA 5JNYA 1AGFB 1FIGH 4YHKH 3LS5H 4PLNC 2WLZA 4XPTH 1H5BA 3MJ9H 3AFLA 4BFIA 5DT1H 1IAOA 5KVGL 2DMKA 3BVNB 3MBEB 2H1PL 2NXYC 3N0PB 4RWYL 2APFA 4EN3B 4FQ2L 1INDH 1NCWH 3GBLA 5GGVL 1NLBH 1AGEB 3MR9B 5A2JH 1RUQL 5KJRH 5FUZH 4Y4HA 3WUWA 1AQDA 5DDHA 4Z5RB 2DJ4A 3CFIC 3R0NA 2ZG3A 4FNLL 5C0CD 5LVEA 4DN3H 4JHWH 1G7JA 1IKNA 1QO3A 2ZCHH 4QHUA 3SO3C 1ZHKB 4DGIH 1R3IL 4U6XB 1FE8L 2BY3A 2DQEL 4K8RC 3TM6A 1J0JA 2KUTA 2P47B 4KHXL 1UZ8B 5A16B 2BOBA 4ERSL 4FTVB 3P9LB 4J1UB 3RY4A 3H9ZA 5F7KC 2GSIA 4WV1A 4DZBA 4JG0L 4RNRA 4UDUA 5DUMH 3OB8A 5JW4R 3IFOA 1IGIL 3DX6A 5E94B 4OF8A 1Q1JL 3DV6B 4W4NA 3O41B 3DX7B 1U8OA 2DQIL 2NX5B 5BW7C 1C5DA 4N1CA 1X5JA 1PY4A 2N4IA 1HKLL 35C8L 1HQ4A 1JFQL 4XT1C 5J4MA 3CDGB 2IPKB 4M8QA 3L3GB 1IMHC 1EK3A 1RZ8A 2WQ8A 5I8CB 5JPMA 4QY8B 2AXGA 1K4CB 1G0DA 2XKNB 1ZT1B 4HPOL 1PQZA 4G7YL 3EO1A 3LVEA 5CZXD 1VENA 4CKVX 4RAUA 5DC4B 4CW1B 4E5XA 1Z9LA 4FFYL 4LHUG 2AJUH 2WWKO 4HWEL 5IMMA 4XBGA 5ITFA 2KQNA 4XNQA 1WAAA 3B9KD 4F7TB 5HDBE 4N0UB 4BZ1L 2NTSP 3T77B 1JL8A 2HG5B 1YY9C 5BRZE 3GK8L 4WHYH 1ZT7B 1GAFL 2DTMH 3ARYA 5GJSH 3WJLC 5H35B 3GO1H 3CFBB 2FATL 5LXGH 2P5EE 3VWKC 1K8DA 4PY7A 3SE9H 1YECH 3F65A 4K3DH 4Q9RH 4XCFL 4PGJA 2J5LB 3LAFA 4XC1L 1MCDA 4B53A 1MJ8L 3IDGA 5IB5A 5K9QG 2GUOB 3DIFA 2FHCA 4LLMB 4Y4KC 4PD4K 1I1FB 3OKLB 4Z77A 3VJ6A 2RAMA 2VLLA 5BS0E 4JJHA 3SHSA 3QUXD 1DFBL 4IRZH 1Y6KR 3PQYD 2Q76A 4HJJH 2EH8H 2PF6A 3G5XA 3IDIA 3MROA 3FFCA 4M00A 1D5IH 3MBXL 1J7VR 1MCRA 5I17A 5C3TA 5JORB 5D7LB 3R8QA 5IMKB 2XTJE 1CLCA 3QULB 1QBLL 1MHPH 5TE6L 4NNPH 3L3KB 1JN6A 5HGDB 3WIFB 3JWOL 4MJIA 3O6ML 3WYRA 1ZS8A 4WWKC 3MGOB 4LDEB 2CK0L 3GSRB 3INUL 1WEJH 4WFGD 1BQHA 4Z7VA 1N4XH 2ZJSL 5ID1B 5D7SL 2ICWB 5E9DE 4PJAA 4QXWA 4PR5A 3WO4B 1YEGL 4R0LB 1CICC 1EO5A 4F7MA 2IFFL 1WBXB 1CDIA 2CDFA 4KK6D 3WFCL 4FQQB 4TNVF 3RGHA 2VN7A 5I1KH 1WZLA 4I5BA 4NN7B 3KJ6H 1CFVL 5D71H 4LBEB 4K3HA 5ESVB 5C7XH 4NFBA 3WEXB 3ARDD 3DGGB 1C8PA 2R29L 1OP9A 1X5GA 2MOVA 4JN2B 4S0SD 3FN0L 1WCBB 3EOAB 5FV2A 3WKMH 4AEHL 1IL1A 3CGTA 4OLZH 1IQDB 4N0FA 4X6EA 3GDBA 1FFRA 2NY5H 3SBWC 3P11H 2AABH 4R4BA 2BZDA 4J6RH 4QRPB 1A2YA 2VDKL 2VXTH 4G8GB 3GSNH 1CGSL 1CFSB 1HI6B 1LO5A 5HI5D 4JZNB 1IC5H 3SE8L 2A9ML 3F6IA 3VGHA 3F7YB 1ZLUK 5FDWB 4OCWL 2HT2C 3DECA 4HJ0D 3FO1A 2WMPA 4HKJA 1Z9MA 2J12B 2R9HD 3UC0L 5C0BB 3W0WE 3RRQA 5I71C 1IGFH 4GG8B 3NABL 2YD7A 3WXVH 4AG4H 3O3EB 3MV8D 1ERNA 3BAEH 3BIKA 3C2AH 4G5ZH 2D7TH 4ZDHB 4Y5YA 4EVNB 4XRCA 1TQCC 2FYYA 4D9RD 4KKNA 1MSPA 4HUUB 1QNZH 3S37L 4MNQE 5B8CB 5F3BA 1FAIH 4Q6IA 3SDCD 1QVOA 3BRGC 5KVDL 5D6DC 2DMCA 4X6DE 1CGVA 2VLMD 1JTOA 1FCGA 5INCB 3HI6L 5ALBL 3T0EE 4G42A 3MNVA 7FABH 3MACL 1OVZA 5F3HA 4W68A 3ZKXC 2X09A 5CINH 1NFIB 3OKDB 5MEPA 4NHCH 5CP3H 3CNKA 1DEEB 5ILTH 4QCIA 2EXWD 2OI9C 4PY8I 1GHFH 3WLBB 5HYSA 2V9TA 2YSSA 1OTUC 2FJHA 4ZSOE 5F9WB 1T2QL 3DTXA 3B6SB 4TPRH 1Q94A 1C5BH 3TN0D 2HVJA 2C1OB 1QRND 1RMFH 4M7LL 5KW9L 1TLKA 3B43A 3MLVH 4PJHE 1FG2A 4QGYA 3WHE0 1LP9A 5D1ZD 1YMHA 4MJ6A 3DSNA 5EOTB 4OCRH 1EHLH 4GAFB 1J0KA 2DICA 4YAQA 3CLFL 5IFJA 1MRFH 3MRLA 3PXHA 3DROA 2YKLL 2H3NB 3RHWK 4JFOB 4KY1L 1NFDA 4G80B 1TNMA 4HGWB 3PP4L 3NIGF 1MQKL 1DQQB 3UTTD 2FBJH 3F8UB 1AE6H 5D1QC 3VFSA 4ETQB 1R24A 1OARL 2XWBB 5CJOH 1B4JL 3BP5B 1L0QA 3OJ2C 1YUHA 2CUIA 3P3YA 4CU8A 1UJTA 4M6OH 1F4WL 5FAAA 2EECA 4Z7NE 2DQTH 4AL8L 3LQZB 2DQGH 2FIKA 5HHVL 4IIQC 3C5JB 1PZ5A 3DWTA 4N8CH 3HZMB 4OLWH 1SMAA 2YWYA 2G5BA 4Q7DA 3HNSH 4KJQD 4HKXA 4X6FA 1FZMA 1INQB 2FO1A 1QQDB 1JV5A 4TNWK 3G6DL 2LTQB 4UUJB 1JZ8A 1XF5B 2IJ0C 4PRPD 5FYKH 3UYRL 1XGRA 4KV5F 1H3WM 2OTWB 4QRTB 1OGAE 5SWZE 1UB6B 2ENSA 2Y1VA 3U30B 3NIFF 3I9GH 3VXUB 4J7RA 3IU4H 1A3RL 2Z93A 1W8NA 4YPJA 5C0FA 4UTBH 3CCHB 2LFGA 1ZA6B 2EKSA 4N9GB 3U7WH 4APQB 4LRNH 3D2UA 1MCEA 1UWGL 3LSOA 3JWNC 4NHUB 2PO6B 3NH7L 4JY4A 3I2CH 5CUSH 2OBGA 2BSSA 5J11B 2COQA 2W9EH 3P9MB 1FV1A 3AC0A 5EBMA 1DQJB 2PYFA 4OCXH 2FX7H 2IQ9H 5EUOA 4RMSA 1XF3A 3OF6A 3TT1H 1A14L 2GW5A 3H7LA 2H26A 4PJIF 5BW7A 3HE6A 1T89C 3STLB 4KKAC 4P23D 5F88A 4ZOBA 1XMWA 5KAQG 2VLRD 4PTUA 3MXVL 4JQXC 1OAUH 5E2VL 2B1HL 2W38A 3MUGB 1MCPH 1P1ZB 1IGML 3DMMB 4YHNA 1T1WA 2OSLA 4KPHL 4JQIH 4EN3C 3ZKND 3S7GA 2EXYD 3ZKQD 2EH7L 2C5DC 3X11B 4MQ7B 5J3HD 4F9LA 2D03L 4DUVA 2VWEC 1G7PA 5CWSB 2D4DA 1AO7E 3BQUB 4GSDH 3ARZA 5K9JL 1F11A 4P2CG 5F7DA 2Z0BA 3D3VB 3RWHB 1B0RB 4G8IB 3H3PL 3S5LA 5JO5A 3D85B 1CXLA 5T3ZH 4HKBA 4M62L 2VO5A 4GKSB 3T0WA 4PV8B 3CFKB 3BH9B 1PG7X 2NY3B 4ZFZA 1RU9H 1U8QB 4UOJA 4M93C 5CJQH 4XXDA 1MRCL 3QHZH 3WJLA 5LQBL 3GSUB 1CFBA 2VLJA 1NAMB 4P3DA 4JRYA 1M05B 4NJ9H 1NCTA 3ECBB 4H26A 4K7PY 1C12A 1EZVY 1GC1C 1FN4B 2F5AL 2VZTA 4RISH 1N8ZB 5IGXH 1UM6L 5IHUH 2BVQB 1C16B 1UVQA 1E4XH 4B50A 4Y4KA 2UWEE 3OR6A 5F9JA 4OF7A 1FORL 3WFHB 3I6LD 3U9UA 2BNQB 3SE4C 2E7BA 1EH9A 5DMIL 4ZS6C 4QRSA 2EE9A 3Q2CA 5E8PA 3BMWA 5GIRA 3AUVA 5C0DB 1AHWA 1LHZA 4HHAA 1ZTXH 8FABB 1IAMA 4YNYA 1GOHA 3OGOE 4KI5D 4PRBA 1FCCA 4WWKA 1Q9KB 3QIUB 2VQTA 2H6PB 3S96B 3QDGA 5I9QB 2W60B 5DVMA 1CICA 1IARB 4OZ4B 1A3LH 3DX9B 3KAAA 4FMFA 3IXAA 4PJFE 1TJIH 2DLFL 5ISZE 4OGXH 3TBYA 5BS0D 1GGBL 3AREB 4LVOB 4MJ2A 3DETD 3GJFA 2IBZX 4ODUB 3RY6C 2V9QA 4P2QA 5E5UB 4R9HA 5EOCL 2NR6D 2IG2L 1MCSA 2CRYA 4MA8L 5DEFA 3MRRB 1S5HB 5F8QC 2XTJD 5TDPA 3CFCH 3ZDZF 2BOCB 3VMOA 2J5LC 1TZIA 3HHRB 2W07A 4KK5D 1FHGA 1SBSL 4X6CF 5DR5H 5E9DD 2E9WA 1X4XA 3K80A 2BMKB 1R3HB 3NAAH 3A6CH 1WBYB 4XCNA 3WMSA 3FTGB 5DMGC 2J8UB 1MFEH 3NACH 4KKBC 5I1DA 2F58L 5T1LD 2NY1C 4FQIL 2HFEA 2P44B 3EO0A 4HBCL 2EYTA 4C83B 3U1SL 2V7NA 4EIGB 4X4YB 3ES6B 5FDYA 4ZO8A 5DSCA 5HY9B 5HVHB 1R5IB 4P2RB 1MCKA 3ISWA 1KEGH 3DXAE 2HJLB 1TCRA 1I1YB 3BKML 4JN1L 5L88H 3OKYA 3WO4C 4R0LC 2XY1A 5I8EA 4D0BA 1S9VB 1FRGL 5BQ7B 5D6DA 3VFGH 3WUZA 2GSGB 5FOBB 1ZHNA 3QUKA 5E2UH 4NN7C 3RZWA 5GS0C 3KPTA 5FOJA 2HVKB 4KROC 5ANME 3BEWA 1S8DA 3ZL4L 3BP4A 5ACMA 1MIEH 1NCBL 5FM5M 1URLA 2VL5B 4HEPG 3CXDH 1VDGA 2PNDA 5EUKB 1S7QA 3GSQB 4X8JA 3EOBB 4Z18A 3EFDL 2G9HB 3W2DH 5HDLA 4TULL 1KCKA 1DDHA 5F7UA 4H8WL 2OQJA 3O3BB 4TTDD 1FQ9C 1SYSB 4YHML 5D7JB 5KSAB 5ADOL 2X1PA 2A6JA 4JFPA 4XH2B 5E5MB 3KYNA 1KIUA 2PTVA 2WINA 3RGVD 1AP2A 2ZCKL 3KYMB 2IC2A 3V52H 4MNQD 4JY6B 3FB6B 4NOFA 4JFDA 5I1IH 3OWEA 1FNAA 1IKFL 4HV8A 4PREA 2F8XC 1FZJA 4LNVA 5LGJA 1WT5C 2CDEB 4JHAL 3SJVA 4ZO7A 1MI5E 5C08B 2C4XA 1W0YT 3IDJB 1FNSL 2OZ4A 4RWYH 4FFZL 1OL0A 1M7IA 4KK8C 4RDQG 3T0ED 1FZOA 3MRHA 3DVGA 1MAMH 5B22A 1U8NA 1U91A 1Q9LA 3RDTD 4MCZB 3MV11 4WY7L 4P2OB 2AK1H 4PJGF 5DFTA 4TSBH 4YIQA 4A6YB 1UZ6F 3KPOA 1S7TA 1CXKA 3GSXA 5IF0A 2PW2A 5I75C 1B6DA 5D1QA 3K0WA 2H2PC 2XACC 5E99H 4M7LT 1UM5L 2C1PA 1HEZA 5D7IF 1NUGA 5IVZA 1FE8H 2DQEH 5ESAB 1EAPB 3SDYL 5L2KE 3FONA 2J6EL 1MCNA 1I9IH 4KHXH 1OAKH 3Q6FA 5DD6A 1FZKB 3VFOB 4MA1B 3G08B 1KJVA 3T65A 2CXKA 2DAVA 3FKUS 4URTB 1HHGB 4H1LH 1IGJB 4GLRH 3EHBD 3RWGA 2RFXB 4N0CC 1IBGL 5EU6A 4JG0H 3QP3A 5F1IB 4IMLA 1JZ4A 3O2DA 1WLHA 1OB1A 2NYYD 2P8LB 3M07A 4KGJA 1Q1JH 5C70A 1WCQA 1X5AA 3OZ9L 2CKBL 1XEDA 3KNBB 4LLWB 4V1DA 1UM4H 1X5YA 3QWQB 1ZT4B 1HKLH 5I6XB 1RZKL 1FFQA 1II4E 5CEZH 3FT3A 5I1CH 2NW2A 2VXVL 4GW4A 5EORL 1OCWL 2JF1A 2XKSA 1KLUA 3MCKA 3G04B 5TQ2H 1CVSC 3CSGA 3VI3E 4X7SL 3H9SE 3SDDD 4XAKE 4ZNEA 4G7YH 1IEBA 3CSBA 1ZMYA 4L8DA 3ULUH 2MHAB 1S9WA 1UQSB 4JLRB 3L7EA 3BGMB 4FFYH 3P73A 4PJ9D 3MLWH 4PTTB 4B41A 5C09D 5KTEH 1T66C 2AV7B 4LVNB 5I1HL 4BZ1H 3DBXA 1NLDL 3VXMD 1MCCA 4QXUL 3G5ZA 1CDBA 4RBPH 3CUPA 4EOWL 5C9JA 3GK8H 3QQ4B 5JHDB 2OXGA 1IAKB 4P4RA 1I8KB 3H7BA 4MWFB 4QOKA 4S1DD 1FDLH 4GO6B 4KK9C 1U92A 5EZIL 1OTSC 3W9DB 3SQBA 1U3JA 2B1AH 4KJYA 5FYLE 4PJ8D 3QWOA 5J1AB 3OX8B 1MNUL 3QUZB 1P7KA 1QOKA 5DZOA 2QQKL 4OB5L 3JTTA 4CVXB 4L3EB 4JPIA 1UXWA 4FQHB 3SCMD 1QRKA 4MMXC 5DI8A 4Z5RA 4Y2DD 5TJWK 1YEFL 3U30C 5FF6A 2I60H 3LKRA 4M1CC 3MNWA 4X5WA 1CL7I 3RIFK 4AYFA 2GJJA 2JK5B 3HI1A 1YPZB 4WVRA 2V2TB 2EDJA 2CMRH 1CE6A 4JY5L 3KPRB 2Y7QA 5JTWA 1S7SB 4APQC 1HXMB 4PLJC 4LLDA 2PO6C 1V8HA 1MLCA 4KJPD 3O6LL 4X4XA 2YD1A 5TE6H 4Z78A 2R23A 3O6MH 3W5NA 1EBAA 3WSQH 2CK0H 4J1UA 3V4VL 4WCYH 2ATKB 4LPCA 2MCPL 4FP8L 3V6BR 4NO2A 4U1GC 4UIMA 1BGXH 4PB9L 2ICES 3RU8L 3LPFA 4ZPVB 2IFFH 4GG6E 2X4OB 5E94A 4PJIA 4YXKL 4NYLB 3C6LD 1G6RB 3IGAA 4X7CC 3O45A 1HHIB 2NX5A 3DUSB 3DV4A 3HZYA 1I3UA 2AJ3A 5KVMC 1DR9A 3HUJB 5D70L 1CFVH 2DN7A 5I30H 3VWJB 5IVXE 3P4OB 1QBAA 3QIBB 1CQYA 4LGRB 4LKCB 1ES0B 3FN0H 4UQ2A 1V3KA 5L2JA 1H3XA 3KPNA 3KS0J 4JO1L 3MCG1 3H0TB 1MUJB 1T0MB 4RGOH 2NY5C 4U0RB 3V0AC 2YA1A 4KZEH 1A1MA 3BSZL 3VFPB 4OLUL 3OTTA 1I75A 3FQNA 3W39B 4NO3A 1G6VK 1DN0B 4OCWH 5FKPB 4PS4L 3QEHB 5ICYB 5AYQA 1XAUA 3IRZA 3RY6A 4LVHC 5EU4B 3QZWA 4KDWA 1WJ3A 4GRWB 4K3EH 1KCUL 2C7UB 1KJ2A 3UO1H 2EZ0C 2JLLA 5J6GA 1BFSA 4D0DB 3TYFB 2C3VB 4MX7A 3VG0L 4RGNB 1LE5B 4FG6C 3D39E 4ZQKA 3CPLB 1ZEAL 4XI5C 2HN7A 3L9RB 1FYTE 1QUNA 5KVDH 4YDIL 3FZUC 5IG7A 1PDKA 3B4NA 5FGCE 3T8XB 4WFFD 2R0LL 4MA3B 4PG9A 1BBDH 3OKMB 4GKOA 3JZ7A 5ALBH 2R56L 4OKVA 4MLIA 5IMOB 2XPGB 1D5BA 1I9JH 4P4KD 4AM0A 5I18L 1TQBC 4NKDA 2J8UF 3RWIA 3VFVA 3LQAL 3IKCA 2AJSL 2MPAH 2OTUA 4OJFH 1CDGA 4LPVA 5D8JH 1RVFL 4GMTH 3QCTL 1NGZA 3FQXA 1A9EB 4PJCB 1NSNL 2E9IA 3BDBA 3UDWA 4M8VA 3FT4B 3QIUC 1N59A 2VLKA 5KW9H 5DA0B 4N1HB 3UBXB 5I9QC 5A3IC 4TVSa 4R0LA 1DUZB 5GRUH 4IEFB 4OCLC 1QR1B 3VH8B 4HF5H 3SEPA 1QFWI 4ISVB 5IR1B 1KCVL 3NCYS 4I9WE 1FFOB 3RPKA 3AREC 4OGYL 5HHMD 2AI0H 3LEYL 1A0QH 4JDTL 4OFKA 4ODXB 4QRQB 4XNYL 3OL2A 1GJIA 4PYHA 2YK1H 3W5MA 3B9VA 4OZHF 3NFSH 3TVMB 1SEQH 1AIFA 1E4JA 1NMAH 1BWMA 3QQ3A 4O2EA 4OV6F 5HYJB 2YUXA 3UTSE 4PRIB 4U1KA 4J3SA 4KXZI 1BWWA 3QG6A 4Z0BH 3QNZB 3R1GL 3QJFB 1LO4L 4G8GA 4X6CA 3S35L 5GJTL 1B4JH 4BQBA 3MV9B 2PUQT 2YUVA 1E4WH 4BELD 5KBNC 4JZNA 4YBQD 5JPNA 4MAUL 4L4TA 1R0AL 5TDNB 5IOPB 3L7FB 1F4WH 1WIUA 2DDQH 3HRZA 5E1AB 3F7YA 2Y5EA 5HHVH 4HIXH 1A9BA 2OL3L 4NJAH 5IK3A 4BQ8A 2LAGB 4DKFL 3GHBH 3KPLB 5FB8A 5JXAL 4KRNA 3ULVD 1WT5A 1TJGH 2HTLC 3CH1A 5TFSL 4J2XA 3KPSD 2BC4B 2AP2A 3RA7L 3MJ9A 4KWUA 4OBRA 3T2NL 4GG8A 2VH5H 3WS6C 3ZDXF 2XI9A 4GAYB 4DCQA 3B2VH 4YXHL 4KKLC 3PWJA 5C0NC 4WU7A 4P46B 4MYWB 4XBPB 2QLVB 4PJ7F 2E7HA 2FWOB 2O5XL 2VWEE 5E8NB 2Y23A 4X7FC 1YN6B 4G43B 4HUWA 3EOYG 4LARL 1A3RH 4NC1C 4D2NA 3TA3D 1CTNA 3ULSA 3K2MC 1A7OL 1UWGH 1KPVB 4JFZH 1MCFA 2VAAA 3GJEB 5DK2A 1QSVA 5SV3A 3JV0A 3MLTA 3KR3L 5ETUA 3UPRB 3U6RB 1KIPB 1MI5D 4S2SA 1WITA 3I3BA 4DK3A 3KPPB 4OZIB 4OAWA 2VYRE 4FTVE 3MRIB 4HGMA 1U2HA 4K9EC 3ZE1E 2IMNA 1EVUA 4CAGA 3QFDA 4Z7UB 5D7JC 5KSAC 1ZWIA 8CGTA 2IQAA 5TPWL 3WHXB 2P5WE 1OLLA 1SQ2N 3QXDA 12E8H 2WUBH 1AJ7H 3GBML 2EEBA 3TO4B 1E28B 2VL4A 1CG9A 3GFUA 3J8F7 3H42L 2B1HH 4M5YL 4CN1A 1IGMH 4RFEB 2IGFL 1JPTL 1AFVH 2MFNA 3HNTL 3VXNB 2GI7A 1Z0MA 3I75A 4PJGA 2XZAL 3BJLA 1KELL 4MA7L 4P2OC 1PX4A 2FB4H 1AXSB 3DRTA 4HGWA 4Y16B 5K9JH 1F4YL 2X7LB 3WFZA 2GJZB 1FLRH 1S9YB 2J4WL 4H0HB 2Y07H 4ZS7H 1K6QH 2DWEB 2HFFA 5D7IA 1JHKH 3NPSB 3QNYB 3BP5A 1U0QA 3LKNB 1G1YA 1U8MB 3PHOA 1YEKL 4WO4A 4B7LA 4Y2OA 1I1AD 1P4BL 4N0UE 3V7MA 1X5FA 3K4AA 1I4FB 1I7RB 1HHKB 2F53A 5LQBH 5J1TC 1CZ8H 4WI9A 2Q20A 1WTGT 1N6QL 4KI1A 1KYOK 1QD0A 3S88L 3H9SD 3VXRA 5EU3B 2X9WA 1CF8H 5L8JB 1X6LA 1BEYL 5KSBF 3BYTA 4YGVA 4LIQE 5E6ZA 4P5KB 2C4FU 4M1GL 2ARJQ 3S4SA 1FORH 2P49B 1FL6A 3ROLB 4M7KL 3PWVB 5TE7L 5DMIH 1T04B 1YPZF 5EH1A 2EDQA 3IJSB 2DQHL 5IWLA 2X6MA 4AJ0A 5IB2B 2FGWH 4KHTL 5F7LB 4GKNB 1AD0A 2DQFA 4TN9A 4IOFC 1RZ7L 5D7LE 1BM3L 1KTLB 1WFOA 2JJUA 4HX1A 4WGWB 1A7PH 1HSBB 2F54D 1XGQB 3OV6A 3EO9H 3GMNB 1NGPL 4XVUD 2X4NA 2FDBP 5DRXB 2DI8A 1X3DA 1BVLB 1EEZB 1Q0YL 3MODH 4LCWB 4PJ5D 2L7UA 5LGHL 2DLFH 2KH2B 1TETL 1M7DA 1T1XA 6FABH 1UEYA 3HUJF 5IV2A 4GQ9L 4MJ5B 5EOCH 4XNXL 4MA8H 2OS7A 2VUYA 4EI5D 2DD8L 1CDCA 4PRAB 3QDAA 1DBMH 2D9QB 4TQEL 3QUZC 3VCLB 3ZTJG 3VFMA 5C07A 3NTCL 1B4RA 2NY0B 5SWSD 1A6TB 3O4LA 1JNNL 4P3CL 2OJZH 2CGRL 2QHLA 3QXVA 5F97E 3U0WH 1HQRB 5DJDB 2BNUA 2JB6A 4KFZC 4WI7A 3TJEL 1U6AL 1UACL 3PWNA 2UYLA 3GSNA 1A5FH 2NZ9D 2HFTA 1B0RA 1U3ZA 3D85A 4LCIH 4MNGA 1LVEA 5I8OL 4LHUB 1JMXA 2ITCB 2F58H 2VITA 2V2WB 5IT2L 1IE5A 2EO9A 1WZKA 2VDML 1RIUL 4FQIH 2VSDA 3O3UN 3OSKA 5C0BE 3U1SH 1DQML 3LN9A 3O11A 2BK8A 3GSUA 1RSFA 2XXCB 4P57A 3ECBA 3CLEL 1P7HL 5D7KE 4JN1H 1UB5B 3X12B 2JJSC 1FN4A 4F7PA 4YUEH 2ZOKA 2HLAA 4XHJD 4Y4FB 3SDXB 1FRGH 5T3XE 5HHPB 3STZB 4N0RA 5B39G 1DBAL 2XNAA 4NKMA 4PRDB 2AKRB 5FGBC 1NEZA 5FO8A 3O0RL 1RFDH 5IFAL 1ZSDB 1CGUA 3HN3A 4BM7A 3ZL4H 3L3HA 1NCBH 4IS6B 2WBJA 5ESQB 1WQVT 2XG4A 3FOLB 3SKJH 3EFDH 1EX0A 2N56A 2HWZH 1B9ZA 5EA0L 4LCCA 5CP3A 4HIIB 4QWWD 4MB5A 4QXGH 4YHMH 3RHWF 5KG9A 3P4NB 1KENH 1D5XB 3OXRA 5TQ0H 3FRPG 5HHOD 5B21A 3RVWD 3E8UL 4PJCF 5KN5B 3HAEB 4AIOA 2YXFA 5ACZA 2E3VA 5BVJB 3QO0B 2L7JA 1UEMA 1FYTD 2W60A 5C0CB 2QSCL 4OZ4A 1JF1A 2JJTC 1IKFH 1OSZB 2QQLL 3V4UL 3O6KL 1MWAL 4G7VL 4JHAH 3MO1A 4HCRL 2CLVA 2DM7A 4R3SA 4QXTA 5JW5B 4NRZA 3K4DA 4S1SL 2H8PB 5AG8A 1YNTB 4U1IB 5J56B 3P2TA 1F4AA 3X3FL 4AH2B 2R2BA 2XQBH 5MEQB 5DVOA 1VADB 4NQEA 4BJLA 1ROWA 5E56A 2HJKA 3HI5L 2WUCL 3EIFA 5HBBA 2XN9D 2QQQA 4F37K 2XXMB 4RMVA 3ULUF 3MUZ1 1AGBB 1AD9A 1CBVH 1RZGB 5GGSA 3VXPB 3VW3H 1Y18A 5CEXA 1EMTH 2J6EH 4DEPB 2PXYA 1DP0A 3CK0L 1RHHB 2CDGA 2I9LA 5B3NA 2LQRA 1MJJA 1ZVSA 2Q1EA 1MHHB 1LE9A 1FH5H 4XBEL 4DVBB 5TE4L 1NGWB 2AXHA 1A02N 1OAYH 1IBGH 4PD4J 2AJZA 3OJDA 4DQOL 3ZT5A 5CKGA 5IP4A 3U36B 1VFOA 3WS6A 3DO7A 2X4RB 2AJVL 2ZSVB 1KXTB 5E00A 3DI3B 3B8SA 5B38G 3EYQD 5HY9A 3K3QA 1KTKE 3OZ9H 3MOAH 5L9DL 3JBG7 1X7QA 2IH3B 4JEGB 1ZGLM 2HJLA 1F6LL 2MKWA 4OCSL 3RL2A 1RZKH 4ONFH 2VXQL 1UH3A 1RZFL 1S9VA 3QR2A 3VXUE 2Z35B 3HR5B 2GSGA 2HMIC 2YUWA 5EORH 2E27L 4MD0B 4Y7MA 4MSWB 4NKQB 3B9KB 1NEUA 2YPLD 4OZHA 2A9NL 1QSEB 5D96B 4C54A 5DJYB 1KCSH 5T1MA 2VE6B 3ULVL 1WAAE 3KYOB 1RUKL 3QIWB 5GGQH 2VL5A 3BT2L 3TVMC 2XFXB 5C3LD 3EDFA 2FL5A 5E03A 1DLHA 5EBLA 5IB1B 4OKDA 2R1XA 3SKUD 4OZIF 2YWZA 4HFUH 3L5WB 5JR1L 3ULUC 2YPVL 1NGQH 2G60H 2VDNH 4PGBA 2X4SB 1I9RL 3SGEH 5IQ7L 3QG7L 1BVZA 3TWCL 5M7QA 2GTZB 3V6ZB 1BFTA 5ITBL 5DMKA 3KYMA 4EOWH 5FO7A 2Q6WB 4G3YL 2R4RH 3UJIH 2B0SL 5JZ7C 3QUXB 3VG9B 5E8DL 2JIXA 4OLXL 3PQYB 4NZDA 1YY8A 5F7NC 5EZIH 3MGAA 4X4ZA 2IANA 1J1PH 5AUMB 1T03L 5CIPH 3F7VA 5J9PA 3QI9C 5F9DC 1NMBL 3FFCE 3IFPB 2AJYL 4PJ7A 1HSAA 4P46C 1OWRM 1CS6A 5JMOC 3MLUL 1IJ9A 3ARBD 1NAKH 4M7JL 4YHOL 5EU5A 2C3HA 3QH3B 3HE7C 2A1WL 2ZWLT 4RAHA 4MQXC 1DSFL 1SY6L 2WBKA 1MIML 5LGKA 3VXQB 2P5WD 5FM5O 4YZFE 4MHHI 1DZBA 4Z7VE 1Y0LA 1EAPA 1SJEB 1VACA 4YWGH 1A7QH 4Z7OF 4XMPL 1TJHH 4G9FA 3TBSB 4K7PL 1Q9OA 3ARDB 5A2KH 4U1JA 4YPGA 3TNMB 1J05B 4TOYH 2H41A 3RWCB 3CFEB 2K3TA 1TCMA 1AR1D 3MV7A 3QRGL 2A2QT 3EOTL 3V9FA 1LMKA 4RMRA 4WW2F 1QLFB 5E2WL 1OQXA 3RWEA 2BXYA 1TTUA 2VIRB 3CVHH 4X4MA 2BRRH 1JGVL 2XG5A 3S34L 4LNRA 4EDWH 1NH6A 2BNQE 4LLVB 5DF0A 3G04A 1DVFD 4WRLA 1U58B 3QCVL 3ALWA 3KYKL 4RCAA 4JO1H 2HLFC 4WEMB 4XP5L 3RTQD 3TEUA 5KVEL 1QYGH 4NSKA 2BFVL 3WNPA 4ZFGL 1EFXA 1RJCA 1ZHLA 1YEIH 4KRLB 5KSUB 2FSEA 3MV8B 4L8CA 1U42A 4P49A 1EFQA 1OAZH 1FGNL 1DEDA 4OF3A 3BZEB 5AWNH 3CFDB 4N8PA 2HFGL 1NC4D 2YD5A 2ESVA 4NZUH 3NPSC 2DBLH 5FXCH 3O8XB 3SDCB 2P24B 4PS4H 3TIDA 2HKFH 4UAOB 2UZIL 2DWDA 3GEWB 4OZFG 5DYOB 4I0CC 5I73C 3BH8A 3PNWB 3UROR 3VGEA 4JRXA 5SX5K 3UAJD 5IFHH 4LKXA 4WW1B 4JFXB 5FUOL 1ZEAH 5KANI 1JE6A 5KSBA 5BO1H 4WW2C 5J13C 4LQ1A 5GS3A 3ZDYE 1K85A 4X8XA 3O3AA 5J1SC 4NWUH 5LAXA 3PDDA 1MCJA 3C60D 3KLAA 3RVXD 2MTPA 3OKEA 4UV7L 3QHTC 1QLEL 4MZ3A 5HI4D 4AIZB 4PGEA 3TN0B 1QRNB 4YDKL 2X70B 5HPMA 3QDJD 4OLEA 4DGYH 3EYOA 3MA7B 4AEIL 5D1ZB 1M1SA 3Q6GH 5IBUG 5DHVB 1IM9D 2AJSH 3PGDB 2K1MA 1G9MH 4ZAKA 2V17L 2WNGA 1DQTA 2MWCA 3CMOH 3QCTH 4Z7WB 3T1FB 4OLVH 1HH9B 2IAMD 1NSNH 1RIVL 2WP3T 3U4BH 2ATKA 1N64L 3BEVB 1KNOA 4P2RE 1ZGLB 3C8KB 2GJ6D 4PGCB 5DRZA 3VRLF 4OQTL 5DS8B 2CKBB 1PLGH 4UT7H 2E8YA 1B2WL 1J9CT 3NIDE 4Q9CA 1BOGB 3I6GA 4LF3A 1ADQL 3FQRB 4HT1H 3DPBA 3PJSA 3DX8B 3IFLH 5FGBA 3MCLL 3MRPA 4X99A 2NLJB 3DO3A 4MLSA 3U46A 2DOCA 4XAWL 4M9PA 5KS9A 4NQCA 4YC2C 2QADD 1SJHB 3KWWA 3TJHC 1GL4B 2PR4H 2HT4C 3WFBL 4K07A 5GRVL 5C0BD 4G6AC 3HMXH 43CAB 3HG1D 3R1GH 2NY0C 5I74B 4IJ3B 1B0WA 1S3KL 5L7XL 4QHNA 4EUPB 4OM1H 4AQOA 1NJ9A 4PRPB 3AROA 4OTXH 3BP7B 2EIBA 2WP3O 4GQPH 5DQDL 3GGWA 2JJTA 4DKFH 1IC4L 2FCBA 5T1KD 1V7NH 1QKZL 3LRSB 3MUHL 1O0VA 5JXED 5C08E 3T2NH 4S0TD 4W81A 3ALXA 5CD3B 4YO0A 2R1WA 3HA0A 2ARJB 2AJXL 3DRQB 4ALAL 4JPKH 2C3VA 1D9KC 5FGSA 1S5IH 4MD5A 2GITA 2ADFH 1B0GA 5D1XA 4HAFA 5EPMA 1P9MC 3TCLA 3UTPE 4LARH 1CQKA 3JV4B 4GXVH 5GGRB 3HZVA 3L9RA 4JVWA 2VB5A 2W92A 4ZUVA 3WIHL 4WUUE 2A6KA 5E1HB 5MENA 2HTKC 2EDLA 1C1EL 4P23B 5CBEB 4A2LA 3KR3H 5EO1B 2VLRB 4I3SL 4QF1B 4XWOD 2E6PA 1RJYA 4LCYA 2OMNA 3CC5A 4Q2ZB 4XVJH 4GAJH 4M61A 4H1LA 1IC7H 4MXWL 3MGTB 1RURH 1W0VB 3P0YL 1HYRC 3IVKA 1T6WA 2EDBA 4U49A 2AV1A 4MD4A 4PJCA 4NT6A 5TPWH 1NL0L 1PSKL 2PTTA 5E08H 3MLRH 1WFNA 3LDBC 3TZVD 1AC6A 4XPGL 4KUZL 1A7NH 4ODSL 3LH2H 2VN4A 3VH8A 5C92A 3T4YA 4M5YH 4U1MB 4CADB 2I5YL 3I3EA 2IGFH 4KH2A 4O9HH 4PJDF 3HNTH 1QP1A 3HCVB 1J11A 1HXYB 3U2SA 4QRQA 2BSTA 4DZ8A 1KELH 4NUGH 1KXVC 3L3DB 4KKCD 4QHKJ 2BDNL 2EDXA 4O58H 5GQBA 3ESVF 3HPLB 3OHXB 4F33B 4YHZL 4OV5B 2J4WH 2DQCH 4ELKB 1LNUB 1VFBA 1PG7L 3Q5TA 2VLJE 1P4IH 2ICEA 5DO2D 5BJTA 5DHYA 4IOIA 5H2BB 5E6IC 1KPUA 1YEKH 3PL6D 1YQVL 4M1DL 2XA8L 1T4KA 3VXTB 2X4PB 3DVNA 5B3JF 2GT9B 1EJOL 5JHDE 1H3PH 2ZNWA 2YRZA 3WFEL 3UXFA 3SPVA 4NP4H 2DI7A 3LKPA 1PD6A 4HS3B 3RVVC 3QI9A 4JO2H 2ZKHL 1U8HA 4OZGF 3VFTB 1GGIL 4PRNA 2EEDA 5D6CB 4L3EE 5CZXC 2X4QB 2F74A 2NY4C 3VU2A 3TPUA 1G7QA 3GHEH 3HE7A 2V6HA 1MCOH 4EEEA 3NA9H 2EDNA 2DQHH 2FR4A 3HMWH 1F13A 4R97B 3BDYL 1KOAA 1CDJA 1JF6A 3B9KC 4HXBH 3QDGE 3IU3B 5D96C 2MQ0A 5BS0B 4HKZA 2M2DA 1J0ZA 4OF0A 3KPPA 4OZIA 5FIEA 3DMMD 4E42A 3H8NA 1JYNA 4JCLA 4OI9A 2VDPL 4LLUB 3FFCD 2XTJB 1L7TH 3MRDA 1Q0YH 3QXTA 1BFOB 1H15A 3LPGA 2VDRL 5EBWA 3QPXH 4CMMA 4FXGB 1TETH 4MCYA 1LD9A 3MLPA 5E9DB 1S7VA 4XNXH 4OUOA 4R96A 4RAVA 2DD8H 2CLRA 3GNML 1QFHA 3P4MB 4NPYA 2Y5TB 1KG0B 1JGUH 3BE1H 1X9QA 43C9A 5E7FA 5T1LB 2FX9L 3NZ8A 5HHNA 3ABZA 3N85L 1DN2A 5T5NG 3NN8B 1JNNH 4P3CH 2VDQH 2WBWB 1BQLL 4PJBF 4BSVA 1DQDL 3BOVA 4YX2L 4XGZB 4ZFOL 2P8PA 4I48B 3T2QA 1RPQA 4POZD 3QEGH 4KRPB 3V7AE 3D25A 4G8FA 4WFEE 4RQQB 4O4YL 3F58L 5HI3D 5I15L 2OL3B 1EVTC 5T1DH 3KPMB 4U6HB 3OGCB 3MRNA 2M1KA 1DQMH 4PP1D 1CT8B 1FVDB 3ARDC 3BPOC 2VRAA 4MNHB 5GRVK 5KAQF 1N0XL 5FA3B 2BY0A 3VE0A 5SWQA 4ZUWB 4RGNE 1G7LB 2NCMA 4OSUL 1DBJH 1YEEH 4J3OC 4QHMA 4Q6YA 4WW2A 4M6NH 3PDOB 1CDHA 5E8OB 3MFFA 1DBAH 1FJ1A 1XGYL 2XWJA 4PJXB 5FYJD 1ZV5A 1UJ3A 5IFAH 4D0CA 2WAHA 4NWTL 5DURD 4WEUD 4OCMC 2LAAA 1JYXA 5CCKL 3PWVA 3RGVB 2X4TA 2ED7A 4N8VG 4LOUD 4MNQB 5EFIA 1U95B 4ZTOH 1KN4L 2W0FA 1T3FB 4X6DB 4MXQC 4HJ0C 1T20A 1YMMA 4ODWA 1FSKC 2R9HC 5EA0H 1HINH 2JB5H 1B88A 4KUCD 3VD9A 1I7UB 3IETA 3E3QC 3T0EB 3LMJL 5HGHA 1J8HA 4NCDA 2IMMA 2JKXA 4WHDA 3RDTB 4H8WC 5IIEB 2F5BL 4D9QE 4HEME 2Q87A 4H0IA 3H3KA 4ODVL 5CHNA 2V5SA 3GUTB 4E41A 1UA6L 3SDCC 4TRPL 1V3LA 3HS0B 3UTZB 3MRFA 4ACPA 1NBZA 2BSED 4XCCL 3D0LA 3C6SB 2ARWA 1TNNA 4IDJL 4UI2A 2OJEB 1MJUH 3LN5B 3D5OF 3P4LA 2EXWC 4BK5A 3GMLA 4IRSA 2X89D 5DJAA 1UADC 1GOFA 3AS3A 1GZPA 4HDIA 1AGDA 4ORGA 2I27N 5DJDA 3KXFA 3R06B 5LCVL 2QV2A 1LO3L 4K71B 3BPCA 1S7XA 2XICA 4HC1L 5TF1H 1J1OH 1HHJB 1VKXB 4MVBD 1LEGB 4XBEH 3HB3D 2CRMA 4NZTL 2VR9A 4NM4L 2VXSH 4Y19A 3F12A 5T33L 2OX5A 1MFNA 2A0LC 2AJVH 4H25B 4RA3A 5IHZA 4F15B 3SDDB 5DWUH 1ORQB 5I16B 3RPIB 5I2IA 1D9KA 1LK3L 5L9DH 2B5IB 3GB7A 1P9MA 2AEQL 5EOCJ 5HHPA 1LQSR 1FPTL 1NGYA 1YEDA 4PJ9B 3WO3B 5C09B 2NXYD 5HGBA 4IM8A 1RZKC 5A40E 4R7NB 3AM8C 1BVKB 4JPWL 4OCYL 5T3XL 2AQ1A 1I7ZB 3BIBX 3VXMB 1ED3B 5AD0A 3VD3A 1OP3K 1FFPA 3K8KA 4WUKL 3SKOA 5F89B 5LG1A 4N90D 5CGYC 4LVEA 4ZTPH 3MMEB 4MQTB 3WJJC 5I66A 2XZCL 4HIIA 4LU5L 1I9RH 5I74C 4PJ8B 3QG7H 1ZOXA 3P4NA 4IJ3C 3D2UD 4HH9B 2R4SL 3QRFM 5A2FA 4BH7A 4K8RD 3MRGA 2CR6A 4JVUA 4Z7UE 1ORSB 3WFDL 1HZHH 4OLYH 4QGTA 4GT7A 4AENA 3UTPD 1FGVL 3GSVB 4Y2DB 3UTQA 1HH6B 2B0SH 3N9GH 3G5VB 1INEL 3FMGH 1UH4A 4LSUL 3IJHB 4WUUD 1XH3A 4OLXH 3CXHK 3A6BL 1T0NB 3U9PL 1UXSB 1Q8MA 4XP6L 2KZWA 4HUXA 3PWUB 5FYJU 2PW1B 1T7VA 4QT5B 3OF6D 4WDIA 3TF7C 2FEDD 1EHAA 3PDGA 3U4EA 3HE6D 3GMQA 3CMGA 3PV6A 4OF5A 5H37G 3U7YL 4HWZA 1XGUA 3K2UL 4U7KA 4G6KL 2AEWA 4XWGH 3ZTJH 2NPLX 4NDMA 4OD2B 5DZLA 2XTLA 2R8SH 5E6IA 1RZGA 3VXPA 3C6LB 1JPFA 4WIQA 5DJ6B 5BZWB 5HYSG 5JDJA 3MLZH 3OB0K 1JVKA 2J2ZA 1M71A 1RUMH 5C6TL 1RHHA 2P7TB 4PJIE 1A6ZB 5E24E 3TBWB 4DVBA 3MRMB 1R3LA 3BFOA 4YDJA 5GRJL 3L95B 1JJUA 1OM3H 3RP1A 4YHYB 2IPTL 2ZUSA 1L6ZA 1ZK9A 4L4VB 1I3RB 4Q0XH 5HDBF 2BVPA 3ZKNC 3EOTH 3D0VA 1T22B 2EXYC 5J3HC 4XNMB 5E2WH 4N1EA 3ARTA 5L6YH 1YY9D 2BX5A 4RDQF 2ZUQB 4L8SC 2ERJB 1OF2A 1AXIB 4YHLH 1EGJL 3PHQA 2VLJD 4XVSL 4LEXH 4JRYD 1AGCB 2R15A