1A22B

Human growth hormone bound to single receptor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
192
Chain Sequence
PKFTKCRSPERETFSCHWTLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH HORMONE
publication title Structural and functional analysis of the 1:1 growth hormone:receptor complex reveals the molecular basis for receptor affinity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (hormone/receptor)
total genus 31
structure length 192
sequence length 205
ec nomenclature
pdb deposition date 1998-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a22B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a22B01
2EIZB 2V5RA 1TITA 4RGNE 4YDJB 2Q6WB 2QBWA 1UYWL 3ARBC 4OCSL 3P0VL 2GJZA 2ZKHH 1RZIB 1YEKL 3HHRB 1BIHA 2V17H 5I1JH 4JHAL 1M1SA 5C0EB 3MCLH 2OTWB 4OF6A 2NY7L 3KJ6L 2CXKA 1CGXA 2DS4A 4QXGH 3D85B 1NFIB 5F93C 2I07B 2GHWB 1FFPB 3R8BB 4X7DC 1NAKH 4LCWA 4NWTH 2EXYD 4KKCD 4JRYD 3T3ME 3H3PH 3Q0HA 1FO0A 5I8KL 1N2RA 3O2WL 3TCXA 2G5RA 3B3IA 4RISH 3DOSA 4WUUE 3BW9B 4PJEB 2XACC 2FATH 4FNLL 2EDBA 4YPGB 3LQZA 4PD4J 3B2UC 4RWYH 3TVMA 1N5YH 5H94B 4TNVF 1FAKT 3CMOL 3SCMB 4L3CB 4NFBA 3NCYS 1NKRA 4RA0C 2YD4A 3P77A 4L4VA 3RVVD 4Z7QE 5JORB 3O6FA 1A9EB 4NBYB 1ZKAA 4LPXA 4NKOA 1FVCB 1HEZB 1WEJL 4KHXL 2AXHA 5D1QB 1FYTD 4N68A 5TDNA 6FABH 4DGVL 1SEBB 5AG9A 1FVEA 1NCBH 1UA6L 2AAVA 1QLEH 3CVHH 4Q9QL 1T22A 4EXPX 1MLCA 5BW7C 3EDEA 4P2OA 3VFOB 3SDDA 1FIGL 1DVFB 1QLRB 3SO3C 3OKKA 3QWOB 2UWEF 2D31A 5FECB 5MENE 1J1XL 3KYAA 1NDMA 4QCIB 5DF0A 4L1HA 1OTUD 3O6LL 5D7KD 2BSSB 3JBG7 4OD3L 2BNRA 4Y5VB 1BD2A 4L4TB 3O6KH 1VENA 1BQLH 5IROC 2CLZB 4KZEH 2P7TA 2IQAB 1WWBX 2V9QA 5E8DL 5GGQH 5DDHB 3WLBA 3QZWA 2CMRL 1MQKH 5I9QB 3RI5K 5IEHA 1U3HC 4XCFH 2DIBA 4ELKB 5CP7B 5ESVA 3GIZL 2UZYB 5DFWH 3D39B 1BP3B 4YHLL 1ZHKA 3WO3B 3RWIA 3CFJA 4FABH 3UPRB 4RGMC 2EO1A 5IBTH 4LVOB 2DMCA 1CE1L 1RIUH 5JPNB 1NGQL 3TA3C 1ZT4A 1C08B 1YEDB 3VH8A 3BN9C 1VGKA 1DLFH 3P3YA 4H0IA 2XT1B 3P0YL 5EZIL 3PL6D 3BGMB 5CILL 4ZYKA 3C6LA 2GCYB 3FONB 2F54B 1CD8A 3TT3H 4RAVA 4OKDA 1JP5A 2CJUH 4NNYB 3MOQA 2XICA 3DBXB 1FJ1B 1FNAA 3FO1B 3KPMB 3C2AL 1TCRB 1OP5H 2ZCHL 3G04A 4X9HA 5AAWA 1N8ZA 4IRSA 4ZO6A 3GSRA 3QDGB 1TZIB 2YWYA 3L3HA 1EK3A 2GT9A 1U8PB 4KJYB 5DC0A 2XV6B 4AIOA 2C7UB 2OI9B 4RGOL 4XCYA 5F6IB 1LO2L 1I8KA 1MUJB 1B9ZA 2NXZC 3LH2L 1NCDH 1O7VA 3V0VA 3OSKA 4KI5F 3U83A 4Y4KA 5IHZB 1MRCL 3FQXB 3QI9D 2OMNA 3P11H 1JGLH 1LDPL 1UM5H 3DX6A 3QIUD 4MNHB 2A6IB 3ES6A 3WFZA 1QSZA 1TZHA 4FQJH 1JPFB 4XCEB 1U8OA 3TBTB 1DL7H 5GGSY 3S3SA 2XRAL 3DX8B 3RWCB 4JY4B 2B1AH 4PS4L 3ILPA 2HTLD 2MHAA 4YFEA 3UEZA 3V7MA 3BGAA 5DD0H 3PGDB 4I3SL 4X6BB 1T1YB 2DLIA 3P4NB 5IMKB 3QUZC 1U2CA 4TSBL 1OHQA 3PF2A 3EGSA 3LRGA 1RUAH 3ELAT 5C1MB 1HE7A 2P5WA 4ODXB 4G7YL 1I7RB 4H1LB 2R2BB 5E7FA 5CZXC 3VFMB 3N9GH 2X2YA 4GW1A 3W0WB 1UJ3C 3MRIB 4EIGB 1BQHA 2Q1EA 1I1AA 4QRRE 4ODWA 4NQXB 3LB6D 1PGRB 1BZ7B 2WINB 2XNAB 1H15B 1G6RA 5CWSB 3T8XB 3ILQC 1AO7E 5J13C 1S5HB 5B21A 4UDUB 3GMNA 1GZPB 3RBGA 4GSDH 4MWFB 3AU1B 3OG6B 3WFEL 2C5DC 4C55A 2MQCA 3IDXL 3WLWC 4DKEH 5I76B 4PRAA 4LKXB 5EOCJ 4FQPA 2E27L 3U7AA 5ILTH 2VAJA 3MCKA 4X6EA 5C08E 2VDPH 1WCBB 2NLJA 5FHAH 3X14A 4OV6F 3WKMH 3WNMA 1F4HA 4GKZA 5GS3A 3LKOA 1TTUA 5FA4A 3ARDC 5D2LE 1WGOA 1E4KC 3GMRA 3M8OH 2DQHL 4KDTC 5HGBB 3RNQB 3UTOA 5CD5C 4HIJA 1J5OH 2DLTA 4HKBA 2BP3A 4NQCB 1E4JA 2OTUB 4XZUB 3U0WH 1ORQB 2YA0A 4G8IB 2VLLB 4L3EE 4S1RL 4WU5B 4GXVL 3U46A 5KAQF 4GOSA 2QADD 1J0JA 5EC1A 3WJLA 4P23C 3MGAA 4GG6B 3EJJX 4HG4J 5KOVC 1YC8A 5HYJD 1FNSL 4N0FB 3UTSB 1IGCH 4XCNB 4PLJD 3AB0B 3O0RH 5FCUL 3RWEA 3BO8B 1I85C 1WFOA 4Y8DC 5F9OH 2R2HA 3RP1A 4UT6L 3MJ8A 2MWCA 2XN9A 5B8CA 5IFHL 3MRFA 4Q58C 4K8RD 1EHAA 3KPSB 4K3DH 1JV5B 5INCB 3MXVL 2D4DA 1D5ZB 4KROC 3VCLA 5L0QB 5C0AB 4RMRA 1INDL 3BDYH 3HC0B 1S7WB 3P4OB 1JGEA 3AXLB 4PTTA 2B1HH 3QISA 4KK9D 4XPHL 3AREB 1UWEL 4R8WL 4QNPF 3RU8H 3VXNA 5I1CH 3IDMA 2DQTH 1QHPA 2ARJQ 4LPWA 2FB4L 3Q2CA 1W2KT 1SYSB 5JHDD 1GPOL 2W60B 1FG2B 3QFJA 2WWKO 3MNWA 3W5MA 4PJIE 1DEDA 5F7DB 2CDFB 2PXYD 2P47B 1ZA6B 2L0DA 4PJ7B 2EKSB 1MY7A 1NJ9B 4Z6AT 5J6HB 5IQ7L 1ZHNA 5ID0A 4FOMA 4DKFL 1JRHL 1E4WH 4XH2B 2W0FA 2G5BB 3RVWD 4KH2A 3CVIL 3JWDL 4NRZB 3MLPA 5AAMA 3NCCB 5FK9B 4RX4D 4Q74A 3SKMB 4YHZH 3BXNA 4WU7B 5LGJA 1WAAE 5IB3B 1MVFA 1F6AA 4JJHA 4QGTA 4MMZC 5D7KE 5C0RH 5I16A 4YE4L 3CSYA 1AGDA 2X42A 2YPLA 5IESL 3CFIC 4TVPE 4JB9L 2FX8H 5DJZA 1KJ2L 1MFBH 3FQNB 3SY0B 3FRPG 1FDLH 2VZUA 4OB5H 4XVTL 3CK0L 4LHUB 3TBWA 4XVJL 5A2LH 4XPFH 3KLAA 1J0HA 1DLHB 1RU9L 2HH0H 3DRQA 1OAQH 5D1QC 3WE6B 3RPIA 3IKCA 2ZUWA 1K3ZA 2NY0D 3Q48A 3QFDA 4JM2C 4QGYA 2F15A 3QNXB 3DVIA 5D7JD 4PJDE 5EUOF 3OAZK 4L8BB 2M8XA 5CEXA 3ZTJG 1OAZH 1JHTA 1DVFC 1KLFA 3RTQD 3NFPA 4X6DA 3REVA 1A1OA 4OZGE 3GSUB 4B0MM 4ODTH 1LQSR 2D7PA 5SWQA 1NCTA 1CGUA 4KC3B 1HNFA 4LGSB 4PRHA 5FOBA 4Y5VC 4KUZH 1SYVA 4CNIB 1MSPA 4Z7VA 4PRID 1OF2B 4W68A 1IAOA 3ZSTA 2XZCL 3LVEA 5H37H 4MJ5B 2D7QA 4EKXA 5I66A 2QL1A 5I9QC 1JPTL 5CCKL 2OSLB 4IOIB 1EGJH 3C6SA 4LCUA 4DFIA 4Z5RB 1SJVA 1L0YA 1VSCA 2HKFH 3CVHA 3FQTA 2AJSL 1DANT 4U1KA 5C2UB 1RK0A 4JO4L 1U3JA 1SQ2N 1VFBA 4LVOC 5J9PB 4BZ1L 5C0CA 4DOHB 4XNQA 1EBPA 1F90H 1WBYB 3NCEB 3VG9B 4KDVA 4KKNA 1KBGL 1KXQE 3OR7A 3QT2A 3UZVB 4BFBD 4DK3A 4AJ0A 4OFKA 4UQ3A 4W6XB 3S5LG 4NUJA 1T2QH 2VQ1A 1Y6KR 1DANU 4U1HB 5AZ2L 3EYOA 4HHAB 4OFPA 1FZMB 1NANI 4NWUH 1YN7B 4POUB 1KELL 5C2BH 1UZ8A 1MJ7H 1ZVHA 3QQ4B 1JGUL 3VXPB 1O7SA 1Y6MR 4HV8A 4Z78A 3PP3H 2R8SH 1JGDA 1N7MH 3ULVD 3W81A 5AZEH 2PTTB 4K23L 1HHIA 4GG8B 1RFDH 2OI9C 2SEBB 5HHOE 5F6IC 4IBLT 3SJVD 1LNUA 5DEFA 1T89C 3GFUA 4NFCA 3C5JA 3OF6D 1J18A 1I7TA 5A3ID 5F7EL 5FGCB 4LPVA 4PRBB 1EZVY 1NCAH 3LN4A 3QIWA 4PJGE 3X3GL 1JMZA 4JO1H 1MCEA 3TC9A 3KPRB 2Y36L 1IGIH 1Q9OB 2FJHA 4NQDD 4J4PC 3F6LA 4NRYA 2ADFL 4JFOB 3JV6A 4JRXA 4XT1C 1KB5L 1T1XA 3B3IB 3FMGH 5D2NB 2P5ED 1EAPB 4LLAA 1J8HE 1MAJA 2NX5A 5K9JH 2HRLA 4CBPA 1A8JH 2NY6D 2XTJD 1FFQA 4G8FB 1XIWB 1NFDF 4NO3B 4XPBH 5I75C 1MHEB 7CGTA 5HVGB 1EJOH 5DRNA 4L9DA 2ZCKH 4UNTA 3F7PC 4NKOB 1QLFB 3VGDA 8FABA 1MF2L 3LQAL 2X4RB 5DD6A 4ACPA 5TDNB 5GGRA 3GSVA 2WWMD 3QHZH 4MA8H 3AM8C 5FYJU 1RZJL 3V0WH 1IGTA 3VXME 1IBGH 3BEWA 4PJ8D 3I6GA 2WLYA 5BRZD 1B4JL 1J1PL 4OGXL 1LP9F 3SDDB 3OKKB 2EDOA 5SX4H 3NZHH 2D31B 2Z8SA 4FQIH 4M7JH 1AC0A 3BPNC 1T03H 4Z7VF 3MJ9H 2PO6B 3ULSA 4XP5H 4G8GE 2WZPD 3T77B 4OKVA 3F8UB 1LE9A 3G6JB 4BJLA 2EYSA 3EOTL 1UH3A 4HJ0C 3Q1SL 3QZWB 1SJXA 3VFPA 1CFTA 5MEPA 1EMTH 4P4KD 4QHLB 4CAGA 5DUPH 5IEHB 4MNQD 5D6DA 1GCFA 1OTSC 3KPLA 5SX5K 4HKXB 5FYKE 3B9KB 4KKLC 4I2XA 3SPVB 2JJUA 4CMMB 4XNMB 4OZIF 3CFJB 1LILA 5MEQA 4OBSA 1MPAL 4YDKH 5T1LA 3WDIA 3O4LA 3HAEB 4LDOB 1OT1A 3W9EA 4LSTL 1ORSA 3VH8B 4BFIA 2AJ3B 1Q72H 1VEPA 1NMAH 1P7HL 2XQYG 5GGTA 3DARA 3MV8A 2UY6A 3MGOA 4ZYKB 3C6LB 2P45B 4HZLB 4NUGL 4TULL 1A1MA 5FKPB 5ID1B 3P30L 5IT2L 2Z4QA 3OTTA 3I75A 4B50A 1JI1A 2FWOB 2YMXH 2XZQL 1LO3L 3BMWA 3EAKA 2AERT 5L0QC 2IALA 2UV3A 4M7ZB 1OP3K 1D3CA 2NY4B 2H3NA 3QIBD 4JDZA 2EC8A 5T5NG 3AREC 2GTZA 4E0RA 3F7VB 2AI0H 4M5ZL 4AT6B 3MRKA 3U9PL 2GT9B 2PYEE 3QQ9D 1MWAB 4XCYB 3BPOB 4MCZA 3P9LB 5DJ8A 1I8KB 4ZOEA 2JCCE 4OZHF 4AYFA 2EDWA 4C83B 1ACYL 3OGCA 3UAJC 5IR1A 3V0VB 1T7VA 3N50A 2BVQA 4G7VL 2ZOKB 4FQQA 4OLWH 1NGZA 3O11A 2HT4C 1CK0H 3TYFA 5GHWH 3LPGA 3ES6B 3PWNB 4UAOC 5D7LD 1YPZA 5IB2B 5CBAB 4PLNC 3MLUL 5D7SH 1T2XA 4DTGH 1OB1B 1MAML 3QBTB 3QDMA 3X12B 5FKAA 1F5WA 3VXQA 3MLTB 3ZO0A 1N4XH 5GISL 3EGSB 4YHPA 2XA3A 1HHHA 3K81A 1KYOK 3MA9H 2AK4B 4PJCA 1EHNA 1QA9A 4HIXH 4OZFG 4YUEH 5BS0B 4JHWL 4ZFGH 1NLBL 1QG3A 4HWEH 3H6JA 4Z76B 3VMOA 1BHGA 3V6ZB 5D1XA 5FYJL 3HI5H 3OPZH 1DSFL 1HHJB 4KK5C 1I1AB 1MCLA 5LWYL 4ODWB 5ABDE 4K7FA 2A2QT 4GMTL 4MAYB 4X8JA 2X4TA 4XPAL 2DLFL 5HGHB 1TQCC 3RY6C 3AAZB 2VLKA 2J8UA 4MHHG 3GMNB 1LEGA 5GRZA 5IMOA 2IPUG 4GAGL 4UIKH 5L7XH 2N56A 5ITFA 1U8LB 2G2RB 5CJXA 1JRHI 5D5ME 3CFBA 1Z0NA 5AYUL 1RIHH 3SOBL 1BWWA 2IJ0C 1X5ZA 3MCKB 2H2PD 3SDAD 4AQ1B 3E8UL 4XXCA 3X14B 2B2XH 3FT3A 2Z35A 3F12B 1KIRA 4X4XA 1SJEA 3J7HA 3LKOB 4M5YL 5HHMB 2UY7A 3LKNA 4NJ9H 5ITBH 4HS3A 1IM9D 3RVXC 1QBLH 3GMRB 4XPGH 1CFSA 1J7VR 5GS0L 4HKBB 1DBAL 4N1EA 2OL3L 1ZANH 3RWFA 1JPST 3DX9A 1MCOH 3V5DA 1IVLA 4PG2C 2CRZA 4K07A 5IB4A 5KVEH 1R3JB 4DGYH 5MERB 3MROA 1D5BA 2IGFL 3VXUE 3VG9C 4XX1G 3DTXB 3O3BA 3UJTH 3D25A 1FNHA 4YHIB 4U7MA 4EN3C 3MJ8B 3MBEB 1I3UA 5JQ6H 1HXYA 2F58L 3DROA 5IHUL 4MJ2A 5EFIA 3VCLB 5HI3D 3TWCH 1RIVH 2P5EE 1REIA 2O5YL 1FV1B 3R8QA 4N0UE 1NBVH 1F3DH 4P46A 1EGJA 4L5FL 4WI6A 5FUCC 2P8MB 2R29L 1YN6A 1NC4A 4ZO9A 3IDMB 5HYSB 2VLRA 5GXBB 4FQ2L 4Y19E 3DO7A 2CIIA 1OOAA 1J10A 5I19L 3HE6D 3BEVB 4HLJA 3NCJL 3KYOB 1QRNE 2DN7A 4MYWB 5ELIA 2NY1B 3N1FC 3MV7A 3ALWA 4TUOB 3KXFD 2ZNXA 4NZTH 1KLUA 3ZHKA 5EG6C 1YPZF 2ARJA 1S3KL 1DDHA 3I50L 2VNCA 3EJYC 1ZHNB 5ALBL 5BRZE 1AIFB 5IK3A 4NN6B 4TRPH 1JNHB 2FIRT 4HX1B 2EDFA 3HB3C 3IDGB 3GSNL 3FRUB 4UTAL 3ZHDA 5CEZE 4OAWA 5KZCD 3L5WA 1XGQA 4A6YB 5I1KL 5CEYB 5KS9B 4L8CB 2ESVD 5D93B 2I9LA 3D2UA 5D2NC 4DN4H 1D5MA 1YZZA 3PWVA 5F3HA 1G9ML 3CSYB 1WBZA 4Y1AD 2H26A 4JZJB 1J86A 1CD0A 2YPLB 1U91A 1QQDB 2K9UA 4UV7H 3A67L 4MJIB 5IJKC 2EDEA 1XIWC 1QSFD 4XAKE 3B2UD 1OP5K 1KIQA 3G9AB 1M7IB 3CLEL 3H9SB 5DJCB 4MNQE 2QQNH 1KCRL 3CUPA 3HCVA 3MRLA 5HPOA 4PJAB 1OARH 5C92A 1M6OB 1FPTL 2P8LA 4ZAKA 3QDJB 4YZFE 2QJDA 4O02H 2RBLA 1KCSH 3ZE0F 1U93B 3TP4A 3S98A 1FLRL 2F19L 2Q3ZA 2A77L 1G9NH 5C07B 1A1OB 3D87B 2D9CA 5EH1A 1HOCA 1WZ1L 1NPUA 1IQWL 4UIMB 3MV9E 3TN0A 4WUUA 1K5NB 4PBWD 2EDQA 4XMPH 2PO6C 1W8OA 4MDIB 2IG2H 3EJZD 3I2CL 3ECBB 5LGHH 4NQEB 4FQXB 1UWXH 3ARTA 4NNPH 5B38A 1T7XA 4EUPG 4H25A 2CUMA 4CVXA 4NQVB 2MPAL 3DIFA 2PYFB 2X89D 4P3DA 5ACMA 4NBZB 1EX0A 3TZVB 5KVFL 3HR5A 4YHMH 4WY7H 4DWHA 5E6YA 2VLJD 1WIUA 3C6SB 4QXTA 3BHBB 1YEFH 5SWSE 5HDBE 3B9KC 3FQTB 4LAJH 5E95B 3Q5OA 5CKAA 3FO0H 3HG1D 3QJFB 4AY0A 1EXUB 4LIQH 1BFOA 3IRZA 4MJ4A 2A6DA 4K7PH 3MJ9A 4S2SA 4YBQC 1YUHB 1CIUA 5K9OA 1JPSL 3NA4A 3LEVL 2VQ1B 4NZRH 5DSCA 3PHOA 5FYKU 5F1NA 1Z3GL 4HEPG 2BNQB 4RMUA 4M7ZC 4MSWB 3DLQR 4I9WD 4Z78B 5IBUB 5I1EH 1DJSA 3CU7A 3RX8A 2MOVA 3BZEA 2DQDH 2W9EL 1OAXL 4HGMA 3NABL 2RHEA 4OQTL 5GGVL 5FV2A 4HFUL 1HHIB 3ZL4H 5T1KA 4FQ1H 3BPOC 4GKSB 1CLYH 1M7DA 2NNAB 1I7TB 3OZ9L 1ODAA 3LN4B 1TJGL 2AEQH 1TVBA 1U8HA 3TBYB 2X5PA 3E1F1 1RJYB 5LXGL 4GBXD 2AEIT 3OKMB 5HGDB 1Q0YL 4MQXC 5AUMB 3ZDXF 1XZ0B 4WFGD 5E2UL 1SJHB 3RIAK 3L7EB 5DA4A 4JDVB 3UTTE 4K2UH 2GJ6D 3RVUD 3QUYA 4Y16A 1FVDB 1AXTL 43CAA 1NEZA 3L6FB 1PQZA 5E00A 4M4RA 4MA7H 5JLZA 3HFML 5GJSH 4YXLL 5TE4L 1JBJA 3BOVA 4H88L 4Z7UE 4NT6A 4PP1C 2HFTA 5DD6B 5CZXD 1D6VH 3RIFK 1F11A 2VXUH 4MAYC 1BJ8A 4X80H 4MHHI 3WFDL 2YXFA 1NFKA 3O2VL 3GJEA 2QV2A 5IW1B 3CAFA 2X7LA 4WI5A 4RRPA 3MREB 5IB1A 3H9HA 3ILQD 4NJAH 2A83A 1RURL 4HLZH 2EDTA 2VXTH 2WUBL 1NKOA 5TQ2L 1PVHA 5GS2D 3QAZB 4R2GD 4LLDA 3QR2A 5ETUA 4ORZC 2DBJA 5EIQA 4R4FL 3X3FL 2E8ZA 3EBAA 2B20A 4AENB 2BVPA 2NW2A 3P9MA 4J3VA 5IMMA 1CFTB 5IF0A 5MEPB 1M7XA 4Z0XB 4BQ6A 1ZSDA 5F96L 5D7IE 3KS0J 4U1MA 1OAYL 2IAMB 2APFA 3VI4F 4QRRA 5A2JH 1ZLUH 1SVZA 4M1DH 4K8RL 1DQDL 1LEKB 2DMBA 5CD5D 4PY8I 3QUKA 2FO4A 1X4ZA 4R90H 1XGUA 1AO7A 1CYGA 1HIML 4RMTA 2H9GA 3DVNA 1XR9B 4UT9H 1A6ZB 3VFUB 1VFAA 1Z2KA 1P6FA 2XZAH 4FNLH 3CPLB 5IFJA 4K94L 5HDQH 2R1WA 1MIEL 3D1MC 3C08L 2R15A 3CMOH 1J0ZA 4XMKH 5C08A 2F74B 3MBEC 4YDVA 3GO1H 1IM3A 1MRDL 1SHMA 3ZYJA 1UH4A 1XF4B 2E7MA 5CZVH 4P5MA 4JFFD 3HUJE 4JDZB 3PQYE 2CSPA 4HD9A 3KYMB 4LLVA 1AGBA 4M3JA 3KPQA 4WFHD 1QR1B 4L4JA 4E0RB 1UA6H 1CD1B 1ND0A 2R1YA 4CU8A 2FCBA 4KMQA 5FM8A 4LEOB 4OF8A 4P2RE 1FIGH 2ICWA 2NY1C 2XIDA 1NANH 5CSBA 1EA9C 4PRPB 3OGCB 5KSBE 1EHXA 4J3XA 1QACA 4TN9A 3F6IA 2LTQB 2OQJB 2C4XA 5L9DL 1JNLH 2OXGA 4XVSH 1CGYA 4GQ9H 4YO0A 5A2IH 4NN6C 3T3PF 2YEZB 4P2QD 4LCYA 3WHE0 1CDJA 5E8DH 3NTCL 1SY6L 3D85D 1V7MH 5DO2C 5B4MC 2ZUQB 4BKLA 3BH8B 3UTZA 5D93C 1MI5E 5INDB 1UH2A 3QDMB 5CJ8A 1Q1JL 3GIZH 1ZV5A 4JZJC 4IRZL 3VWKB 3BESR 2ICWI 4U1IA 4F37F 2FYYB 3KVQA 3PP3K 1H3WM 4PJIA 3RL1A 4L29A 1FZJA 1NGQH 2AGJL 1KXTB 3SCMD 2AJUL 4UTBL 4GRLC 4ALAL 1JMXA 5J57B 32C2B 5D1XB 1ACZA 3G6DH 5FO9B 1WSST 5EZIH 1Z9LA 1TJIL 3VFNB 2VDOL 2WQ8A 4N1HB 5JW3L 4NKMA 1IGYA 4K7FB 2AXJA 3B5HA 4OCNC 2BOCA 5KW9H 2I27N 3GSXB 2YR3A 2J8UB 5IMOB 2IPKB 5IOPB 4U1NA 2V7NA 3MR9A 1IFHH 1WAAA 5J1SC 4DAGL 3C2AH 3FOLA 1YMME 2KQNA 3ARGB 4HCRL 1A4KA 1UACH 4JFXB 3UBXA 2AXFA 1WFNA 4FQXC 5ICZB 3G5VB 1RZ7H 3FT3B 4RGOH 3IDJA 1KIRB 4GRWE 3G5ZA 4KTYA 1F3RB 4ZFFA 1HYRC 2BSTB 4HIIA 1J05B 3TZVC 3FN0L 4P5TB 1OSZA 1HILA 5JW4M 1MRCH 4CJ0A 4PJXF 3N06B 4RA3A 4KXZH 8CGTA 4OM1L 4PJDA 1DE4A 3OXRA 4XVUD 4PV9B 3FT2A 2EH7L 3D39D 1TMCB 1YECH 1LK2A 2XRAH 3KWWB 2RCSL 5D4QA 1ZS8A 4OZGA 4Y2DB 1R3HB 4XPTL 3PL6A 3H42L 4I3SH 3ZYIA 5E2VL 2CR3A 3ULVL 1LO4L 1YMHA 4P9HL 5T5FH 3O8XA 2Y6SC 3ZYZA 4JJ5B 4FXKA 1EFXB 2FEDC 3JWNC 4OM0H 1CN4A 3G6AA 1CICA 4LSUL 1I8MB 2VDMH 1JJUA 2F54D 3X11B 3IU4H 5EIIA 4WFFD 3B9AA 4XX1E 3JV5A 4V1DB 2Q86B 2F5AH 5GZOC 1KEMH 5JHLH 4KQ3H 1YN6B 1NC4B 3TO4B 3QP3A 4ZUTA 1BAFL 5IVXF 3DO7B 3PWUA 2CIIB 4PGBA 5C09E 3RUGF 1D7FA 4F7CB 3K74B 3MV7B 3KHQA 3MTRA 1N3NA 5C0FA 4X6CE 4N0CC 4BH7A 5I8EA 5I18L 5L2JB 3WFEH 5L8LB 2ARJB 3BIKB 3IDXH 3QIUA 2RAMA 2FHBA 2ZP0T 1JZ4A 4N8VA 1FSKB 1OW0A 1IRAY 1WFTA 4JDTL 3QO0B 1FP5A 2C1OA 1C5CH 5CEZH 4OAWB 4WFEE 2Z91A 2KZWA 3D69A 3JSSA 3MLYL 2I9LB 3QJHB 4PJIF 3PWVB 5F3HB 3ROOB 3V6FB 3BQUA 4E9LA 5FDYA 1IJ9A 2J1KA 1I7ZA 4S1RH 3SQOL 2DLGA 4GXVH 3LKPA 5JXAH 4K3JL 3S4SB 4L8SA 2OMBA 1EERB 5HHOA 3L9RB 3OJVC 4JPIB 5J1AB 3HCVB 3JWOL 2VQTA 3SHSA 1FNSH 4PJGA 3WIHH 2YPVL 4PRDA 4O2CA 3HZVB 4ZAKB 5FCUH 3TIDA 4LSPH 5DI8B 3W0WD 1MHCB 5IFHH 4WNQB 4DZ8A 4M62L 3MRCB 1I7UB 4OCWL 1YNTA 3WFHA 4F37K 4TSAH 2Q8AL 4FTVD 1INDH 5SWZD 4IMKA 2D03H 1J8HA 1HHKA 4UBDC 1UWEH 5K33A 4A2LA 3H0TB 2ICCA 3TM6A 2EEDA 3QAZC 3P73B 3HS0B 3DSNA 1R3LB 5B38B 1KFAH 4H25B 1AQDB 1OY3B 2CUIA 1EZVX 3HR5B 3WEXB 1Z9SA 4BQ8A 4U1JB 1UEMA 2AEWA 1T04B 2IAMC 3BIBX 1T21B 3VRJA 2DLHA 5GRVL 1I3RB 3MNVB 4DN3H 2OJZH 1J1OH 1WK0A 1OPGL 5CSGA 4M9OA 4UINH 4UILL 1OQXA 4NO0D 3JWDH 3QRGH 4NQCD 1WJ3A 1ZVSA 1PG7W 5TQ0H 5MENB 5I1LA 2ZPKL 1JYXA 4JN1H 3VRIA 3MA7B 1JYNA 1W8NA 5DD5L 4YE4H 2HFEA 5F7MC 4PGDA 4U6VH 1P84K 5MI0B 3QXDA 4JB9H 5DSCB 3UTSD 1KJ2H 3LV3B 4M1CC 1VGEL 4KTEL 1UWGL 4O58L 3CK0H 3S34H 1BFVL 2VZTA 4XVJH 1P4BL 4QHUB 3RZCA 3S8WA 4M7LT 3KPSD 2C1PB 5EO1B 5E8OA 4LNVA 1P7QA 1PG7X 4CW1A 2A6JB 2GUOA 3WL9B 4XAWL 2GK2A 5FUZH 1ZGLA 3GZKA 2ATPA 3NCFB 5ERWA 1ZMYA 3ARED 5HSFA 3KGRA 2GAZB 1UQSA 2BC4B 4U3XA 4XP6L 3ZYOA 1LK3L 4MQ7B 1IC4H 3MMEA 4JFDB 1ULVA 2DDQH 4ZDHB 1NLDL 3MOAH 3Q6GL 1VPOL 5I1DA 4FG6D 4Q0XH 1BWMA 3S35X 2X4UA 3RWJA 1JYVA 4APQA 1RZGB 1P84J 3G5YB 3PDDA 3WD5L 1YY9C 5EOQL 2MJWA 1MEXH 2F9BT 3GI9L 4AK1A 2ZUQC 1JPTH 4OF0A 1G7QA 4Q9BA 5CHNB 5DJYA 4JQXA 5E6IB 5I8OH 3QUYB 2A6KA 4YLQT 3S37L 4BSJA 2UWEB 3QXWA 3VWKC 4CKVX 1PQZB 5IKCA 2PTVA 2PYEA 2V2TB 5E00B 3L95A 5IEKA 3JXAA 4L4TE 4BZ1H 2V7HA 4NM4L 1EEYB 1T1ZB 4WW2A 4OI9A 4QWWD 1PY4A 1KBGH 5D1XC 3VRLE 5ADPL 5C6PB 3THMH 2FGWL 5EZJB 1P4LB 1G9EA 4NNXB 1B0RA 2CQVA 5F9DC 4F3FA 4YXHL 4PGJA 2ICWJ 12E8L 3RTQA 1DQQA 3QWRA 1JUFA 2YA2A 3OGOE 1GJIA 2JJSC 2X7LB 4EQ3A 3DXAD 1GGUA 5F88B 5IB1B 3H9HB 3JVGA 3VJ6B 2G75B 3C60D 4NN7B 3T0VA 4PREA 5FF6B 3ARGC 1KGCE 1U3ZA 5JPMA 2R4RL 4G43A 2X1OA 3F62A 1XCQB 2ADIA 3RGVD 2VN7A 4QOKE 5D6CA 4K23H 2BFVH 4HXAH 2BVPB 3U30B 4ONOA 4NO5B 3P9MB 4WFFE 5IMMB 2X4QA 5IF0B 4IOFD 3JV4A 3U7WL 2ZG1A 4P5TC 5F7EH 1OAKL 3X3GH 1MFDL 3DUSB 2FEEL 4QRRB 1CLOH 1OTTD 3G08B 4Q2ZA 2Y36H 1ZWIA 3QDGE 4G6AC 5FYLD 1XGUB 5GZNC 4KPHH 3PE9A 4X7SL 4DFHA 5BXFA 3SDCB 2Q20A 1KB5H 3ARVA 3BSZH 4Y2DC 2BMKA 3NPSB 4NKDA 4LRNL 1MHPH 2R1WB 2I5YL 4I48A 5E5RB 1IC7L 3K4AA 5IG7B 5BVJB 5C08B 5JW4N 5JOEA 4P59L 5JXEA 3DURA 1IM3B 5DQ9A 5I8CB 3CX5J 2PCPA 1SM3H 3UDWC 3CXHJ 5D2LB 1XGPA 2VIRB 4YWGL 1UWXK 1MF2H 4CGTA 3LQAH 1TLKA 3KPQB 2P42B 5A2FA 3TO4C 1T4KA 3EO1A 2R1YB 1CGTA 5GIRA 3VWJD 3T4YB 4L3EB 1B4JH 3MRMB 1J1PH 5F1OB 5I2IB 2XKSA 4LPUA 1VKXA 4ZUSB 3CFDA 3QA3B 1KNOB 3VXUA 2BXYA 4Z7OE 1DFBL 1A7PL 1BZQK 3GHEL 4X5XB 3V5HA 4WW1B 3EDKA 1BJ1H 3MACL 3NIFF 1BJMA 5HHVH 1JF1B 1FSKC 2DWEA 4XNXH 2Z31B 4M61A 1N0XH 1ZLSL 2CDGA 2VUYA 2XKUA 4KK6C 3Q1SH 2R4SH 3KPRD 1NMBL 4HS6A 5CP3H 2P5EA 3TO2A 4N0UA 3VXOB 4LCWD 5I15L 2JB6B 2DI7A 2YUZA 4LLYA 3QUMA 2HJFA 4Y19A 1A5FL 3IU3A 1X5YA 1U8NB 1KPVB 1S7QB 3FZUD 4U1IB 4NCC1 4U49A 5DFTA 2XQBL 1QRNA 3FOMA 4LEXL 1EPFA 3MPCA 3TVMD 3WUWB 4XHJD 1FZJB 4LSTH 3QPQC 2EE9A 4GLRH 2BJML 2AJZA 4JFEE 1JWSB 3ULUE 5HHPB 2WQRA 4HUXB 5FGRA 2VAAA 4PJ8A 3GBLA 5BMFH 4NUGH 5BRZA 3DX7B 3P30H 2VO5A 3GJFH 5IT2H 3VI3E 5HYQA 2W0LA 4NQCE 4Y4HA 3FQUB 1LO3H 4MA3A 2YC1A 3PWLB 1F8TH 1EVTC 4IMLB 5EU6E 1JPGB 1VHPA 1KCVL 4P2OD 3FOLB 3SDDD 4DK6A 4GG6E 2YOCA 1CR9L 4IHOB 4NOFA 2AJYL 3UTSE 3U1SL 4DVRH 3U9PH 5KVDH 5FXCH 5DK0A 4QF1B 2PO6D 5EOTB 4WWKB 1JWMA 1AH1A 4KTDH 3G5ZB 4GRWH 4ZFFB 4P4KA 5JIKA 1BD2D 4MNQA 3CLFL 4P5KB 3KPSE 1OGTA 1RHHB 1XH3A 5C0AE 1OSZB 3WIHA 1HILB 4OGYL 2A0LC 3S3PA 1RZKL 4PJBF 2D7OA 1F00I 3KLSA 2OZ4A 3RHWF 4H5SB 1LK2B 1RUKH 1YJDL 3NCBB 1MAMH 3MV9A 3AMKA 3QUXB 3T1FA 4Q6IA 4G6FB 5K9KA 3RY5A 1YMHB 5D9SB 1INQA 2K7QA 3EZ8A 4PJ7E 1FL3A 2Y5EA 4LSQL 1U8IA 4XXDA 4HULB 4YBQD 3D9AH 3L3JA 5DQDL 3ULVF 3T2NL 1AR1C 4N8CL 3HI6L 3G6AB 4RFOL 4OFDA 3C6LD 2FR4A 1UXSA 1NLBH 3QIBA 4EDXA 1GAFL 2V2WA 5DJ2A 4QEGA 1V5JA 4HF5L 1RVFL 2YSSB 2BHUA 3EYSH 4HJGA 1DSFH 2J6EH 5SWSA 4ZUTB 2IPTL 2NY4D 4GMTH 4XPAH 1UT9A 3EOAB 1BGXH 1TPXB 3OAYH 4PGBB 4IOSD 4IRSD 2OK0L 4O2FA 4O51B 3IDYB 4F58L 4GAGH 1ZLUK 1PZ5A 4O00A 4JREB 4DJMA 4ZOCA 2ID5A 4HUKB 1CU4L 5AYUH 3SOBH 3ZDYF 1DUZB 1AY1H 1AJ7L 1BM3L 1QO3A 3E8UH 4KJWC 4Y4KD 3BVNB 1ZHLB 4NGHH 4FXLA 3I9GL 4M5YH 5MHSE 5ACZB 1YEHL 3MRDB 4MQXD 4NHUB 2X4SB 5E4EB 2VL4A 5GS0H 5EUOB 5E6IC 3BZ4A 2H32A 3RVTC 5HTSA 2P8PA 1DBAH 2VXSH 3BRGC 3BH9A 4TTDD 3EKCA 5HHOB 1MJJA 1R5IA 4OSUH 3WV0A 2EIDA 5DUBA 2YN3A 2X70A 3KJ4C 4KMLB 2AK4D 1NAMA 5E8PA 2KDGA 1T5XB 1Q94B 5L8JB 3TIDB 5T1MB 4PP1D 3PP4L 2DBLL 3N1GC 1ZT7A 1E27A 5E5MB 1VADA 2O5ZH 5IHUH 1I1AD 4F57H 4MAYD 2DQFA 2XG5A 3WHE1 3UTTA 4DOHE 5GGRY 4MD0A 1GGIL 2WV3A 1KB9J 4NN7C 2R29H 3O9WA 2I60H 4FQ2H 3FAWA 1ZT1B 3QXAB 1JF6A 3NCJH 3ZDZF 1Z5LA 3V7AE 5GS1A 3U30C 1AC6A 1KCUH 3QNZA 4EI5A 3QG7L 1XGTA 4MQSB 4Z7UA 3WIFA 2AJXL 5FDWA 5CJQL 4YR6A 3IDIA 1DBBL 1IEAB 1S3KH 1KCLA 5HHMD 1WUNT 3VRJB 2YD1A 4EOWH 3IFNL 5KTEL 3T2QA 3VXMB 1KJMA 1DN0B 4BQCA 5LBSH 4LLQA 3C8KB 5D70H 4EUPH 1LO5A 1ZHBA 3GHBL 1ZVSB 5GPRA 2VR5A 1E4XL 2NTFB 1K8DA 1W72A 4ZXBB 4WEUD 3SDCC 3QYCA 2A38A 3VRIB 4XB7A 3NPSC 1YC7A 4G8GB 3QWQB 1NBYA 5FGCE 3QXDB 1WTLA 3A67H 1GGTA 2FZ3B 3MBXH 4IS6B 4U6HB 3KPRE 5FGSA 3B5TA 3QDAA 2WP3O 4KI5C 4HUMB 3QEQE 4I5BA 4W4OC 1KCRH 4HUWB 5F89B 4Y0GA 3LHPL 3VFWA 2CKBA 4MMXC 1S9XA 5DRZB 5E8OB 4G80A 3K2UH 1G84A 1AGEA 2J12B 2Q7NA 2HRPL 2ATPB 3MRPA 3E0GA 2Q3AA 5EUKB 1JGVH 2A77H 3ARBA 4X0KB 4J3OC 1FGVL 1WZ1H 1IQWH 2FEEI 4YNYA 4YIQA 3QFJD 4GJTB 3GGWB 1T5WA 4G9DA 3I2CH 5KSAC 4E42A 5DHVA 4ESKA 4IEFB 1SMAA 5T3XE 2NQCA 3SDYL 3FCTA 5F9JA 2Z31C 3HA0A 3OBAA 4CADB 3IFLH 4YBLB 4NCC2 5KG9A 4MB3A 2C4FT 4LCIH 5KVFH 1R24A 3HUJA 3PQYA 3TLRA 4JAMA 3N85L 2R69L 3TT1L 2DQCL 2IBBA 1LP9B 3EFDL 4OLUH 3BISA 1L7TL 4Z95L 5B4MD 4S1QL 1KTLB 1A1NB 1GZQB 1WWCA 4P2RA 5GSVB 4R4BA 3G6JE 1F42A 2YPLD 2FX9H 2VXQL 1OQOA 2DYPA 1X7QA 2JCCB 4XNYL 2APVA 2E7LC 4G8EA 5KSBA 2C4FU 3GMOA 3QEHB 4JGJA 4MJID 1ES0A 1T7ZA 2E7CA 3SE9L 1VACB 2A1WH 1YEEL 4YX2H 2DJ4A 4L8DB 3KLHD 1B0RB 3TPKA 3N1PC 3ARZA 4KRPD 3CD4A 4OZ4B 4OIBA 3U7YH 5CINL 4MD4B 1Z3GH 4KVNL 5BW7A 2OR7A 1ZEAL 5DRXB 1ETZA 3PJSA 5IBLC 5FA3A 4LHQB 4PGZA 4OZIB 2AV1A 5I1AA 4PREB 4LK4A 1T0NA 5HD8D 4RFNB 1PAMA 1FNGA 2W9EH 3NVQA 5E5UB 1YNLH 1OAXH 3CX2A 3NABH 2NZIA 3GMLA 1MNUL 5D6CB 4HFUH 3ARWA 5E70A 2NY3B 4WWKC 2X89A 2WIIB 5IROA 5E7BA 3SGEI 4PRHD 4NQED 1BBDH 5TF1H 4FQXD 2VC2H 5TE7H 2W59A 3CDGA 3P4MA 5CKGA 4F2MB 5LAXB 1U3HA 5L6YH 5D8JL 5LXGH 3MUZ1 43C9A 1DTUA 1Q0YH 1YQVH 1L9NA 4POZD 3V6BR 1RJCA 1CXIA 5DRWB 4U3CA 2HG5A 1NL0L 5E2UH 1NSNH 3I3EA 1G9NC 1A6WL 4F7TB 2HJLA 2GI7A 3JUYA 4ONGL 4ZQKA 3TA3A 3QUXC 2BMKB 1KC5L 5D5MB 3TJEH 3O41A 5C0CD 1YMMA 2R0WH 2HFFB 3O3EA 4JZOB 2DKSA 2ADJB 3NIDE 4OZHB 1QFPA 3OKEA 4QRQB 3VFSB 1FRGL 2CO7B 3DURB 3O3DA 5J6GB 3HI1A 4I3RH 5FM4A 3S96B 4WI2A 3ARFB 5F8QC 5IW6A 4H88H 3HZKA 2ITDA 1B2WL 4EVNB 2OX5A 3FT4B 1KIPB 4LVNB 5J12B 4MVBC 3MRJA 5DJDB 4GKNA 5GIRB 3ZMRA 5GZOD 2QQKH 1TPXC 4QHMB 4RQQA 3WFDH 3IDYC 1RY7B 3CFDB 3WDHA 2BVOB 3OHXA 4YXKH 3MNZB 1T3FB 3HZMB 4H1LH 5BS0E 4JREC 4I3GA 3CSPA 4M6OL 3V5HB 4X8XA 1WIOA 2BVEA 3W2DH 2VDNH 4N0CD 1AD9B 4N9GA 3PGFL 5GGUB 2HVJB 3GI8L 3EHBC 2HJKA 2DWEB 4NM8L 4ZFOL 4HK0B 4AEHL 4M61B 1S7RA 3X17A 3F7YB 3NFSL 4KV5F 4F7MA 1GOHA 1UB6B 1ZA3A 4TTGA 3OJMB 4JO2L 3BZFB 2DQEL 3TH2T 3K80A 4N0UB 4WI8A 5DEGB 1KSRA 4KU1A 5E4EC 3UJIH 2J6EA 1AGCB 5DR5H 1GOFA 2BHZA 4Y19B 4JRXD 1WCQA 4PGCB 3QUZA 4YFLI 3DHJA 5C09A 1FL5B 3H7BA 2HLFC 4JG1L 4E41E 3HRPA 2QR0B 5DJAB 4X6CA 4YJZL 3E3QC 4ODUB 3V2AR 4ZD3H 3SGJC 4HFWA 3ULUH 3R06A 5CUSH 4K94H 4ETQB 1UJ3A 2YD6A 1U41A 2VAAB 4HBQA 4HH9B 3U9UA 3JZ7A 1PX4A 2Y07H 4M00A 5HYQB 2KL6A 4ZS6C 4TSCH 3MYJB 3NN8A 4KY1H 3L3DA 5ESAA 1AP2A 3BE1H 4XMLH 1UM6L 2JB5L 2JKXA 5KSUA 2QQLH 4AL8H 3FB8A 4MA1B 4M1GL 1NH6A 1H3GA 4MXQC 2MQ0A 2L7UA 4QRUA 5ENWA 4HKJA 4X5WA 4UBDD 2FX7L 5T3ZE 2MCPH 1N64L 4WGVB 2DQJL 3VXSE 4ISVA 5CJBA 2EYRA 4QHNA 4MLIA 1OGTB 5FM5M 1A64A 5C0JB 3BD5A 4FFZL 1XH3B 2FJFB 3ARDA 5L9DH 3BI9X 4MDJA 5EU4B 1HWHB 5CJOL 4KDTA 5ISZB 1MREL 2IH3B 2OLDA 5AD0B 4RDQF 5E9DB 5CGYC 1HDMA 4D0DB 3IDNB 3RAJH 3AS2A 3TNNB 5FHBL 3VXTA 4R7DA 1KENH 4ZXBC 1L7IL 4P23A 2K1MA 2VZSA 3O4LD 3MOBL 3GMQA 2J7LA 1Q1JH 4HC1H 4HW6A 1FL3B 3RGHA 2YK1H 1A6UL 2HFGL 2NY2D 1QFWL 5TJWK 3DV6A 3OB0H 4LKCB 4NQSA 4OCXL 5TDOA 1I85A 1QRKA 3BPCB 4JFPA 2AGJH 1UXSB 3X13A 5GRUL 4ALAH 4U2ZA 4PTUA 3LEXA 5DJ2B 1RJLA 1G0DA 3LKQB 3K8MA 4YFLF 3CDYA 5JW3H 5SWSB 5KS9E 5JZ7D 1PFCA 3C9NA 1P2CB 1YYLH 2OYPA 2EIEA 3EOBA 4JZNA 3EFFB 2EIZA 1A14L 2R0KH 5DEZA 4DGIH 4YEEA 1NMCB 5EOCL 4JY5H 2PKDA 4YDJA 1IKFH 2Q6WA 3TH3T 3IJYB 5EA0L 3L5HA 1RZIA 3CH1B 3H9SE 2QHLA 3JTSB 3B9VA 3MXWL 3PV6B 5C0EA 4HCRH 4PRPD 4PJAE 2OTWA 4TUKL 3NIGE 1KJ2B 4H0GA 3WNOA 1XGYL 2YZ1A 1QO3B 3QDJE 1E4XI 4WUKH 1MJ8L 4RZCA 1A02N 2VDLH 2I07A 3DNKA 3BKYH 1FFPA 4FZEL 3TIEB 2CR6A 4YBLC 2L7JA 3FN0H 5DLML 1AI1L 1TJHH 5C07E 4NRXA 3D3VE 2W65B 3NAAH 3IFPA 4WDIB 3S5LB 4TQEL 3BW9A 4PJEA 4EIZC 4UV4L 4YPGA 1JZ5A 2CDEB 2VZ1A 3QDMD 4JFHE 5H94A 1H5BB 4NQEE 2EH7H 3KYNB 4L3CA 1ONQB 5F21B 1S9VB 3VWKD 3WHXA 3RKDC 4XPTH 3H42H 4HQQL 4D9LH 5D1ZB 5JORA 3S9DB 1A9EA 3TYGL 1FVCA 4P9HH 4JVWA 4Y8AA 4PJHF 5D1QA 4LLWA 1EHLL 5J3HC 4JQIL 5D1XD 1P4IH 1SEBA 1ZT7B 1TTFA 4JM2A 4LSUH 4WTZA 5F1SA 3ESVF 5JW4Q 3VFOA 4U7SA 1DVFA 1QLRA 3UTTB 3QWOA 5FECA 3HMWH 5L2KE 5JMOC 5E1AB 1E6OH 4I77H 2YD7A 4HZAA 4RFNC 2P1YA 1DBKL 5L88L 5FYLL 2BSSA 5DD1L 3ARGD 2NY3C 4NN5C 4Y5VA 2FH8A 5GS1B 4L4TA 4Z7WE 4JG0L 3JV0A 3LD8B 2IQAA 4EI5B 1NCCL 4W4NA 4O5LL 4FA8A 3I6LE 5DDHA 5FDWB 2CLVB 2BNQE 2VKXA 4YR6B 2E9BA 2I9TB 3HPLA 2ADGB 4N0YL 3VGBA 4P3CL 4ELKA 2DWDB 1H8SA 1KJMB 2CLRB 4G5ZL 3V52H 1QVOB 2D0GA 2YKLL 3UPRA 2QSVA 4FP8L 4YK4B 4FFVC 3GBNH 1K8DB 4QTIH 4G6AD 5JPNA 4KK8C 1C08A 1YEDA 2AJVH 1RV6X 4O4YL 4NZDA 5DZNA 3AROA 4MJ6A 5IQ9B 1GGCH 5DMYA 4Y2DD 3V79C 3ZKMC 3ZTNH 1CFVH 4PB0H 5GQBA 3SQOH 4QOKA 5GRWA 2EE3A 2GCYA 1IL1A 3BT2L 4KJQC 1A6PA 3FN3A 4I5BB 4FQCL 1DBML 3ARFC 1EFXD 5C0IA 3VFWB 4NNYA 4OLYH 5D7IB 3DBXA 1VFMA 2YPVH 2GFBB 2ZJSL 3FO1A 3KPMA 4LVNC 15C8H 1IC5H 5J12C 1JZ3A 1TCRA 4ODHH 3HLAB 5DVKA 4V1DD 4M62H 1IAIL 3MRPB 4P46D 5I30L 1HSBB 3QDGA 1TZIA 2GTWA 4ZO7A 1F3JB 3J8F7 3EDJA 4AMKL 1NC4D 2FDBP 2VLRD 2J2ZA 4JRWA 4KJYA 5IIEB 2C7UA 3ARBB 1KB5B 3GSOB 4YNYB 4YIQB 1HSAB 4JO3H 3BKJH 1T89A 1RD6A 3MV7D 1DCLA 4AG4H 1TETH 3EYVB 3HTLX 4E42B 5IHZA 4Q6YA 1S7UB 3U4EB 1DN2A 3QH3B 1NUGA 4MNHA 2IMNA 4PJEF 3CIQA 4FXGB 5KG9B 3GRWL 1JPFA 4J4PA 4XCEA 3TBTA 3PQYB 4XBEL 1JI2A 4WTXA 3RWCA 3R0NA 4ZUVB 4NKIL 4J8RB 4PY7B 3PGDA 4X6BA 3P4NA 1D5XB 5IMKA 5EBLB 2P46B 3L3KB 2GSGB 3OR6B 2R0LL 4R4BB 1P7KA 3S88L 1M4KA 4Z0BL 1U58B 4ODXA 1W0VB 2F5BL 1FGNL 1I7RA 4G8EB 4KKBC 4H1LA 4RGND 2P24B 5LCVH 3VFMA 1ES0B 5I17B 5DD5H 1B0GB 2BERA 3QPQD 4D3CL 1RMFH 1DQML 1EBAA 2GSIB 1MY5A 3AM8A 1I1YB 4XBGA 4NQXA 4ZAKD 2IMMA 1GHFH 1BZ7A 1RUPL 2NY5L 2WINA 2XNAA 1H15A 2ZG3A 3PJSB 3MLSL 4W70A 5CWSA 3T8XA 1P4BH 4NOBA 3TBSA 1S5HA 4UDUA 5HHXL 1GZPA 4MWFA 1MI5B 3AU1A 1PBYA 3I85A 3MLVL 4MA1C 1MCSA 1T0NB 1KTDB 1F58L 3INUH 1FNGB 5IB5B 4ZMAT 1P69B 3VRLF 2IFGA 3TN0D 4WUUD 5I76A 2HMIC 1XT5A 4LKXA 2CRIA 4WEMB 5HDLA 1FORH 2JIXB 4F33B 1WCBA 2UVFA 1LK3H 1NQBA 3CDGB 4Y89A 4FFYH 4OLVH 2W9DL 4GT7A 3HC4L 1WICA 2VTFA 5DK3A 3Q6GH 1VPOH 1U3HB 5ANME 4ZTPH 2AEPL 5HGBA 1G1CA 3T65B 3GJFB 3RNQA 3MJGX 3AUVA 5DWUL 1BVKA 4NQCA 3LKRB 3JTTA 2A0LD 4R7NB 2OTUA 4XZUA 3F5WB 4OZFB 1ORQA 4G8IA 1F4XL 2VLLA 3IXAB 2HJLB 4WHYH 4G3YH 3TV3L 1MWAH 1U8MB 3FJTA 4GG6A 3UYRL 4GMSL 4RMWA 5MEND 3S37H 4G9FB 4HUUB 3UTSA 4N0FA 4XCNA 2WBJB 5A1AA 4GRWB 4X4ME 4EDWL 3BYYA 3KPSA 5IW6B 3LSOB 1JV5A 4WEBL 1AR1D 1D5ZA 2PTUA 4PFEA 3QZWG 4PP2B 5ADPH 5C0AA 2VZOA 3QXUA 3HC0A 4IRJA 1S7WA 3P4OA 5AG8A 1A6VL 2LU7A 4GKNB 1GC1L 3AREA 3K7UA 4HIHB 12E8H 3JWDC 1CI5A 1VFUA 1SYSA 2H45A 3E6FB 1NMCC 3GDBA 4KJPC 4UDTA 1FG2A 1NGXA 3VXRB 5C7XH 3T4AA 4XC3L 3GKWH 5F7DA 3VH8G 2CDFA 2D7NA 5T1KD 4HC1A 1I1RA 1ZA6A 4QYOA 4PJ7A 1IGFH 5BJTB 2EKSA 3WYRA 1NJ9A 4XTRC 5J6HA 5KAQG 3SGKC 2HJKB 4HUVB 2PF6A 1FBIH 4GW5B 1CDBA 1T66C 1VFOA 2XWJB 1GGBL 4XH2A 2G5BA 4HXBL 2J5LB 4XI5C 4F7MB 4S10A 4NRZA 4KJWD 3U7WH 2F8XC 3QSKB 3L3OB 3GK8L 3BD4A 1QFWI 1UM4H 4BA8A 4WU7A 5KN5B 2Y06H 1MFDH 5DS8B 1OLZA 3MLXH 5GGVY 4OCRL 1TXKA 3FO2B 5C09B 2BY2A 5BZDB 3CSGA 3H7BB 1H5BC 3QUYD 3CZFB 4Y16D 2DQUH 3SY0A 1G6RL 3LS4H 4N9OB 3KDMB 4LHUA 5D1ZC 4OV5B 1URLA 4LRNH 1UJ3B 4K3EH 1K6QH 3VFRB 3U9UB 1Q9WB 4J7RA 1RUML 1VESA 2EKJA 4P59H 4C56B 5LQBL 5F7KC 1HQRA 1V7NL 2Y72A 3QNXA 3RY6A 4YAQA 4PJXB 4L8BA 1CCZA 4YWGH 5E99L 4CL7A 3RI5F 3SKJL 3GSUA 2OL3B 4BM7A 3QQNA 4QRUB 5I73B 4HKJB 4JKLA 1VB9A 1G6VK 5T3ZH 4XB8A 1E28B 2EYRB 3LD8C 4CNIA 2HKHL 4EI5C 1OF2A 4KFZC 2BX5A 3FFCB 4MJ5A 3REWB 4NBXB 4MDJB 3MACH 4IJ3C 4V1DE 2V2XB 4LRIC 2OSLA 5KJRL 4IOIA 4PUBH 4HPOL 1BQHG 4OJFL 3D48R 4Z5RA 3WNPA 5A16B 1CGVA 4FHBD 4QRRD 3T04D 4HWBH 4YK4C 4PG2A 1PG7H 1I8IB 1MRFL 5IVXB 2I24N 5DURD 5D72L 5J9PA 3SGEH 3IJHB 1EUTA 1WBYA 1U8KB 5GGSA 5H2BB 3RUGB 5C0NC 1BOGB 2VWEC 4D9QE 1UKSA 3IAPA 5CIPH 1NGPL 1A5FH 25C8H 3MSPA 2VOTA 3MFFB 4J3UA 5M94B 2XQBH 4EN3A 1HXMB 4UQ2A 4U1HA 2H41A 4HHAA 1AKJB 1BX2B 1FZMA 4PYGA 3HPJB 1DBJL 5C08D 3S35H 3FFDB 3W39B 5C6WH 3T0DA 3QQ4A 3VXPA 5HGAB 1IGML 3SE3C 2HP4A 2D4FA 2A9ML 2JK5B 3OKDB 2H1PL 4L9LB 3U2SA 3EYUH 4X9IA 3GSNB 1GIGL 5I1HL 4EUPB 1FL6B 3FB6B 2PTTA 3DRTA 3BKMH 4GG8A 3QEGH 4L3ED 4Y4FB 5I1IL 2E7HA 1K4CB 2SEBA 3IVKA 3P40A 1KCVH 3FAXA 1R0AH 4JPVL 4J3SA 4NFDA 2CGRL 4A6YL 2AJYH 4V2CB 4PRBA 5A43C 1JFQH 1LMKA 2J3SA 5DQJB 4RMQA 3B9DA 4QT5A 5BQ7A 1UZ6E 4RZCB 3KPRA 3QEQA 1Q9OA 2BCKB 3U82B 5J1TC 4MXVF 2OS7A 2ZKHL 2ATKB 3LQAC 1GL4B 1UFUA 4JFOA 4NRXB 5I1JL 5D2NA 1RZKH 3IFPB 3MCLL 4RAUB 1EAPA 3ARUA 1G7PB 4G6JL 4QXGL 4OLXH 3ZE1E 5EC2B 5M7QA 5DK2B 5TFSH 4G8FA 5IJKA 4QXUH 1XIWA 4U31A 4NWTL 3GRWA 3RNKB 4NO3A 3WHXB 3H3PL 1XF1A 1MHEA 1RULL 1FFRA 1KLGA 4MS8C 1CDGA 1R3KB 3VG0L 2B0SL 5JDSA 1IAII 1QLFA 4RISL 5E1HB 2MCG1 4V2BA 3IETA 4LLWB 2X4RA 5E2TL 3FO9B 4NP4H 4PJFE 4RWYL 1EEZB 1N5YL 4S0TD 3T2NH 2XOTA 2ARWA 1OSPH 2E9WA 4JM2B 5DJ6B 2DOCA 1GAFH 2NYYC 2PN5A 4HF5H 3CJJA 1UC6A 5JW5A 5DYOA 2R56L 4LSSH 3PDGA 5IBLD 6FABL 2PO6A 2D0HA 3T77A 1NCBL 2AXGB 1QLEL 3CVHL 4R0LB 2NXYC 3TNMA 3G6JA 4TVPD 4I0PB 5ICXB 2E8YA 4LVEA 4RFEB 4FQLL 3HPLB 4QHLA 4J3WA 2YD8A 1IZJA 1BM3H 5E8NB 1CG9B 2BVTA 4HKXA 3B9KA 3SPVA 3UO1L 5DVMA 1G7IB 2EDKA 4CMMA 4XNMA 3O6KL 3GBML 5EU5B 2FHFA 2UZXB 3CNKA 1BFTA 4GUPB 1YEHH 4CN4A 1TNMA 1YNKH 3HAEA 1T1WB 4ODVH 5J7CC 4YHNB 2AJ3A 2QSTA 3MLRL 1N59B 1BIIA 2GQHA 4MJ6B 4JFDE 4YHOL 5C8JB 1CBVH 4QOKB 2WBJC 4G6FD 4HZLA 5FKPA 4LCCB 1IL1B 5ID1A 4FABL 1X5KA 3SDXB 3DV4B 3O8XD 2R9HD 2FWOA 1RIUL 4X6DF 5C0IB 1KACB 5J4MA 2FJGA 1X3DA 3MUJA 4QHKJ 1CICD 2X40A 4Y5XB 4OUOA 3GSQA 4YQXH 1MLBB 3M1BB 4UB0H 3AY4C 2GTWB 1F4WH 1QFHA 3F7VA 3ZE2F 2UWEE 4AT6A 4BSVA 1MCIA 2ZZUT 1MWAA 4OTXL 1HCVA 2N4IA 3P9LA 2UUDH 3TCLA 4C83A 1FH5L 2E9JA 1GOGA 5EWIH 2ZOKA 4KZDH 3D0VA 1QNZH 1JE6A 3D0LA 3BP4B 2YZ8A 1CQYA 5DD3L 4NPYA 2J5LC 3EHBD 5J56B 3NA9L 2J8HA 3PWNA 3OB0K 3EIFA 5IB2A 5CBAA 5CJQH 4PV8B 1NCDL 3GMMA 1OB1A 5IBUG 1OGAE 3UTPE 4N1CA 4MAUH 3X12A 4ODBD 2VZVA 3MLTA 1JGLL 1UM5L 1A3QA 4O2EB 2CK0H 1P7KB 3GHBH 4K9EL 3BQUD 1CQKA 4HS8H 2AVGA 2AK4A 3VMNA 5I75B 4O9HL 4PJ9B 2FHCA 2EEBA 5BS0A 2HLFD 5HHOD 2X9YA 4Z76A 3V6ZA 5E0QA 1K2DA 5DD0L 4FMFA 1HHJA 2QADB 1WQVT 3F58H 4XBGB 1S7XA 4IDJH 5HY9B 4D8PB 1RUAL 4MAYA 4ENEC 5HGHA 1BECA 5HYJB 3AAZA 7FABH 3TBSB 1I9JH 3Q6FA 1DUYB 4ZS6D 3N9GL 5GS0C 4U33A 1U8LA 3BPNB 2G2RA 3U36B 5K59F 4EQ2A 5EDXA 4HJJH 1L9MA 3PG2A 2HRPH 4MGXA 5I73C 4Y5YB 1J8HD 4CMHB 1JHKH 2CH8A 4MXQD 2LVEA 3B6SB 3F12A 1FGVH 4KI5E 4JFEB 4GSDL 5CLTA 3SKOB 2A74B 2RB8A 4U0RB 3TFKD 5GGTL 2C26A 2BDNH 1C1EL 2EDRA 4DKEL 2D3VA 2ORBH 1BVKB 3RFZC 1KJ3L 5FV1L 4LQFL 2PXYB 1OM3L 3JTTB 2UZIH 3LDBB 1FFNB 2VDPL 5FHAL 5TPWH 1FC1A 3VXMD 2C3HA 2O93L 4L4VE 1R3JA 5EU6B 5MERA 4BELD 3N85H 2DJSA 2R69H 3TT1H 3M8OL 3DTXA 3LN5B 3OKNB 1J5OL 2EXYC 4KKCC 4YHIA 3VE0A 4G8GD 4OFIA 5DVOA 4Z18A 3MBEA 4YPJA 2CKNA 5KANI 3B2VH 2PUQT 2IQ9H 4U3HA 1FV1A 4IRJB 3S7GA 1OWWA 1IGCL 1PSKL 3RZCD 3IAGC 4L9LC 3O0RL 5FM5O 2P8MA 1AQKL 5F9OL 2JELH 3RVVC 5HYSA 1P7QD 5FYKD 3BEVA 4UDTB 4K3DL 3KYOA 1NGXB 4Q7DA 4HH8A 3T4AB 4Y4FC 4WENB 5EBGA 4TUOA 4AQOA 3EO9L 4ZSOE 1G9MC 3BDYL 1IEHA 4M6NL 3VFVB 4QYOB 4G42A 4X4ZA 3RA7L 3RU8L 4QTHB 2A9NH 5I1CL 5JUEH 2DQTL 2J88H 2NW3A 3GUTB 1AIFA 2DB8A 5JOFB 1JNHA 4HX1A 5ADOH 4I0KA 3IDGA 4APQD 4UAOB 3FRUA 1K3IA 3PABB 2NR6C 4WWID 4A6YA 5CEYA 2NCMA 5KS9A 4L8CA 1N26A 5AWNH 5D8JH 2QHRH 1IEBB 1ZVYA 4JZJA 4PRIB 1BBJB 4WI9A 1NL0H 4WGWB 1QQDA 4OD1H 3TJHC 1A6WH 3QCVH 4MJIA 4PJ5E 2HT3D 5FB8B 2PYED 1M7IA 4QRPE 3H9SA 5DJCA 4YHZL 4GRLA 5JNYB 2XI9A 4RNRB 4OUUB 4N5ED 4PJAA 3KHOA 1M6OA 5DJ0B 3QDJA 1UCTA 1P1ZB 1HQRB 3MC0A 2FX8L 1J0YA 1A3RH 1MFBL 1TQCB 5J3HD 3SGDI 1HI6B 4KAQH 1U93A 2AABL 4YAQB 1QSEE 4PJBB 3DGGB 2G60H 3QWRD 4JKWA 4OIIL 4QNPE 5C07A 3FB5B 1A7RL 4XP4H 3D3VA 4UIMA 4XPFL 1CVRA 3BN3B 2HH0L 3VD3A 1BFSA 1BVZA 1K5NA 5IVOA 4M6ML 1U6AH 4MDIA 3ECBA 2FO1A 4R0LC 4NQEA 4FQXA 4BQ9A 2WNGA 3ALXA 5IV2A 4I0PC 1H8OA 1OAZL 4NQVA 3SBWC 1SBSL 2NY3D 4WV1C 2PYFA 3WN5B 3TZVA 3OAUL 3PGFH 3BHBA 3GI8H 1WZKA 1BVLA 4LU5L 5GJTH 5IFAH 3SJVB 4AEHH 4JFYA 1A7OH 4KUZL 2OJEA 5B3JF 2BSRA 4ELMB 2P44B 1Y6NR 3QJFA 4LIQE 2EXWC 1EXUA 5L2KA 2IFFH 5GGSB 4LASH 3VD9A 1YUHA 2R23B 1EGJL 3RPKA 5HHNA 2HN7B 4NQDB 4KK8D 2ED8A 4EN3B 5C6TL 2BY1A 4LCCC 1L6ZA 4UQ2B 4JG1H 4Z7WA 5CD3B 1AHWC 1RZFH 5JXED 4JEGB 1S7TA 5ESQB 2BNQA 4KJQD 4Y5XC 4MSWA 2XTJB 1HCFX 2YD5A 3U2SB 5EUOE 1EO7A 3DPBA 3MRNB 1T2QL 2D7TH 4WHCA 4NWUL 3DRTB 4MZ3A 1I4FB 3R1GH 1UM6H 3IVKB 1I1FA 1I3VA 4GKSA 3DSFL 1JYWA 2VMFA 1KEGH 2X1PA 3E3QE 2YD3A 4KMTL 4M1GH 3FTGA 2NNAA 2OXHA 3VXUD 2HWZH 4RMVA 5CSZB 4UUJB 3TBYA 5DC4B 1RJYA 4QT5B 5BQ7B 3H3KA 5AZEL 3OKMA 5HGDA 3MV11 3RL2B 3QEQB 1N64H 5AUMA 2EDHA 1XZ0A 5GRJH 1RFDL 3WNLA 1SJHA 3L7EA 2DD8H 3C5SB 5H37G 3LEYH 1QEWA 1LWRA 1WTGT 4JDVA 5KSVB 1MREH 4Z7NF 1AD0A 2KUTA 1A3LH 4JO1L 1C7SA 3MLWH 1FVDA 2XN9E 3WSQH 3PWJB 4B53A 3L6FA 1LEIA 4Y19D 2N7AA 4F7PA 5CLWA 4PJ9C 1KLGB 1FQ9C 1QRND 2WWKT 3OXSB 5JDSB 1E6JH 3FMGL 1WT5C 3L5XL 2OP4H 3L5JA 3IETB 4TNWF 1XMWA 2HFGH 4I18B 3SKUD 4BZ2L 2DQIH 2QADC 3OX8A 4OCXH 1J12A 5F7LB 3ROLB 5BO1H 1VERA 5GRUH 4I8DA 1BLNB 5FEBA 5IW1A 1EJOL 2VLME 4PLJC 5JW5B 2ZCKL 1DZBA 5DYOB 4Y4HD 5CEZD 5JA8B 3MREA 5HVHB 2EDDA 4EJ1C 4K8RC 3QHZL 5EPMB 1T2JA 4Q9RL 4Y5YC 3TNMB 4CMHC 1A14H 3KPNB 5EOCH 2VH5H 4XC1H 5E08H 5EZOL 4HK3J 5EA0H 2EECA 4ZUUB 4AENA 4XAKD 3NZHL 3ULUC 4CJ1A 4Z9KB 1IKNC 3F7RA 4K94C 4Z0XA 1PKQB 4M7JL 3MXWH 3MJ9L 2XFXB 4M43H 1UCBH 1U92B 4U0RC 4S11A 1BQUA 4AEEA 1KOAA 4KHTH 4XP5L 2IAMA 1XGYH 1MJ8H 2PXYC 2VZ3A 1MCKA 5CZKA 1LEKA 1T0MB 3LDBC 2VL5B 4FZEH 1FCCA 3EUUA 5BV7H 2VXVH 1XGRB 5HI5D 1EMTL 1XR9A 1PYWA 5DUPL 1A6ZA 1FZKB 3VFUA 1BIIB 1PJ9A 4WCYH 3NH7L 3RVWC 4HT1L 1S78D 3CPLA 3MV9D 3FB7B 4ZNCD 1NFDE 1OAUH 3SE4C 4MNGB 3I3BA 2F74A 3DYMA 4GAJH 4YDKL 2DTML 5B38G 4BZYA 3H9ZA 1H0DA 2QKIA 2FJGB 1XF4A 4GW4B 4HQQH 1F6FB 1JWUB 1Q72L 3TYGH 1NMAL 2I25N 5J0BA 1F6LL 3GSQB 4IIQC 5ANMA 1NGWB 4IRJC 4OGAD 1EHLH 1MCDA 4JQIH 3KYMA 1LP9E 1QR1A 1S5IH 1Y0LB 2EICA 1CD1A 5SWSD 3GEWB 4BSVB 4D0BA 3PWPB 1ADQH 4LEOA 4MX7B 3T0EB 3VFTB 3TCLB 2IBGA 4PRPA 3QQ3B 2PR4H 2HT2D 2A73A 2JLLA 2JJTC 2OQJA 3D0VB 3D0LB 2AI0L 2WBKA 3BWAB 3NMEA 4X4MA 3A6BH 1H9VA 2YEZA 4HSQA 4NPYB 2MKLC 3DVFA 4U1SA 3O2DH 1NCCH 4PGEB 2D9QB 4U6XA 3VD4A 4F9LC 2X1QA 3GMMB 3IJSB 3BH8A 4N0YH 3SDAB 4OZIE 4P3CH 3MODH 4OLWL 5INDA 3EYQD 4X99B 2I26N 4J1UA 1CK0L 4ZTOH 1R5WA 5GHWL 4ZUWB 3VWKA 4G6ML 2YBRB 4FP8H 2FYYA 2X4PB 2MSPA 3ZKSD 5C3TA 5DJXA 5BVPH 1UKQA 2EZ0D 5FUOH 5DMKB 32C2A 1K2DB 2D2OA 5FO9A 5I6XB 3W9DB 1S7VB 3VFNA 5EO0A 5DTFB 1N4XL 1S7XB 2LVCA 4PG9B 2XWBB 4R26L 3BT2H 3GSXA 2IANE 2UYLB 3MA9L 1DBMH 4FQCH 1YEJH 4HIXL 3Q6FB 1Q9KB 2IPKA 4ZFGL 5IOPA 2JJSA 1U8QB 4JFQA 3OKOB 1G7HA 1K4DA 3HI5L 3OPZL 1H3VA 3RX5A 1PLGH 3UTTD 3ARGA 5I30H 3KR3H 4TNWK 1BQSA 4JFXA 1XF3A 1UVQB 4AMKH 1NEZG 3O9WD 4OZHE 3GMPB 4D0CB 4E41B 3CH8A 5ICZA 3G5VA 4HWZB 1C8PA 1PKOA 4LSRL 3WS6C 1MCPL 2J8OA 1FO0H 1KYOJ 2BSTA 1J05A 3WN5C 4P9HC 3WFBL 4P5TA 2E6PA 3HE6B 3WJJC 1HH6B 4EI5D 2NX5E 2GY5A 5E94B 4KRLB 1RIHL 2DICA 3KXFB 5BCAA 4LPTA 2V5SA 1WWAX 5A3IC 3EZJB 4PV9A 2DRUA 2MNUA 4GRMB 4NJ9L 1ITBB 3KWWA 4RRPG 1QBLL 4NHCH 4FFWC 4Y2DA 4ORGB 1R3HA 2OBGA 4P9MH 1SEQL 1JN6A 3KPPB 3HMXH 3PUCA 3STLB 5C0ND 3OMZA 3VE0B 2R0LH 3S88H 4JJ5A 1MCOL 4Z0BH 1EFXA 3WIIL 2ESVB 1KT2B 3VXSB 3WNNA 1U9KA 2AV7B 5KVEL 1KN4L 4DGYL 1I8MA 4F9PC 3UDWA 1E0OB 3X11A 3U0PB 5EO9B 1IT9H 2XTJC 2Z8WC 2Q86A 4V1DA 1A6TA 3UJTL 4S1SH 2E5EA 2RFXB 2X9WA 5EU3B 3CXDL 3TO4A 5HHQB 5C0BE 5C0GB 3IXTB 3HNTL 3UCRA 3PNWA 2AQ1A 3LZFL 5JQ6L 1JF5A 3RIAF 3MLSH 3VDAA 4HDIB 4H26B 4F7CA 5HHXH 2WWMC 1ED3B 2EH8H 4K55A 2OM5A 4BUHA 5DFVC 5L2JA 3ARPA 1U42A 4G42B 5C71A 3ARBD 5CIPB 3BIKA 4GFTB 2NW3B 1G0YR 1M05B 4F7EB 3QO0A 1A6AA 1MCFA 1U95B 3JWOC 4YGAB 2W9DH 3HC4H 4NZTL 1EJ6A 2VYRE 4JLRB 4R97B 2DI8A 3QJHA 4PJCF 3MV8E 2AEPH 3MRHB 3E6HA 3CCHB 2LABA 4HGKC 3RIFF 4CDHA 5DWUH 5JR1L 3PQYD 3ROOA 3V6FA 1PX3A 4Z77B 1KXVC 4TRPL 1EH9A 3VFGH 35C8L 1AFVL 4EBQH 3S4SA 2VQUA 3L9RA 4CVZB 4P2RD 4AEFA 4GRLB 1F4YL 4JPIA 5J1AA 2DYPD 2J8UF 4I18C 3HZVA 5DMIL 2H8PB 3HE7A 5ISZE 1HINH 1D5IH 5DI8A 2DIAA 1A2YA 1MHCA 4TVPL 1F4AA 3MYZA 4WNQA 4C59B 4Y2OA 3MRCA 1I7UA 5E6ZA 5E9DE 3A0OA 2AKRB 1CLZH 4WEBH 1X44A 1ZXQA 5EORH 1AR2A 3D3VB 1G7JA 2XY1A 5HVHC 1OARL 1RZ8B 1A6VH 3H0TA 1MI5D 3KPOB 2OR9H 4X7CC 4O02L 3P73A 3QPXL 3HS0A 4DQOL 1FG9C 1R3LA 5LG1A 1IQDB 3WS3A 5IV2B 2YUXA 4PR5B 1AQDA 4QRTB 4LFHD 1C16B 3MV01 3WEXA 4AIZB 3KYKH 4U1JA 3QQ9C 4XMPL 1CT8B 4PJFA 4BH8B 1BVLB 1T04A 2IG2L 1T21A 1BMGA 5IJVB 5LGHL 1I3RA 3MNVA 4JFYB 1U3HD 4NNPL 3NCMA 2OJEB 2BSRB 2HTKC 2BK8A 3EYFA 4URTB 2B4CL 2O5XH 3UC0H 1P5VA 5MENA 5L2KB 4WY7L 1YQ2A 1ZGLM 5I1GH 3MA7A 4TYUA 5HHNB 2WM0A 1YEFL 3Q5YA 3QNYB 4MXWH 3TA3D 3QEUB 4OT1L 3BN9D 4FZ8L 1YMMD 4FRWA 3UBXG 4Z7WB 2VITB 2XA8H 3LV3A 3B5GA 2FBOJ 3U0TB 2GJ6B 3VGGA 1S7TB 4LL9A 4XHQA 4NZUL 4QHUA 2EYTB 5E03A 2YXMA 2C1PA 5EO1A 3ZHLA 1RUMH 1HKLH 1BZ9B 5B39A 2A6JA 2ZUYA 4NZRL 3WL9A 1T83C 5SX4I 3B83A 1A0QL 2GAZA 2Y5TB 5SX5H 1RPQA 1I1FB 2BC4A 3T0EC 4M4PA 1MCHA 4MQ7A 3FTGB 3BD3A 5I1EL 2GK0B 4JFDA 4ZDHA 1IGJB 5IVNA 2NXZD 3FHQA 3LKSB 3UYPA 2DQDL 4JKPH 3MO1B 3EO0B 3FQRA 1RZGA 3ZL4L 1GXEA 3G5YA 3FKUS 4PJHB 4FQ1L 1R5VA 1CLYL 3WKNA 4BYHA 5J06A 4R2GB 1Y18B 1QEWB 2RR3A 3WXWH 4XWOC 3OJ2C 2H2PC 4LLUB 3SDAC 5KJRH 4DZBB 1L4IA 5CHNA 4HPOH 3LMJL 1AD0B 4LMQE 1D6EB 5E6IA 4NC1C 5IGXL 4QRSA 4X6FA 2UWEA 1V3MA 1LEIB 1ADQA 2V2TA 4XRCB 4F7PB 1MRFH 3QUZD 5C09D 2EC9T 1NGYB 4GKOA 4AM0B 1EEYA 2DQGH 4L3AA 1T1ZA 3V4PH 4LNRB 1A7NL 4K2UL 3T3MF 1HZHL 3W82A 5EZJA 5I6XC 3OX8B 4M6AA 1P4LA 3DGCR 1S9YB 5D71L 3LQMA 4NNXA 1CGSH 2J4WL 4N8VG 2K7PA 4CUCA 3QB7C 3O2DA 1H3PL 1DBJH 5CJ5A 5GJSL 4ODSH 2GYSA 2EC9U 1A7QH 3L1OH 2JF1A 2ZUUA 4GAYA 2IH1B 4ENED 1IGMH 4WFED 3BFOA 2DKMA 5F88A 2F53B 1V3JA 1OGAA 2H1PH 3VJ6A 4MD5B 2ZCLL 1RK1B 3GM0A 2G75A 4Z7QF 4WTWA 2VWEE 1CWVA 4CN6A 5I71B 5FF6A 5GS0D 2Y23A 1GIGH 1XCQA 3K8LA 4JFFB 1MELA 3WLWD 1UYWH 4OCSH 3HRZB 5I1IH 3P0VH 2AK1L 4NO5A 1YEKH 1G7LB 4JPVH 3SGDH 3STZB 1BEYL 1MQ8A 2CGRH 1MVUB 4JHAH 1HKFA 4RAHA 4NJAL 3HE6C 3Q5TA 4HKZB 3PXJA 2VXTL 3MJ7A 3ZDXE 2NY7H 3ARQA 3KJ6H 3DUSA 3ARDD 3OJDB 3FFCD 3G08A 3ALPA 4OBRA 1KJVB 3WBDA 4WJ5B 3BP5A 1ERNA 5I8KH 2IADB 3SDCA 1PYWB 3O2WH 4HEME 2FIKB 1ZLVH 4YFDB 4S1DC 3NFNB 4P2QB 2VSDA 2XWTA 4P23D 4G6JH 5FYKL 5E8EA 5BVJA 4M1DL 2Z93B 5IG7A 1I9RL 5FGBC 4LBEB 4X4YB 4R90L 4K71B 5I8CA 4I13B 4JN2B 5H35A 1RULH 1H0DB 2QKIB 3ZT7A 4W4OA 3VG0H 5D2LA 2B0SH 4UT9L 1QBML 1AKJD 2VIRA 1WEJH 4KGLA 5ANMB 3UYOD 4KHXH 2XZAL 3MGTB 4KROD 2LAGB 3A6CL 5E2TH 5HDQL 4DGVH 4LLMB 1X5FA 4R9HA 2ITCB 4Q9QH 4XMKL 4OI7A 3T4YA 4L3EA 1A7BA 3GO1L 3MRMA 4D0BB 3RJQB 5I2IA 3L7FB 3OWEA 3UMTA 3V6OC 4ZUSA 1MCNA 5CZVL 4OLZL 3QA3A 1KNOA 1J1XH 2R56H 3OQ3B 4HLZG 2A73B 5HXMA 4Y4FD 4X5XA 3O6LH 4WW1A 4PRNB 4P3WA 3HMXA 5F3BA 4OD3H 5KSAA 1IAKA 1J87A 4ONHB 1JF1A 3W11C 2Z31A 1NBZB 4U1SB 4OGZA 4U6XB 5GSRB 1TVHB 1PD6A 2CMRH 3VI4E 1KG0B 1LGVA 3EJZC 4FQLH 4R97C 2JJVA 4UOJA 3VXOA 3CFEB 5BZWA 3RRQA 4OLEA 2JB6A 4TUJB 4A2MA 4J1UB 4D9RE 1JNLL 1K8IB 1R5WB 2NR6D 4XVSL 3UO1H 1MFEL 4YGVA 4YHLH 3PIQB 4GQ9L 5IHBA 3GBMH 4CVUA 1U8NA 1KPVA 1S7QA 3CZJA 3GIVB 5TGBB 3WUWA 1CE1H 5DJXB 1V7ML 4UI2A 5JOPD 3MLRH 4ZSOA 3TJHD 2E7LA 1JWSA 5EN2B 1DQJA 5HHPA 3P0YH 1NC2B 4YHOH 4MCYB 4HUXA 5EO0B 1G7MB 5CILH 1IARB 2VABB 3LS5L 3DX7A 2HVKB 2ZG2A 5D1QD 5I0ZA 4H8WL 4CU7A 3FQUA 1EFQA 1NCUA 4LF3B 4EEEA 4JM2D 4JFQB 3PWLA 2X09A 1RZKC 2GJJA 4IMLA 1JPGA 1G7HB 1K4DB 3G6DL 3MRBA 3V4UL 3IT8D 1DVFD 2ZCHH 4HGWB 1CDCA 4IHOA 4G9FE 5DZOA 1XF3B 1R3IL 5KW9L 3IF1B 1YJDC 1CIDA 2HLAA 4QF1A 5EOTA 4PJ5A 4WWKA 1X9QA 3WCYA 3G9VA 4OTXH 1LO2H 4QRPA 5EBWB 4BK5A 1IFHL 3IFOB 1MFAL 1FH5H 3LH2H 4L4TD 4P5KA 1YEIL 3M45A 1CLCA 1RHHA 3OB8A 4I0PD 3T3PE 4BFGA 4WRLA 3QG6B 1LDPH 1UACL 2BY0A 3BP6B 4QY8B 2E9IA 5DD3H 3O45B 1RZ7L 2OCFD 3NA9H 1QSEA 1MH5A 4H5SA 4XNUL 5J11B 1EEUA 4GBXC 3VXRE 4PS4H 5F7YC 3QUXA 1ZAGA 1JN6B 1OCWL 3UBXI 2EXWD 5D2LF 5D9SA 4TSBH 5C9JA 1NDGB 1KGCD 4K9EH 4G7YH 2W91A 3FQWB 4RBPH 4O9HH 4QOKD 5FO7B 3RVUC 3S36L 1YECL 4Z8FL 3DETC 4JPKL 3L3GA 5FYJE 5L8KB 2YSSA 1A6TB 2X4NA 1QOKA 4ZFOB 5T5FL 2WMPA 2BNUB 5JO5B 3AGVA 3PNWB 3G5XB 4XP9L 3EOAA 4OM0L 4UNVA 1BF2A 5C70A 4O51A 3LRSB 3QDGD 3S37X 2VDML 2H6PB 3IU4L 4GO6B 1QR4A 4AH2A 4BFEA 2F5AL 1NBQA 1KEML 3FN9A 5JHLL 4KQ3L 5MEOB 3QUML 1DUZA 2E27H 4FTVB 5SWZB 4TNVK 4X98B 1PDKA 4C56E 1U36A 4LSVL 4EI6A 1A6AB 3BVNA 1S9WB 4WIQA 1P5UA 3RBSA 4HG4K 1ZHLA 5ACZA 2RIKA 1WC7B 4NO2A 3MRDA 1HNGA 4R2GC 4PJXE 4NHUA 1UXWB 5GGTH 1D9KB 2DQHH 2X4SA 1C1EH 3E6HB 4J4PD 2FL5B 2FSEA 1J11A 5EUOA 1IMHC 1KJ3H 1C7TA 1IE5A 4LQFH 1OM3H 4LOUC 1BREA 1MHHB 1C5CL 2VE6B 3D6GA 1MCQA 5CEZL 5EB9A 3QULA 4GQPH 3AC0A 3SGJA 1CF8L 1JK8B 4PJ9D 4NO0B 2DJUA 3FFCE 1T5XA 3HE7B 1Q94A 3BWUC 1WAAF 2XKNB 4RIRB 4UT6H 1A2YB 5T1MA 3ISWA 5JXAL 5E5MA 1INEL 1FNEB 3MXVH 1N6QL 3VGAB 5DHYA 5IWLC 3K1KC 5IVXE 1G7JB 1QKZL 1HYSC 4H0HB 1PSKH 1P53A 2Q76A 3WIHL 4XPHH 2P4AB 3RUGE 4R8WH 3BRDA 2YD9A 5I71C 1AQKH 1A4JB 4LSPL 2FB4H 5ECJE 1ZT1A 4JRYE 2OZ4L 3QXAA 1GPOH 1LO0L 2WLZA 3TBVB 3WS3B 4PB9L 4TSAL 3ZTJH 3BIAX 4U1LB 4B7LA 1F13A 3EO9H 1V3KA 2EDJA 4PJDF 4M6NH 2D03L 4HJ0D 3RA7H 1XFPA 2ICEB 4JFED 1IEAA 4PJFB 3ULUD 2DKUA 5IQ7H 4OZGF 3KS0H 5IHLB 4DKFH 1JRHH 3VXMA 3MJ6A 4JFZL 1C5DA 1DN0A 1OTSD 1KFAL 5E2JA 3CVIH 3EYFB 4ERSL 3C8KA 2FECL 4KKLD 3MRQB 3UZQA 3RWGB 2VR9A 1SBBA 2NTFA 4ZXBA 1FYTE 3VD7A 2WW8A 3VDCA 5EU6D 4G8GA 5IP4A 4U6YB 1JL8A 4DN3L 2OJZL 1FZOB 2VDKL 1J1OL 5IESH 3V5KB 5IVZA 5TH2B 4UINL 2FZ3A 4IS6A 4U6HA 4K71C 3QRGL 4WO4A 4XVTH 5TQ0L 1JZ8A 1ITCA 4HUWA 4JN1L 5F89A 1KTRL 1T0PB 3SE8L 1SMOA 2GW5A 2Y7QB 4H20L 1RU9H 5EBMB 2PETA 5DRZA 2BZDA 2ZSVA 4FN0A 1J0KA 5C0AD 4U6VL 5B39B 4UU9B 1FFOB 2MQ3A 2KBGA 2R0ZL 3SCMC 2X41A 4IRJD 4G6KL 2AABH 5BV7B 5EUKA 5JOPE 4BSWB 4OIIH 3S34L 1GSMA 4BQBA 1CVSC 4X0KA 1A7RH 4JQVC 4PPTA 5GRXG 2CD0A 3GGWA 4M6MH 4I4WA 1NFDA 2PW2A 3UAJD 1K85A 2R2EA 3T09A 5AYQA 5FUZL 3DXAB 5DA0B 3FQRB 2DM4A 2COQA 4N90D 2HT4D 3C60B 1R5VB 1SBSH 4CADA 2CIKB 4UNUA 1S7SA 2XZCH 3LAFA 3C5ZB 1Z6JT 5JIHA 3MUGB 1IC4L 3O4OB 3GSWB 3PHQB 3RGVB 2Q7YB 5CCKH 2PW1B 2DDQL 3OAUH 5T33L 1NAML 3MOAL 4M93B 4ZODA 3CFKB 1LP9A 4LU5H 4Q0XL 2AW2A 3MQIA 4QRSB 4X6FB 4LHJB 2AJSH 4JO4H 1KTLA 1A1NA 4PJGF 2FBJL 1GZQA 1K9TA 2BVYA 5GSVA 1N0LA 2VRAA 2JCCA 1MEXL 4TOYL 3KJ4B 2BRRL 3Q3GB 3QEHA 3QHFL 1AXSB 3V8OA 4XVUC 5I8OL 1VACA 2V9TA 4LHUD 5F8RC 2DM2A 4L8DA 5C6TH 1LDSA 4IDLA 5AZ2H 2CRMA 5HVWA 4KK5D 4DKDC 1KELH 4JANB 4OZ4A 4MD4A 1JGUH 4GAYB 1AE6L 5DRXA 5MHSD 1DEEA 1ZLWH 4OZIA 1VA9A 1OGAB 3THML 3T08A 3B9EA 1FNLA 4X5LA 2O61B 3LIZL