1A22B

Human growth hormone bound to single receptor
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
205
structure length
192
Chain Sequence
b'PKFTKCRSPERETFSCHWTLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPPIALNWTLLNGIHADIQVRWEAPRNADIQKGWMVLEYELQYKEVNETKWKMMDPILTTSVPVYSLKVDKEYEVRVRSKQRNSGNYGEFSEVLYVTLPQMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH HORMONE
molecule tags Complex (hormone/receptor)
source organism Homo sapiens
publication title Structural and functional analysis of the 1:1 growth hormone:receptor complex reveals the molecular basis for receptor affinity.
pubmed doi rcsb
total genus 31
structure length 192
sequence length 205
ec nomenclature
pdb deposition date 1998-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
B PF09067 EpoR_lig-bind Erythropoietin receptor, ligand binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a22B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a22B01
2CRZA 1RZ8B 1N6QH 2EH7L 3SE4C 1CK0L 2OJZH 4MQTB 4Z7WA 3MO1B 4O02H 4KVNH 1IAKA 4X6CB 4IRJD 2CIIB 5F72S 3WIIL 2V7HB 4YGVB 3KDMA 2IBZY 4X7CC 4OCXL 2C9AA 4L3EA 1VEMA 3QWRD 3JWDC 1CT8A 8FABA 4ZAKC 4PJDE 3NN8A 4TUKH 3NA9L 4U1IA 4QHNB 3FN9A 4FN0A 5HSFA 3T4YB 1SBSH 2X6MA 9CGTA 3V95A 3WLBA 3LKOB 5EUOF 5D5MB 2WIIB 1MCQA 1NAMH 3JV5A 3DI3B 5ENWA 2E9JA 5DJ8B 3RVTD 1CL7I 2ICWI 1NMBH 4MCZA 3CZFA 3LN5A 3BUYA 1J8HB 1DQLL 3NGBB 5CJQL 5KVMC 3HNTH 5A2IH 4GG8A 2DM4A 5MEQA 2AJXL 4PJAE 1ORSA 4OCRH 2VXVH 3VFUB 1KCVL 4QTHA 1NGXB 2XKNA 2O61B 3EAKA 3GBLA 4QRRD 2G5RA 4F57H 1P4BH 5HI5D 4S1QL 5HVHC 2ITCA 2E9BA 5JA9A 3LV3B 1PEWA 5INCA 1CICB 3EJYD 3Q6FA 4FQLH 4JGJA 1WVZA 2BNRE 3U4BH 3HNTL 2X9WA 2X05A 4OGYL 3U30C 3TYGH 2CKBA 4X5WB 2NXYC 1KTKE 2FX9L 4NPYB 3AS1A 1I1YA 2BCKA 3BGAA 5HGGS 5HD8C 1L9MA 4LL9A 3O6FC 5C9KA 1TJGL 3H7LA 3ET9F 4S1QH 2B2XH 2EYRA 3Q5TA 5F70A 2NXZC 4C57C 5JDSA 3HE7C 5HDLA 2DS4A 4FMKA 2XWBB 1JHLH 3MJ9L 3BWUC 3EDKA 5T33H 3TYGL 4DN4L 4D0CA 5F7LB 1AD9A 1K9TA 5EPMA 2HG5A 2NY6D 1A6UL 1QLRA 4OSUH 3OG6B 3QHFL 4UAOB 1N4XH 2EDFA 4UBDC 1DEEB 4AIZA 2EDJA 4KK5D 1JV5A 1YMMB 2FHBA 6FABH 4WTWA 1C16A 3ESUF 4FP8H 4F7EB 1C5BH 2MKLC 3G08A 3RAJL 2A6IB 4HIJB 5FK9B 2BFVL 1LWRA 5MI0B 3I75A 1MFCH 5TF1H 1KCRH 1C8PA 3B9KD 1ZXQA 4OCLC 3VFTB 4AQOA 4KKCC 4QRTA 5BOZG 3ARSA 4HEPG 1L7TL 3ZKMC 1JRHI 4L8SA 1TQBC 1K2DB 4IMKA 4EN3B 1BQSA 4LSRL 4EJ1C 1BP3B 1WC7B 2ZUSA 5IEKB 2EDRA 1I3RB 3GGWA 3BJLA 3RA7L 1OPGL 5F7DA 1FQ9C 4J1UB 5CP3A 5DUMH 2Y9RT 3FB6A 4NZUL 5DFVC 3HE6A 4JQVA 5A2JH 1H9VA 2FIKB 2Z91A 1IGJB 3OKKB 4FABL 2X1XR 3W0WE 1A1OB 2WANA 2YD4A 4MNQD 4ZUTA 4HAGA 5EOTA 4MWFA 1RHHB 2H1PL 4ODSL 1A6WH 4XP5H 5HGBA 3QUYB 5JW5B 4JKMA 3VW3L 3VCLA 4BH8A 3MREA 1RUKH 2Q76A 1H0DB 5KVFL 4G8IB 1RZJC 2P5WB 3VH8B 1MWAH 3MOBL 1UB5A 1AIFA 5I8EB 2X9YA 3WNMA 5EU7E 1YN6A 5GS0C 4OI9A 5DA4A 4AEHH 5GRVK 3VXSB 3WNNA 2AXGB 4EIZC 5C09B 3IAGC 1B0WA 3VD4A 1C1EL 3AY4A 3K2MC 1R5VA 3DX8B 3UPAA 2XN9E 3NN8B 3U4BL 3LH2H 3OXRB 4TPRL 1AO7B 3DX7A 4PB9L 4MD4A 1F2QA 3S4SB 4BH7A 4O58L 3RY5A 4PGCA 4AEIH 3NACH 5FYKL 4NQTA 3CPLB 2CSPA 3X14A 2DM3A 3FONB 3QPXL 5E00B 5IQ7L 1G1YA 5F89B 4Y1AB 3QEGH 4KQ3L 4CU6A 4OIBA 4GG6B 1DUZA 3BDXA 5MERA 1AE6H 2RAMA 3C5JB 1INQA 1PZ5B 2HFGL 1MAMH 1CFTB 4ZDHA 1N5YL 3KPRA 5IFJA 4EI5A 1QFPA 1K3IA 2BJMH 2BVQB 3WIHH 1FO0L 2CRMA 2VYRE 1U3YA 3ROOB 1FZOA 3UYRH 1T2XA 1IFHL 1GL4B 2R4RL 1G9ML 1HILA 4J3TA 4WENB 3NCYS 3MZTA 5D1ZC 4PD4K 4LBEB 6CGTA 4YNYB 2EO9A 2P47B 2XACC 3JWNC 4LSQL 4GXVL 1TPXC 4HUVB 2P8PA 5E2TL 3WE6B 3OAZK 4XXDB 4OGAC 1DN0B 2BFVH 1CDYA 2C5DC 3QUZD 4JG0H 4NO5B 3OSKA 4Y5YC 2VITA 4RDQG 2G5BA 4WTZG 5IVNA 3L3HB 2FJFA 5KSAD 3AREA 12E8L 1A3LH 1I3GH 3O6LH 4ENED 3FT4A 3T3MF 5DVLA 3CFBB 4RZCB 4X9GA 5J12C 3ULSB 2D7OA 2VXTL 2XQBH 4HXAH 4PG2A 2N1KA 5T3XD 4ZTPH 3H9SB 4LHUG 1BZ7A 5E2WH 3R4DA 2PTVA 4PS4H 3MFFA 5I6XC 4IRSD 5J57B 5EU5B 3VDAA 4OLZL 1IM9D 3QQ3A 2XICA 3QUXD 2NY0D 1K4CA 1BLNA 1TPXB 2NPLX 2PXYB 1EA9C 2VISA 3BZ4B 4EDWH 4RGNB 3CLFH 4JZOB 1U8OA 3W81A 2EEDA 2CIIA 1Z9MA 3ZE1F 1NCBH 5LCVH 4U05A 4RGMC 2FO4A 2ZZUT 1DZBA 4JO2H 3LD8C 1BQLL 2HTLC 5HYSA 3OXSA 4NQCE 1A1MA 3MGOA 3BKJH 3MRHA 3NTCH 2R0KL 1OTTC 5BO1H 2ICWA 3ARBC 4ZFOB 3OAZH 1KCKA 5EZJB 4HXBH 2VZUA 1JPFB 1UZ6F 1VFBB 3AROA 3HUJA 4CVXA 3O3BB 5DYOB 3LS4H 2VC2H 2VXVL 3VXQA 3D87B 1TZIA 1NC2A 4YK4B 3WJLC 1CYGA 4HUKB 4C54A 4R2GB 3TZVC 1QHOA 4HHAA 5AG8A 1D9KB 1YQVH 3T8XB 4HFUH 5C86A 2FJHB 1ORSB 4JAMA 3H3PH 1EGJA 1IGML 3O8XC 1FSKB 4RRPA 4QTHB 4LSUL 5DZNA 3OGOE 3W9DA 3VWJA 1PSKL 5E4EB 3DV4B 3S37H 1TLKA 4PRNB 1F4XL 2CQVA 3RWGA 4YAQA 4X4YA 1AKJB 4AENB 3MQIA 4G6KL 3MCLH 1EX0A 5I1KL 1YN6B 2Y5TA 2FBJL 1FJ1A 2COQA 5F9OH 2GI7A 1I9EA 3REWA 3VU2A 1J88A 4YDVB 4M7ZC 1RK1A 1MJ8H 4JJHA 3FMGL 4K3JH 3GB7A 4JHWH 1Z0MA 1BEYH 1HQRB 5F3BA 1YNKH 1DBBH 1E28B 2E8YA 3QCUH 1FVCB 2VLME 1LK3H 3V4PH 4HJGB 4U6HA 4OCYH 4OF6A 3RPIB 3SKJH 3L95A 4MCYB 4LQFL 3GK8L 4NDMB 1BZ9B 4I5BA 3WIIH 1JZ5A 2C3HA 3LS5H 4ZXBB 2RJMA 2A74A 3TNNB 1AD9B 5DJ6B 2AVGA 3HTLX 5IMOA 3IS0X 4WU7A 2DMKA 2Y7QA 4QOKD 3S36X 1NSNL 2PCPA 5TPWL 1LDPL 4E41D 3PGDA 3OKOB 4EI5C 2DLTA 2V5SA 4OLVH 3V0VB 2V7NA 4KRPD 5C0JA 2A6DB 3LS5L 5BRZE 2EIZA 3MCKA 5E8PB 3W0WB 4G9DA 4X6DB 1OAKL 4R90H 4WHCA 3VG0L 3P9LA 1ONQB 2GSGA 3OTTA 5A2KH 4KKLD 3WO3B 4WGWB 3O9WA 4L8DB 3BDYH 5K9JL 5FV1L 1JWSA 1BQHA 1XF3A 4M9PA 2AEIT 1A3RH 3PHSA 4GBXC 3DROB 1NBYA 1B4RA 4QXTB 3PWPD 4LASL 1FZMA 4FQJH 1KG0B 5JHLH 3GMQB 3ZDZE 5DHXB 4MD5A 5LXGL 4F37K 3U2SA 3P9MA 4Y5VB 1XEDA 2R23B 1XGPB 1UEMA 3MV9B 2V9TA 2ATPB 5K9OB 1YY8A 1BD2B 3ZSSA 1CFNB 3TWCL 1BOYA 4TVPH 2GK0A 1HWHB 3AM8C 5KVEH 1FGNH 1FORH 3KYAA 4FZ8H 1NQBA 4K3HA 3LH2L 2V2WA 5CGYD 2M2DA 3TBTB 2H26B 3BGMB 1JZ6A 4GAJH 4Z7UA 5E8DL 4TSCL 1MRCL 2XOTA 1N6UA 2F8OA 2C1OA 5C0EB 4YUEL 3JV4A 3ARBB 5IB3B 5IROA 3WFEH 2MNUA 4ZPVB 1A1MB 1HHIA 2EIEA 1D5BA 3HUJF 5TGBA 3BN9D 4OV5B 1QSEA 1FGNL 1FNAA 4R3SB 1MEXH 4E41B 5EZJA 3U4EA 1MJ8L 4XGZA 1MJUH 4U1LB 3V6OE 3T0EB 4NQSB 4Q9CA 4M1CC 1T22B 1G1CA 4U3HA 4WWKB 4PP1D 2MCPH 2E6JA 4JFPB 4RFOH 5IMKB 2HLAB 4K7PY 4R7DA 4U3XA 3TZVD 1CGWA 1D9KA 3T8XA 3SEPA 1CFBA 1G9MH 4F8QA 2VXSL 4BUHA 3KJ6L 4XBEL 4YBQD 4GW1B 2VWEC 5IEHB 4BZ2H 3MUY1 2IQ9L 1P53A 4PJ8C 2VXQH 4JKPL 3RA7H 2A77H 4PRNA 3DMMA 1YY9D 2BY1A 4XMLL 5LVEA 3U36A 5E95B 2XTJE 4JRYE 5DHVA 4G3YH 3I6LE 1KNOA 3QDJD 4M7JL 2YEZA 4WFED 4BQ6A 2FR4B 4W81A 1GC1C 5C0FB 4PV9B 5I30H 4OLEA 3O3DB 4G43B 2NY1C 1OP5K 3T0EE 2ZCHL 4ZFFA 2OTWA 2IH3B 1I3GL 3WE6A 1TVBB 3NZHH 1RU9L 3GB7B 5L9DL 3QH3B 1A7OH 4ODUA 2BOCA 4R97B 5ESVB 5EBWB 5DD1L 4CW1B 5JOFA 4U3CA 1NCDH 3OMZA 2R56L 2ZOKA 2ZSWB 5E2VH 4EI6A 3VXRA 2YA1A 4PJEF 3LRSB 4U0RC 5SWSE 4OUUB 3L95B 3SDXF 4I5BB 2GT9A 1CN4A 1FFNA 4LLMB 3WL9A 4K3DH 3RL2B 4TN9A 1HYSC 1PBYA 1JWUB 4HK0A 5EOCJ 3ARBD 4RIRB 4QHKJ 1IC4H 3QRGH 1Q72L 4LP4A 3GHEH 4S2SB 3DBXA 5E2UL 4HIIB 3O0RL 4OCWH 3ROLA 4PTTB 3FO9A 2PXYA 2VISB 4WFGE 1W72H 2Z9TA 4N0CD 1S7WA 5GSRA 4W6XB 1YEKH 2VLJD 3MV7E 2MKWA 4DAGH 5FYKU 2NTSP 1OSPH 3BJ91 4L8SC 2OR9H 2IANB 3V4UH 4TUOA 3W11C 1ZV5A 5CINH 2IBBA 4WVRA 5B39G 2WBWB 2J5LB 2L0DA 2X70A 4GW4B 3VJ6B 4JO3H 5GGTH 4GQPH 4ZAKA 1CF8H 4Z7NE 1FE8H 5FO7A 5JXEA 4JFHD 4KKAD 5MEPB 3O3BA 4KV5E 4IRJA 4LSQH 2ZKHH 1JWMA 3MRQB 3O3EA 4FTVD 4PJXE 3MRJB 5D7KD 1PY4A 1QKZL 4DK6A 1AP2B 4HMEA 5HBBA 5JR1L 1FIEA 3MRRB 3TN0A 4GH7B 4JFOA 1CGSH 4BFBD 1AXSA 4KTDH 5HGAA 3N50A 2ATPA 5D7IA 4HUNB 4Z7NF 2Z8SA 3RWGB 1JVKA 3UAJD 5MENB 3HS0A 2AEWA 5TE6H 2DQFA 4QRQB 4D0BA 4QLRA 2YSSB 2RIKA 3DTXA 5I18H 3MOAH 5GS3A 4I8DA 5BV7C 3I02A 1G84A 4KUCD 3LCYA 1CBVH 4JFED 5JORB 2W07A 4L3CB 1PLGH 3DHMA 1MCWW 2ZUXA 5D71H 3GMNB 1F3DJ 1KLGB 1IBGH 1AQKL 4AT6A 3AAZA 4HS6A 4ETQB 3IJHA 1C08B 2NY2C 1NCWL 3CZFB 1DQQA 4MNHB 1HYSD 1U8HB 1JGDB 1SHMA 3OX8B 4UNVA 2Q6WA 3TIDB 1S7XA 4HH8A 3SKNA 4Q9RL 2FSEB 5C7XH 3OHXA 2PYEE 1MRDH 4WJ5B 4JB9L 3NOIA 4LEOA 3RWFB 5IHUL 2PCPB 5CWSA 4YHOH 4CDHA 1HSAA 4PJDA 4ZUSB 4M61A 3CIQA 4NUJB 1XIWB 5IKCB 2W65B 4JRWA 3N9GH 3GSOB 5BW7C 5I1GL 3FO1B 4FFYL 1DUYA 5E8PA 4QXGL 3S35X 1ETZA 4U0QB 4FTVB 5H94B 4J4PA 1WT5A 3FO0L 4XBGB 4Z7WE 3W11D 1J0HA 1QRKA 4MAYD 2BHUA 1H3XA 3GO1L 2NYYD 4ODXB 1ZGLA 4HFWB 4UT7H 4NO0D 4KAQH 5ESVA 3P2TA 3UTSA 4X4XA 4J3OC 1UH4A 4M62L 3NABL 5JDSB 1I7ZB 4LVOB 5ILTL 4YHYC 4WW2F 2Y5EA 4HPYH 1R3HA 3C9NB 4KJYB 1ZT7A 3MLVH 1U93A 3MV7D 5DVKA 1HSBA 5E7BA 1MCHA 1QNZH 3D1MC 2FBJH 4IHOB 2IMNA 4K9EC 1MJ7H 2ICES 3DO3A 2YPVH 3H2WA 2XFXA 1V3MA 3HB3C 3ZKQD 2HFGH 4Y5XB 3GSWA 4H5SA 1KB5A 3X11A 4OD2B 1MCKA 1UJ3C 2GJ6B 4LARH 3TA3B 3HI6H 1HHKA 3MXVH 4AH2A 1ZGLM 2FWOA 3EZ8A 4JQIH 3TT1H 2GJ6E 3PNWA 3UDWC 1ADQH 4DZBB 3DX9A 4DVRL 2E7BA 1IGFL 5D2NE 2K1MA 5DQDL 3RUGA 5C07D 5IIEA 3UZQA 4ERSH 3TVMC 2X4QB 3CH1A 43C9A 4EOWH 2CLRA 4OZHE 4KQ4L 3QNZB 4LOUC 1P9MC 1IM3A 4L4VB 5L2KB 1SEBA 5JPMA 3GSNA 3HFMH 4G8EA 1CK0H 1DDHA 3JVGA 1IQWL 2A6KA 3KPSB 4PJGA 4HJJH 4UOW1 1U8QB 3CC5A 4CJ0A 4L4VE 2QHLA 1A7PH 5F1IA 1C5DA 2E6PA 4LHUA 5DD6A 2ZUTA 4PBWD 4WI5A 1VSCA 3IJYA 3I6GB 1PJ9A 1OTTD 1LK3L 2J8UE 1HZHL 1IQWH 1NH6A 3CU7A 2YUVA 2XY2A 4LPCA 4GSDL 4OQTA 4OLZH 1ZVSA 4KJWD 4JVPA 4WFFD 3S88L 3UMTA 1T1WB 5DURB 3T0BA 5L0QC 1U3ZA 1AGFA 2DQFB 1AXTH 1Q9OB 5AAMA 3IDNB 3VWJC 2DBLH 2QR0B 2VXUH 3S8WA 3BWAB 3ZE0E 1EHXA 2VDPH 1MI5E 3FQXB 5HYSG 4AJ0A 3O11A 5I73C 3MA9L 1MELA 5LGHH 1JNNH 3L1OL 3NTCL 3H7BB 5CBEA 2V5MA 4E0RA 2JIXA 2XWTB 3VGHA 1WBYB 3MODH 4TSCH 3SDXE 3QEQD 3WL9B 1BFOB 3EJYC 2LAGB 4FZEH 4ZUVA 3JUYA 4PRPE 4G80B 3DURA 3C5SB 3FCTB 3M17B 4WJ5A 2YD5A 5D2NC 4K3EH 5GGRY 5I15L 5GGVY 1OAUH 1TNMA 3VGBA 4YE4H 4DJMA 3QIUB 1XIWA 1YUHA 1UH3A 3MGTB 4PGEB 1OSZA 2UWEB 3RPKA 2XRAH 5I1IL 5DMIH 3ORJA 2MCG1 3VXPA 3BUTA 4PJ9A 4QRTB 4HH9B 4Z7OE 4S1SL 5EU7C 1EJOL 1K2DA 1NDGA 3TT3H 2IAMC 2CIKB 4HUUB 4OD1L 4UDUA 1U2CA 4LVHC 3QUKB 3FMGH 2P7TB 4FP8L 3OZ9H 4QRRA 2W0KA 3LQAL 3MJ9A 2Q7YA 4YQXH 5ETUA 5D8JH 2FX9H 4YBLC 2B39A 5ERWA 3BO8B 4DZ8B 3IFPB 3D2UA 3L3DB 3RVWD 4OJFL 3VXSE 5DDHA 3LKSA 4G8GB 4YZFE 4CU8A 4N0UB 5CP7A 1DQJA 3VFPA 2D7TL 3TA3A 1GGIL 4PGDB 1I1FA 2B1HL 4Y16B 3QO0A 1PZUB 4LLUA 2CDEB 4U1GC 3BZ4A 4I0PB 4U6VH 2R56H 1QSEE 3O4OB 1OHQA 5EU6D 4PRHD 5IIEB 1JTPA 2HH0H 1A2YB 3MSPA 3UTPD 4F3FB 4LRNL 3AUVA 1S9XB 4QRQA 5C6PB 4KZDL 3EO9L 3F6IA 3F8UB 4JGMA 4F7TA 3VH8G 1AD0B 4JEGB 3D69B 1EZVX 4H20L 3LN4B 2Z92B 2HLFD 2OTUB 3U6RB 4NC1C 4NQDB 1KLGA 3LAFA 2GTZA 3MNVA 1N64H 1WBXA 4Y4FB 5KJRL 1F6AB 2ZCHH 5SV3A 1LE9B 5EU4B 1LEGB 5EZOH 1YEIL 4ODBD 4GKZB 3UJTL 3CLEH 4ONGH 1K6QL 1KV3A 5JXAL 5IFJB 4PLKC 3CDCA 1QFWM 1G7PB 4KGLA 1SY6H 1EERB 3QPQC 4Y2DB 3Q3GA 5T5FH 1GJIA 3IDMA 1T20B 4G9FB 1B3JA 3OKEB 3N1FC 3RWIB 1YPZB 1FZKB 4AY0A 4QF1B 1ZWIB 1KB5L 1CL7L 1AGEB 1FV1B 5HJ3B 3M07A 1TTUA 3IDXL 3B6SA 1AFVH 2QR0A 5F44A 4BZ1H 2Q86B 1FNGB 1BAFL 1HQ4B 5HHNA 3REWB 2CUHA 3JTSA 5C8JB 1GHFL 1HH6A 3W2DH 4LU5L 3UPRB 4P5TB 4QOKA 4JM2C 3BZEB 1H3WM 2DDQH 4ZQKB 4PRAA 5ANME 3RIAK 3P0VH 5C0RL 1QFUL 3T4AA 5IBTH 3FB8A 2RB8A 2KQNA 3HE7B 4PRHB 4GXVH 4YHPB 1A0QH 4G8FB 3MR9A 4M1GH 4HAFA 4ZXBA 1WZLA 3NPSB 1JF6A 3H6JA 2QHRH 3EOYG 5ESAA 5SWSD 4PRIB 2XFXB 4LSSL 4IRSC 3LQAC 2F5AH 2D7QA 2VZOA 4WU5B 4YHML 1Q9KB 1WFOA 4JLRA 2H9GB 4LNRA 3IDUA 1E27B 1R3LB 5DF0A 2MQ3A 5T1MA 1YJDL 4BZ2L 1WBZB 2F54E 2IWGA 3HPLB 3VWKD 3SKOA 5DEGB 4NCDA 2HFEB 3W0WA 3JBG7 5KSAC 4Z7OF 3QIWD 5DTFB 1J8HD 3IGAA 1LP9B 3BHBB 5I8OH 4OLUH 2HJLA 4UV7H 1J0ZA 3NCEB 5IB1A 1PGRB 1VB9A 5H8DA 3KYMB 5EBLB 1IAOB 1XMWA 5L6YH 3O9WB 4PREA 5J1AB 1MRFL 1MWAB 2K7PA 1YMHB 4P2OC 4QRRB 1UXSA 1MVUB 3DUUB 3X13B 1A7OL 1X5IA 5ETUB 5JXEC 5TQ0H 4E9LA 3VG9C 1KCSL 4J6RH 1AQDB 5DD5H 2AXFB 2VL5B 4MNGA 4PTUB 1A9BA 1G7MB 4XNUL 4G6MH 4LLDB 3B8YA 5BRZB 4HIXH 1VFAB 5HYJE 3B9EA 2F58L 5T3XH 4MNGE 1S8DB 2VZSA 4R4FH 2AJ3A 1BVLB 2XPGA 4P5TD 4M8QA 3VRJB 3QZWB 3BPCA 1GGTA 2VRAA 1BBJB 3U79A 3QEUA 3MA9H 3PP3H 3RVUD 2DQJL 3QUMB 1CU4L 1FPTH 3O2VH 3GUTB 4JJ5B 5E9DB 3FQXA 1QR4A 4ZOAA 1S7SA 4MJ2A 1N59A 2GHWB 1S5IH 3HC3H 4LNVA 35C8L 3SE4A 1JYVA 4P23B 3RZCA 1JGLH 3EYVB 2OJEA 3AMKA 4NZTL 3DECA 4MXQC 1U3HA 2H6PA 3CCHA 1CG9A 2BC4A 1Q1JH 1DBJL 1A6ZA 4MJID 5T3ZD 1G9NC 2VAAA 5FCSH 3HMXH 4NNPL 2ADFH 2KPNA 5HDQH 4PPTA 2PO6B 1Y0LA 2VC2L 4I48B 1ZVYA 5I71C 5FYLE 3QYCA 2GSIA 1FZKA 5HVGB 1G7QB 2FL5B 4HUXB 1B0GB 2V7NB 2NY5L 5AYUL 3SDAC 4PJ8A 4OCNC 1HYRC 5D6CA 2GAZA 3JTSB 1TVBA 1XZ0A 2Q20A 4MGXA 3DRTB 4XC3H 5D8JL 4OLWH 4YIQB 3UBXA 4DVRH 2AERT 5MP6L 1YEEH 4N8VB 3KPMB 4AYFA 1IL1B 1JYNA 3OJDB 4PRBA 1ZA6A 3OJVC 3PUCA 3VXNA 2R8SH 4L3EE 5KOMC 1MAJA 2D7TH 2ARJA 4UUJB 2NMSA 4YHPA 1K8DA 4R90L 3IB4A 5EO9B 3BKCH 4HXAL 3BESR 1RIVL 4FOMA 5DDHB 1ZA3B 4J3SA 4TULL 1YNLL 3IDJB 2FX8H 4GRWH 3VFPB 3EYFB 1U8KA 4HPOL 5GRXG 1QOKA 1XGPA 4ZUWA 5FUZH 4LSPL 2YPLE 3ILPA 2WUBL 3LPGA 3GHBL 2EIBA 3I3EA 3N1MC 1AC0A 4APQA 4LAJH 4OAWB 4I0PA 3OJ2C 4ZFGL 3MRCA 3HZKA 1WZ1L 2RCSL 4KDTA 5D1QB 3P0YL 1QPXA 4JCMA 4YPGA 4D9LH 2O5YH 1P5UA 1IILE 3VGFA 5DUPL 4P2RE 4I0KA 3AC0A 4K8RC 2C7UA 1FNHA 3LKRA 1XF2A 1U95A 2YRZA 2R9HD 3PL6D 4OLXL 4Y4KB 3N0PB 2IPTH 2X70B 3VJ6A 5ICXA 3QIWC 3WLBB 4EUPH 3RTQD 2RHEA 3D39D 4XGZB 2PN5A 2PW2A 2VLRE 3VG0H 4I4WA 3SJVB 3QBTB 3CFKA 5A43C 4JKLA 4M43H 3CFEA 3QQ4B 2HP4A 4ZUUB 5EO0B 1MWAL 5FA3A 2X4SA 4FQPA 5DD0H 1MHHA 1TVHA 4BSJA 1NMBL 2EDBA 4FNLL 3DSNA 4DFHA 1LK2A 1VEOA 1F8TL 3VCLB 3BPCB 1VACA 1URLA 3B4NA 1A64A 5HHOB 3CFJA 4NQCD 3HG1A 3WS3A 1YNTA 3FRUB 4NRYB 2O93L 4V2CB 4EVNA 5CUSL 4QF1A 2FH6A 3FOLA 1AIFB 1OD9A 2B1AL 5DT1H 1INDL 2D0GA 2P8LB 4QY8B 5HPOA 4Q9BA 4NHUB 4G43A 4P4KA 4XTRD 2YWYA 1NGYB 4FQCH 1QSFD 3PWJB 2N7AA 4R96B 4UMGA 1RUAH 2DAVA 5B8CB 1AI1H 2DQGH 1EO8H 4NQEE 1UC6A 2XZQH 5E24E 3ARDA 5AYQA 4KHXH 2PETA 4JFDB 1FL6A 1X5HA 4KTDL 4PJEE 1FFNB 5MENE 3I6LD 3C2AH 3QDJE 1PYWA 4QO1A 1PKQB 5EPMB 2AJZA 3LB6C 4PJCF 1ZANH 2P44B 2Y06H 3VI4F 2UZIH 1L9NA 4RIRA 4RX4D 4PLKD 1QVOA 3A6CH 3MUGB 4TSBL 3VRLF 2WAHA 3WHE1 4YLQT 5BZWB 2P5ED 4KHXL 1OP3H 3B43A 2VJXA 3B9AA 5DZOA 4JR9L 4HUXA 3GSVA 3D39B 3IDIB 3DUHA 2GJZB 1RJZB 3KPQB 4HIJA 3VFNB 4HUVA 1MVFA 2Q3ZA 4XXDA 5H35B 1QFWL 1BWWA 5TQ0L 1GYAA 4XMLH 3RVTC 3KYMA 5EBLA 5FCUL 1U92B 5IMMA 1IRAY 4DQOH 2PW1B 4ZSOA 2ZUQB 4Y1AE 5DSCB 4PRBB 3DO7A 1W72L 3VXNB 2KDGA 4PRIE 5F8RC 3NFNA 1ZT7B 3P0GB 4WV1A 4W4OC 4LSRH 2D7MA 5LAXA 3HR6A 4X7EC 4RGND 1QLEH 7CGTA 1D3CA 3ULVD 1H3GA 2EDLA 2BERA 3BISA 4PJEA 5DEFB 4Y5VC 2VQTA 3S37X 2FJGB 3D85B 5IG7B 4ZUTB 3BP7A 4NZUH 5C6WH 5EU6E 3MACH 1ED3A 5FGBC 4KWUA 3H9HA 4XH2B 3LEVL 4DGYH 1AXSB 3ZKXB 1EO7A 3E8UH 2CRYA 4DW2L 1DANT 5FGRA 3W39B 1BBJA 4XP6L 1IMHC 1FFOB 2QQKL 2DQEH 2VN7A 3LS4L 3QP3A 1QFHA 4U2ZA 3ULVE 2XRAL 2LTQC 1ZLUK 2C7UB 3EYQC 1H5BA 2DQHH 3Q6GL 4G7YL 3O2DA 5K9KA 3D3VE 4EEEA 2Z93A 2IEPA 4PGCB 3JWOC 3GSUB 2NX5B 1KACB 5T5NF 5E00A 5TE7L 1SMOA 4I2XA 1IE5A 1FC2D 5DYOA 4XVUC 2X4RB 4NN5C 4OIIH 1TZGH 3CC5B 1RZKL 2N56A 5C0AA 3QIWA 5BVJB 1CVSC 1WWCA 1LP9E 5DK0B 5LBSL 5TDPB 1U3JA 2HT4C 4JFHE 4E41E 1PDKA 1QFUH 3EFDL 3VFSB 2PO6A 5I74B 1TQCB 1IBGL 3RJDA 2VXQL 4I3RH 5HHOA 3HZYA 1K4DA 1QKZH 4L3AA 2EKSA 2JJUA 5ELIA 1IGIH 2DM2A 1T7WA 1Z0NA 4MJ6A 4UIMB 4XC3L 4JZJA 5E8EA 5IQ9A 2CGRH 3EO1B 4FTVA 5H94A 4LQFH 3IT8D 4P46B 4HJJL 3BH9A 2OCFD 2BDNL 2CR3A 3C5ZA 1CFVL 4U1HA 3L6FA 2XWJB 1MIMH 2F53B 3WHXA 1HQRA 3E2HC 4JDZB 1OT1A 5ANMB 1BD2D 2HFFB 3IFOB 4D3CL 4YHNA 2BNQB 4Y19D 2CGRL 2FDBP 1MI5D 2ZUWA 4JFZL 2ADIA 2AKRA 3B8SA 4PJCE 4WHTA 4C83B 5JPNB 2WBJB 2OQJB 1B88A 5DJAB 5DJ2B 4XPGL 2AXJA 4Q2ZB 3A0OA 2DYPD 2XA8L 4M02A 3STLB 1IKNA 2XTJB 4JRYB 1HHKB 3PV6B 5JXED 5ILTH 4RMRA 1SBSL 2W60A 1ZHNA 2N4IA 1FNEB 3BDYL 3R1GH 1O7VA 4UTBL 3EOTH 3RUGB 4IMLB 5K9QG 5J13B 4L8CB 2PNDA 3VXPB 3V5KB 4LLYB 1JFQL 3ARWA 4FQJL 3NH7L 4XP6H 1KFAH 3L3OA 4ISVB 2AQ3A 4P0DA 4UDUB 4C4KT 1RIHH 1DVFD 4MA7H 4QCIA 2WW8A 4P5KB 1LO3H 5FO9A 5GZOD 1KJ2H 1H8NA 4XCNA 5DMKB 2A6KB 1GGBH 1LO0L 4PD4J 2AK4D 1I8LA 1KB9K 3FO0H 1UYWH 5ERWB 4FQHB 3RZCC 4FNLH 5EBMA 4DZ8A 4EOWL 1NC2B 2E3VA 2H32A 5DJCA 5C07E 3ELAT 4ZYKB 2ZSVB 2NXZB 2VABB 3HN3A 1T1ZB 1KEML 1FFQA 5F9WC 4AM0B 2MQ0A 1DQJB 3BSZH 5CSGA 1QFOA 1FRGH 1WZMA 1RFDL 1U6AL 3MV9A 1LNUA 4OCYL 4WRLA 3SDCD 2NQCA 4LSVL 4JY5L 4ORZC 1FL5B 4XPBH 3U9PL 3MRGB 5F1KC 3MX0A 3BVNB 5T3XE 1BM3H 1XCQB 4KMLB 3P11L 5D7LE 3LKNA 2OSLB 3KS0H 5LGJA 4IJ3C 5CSBA 2BVOA 1NGYA 4F7TB 1AGCA 3CNKA 4X7SL 4YHZL 4GRLA 5FFLA 3QSKB 5K9KB 1PLGL 2ZOLA 3U9PH 4OFYD 1MCJA 1CGVA 1UKTA 2CJUH 3GSRB 1L6XA 1II4E 3LKQB 1RV6X 3L9RA 3O6FA 3RVVC 4EUPA 2A74B 3GI8H 1ACZA 4BZYA 1OTUC 1NC4A 2AABL 5IMLB 2Q3AA 2AV1B 4KUZL 2F54A 3M8OH 2HN7B 4JHAL 1T20A 4HWZB 5E8NB 5F3HA 4ZPTA 4A6YL 4N0YL 2CUIA 4CNIA 5KSAA 1T7YA 3SO3C 1P1ZA 3F7PC 4HULB 3P4NB 3V6FA 5LCVL 1MFEL 2HRPH 3U7WH 2P43B 1PKQE 5BOPA 2VKWA 2QQQA 3MNWA 2MMXA 3OF6A 1RHFA 2B0SH 3PABB 4K7PX 5EWIH 3ZYZA 5KSBA 3O3AA 1A02N 4JHZA 4NSKB 4JDZA 1IM9A 4IBLT 5D7JC 2ZCKH 4KY1L 4D94A 2VDPL 2C4FT 2GCYB 2W0LA 5DUPH 1RZ7L 2GT9B 2B1AH 2D2OA 3MRFA 4OGXH 2BXZA 1Z6JT 2VLJB 4C83A 2E27H 3LKPB 4RGNE 1FIGL 1MCEA 1IGCH 1QSFA 3HCVB 5AUMA 3U9UB 5FDYA 4JPWH 5A1AA 4PUBH 3B3IA 4S10A 2IAMB 5FUOL 2WIMA 3LQAH 2IQAB 5EULV 4NKQB 3LEYH 5DC9B 1CFNA 4ENEC 4P48A 4YXLH 1UQSB 2X4PB 1D5XA 4X6CA 4L8CA 32C2B 1QSZA 3K7UA 3LRHA 3QIUC 3STZA 1EH9A 5GJSH 4EN3C 5GS1B 3P11H 1TJHH 5FOJA 1C5BL 3CVHA 1QYGH 1A1NA 3IFNL 2H2PD 3FRPA 3MRPB 2ICWJ 4FG6D 4MSWA 1G0YR 2CDGB 1XIWD 2FIKA 2Z91B 1Q0XL 4S1DC 1SMAA 4P2OA 5MEND 4LLDA 3IU3B 3P30L 4WI6A 4GG6F 1ZT1B 1OP3K 4EKXA 1HH9A 2ITDA 3ZE0F 2JE8A 4XMKH 1FH5L 3BP5B 1P5VA 4LKXA 4MA1C 2B8OT 2IMMA 2FEEL 2CLZB 4L1DA 5EZLA 3RX5A 1HDMA 3MYJA 1IGTB 1NAMA 4BFEA 1TENA 3LDBC 4HT1L 4QT5B 2ID5A 5CFHA 1ZHKA 5JLZA 3LKNB 1C7TA 1VPOH 5I1DA 1AXTL 5ESQA 3O45B 1NC4D 4BYHA 3PWUA 3GUTA 1T1XB 2IH3A 2ZPKH 1S7SB 4NOFA 4U49A 3VXOB 1DL7H 3SY0B 4F7MA 1A7NH 3QFDB 3VFMA 1NUFA 3R0MA 4YBHA 4M9OA 1DSFH 2CKNA 3EDDA 3HPJA 4WW2A 3G5XB 2OJEB 4R4FL 1MQKH 3QI9A 1NL0L 1I4FB 3EOBB 4WHDA 5JIIA 1KYOK 2CLVB 4LLVB 3S7GA 5HHXL 4JM2B 2XA8H 4RAUA 4GS7C 4W6WB 2AJXH 4XNZC 2FEEI 2LU3A 1JL8A 3WN5B 4YH6A 2FSEA 5TQ2H 4NYLB 1EMTL 5E08H 1FE8L 4OF3A 4A2MA 2X4UB 3AXLB 1I8IB 1A4JA 5DJXA 4GAYB 3PWPA 4LPTA 1M7DA 1RY7B 1KFAL 4R7NA 1T0NA 2XXCB 1NDMB 1UM4H 5CBAB 5C0AD 4LLYA 1KT2A 3QCVL 2EC9T 1UJ3A 1F58L 3HZVB 2W9EH 3LHPH 1I7UA 4WI4A 1A14H 2VITB 1CL7H 3ZYIA 5DRNB 4Y5XC 2YPLD 3GMOA 3TPKA 1KTDA 2Y1VA 4O2EB 4PJ7A 4PB9H 4PRPA 2G2RA 3KLAA 4RNRB 1A7QL 3WFDL 1U41A 3BE1L 3RHWK 4XP9H 4MDIA 3MCLL 3JZ7A 2NR6D 3DV6B 4OSUL 4LFHD 4XPBL 3I50H 3RJQB 5FGBA 3TA3C 3P73B 3C5ZD 1CXIA 1NMCC 2BRRL 4JFOB 3HUJE 4XHJC 5T3ZH 3QUYA 5JW5A 5DUBA 3PNWB 3HC0B 2WP3T 3OL2A 3MA7B 1FO0H 3CZJA 4HS3B 4KKBC 3KPSD 4A2LA 1OD7A 2G75B 4LEXL 1YYML 4OZFG 4GJTB 2J12B 1KC5H 4LVOC 3O8XA 4D0BB 2VDRH 2XXMB 5LGJB 4X5XB 4IRZH 1UCTA 4MB3A 3OXRA 1N59B 4PJGE 1Z5LB 2J8UA 4F2MB 5F6IC 3MOAL 3ZTNL 1LDPH 1NEZG 2AP2A 2EH8L 2CMRH 4BQBA 1WV7T 3FT3B 4MJIE 3VWKA 1TZIB 1RVFH 4HG4J 4MAYC 1JGDA 4U7KA 3LKQA 4ZUUA 1YEIH 2P4AB 4P4KD 4OZHA 3WKMH 1F5WA 43CAA 3O4LE 3ILQC 2R1WA 2YD7A 4X98B 3ZHLA 5D5ME 1U91A 1HI6A 3U46B 1LK2B 5ICYB 3WSQL 2UWEF 2V5TA 5C0GA 1PG7L 2F54B 4KJQC 1Q9WA 1JZ4A 4NRXA 1CDUA 5TDOA 1NAML 1WF5A 5LGHL 5ICZB 4P3DB 1U58B 4NKOB 4P57A 4P4RA 5C92A 4RMSA 2YN5A 5DHYA 5HI4C 1INEH 1F00I 1ZEAH 4HZLA 3MNZA 2AQ2A 3KWWB 4PG9A 3L5JA 3QHTC 5IBUB 1T1XA 4JDVA 3JUZA 2UUDK 5D2NA 5FEBA 5CCKL 3C6SA 2MPAH 1D6EA 2O5XH 4WO4C 1SM3L 5FYKH 1A3QA 1UZ8A 1WTLA 4GKSB 1BOGA 4NZRH 2OZ4A 3FZUD 3QT2A 3TCLB 1JGUH 5HPMB 3LHPL 3RPIA 4JREC 5F97E 4NKIL 1T1YB 1WBYA 2GCYA 3T2OA 4H25B 5GIRA 2WQ8A 4N9GB 3ZHKA 3RY6A 3O4LB 2CXGA 3P77A 3IETA 5FAAA 1EEYB 1RZKH 2VDOL 1XAUA 4XCYA 3QI9C 4Y5XA 3HCVA 2X7LB 5AUMB 3U9UA 2V2TA 4NT6A 1V05A 1I8IA 4YHMH 3K1KC 2YPLA 1EDQA 2GKIA 3MCG1 2H41A 4EQ3A 5IW6B 4X9HA 3PDOB 2YOCA 2P5EE 1XH3A 1BFSA 2AV7A 5ID1B 3V6ZA 4PB0L 4JZOA 3MGTA 3MLXH 1HHJB 3T65B 1NFIB 3TNMA 3HR5B 43C9B 5GS0L 4ODTL 3W5MA 2MCPL 25C8L 1KPUA 2DL9A 1BGXH 4Z77A 4NO3B 1ZHBA 1H15A 4ERSL 2GJJA 1XF2B 4J23A 1U92A 5IMMB 1J18A 3OR7B 3DO7B 2WIIA 3WIFB 1DDHB 3ZO0A 4NN6C 1MIML 1E4KC 5D96B 4XMKL 1OAYL 3ULUL 2VXUL 4PY8I 3B9KA 5E1AB 2JB5L 2FHCA 3SDXB 2AJYH 3G5YA 5F9AC 1YEGL 4HLJA 1S9VB 5GGSB 5GGVL 4JG1H 3H0TA 4G8GA 4V1DD 4Z7VF 2X4SB 4ZG1A 1A6AA 4UTAL 2FGZA 1MHEB 1KLUB 2WUCH 5DS8B 1RZ8A 3DYMA 4PJFA 1R3JA 5SWZB 1BD2E 4N0FB 2NY1B 1JF1B 2HVJA 4ZNEA 2AXHA 4BKLA 5D1ZA 1T1WA 2YD6A 3KDMB 5TDNB 4QY8A 4MJIA 3J7HA 2X9XA 4L29A 3TBWB 3V6BR 1KN4H 3QG7L 1RIUH 4TTDC 3PXHA 1JMXA 1MQKL 4QHNA 4TOYH 4FQLL 4K8RH 2VLRD 1BF2A 1F11A 3T4YA 2BSRB 3LN4A 1KTLA 3F7VA 2P42B 3WO4B 1SYSB 1UCBH 3K80A 3AB0C 4WW2B 5GGRB 1SY6L 3WUZA 1MOEA 5CHNB 1FYHB 5BJTA 3MACL 3I3BA 5DMIL 3QI9B 1EMTH 1I1AA 2ESVA 5E08L 5F88B 1FO0A 1XR9A 1BZ9A 1E6OH 1ZT4A 2YBRA 3U7AA 4Q97A 1QLFB 4HFUL 5GRZA 3K0WA 3OKYA 2D9CA 4DKEL 4POYA 4LASH 1EFQA 2A0LC 4DGIH 4OFPA 1JHLL 1B4JL 3I6KA 5ICYA 2AW2A 4LCUB 5HHVH 4M1CD 4NCC1 3HA0A 4MX7A 4JQIL 1EXUB 4R4BA 3PQYB 2R2EA 1A4JB 3HZYB 5DJXB 3F5WA 3H3KA 3ZTJG 2DWEB 4ODHH 3UTSD 1A6UH 1CICA 3FT2A 3D39A 1IQDB 3BP6B 3Q6GH 2PYED 5KSVA 1Y6KR 2ZCLH 3I75B 2X42A 4L8BB 1JHKH 5F9OL 4ONHA 1WAAF 1AGDB 3KPRD 1X44A 4ZS6D 5C8JA 3SPVB 4MNQB 1OQOA 4XP1H 3QFJB 1GGCL 4K94L 4F33A 4IOFC 4H88L 1GPOL 4J3WA 1YEEL 3TCLA 4HF5H 4J3XA 2R4RH 1F02I 1CE6B 3AM8A 4XAKD 1WWAX 5HDOA 3TGXA 1JPST 3FL7A 4Q2ZA 2BK8A 2IBZX 3EDEA 3NZ8B 3LMJH 5E6IB 1N6QL 2EYTB 4HD9A 2VLRB 1R3LA 2FLBT 5IW6A 1M6OA 2WUBH 4R26H 4KUZH 4XPTL 2Q76B 2QKIB 4BQ8A 5I0ZA 3ARGD 5EZIL 2AJUL 4Y1AD 1PD6A 1J05B 4ONGL 3QI9D 4KFZC 3T65A 4NFDA 4HIEA 4KDWA 4NIKB 5GGUA 5HTSA 5K59E 3TO4C 1NLDL 1V7NH 3VD5A 3ZE1E 1U8MA 1EEZA 5I17A 5B21A 1QEWA 1A7RH 3GJEB 2LAAA 1S3KL 1H15B 1T5XB 4R0LA 5JOPD 1IAOA 3OR7A 1MQ8A 4R26L 3CPLA 4NM8L 5K9QI 1W0VA 2H32H 3BH8A 4Y16C 1K3ZA 3NZHL 1FYTD 3FB6B 4O5LL 1AQDA 3QDGA 4K9EL 1NLDH 4NQSA 1S7QA 1YYLL 3MLWL 3PWLB 1HXMB 3QEQE 5L8LB 3ZHDA 1TITA 1J8HA 4FFYH 4OZHB 4O9HL 4FQXC 4BA8A 5DK0A 1U36A 4LK4A 1UWXK 3K81A 3FTGA 3VFUA 3ZLQC 5HGAB 4YO0A 3GIVA 5M7QA 5JDJA 5TE7H 5BS0B 1D5IH 1MCDA 4CKVX 4M3JA 4TNWF 1JP5A 5FUOH 5GXBB 2X2YA 2YPKA 2ATKA 3T0WA 1I1AD 4MQ7A 3BVNA 5IVOA 1ZWIA 4P4RB 1UKQA 4U1NB 4Z7UE 3GBML 1CI5A 1BIIB 4P3CL 5I1HL 1UM5L 1U8NB 1GZQA 2ZCLL 3NFPA 3BD3A 1QRNE 4LF3A 4K23L 4YGAB 3RU8L 4AEHL 1YEKL 2P46B 1JNHA 2J4WL 1YJDH 3UPRA 5I2IA 4P23A 2VDNH 4XP1L 1HWGB 1ITBB 5CJXC 5CJBA 4D9RE 3OAYH 3RNQA 3T4AB 2VZ1A 4KJWC 4TVPE 3MBEC 3EUUA 3U0WL 3HE7A 5DO2D 3UJJL 5KTEL 1NLBL 3S35L 1E4JA 3BPLB 4MAUH 4CUCA 5DQ9B 3C2AL 3AS3A 3PP3K 1FGVL 3DNKA 3WFZA 3NCJL 4HWUA 5C0IB 3EYUL 4Y4KD 1BLNB 1D9KC 4X9IA 3CUPA 1NKOA 3RZCD 2IALA 1YNKL 3WFHB 1NUDA 4M03A 5I16B 1XH3B 5E5MA 1KJ2B 4POUB 2YWZA 1BGXL 4D9QD 5IFHH 3PWNA 3FO1A 1Y18A 1JPSH 3FAWA 4WTXA 4KZDH 5E0QA 4X7DC 4MNQA 1E4WH 2XT1B 1AXIB 3OGCA 1N3NA 1KXTB 4LVEA 1MFDL 5DD1H 4CU7A 1NBZB 3GGWB 1GOHA 2FJFB 3T0EC 5GZNC 4WUUB 5K93A 3RVUC 5FUZL 1CBVL 5JW3H 2EKJA 2F5BH 2AXFA 4S0SD 1T80A 1WTGT 1A9BB 1INEL 3G5YB 5BV7H 4AEFA 3H9SA 4HK3J 5C0BA 3QIBB 1T1ZA 4Y7MA 1QSFB 3C6LB 3FFDA 4R9HA 2C3XA 2OXGA 4PJGF 4Y8DC 3N85H 3DRQA 1MHEA 3OR6B 4DGYL 4IIQC 2QKIA 2HVKB 4OTXH 4WEBL 1EFXB 1FL5A 1R3IL 1YQVL 4XCFL 5BW7A 4IOFD 1EGJL 4G8IA 3HRPA 3TEUA 3HS0B 2C3WA 5CJQH 3DVFA 5CEZD 4HZAA 4GBXD 3OKNB 4HEME 1MHPH 5I1GH 1T2QL 2WWMC 3MLUL 1DLHB 5F9WB 2MQCA 1P7HL 4QWWD 4G6KH 5IB4A 5DQDH 3QJHA 2MWCA 1BVKA 4F57L 5HHQB 1DLFH 2D03L 1ODAA 3QXWA 1T0MA 4XRCB 3RZCB 1IC5H 3TWCH 4HJGA 4U6HB 4NJAH 1JFQH 3WJLA 1XF4B 1F8TH 4Q9QL 5CHNA 4AIOA 3SJVA 1NCNA 1NBVL 4WNQB 3PWLA 4GMSH 2BJML 3WIHL 1OY3B 4OGYH 5EORL 5ACMA 1MRCH 5GJTH 5GS0H 2BC4B 3B2VH 4UINH 5DJ6A 3UTPE 1RULH 5ACZA 2LU7A 4UT6H 3CMOL 4NO2B 5IMLA 5CLWA 4YXKH 4P59L 4UIKH 4X6DF 3QWOA 2DB8A 3I84A 1Y0LB 4I48A 5C6TH 5A3ID 2JLLA 3U0PA 2APBA 4ZS7L 5T3ZL 3EJJX 4U4BA 4PJDB 4ZFZA 1RJLB 2EIZB 3MCKB 4KTEL 2VDOH 4OZFA 4L8BA 4UINL 4X6DA 1WGOA 3MV8B 2GEEA 4KKLC 4P3WA 3PWVA 1U8NA 3UDWA 3IXTA 1FVEA 1NMCB 3O11B 1RUML 2DIJA 2VR9A 3C6LD 1SBBA 3SKMA 4ZS7H 15C8L 3ZL4H 2FATH 5D7SH 1WK0A 4K3JL 3V0AC 3MLYL 3EOBA 4G8GE 3GMPA 2W0PA 3CSBA 4M6OH 4OT1H 3QDMA 1XGQA 1MFCL 2DL2A 3ARFC 1MFEH 2HRPL 4XWGH 2X1PA 4QRSA 5C3LD 3FQNA 5IBUG 5I30L 1MIEL 2VB5A 1SJEB 2BXYA 2R29H 5HGDA 3DURB 3MFFB 5IFAH 1KENH 1CLOH 3PP4L 2GJ6A 3B3IB 1ZLWH 5T1KB 1Q94B 1S9WB 3ARUA 4PJ5B 3VFGH 4P9MH 2GK0B 3QO1A 4OAWA 3QIUA 4Z95L 2LU4A 4YXHL 4TULH 3GI8L 5I9QB 2JK5B 4JFXB 4IOIB 4P9HC 4TUJA 2Q87A 4FQIH 2AI0H 4WWKD 4GLRH 3NIGE 2C1OB 5GHWL 2DQJH 4K3DL 3BZDA 4PJ9B 3JVGC 3ARBA 4CVZB 2WWMD 5IB3A 2G9HB 3SE3A 3TZVB 4Z7VE 3ALWA 1E4XH 1FG2B 5DFTA 3QEHB 5SX5K 4I9WE 4JRXA 3BQUD 4YK4C 3SDCA 4XVSH 35C8H 4NBZB 4WIQA 4UU9B 1CTNA 1KTDB 2JJWA 1MHPL 4M5YH 3U4EB 1Y6MR 3DIFA 3KPSA 3IVKA 3NPZB 2VE6A 2RR3A 1A6VL 3QDJB 1OF2B 3MROB 5EB9A 4N0UE 4XBPA 3UCRA 4M5ZH 4MDIB 3SGDI 4OZ4B 3QQ4A 4HCRL 4GG8B 3V8CA 4K2UL 2VLKD 3DLQR 4MS8D 3TVMD 4TNVK 1MCRA 3QXDA 5EUOE 3VE0A 4ELMF 5BZDB 4KY1H 1MCIA 4E5XB 4NKDB 3CSYB 4Z7QF 3LVEA 2FBOJ 3CMOH 5GGTL 4FA8A 2IPUG 3A6BH 1ZVSB 4MXVE 1I85A 4OJFH 1ES0A 2W9EL 1KNOB 4AENA 3I2CL 4EVNB 3T0ED 4Z7UB 1V3KA 4KQ4H 4IDJH 1UWEH 3G5ZB 4LPXA 3IDNA 4JVUA 3QUML 4GAJL 1CD0A 1MFAH 1MCLA 3SGKC 1JNLL 4OFVA 1RK1B 2EZ0D 3DUSB 5GRUH 3JTTA 2DYPB 4FXGA 5C0CD 1KELL 4OZIB 1LQSR 1T0MB 2Y72A 4WHYG 2Q7NA 5D5MA 3V6OC 4EDXA 4V1DE 3U30B 5ENWB 2GTZB 1KJ3L 3RNQB 2R39A 3ULVH 1G6RA 3DYPA 2XWTA 2W9DH 4GKZA 1CD9B 4AIXA 2HKHL 1IGIL 4DN4H 4XNYH 2NXYD 5D5MF 3CX5K 4JPKL 3FN0L 3GBNH 1T04A 2SEBA 1MY5A 4GSDH 2C26A 1DSFL 4PTTA 2IADA 5L7XL 1A3LL 2FECI 2XTJC 5IFAL 5I16A 1C12B 1RSFA 5DHVB 3F12A 4BUGA 4P9HH 5LGKA 5F71A 4MLSA 5EH1A 2FIRT 4M7KH 1G6RH 1V8HA 4PG9B 5LWYL 5EO1A 4FRWA 2EYSB 5D2LB 5FECB 4H26B 1BJ1H 1PW3A 2HH0L 4FQIL 5D7LA 3IRZA 1Z9LA 3WDJA 1UZ8B 1T6WA 4APQD 2IBGA 1NMAH 3K2UL 5F7DB 5HD8D 2P7TA 2ZOKB 2ZSWA 5BS0E 4YDLB 3B5GA 1XGTA 1HINL 1QRND 4GUPB 1WEJL 3OBAA 4N0CC 4IRJB 4QXTA 2QQKH 4UT9H 1ITCA 2EXWD 4OCRL 1CXKA 3KS0J 1M7XA 5B38B 2XNAB 3TJHD 3DV6A 4MJ5A 1SJEA 1I7RA 3QWRA 5E7FA 1R3IH 1XCTB 1YA5A 5MEOA 2V2TB 2R23A 4CGTA 4DKFL 4QXUL 2DLFL 3PL6A 3ARED 5I74C 5ISZB 2ENSA 1X7QA 4I13B 1DQML 2YS4A 4HV8B 2LTQB 1LD9A 4NN7C 1UB5B 4O9HH 2YD2A 3S35H 3V7AE 1KXVC 1X5XA 3VFTA 1OAXL 2R2BB 4KMTH 1YN7B 1T66D 2C1PB 5FXCH 4U1JB 3JV4B 4UILH 4U6TA 3OQ3B 1AO7A 3DX7B 3OKMA 4GAFB 4U1MB 5CLTA 4PJAF 3S4SA 5F9JB 3MUZ1 4LDOB 3O41B 1MWAA 3S37L 3TT1L 3RI5F 2B4CC 3PL6C 1MVUA 2F9BT 4XRCA 3W2DL 5GRUL 4HJ0C 4JM4H 5MEPA 3WNOA 4JG0L 1I75A 4LCWB 3DGCR 3MC0A 4JM2F 1UB6B 3O2DL 1CDBA 4D0DB 2JTDA 1CFQA 1AE6L 1S7XB 2HLAA 4NQVA 1GC1L 2BVQA 3HG1E 4PB0H 1N5YH 1NANI 2Z31D 1OGTB 2XA3A 5LQBH 1V5JA 1MCOL 4LEOB 3RWFA 4GW1A 4M48H 5C08A 5DD5L 4IJ3B 5IROC 3VFSA 3C5ZC 1EVTC 3TO4B 5D7IB 4R8WH 3MLPA 3U0PB 4FFWC 5CKGA 1YPZA 2F5AL 3MRGA 4PRDA 3LV3A 5LBSH 3S3SA 1AHWA 3PDDA 5C09E 5ICZA 5D6DA 3QFJE 1ETZB 4ZTOL 1ACYL 1A7PL 1A4KB 3RDTA 3S6CA 4LHJB 4X5WA 3DX8A 1E4KA 3T08A 5E2VL 1YMMD 4OZIA 3GMNA 3WV0A 3U1SH 3QXAA 5L2JA 1KN2L 4OTXL 5F89A 3EYVA 5KANG 3HNSH 4P2RA 4UOW0 5JIHA 4K7PH 1R0AL 4OUUA 1F3JA 1GIGL 3KPOA 5EG6C 5C07B 3GSRA 5BVPL 1XGQB 2YR3A 1FNSH 4NC1E 1CFTA 4ZDHB 2D0FA 3TJEL 1BJ8A 1JWUA 4HK0B 1YC8A 4HDIB 4WEUD 2SEBB 4WU5A 4QHUA 5BXFB 2IADB 5JW3L 3F5WB 3ROLB 2HJFB 2IPTL 3QO1B 5DJ0A 5C08E 1FNEA 5HVHB 4JFFD 2BY0A 3D3VA 4LCWD 3RVWC 1FNSL 4Y2DC 2ED8A 1U3HD 2HFEA 4YNYA 2OXHA 2CLRB 5D6CB 5A40E 1IM3B 2HTKD 2HT3D 5HYSB 2G9HA 3UYOD 5D7LB 3V0WL 5M95B 3QEGL 3V52L 1S7TB 2I5YL 5GS0D 4F58H 2G5BB 4LLQA 4P5KA 4M6NL 2I9LB 5KVEL 4L4TE 1ZLUH 3BEVA 1G7LB 3X13A 1S5IL 2DF3A 4J1UA 5B8CC 1U8PB 2ARJB 4UUJA 5TFSH 1RMFH 1KOAA 3MBEA 4Z78B 5EU6A 1YECL 1K8DB 3P4LA 1DJSA 4ODTH 3D18A 3HC4H 1V7ML 1J10A 1XGRA 4OZ4A 1CE1L 3HZMA 4YHKH 5I8KL 1B0RB 1L0QA 4HGWA 1EPFA 2EYTA 3MRRA 4OCSL 3TN0B 3TO2B 1P4LA 5L2KD 3IF1B 1ZSDB 4DKDC 4AH2B 1JE6A 2KZ1B 2VSCA 5HI4D 4AZ8A 3CXHJ 5GZND 5T1DL 5KVGH 3ZL4L 4DZBA 5DRWA 4MVBC 3UC0H 4CBPA 3E3QE 2FX7H 2EDEA 4N8CH 2XZZA 2I26N 4RCAA 1KIRA 4IEFB 4DEPC 2KBGA 4JM2D 2KUTA 4OQTH 4NJ9L 4XC1L 2H2SC 3WUWA 3VGAB 4MD0B 2FO4B 2OZ4L 3GRWH 1HHGB 1SVZA 1UA6H 4XPAH 3T2NL 4MLIA 12E8H 4GKNA 5IB2A 4GRLB 2VDML 3HRZA 3DUSA 3SQBA 5DXWA 2BMKA 6FABL 4ELMA 3HI1B 1J1XL 2ICWB 1FNLA 2L7JA 4NM4H 3QQNA 3H7BA 4U6VL 4HS8L 1EVUA 3AAZB 4HS6B 4ETQA 1KCRL 1UB6A 2E9WA 3C09C 3GBNL 4Z8FL 1OT2A 5DURD 5CEXB 1ZT4B 1MLCB 4PJHE 1RVFL 4KJPC 3L9RB 1KCUH 2VLLB 4HT1H 4ZUVB 1X9QA 5KSBF 3RP1A 3BP5A 2JJTC 2ZNWA 5J8OA 2VAAB 4XCCH 4WDIB 1YPZF 2DLEA 4R0LC 4S1RH 3GJFA 3AY4C 1J86A 1PG7H 5CWSB 3L3JA 5EBGA 3TBYB 1SEQH 2DKUA 1G7QA 1A7NL 3FT2B 1MCSA 3TPUB 4YDKL 3D25B 4U1NA 2UWEA 1FPTL 4RMUA 5EO1B 3AGVA 4LPYA 5E94A 2GAZB 3WLWC 1OAKH 4XAWH 4G8GD 1N0XH 4WUUE 4M62H 3QUXB 3FFCA 4Z95H 5I66B 4HK3N 2Y6SD 1A6TA 3V4VL 3OKDB 5DQJA 5BQ7B 3HNVH 3OJDA 1B2WL 1TIUA 3HG1D 2BVUA 2B0SL 2UYLB 1FL6B 4RGOH 3KG5A 5HHPA 3C9NA 1UENA 4KJYA 4KK8C 5GHWH 4BFIA 1VKXB 2JJTA 3E6HB 4LMQE 1WQVT 3TF7C 4IDJL 2Y07L 5GRJH 1S7RA 2R1XA 5T33L 1TJIL 2OYPA 3FN3A 4NZJA 3X11B 2BSTA 3KYKH 1H3PL 2QBWA 2VLRA 4LDEB 1YY8B 1CF8L 3VD3A 3PGDB 2QADB 4UQ2B 4HKJB 3TYFB 2NX5E 4I3SH 4IS6A 3DX9B 2R2HA 1FIGH 1UWGL 1X7QB 4YDJA 3NCFB 1MFBL 1T0NB 5KAQF 1YEFH 4L1HA 1PVHA 5D1QA 4CRPA 5HDBF 3UBXG 3QG6A 3UTTE 3CX5J 3V8OA 1X5AA 3MRIA 2WINB 1EHLL 3U0WH 1NDGB 2X41A 3MRKB 3MRDB 1D5BB 2LQRA 3V4PL 5FYLD 5I76B 1I9RL 1J1OL 3ZKMD 3MGOB 3NVQA 3DXAA 4Y2DD 5EZIH 4Y16D 1U8LB 1EV2E 4EXPX 5KN5A 4PRPB 2ADGA 3KLAB 4RNRA 5KW9L 5CGYC 3MBEB 1FZMB 4LLWB 4P2YA 4Z78A 1S7QB 1ORQA 5C9JB 2BNUB 4PJBE 1U8QA 1J1PL 5FYKD 3ZZ1A 4KK5C 1CFQB 3DX6B 4OB5L 1JGEA 4O02L 4M93B 3CMGA 1YYMH 1OW0C 3G5VA 4DWHA 1KUMA 1ED3B 1WCBA 2UZYB 3WHE0 3IDMB 2VUYA 3QJFB 2CDEA 3MA7A 3K74B 2H1PH 1HHHA 4HKBB 2GTWA 2B1HH 3U36B 1KIUA 2DJ4A 1ZLWK 4I0PC 2OP4H 1UT9A 4APQC 4Q6YA 1ZHKB 2R0WH 3O3DA 4FXKB 4MD0A 2HJKA 1S9XA 2CMRL 1WWBX 4OZGF 4P4KB 1VEPA 2ARWA 5JA8B 3VG9B 4K7PL 1R0AH 2F19L 2AJUH 1KB5H 4P5TA 1JK8B 4WFEE 1MUJB 4NRZB 4H1LG 4EDWL 1L0XA 5JOFB 4E41A 4WFHD 2OR9L 3SDAD 2DQIL 2CLVA 3D0VA 3VWKB 3KPOB 3LPWA 2I24N 1TETH 4WI2A 1U8IA 3RL2A 5T1LD 1MLCA 5IMKA 5IGXL 5KSBE 3QIWB 4KXZI 5ABDE 4HBCH 4QRPA 4X6DE 4M5ZL 4TVPL 4X6FB 1T2JA 1RZJL 3OF6D 4HDIA 1V3JA 4FZ8L 5INDB 5FGCB 2A1WH 4MHHI 3KAAA 4LPWA 2ZG3A 3GMRA 1JGLL 3OAUL 3OJMB 1F4HA 4MA8L 4MXWH 5DC4B 3MRMA 5DLMH 3BXNB 1I1AC 4DKAA 4L9LA 4NWUH 1R5WB 2X89A 4HQQL 1HQ4A 5HHNB 5D2NB 2ADJB 4QKXB 1D6EB 1C7SA 2NY6B 4D9RD 2XZQL 4NNXA 4GRMA 1N3NB 4HUUA 1HKLL 2CIKA 5L8JB 1I8MB 7FABL 3ARGC 4AEIL 4LLQB 5ID0B 1Q38A 1T89A 4HW6A 2X1QA 3GMOB 4OUOA 5ADOH 3UAJC 3U0TA 3FB8B 3QCVH 3CGTA 3BIKA 4NKMA 4UV7L 4KRLB 2UV3A 1X5YA 1KC5L 4NBYB 4RISH 2DI7A 4GQ9L 3A67L 3KR3H 3FQNB 2Q8BH 3IETB 3WFCL 4WCYL 5DGQA 3F7QA 5IOPB 1WISA 5D70H 4MWFB 2NLJB 4MMXC 2XPGB 5DI8B 4ODWA 2CKBH 3BZFB 4I9WD 3NCCB 4IS6B 3QCTL 3QDGD 2VOTA 4KKAC 1MRDL 3ZYJA 4Z7WB 3QA3A 3T1FB 3SDAB 4I0CC 1HCFX 3VH8A 2JK5A 4JFXA 2IFGA 2G75A 2R4SH 5IESH 1A7BA 3HR5A 1U3HC 2O5ZL 3CFCL 5IM7B 4OZHF 3OPZL 3MLTA 3ZT5A 4JPVL 4V1DB 1PX4A 4XVTH 2EDHA 2GY5A 1HHIB 4XWOD 4I77H 2CO6B 2ZNXA 5IHBA 4UTBH 4HIHA 5TGBB 3KGRA 5GRWA 4PYGA 3H42H 4NM8H 2Z92A 5J89A 1BFVL 5DMKA 3HAEG 3E6FB 4YHIB 1QZ1A 3NH7H 5F1OB 2VL5A 4F7CA 4XP5L 5C2BL 2QLVB 1INQB 1PZ5A 5HI3C 4TQEH 2VSDA 2V9RA 4EI5B 2EDOA 5F7NC 3UROR 3FB5A 4CMHB 2ICEB 2QTEA 5JQ6H 3U82B 3C87A 1GGBL 1LO0H 4J2XA 3QWOB 2XKNB 4E5XA 3VA2C 4U1SB 1OAZL 1BFVH 3L1OH 2DQDH 3H3PL 1QTYT 4M61B 4DKFH 1IEBA 3L5HA 3X3FH 1F3DH 3CXDH 4MDJA 2P24A 4XVSL 4TQEL 3GDBA 5GJTL 5DR5H 3TFKC 2AS5M 1U8JB 4LIQL 3H8NA 4G5ZL 3RTQC 4FQXD 5I1HH 3IXTB 3H9SD 4ZFFB 2D0HA 2PF6A 1I1YB 1QR1B 4QHLB 3UBXB 3EKCA 5C3TA 4CMMB 3QUXA 3BKJL 5CJ5A 1NGQH 3RFZC 3NMEA 1IT9H 2XZCH 3GJFK 3UC0L 2PXYD 1UVQB 2BZDA 2ZP0T 5FO8B 2VZ3A 4TTGA 2XWBA 4YHYB 5D1ZD 3CAFA 5ECJE 2PYEB 1IC7H 3P3YA 4HKZA 4NN6B 4OQTL 2DLGA 2D3VA 5GSVB 4GQ9H 3RWDA 4WGVB 1U8KB 5J6HA 2BSTB 4I3RL 3STLA 1FN4A 1EXUA 3NCBB 1HN1A 3EYUH 3PV6A 4CADA 1UJTA 2BVEA 3IRPX 4FFZL 3IFNH 2EE3A 5KSAB 3WEXB 3K4AA 4OZIE 3QDAA 3DSFH 3WNLA 3MFGB 3SO3B 4YX2H 3WN5C 3L5WB 5EIIA 4PJ8B 1YDPB 1GCFA 3UX9B 5J6GA 3T0XA 4AG4L 5IVXB 3HKFA 2BDNH 5D72L 5DTFA 4LFHG 4RAVA 5CEZE 5FECA 3FQTA 4PJXF 4ZTOH 1ZLVK 2NW2A 3RVXC 3QFJA 5IESL 2E7LA 2RCSH 1S5HA 5D7IF 1IM9B 2DLHA 2DWDA 4LRIA 4UB0H 3IJSB 3GMMA 5FO7B 4G6JL 3SO5A 3WS6C 5F7KC 1S7UB 2BSSA 4Q9RH 3GRWL 2RGSA 5B39B 4PTUA 1D5MB 5E1AA 3MRFB 3OKKA 2Z4QB 5HYJB 1LGVA 1JGEB 5L0QB 2ZSVA 2JB6A 1KB5B 1OAYH 5EOTB 3MLYH 4NP4H 4Y2OA 2IAMA 1NCDL 4YPJA 4JY6A 1NCTA 3V4VH 1M6OB 3QJFA 4TYUA 3PGFH 2GY7B 2F8VA 5JQ6L 2NY4B 5AG9A 3QA3B 1OP5H 2X4PA 4JFDD 4WO4D 3SDDC 1DP0A 3QEUB 3O2VL 2DMBA 2HKFH 3KLHD 1KBGH 1QA9A 4PV8A 4G6FD 5GS1A 2YMXH 3VXUB 1UXWB 2YUXA 3OKMB 5C08D 1JK8A 2YXFA 5TH2A 1VA9A 3BGFB 4MVBD 3PG2A 1W8OA 2P5EB 2ZOLB 1J5OL 2I5YH 3X14B 1RIUL 3TT3L 2Q8AH 4Y1AA 2E6QA 3PGCA 4XPFH 1ZTXL 3MJ8B 5KG9B 1X4ZA 1CR9H 1AFVL 3C5JA 5EORH 4NQVB 4RMQA 4TVPD 1DQMH 2Z35B 2A6JA 1NKRA 4M43L 1V7MH 2OLDA 3BKYL 5DRXA 1B90A 5E99H 2AV1A 3WD5H 5EZLB 1T83C 4M6MH 2J6EA 3PF2A 5KANI 3GSVB 4P2RD 4DKEH 2F53E 4K2UH 4KKNA 5FHBL 2I9TB 2VLKE 4PGEA 4G6AD 4N1EA 5IV2B 1A0QL 1P1ZB 2P8MB 3VGEA 3VWKC 4CVWA 1MCNA 1MI5A 4F9LA 1A5FL 1A4KA 3G6JF 2APTA 2NZ9C 3G9AB 1BFTA 1N5AB 4H8WC 1WFTA 1G7HA 1BJ1J 3BP4B 2WMPA 2JJVA 4N8VA 4X0KA 5IUSA 4P4KC 2HTLD 2UY7A 2W0FA 3VD7A 1F3JB 5E4IA 1RPQA 3UJIH 4RAUB 1G6RL 1CIUA 2ED9A 2R1YB 3ES6B 3GKWL 5GGVH 5IT2H 4MZ3A 3LKSB 4EBQL 3WN5A 3U2SB 1CGUA 2YZ1A 5KJRH 1XIWC 3VXUD 3SE8H 3NZ8A 5E6IA 1OAQL 2BNRB 4ZNEE 4CJ1A 4XH2A 3EYFA 3DYOA 3L7FA 4OKVB 3QO0B 3QUZC 4ODWB 2EDNA 4RA0C 1A6WL 4OZIF 4JKPH 4RFNB 1VADB 4TSBH 4JFYA 4Y19A 2X4TB 4UDTB 3SDAA 3D3VB 5GGSY 4RWYL 5D4QA 2HT2D 4XNUH 1JZ3A 5D7JD 4F3FA 1TQCC 2X4QA 2D31B 2GFBB 3UPCA 2R2BA 3D9AH 2LE9A 5F96H 2EXWC 2DD8L 3OGCB 4V1DA 3MJGX 4U1MA 3T1WA 4B53A 3QUKA 2XQYG 1P6FA 3CVHB 3O41A 3MPCA 1F97A 5GQBA 1W0VB 4ZFOA 5FCUH 5DMGD 5EN2B 3B5TA 1EFXD 1WBXB 4ONFH 4KMTL 4GMTL 5CIPH 3TBSB 3EHBC 4RAHA 3T2QA 1IEAB 1JPGA 4QNPF 3QIBA 2Y07H 2JB6B 1JHTA 2ITDB 5ITBH 4O5LH 3FFDB 5DEZA 4F9PA 2FZ3A 4HXBL 4XAKE 5F1NB 1YYLH 1T0PB 4NQEB 4P99A 5AD0B 3QULA 2ITCB 1KJ2L 2NR6C 5ADOL 3CK0L 4PJIB 1S7VB 5INCB 4KDTC 4DVBB 2FR4A 1AHWB 2BNQD 5IQ9B 5DWUL 1MF2H 2HMID 1BWMA 3EW3B 5JIKA 1C1EH 3C8DA 4UV4L 3ARDC 5B38G 5J3HD 1OTSD 3PWUB 3RIFK 4Q6IC 5HYEA 1L0YA 5IB2B 4E42A 5B8CA 5DD3H 2YA0A 1I7TB 5HVWA 4RWHA 2NCMA 5IBLD 4JN1L 1WLHA 4NCC2 2CO7B 3GSUA 4KGJA 5EU3B 1ND0A 3QCTH 1VFOA 1FVCA 4DFIA 2E7LC 3IYLW 4Y4HC 4YHLH 4P2QA 3MR9B 2PYEA 3IAQA 4G8FA 5I8CB 5GISL 4D0CB 3VXTA 2VXTH 3EJZD 4PJ9D 3G6AB 1ZAGA 2C4XA 5KOVC 4YC2B 5CP3H 5KBNC 4PJFF 4HWEH 1J7VR 1KN2H 2V9QA 2OR7A 2W60B 2WBKA 4YFLF 4JB9H 4YDIL 5HXMA 1FGVH 4U6YB 2YA2A 4XPGH 3B2UC 3VGAC 3WKML 5DEGA 4K55A 3T0DA 5BV7L 5L9DH 4JZJB 5E8EB 1T21A 2IH1A 1F45A 5CBAA 3UTTA 3BEWB 3GZKA 2H45A 4D2NA 2NY5C 3NIDF 3B6SB 5CEYA 1N7MH 4NOBA 3QDME 3RGHA 5CGMA 1SVCP 3BH9B 4EN3A 2APXA 1UJ3B 1W0WB 1G7HB 1IC1A 1E0OB 1S7TA 3ZE2E 2BOBA 4NQED 2XTJD 3ARGA 4JHAH 4JRYD 2DQDL 4L8DA 3ALPA 2R0KH 3GO1H 3IJSA 5D7IE 4X83A 2NTFA 2J88L 1M4KA 2X4NA 1Q72H 1T1YA 1BJMA 2X5PA 1KB9J 1D5MA 3SCMC 1A1OA 3U83A 1Z3GH 4HUWA 4QHMA 4U1KA 4JZNA 5HGDB 1LVEA 4PJXA 4XMPH 4HGWB 1B0RA 1YEHH 1I3UA 1VDGA 2F5BL 3SJVE 5JW4R 3UTQB 4D8PA 1WWWX 4PJDF 4FXLA 5IHUH 4Y16A 5GZOC 1VADA 3BGFC 3HC0A 3CH8A 4BSVA 4LARL 2X4TA 3FHQA 1BF8A 3MRNA 2AV7B 4S1DD 3HPLA 3MRBB 2AK4B 1WAAA 5CINL 2E7MA 3PHQB 1X6NA 4LU5H 5FV2A 5I8EA 3RY4A 5CEZH 1Z3GL 2LFGA 4KU1A 1U9KA 2V7HA 4H1LB 4OGXL 4YGVA 3QUMA 5I19L 2ZJSL 1CD1A 1UADC 3EFFB 1KPUB 2DTMH 4KRMB 3OKNA 4NO3A 3I02B 5IBTL 3IXAA 4LAQL 4MD4B 3QQ9D 1DR9A 1FORL 3X3FL 3NFSL 1H3UA 5B4MD 1G7JA 5KN5B 1HKLH 1JYWA 1Z9SA 1DVFC 4L9LC 4YUEH 3MNVB 1UGNA 4R4NC 1MJJB 3IFLH 5EBMB 5J4MA 4J12A 3EYOB 1L6ZA 3RDTD 1KJVB 3KYOB 5C0BE 2Q6WB 4XCEB 3H9SE 4GW5A 3SCMA 1JHKL 4R7DB 4JQXC 1JN6B 5FYKE 2FYYB 4AM0A 3UP1A 1MY7A 2A6JB 2FZ3B 2R1WB 4WDIA 3QXDB 4MAYB 3MJ9H 3HI6L 3GJFB 5E5UB 1GGUA 5F1SA 1UG9A 4NO0B 3S36L 4UB0L 4RMWA 2QJDA 3HE7D 3OB8A 1OW0A 1FFPA 4HPOH 3KNBA 1SJXA 2A38A 3LSOA 4N90D 4OZGE 4OZFB 4XT1C 5DMGC 4KTYA 3IDYC 2HJKB 4X8XA 2R15A 2OI9B 4A6YB 5KW9H 3MXWL 4E42B 3C6SB 3FO2B 3MGAA 5C0NC 2VIRA 3RAJH 1IVLA 2BSRA 2NY7L 3LEXA 3QH3A 4UBDD 3BP4A 4NRZA 5EOQH 5JO5B 4NQCA 2P49B 2BSED 5EU3A 1I8KB 1LO2H 1VHPA 3W82A 5DJZA 1NEZB 5KS9B 3LRSA 1UA6L 4YHNB 1CZ8H 4Y4HD 1IKFH 2FRGP 2HKFL 5EO9A 3HE6C 4V2BA 3O6FB 1ZHLA 1RI8A 4PR5B 3N9GL 5DUML 4N90E 1VERA 5E8OA 3ILPB 3VRLE 1Q9KA 5GPRA 2E5EA 3ARDD 4APQB 1E27A 4TRPH 2DWEA 3ALXA 3FO9B 4HKJA 5ALBL 2FL5A 2DD8H 5L8KB 5BRZD 3N1QC 5CEYB 3BT2L 3QNZA 1GOGA 2W92A 5D93C 3RUGE 3ARFA 1SY6A 3OXSB 3LKRB 1MH5A 5KVFH 2V2XB 1ZHBB 3WJJA 2P5WE 4XNQB 3MUJA 2WBJC 3MRPA 4M6ML 4ALAH 5ADPH 5IB5B 4MSWB 3C8KB 4PY8J 1A9EB 4K8RL 5EN2A 5FYJL 3VRIA 2X4NB 1UWEL 3HI5L 3HMXL 4NNPH 5IK3A 5J9PB 2VDKL 3IU3A 3O3EB 3B9DA 3TBSA 5DJCB 3LKPA 1I7RB 1QHPA 2ZUYA 1IGFH 2FJHA 4FFWD 3ZSTA 1XCTA 3CDGA 3QXVA 1WCBB 5DI8A 3P0VL 3FQWB 2FECL 2APWA 5D1XD 5BZDA 4HGKC 3DV4A 2IQ9H 3FHAA 3CFJB 4OFYA 1R3JB 5SWZA 4X4YB 1N2RA 2GTWB 2BVPB 4JHWL 4QT5A 2KH2B 1J1PH 4HIEB 4M1DL 25C8H 3QEQA 4PGBB 5EC1A 4PLNC 4F8TA 1XGUA 3MBXL 4ORGB 4MJIB 3O6FD 3VXSA 1LEIB 4HMCA 4WY7L 5CIPB 3DMMC 4Z0BL 4CL7A 1AGCB 1OCWL 1YPZE 3HAEB 3I2CH 4RGNC 2Z31B 1UWGH 3QUYD 3JTTB 5I1EL 1HOCB 2FATL 5D7SL 1K8IB 1EO8L 4ZOCA 1SYSA 3IDGB 4XVJL 4UQ3A 1JF5A 5TF0A 4AMKH 3BOVA 5F21B 1T66C 1U2HA 5E2TH 2NZIA 5LWYH 3TC9A 3ZYOA 2R0WL 1YNLH 2FX8L 3NAAL 4JZJC 3KYOA 5FA4A 1XR9B 4P2OB 1CG9B 1NGZA 4OF0A 4U31A 1TZHA 2E7CA 3PJSB 5D1QC 1D6VL 4G80A 3FB5B 1NC4B 4OZGA 3VFWA 4GOSA 4WU7B 1AO7D 3MUGA 2WUCL 1R6VA 3I6KB 1FAIL 5CSZA 3BPNC 2A77L 3QRGL 4MX7B 1NFKA 1L7IH 1MFDH 5E2UH 2EDQA 4Q74A 4JPKH 1IGTA 1NAMB 3GSNH 1HILB 3B5HA 5TQ2L 3IDIA 1EO5A 3ULVC 3GKWH 1IQDA 4HIXL 2OMBA 3KPQA 5IGXH 5EWIL 1WCQA 4LGSB 2MTPA 3IKKA 1KT2B 1RAMA 3ZKXC 3GSQB 1OB1A 4GRMB 2FEDD 4DUWA 5J56B 2NW3A 1F90L 3L7EA 3P4OA 4LCCA 4NUGL 2DRUA 3W5NA 1F58H 1ERNA 1MHCB 2H8PA 5F7WC 5HHMB 5IVXE 1KPVB 4XHJD 3EZJB 1JPTL 1H3TA 2C3VA 5HHXH 3NIFE 3LPFA 4OIIL 3P73A 4MMZC 4X4MA 3LEYL 3BW9B 5MEOB 5BCAA 1I1FB 3CFDA 1I1CA 3MLVL 2X4UA 2Y6SC 3AXLA 4H0HB 3KYKL 3LB6D 3RTQB 4XNXH 4GAYA 1SJHA 2Y36L 3WD5L 5SV4A 5TE4L 3V5DA 3ARRA 2GITB 2JCCA 4HBCL 3MRBA 3L5WA 5EIIB 4MA3B 2K3TA 1LD9B 3WFCH 1OSPL 2OK0L 4YPGB 4BZ1L 4MS8C 3AFLA 2M1KA 1I1RA 1D9KD 1U8MB 2DMCA 2DOCA 4KPHL 1S9YB 5TE6L 3NIFF 5H35A 1AGBA 1NCCL 4L4VA 5GRVL 4DGVL 4L5FH 3TLRA 4HF5L 2PUQT 4Y0GA 4OV5A 1I9IH 1EIBA 2DQHL 4G7YH 4Y4KA 3MJ6A 1HNGA 1A14L 4PJ9C 2VDRL 4ZOBA 3L3GB 4O2FA 2G2RB 4UILL 4OF5A 2IPKB 3KPPA 5JNYA 1ZANL 1P7QB 4UV4H 1HE7A 5EU6B 2DBJA 2G60L 3CFCH 1JGVL 4LPUA 4PJEB 4DK3A 5E2WL 43CAB 1YJDC 4OF8A 5A3IC 3V7MA 1OGAE 2ICEA 3O2DH 1F4YH 1Q9WB 4FMFA 4FQQA 2R8SL 3OKEA 4CN4A 3RHWF 15C8H 2YPKB 4PIRF 4QTIH 4NRYA 1KIQB 3MXWH 5D70L 4C55A 1QFWH 2DKMA 1FV1A 2P24B 5GGQH 2EEBA 1RIVH 3KXFE 1G7IA 1IEHA 1T03H 1AGFB 2APVA 2Y5TB 4PJCA 4G6JH 1LEIA 1NCAH 5JHDD 4LF3B 1W72A 5JTWA 1RURH 3GNML 5D9SB 5F8QC 2J8UB 3BD4A 4DCQA 1TNNA 5EUOA 3T3PF 2H3NB 4WFGD 2E8ZA 4I2XB 4RMTA 1XF4A 2M8XA 4KI5C 3JWOH 5K33A 1S78D 3M1BA 5KG9A 2WWKT 3JV6B 2XKUA 3U7WL 1EBAA 4G5ZH 3RKDC 2WBJA 3RWHB 2BHYA 3ZTJH 1DANU 5MI0C 5GSVA 4XCYB 1GVIA 3KPSE 3KHOA 1HI6B 3MLSL 4NKIH 3U46A 2XQYK 4Q9QH 5DK3A 4YHOL 5C0GB 4HIIA 1JUFB 1K5NB 4N1CA 5DC0A 2HJFA 1FHGA 5LXGH 3ARQA 1JNJA 2A6DA 4PY7B 1YDPA 2DQTH 4GRWB 1LP9A 3BHBA 2PXYC 4PG2C 3SGJA 5KAQG 3TBVB 4OFDA 3WDIA 1BVZA 3P9LB 3BI9X 3VFRB 4OGZA 3GSQA 2XWJA 3T0VA 3AU1A 4X0KB 4HUMB 1RIHL 1UXSB 3DUUA 4OZFH 5HPMA 2QADD 1BQHB 1XF3B 1J9CT 1DFBH 2JELH 1H3PH 2WWKO 4BFIB 1VKXA 4HWBA 3SDDB 1MPAL 3BYTA 2AKRB 3D2UB 5GGSA 5AWNH 5JOEA 5LKNA 4WFFE 1RK0B 4MD5B 2FJGA 3D85A 3EOAA 1EBPA 1CXLA 4GMSL 5IG7A 1JGVH 4JFEA 4J3UA 1WIPA 3RWCB 4OT1L 3VRJA 5ITFA 3FQWA 2PTTA 2DI9A 4XZUA 1U6AH 4UQ2A 3TYFA 1HZHH 4HC1H 2R2HB 1UWXH 3KPNA 1FYTA 3E2HB 4J8RB 4IOIA 4K94C 4NGHL 3S3JA 2YXMA 1F13A 2LVCA 3L3IB 2W9DL 2PYFA 1E6JH 2CKBB 4W4NA 1R5VB 4JJ5A 5E9DA 4ISVA 1AJ7H 4M7JH 5FHAL 4YX2L 3HRZB 4M93C 4I77L 2F74B 1NFDE 4OFIA 3ULUF 3TH4T 4TRPL 1MAKA 4ZSOE 1CDIA 2PR4L 5IHZA 1RZIA 3BPLC 4YDLC 4LVNC 4X4ZA 2P5WD 3OX8A 3GRWA 1E6JL 2H32B 3BKCL 4RRPG 4LQ1A 4GG6E 1I9JH 5ACLA 3PJSA 1A47A 3JWDH 3KYNA 3GSNL 4PJIE 4RQQA 3AS2A 4HGMA 1UH2A 5DRXB 5I75B 3CSYA 2GSIB 1NFDF 3QULB 3M8OL 2A73A 1CLOL 1Y6NR 3TBYA 4GT7A 5FGCE 4ZFZB 1UFUA 2I9TA 3V6FB 1G7IB 3NA9H 5DHYB 5D93B 2WBJD 3CX2A 2NY3D 3G5ZA 2O5YL 4B50A 4LIQH 3VMOA 5E56A 4POZC 3T09A 4XNMA 2Z8WC 3MMEA 4PJ7E 5CD5D 4NUGH 1N8ZA 3O6MH 1T5WA 5F7MC 4I3SL 1A21A 1IL1A 4M6AA 4NN5B 2HMIC 4TTDD 3SGEH 1A6TB 2BOCB 3VXRE 3VFOA 5J1TC 3GSXB 3SDYH 1E4XL 4XB7A 4TPRH 4RZCA 5SX4I 3FQRB 4IMKC 2VWEE 2W0FB 1NAKH 3BSZL 2VR4A 2DQEL 2EICA 3BMVA 4HX1A 2HFTA 4LLMA 4FZEL 4B0MM 4QRPB 4YZFF 1F6FB 1A6VH 4Q6IB 3ULVL 1OAUL 4FQ2L 1ZTXH 1FL3B 2IQAA 4JRYA 5T1KA 5IW1A 4JN2B 3MREB 4XVJH 3KJ4C 4AEEA 1IAIM 3F12B 5H37H 5FKPB 4XP9L 4TUJB 1AGDA 3SDCC 2XN9B 4RSVA 4W68A 2GFBA 3EDFA 3IGAB 3GJEA 4LRNH 1NCUA 1T5XA 4R0LB 1SEBB 2WM0A 3MRDA 5EIVA 4IRSB 2IPUK 1FG2A 1OPGH 1J1XH 3V6OA 1ZLSL 4H20H 1AH1A 4OCMC 5SWZE 1U8LA 3RWJA 1NSNH 3LZFH 2CKBL 5TPWH 1VGEH 4XP4H 2VDQL 1OF2A 4NFBA 3CFEB 4F37F 1JPSL 4LMQI 4BM7A 2VLJA 3MV01 3P30H 3A6OA 3CLEL 3EOAB 3I6GA 5KVDL 4ZXBC 4EXKA 4MYWB 4K9EH 5FYJU 4NBXB 3VW3H 5F1NA 3PV7A 2RBLA 1H8SA 3GIVB 3PL6B 1M71B 4M8QB 4BQ9A 4OCWL 3L3KB 3ZTNH 3MYJB 2OL3H 4M8VA 1FZJB 1LE5B 4DN3H 4K7FA 1FYTB 3VXMB 3ARTA 4DVBA 4BKLB 4RFNC 1R24B 1Q9OA 5ESQB 5BVPH 2UZXB 4HWBH 3BT2H 1UCBL 3O81A 5HHME 1NJ9A 1CGYA 2PO6C 4O51B 4MXWL 1MUJA 4L3CA 4DQOL 1DBKH 1QQDA 1CGTA 3BH8B 4XNXL 1XFPA 3NGBC 4K3GA 2AEPH 4O00A 3T04D 3OKLA 3RU8H 5GGRA 3UYPA 1MJJA 1I1AB 3MJ7B 1J8HE 3FQUA 5IHLB 4M1GL 2VDKH 2AJZB 3QDGE 5FUCC 1LP9F 3GFUA 3WMSA