3EAKA

Nbbcii10 humanized (fgla mutant)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'QVQLVESGGGLVQPGGSLRLSCAASGGSEYSYSTFSLGWFRQAPGQGLEAVAAIASMGGLTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAAVRGYFMRLPSSHNFRYWGQGTLVTVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NbBCII10-FGLA
publication title General strategy to humanize a camelid single-domain antibody and identification of a universal humanized nanobody scaffold.
pubmed doi rcsb
source organism Camelus dromedarius
molecule tags Immune system
total genus 28
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eakA00
4BFGA 1OAYL 3ARDA 3VXUD 2EEBA 4BH7B 5EU7C 4Z7VB 4U1KA 2BXZA 4XVUC 3MNZB 3DO7A 2AJYL 4PJIA 3B5TA 2UZXB 5LJYH 3I50L 1TNMA 2YA2A 3EDDA 5DMIL 1YN6A 4OZFB 3GB7A 1GHFH 3VFTB 1YY8B 4U1HA 3OPZH 3I6LE 1GGBH 32C2A 3LH2H 4XC3H 4XBPA 4S1RL 3DYPA 1AKJA 2BHUA 2V9QA 3FTGA 3VW3L 1A5FH 3GJFA 1F90H 3G08B 1T22A 2O61B 1S5HB 1SBSH 3Q2CA 4OGZA 3FQRA 3NCCB 1TJIH 2DQGH 3VXMD 3W0WE 4PTUA 3D2UD 2IADA 4XWGH 5I0ZA 1VA9A 5J13B 1AP2B 1RHHB 5F1KC 3T0XA 5B4MC 1EEYB 1FFQA 3HB3D 3HG1B 1HXMB 1TZHB 3JVGA 2AV1A 1VENA 4PRAA 1J8KA 3P9LB 2CGRL 2Q6WB 1U8IB 1C1EH 4KI5E 3QUMB 3VH8G 4G6JH 4C57C 1HHHB 2P8LA 1GGYA 4KHXL 4LCUB 4TTGA 5E6ID 4QT5A 3K3QA 5DJXA 4H25B 1I8KA 5KSBF 3MRLA 3KLHD 4OZIB 1TVBB 3OGOE 1AIFB 1AO7A 4OGAD 2DTML 1SYSA 3DRTA 3QUYA 2WLZA 4RZCB 3QIWD 4P2OB 3MODH 4GSDH 3AY4C 2QADB 1RUQH 5CEYB 3FQWB 2ICWA 1L7IL 2X41A 2QQLL 5ICYB 3QSKB 4JKPH 3HAEH 4WI9A 1UYWL 3L3OB 3LKOB 3QPXH 4FTVE 3W5NA 1RHFA 2BOCB 1YY9C 3TV3H 3RWGB 3W82A 2BFVH 5IFAL 3O4LD 5EZLB 3FB7B 1I8MA 4XCFL 2UWEF 2Q3ZA 2VXQL 1KEML 2MQ0A 5HGBB 1ZT7A 5KTEL 2VL5B 4PJ7F 4KUCF 2C3XA 4EIGB 4D3CH 3RIAK 1IAKA 3D0LB 4CMHB 2FJGB 3CFEA 2Y36H 1KXTB 5D1XD 4WENB 2ZCLL 3VG0L 2WMPA 2R0KL 2KPNA 3MUZ1 2C4XA 4P57B 4LASH 2GSIB 5DSCB 4NQCA 3VCLA 5FDWA 3P40A 3L6FA 4ZMAT 3VFSA 3LMJL 4IRJC 5TH2B 1HIML 2NX5A 5DDHA 1KC5L 2FB4L 1QFWL 2EDWA 2W92A 4OIIL 2HKFH 1NEUA 1YEJL 2V2WA 2BP3A 1G9NH 4MSWB 3TZVD 4PREA 1C5BH 2XN9E 4MJ5B 3S98A 5IHBA 3NGBB 5BQ7A 5DWUL 3MGTB 3TESA 1EJOH 1LEKB 2VXSL 4KROB 1FG9C 5CJOH 4NFDA 3EHBD 5SX5H 4K3HA 4ZXBD 3S34L 1FHGA 3LCYA 5AUMA 1XEDA 2AJSH 3QEGH 2GQHA 4YFLI 1TVHB 2XKNB 3LD8B 1AGBB 2BOBA 3BEVA 4GRLB 1ZHLB 4R9HA 3BEWB 3ZDYF 1KT2B 4XP9H 5E1AB 1KTLA 2CQVA 2VQUA 1QFHA 1GGUA 4WUUE 3VXRB 5FO8A 4OCYL 1KGCD 3HNVH 3BI9X 4NUJB 1ERNA 2UZIL 5HHOB 3QQNA 3BOVA 3IFNH 4GKSA 3W9EA 5EBLB 3NACH 3EDJA 3P4MB 4FQQB 3PGCA 5BZWB 3WXVL 1MNUL 1TQCB 1P7KB 1IM9D 1WCBA 3W5MA 2R15A 2CDFA 1C5DA 4Q9QH 5DD3H 2GT9B 4M61B 1U0QA 1VB9A 1W72L 1IGMH 2Z91B 5EU3A 4RWHA 1F2XK 4F58L 2PXYC 4CGTA 3CVHL 4K94C 2NW2B 3I6KA 3T0EE 2FWOB 3GSUB 4LBEB 1RU9H 5DHVA 2MQ3A 1Q0YH 4R97B 4OBSA 4YGVA 3IDJA 3QEQB 4NQXB 4Z95L 3W0WA 2XKUA 5HHVH 3FO9A 4X5WB 5I1AA 1BVKA 3RWFB 3B6SA 5ETUA 4HW6A 4HH9B 5MI0B 4S11A 1ACZA 1RUKH 3D39E 3V0AC 2CJUH 2YXFA 4YXLH 3BH8A 1BX2A 5ID1B 1BREA 1IAIH 2F5BL 2YC1A 3GHBH 4HS3A 3BWAB 5FCUL 5I9QB 1XIWB 1G9EA 1QBAA 3GNML 1K85A 2WK2A 4GMSL 4OAWA 1KG0B 4L29A 5EWIL 3ZE2F 3BP4A 4PRDB 1ONQB 2DQIL 1EFXD 3FZUC 5F7HA 3B9KB 3BISA 4LSVH 3JV5A 1IILE 2P5EE 1NDMB 4JO1H 4P46C 4K3EH 2GJ6E 2A77H 4P4KB 5T33L 3L7EB 3WUZA 1VCAA 1S3KH 2PW2B 4OT1H 3L3KB 4G6KL 5LGHH 3NIDF 3P9WB 4MCYA 5D1XA 5BVJA 4NO0B 1S7VA 2CPCA 5GS0H 2P48B 1AJ7H 5EO9B 1URLA 3A6CH 4H5SB 5K9KA 3DX9A 3QHTC 1OAQL 4PBXA 4C4KO 1GYAA 2HA1A 3O41B 1GOFA 5HHXL 3MOQA 2F54B 1A9BB 3S96A 1C5CL 4WW2A 4LDLB 4K9EC 4JRXE 2XZZA 4ODVL 2QSVA 5D72L 1DLHB 1XF2B 3LKRB 3SDCC 3KPSE 4XNYL 3BDYL 3TJHD 3AREA 4XMPL 3S37L 4DKDC 5E9DD 1GXEA 1XZ0A 1Q0XH 3KPSD 3RY6A 5D8JL 4PJ8C 2VR4A 1FGVL 1MWAH 1NMCC 1AY1H 4I0KA 4KRPC 4LCWE 3EUUA 4NPYB 1B0RB 2BSRB 2COQA 2FHCA 1RZJL 3WFCL 4L3ED 5IB4B 3LEYH 3DX8B 4QRRE 1JWUA 4U6TA 1OP5H 4JY6A 4ZXBA 1YN7A 2X7LB 5DVNA 4PRNA 3NABH 5GGUA 3QNYB 5IV2A 4Q2ZA 4ZPTB 4W81A 3MRNB 1YEDB 1W0WB 2NY4B 3DXAB 4YQXL 5JPNB 4K8RH 4Z7WA 4XH2A 2HRLA 2IAMB 4JFZL 5GISL 3VGHA 1Q72L 4JQIH 4L4VE 5JIIA 3QNXB 5IROC 2ATKA 3EIFA 2IANB 8FABB 2LTQB 4ZS7H 5JUEH 2WWKO 15C8H 3D0VB 1EIBA 3UBXI 3O8XB 1DQDH 3RX7A 3UTTB 2QQKH 4ODBD 3O45B 2X4NB 4FA8A 4IHOB 1IM9A 2WM0A 1UENA 4HEME 5DT1H 1CQYA 2VDPH 2GAZB 1Z5LA 1LGVA 3C5JA 2A6JB 4PJFA 2BY0A 1G7HB 4GBXD 2EDEA 4YHPA 1AR2A 1FPTL 1J86A 4LSSH 4WU5B 3ZHDA 2CD0A 3HE6D 1EXUA 3T0DA 3ARPA 3RDTC 5KVGH 1HQ4B 2VC2L 4D0BB 3OAUH 3U0TB 5C09E 3RAJH 2W0LA 2GSGA 5HHPB 3DIFA 5F1IB 4NN5B 3OGCA 2IQ9L 3TCLA 3EW3B 3L3IB 4K8RD 5T1KD 2JTDA 4G8FA 1DBBH 3QDMD 1DVFD 4KC3B 5GGTL 4JAMA 1I8LC 4HV8A 2IH1A 2DYPD 1Z9MA 5LKNA 1IC1A 2VLKE 1SVZA 3NA9L 4IBLT 3FT2A 3ZZ1A 4RNRB 3IB4A 1QLRA 2O93L 3VMPA 1BM3H 5C0EA 4M4PA 3SGKA 3WKMH 3NFPA 5EU6E 3CCHB 1R3KA 3HMWH 3DNKA 5IGXL 4NQVA 3LKPB 4XMKH 3SBWC 3MCKA 2JELH 2VITA 2VR5A 3OKNA 1EFXA 3QCUL 1S7SA 4PFEA 2BVOB 2YK1L 3VGAC 3IU4H 4X6CE 4OSUH 1F02I 43C9A 1CTNA 3CFJB 3CC5B 2IFFH 1YECH 1XR9B 4YZFF 1OAZH 2P5EA 5FHBH 5CCKL 3MNVA 2GJ6A 2O5XH 4KK6D 1K3IA 2YSSB 5IEHB 1I4FB 12E8H 2DQDL 1OM3L 3QUXB 4I2XE 3V6BR 3WEXB 2Z8RA 4JVUA 1Q9OB 5FO7A 4KTDL 2HTKC 1P2CB 3GSNB 5TE4L 2FR4A 3NA4A 1A1MA 3X13A 1BIIB 3BN3B 4G43A 3S8WA 1SY6L 2AAVA 4Y4KC 4F7CB 2ZUUA 5CILL 3RNKA 4Y2DB 1F90L 3QJHA 1T1WA 5FKAB 4OGYL 1M4KA 2KL6A 2BRQA 4CMMA 5HPMB 2W0FA 5IM7A 4N0YL 4XWGL 5IBUG 2ZZUT 3HC0B 4JRXA 4LKCB 3DX7B 5DURB 3IRZA 1SYVA 4P2RE 1QZ1A 1T7VA 4Z7OF 3KPSA 4ODUB 1MHHA 1BHGA 5FUCC 4UMGA 4JZOA 1R6VA 3F8UB 3ROOA 3BRFA 1UEYA 3Q1SL 3NPSC 4I0PA 3HRZB 4M02A 4YNYB 3LIZH 3QXAA 5DJZA 3OKKA 4XP4H 4MA7H 4H26B 4MXWH 4XNUH 3X3GH 4XCYB 5CSZA 1UJ3C 2ICWI 1LEGB 5IQ9B 5I73B 4GT7A 1M6OB 1PLGL 1RUQL 3KDMA 5GGVH 4R3SA 4KDTA 1D9KC 1U9KA 2EDYA 1LEIB 5IK3B 4M03A 1P9MA 3IJHB 3PIQB 4FS0A 2G5BB 4ZUSB 4KJWC 1AXIB 4PV8A 5IQ7L 2A0LC 1KN4H 1NUGA 1C7TA 3KS0J 4X7FC 1A6VH 4EI5A 2WIIB 2V9RA 4Y2OA 5C07D 4GBXA 4TSCH 2OK0H 1JFQL 5BVPL 5TQ2L 1MWAA 3PHQB 3QDGE 1LP9B 3HE6A 4UQ2A 3EOBA 4XTRD 2A6KA 1MH5B 2P8MA 2VLRB 4TULL 5T1DH 3MJ6A 3IAQA 4OCLC 4RMRA 3C5ZB 3RL1A 2XWBB 3NH7L 5I8OH 1P5UA 3V5KA 4OZHF 4LASL 3N9GL 3LKNA 1PJ9A 4EXKA 3L1OH 4WUKH 3IDMB 4O58H 1QHPA 4UINL 3BN9C 5T1KA 3WNMA 5KS9B 4XT1C 1DVFA 1U6AH 4JJ5A 2UUDK 2DYPA 4F7TA 2EC8A 4I3SL 5I1LA 1AGFB 2P8PA 4M7LH 1NCDH 5ESVB 2XNAB 3PNWB 1CFVL 3RZCD 1NCTA 4M6NH 2BVEA 1X6NA 4JPVH 2E5EA 2X6MA 1DBKH 5EOCJ 1C5BL 5I66A 5ICZB 3O3AB 5CINH 5MEQA 2B1HH 5EU6A 5DJ6B 2IMMA 4X5LA 4H88L 3RU8H 3FMGL 3ZDZF 2XV6B 1CDJA 4G80B 1EJOL 4LSRL 1YMMB 3VI3E 2JLLA 4AENA 2P7TA 3GKWH 1J11A 2DQFB 5C0IB 1JGEB 5D2LA 1FYTB 1LE9A 4HXAH 1YPZE 3S9DB 4PJ9D 1IKNC 3KJ4B 5CAYB 3QEGL 2C1OB 4Y4HB 4YDIH 1ADQH 4Z8FL 4MCZB 4NZJA 1KB9K 3C6LC 3DX6A 3RPKA 4OZGE 4KKAC 4WFGE 2BSSB 3GMPA 4APQC 2FEEI 4RGMC 4PGBB 4K71C 1KTDB 2XFXA 5EO0A 4IJ3B 3IDUA 1KN2H 1SBBA 3BPOB 2A83B 3EYOB 1I3GH 4JFPB 1E6OH 1ZANL 4MQ7A 5HGGS 4ELMA 4I2XA 2NNAA 3GMOB 4U6HA 1PG7L 1U8NA 2Y07H 3WFBL 4Q9QL 1IKFH 3EYQC 4TN9A 2Q1EA 4BFEA 4ZUVA 3CH1B 1W0VA 4RGND 1MY5A 1IGML 4JPKL 2Y4SA 3VWJB 4YHYC 2VLLA 1D7FA 4M62L 2YN3A 4CU6A 4HBCL 4POYA 3BKYH 4UAOC 4UBDC 5DMGC 4YAQA 1OWRM 3T77B 1Q0YL 4NP4H 4NGHH 1DN0B 1P4LA 4WWKC 3PDOB 4YFDB 4QHLB 4NWUH 2NXZD 5FV1L 5I16A 5DRWA 4XGZA 3QQ4A 4P2RA 2R8SL 3OZ9H 4FFVD 2V2XB 4FNLH 1F4YH 4N90D 5CJXC 3VXPA 2RQ8A 2OTWB 2R0WL 3WFEL 5KOMC 1RZ7H 2AJVL 1T2XA 1U2CA 1L7TL 1ZS8A 5ITFA 1T66C 2R0LH 2AP2A 4U05A 3U30B 1XGUB 3C87A 3CFCH 4PBVC 4J7RA 1F42A 4FFWD 4MNGB 1KB5B 4ZUTA 4Z5RB 5IR1A 3DSNA 4H1LB 4LRIC 3IAGC 2ZNXA 4X6BB 3SGEH 1XR8B 4P9HH 1U3HB 2DQHL 4OGXL 3G5XB 4ZFFA 1VDGA 1MAKA 5D2NB 4RBPK 4PP2A 2CR6A 5E94B 4X80L 4F8TA 2AJUH 2MTPA 2VWEC 3QYCA 4UQ3A 2BNRE 1JHKL 2A77L 5KSAB 2XZCL 2W9EL 3HS0A 2AK1H 4KGLA 4F3FA 3FOLB 4M8QB 4O4YL 5HBBA 1S3KL 3IDGA 5D1QB 1H3XA 1KCLA 4E41D 1VEPA 2C3WA 4Z9KB 1T4KB 3PL6B 4WEMB 2RFXB 4TOYL 1AGEA 1WZKA 3HI5H 3KPPB 3LRGA 3QDGA 5GS0L 4DN3L 4JM4H 3A6CL 5TFSH 1IGYA 5ANME 5FHAL 3R8BB 1H5BC 1WBYB 2IPKB 2WZPD 1QQDA 3ARBB 1NLBH 5IJKA 4RISH 4WTWA 2JCCA 3L5XL 4GS7C 1PZ5A 5F93C 4DKEL 2DBJA 3S36H 3MRIA 1CXIA 4JY4B 5IHUL 3M17A 1HILA 2GITB 2QQNH 4QRQB 1NBZB 1LE5A 5D9SB 5J3HC 3LVEA 3GSQA 4L8SC 1SEBB 5HYQB 2PCPA 4FMFA 3FQUB 3MLSH 5JR1L 4JKLA 1WAAF 4OZ4B 1MCLA 3K80A 1MWAL 2HYMA 4QOKB 1CYGA 3IGAB 3SO3B 1UB5B 1AD0B 2DICA 1F4AA 4KQ4H 3U6RA 4R7DA 1OSZA 1JNNH 4NKIH 1EMTL 3KXFE 2ADJA 1YPZA 4M48H 3VXTB 3BZ4A 2QKIA 1BZ9B 3WNOA 1OAUH 5AZ2H 2HJLB 1QLEH 3ZT7A 2D31B 3TO2A 4JQIL 4YHNB 1Q94A 3WUWB 4Z76A 1LNUA 1A7RH 1ES0A 1HSBA 1FGNL 4JHAL 4MA8H 4ZS7L 1S9WB 4U3CA 4OZGA 4KHTH 4TVPH 4BQBA 2QQKL 3RNQA 4ALAH 1EGJH 3P30H 2RGSA 3LKSA 4CJ1A 1KCSH 1D5BA 2VMFA 4FQHB 5C9KA 4MJIE 3HC3L 4S0TD 4R4FH 1U95B 3OKOA 1C12A 1QSVA 1QACA 4ZO8A 4LDEB 3VFOB 2KUTA 4LSSL 1XCTA 1NGZB 2P4AB 3CLEH 2VXUL 5F7WC 4HIHA 1P53A 1MCPH 5J57B 1QSFD 5JQ6H 1JI1A 4BH8A 5DJCB 4F7MB 3DMMB 4HC1H 4Q6IB 1JK8A 1HYSD 1MHEB 2VO5A 5MEOA 1UEMA 1ADQA 4HWZA 1DBBL 4QWWD 5I19H 4KKBC 2YA1A 4F7EB 5I1DB 4XX1E 1AR1D 2B20A 3L95B 3OBAA 1KJ2H 2FO4B 3VFGL 4TVPD 5MERB 5GSVA 5GRUH 2C7UA 3B8SA 3BD3A 2H8PA 4OCWL 3HMWL 3O9WA 5J1SC 1CU4H 3FHAA 1FAKT 1HH6A 1MF2L 3DROA 4OFVA 4XMKL 4ZFOB 1ZLSL 4ZOBA 3C60D 3GI8H 4HFUH 4KJQD 2D7MA 2JELL 4P23B 1DANU 4CU8A 4RRPG 3WIIL 2VLJE 5JPMA 4IDJH 5DEFB 4CMHC 2IPTH 4YHLL 2E9BA 3MBEB 4HKXA 1JUFA 2NXYB 2IJ0C 5IVXB 5FHBL 1RJZB 1LK3H 5F7MC 5HD8C 5ACLA 3THMH 3H3KA 1HHJB 4FFZH 3UBXB 5C0JB 4I3RH 1FZOA 4OB5L 1IAII 4R2GD 2EYRA 4IMLB 1K9TA 4U7MA 4FFYH 3WE6A 5H94B 4NRZA 1OGAB 4N1HB 3EYUL 2XQYG 4Y19B 3WJLC 4QYOB 3TH3T 3DLQR 4NT6B 4ORGA 5ANMA 3BKJH 5K9JL 1NFIB 2ED7A 4KI5C 1GOHA 1QOKA 4N8VA 5IMLA 5DMKB 2ADGA 4NZUH 3NGBC 5IIEB 4YBLB 4TSAL 3RUGE 5D7LB 1XGRB 3HI1A 2BDNH 2EZ0C 1OWWA 5IFHH 1YDPB 2OLDA 1RVFL 1JYVA 3DBXB 1DBML 2FSEA 4KROC 2FL5A 1F45A 4OF6A 4WI7A 3BP5B 4WV1C 2FIRT 3LKQB 1DQTA 3S37X 2DDQH 4XXDB 1YEFH 4WI3A 1MQKH 3QXTA 4OUOA 4GRLC 1DQQB 1NCWL 4UT6H 1WWWX 5FM4A 2NLJA 4KKNA 4JFDB 3EZ8A 1P4BL 1OTTD 1KLUB 4G7YL 3GJEA 3VRJA 4GRMA 2J12B 2VOTA 1N4XH 4PJDB 1KTKE 1FZJB 3F6IA 4LPTA 3ILQD 5JHDD 2V7NB 2YBRA 5E8EA 2D2OA 2ZOLA 1X7QA 3C09B 1EO8L 2ITDB 3ARDB 5TF1L 2E9WA 4LEOA 2MJWA 2EH7L 4DFIA 3K0WA 5B39A 4PJIB 3X14B 4M7JH 2QQQA 4JM2D 1G6RB 1YN6B 4U6VL 1U8OB 4L4JA 3GB7B 4R97C 2OK0L 4NWTL 3EKCA 3TBTA 1YEHH 4HLJA 1T80A 4U1HB 2DI9A 3GMRB 5JOPD 1MOEA 1FLRH 32C2B 3AMLA 4Z7UA 5T1DL 3ABZA 4XBPB 4D9LH 1AKJB 2J7LA 4HZLA 3FTGB 5F44A 2FGWH 5HI5D 3GJFB 4QXGH 1JF6A 5MI0C 1KCRL 4BZ2L 1OAKL 1SJXA 5LBSH 5C08E 4K07A 2VNCA 4GH7B 2DQJL 1T22B 1RJCA 3FQRB 3QEUA 3QNZA 4O58L 3PXHA 4GRWB 1U8MB 2ZUYA 1OB1A 1T7WA 5I8CA 4I13B 5GGQL 1XIWC 4JQXC 3P9MB 3K1DA 3Q6FA 4EVNA 3U7YH 4PJCE 5ACZA 1WISA 1EGJA 2XQBL 3D6GA 3O2VL 3VWKC 3WMSA 3TBWA 1UACH 4Y16D 3RU8L 4QT5B 5SV3A 3WD5H 5DJXB 5DHYA 3IDIA 3TBYA 1I8KB 3C60A 4QCIA 4R7NA 4U4BA 5IMMA 1RZFL 5DRXB 3U1SH 5SWQB 3OAZK 1SYSB 3DRTB 4HUWB 5C0ND 3QUYB 4FQXD 5TGBB 2HP4A 3G5VA 5EUOE 4HXAL 4N0FB 5C0BE 5C7XH 3EJZD 2ICWB 4KI5F 3RVWD 3RVUD 4YDIL 4HC1A 1ADQL 2OM5A 1TJGH 1KF9B 5ADOL 5DJYA 4CVXA 1J0HA 2F74B 2NPLX 4HIXH 4P49A 1GZPA 2AEWA 5JOFA 1I8MB 4MAUH 1B6DA 3EDEA 3BPNB 3O3EA 5ELIA 1ZT7B 1KN2L 1KBGH 1NSNH 1BFOB 3K4DA 4I9WE 1RJLA 3H2WA 1IAKB 1KJ2A 3C2AL 3CFEB 4OLXH 4MVBC 3GIZH 2H1PL 1JHTA 3I9GH 5CEZE 3MOBH 3L5IA 1LO3L 2PETA 3WIHL 4NQCB 5FDWB 4PJHE 1HYRC 4QTHB 1FCGA 3VCLB 3MLZL 1T20A 5FYLE 3MRDB 4JRYB 5DS8A 3L6FB 2DB8A 1DFBL 3VFSB 1T5WA 5E8PA 4FP8L 4I4WA 3RUGA 4OLVH 4NP4L 4NGHL 4P0DA 3QP3A 1MCNA 2B7DT 5MEPA 2NX5B 5DDHB 4ZSOA 4KZDH 4NWUL 1QRNE 1YNTA 1JZ4A 3QFDA 4UV4H 2V2WB 1KFAH 1EO5A 1F4YL 2PYEE 1HXYA 1QVOA 4PREB 1MRCH 1A14H 2LFGA 3I75A 5BQ7B 2X5PA 4YBQC 3QRGL 5EOCH 5EORL 3DETD 3BUYA 1Y18A 3HA0A 2RR3A 5JHDA 5F89A 4J3XA 2D3VA 4HUVA 1BD2B 5E8DH 3VXUB 2WV3A 3DGCR 1DQML 4NQSA 2BOBB 4X9HA 1XT5A 4XNMA 3UPRA 5ITBL 1KTLB 2AJUL 1SMOA 5F7DA 1WWCA 5FO8B 1U91A 3QO0A 4JM2A 2N7AA 1I1AC 2AK1L 4RQQA 1M7DA 2BCKA 4GKSB 4DJMA 2JIXD 5C2BH 1INEH 4UOW1 3TT1H 3PGCB 5JW5A 3VH8A 5HYEA 3MJ9L 4YIQA 2CDFB 4G7VH 3UDWC 1RZKL 1X5LA 2GUOA 1FE8H 4JM4L 1GCFA 3CZJA 4YPGA 3OQ3B 4N0RA 5DGRA 5EU3B 3Q3GB 2DQTL 4FQJH 4LLQA 4PGJA 5A2FA 5BV7B 3I6KB 3ES6A 4PJBE 4PLJC 1ZTXH 5DHVB 4ZAKC 3D2UB 5HYSA 2QSTA 4L8BA 1GVIA 5JOEA 2G9HA 5F9AC 2ADFH 3W0WB 3OKDB 3MRBA 4ZYKA 3FO9B 3FN0H 2ZSWA 4NM8L 4KK9C 4JDTH 3SDAD 3VFWA 4YXHL 4QHNA 1BVKB 2G75A 4PYHA 4BUGA 5ETUB 5D70H 4PJCA 1NAMH 2KQNA 4U0QB 1AGDA 4D9RD 4NNYB 4Q0XL 3TVMA 3ISWA 3BH8B 1BX2B 2AGJH 1F5WA 3F58H 1MRDH 4ZO6A 4ODHH 5BOPA 2YC1B 1IGIL 1XGQA 4HS3B 4KQ4L 1CQKA 3QIWB 4LMQE 4QGTA 1OGTA 5FDYA 4LPYA 4TSBH 5JA8B 4OFDA 5EUOA 4L29B 3MLRH 3BDBA 2WBJD 3BP4B 5FUOL 2VLME 3A6BH 1XGYL 3OKEA 4CN4A 1A0QH 2DS4A 5FO9A 1WK0A 3AC0A 1WT5A 4M9PA 5F96L 5IB1A 1S7TA 4KHTL 4Y2DC 4ALAL 2B2XL 4AIZA 2PKDA 5D7SH 2V9TA 3H3PL 1JNLL 1KCSL 5DUPH 5TDNA 3ZTJG 4MCYB 1U3ZA 5D1XB 4R4FL 5BVJB 5DQJA 1S7VB 4HDIA 1PG7X 1RJYA 1CFSA 2YUVA 1QR4A 3GSRA 5K9KB 5DJ0A 4DKFL 2MOVA 4XHJC 5HGHA 4P5TD 4PY8J 5IB5A 5JQ6L 1QYGL 1R0AH 4XVTH 2Y72A 1Q9KB 1NDGB 5JXED 4HUMB 1HNFA 5KVDL 4KKCD 4J12A 3S96B 4WW2B 2CMRL 35C8H 3EO9H 3QIBD 2X05A 4MD4A 3R1GL 5J6HA 4LSQL 1QRNA 1I7TA 5I73C 1EERB 3U46A 3QWOB 3AREB 3TZVB 4GW4A 2VDRH 1D6EA 5I76A 2R2HA 5F8RC 1KJ2L 4MQXD 1KELH 1OLZA 1IEHA 5HI4D 5IBLD 5GRUL 1E6JL 2OYPA 1WBZA 2EH8L 1ORSA 1P6AB 4JY6B 4ZXBB 1YN7B 2DIAA 1FH5H 5DHXB 1YEEL 3SDDA 1T03L 4PRNB 1OP3H 1U93B 2F8OA 4NZTH 5GGUB 1T21A 3K81A 3GI8L 4HUKB 5IV2B 4Q2ZB 1P4IH 3O2WL 1CLZH 1JPST 4Z7WB 4XH2B 3UEZA 1K3ZA 4L9DA 3L7FA 3IKCA 4Z0BH 2ATKB 2I26N 4PJXB 1D5IH 3C5ZC 1QFWM 1CGSL 2JIXA 4GAFB 5C6PB 1T6VN 3V0WH 2ZCKH 3RWJA 1F3DJ 4KK5C 3RTQC 5KVEL 1IM9B 4HWBL 2VKXA 3JTSB 5A16A 4I3RL 2GTWA 1Z5LB 3C5JB 4PJFB 1NUDA 3WS6C 3TBSA 5JHLL 4YHPB 4FFYL 4XRCA 3HR6A 2NY5H 1B0GA 4LCCC 1XH3A 1FDLL 3SGEI 1EXUB 3UC0L 3BKJL 4U1IA 2X4PA 4CKVX 4PJBA 2EO1A 2YPVL 4O51A 1X5XA 1RUAH 1IBGL 1PDKA 2GSGB 3DIFB 2BDNL 1FNEA 3OGCB 5GHWL 3TCLB 4P2QD 1NFDF 3EFDL 4HQQL 2X4SB 4G8FB 4PLKD 4XCEA 4HV8B 1H9VA 3HUJA 3FT2B 3QAZB 1QLRB 3KJ4C 2DDQL 3ESVF 4X99A 1YEFL 5C0EB 4P5KA 3ARSA 4RAUA 4Y4HC 3EOAA 1IEAB 1R3KB 4U7SA 2R1WA 3EZJB 4X4MA 2HKHH 3VFPA 4NQVB 1JF1A 5ADPH 3QISA 1Z0MA 3MCKB 1F4WH 1XF4A 2H2SD 5CSGA 2VITB 3IDNA 4IJ3C 3BPOC 1N4XL 1EFXB 3OKNB 4R8WH 1S7SB 1X4YA 1WQVT 4TQEL 2MPAL 4M3KB 5KSUA 4FXKA 1WIOA 5CBAA 5D71H 1CL7H 5DFWH 3ULVC 5HGDB 43C9B 5T1LD 3BFOA 4DK6A 2FYYB 2XZAL 4K23H 5T3XE 1AXTH 3TIDB 4GAGH 2GJ6B 2P44B 1YQVH 3WN5A 4M6OH 5L8KB 2W1NA 2FBJH 2V2TA 5AYUL 5H37G 4U1LA 2YKLH 1YEIH 5DRZB 5I1EH 1NAMA 3N85H 3BZDA 4S2SB 2EDFA 1MY7A 4P4RA 1I85A 1IGCL 4X6CF 4UIMA 2FR4B 1A1MB 1B4JL 4ETQB 3RGVD 3X13B 4LAQL 5FV2A 4D9LL 4P5TA 4G43B 2HJKA 3FO2B 3KPNA 3RNKB 3CD4A 3QJHB 2IBGA 1T1WB 5JXEA 1EHNA 1G1CA 3RWCA 1HINH 2W0FB 3QIBA 4X8JA 3ZKMD 5E5UB 1ND0B 1BFVL 2R69H 1FO0L 3BSZH 4J8RA 3MLUH 1G84A 3D3VD 4DW2H 1SYVB 2VSCA 4RDQF 1L0YA 3KPSB 1MHHB 2GW5A 5EOQH 4LHJB 3T3ME 5JNYA 2YUZA 4NQDE 2BX5A 4JZOB 5D2NC 1FVEB 4L3EB 2EXYC 3DV6A 1VESA 1AI1H 1UACL 3PQYD 4MAYD 5M95B 2C3GA 3QXAB 5CEZL 5DJZB 3OKKB 4O2FB 2X89A 5L8LB 2E8ZA 3O6FD 5CSZB 5JMOC 5FYLL 1K6QL 2Z0BA 5TQ0H 1ZLWH 3KDMB 2X1QA 5C7XL 4JFED 4R3SB 2VDNH 4ONFH 1P7QA 3Q6GH 5FCSH 1BLNA 4DKAA 4DWHA 4JDVA 4KH2A 3SJVE 3LV3A 3GK8H 3RQ3A 1BQLH 1NUFA 5EPMA 3IU3A 4PV8B 3MRKA 4HMDA 1X44A 1INDL 3LB6D 4QRTA 1A2YB 1BBDL 3VFRA 2SEBB 2I5YH 2V17H 3EJYC 3V7AE 5FA4A 4GBXB 4JQVA 1AQKH 2IF7A 3MUHL 2XYCA 2EDQA 4OLXL 3F7PC 2OJZH 3HE6B 4UQ2B 2A6KB 1FG2A 4LLMA 1ZVSA 3RL1B 3MOBL 4FABH 5H2BA 3V5KB 1J1OL 2E27H 4MJ6A 3V4UH 3V8CA 3LKNB 4BSJA 3MRHA 4NFBA 1ULVA 3ME0A 4OD2B 4MLIA 2HRPL 4H0GA 1HE7A 3SO3C 5T1KB 3WJJA 3TO4D 3QDMB 1DVFB 5LCVH 4JJ5B 5CIPB 4LGSB 2XZQH 2DYPB 4F7TB 5B8CA 5I1LB 4YO0A 5AD0B 2P8PB 1G0XA 3MRMB 3OJMB 1MJJA 3VGFA 3FQXA 1N5AB 1OTSC 5KJRH 4R26H 1MRCL 5I66B 1A14L 1GGIH 5MEQB 4LARL 5EFIA 1NCAL 3CUPA 5IW3A 4PPTA 1JGVL 1G7PA 1LO5B 2K1MA 1NANH 2H6PA 2DJ4A 3MA9L 2P7TB 4J23A 4AENB 2EDLA 5IG7A 5D2LB 2WP3O 3V52L 1LE9B 3DTXA 3H9ZA 2BNQE 4EN3C 1MFCH 4IM8A 2YUWA 2L0DA 4X7DC 2R4SL 5IJVB 2R29L 4OLYL 5D7JD 2FX9H 3VI3F 3G9VA 4XPTL 3N1MC 3GMPB 3U4AA 5TDPA 3TYFA 5AWNL 4PGDB 3V6OA 5EO0B 1DBAH 3PWPE 1YPZF 1II4E 1YNLL 1IEBA 1JMXA 4MQ7B 3UJJH 5LGKA 4ELMB 4U6HB 2C3VA 4KWUA 3RGVA 5D93B 1U8NB 4ZUVB 4G9FE 3HE7D 2EIEA 3UJIL 1KCUH 1SMAA 1A21A 3UZQA 5TDOA 1S7XA 2OTUA 2VLLB 5C0DB 3Q0HA 4WNQA 4IIQA 2N4IA 1R3IH 5I74B 4D0CA 1GC1C 1JV5B 5F9JB 4HT1H 2GTZA 3FN0L 5I16B 5DRWB 3BIKA 4F9LA 3QQ4B 2N56A 4XPGL 3JWDH 5EULV 4P23C 2FIKA 1GGCH 3LQAL 5CD5D 1JZ8A 2PO6D 1NAML 4JJHA 4NQDA 4S1DC 3P0YH 3PQYA 1A6TA 4MAYA 2AKRA 3HN3A 3MBEC 3T2PA 2NXYC 3O6FA 3F58L 5ITFB 5DUMH 5E2VH 5IR1B 4ZUTB 1GPOL 2AW2A 4C56E 3LDBC 4GKOA 4R0LB 2B5IC 4ZFFB 4OFIA 4JO3H 4XNQB 4PP2B 4QGYA 3SDXE 3MRFA 2CIIB 3I85A 4JGJA 3RWEB 1UWXK 3I84A 1DE4A 1YJDL 2ZWLT 2GYSA 1GZQB 3HS0B 5HVHC 4F3FB 4LVOB 1T0PB 4R4BA 3IDGB 5D7SL 3DUHA 1VKXA 4PB9H 3VD7A 4WTZG 5DXWA 1AGEB 3OX8A 5I6XB 5CP3H 4UTBH 2Q3AA 3V4VH 4LLVA 4OTXL 1WZ1H 4JPWH 3AGVA 4QXWA 1N0LA 2RHEA 2JB5L 1IGYB 4B5EA 3VXNA 4PYGA 4UB0L 5I18L 1ZHKA 2IG2L 2J88H 3QG6A 1QQDB 2QJDA 4XMLL 2JCCB 5JDSA 1JI2A 3TO4A 1PZ5B 4XVTL 1B90A 4I5BB 3MRIB 3VD3A 4YX2H 5I1JL 5INCB 1JMZA 3O3DA 3M17B 1N0XH 1HILB 3WFDH 2I07A 2NYYD 3RZCB 1LE5B 5IF0B 2AERT 3GSQB 1NLDL 5I1GL 2PCPB 1JF5A 2HMIC 1NC2D 2UY6A 5HHOD 2CLRA 2X09A 3ARDC 3HMXH 4E9LA 1RK1A 4OCMC 4XZUA 3CDFA 2P5WE 5KW9H 1IVLA 2EE2A 4J4PC 4R7DB 5JW4Q 1OSZB 2ADJB 1KXVC 3BZ4B 2VDKH 2O26U 1G7MB 5GRWA 3TO2B 1Q94B 2DM2A 5D7JA 4Z76B 1LNUB 4X4YA 1ES0B 1HSBB 3QHFH 2FH8A 4HJGA 4LEXL 1QTYT 5KSBE 3BZFA 4MYWB 4OZGB 1QEWA 4BA8A 3RNQB 3V0WL 1OAXH 4J6RL 4QEGA 3MGAA 1D5BB 2G2RA 4WEUD 3S5LG 2DM4A 1IT9L 1U58A 4RGNB 1C12B 3QI9A 2NY5L 2AK4E 4TRPL 2DQUL 5CZKA 1XCTB 1VPOH 3MREB 4HIHB 3IETB 3JVGC 4LFHG 2V5MA 5DGQA 3ARYA 3OHXA 5EB9A 1MAJA 4A6YH 1V7ML 3LZFH 1RY7B 4MX7A 4XNXH 5GSRB 1A22B 3W39B 1AGCA 4XVJL 5T3XL 5D5MB 3ZTNL 4KUZH 5MEOB 5GRVL 1OTUC 1UC6A 1QSZA 4AMKL 4HWZB 3C08H 2PO6A 1VERA 5KAQF 4XAWH 2RAMA 3EOTH 3HHRB 1LO0L 5GSVB 2C7UB 1HKFA 4ZO7A 5HDBE 1N8ZA 2H8PB 3GJFK 4NBYB 4U0RC 2H2PD 3CJJA 2HKHL 3DROB 3FB6A 4Z7QE 4URTB 1UWGL 3PWNA 5HDLA 3TN0D 5BJTA 3WO4B 1F4WL 3BPNC 2B1AH 3B3IA 1ZLUK 3RKDD 4CDGC 2C4FT 3FFDB 4R8WL 5JPMB 3ZKQD 1ZV5A 5D71L 3S4SB 2AABL 4Q9RL 4HKXB 1JUFB 4EOWL 1BQUA 1JE6A 4K23L 2HN7B 4DEPB 2YMXH 2F54D 4MA3B 4I18A 4NNPH 1NCBL 4G5ZH 1HCVA 1A9EB 4E41B 5DQDH 5HYJD 5DTFA 2B4CL 3MBXH 3WSQH 3QH3A 3SCMD 2YKLL 3GKZA 3VFNA 1YEIL 2GIYA 5HI3C 2XWTA 5I1EL 1KPVB 3FRUA 2EYRB 2FNBA 3H0TA 2YUXA 1IAMA 4I3GA 3MYJA 5J11B 2X42A 3WE6B 3QXUA 3CDCA 4DGIH 2W0KA 3MNWA 3MRRA 4HG4K 2X70A 4WI5A 5ANMB 4JG1H 4FQ2H 4WTXA 1BVZA 1RIVH 2X10A 5IMLB 2ADGB 5HVWA 5B4MD 1T83C 4MHHG 4RFNB 1H8NA 2FEDC 3DXAD 3HI1B 3KPRD 1CGXA 4OM0H 2NW3A 1KYOK 1FVCA 4S0SD 4N9GB 4NRYA 3HAEG 2FSEB 2IBBA 3AAZA 2G60L 3NIFE 4DQOH 1PBYA 4UTAH 4ZUWB 1CN4A 4LNRA 3BT2L 2Y23A 1XF1A 1T0MA 1A7NH 1RMFL 2P5WA 3E8UH 3MSPA 5CP3A 2NLJB 2H32H 2E7CA 4L3CA 4P9ML 3GJEB 3VRJB 1J1PH 2I9LA 4GRMB 4OM1L 5E8OA 1KCVL 3MA7A 5E08H 2YBRB 5E8EB 2ZOLB 2OL3B 3LEXA 1A6WH 4POZD 1LDPL 2J1KA 1QO3A 3OXSA 1VFAA 4JN1L 1KACB 1R5IA 4PJAB 3HCVA 3GK8L 2OMNA 4LEOB 5KSBA 1T2QL 3CFDA 5BV7C 3GO1H 1BIHA 5B39B 2QHRL 4L4TE 3T65B 1ZK9A 2Z92B 3HB3C 4UU9A 4Z7UB 5EBMA 3HMXA 2AK4A 4NYLA 2R0ZL 4HZLB 4JVPA 1TZGH 4IRJD 5FGBA 4FABL 1T89A 1PAMA 3V4UL 1IC5L 4G42A 2H45A 4AEHH 4M1DL 5E6IC 4GMTL 4UDTA 1CFQB 4I77H 2LQRA 4OGAC 1OB1B 5I8CB 4YHIB 1TITA 2QTEA 3QIWC 1WFTA 4NO5A 4HKJA 5KN5B 3MGOA 4DAGL 3H9SD 3V5HA 3Q6FB 5KZCD 4O2EA 5ACZB 3S88L 2D7TH 4K94H 1CK0L 3ZT6A 1RZGA 5E7FA 3SE8L 3IDIB 3QFJD 3TN0A 3C60B 4R7NB 4QCIB 3VA2C 5IMMB 3ARFD 2ICWJ 3MZGB 1BD2D 5CJ8A 5HY9A 1DUYB 4AT6B 3CFKA 1TFHA 3G5VB 1IGTA 2DQEH 1FNHA 5DZOA 4PJCF 4L8CB 4JANA 2NTFA 1A6UH 1MFCL 1CXFA 4A6YA 1OSPL 4XPAH 3QJFA 2QBWA 5F7UA 3QCVL 1RPQA 5DJYB 4CVXB 5IB2B 2FX9L 3SCMA 3S7GA 1GZPB 5JOFB 1U8QA 1R3LA 5EIVA 3UXFA 4XPHH 3W9DA 5I1KH 3OMZA 3SE3C 1FSKC 3O3EB 4R2GB 5SWZD 3RVXD 2YPKA 3NCJL 1DBAL 3CFBA 4JG0H 2P42B 3MV7E 1RJLB 3UJJL 4WDIA 4WW2C 1U2HA 2HFGL 2X9YA 4Y4FD 4N68A 3T4AA 4LHQB 1LD9B 1E4XH 1PX3A 4HJJL 4DUXA 1QSED 1EUUA 4OD3H 4NCDA 3ZHKA 3TZVC 4K2UL 1ZEAH 1WV7T 4WY7H 1CL7I 1JPTL 3RY6C 2PNDA 1I3RA 2ESVE 4WFHE 5DS8B 3AU1A 2AEPH 3KPRA 5DVOA 1T5WB 5E8PB 1R3IL 4I4WB 3RUGB 3B9DA 4Y5VC 3C2SA 3MPCA 2M26A 3C5SB 3L3HA 9CGTA 1MI5E 4ZSOB 1PKQE 4G3YH 1YNTB 1I3UA 2PUQT 3NFNA 4C83B 4PJHF 1HXYB 1QVOB 5EZIL 2X4UA 2J5LB 3AY4A 5JLZA 2XA3A 3I75B 5KOVC 5FXCH 3GBML 4XC1L 2FCBA 1P84J 2YD4A 4K9EH 3TPKA 5CJBA 3W11D 4PRID 3BUYB 1CGUA 2CKBL 4LDOB 5I17A 1Y18B 3WLBB 1OF2A 5JHDB 5F89B 5C0AE 4HMEA 4HUVB 1U92A 1WICA 2YD9A 4XNMB 3UPRB 4HUXA 1FORH 1FVDB 4HXBH 3BQUD 5F7DB 1U91B 4LLYA 3QO0B 1MCIA 1U8PB 1OOAA 4JM2B 2Q87A 4AG4H 4RQQB 1M7DB 2F53E 5FA3A 5JW5B 1NQBA 3VH8B 1J12A 3B2VL 1IM3B 4BELD 4YIQB 4D9QE 3QWRD 3SE9H 2F8XC 3NFSH 1QNZH 2D0FA 4IRJA 4MZ3A 2GUOB 5IB3A 1YJDC 3V4VL 1F4XH 3IFLH 3O0RL 1MCKA 3SOBH 4LLQB 2X1PA 2H32A 4DTGL 4KTEH 4OF8A 2BVQA 3ES6B 4HF5L 2DD8L 4M1GH 1ZSDA 4HCRL 5MEND 3IDYB 3SGKC 3BD4A 1CIUA 4L8BB 3SDCD 3RFZC 2ZCHL 4ZYKB 3MRBB 2CR3A 1G9ML 4LVEA 2ZSWB 2F19H 4OF7A 1EH9A 1N0XL 5GXBB 3VFWB 5SWSE 4HUNB 4KK8D 4QHNB 1R3JA 2G75B 5J8OA 3PGDA 2HJFA 3DVGA 2XTJD 1JHLL 4NKDA 1AGDB 3P0VL 4Y16B 4PJBF 1UKQA 2EC9T 4G6AD 3KHQA 3QFJA 1UCTA 4Y5YB 2Q86A 3HMXL 4ZDHA 5FAAA 3T4YB 1XGQB 5DUBA 4ISVB 2APFA 5SX5K 3SE4C 4F15B 5BZDA 4FQXB 2FHFA 1OGTB 3EYVA 5DD6A 4EJ1C 4LF3A 5EUOB 4U3XA 1XCQA 4N8PA 3LSOA 2VRAA 3G6AA 2ZKHH 4JHZA 1JYWA 4NUGH 4QTIL 5L88H 2E8YA 4Y5XB 3FO0L 3RBGA 1P1ZA 1S7TB 4OLUL 1GIGH 5SWZA 5D7IB 4YFEA 5EIIA 5ISZE 4GW1B 1MPAH 5F7EH 1BBJA 1D6VL 2PXYA 1CGVA 5TDNB 5F72S 3ILPA 1NANI 1QSEA 3K4ZA 2A1WH 1QFUL 5L2KD 4N9OB 3TJHC 4HDIB 1UVQB 5GRYA 1RJYB 4YHOH 1FAIL 4RDQG 2YEZA 1WZMA 1J0KA 3GSRB 2PTTA 2DI8A 5HGHB 5IB5B 1EO7A 5DZNA 4POUB 2FJFA 4A6YL 4G8IA 3LZFL 1MAMH 4C58B 4XNXL 1BQSA 4GAJH 3REVA 1U3HD 1SJEA 3MV8D 4ZO9A 4GAYA 4MD4B 4OQTH 4M8VA 1OAYH 1H15A 1MI5A 5J6HB 1PKQA 3LN4A 1QRNB 1FFPA 1I7TB 3H9HA 3U46B 2ZUXA 5DVMA 2BNUA 2EE3A 1KPUA 4GW4B 1D6EB 5I76B 2R2HB 4KDTC 3EOTL 5ESQA 3I50H 3M8OL 4K3JL 1P9MC 2W65A 4QRUB 1FJ1A 2LU3A 1WBZB 5D1QD 3STLA 1ITCA 1ORSB 4AH2A 1MCRA 3FFCE 3R06A 4S1RH 1T21B 3FFCD 3VW3H 2B1AL 1WFOA 2HFEA 2NZ9D 1S9VA 1TTGA 3L7FB 3PGFL 5J1AA 3IKCB 5E1HB 3HE6C 4GXVH 3QUZD 1OVZA 1WLHA 4H20L 2YMXL 2IBZY 2J6EH 4NNPL 2JIXB 4OFYD 5H37H 2Q8AL 1PW3A 3RWJB 2P24A 3WSQL 1X5ZA 4ZD3H 5F9DC 1E4KA 3S3PA 5A16B 1S9KC 3UTPE 3QWRA 4ODWA 2EYTA 3L9RA 4KHXH 3TBSB 5CHNB 4M93B 4XRCB 1LK2B 1A3RL 3AB0B 1B0GB 1L4IA 1BF2A 3VXSE 3FCTA 2DTMH 2FBOJ 4FQ2L 2B4CC 5T1MA 4PJBB 2DLFL 4O51B 5LVEA 3SDCA 1RV6X 2IBZX 1L7IH 3PP4L 1CWVA 5FUCE 2QQLH 3SDAB 1FNEB 4PJ8A 3SPVA 4OM0L 3VMOA 5CZXD 1ZE3C 2CXGA 1FRGL 3AS3A 4XCEB 5FYJH 4LL9A 5IFAH 3FN9A 1NBYB 3HUJB 1MFNA 4XCFH 5JA9A 2MCPL 2CRIA 2VXQH 1LWRA 5HJ3A 5KTEH 4X99B 1NGPL 3GSOA 1BAFL 4RAUB 3QIUD 5EC2A 3MC0A 1B4RA 3EOAB 3BX7C 4KK6C 2R1WB 2ZUQC 5FYJU 5EC1A 5E5RB 3UTSE 4JDZA 3VFPB 1JF1B 3G6JE 2ZCLH 3R4DA 3VG0H 4NJAL 4NHCL 1XF4B 2R0KH 2WBJB 3IDNB 1YYML 3O6KL 2EYSA 1ZXQA 4JZJC 3PWJA 4FXKB 4CBPA 3VI4E 5CBAB 5D96B 5E08L 1RK0A 2A0LD 3LMJH 5D7KD 1DBJL 3DMMD 1HIMH 1UXSB 2WNGA 4NNXA 2EDOA 2YD5A 1KC5H 3SGDH 3WN5B 1J8HE 4GXUN 1CG9A 1DQLL 2FB4H 1DL7L 1QFWH 3HPJA 2V2TB 1AHWC 3NBNA 4FG6D 5ISZA 1YEJH 4I8DA 5FYJE 4L9LB 1NKOA 4M4RA 2WUBL 1KJMA 5DK2A 5L2KA 1H3WM 2VISB 3ECBB 4P4RB 1I8IA 5DWUH 1CZ8L 4QY8B 2N7BA 5J6GA 3CDGA 2VXSH 2H9GA 4KTYA 1WITA 4P5TB 2HJKB 3TYGL 3HTLX 3KPNB 4U33A 2C1PA 3MR9A 2BVPA 3BN9D 1MVFA 4GG6E 2UZYB 3S34H 2CRMA 1V3LA 1I8LA 3LN9A 3V5DA 1IJ9A 5FM5O 3M07A 3TWCL 3RWCB 3QIBB 3MV8A 2HTLC 1KUMA 1I7UA 3TNNB 4ZFZA 4WIQA 4J8RB 4X6DB 1NBVH 4OCYH 4MNQD 2GJZA 5FECB 1DN2A 4OZHA 1RUPL 4GG8A 2UZIH 1H0DA 5EO1A 2HLAA 5IFJB 1DSFL 1JZ6A 3SBWA 5JNYB 4R0LC 3WXVH 1MNUH 4LK4A 5E0QA 1ZA3A 4ONGL 3DV6B 4XP5H 1Z6JT 4LPXA 3KGRA 1VEMA 3FFCA 3KYMA 2I9TA 1WVZA 5DRNA 3F7YA 1N6VA 4LVOC 2ZOKB 4Y1AE 4F58H 4Y19D 3CVHH 4LIQE 3VRIA 2DQEL 2DKUA 1A47A 4PY8I 3T3MF 1I7ZB 4N0UB 4Y8DC 1A6UL 1BLNB 4MB4A 3RVTC 4JDVB 3LV3B 4KDVA 5CLWA 1PYWA 3TT3L 4OIAA 5EPMB 4OQTA 3IU3B 3MRKB 2O5YL 1QRKA 2MSPA 3KR3L 4QRTB 4XPHL 4G9DB 3KYNB 1NC4D 2X1WL 3QWQB 2AJ3B 5FA4B 3E3QC 4AL8L 4C4KT 5C3TA 3RZCC 2F5BH 5IHLB 1E4XL 4LLMB 5BRZD 1ZVSB 5FCUH 1AQDA 4MJ6B 1P69B 4YDKH 4GMSH 4N8VG 43CAA 3KHOA 5EWIH 3WIFB 4ZTOH 2AEPL 5A1AA 3GMMB 4J2XA 2DQIH 5DQ9A 4K55A 5CBEB 2IWGA 3WNNA 2R9HD 3QQ9D 4E5XA 3H42L 4MB3A 2XG4A 2H41A 4JGMA 5CGTA 5B8CB 4PJ9C 3CSPA 2XIDA 4DGYL 1MJJB 5T33H 2J6EA 3G04A 1UJ3A 3QIUA 3RIFK 2VQTA 1NPUA 1DJSA 2UVFA 1CE1L 5HHMD 2BVTA 5EFIB 1A3LL 3CUPB 3GFUA 1G7PB 1H3UA 1KLFA 1D9KA 3G6DL 4NCC1 3WDHA 3QDJE 3C8HA 1ZOXA 4LPVA 1ZGLM 3DRQA 1UB6A 4K9EL 3UTZA 3O3BA 5IG7B 1ETZA 1NGWA 2NY3C 4AEIH 3E2HC 3MXWL 2VWEE 3UYRL 1CDUA 1OAQH 2WWKT 4QHKJ 1B0WA 2YR3A 3OWEA 2GY7B 5HHXH 4KRNA 3TA3D 2EIDA 4G6FD 5E24E 1C5CH 5GGSY 1WGOA 4WHTA 7CGTA 1FORL 2OZ4L 5BCAA 3EFFA 5IBUB 3CLFL 3L5HA 4ODVH 2OSLA 5D72H 1ZHBA 5TDPB 1K2DA 3TYFB 4XNYH 4XMPH 3S37H 5JW4N 3TPUA 5D8JH 1IEBB 4OZFH 4WI4A 5FGCE 3WNKA 1FGVH 1G7JA 2C3VB 2NXZC 4GO6B 3RGVB 3EO0A 2R56L 3WFCH 1RZJH 1Q9WA 4PJ5D 4FFVC 1F4XL 2NY6C 3BE1H 2YRZA 5F1SA 3DSFH 1RZ8A 5KAQG 4Y7MA 2OTUB 4RIRA 4GG6A 1MVUA 2HVJA 4WNQB 4FXLA 4YQXH 1AO7D 4IIQB 2OXHA 2LAAA 4JFZH 5GISH 4HS6A 2E7BA 2EIBA 2FJHA 3HZVB 2WSKA 2GTZB 4MNQA 2F19L 1TPXC 3MOAL 3RIFF 3BIKB 5KBNC 3WO4C 3JTTB 2FIKB 4XX1G 4Z7VE 1U3JA 1Z9SA 1T7XA 3SQOL 4DCQB 2VSDA 3PQYB 2WLYA 1A6TB 3AFLA 1OARL 4MAYB 2AKRB 4NN6B 3A6OA 2Y1VA 3T0WA 3O6FB 4DOHE 1IKNA 1G9MC 4DEPC 4AYFA 1BOGA 1AD9A 4HAFA 1RURL 4RFOH 3CSBA 4JFEB 1A7PH 1A6AA 1FL3A 1MLBA 5BW7C 2NR6D 3K74B 3MRFB 4NUGL 1QHOA 1DE4B 2IQ9H 2BRRL 3FOMA 3CX5J 4RGOL 3WHXA 5GGTH 2XWJA 3CAFA 1MCFA 1NC4A 2NX5D 2MCG1 2EKSA 4R4BB 3HG1E 1VKXB 4KRLB 1EZVX 5ALCL 1MPAL 3IVKA 3TIEA 4X7TA 3BP6A 3DUUA 3T04D 3OX8B 3MV9D 5BRZA 1G7QA 1MIML 3SDXF 4N1CA 5J9PA 2Q20A 1QBLH 5IGXH 4CRPA 4HK3J 4NFCA 3ROLB 1VADA 4OZIE 5I8EA 1HEZA 3SY0A 4MQTB 2YOCA 3QCUH 3KNBB 3OF6D 5HTSA 5JDSB 3TO4B 3CVHA 1M05A 1MAML 2YK1H 2P1YA 4ONHA 5CJXA 5DMYA 3WHE1 1ZT1A 2I07B 5CCKH 5IVZA 2Z35B 4HH8A 1G6VK 1IARB 5GGRY 1X9QA 1B2WL 2OX5A 2DQDH 3S3SA 4LRIA 2XG5A 5ESAA 1OM3H 5FB8A 2WWMD 5F6IB 1OT1A 1RK1B 4KTDH 3BKML 5TE4H 4LCIH 4FXGA 3CU1A 3AROA 5HDQL 3T0AA 1SY6H 3I6LD 3SKMA 1NL0L 5CILH 1S7WA 2Z8VC 4CAGA 1OD7A 3TA3A 4OGYH 4LOUC 1JZ3A 4LFHD 3KPQA 5HD8D 1C08A 1G7IA 5D7JB 5INDA 5A2JH 4X4YB 1MFBL 4N0YH 4GXVL 3O2DL 3KYKL 2D4FA 1Z0NA 1SJHA 3BZFB 4BFBD 1QEWB 1MREL 3QULA 5TE7L 3W0WD 2J6EL 2C26A 5DO2C 1HYSC 3X3FH 5JIPA 3KLAA 4ZD3L 1H5BA 5E7BA 2G2RB 2D7QA 4PJ5A 3B2UC 2BERA 1U58B 4XNZB 2EDJA 3HE7B 4QWWC 2CO6B 4KI5D 4UNVA 3Q1SH 1QR1A 3RWHA 1AR1C 4RX4D 3KLDA 1A7BA 5A2IH 3U79A 5JORA 3RA7L 2AVGA 1HH9B 3EO1A 3I2CL 4D0DA 3OHXB 1U42A 1PLGH 4C59B 1P6FA 5HYSG 1L9MA 4JO2H 4OI7A 4MX7B 4L8SA 4HX1A 1E4WH 4OLWL 3B9VA 4U1GC 1AGCB 1RAMA 1CICC 5K33A 3C60C 1VFBA 4KJQC 1V05A 1A1NA 2ARJQ 4LSUL 4H8WC 2PO6B 4FTVD 5FYJL 3VXRE 4Z7VA 5IQ7H 4EI6A 3AS1A 5CP7B 5ID0A 4U6YA 3V0VA 1JFQH 5BVPH 2AEQL 5TQ2H 1N8ZB 4OZFA 4WTZA 5E03A 2H3NA 1F13A 1D5ZB 1JRHL 4TULH 3STZB 3FB6B 3MLXL 3PWNB 2DLEA 4KVNL 5DJ8A 3DI3B 4TNWK 3NH7H 4R2GC 3N9GH 3CIQA 2F5AL 3G08A 2BSTA 3PE9A 4UINH 5IW6A 5C6TH 2J8UB 5HDBF 4P2CG 3QEQE 3NZHL 3IJSA 1F3RB 3BGFC 1Z3GL 3REWA 3U0WL 3G5YA 4I3SH 4Z7QF 1RHHA 5DTFB 4S10A 4FQCL 1CFVH 1OW0A 3VFNB 5D6DA 1TZHA 3MV9A 2XWTB 3JV4A 5B22A 3ARED 2Q6WA 3FRUB 1U8IA 5GZOC 1IFHL 3MYJB 4H88H 4XAKE 3FMGH 4LCUA 2XN9D 4LSRH 3MRRB 5E2TL 2X70B 3UTQA 4LIQL 5ERWB 4OZIA 4O00A 3TP4A 4AQOA 3OF6A 5C86A 1QA9A 2VZ1A 3WL9A 3P11H 2J5LC 3BRGC 1CXLA 1OCWL 3FB8B 1OTTC 2ICCA 2NW3B 4Z8FH 4LLUA 4N5UA 4NRYB 2DAVA 3V7MA 1NBVL 4RCAA 3AAZB 2VXVL 3ILQC 1NC2B 3VDAA 2OI9B 1BQHG 4KY1H 5GGTA 3RIAF 4WUUD 4YC2B 5EZLA 1Z9LA 1FIEA 4LNRB 1DDHA 3BYYA 2WQRA 3ZL4H 1ZANH 1T0MB 4XP5L 3S5LA 3D0LA 2AQ3A 1CDHA 1PG7H 3QR2A 3WFBH 4AM0B 4L3CB 4JM2C 4WI6A 2UVEA 3TJEL 2I9LB 4BK5A 4JPKH 3NIFF 4M62H 1J1XL 4Y0GA 3WHE0 4HBCH 1CFBA 3T2NL 3T0ED 1QO3B 4JLRA 3TH2T 3ZYJA 1VFAB 5HI5C 1R5IB 2Y5TB 5KSBB 3BWUC 3ZKND 1JPSL 4DGVL 1MHPH 3CFDB 2BHYA 2R8SH 3WJLA 4NHUA 2CIKA 5EBWA 1QUNA 3IDYC 3E1F1 1UZ6F 1UH3A 4LVHB 1N5YL 1BWWA 2R0WH 3VXQA 3K1KC 3WFEH 2X9WA 2APTA 3VFMA 2AJVH 4RX4A 3D39D 5HSFA 1L7TH 4UU9B 3OR7A 1AFVL 2YHGA 2NZIA 1T7YA 2QSCH 4YDKL 2UWEB 4G42B 2ZUTA 4Y16C 1SY6A 3RVVD 5A40E 4PJ7B 3BKCL 2DQHH 4OGXH 2FGZA 4ZTOL 4WV1A 3VD4A 4Y5YC 3MXVH 4V2CB 3MMEB 1TVHA 2XKNA 5D6CB 5C0NC 5CUSL 4FTVA 3LEVL 4WWID 4FQXC 4X80H 1CDIA 3BEWA 2IANE 4NO5B 1JHKH 3EJZC 4PR5B 2P5ED 3OB8A 3VXRA 3V5HB 4DN4L 2XZCH 2W9EH 4O2EB 2GJ6D 4O4YH 5FKPA 3UTTE 4NUJA 3RVUC 2VZTA 4LPWA 2NY2D 2RCSL 1RZGB 5EBLA 3P4MA 3F12A 1DUZA 1RUML 1LO4H 4TOYH 1WT5C 4Z18A 1X5KA 3CK0H 1A6ZB 4Y5XC 3TN0B 4DN3H 5HY9B 5HGAA 4AEIL 2EDHA 1TQBB 5FHAH 3DHMA 3JUYA 3X11A 4HMCA 5GIRB 2W38A 4JANB 2NTFB 3CMOH 1RZIA 3L5XH 3AXLA 3TEUA 4DKEH 1I9IH 3QJFB 1N6UA 1I1AD 1HI6A 1HHKA 3LHPL 1UCBH 5IHUH 5HYJB 3HAEA 1DQJB 4X5WA 3SCMB 4OCRL 1NGQH 5GJTL 1U8QB 1R3LB 1CR9L 4JRXD 3W9DB 2R4RL 2HT3C 1PSKL 4R90L 4B41A 3JSSA 4YEFA 3OB0H 3CFBB 5JR1H 3GBNL 4PJEF 4WDIB 2AJZA 2XN9A 4G8EA 5ICXB 3UO1L 4JFYA 3KYAA 3T4AB 5ID1A 3NVQA 3MUJA 4LCWD 4TTDC 1BJ1H 3L3DB 3BE1L 3DSFL 4I0PD 1K5NA 4QRRD 3BMWA 1EMTH 1XIWA 4M5ZL 5GS0D 1I3RB 4JQXA 5C0RL 2UV3A 5CGYC 1OT2A 3AU1B 3KPRB 4ENED 3RI5K 4ETYA 4U6XB 2AJXL 5E00A 3DETC 1D5XA 1JWSB 1ONQA 1ZA6B 3SGDI 3L3HB 3VWKA 1FGNH 1QFWI 4YDLB 4JHAH 4L4VD 2WANA 4WUUA 1Y6KR 3MV01 5IVOA 3VGGA 3NFNB 3PWVA 4NQUA 3M45A 3QUML 2X4UB 5JLZB 3DV4A 3HC3H 4V2BA 4EI5D 3GGWB 2R2CA 1NFDE 1YEGH 4JKKA 4FZEL 4RFOL 2VXUH 5I17B 1A7PL 1OF2B 5ENWA 2FLBT 1U92B 3T0EA 2MMXA 1I9RL 2A38A 3UX9B 3Q5TA 4HFWA 2YD2A 5C09D 1A9BA 4LLYB 3MUGA 1WF5A 2FO1A 3PWLA 5EU4A 1OLLA 1XFPA 4M43H 3LKRA 2WW8A 4JREB 1YYLL 1JN6A 5FA3B 2YA0A 3TNMB 2Z8SA 3VFGH 3D39A 2VLKD 3MCG1 3SDAC 2BMKB 4HKBA 4PGEA 4OCWH 3DVIA 4IRJB 5IB3B 3JWOC 1QBLL 5EU6D 2ICEA 1MF2H 2A73A 1ZLSH 2X7LA 2H32B 3GSXA 2BVQB 3WIIH 5FIEA 1ZSDB 4W70A 3MRNA 1YEDA 1I75A 4MD5A 3U7WL 1CT8A 4YHLH 4F7PA 4PY7B 3MRGA 3IT8D 1F3JA 4PGZA 3H9SB 4YR6A 2IANA 2HT4D 5KZCB 2WBJC 1R3JB 3CVIL 4UIKL 3UYPA 3PGDB 2HJFB 3DVGB 3J8F7 4NKDB 4BFIA 1NGXA 5C0CE 5TPWL 4B0MM 1UGNA 5D96C 1FFOA 4DUWA 4OB5H 5A43C 3QFJB 1J5OL 4X6EA 3ARFB 1B88A 4I48A 3VMNA 3K8MA 5DUBB 1G7HA 4LCIL 5C6WH 5DC4B 3EYUH 1LP9E 3U36B 3EYVB 5DD6B 2VLRE 4U1NA 4EDWL 4HPYH 2DRUA 4P3DA 5E4IA 4LF3B 4L9LC 1XCQB 5K9JH 3RY4A 2AXGA 3JV0A 5KANG 1I1AA 1HQ4A 3G6AB 4M7LT 4TSAH 4QO1A 3P3YA 4RMSA 4IOSD 3RTQD 1RVFH 3WFHB 5KS9E 1ZHNA 3IAPA 1DBMH 1P1ZB 5SWZB 5JXEC 5EIIB 3KPMA 4KKCC 3X3FL 3D9AH 4YHML 4P2RD 2A6DB 2ZJSL 1BBJB 3SQBA 4A2LA 3E6FB 1I9EA 4RNRA 4Y4FB 4OLZL 5EOTA 3ILPB 4KXZH 4HUUA 2YWYA 1SQ2N 4LCWA 1QSEB 1Q1JL 4ZAKA 1NCWH 3KPLA 4QRRA 2YEZB 2MKLC 4MQXC 1P4BH 4G7YH 2PTTB 3LKPA 1KIPA 5HI4C 1YMHA 5IBLC 4TPRL 2Y7QA 2CUMA 2FJFB 2OR7A 4DK3A 1FYTE 1QG3A 4G8IB 4JO2L 3IXTA 3LS5H 2E3VA 1E4WL 1KTRL 3REVB 4CW1A 4F8QA 1EO8H 4L4VA 5TF1H 1FFPB 4JZNB 4PD4J 3UPCA 2EH7H 5MHSE 1MHCB 1X5IA 2BNUB 1KPUB 2VUYA 1M1SA 2OMBA 3K8LA 3BW9A 3F5WA 3TM6A 5ESQB 4N0CC 1N64L 3RBSA 3CDYA 4U6VH 2W65B 3ARGC 1LILA 2NY0C 4NWTH 1FJ1B 1U8KA 3DWTA 4U1JA 3STLB 4PRIB 4GQ9H 3ULVE 1NFDA 1HOCB 3ARUA 2VH5L 3BH9B 3R06B 3QDGD 5L0QB 2HFEB 4O9HH 1EX0A 4GKZB 4ODTL 1KCRH 2W91A 4BZ2H 1XMWA 1OAKH 2J4WH 1S9VB 2DQJH 3V2AR 2NQCA 4X5XA 3ULUE 3AS0A 1ZMYA 2FX7L 5J1AB 1JNJA 5C09A 3BQUB 5HPMA 2HFFA 4DZ8A 5C6TL 4WHCA 4J3TA 2QHLA 5GGQH 5EG6C 3T2QA 1GGTA 2OJEA 4XBGB 2EDXA 4WI2A 2P24B 1NGYA 2R2BA 2VLKA 4ODUA 3V7AG 1BJMA 4JR9L 2XQBH 4WFFE 3O2VH 4M1CD 4ODWB 2EYTB 3L9RB 4PLKC 2YD1A 4NRXA 4QHMA 4LVNB 5B8CC 1UFUA 4AIXA 1MEXH 1RZFH 4RAHA 1INQB 3FCTB 4R4NC 4H26A 5FF6A 5MENB 5ACMA 4MNGE 4ZPVA 1EK3A 5T1MB 3P11L 3SDCB 3CSYA 3L3GB 4NN7B 4JN2A 3QG7L 4PJ8B 1CLYH 4X6CA 3SPVB 5D2NE 3V6ZA 2H2SC 1RFDL 3IJHA 5ADOH 2CK0H 1BVLA 4M7KL 2XTJB 1QFPA 2EXYD 2H26A 5TF0A 3VFUA 1FL6B 4Y88A 4KY1L 4G6ML 3QDHA 3ZMRA 5C0CA 5F3BA 3CXHJ 3MLWL 4WFGD 2ADIB 3GSOB 1OP9A 2ARJB 5EC2B 1N2RA 3ZL4L 3C2AH 1JZ2A 2WBKA 1I1YA 1OP3K 4JDZB 3UPAA 2VAAA 4O02L 5HYFA 1S7RA 3PHQA 1NCCL 1E27A 1MH5A 2H1PH 3NOIA 1LO3H 3V6OC 3VE0A 1R5VA 3C5ZA 3WIHH 2EYSB 3MLZH 3RGVC 3IFPA 1DFBH 2DIJA 1RK0B 4LRNL 3RTQA 4FP8H 1U41A 3IDMA 2EC9U 5KS9A 4AEFA 1A1OA 2DWDB 4NNXB 1CG9B 3BAEL 1MHPL 3G6JF 3HPJB 5SV4A 4LCCA 3ZKMC 1MJUL 1JPFB 3QCTH 1SHMA 3FT4A 3LPGA 1TIUA 1KJMB 5DK2B 5L2KB 1M7XA 3VI4F 3OR6A 2IALB 1I8IB 3O3AA 4QOKE 1T0NA 3QRGH 5DJ6A 1YEKH 5FYKH 5J6GB 4BKLA 3PP3H 4M6MH 4F9LC 3BD5A 1V3KA 3B9AA 5EORH 2VYRE 2C1PB 3MR9B 2BVPB 3O9WD 3FB5B 5F7YC 2QSCL 4XPBH 4PGCB 2DQFA 3OKLA 2ZP0T 3V5DB 1JGEA 3MV8B 5FYKU 1HSAB 3CU7A 4KDWA 3M1BA 5LQBL 3MXVL 1DQMH 1OTSD 4Y4HA 5ITBH 2C3HA 2HG5A 1Z9OA 4QHUA 4UV7H 3E6HA 2MHAA 4OZHB 4DZBA 2FECL 4GG8B 5I1IL 1H0DB 5EO1B 2HLAB 4GG6F 5CKAA 2BNRD 4ZOEA 3EGSA 1MIEH 2V5TA 1RULH 4WVRA 5E4EB 3UMTA 2YPLE 1EHLL 3CXDL 2F15A 1ZA3B 3CX2A 2NY1C 3MJ9H 1LO4L 3DURB 3WBDA 3GMOA 5JQHC 2ZSVA 3CK0L 3FFCB 2I9TB 1RZKH 4YK4C 5DRNB 3F7YB 1ODAA 5FYKE 1FNSL 4PRBA 2DQTH 4ZQKB 4ZNEE 4MHHI 3VRIB 3VD9A 2KQMA 2W9DL 25C8L 2D0HA 3CMOL 5AZEH 3V6FB 3QUZB 3O6ML 1I9IL 3QHZL 4XCNA 2CH8A 1UCBL 1PYWB 4NM8H 4WGVB 3PDOA 5F88A 1XF3B 2ZG3A 4K3GA 4QHLA 4YXHH 1JGLL 4WFEE 1KCKA 1NGQL 5BMFL 3QO1A 2BJML 2V5RA 1CVRA 4Q0XH 2XRAL 4P99A 4JHWH 1LVEA 4L5FL 5B3JE 3GSNL 1IGIH 4TYUA 5JXAL 3BXNA 4O5LH 1KENL 1VACA 4PIRF 1ZT4A 1AQDB 4BQ6A 3GIVA 3UTOA 4CVZA 4MNGA 2VZOA 4U1MA 5T3ZE 43CAB 5FUOH 2VDQL 2A2QT 3KXFD 3EYFA 5DQ9B 5IHZA 1XGYH 1A4KA 1JYXA 4NKQB 3U83A 1U3YA 2PYFA 3P4NB 2VXTL 5D2NA 1PD6A 5F96H 4XI5C 1KJ3H 5E94A 1M7IA 2P45B 4G8GE 5LAXB 3NPSB 3OKMA 5FUZL 5IVXE 3SKJL 5CSBA 1MCBA 1UM4L 4B7LA 3G04B 2VJXA 3K7UA 3QIUB 2B2XH 1GAFH 3OTTA 3SKOB 5IESL 3MRJA 4MZ2A 3H3PH 1JNLH 3MROA 5D7JC 4OCSL 1T4KA 1S9YA 1RIHL 3U9UA 3K2UH 2RFXA 1UADC 3PJSA 1A8JH 3N1GC 1YEGL 4MJID 3DRQB 1UB6B 5DYOA 5J13C 3UTZB 3O3BB 1OGAE 1SJVA 4HIJB 3WLWC 3U9PL 1IC7L 1NEZG 4XXCC 5IBTH 4DKFH 2EE9A 5DD0L 1WBYA 1QYGH 2IPKA 5ILTH 4PS4H 3HE7C 5KVDH 2VZVA 2WAHA 5L6YH 2CMRH 5D7LE 1KNOA 4XHQA 3EFFB 3R1GH 2OSLB 4LSQH 1ZHBB 2W0PA 2AI0H 1E4JA 1K2DB 4P2OC 1DLFL 1CDCA 3PABA 2QADC 4M43L 2DIBA 1G6RH 3T1FA 1S7QB 2Z31D 3RHWK 5GJSH 1G7JB 3TBVA 3EO0B 4UUJA 2CKNA 1JTOA 1E6JH 4X4ZA 3SKNA 4X9IA 1Q9WB 2EH8H 3BRDA 5CD5C 2PO6C 1RZ8B 1YEEH 1T03H 2I27N 2F58L 2X4QB 4F2MA 4JFDE 3DJ9A 4GG6B 1MVUB 4WI8A 2HVJB 2A9MH 2CDGA 3O2WH 4IS6A 4UDUA 4PJDE 3WIHA 1FYHB 3VXTA 4L3AA 5HHQB 1TETL 2FJHB 2VLJD 2XXCB 4YHNA 3WUWA 4MNQB 4Q9CA 2HMID 2FATH 2BNRA 1CGSH 5K9OA 1W0YT 3MJ8A 4PJIE 5KVEH 4J4PD 5EBGA 4HWBH 5DD5L 2YPLA 5DD1L 5MP6H 1MJ8H 5L2JB 4EN3A 4KZEL 4JFHE 2Q7NA 5JHLH 1BOGB 5FOBA 4R6UA 2OR9L 3ZE1F 7FABL 1AD9B 1MFEH 3UAJD 1F6LL 3VGEA 4GXUM 3P73A 1FDLH 4HPYL 2JB6A 4ZNEA 1VGKA 3UC0H 4Z7VF 5IP4A 1A6AB 3PDGA 2VKWA 1FL3B 2YPVH 4RGMB 1K4CA 1HCFX 5DJCA 1IBGH 4F7MA 1MRFL 2D7NA 3AM8C 2OTPA 5GHWH 4HGWB 3D69A 4HQQH 3EFDH 4PBWD 3FOMB 4XVSL 5IMKA 3WHXB 3ORJA 2XWJB 1NC4B 3RHWF 2EKSB 1I1FB 4MXQD 1J0JA 3MRCA 1Q9LA 5I1DA 4OJFL 3D9AL 3CFIC 3I3BA 3TIEB 4YHYB 3F65A 4TUJB 3BP6B 3DUUB 4X7TB 5CWSA 1F6FB 3LOWA 2NYYC 3LD8C 5CD3A 3ULVL 4XWOC 2FZ3A 5BRZB 5J9PB 3IJYB 3Q48A 3MJ9A 4NC1C 2YRPA 1Q8MA 1VADB 4PUBL 2OI9C 3ZLQC 3CMGA 1HEZB 3SY0B 4YC2C 1ZAGA 3KXFA 1W72B 2M8XA 4CADA 3ULUL 4NBXB 3BPLB 4TQEH 2MPAH 3CVHB 1C8PA 3NPZB 1TQCC 1M05B 3LY6A 5TE6H 3RRQA 2EIZA 3LS5L 4ONHB 5HYIA 2APWA 4PJGE 1ZT1B 3MBEA 2XZAH 4XP6L 4LCYA 4G8GA 2HLFD 5IVZB 1AXSA 1N7MH 4U1KB 4CVWA 4UZGA 5HHMB 1CLOH 1FBIL 1PEWA 5AYUH 3DO7B 2EDNA 4OZIF 2KH2B 3QXWA 1I9JL 4EUPH 3MX0A 1UQSA 1ZKAA 2LAGB 2ZNWA 5ESAB 5FB8B 5C0JA 4MJIA 2F9BT 3JV6A 1IGCH 4GQ9L 3UJTH 5GS2H 4FXGB 1B4JH 2ZUVA 4JB9H 4LAQH 1OGAA 1KB5L 3EOYG 3KJ6H 4O9HL 5DA0B 3H8NA 4HPOL 1S7WB 4LVHC 2D7OA 4NQCE 1S78C 4D94A 1VGEH 3TA3B 2J4WL 4G6FB 3KPQB 1Z2KA 3TFKD 5DMKA 3NCBB 4JRYE 2KBGA 5C08D 2WBWB 1BFVH 5IIEA 5INDB 1FO0H 4PTUB 2IADB 1E0OB 2XA8L 5HI3D 1YDPA 5I9QC 1T89C 1WIUA 5DJDA 2LVEA 3DBXA 3HZYA 4QXUL 1MFDL 2IH3A 1FC1A 1LMKA 1CBVL 4UT9L 2Z31A 3KLAB 2AV1B 1KJVA 4PRAB 1H5BB 2FLRT 4HWNA 4NKOA 1H8SA 4LLDA 1BF8A 4PJ5B 2P8LB 3B9KC 4GS7B 1QR1B 3RWHB 3TVMD 1L9NA 5CEZH 1IGFH 1MEXL 3MRLB 4P4KC 5JORB 2PF6A 1AO7B 3EO1B 1ZWIA 2YRLA 3QBTB 1KLUA 5FYLH 3VGDA 5JW3H 1K6QH 2VLJA 4IRZL 2FH6A 4L8SB 3FRPG 3O6LH 1BD2E 4QHKI 5C0BD 1HNGA 1CLYL 3TN0C 3VXUE 5FOJA 3S97C 3D18A 4K7PL 1A1NB 3OG6B 3RKDC 2CK0L 4NJ9L 1SM3L 1TQBC 2XY1A 4L1DA 1INDH 4J4PA 4EI6B 5ID0B 4U6YB 1BBDH 3X14A 2EDKA 4ZOAA 2R23A 1G6RA 3V0VB 1YUHA 1JGUH 1U8OA 2WP3T 4DOHB 4I9WD 5B38G 4KKLC 3FT3A 2H3NB 3SCMC 3GMRA 5DJ8B 2BY3A 2IGFL 1J1OH 5CEZD 1KXQE 1KLGA 4IDLA 4L8DA 1BGXH 1JPGA 3HC4H 2A74A 3VXME 5JW4M 2BSTB 5HXMA 2HRPH 5IW6B 1JBJA 5FYLD 1DEDA 1RSFA 1U8MA 3IJSB 4P5MA 4RMWA 3REWB 2HWZL 1HZHH 3G5YB 4FQIH 4YDVA 2Y5EA 1QRND 2NY4C 3P9MA 2Z93A 2ED8A 4UT7L 3MV9B 4HLZG 3JV4B 3QCTL 2IAMC 2XQYK 2EICA 3VJ6A 1IMHC 3CGTA 2PYED 4HWBA 1NCAH 4LARH 1KEGH 4YDLC 1JGVH 2LTQC 4MS8D 1YEKL 5FYKL 2JJSC 4M6ML 3O8XC 4TUKL 4KV5E 3UTQB 5J0BA 3MA9H 5SWQA 3S35H 5DRXA 5AYQA 1ZGLA 1YC7A 4ERSL 4XPBL 1LO2L 3SDDD 1QA9B 3V52H 4HUWA 3WL9B 5AUMB 5TGBA 2X4OA 4N0FA 4IOFC 1T5XA 5DEGA 4YJZL 4OD1H 2GY5A 3BEVB 2R4SH 4PJGA 5E5MA 4LLUB 2R29H 4OLYH 4X7SL 2OP4L 3O4LE 4JHBA 5C0GA 4UV7L 1WUNT 2F74A 4HD9A 5GRJH 4XPTH 5JMRA 4GW5A 4POZC 5AWNH 3W9EB 4KXZI 5J06A 1MIEL 1DDHB 1RULL 3JUZA 1YNLH 1EA9C 1BFOA 3S5LB 2CSPA 4NN5C 1WCBB 3DARA 3P4OA 1C5DB 1GC1L 1F2QA 5A2KH 3UJIH 4ZFOL 6CGTA 5T3ZL 4JREC 4ODSL 4YGAB 3PHSA 3U4BL 5C08A 1UA6L 4QTHA 3KVQA 5AZEL 2CDEA 3KG5A 3HZMA 3MRDA 4JRYA 1BJ8A 4JLRB 4YGVB 3IDJB 1BWMA 3NCFB 2V5SA 5AEAA 4XPGH 3HNTH 5I1AB 4NHUB 3B6SB 2CIKB 3NZ8A 3LQAH 5EBWB 2D9QB 1ACYL 4ORZC 3DI2B 4N8CH 3VXQB 4EUPA 4JHWL 3VFMB 1T83A 5F9WB 3OR7B 3L3JA 4O5LL 5E2UH 4PG9A 1GPOH 4OAWB 4PG2C 2DM3A 1MCQA 2VQ1A 4EDXA 4X83A 5C0BA 4BUHA 1MUJA 4KJPD 4HIEA 1HHIA 4WV1B 3QUXC 4Z7WE 3ARFC 4HWEL 5IT2L 1BD2A 1BPVA 4M7ZB 4ZS6D 2VLMD 3VXUA 3RWDA 5DLML 1PQZA 3B43A 4FTVB 3WDJA 2Y6SC 3DPBA 4CNIA 1KGCE 1YJDH 1KJ3L 1FO0A 4PJXE 2GEEA 4HKZA 5KVFL 3A67L 5FKPB 1GAFL 3DYMA 4MMXC 4KQ3L 3F12B 1DUZB 2IPUK 3VFVA 4PJFE 3HR5A 3K2UL 2NY7H 4OTXH 3RVXC 5HGAB 1NAKL 3MO1A 2JB5H 1FZMA 4MMZC 4UB0H 2A9NL 5IBTL 3DX9B 2IG2H 3RL2A 3Q3GA 3RP1A 5FK9A 3X11B 5I18H 3DUSA 4UNUA 4XMLH 4PJHA 1EFQA 4Y4FC 1NMBH 5ILTL 1KV3A 1RIUH 1RZIB 3VXMA 3MYZA 3OAYH 3AXLB 4PS4L 5I1JH 5C70A 5BO1L 3D2UA 1HI6B 1HHKB 3LQZA 5L6YL 4HK0A 3MACL 3OKDA 1PY4A 3HAEB 4K3DH 4ELKA 2AI0L 1NLDH 3D85D 1BQHA 1G6RL 4LGPB 4LPCA 5I1GH 1XZ0B 2PYEA 3BO8A 3GI9L 4NNYA 5GJSL 2AJZB 5E6IA 4KVCH 2XN9B 5KG9A 4G8EB 2XICA 3V79C 1CE6A 1TCRA 2ZUSA 4JFYB 2X1OA 1JWUB 2ZPKH 2JJTC 1K5NB 5GRZA 4NM4H 3QIWA 4KPHL 2X89D 2A9ML 4YEEA 5I15L 5E00B 4JEGB 3W11C 1D5XB 3VWKB 1P7QD 5DJAA 4LEXH 4GQPH 4J1UA 1GH7A 3O4LA 3RWIA 4WUUB 5L0QC 2DM7A 1V5JA 2FATL 4XCCL 5GRXG 3PWVB 4FN0A 4J6RH 4HJ0C 4BSVA 4MD0A 5F9OL 3BQUC 3DV4B 3PV7A 4PRHE 5MP6L 1MJ8L 1IT9H 1KIUA 1F8TL 2GHWB 4PRHD 4PV9A 1MFEL 3LAFA 4TRPH 2DQUH 4W4OC 5ENWB 3ZDXE 1E4KC 1BZQK 1F6AA 3T0EB 1V7MH 3SE3A 5DF0A 5DI8A 1Q9KA 1NDGA 4GLRH 4HFWB 1N6QL 1KULA 4XVJH 5T3XH 4LVNC 3ZTNH 3V95A 4NO2A 3MUGB 4AMKH 2DMKA 4RWYH 2HT2C 4DVRH 4UOW0 4JAMB 1F11A 3PWLB 5EU4B 4Q58C 2IH1B 5ALBL 3SEPA 1R3HA 4M6AA 5E9DE 3GHEH 3QWOA 1JN6B 3MRPA 4NN7C 3TZVA 4IMKC 4LHUG 3D39B 4LAJH 1LO0H 3JWNC 4HKBB 4KK8C 4PGEB 3NFPB 4L3EE 3RX5A 1JGDA 1Y0LA 2XTJC 4Y5VA 2Q8BL 1IC4L 2ICEB 2B0SL 1UWGH 2A73B 5IKCA 3LN5A 3D5OF 3GSXB 4G6AC 1U93A 4QRPE 4QRPD 2VERN 3ZE0E 4MD5B 2DMCA 5TE6L 2AABH 4Q9RH 1CT8B 4F7PB 4OKDA 5CIPH 3MRGB 4EOWH 5BXFA 1F3JB 2P5EB 4YR6B 3MNVB 4PJXA 1GL4B 5DFVC 2AV7A 5IEKA 1N7ML 1NCBH 5KSVA 3VWJC 5T3XD 2NY2B 1CLOL 4BFIB 1NGXB 2B4CH 3ULUC 5C71A 1FFOB 3JTSA 4X6EB 4I48B 3QZWG 2VL4A 5FO7B 3UJTL 5E70A 4XB8A 3HFML 1XF5A 4JB9L 4U1NB 3MLYH 4P3DB 2GCYA 3KJ6L 3C8KA 2AXGB 1UH4A 4RFEA 2K7PA 4RMTA 1VGEL 1YZZA 1I1AB 2K9UA 4CMMB 5IM7B 1YNKL 5LWYL 3IKKA 1W8NA 3QDME 5J7CC 1ZHNB 3U30C 4JRXB 3RPIA 3PXJA 1WTLA 4JFQA 4TVSa 2X4SA 1LP9F 3D85A 2G60H 5JZ7D 3KPMB 3DECA 5LXGH 1U3HC 2PR4L 1FN4A 3HPLA 5EOTB 3CNKA 2FEEL 4HUUB 1IQWL 3BT2H 4LCWB 4NQDD 4Z77A 3ROOB 4ZAKB 1RMFH 3KPLB 4I0PB 4BSWA 1IEAA 4QRRB 5KS9F 3V4PH 1IGFL 4P9MH 5KSAC 3OSKA 5BV7L 1KIPB 4OM1H 1YMHB 1CF8H 2Y7QB 3C9NA 5D1QC 5JW3L 2L7JA 2MFNA 1KCVH 5E4EC 5D2LE 1UM5H 1UZ8A 3PL6C 3IXTB 2I60L 3O6LL 2YD6A 4XP1L 3RJQB 4CW1B 4L4VB 5HGDA 1LDPH 3FL7A 2J8HA 4JN1H 2FYYA 5D4QA 1VFUA 1T2QH 2NZ9C 3SJVD 3TIDA 3FONA 3D48R 3SE4A 3ARBC 3BW9B 3F5WB 3QUZC 4KFZC 2QHRH 4X4XA 4EI5B 3GMQA 4PP1D 4M5YH 4PRHA 1KOAA 1U8KB 1TXKA 1JGUL 2DBLH 4U1JB 5DRZA 4ELME 4EQ3A 4BZYA 1MFAH 4S2SA 1GHFL 1MWAB 1NFDB 1C16A 3BVNA 3EOBB 2P8MB 3OPZL 4ETQA 1GGBL 2R0ZH 2X4TA 3LH2L 4XC3L 3GM0A 3FO2A 1IC5H 4MDIA 5DVLA 4M1DH 1A5FL 4GMTH 1H3VA 1BGXL 4OCXH 4X5XB 3HC4L 1CLCA 5C09B 5LG1A 4EKXA 1SBSL 3WV0A 2HFFB 1HHGA 1TJIL 4DZ8B 2DQGL 1ND0A 2K7QA 3ULVF 1YC8A 4UI2A 2OJEB 3KYOA 1HZHL 4H0HB 4DAGH 1UJTA 1D3CA 4S1QH 4FQIL 4MWFA 1NGYB 1BP3B 2R2BB 2VLKB 3GRWH 5E9DA 3S88H 1DCLA 3W2DH 5FEBA 1G0DA 5GZNC 1R24A 1CK0H 5CZXC 1C1EL 2MNUA 3ULUF 1U8HA 5EU6B 1FVEA 3MLVH 4G6JL 4L3EA 1KEGL 4NRXB 3SE8H 4QHMB 3I3DA 2HTLD 2CXKA 1WBXA 4O2FA 3S35L 4ZFGH 5FF6B 1TVDA 3UP1A 3QIUC 1KIQA 4QRPA 4ZPVB 3MTRA 2VDMH 3CSYB 3MODL 4GSDL 2DF3A 3VU2A