1QFPA

N-terminal domain of sialoadhesin (mouse)
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
118
structure length
118
Chain Sequence
TWGVSSPKNVQGLSGSCLLIPCIFSYPADVPVSNGITAIWYYDYSGKRQVVIHSGDPKLVDKRFRGRAELMGNMDHKVCNLLLKDLKPEDSGTYNFRFEISDSNRWLDVKGTTVTVTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords PROTEIN (SIALOADHESIN)
publication title Crystal structure of the N-terminal domain of sialoadhesin in complex with 3' sialyllactose at 1.85 A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 24
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1999-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1qfpA00
5ILTL 2B2XH 4IJ3C 4F2MA 5D2LF 4FQXA 4WO4A 4JREB 1LO0H 2ADJB 2QR0A 1QO3A 5EO9A 2DWDA 3VXTA 3BPNB 4ODVL 4F58H 2XICA 1OGAB 3ARFA 5ICXA 2W0KA 4JPVL 2G60H 4WO4C 3PNWA 5E5MA 5T1DH 3TN0B 4S2SA 2VLJE 2VLLB 4Z7QF 3UMTA 1R5IB 4F7MA 4HJ0D 4UIKH 4EXPX 2W65B 2ZCLL 3P73A 4D0BA 3BH8B 4LFHG 2APFA 2P8LA 4KVCL 4LLVB 3WIHL 1X5FA 5MEND 3I6LD 3DHMA 3CLFH 4XVUC 1W0VB 3C5SB 4FQ2H 1S7QA 5JIKA 2WUBL 2PR4H 1V8HA 4HCRL 2AXGB 3ALXA 3ZKQD 3JWOL 5A2JH 3KJ4B 4FQJL 5DJXA 3BDXA 4JDZA 3KPSB 2DB8A 1T1XB 1U41A 3HZKA 4HWNA 2ITCB 3U0WL 4KGLA 2COQA 1T1WA 4ZPTA 5E9DD 4JFFD 4YNYA 1HINH 4XHJD 4ZFFA 2GY7B 2VXTL 3P4OB 2DKUA 2CXKA 5I1GL 3GIVB 1BQLL 3VXSE 3T3MF 1BOGB 4URTB 1B0RB 1N64H 2QADB 1A6VH 5F8RC 1D9KA 1SHMA 2F5BL 4NCC1 1YQVH 2X70A 3B4NA 3F65A 3ZE2F 5DJDA 4G8FA 5E7BA 2P5EE 3ARGA 1IC1A 3LPWA 3BD5A 1D9KC 3EUUA 1V7NL 1U0QA 3MRIB 4FTVB 5LCVH 4WU7A 4POYA 5FYKE 4PRBB 2FSEB 4FQQB 1A7RL 3CK0L 3EO9H 4PJBF 4L4JA 3CVHB 3RDTD 2EO1A 4GQPH 2FB4L 3WFDH 1A1NB 2DYPB 2H8PA 1ZT4A 3AFLA 5B3NA 3E6FB 4YAQA 4EUPH 1MJ7H 5I15H 1HXYA 4NP4L 3GKZA 1T21A 2JCCF 4U49A 4QT5B 1QA9A 2IFFL 3MODH 1E4WL 3LAFA 2RBLA 1DBAL 1UA6H 4RISL 2DTMH 2YUVA 5FCUH 4C4KO 4P9HH 4S1DC 2EDFA 3IAGC 3GSWB 2NXYC 1JPTH 2NYYC 1HH6B 4NQEE 4WFFE 4AJ0A 3MV8D 4CDHA 2ZG1A 4QWWC 5I8KL 5MEQA 5GGRA 1NANH 3SGJA 3WIIL 5E99L 3I2CH 3PP3K 2OL3B 4JFOA 4GKSA 1BHGA 4YPGB 4QO1A 5HGDB 3D3VB 3O0RH 4NN7C 2WWKO 1T0MA 3DRTB 3VCLA 2HFFA 3SGJC 3SGKA 2W59A 3ZO0A 1FIGH 5DJYB 4X83A 4WFHD 2Q7YA 4KROD 4HIJA 2DI7A 1XCTB 2QTEA 4H88H 1QSEE 4Y2OA 1RJZB 1OSZA 5KSBE 4Z7UE 3GBNL 4RZCA 2WLZA 5IT2H 1UADC 3ZE1F 2UYLB 2YPVH 1CF8H 1U95A 1TZIA 1FSKB 4FHBD 4XGZB 2J8UE 1EFQA 4LVEA 4X4YA 3UTTB 4HDIB 3NFSH 2GCYB 3FHQA 4DVBB 4FFZL 25C8H 4PJCA 3O3EB 1KJ2H 4ZUSA 3GBML 3KYMB 2BC4B 4JM2B 1N7MH 3D1MC 5K9QI 4LKXA 1CT8A 3ECBB 5J4MA 4XNXL 4XPFL 4C56E 3S34H 4IRJD 4HHAB 4EQ2A 5K9JL 5EU6B 1VEPA 1LE9B 1QLEH 2HG5A 5IOPB 5EIQA 2Z8RA 3NACH 1EHXA 2BNRA 1VA9A 2EE6A 1Q9LA 3SO3C 4M93C 1FLTX 3RI5F 3SKJL 1KCLA 5GS0C 1EEYB 4CVXA 4NN6C 5LBSL 3WNKA 4N0FB 4TSAL 2DDQH 3EDEA 35C8L 3TWCH 2XZZA 4OLYH 1YJDC 5BMFH 3U36A 4ZNEA 3O3DB 1RZGA 1ZLVH 4CADA 4JFDE 1JNNL 1CGSL 4YLQT 2VLMD 4O4YL 2DJ4A 4NWTL 3WN5B 2GSGB 5GGUA 5E8OA 4ZPVB 1J8HA 1XF3A 5BJTB 4OLVL 4HG4J 3U30C 4P2OB 3MRFA 4TULL 1LMKA 4EIGB 4Y88A 1NUNB 4X5WB 1FO0A 1IGML 4XC1H 2AJ3B 3G5YA 5ANMB 2QSTA 4RGNC 1OB1A 2NTFA 3D9AL 1MIML 3ME0A 4AEIL 1J1OH 3D0LB 4MDIB 5DJZA 3OXSA 3UJJL 1AO7E 1HHHB 3V0VB 2D2OA 1KPRB 4PJ7E 4GQ9L 5DZLA 3QUYC 1B3JA 3OB8A 5I8CB 4MS8C 2A0LD 1FRGH 2XTLA 3MRGB 4P99A 4UT6L 4BK5A 1AGFA 3B9KC 3PUCA 3ZKXC 5KANI 4BKLA 2YD1A 5INCB 2JELL 3VFWA 4ZXBA 1MI5D 4JZJA 3GMRB 4N9OB 2DMKA 2ED8A 5BRZB 4HLZH 4P4RA 1EJOH 4NZRH 3BQUB 3DGGA 4FNLL 1QFWH 4GXUN 2A73A 1K6QH 1FFQA 1X7QA 4ZXBC 4JZJC 5E8DL 5HDQH 2MQCA 3D69B 4XNMA 4G6AD 5DK0A 1MNUL 1LEKB 2PTUA 1FQ9C 1RJYB 1JWMB 1UCBL 3PWJB 3Q5TA 5BVPL 3SOBH 2AXFB 1JRHH 4Y4KA 4BFIA 1IQWL 4R3SA 2D4DA 5EC2B 4XNYL 3VGBA 1XGYL 4ZFOA 4XVSH 5L2JA 4K3DH 2EKSA 1MCDA 4H1LB 1EIBA 1G7QB 5I2IB 4A2LA 4ODHH 4Y4KC 4JFXA 4DN4L 2VC2H 4PV9A 3IRZA 5GIRA 4E5XB 4M7LH 4YDIL 3WLBA 1F2XK 3K81A 4JG0L 4GRLB 4G5ZH 5JXAH 1WBYA 3G6JE 1INDH 3TYGL 3ULVE 4Z7WE 5M94B 5DT1L 2VLRD 2GTZB 4HPYH 4TUJB 4FQCH 4PLNC 1RHFA 4FRWA 4IOIB 3AMLA 1U8HB 1WZKA 2BHUA 4XNZB 4HS6A 4K3JL 4BA8A 1XF4A 3Q6GH 1FNEB 5C9JB 4UI2A 1T2JA 4JDTL 5E1AA 1J5OL 5TDPB 1WTGT 4G8EB 1CGXA 3LIZH 4AY0A 2IPUK 3TBWB 4HUVB 1HWHB 2EYSB 5FO7B 4NJAL 4LCWB 4NQUA 5D8JH 1FORH 3U1SH 4KJYA 3FFCA 3WUZA 3B6SA 4G6MH 3CMOL 4PJAF 4R90H 5HXMA 4HPOH 4S1RL 3W2DH 4PYGA 3DSNA 4N8VG 2P48B 3UTOA 1EBAA 4X5LA 5I8EA 5DD5L 1GGYA 1PG7W 3D2UD 3GKWL 2SEBA 1OAXL 4GG8B 3BT2L 3R1GL 3DIFB 4ONHA 4QGYA 5HHPA 5L0QC 4NZDA 3ULUF 4XPGH 4MJ2A 4H25B 1YEEH 2ARJA 2G60L 3NPSC 3FONA 2EZ0D 1YEKH 5I1DA 1SVZA 2HP4A 4BJLA 4PY8J 2C1OB 3LV3A 3NABL 3AGVA 4YX2H 1ONQA 1MCBA 3UO1H 3CXDL 3V4VL 1EXUB 1KT2A 2XG5A 4W6WB 4ZG1A 4PJDB 4GAFB 4Y5VA 4A2MA 5BV7H 5F9JB 2PR4L 1YMMA 3PWVB 4Y5XA 4MCZB 5DRXB 5IFJB 5KW9H 1QRNE 3KPMA 3QA3B 3ALPA 1OAQH 5FXCH 3DX7B 5EN2A 2YC1A 4ZUTA 3CDYA 4PRPB 1F2QA 3VFNB 4Y5VC 5IEHB 4Y5XC 4WU5B 5DD0H 5E03A 3WCYA 3RX5A 4LOUD 3MJ8B 5E24E 2LU7A 3KPPA 1OOAA 4YHNA 1MHEA 1KTDB 3L5HA 3B2UC 4MYWB 4AENA 4PRDA 4TNVF 1CL7I 1C08B 4UOW0 1K5NA 2HKHH 1GGIH 1A3RH 3HNSH 1N64L 3RWCA 4ELKA 1CK0H 1XGUB 4OGYH 4UT9H 4PBXA 4GW1B 4HWZB 5F9DC 3KLSA 4HBCH 4HFWB 4D3CH 1CDYA 5LGHH 1YQVL 1E4XH 1RZJH 1UB5A 1MVUA 3BPLB 5ALCH 4OV5A 1MFBH 4GBXC 3T0EE 5I18L 1UM6H 1QACA 3UJIH 5J6GB 1FPTL 4ZYKB 4PD4J 2OM5A 2F8XC 3QXWA 3CFCH 2QHRL 3AY4A 4YEFA 4DN3L 1ZA3B 4K3EH 1LD9A 4P5KB 2AEQH 4TYUA 5FM4A 3WFDL 3Q3GB 5D7JD 3DUSB 3AY4C 4LHUD 5DJ0A 3CZJA 4TRPL 3K0WA 3BD3A 2C3WA 5DMGD 3DMMA 1T3FA 4MJ6A 2HTLD 5I15L 3G6AA 4Z95H 1MELA 4EI5D 3N9GH 1JGDA 1S7SA 5EDXA 1BJ1H 3C5ZB 1WC7A 4TN9A 5E6ZA 1HYSC 3KPRD 3DMMC 4U6YB 3K4DA 3RWEB 2V2XA 1S5IL 2BNUB 1AGCA 3KYNA 2LVCA 3QDJD 4HV8B 2GUOA 2Y6SC 3MJ9A 1IAMA 4HZLA 5BQ7B 3CH8A 2ZCKL 4YGVB 3H2WA 4JY5L 4KHXH 3BGMB 4QF1B 5ERWA 1R5WA 3BGFC 3VFTA 4NO2A 2DKSA 4YHIB 1II4E 3O0RL 5LVEA 1LK3H 1LO5B 2D0HA 1FIGL 1ZOXA 4JPIB 3E3QE 3FO2B 3P11H 2HT2C 4YDVB 4XZUA 3H9HB 3OJ2C 1JF6A 1JZ2A 5IT2L 3HC0B 4ZNCD 1AXSA 2QKIA 3VGGA 3PG2A 4LIQH 3LRSB 2EIEA 4HK0A 4OF8A 1VEMA 5F1OB 5IBLD 3VRJA 2Z91B 4S10A 3PL6C 1SEBA 4RBPH 2J8UF 3OKMA 4PJGA 3BPCA 4TNWK 2C1PA 4NIKB 4PBWD 2KPNA 2F15A 1EFXD 1KIPA 2UV3A 4QHNA 1ZHNA 4JZNB 1N7ML 3RVXD 4G42A 4PJ5A 2WUCH 2AJYH 1N6VA 3IDNA 4IS6A 1FBIH 1WZ1H 4LQFH 1G7LB 1RZ7H 5ITFA 3OGCA 3O6FA 1DSFH 1LO4L 4KK9C 4NJ9L 5ECJE 1QLEL 1Q94B 4PD4K 1DANU 4TVPD 2EECA 1N5AA 4FQ1H 3SDDC 1VFAA 3UYPA 2FYYA 2FGWL 3HI5H 2BVPB 3GFUA 1YJDL 1DQLH 2WMPA 2EDLA 3O6FC 1OP5H 4QTHA 5AYUH 3RL1B 3H3KA 4QRRE 5EPMB 1W72H 1N3NA 2GK0B 5ID0A 4NQDD 3UX9B 4JQIL 2EH8H 1IBGH 4LEOB 2DDQL 2C26A 1I8LC 1JPGA 5BMFL 3FJTA 3VXUA 4AEFA 3QIWD 4ZOEA 3X14B 4QRPD 4HMCA 2W60B 3GHBH 2IPKA 3S3SA 3UCRA 3QULB 3FQUB 1FL3B 5HGBB 1LK2B 4F8TA 4JPWL 4QOKB 4P48A 3PV6A 4OZGB 4Q9BA 1S9VA 3QPXH 3RFZC 3BN9C 2BY2A 3ULUH 1PZ5A 4POUB 2MNUA 5DD3L 5FV1L 4FMFA 2VAAB 4XC1L 5FM5O 3VFMA 3RNQB 1JP5A 4OUUA 5E9DB 1AGEB 4HKXB 1PKQE 2YPLE 3MR9A 3OJDA 1BFOB 5ENWB 5HHOE 1OAYH 1NBQA 2NY5H 1EZVY 5D9SA 4GLRI 2E6JA 2EXWC 1OP9A 2DBJA 5KSUA 1G0XA 4HUMB 1HSAA 4FMKA 5JA9A 4C83A 1JHLL 2P24A 5GISH 1DQDH 1DLFH 3D39B 4MSWB 1G6RB 2WW8A 4JJ5B 2OTUB 3MRMA 5D7LE 4O5LL 3VFUA 1I9JL 4DKEH 4JM4H 1QVOB 5HPOA 1ZGLA 4PRHA 5C6TH 3KNBB 1ZHLA 3OV6A 5C0BA 3V0WL 4ZO9A 3SGDH 1WISA 4R97B 2O5XL 4F7TA 4XXCA 3D18B 4JRXD 5D6CA 1CE1L 3DARA 5J11B 3GJFH 2CRZA 2QQNH 3OF6D 2VZ3A 3HAEB 3ELAT 4YR6A 2LTQC 2OR8A 4R9HA 3S4SB 1ETZB 3WXVH 4XXCC 4CNIA 2NY1C 4P4KA 4HXAL 5JHLH 2PKDA 1A1MB 4HH8A 1ZWIB 2VDLH 3UTSB 5I1JL 1QNZL 4M7KL 1V7MH 5HYQB 4NQCE 1QSVA 5ACZB 2FBJH 4P4KC 4QY8A 1I9EA 2WBJD 4K3DL 3T8XA 1MCIA 2YPKA 4U0RC 5CMAA 5JMOC 4K71B 4LGRB 4LCYB 3EHBC 3QI9A 4M7LL 2D31A 3BW9B 4G5ZL 5JXAL 1INDL 3HNVH 4G6KL 4U2YA 3ULVF 4LARL 1X44A 5JPMB 1OTSD 4CDGC 4HPYL 3QI9C 3QBTB 2WIIB 5IB5A 5C3TA 1OWWA 3VFSB 4QHLB 3IU4L 1A6UH 2JK5B 4ZO6A 1JYVA 2GJ6E 4KQ4H 3QXAA 3MYJB 4F7PA 2BXZA 4J3OC 2ZP0T 3D85A 3O2DA 1AD9B 1YY8B 3GIZH 5J13B 4YK4C 3PHOA 1BJ8A 3W9DB 4D8PA 1D5XB 3IFNH 3QJHA 2FJHB 3U1SL 3QWOB 4G7YL 3H0TB 2FX8L 4G6ML 2HN7A 3PHSA 1H3WM 4FFVD 5C0DB 5HVWA 4E0RA 4HPOL 2YWYA 2AABH 3QH3A 3BESR 2VDOH 3BWAA 5I66A 4WEMB 1FVDB 2PYEA 1R3JA 2VIRA 1RHHA 3WHXA 1KLUB 5CBAB 3NIDF 2XWJA 1GCFA 4IRJB 1S7TB 1QSEA 3RNKA 5JXEA 2GTWB 5KSBA 4F8QA 3UROR 1F00I 3UTPD 1D7FA 1YEEL 5F7FA 4EZMA 5EUKA 4EDXB 2RFXA 5BO1L 3FB5A 3G6DH 3FL7A 3LKPA 4QXUH 2A6KB 3HC3L 5J6HA 5JXEC 5DK3A 4NNPL 2DQHH 3P4LA 4KMTH 5FB8A 5GS3A 1YEDB 4NHUA 4WENB 4JLRB 1TTGA 2HJFB 3AS0A 4XP6H 2VE6B 1HHGB 4EJ1C 1LEIB 3F7QA 3TBTB 1CD0A 3C60B 3P0GB 1OAQL 3ARRA 1QTYT 4JO4H 5HSFA 3MYZA 3LMJH 3PABA 3TBYA 3L7EB 3MO1A 2CLRB 3ZTJG 2E7HA 4HS3B 5DD0L 5J1AA 3DECA 3G9AB 4I4WB 3TT1H 1WCQA 3OZ9L 3R06B 5DRZB 2B4CC 3MRDB 1U3HB 3I9GH 4GRWF 1EAJA 3P4NB 3SCMA 3DX9A 2X4TB 1YN7A 4HC1A 1WFNA 4C54A 5GZNC 2VSCA 4N5EC 5FO8B 3S88H 1N6QL 1GGIL 1A3RL 3HNSL 3OG4B 1CK0L 4CMMB 3GNML 3NZ8A 5ICYA 4JFDA 3SCMC 5T1MB 4OZFH 1E4XL 3P30L 1RZJL 1QLRA 4KI5C 4JQVC 3HR5A 4LRNL 3MRBB 5ALCL 2X4QA 5IHUH 3HZYA 3CUPA 3EYUL 5E00A 1RSFA 4OGAD 1UKQA 3TYFA 2FHFA 4WW1B 3ILQD 4JANB 3GMLA 5CP3H 2HVKA 3B9VA 1BIIA 4HKZA 2ZKHL 5E2WH 3SGEI 1CZ8L 3ARBD 5HHQA 1NDMA 5CJXA 4MD4B 4Z0BH 2BCKB 2Y1VA 1TTFA 4U6HA 4OAWB 4Z95L 2WINA 1INQA 1MCKA 3MGTB 2X4PA 4PJ7A 2FJFA 2JB5L 2JIXD 2VH5L 3LN4A 5L2KD 1JWUA 1DN0A 8FABB 2ICWI 2BOCA 3DYMA 3SEPA 1FHGA 5F7MC 3QIUD 1M6OB 3ZDZE 5ISZD 3P4MB 3G5VA 5CEZL 4IRSB 1ZS8B 1NFIB 3QUXD 1BFVH 3T0XA 2DI9A 3BYTA 1E27B 1M71B 2YS4A 1WBZB 4YDKH 4I0KA 4Z0XB 5IMOA 5CZVL 4WCYL 4HQQH 4NO5A 1LP9E 5C8JB 3NFPB 5KS9A 1LK3L 4OLWL 1URLA 4MDJB 1B88A 2X7LA 4M48H 3U4BH 3P11L 1U8PB 2J6EH 4JDVA 1ZANL 5IQ7H 5DK2A 4HJGB 5HHMD 4N0CC 3QCTH 4FQHA 2ESVB 5SWQB 1J18A 2ZUXA 3QNZA 5ETUA 4OSUH 5EULV 3CDFA 3QZWG 3LD8C 4JHZA 2OJEA 4XNQA 1RFDH 3IFOA 3PP3H 3FQWB 5EUOA 5ESVB 2A74B 4NQVB 5AUMB 3ULVH 4XBPA 5F93C 3G6JA 1A4KA 3MLYL 3IAPA 1JIBA 2ICWA 1BEYL 2AJYL 2XV6B 3ARSA 5E2VL 3W11C 1W0YT 1FBIL 2BVQA 5I9QC 2HJLA 1CDBA 2V9QA 5F88B 2OZ4H 3DYPA 6CGTA 3QEGL 4HUKB 4YBQC 1DBKH 4FQ1L 2CLZB 3RA7H 1JPFA 1ND0A 1Q0XL 2VDPH 2YD7A 1CIUA 2AEIT 5E94A 1DQLL 3DURA 5F96H 4IDLA 1MCCA 1XH3B 3B5HA 3MV7E 3DO3A 1U8IA 3MBXH 3W0WA 2EH8L 1IBGL 3GUTB 5KZCD 2VLKD 5EBLA 4YO0A 3BZFA 5JHDA 3H9SA 1BLNB 3SDYL 4PJXA 3HCVA 1QR4A 5L8LB 3M8OL 2R0LH 1X5KA 1YYMH 5C0AD 4ONGH 4X7TB 3FTGB 4QHUB 15C8L 3MZTA 1B2WL 5IG7B 3L3KA 5GSRA 3SDXE 4JB9L 2GAZA 4L4VB 4D2NA 1FNLA 4GMTL 2LFGA 1ACYL 4F9LC 1AE6H 3W39B 5BOPA 2AKRA 1OW0A 5KSVA 4NSKB 2VL4A 4M02A 1KJ3L 5JOPD 2VISA 4WHTA 1DBJH 2I9LA 2PCPA 5T3XE 4YXHL 1U93B 4AQ1B 3QNXB 1OAYL 4LSDA 3AM8A 4X4ME 4GRMB 5DFTA 4WW2B 3IXAB 3BKYL 1E0OB 1S9XA 4X80H 2AEPH 3MLPA 2Z31B 1UEMA 5GRWA 1RAMA 2VJXA 2YD5A 1DQDL 4J8RA 1N59B 3L6FB 5F72S 2L7JA 4WWKD 1SMAA 5TE7L 3BKJL 1TJHH 4YQXH 5C0ND 2J2ZA 3KPNA 3OKKA 4DKEL 3EFDL 4RCAA 4Y4FB 4GRWH 3MGOA 3RVVD 2B1HH 1TVHB 3OX8B 1ES0B 1U8OB 4GG6A 1GGUA 2EXYC 2IQ9H 3TEUA 3N06B 2CIKA 5GJTL 1NH6A 4BQ9A 4M7ZC 4LHUB 1QSFE 3QCUL 4Z8FL 1ZT1B 3B3IB 1Q9KA 4PTTB 4JFZL 2DQEL 2FATH 5JHLL 5FK9B 4HULB 5IUSA 1F90H 5IEKB 4MQTB 1J1XL 2VDLL 1YDPA 3KPRB 5CP7B 1V7ML 5TE4L 3HE6A 4NN5C 1NCCL 3BP5A 4LLWA 5FYKL 2X44D 2EYRA 4UINL 1RK1A 3SJVA 2BNQA 1NPUA 4LPUA 3T0EC 1U3YA 5D1XB 5DA0B 1RVFH 1IC4H 5DJ6B 2FIRT 3HE6C 1I7UB 2HLFD 4ODSH 1PG7X 1IC5H 1OQOA 3V95A 4DGYH 5DJAA 5I75B 1CTNA 4H5SB 1ED3A 3FCTA 5HI5D 3AU1B 3HUJA 4PRIE 1MRDH 2WWMD 5C09E 2AK4B 1A6UL 5IK3A 4XTRC 1YC7A 4YGAB 1MUJA 3BMWA 5I0ZA 4KQ4L 4ZODA 3U9PL 4JGMA 1UB6A 5BS0B 4GT7A 4JFPA 3LQAH 2C5DC 3W5NA 1EA9C 2W07A 3QJFA 5DHVB 5HDLA 3MA7B 4ODXA 4O51B 2BSSB 5B38A 3B5TA 5A2FA 3QCVL 4TNWF 1J87A 4KJPC 3G5ZB 3QYCA 2XPGB 1QFHA 3BH9A 4U1MA 3RUGB 3ZHKA 1QQDA 2VDOL 2UWEE 3VFVA 2V5RA 4CVZA 1JN6B 2XZQH 3VGHA 4X6FA 4J3SA 1BVLB 3TIEB 3RL2A 2GT9B 1K8DA 1FAIH 2HJKB 4OZHE 1R0AL 3OXRA 3O9WD 5CZXD 4WIQA 3CDGB 3RGVA 1OVZA 2B0SL 1F4WH 2GEEA 3E3QC 3QEHB 4UDTA 1Y6NR 1TVBA 4LASH 4QXUL 5T1KB 4OCMC 5GRVL 4PB9H 1QYGH 4XCEB 2DQHL 4ONFL 3QHFH 3RGVC 4N0UA 5FAAA 4KMTL 2NPLX 5BRZE 2F54D 1YEJH 3VXRA 1GGBL 1FLRH 5TQ2L 4XP6L 3O3BA 4YIQB 2FECI 1NBZB 3FRUA 4KK5D 5LQBL 4JO4L 2A83B 4HUUA 4XPTH 1EHAA 1NDGB 1FV1A 3LMJL 1GZPA 3QFJD 4AEHL 4I48A 2LAGB 3HE7A 3EYQC 1AQDA 1A6WL 5E8NB 4KKCD 1QO3B 3KJ6L 1GGCL 5I19H 4XP4L 3QUMH 1XR9B 2YRZA 1FH5L 4Y2DA 3LQZB 2HT4D 1S9KC 2L7UA 5BW7A 3LPFA 1RUPH 4MJIA 3HE7C 3FQXA 1E4KA 2A6JA 5EZJA 1VFBB 3I9GL 4P2RE 4HC1L 1IRAY 3WLWC 5BW7C 3IDGB 5IIEA 5F3HA 5FFLA 1BAFH 1E4KC 1T83A 1G9NC 4FS0A 3IKCA 2VITB 4YWGH 4P46D 4HIIA 1F6FB 1S7QB 2QSQA 3GMQA 2F53E 4Y1AE 2YOCA 1A4JA 1T83C 5JA8B 4LPYA 4OM0H 1RURL 4JDZB 2ITDA 4V1DD 2HVJA 5T1LA 2R39A 4Y4HD 3TIDB 3TPUA 3ULUD 3KYAA 3HZKB 4W4OA 1IZJA 5DI8A 1C12A 4E41A 2R23A 3G08A 4LCIH 3FT4A 4KXZH 3TA3D 2C7UA 1FZOA 2YR3A 3C08H 2NW3A 4RDQG 1RD6A 2HFEA 2H2PC 3H9YA 5C6WH 1PKQA 4PY8I 4GW4A 3T4YA 4NZJA 3NGBC 4F7EB 3IJSA 1WUNT 2IANA 2XN9E 4R2GB 4HLJA 3MV9A 4MMZC 4G8FB 2ZSWB 2R2HA 1A1OB 1TFHA 4XBEH 2X89D 1PEZA 4HIHA 3ZKNC 5KBNC 1BFVL 1U92B 1H15A 1R3IH 4GXUM 3EZJB 4NYLB 1JI2A 2ED7A 2DQFA 4G9FE 4LSVH 2QQLH 4HUWA 3EW3B 4KDTA 4ISVA 2N7AA 4ZOAA 1LP9F 4YAQB 1SJHA 1YECH 1SBSH 4KDTC 1DUZA 4EUPB 3NCJL 4OCXL 2J6EL 3WNNA 1QA9B 2NXYB 3O4LA 5IQ7L 4FZEL 5C07D 4XMLH 5JLZB 3DPBA 4OSUL 3QXDB 4NQCA 3REVA 4Q2ZA 4R7NB 3SDCD 4MWFA 3S4SG 3KGRA 3GMMA 4NN7B 3IXTA 2EKJA 4P2QD 5DUMH 1K4CA 5D7IE 2R1YA 5GGRB 3RKDC 3VG9C 4R96A 3VI4E 2IALA 1KELH 4JFOB 3U48A 1S9YA 3ULVL 3MNWA 5DJ2B 4E9LA 2X09A 4U33A 4X4XB 2EEBA 3GSRB 1T0MB 3MACL 3QRFM 3VCLB 1VACB 2A9ML 5EO0B 5I16A 5ESQA 5H2BA 1FYTD 3IJYB 2OZ4L 1GAFH 5CEYB 4CGTA 3BP4A 5KN5B 1DBKL 3UZQA 5I1HH 1FZMB 1MIEH 4F3FB 4XPBL 5IF0B 1KIRA 4JFEB 2CKBL 4CU7A 1EO7A 5E6YA 4RWHA 4Z76A 4M8QB 4ZO8A 5C0JA 5F97E 1XFPA 3HI6L 5L6YH 3MBXL 4L3CB 4JR9L 4WDIB 3CFIC 3F7PC 3MCKB 4ODTL 5CD3A 1REIA 1F58H 4L3ED 2X5PA 5T5FH 4DUVA 5E4EC 3MJ7A 1WWAX 4ZUSB 5DFVC 4R26H 3RGHA 3BAEH 4LKXB 4MNGB 1RK0A 2PETA 2PW1A 4FFWC 4WJ5B 3LSOB 5J3HD 5HHNB 3QDME 4ONGL 3PGCB 4XH2B 5J56B 3QDGD 2Y4SA 1U8JB 4M93B 5J06A 1SJEB 4WFEE 4ZUUB 3VE0B 2HG5B 4L5FL 4NN6B 3P77A 1CFQB 1JHKH 3HLAA 4LMQE 1AE6L 4HKBB 5J7CC 1FL6A 2APTA 5KVEH 4XCFH 1FDLL 1RZFH 1CLOH 1DBJL 5FDWA 4OM1H 2X4RA 1CCZA 3FN0L 5D1ZA 3TZVD 2KQMA 3M17A 2NXZD 4DUXA 4M62H 5C0CA 4X6DE 2GKIA 5DMJB 4P5MA 4HGWA 5D1ZC 2HMID 4OUOA 5GGUB 3I3BA 2V2TA 3RTQD 1HHJB 2CD0A 2NX5D 2Y7QA 4FZ8H 4PJFE 4NUGL 3I02A 4RGNB 5DF0A 1TJHL 4Y19B 4MAYD 3FN9A 3GMNA 3TM6A 1EAPA 5HY9B 4M03A 2XKUA 4AZ8A 3DETD 2B1HL 2YHGA 3CMGA 5HVGB 1QLFA 1DVFA 1AR1D 3K3QA 1OB1B 1KGCE 2KZWA 4NBYB 1TTUA 1S8DA 3UC0H 3VXMB 4YBLB 4EIZC 1EHLL 3O6KH 3MROA 3RPKA 3QUYB 3QO1A 4R7DB 4LLAA 1YY9D 3VMPA 1DVFC 4M5YH 2R9HD 5L7XH 5IM7A 4NFDA 4O02L 4OFYA 5F6IB 3SE4A 3WBDA 2VDNH 3B9KB 1HNGA 3MRNB 1TQBC 4PTUB 2CH8A 2R1XB 3PHQA 2VR5A 4QRUA 3SE4C 3IU3B 1AGFB 1XMWA 1OF2B 3V4PL 4U1SA 1DLHA 3IVKB 4I77H 1XR8B 2DLFL 3D6GA 4OD2B 4GKNA 4JO2L 5E08L 2FLRT 3EJJX 3FB7A 1I4FB 5SX4H 4DAGH 4I9WD 1KCSH 1IC5L 5MENE 5IV2A 4OI8A 3I6LE 4DGYL 5CCKL 1F3DJ 2A73B 4G7VL 3KLHC 1X7QB 3VA6A 1YUHB 3KLAB 1ZHKB 3X13B 2P44B 3B8SA 2ADJA 3MLZH 4XNMB 3C9NB 4QHKJ 3CPLB 4K8RD 4QCIB 5ICZB 4HX1B 4LVNC 2A38A 3OQ3B 3S37X 1OGAA 3GK8L 3T08A 5JW5B 5LXGH 3LKNB 3LQAL 5EIVA 4JREC 4Y4KB 3TN0A 1QSZA 2VLLA 5L2JB 1R5IA 2DL9A 1XGPB 4KTEL 2YD4A 2W65A 4APQA 5E9DE 3BH8A 4PJBB 3UTZA 4JFFE 4MA3B 4LLVA 1WEJL 2IAMD 1EX0A 5DQDH 3TP4A 5E1HB 3A6BH 3DOSA 3P0YH 1W0VA 3X3GL 3C5SA 5IB1B 3TV3L 4APQC 3EDDA 3VRLE 2ADGA 3NIFE 1GH7A 1NCDH 2AXGA 5HHXH 1I3RB 3HC4L 1NAMH 1U8KB 3R0MA 2JCCB 1CGTA 1FAIL 2FEDD 2O5ZH 4OZHF 5CIPH 1KOAA 3HG1B 2H2SC 5I76B 3FO1A 3VXQB 4XVTH 2ITCA 3O81A 5IHLB 4M6AA 2WBKA 1RIUH 4RA0C 3OAYK 1DL7H 2GYSA 1QYGL 5FEBA 1FGVH 1OSPL 1Q38A 4ACPA 1J1PL 3O8XD 5IB4B 3P4OA 1L0YA 3GIVA 4LU5L 1BOGA 4R4FH 3MLSL 3L7FB 3TESA 1FLRL 5F6HJ 5D7SL 5K9OB 1ZVYA 2NW2A 2FD6L 2DOCA 5GRXG 4UILH 5AWNL 5L0QB 3EIFA 1A3LH 3RWFB 3WFHB 3NBNA 1HXMB 1IGTB 2E8ZA 3NPSB 4I18B 3V5KB 5C0AB 1I7ZB 3MRIA 4FTVA 4MMXC 4PGDB 1G9NL 3HRZB 3FONB 2FSEA 4FQQA 1KB5H 5I1DB 1G7PB 3MV7A 3CVHA 2XTJD 3BEWB 2PNDA 4OQTL 3LV3B 3MV8E 4IHOA 4MXVE 1GXEA 1A1NA 2DYPA 5MI0C 4LPCA 1I3GL 2A6DB 3E6FA 5CINL 3MBEA 5AZEH 5JO5B 4LGPB 4YWGL 5I0DA 5I1IH 4Y5VB 3KXFB 3KPMB 1JGLH 4QT5A 3QQ4B 5JW3H 1IGIL 3MBEC 5TGBB 4K7PY 2J4WH 4WFHE 1GSMA 2VERN 5JQ6H 1NLBH 5DVNA 3SDXA 3SKOB 1TNMA 4Y16D 3GSWA 4HWBA 5F89B 1IAIH 3O4OB 5FM5M 4X6CE 4AMKH 1OP3H 1MHEB 1N0XH 4JO3H 1TQCB 4BUGA 3S36H 4PRDB 4LHJB 2OL3A 1OT2A 4NHCH 1K5NB 1T1YB 1SY6L 3BE1H 4DW2H 3D3VA 5FYJH 3QXTA 3LKSB 4I0CC 1CFTB 4GBXB 3DRTA 1FFOB 1IEBB 4XI5D 5DJYA 3BO8B 4RWYH 1EMTL 1XCTA 1I1YB 4U1GB 3UJTL 3STLB 5C0IB 1GIGL 1H8SA 2H32A 4XBEL 3G5XB 2UYLA 1H3UA 3IKKA 4AIZB 2DD8H 4HK3J 4O00A 4G8GB 2CLVB 3OB0K 1P7HL 1MWAH 4KGJA 4FQXD 2QQLL 3UTTA 1MRFH 4HDIA 2GCYA 5CLWA 4M43H 4DVBA 3O3EA 2RB8A 5DVLA 3ZKMC 1FYHB 5EWIH 3ARFD 2BC4A 4JM2A 5TE6L 1KCVH 1T3FB 3DMMB 4MJ6B 3ARVA 1UJTA 3ECBA 1SBSL 2YKLH 1CICA 2JJWA 3ARUA 2VLME 4GAJL 1JGDB 4XP5L 2WZPD 5EU6A 5GHWL 1LE9A 3UTQB 4EBQH 2Y5TB 5ALBH 5IOPA 3T3PF 1CICC 1IC7H 4UNUA 2W9EL 3INUH 4DOHB 3BGFB 1T1ZB 3ILPB 3MLRH 4LHUG 5FHAH 3T77B 4AM0B 4JY4B 1EEYA 4C58B 5IW6B 1CQKA 1UZ6E 4ZS6D 4N0FA 3V6BR 4UT7H 5DUML 5D7IF 1J88A 1R5WB 3V6ZA 1EEQA 2OR9H 3MLVH 3O3DA 2FDBP 2PO6D 4NO2B 1A7OH 1CQYA 4K94C 3SQOH 5K93A 32C2A 2GSGA 1RJLB 4ZPVA 5HPMB 2NY6C 5DO2C 4PRIA 2YD3A 5D72L 1EO8H 3BP6B 5BJTA 1T03H 3PL6B 3TT3H 5DUPH 1WGOA 3VFOB 4P2OA 4KTYA 5KS9F 1ZTXH 4OI7A 4RMSA 1D9KD 2AJ3A 5KTEL 5L6YL 2BVOB 1UH4A 4GKZB 5ANMA 1T7WA 5F1SA 3MUHL 3OKOB 4JKPL 2C1PB 1MI5E 3RP1A 3ARGD 1F58L 3U82B 3D0LA 4MDIA 4S11A 2FBOJ 4U3CA 2F54B 1DQTA 1TJIH 3TJEH 1HHHA 1XIWB 2R69H 2WV3A 3BAEL 1NFDF 3EDFA 4R26L 3V0VA 1CGWA 2UWEA 3SDDB 4PGCB 4DKDC 1KPRA 1NCAH 3JTTB 2I24N 1NCUA 3O6FB 5I8CA 3QPQC 1QFUH 2YN5A 4XX1E 1N5AB 1PAMA 2NMSA 4UV7H 5HYJD 3MLUL 5B39G 2W0FB 5IR1B 1VHPA 2IMNA 4ESKA 4PP1D 1I3VA 3VDBA 1AXTH 1V5JA 1RZFL 1RU9H 1EEZB 1K3IA 3T0AA 5ID0B 3GMRA 4OM1L 2YK1H 5BRZA 3MXVL 4HF5L 1PLGH 3BQUA 3BUTA 4QWWD 1UVQB 4KRPD 3QZWA 4M62L 3NCEB 3O2DH 1WIUA 5F7EL 4WTWA 2VLRE 2MHAB 2G5RA 1DANT 2IPKB 1KV3A 4POZD 3WKMH 1LEKA 4OCSL 1RJYA 2JF1A 3WL9A 2NY7H 1JWMA 3PWJA 3TO4B 1JK8A 3FKUS 3BDYL 2AXFA 1Z0MA 3QB7C 5F3BB 3EOBB 4UOJA 5EC2A 4RGMB 3K8LA 3QFDB 4PJXF 2DQGH 3MXWH 4H1LA 1I7TA 1G7QA 3VH8B 5I2IA 2VLJB 1ERNA 2YBRA 3U79A 3WFCL 4DVRL 1A7QL 3EYFB 4OUUB 5ADOL 1IKFH 3E2HC 1GHFH 3IAQA 1P2CB 3MR9B 5JR1L 1OY3B 5TF1H 4GRLA 1OGTB 3UP1A 1CG9B 2VKXA 4M5YL 4KPHH 1KNOA 5L7XL 2GTZA 4OCRL 3F5WB 3NCYS 2H6PB 4TUJA 4ERSL 1NMBH 1FFPA 4P23B 3N1FC 4OI9A 4IOIA 4IRZH 2CJUH 2R8SL 4XAWH 3BEVA 5JW4Q 2P24B 2YRLA 4LP5A 5C1MB 3QT2A 1FNEA 3O2VH 5C9JA 5DJCB 1VGKB 2F8OA 2KQNA 1GVIA 5IVZB 4G8EA 2NZ9C 4M9PA 3TBWA 4L4TD 4HUVA 5FO7A 1WTLA 2IBGA 1NUDA 4DAGL 4LCWA 4ENED 4JQXC 1UWEH 5GS0D 4PV8B 1U8QB 3IDXH 3VXSB 3HMXH 2NY1B 3FO0L 4ZAKB 4N9GB 3PGDB 2IPTH 5GGSA 3L3JB 1NBYB 4CNIB 1HEZA 5IHBA 4B7LA 2P5EB 4GG6F 1Q72L 2K7PA 5LXGL 1AQKL 4U7MA 4H25A 5B8CC 2CMRH 4DJMA 5I17B 3V6OE 1G7MB 3T8XB 4UQ2B 3SDAC 2C1OA 2BJML 4K3GA 1B4JL 4PGBB 4G9FA 5DVMA 1J8HD 5J1SC 3A6BL 1EXUA 1TDQA 2VZVA 5F9JA 1OAKH 3VRLF 3PWVA 4MCZA 5DRXA 1YEFL 6FABL 5HD8C 3NIFF 5IFJA 5HHXL 3QA3A 3DX7A 1M7XA 5IB2B 5IB5B 4YBHA 4PRPA 3VFNA 5IEHA 5I1AA 4WU5A 2D7PA 1L4IA 2MMXA 2EIDA 4FOMA 3UYRL 4OCNC 3WNOA 3MJ8A 3CFDB 3L3HB 5IVXE 4B53A 3VFPB 5JUEL 1KTDA 1ODAA 2Q8AL 4ZTOL 2DQIH 1FGVL 5EH1A 5EBMA 4EUPG 4NQEB 2BSRA 3HUJF 4OKVB 4LMQI 1T4KB 1C08A 3UYOD 1TJGL 5E7FA 5EZOL 2MKWA 1EK3A 1PG7L 1XGUA 4KQ3L 3VXNB 3N1GC 4GW1A 2B1AH 4HWZA 3CZFB 5FUZH 4G8IB 2B8OT 2Q7NA 3AS2A 1RHHB 2OR7A 4JFQB 5J6GA 1KTRL 4ZYKA 5KSBB 4Z7UB 1MJUL 2Z9TA 3NAAL 2EC8A 3QDJE 5EUKB 5HI4C 2R4SH 1KB5L 2NY0B 5SWZD 2B20A 5F9WC 5FOJA 3IFPB 4G43B 1ZA3A 2YZ1A 4FXKB 5CGYC 3WDIA 2PYFB 4P59H 4P5KA 1KCRH 2J8UB 4DGVH 2OMBA 1MEXH 3Q3GA 4LSRH 4TOYH 3DUSA 5AZEL 5FB8B 2AJSH 2R4RH 1IAOA 5I1IL 1I9RH 4NKIL 5C3LD 5TF0A 3DVIA 1NKOA 3JUZA 4XNUL 2J4WL 3QDMA 4C56B 5E5RB 4F37K 5E8PB 2EDOA 3RJDA 2CKNA 1MH5A 4U6YA 3TH4T 1BFSA 1RPQA 3RWEA 5C9KA 5KAQF 2BNUA 5J1AB 1VCAA 2MKLC 3ARED 4HV8A 5FO9B 1PY4A 4YGVA 2Z92B 3S9DB 1GL4B 3BGMA 1SMOA 4QF1A 1I7RA 4OZIE 3LCYA 4MQSB 1OAUH 5D1QC 3WV0A 4WEBL 2Q86B 5T3XL 3MLTA 4QTIH 2C9AA 4NHCL 4YHIA 2XKNB 2UZXB 3BE1L 4G6JH 5AG9A 5IHZB 1YEIL 5GGVH 4HS8L 4YH6A 3NZ8B 1LO5A 2MCPH 5ICYB 4JFDB 2UVFA 1K8IB 2NQCA 3U4EB 1X5YA 3FO2A 3HR5B 4OBSA 2ZUUA 5C0FB 2CSPA 3HC0A 4TVPE 1OARH 4PJFA 4Z7OE 5EU3B 3FFCD 4RGOL 4OD3H 4HAGA 2X1PA 4X99A 1FZJA 2Z91A 3T2PA 2FX9H 3NH7L 5E2TH 1MWAL 4Z7NE 1BM3H 3GMLB 3OR6A 4NQDE 4M43L 2XFXB 5JQHC 2ADIB 1NDMB 5EWIL 1YPZF 4JZNA 1PZUB 2ERJB 1KCVL 1NKRA 1I1RA 4IIQC 2YKLL 1AO7B 4J23A 4QRPE 4G6FD 1MCOH 3LEXB 3KVQA 1G7LA 3QQ9C 1M05B 5EBWB 4PJ7B 4NCC2 2VB5A 4BYHA 2IF7A 4EBQL 1A0QH 1IAIM 4KZDL 1T66C 2BOCB 2EIBA 1ACZA 1LWRA 5HYSG 5I6XC 5FHAL 4K55A 1YMMD 3RL1A 5EPMA 5DQ9B 4YXLH 1UZ6F 5CAYB 2GK0A 1X5JA 3PE9A 4LEOA 1XF2B 1NQBA 1L6ZA 2CXGA 1A7OL 1F42A 3X14A 2ATPB 4KKNA 3MLWL 2P42B 4HJ0C 4IOFD 1FFRA 4LBEB 3ARQA 3FQUA 1EDQA 1Q0YH 3QULA 1FL3A 5HGBA 1LK2A 2LU3A 4QOKA 1EO8L 1P53A 4X98B 1SEQL 5DK2B 3TT3L 2BDNL 1PBYA 3H3PH 3UPCA 1UXWA 1QPXA 4EI6B 3LD8B 4M1DH 3PWLB 3QNZB 4HLZG 1CVRA 2AP2A 1QBAA 5JORB 3DXAD 3QQ3B 3RNQA 5E9DA 1AGEA 2AJXH 2MWCA 2IADB 4HKXA 4XNQB 3O2WL 1BFOA 3O8XB 1IQDB 4LLYB 5ENWA 4NZUH 2X4OB 1MCRA 5I9QB 4JRXE 3WFZA 4ELME 3MRRB 2PXYB 1G1CA 3TJEL 2P5WD 2DQTL 4Z7WB 1NGPH 4XHJC 2VDQH 4X6EB 1LE5A 3VWJD 4MSWA 1VFUA 1G6RA 1ZMYA 3O41B 4JJ5A 5IB3B 1QHPA 4UV7L 2OTUA 3QSKB 2IBZX 5A2KH 1KN4H 1HYSD 5EZIH 1A14L 5E94B 2CKBB 5JPNB 3GMPA 3JWDH 3GSNH 5TDNB 2DLIA 3PP4H 3KNBA 1A7NH 2Y6SD 4K2UH 5E95B 2EDKA 1J8KA 3FOLA 3LRGA 3D18A 2OJZL 1XGQB 2UZIH 1PLGL 3BZFB 43CAB 1ZGLM 3HAEA 3HA0A 2EEDA 3F7RA 5HGHB 3S4SA 1ETZA 1S3KL 5SX5K 4OTXH 2AJUL 3HB3C 3EKCA 1JV5B 3WKML 4TUOB 4DQOH 5J11C 1JGUL 1O7SA 1N4XL 4X9FA 1A1MA 5FKPB 4LPWA 4LHQB 4MA7H 1ZWIA 4KAQL 2GAZB 3MNZB 1CI5A 5HYQA 2HT2D 1HKLH 3ESUF 4PP2B 3MXWL 2UZYB 3BZ4B 1GC1H 3IT8D 4DK3A 5KSVB 1GPOH 1S7VB 1B0GB 3ZL4L 2VISB 4M6OL 2ZJSL 1ZLUK 5F7HA 3V79C 4JGUA 5HYFA 1KENH 2X10A 3BW9A 4Q74A 5TF1L 2VSDA 4WHYH 2J88L 2B39A 5FHBH 5JPMA 3U0TB 1QUNA 1AHWB 5AG8A 3QUZB 1FC2D 1QRNB 4H20H 1DEDA 3DO7B 3VFSA 3AXLB 4QHLA 3PJSB 4M9OA 1W8NA 2JK5A 4S1SH 2DM3A 3Q5YA 3O2VL 4MD0B 3MYJA 2YXMA 4LSSH 3UTPE 5M7QA 4PJ5D 4NFCA 1HQRB 5DGRA 4X6CA 4KROC 1AD9A 4QNPE 2QV2A 1FFNB 1YY8A 3FZUD 2ZCHL 4LEXL 1UG9A 3C09C 3W9DA 4NQTA 1D5XA 4OZ4B 1ZVSA 3LPGA 5F1IB 4BQBA 3GMOB 1MSPA 3QWOA 3IDXL 3H0TA 3HMXL 1S9WB 3SN6N 5FYJD 2X9YA 2OS7A 4MNQD 5C7XL 3GJEB 5J57B 5DEGB 1XT5A 3DROB 1FVDA 2CDEB 1JNLH 4QYOB 2X05A 5IESH 3ULSB 1KLUA 1Q9KB 5DRWB 5CBAA 5E4IA 4IRJA 1S7TA 5B21A 3DVNB 4WY7H 3T0EB 1AY1H 1KFAL 3VXUD 1BJ1J 1YDPB 1I8KB 2W9DH 3OR7B 5F7UA 3T2NH 3HE6B 4KU1A 3JSSA 4IRJC 2A6KA 1NC4D 5D4QA 4I8DA 3T0BA 2Q87A 4QRQB 5AEAA 1M4KA 3MTRA 1R3HB 2LV4A 1YEDA 4CAGA 5HI3C 4BUHA 4JLRA 2LABA 4OLXL 1OAKL 3VU2A 3HMWH 1HHGA 2DN7A 3GSXB 3RU8L 5J89A 1UZ8B 1LEIA 5CJQH 3TBTA 2VXSL 3C60A 3QG7H 3RAJL 1H3XA 3DI3B 1T0NB 3IFLH 4DEPB 1ED3B 1EJ6A 2Z0BA 5D2LE 3L7EA 1J86A 2CLRA 3WD5L 4O9HH 4HS3A 1KC5L 5T33H 5IK3B 4JG1H 1KJMA 1RMFH 2XG4A 3C60C 4I4WA 4HZAA 3B9EA 1BVKB 5IVXF 1AKJD 3R06A 4KUZH 5DRZA 1R5VB 1T2QH 4YHML 3CFJB 3MRDA 1U3HA 4Z7QE 1Z9MA 3P4NA 4UOW1 5GPRA 4NDMB 1NGWB 5F70A 5FO8A 4JEGB 2BMKB 1V3MA 2QQKH 1Q1JL 1RUQL 5IGXH 2EE3A 3MCLH 4CMMA 4NRYB 3WIHA 1BX2B 3REWA 5T1MA 5FUZL 1QQDB 3VD9A 5IBTH 4CVZB 2IFGA 3MRBA 4MLIA 4PRHD 1RULL 5C0BD 1JF5A 2FEEI 4HCRA 1WV7T 3C6LD 3RL2B 4CJ1A 5L2KE 4XHQA 2QJDA 3LHPH 3PQYD 3B9AA 3S37L 5IVNA 5BXFB 5ISZE 2IJ0C 3K2UL 3RGVB 3C5JB 4GO6B 4XBGB 3OAUH 5L9DL 2EH7H 3JWOC 3OAYH 1TVBB 1TPXB 1AFVH 4P59L 4JANA 4HWEH 2DQJL 2R0ZH 4P4KD 4DGVL 5EFIB 4OFIA 5H35B 3VG0H 4MB4A 4TPRL 4TOYL 2AJSL 2X4NB 4MD4A 2R4RL 3T3ME 2V9RA 1WF5A 2E8YA 1I9RL 5CSGA 4ZUVA 1C5CH 4OAWA 3ES6B 1CD9B 3FRUB 4PBVC 3TFKD 3KDMB 4P3CL 3ZE2E 1CU4H 1JGEB 3ZTNH 8FABA 2Q1EA 4NRZB 3S3JA 5HHME 1M6OA 1KXTB 4ZFZB 3P4MA 4OIAA 3OBAA 1ZS8A 1KXVC 3U7AA 2CUHA 4G6AC 3VGAC 4GH7B 1E27A 4QRRB 1OAUL 5CBEB 5IJKA 1WBZA 5FGSA 4G3YL 3OHXB 4Z0XA 3RX7A 2F74B 3PIQA 1F3DH 1P4IL 5IIEB 4G6JL 3W81A 5C8JA 1UEYA 2O5YH 5C92A 2AI0L 5IJKC 2MCPL 1M7DB 3D85D 4JKKA 3NA9H 4MDJA 5F6HI 4NWUH 3DHJA 4W6YB 2RQ8A 2VLRA 1U8PA 3IYLW 1A4JB 4HJGA 3B43A 1LO3L 4O2EB 1U9KA 3WDJA 1IJ9A 2ESVA 5SWQA 4Z7OF 1UENA 2HVJB 4XXDB 4NM4H 4N0YH 4JO1H 1H3VA 4NM8H 2Y07L 5CUSL 4N8VB 4P2RD 3NGBB 4JAMB 3QISA 2PYED 1UKTA 3FQRA 5GGQH 5IFAH 2NW3B 2BSTB 3FQWA 4L4TB 1G7JB 1T89C 5GGRY 2VLKE 1PKQB 5JXED 2YPLB 5D6DA 2HRPH 3CGTA 2A74A 4NQVA 5AUMA 4K9EC 5D93C 3N1MC 5HHOB 1JZ8A 1GRWA 4PJ8D 4X0KB 2X4UB 1FVEB 4H8WH 1CR9H 1AI1H 4OD1L 3VH8G 3KPOA 5C0AE 1IKNC 1DZBA 2EDWA 3UZEA 3IDYC 5D7LB 3ZE1E 2CGRH 4EN3D 4E42B 4Q9QH 1NGYB 1XH3A 1OP5K 3OB0H 1ZHBB 4J3UA 3GUTA 4N1HB 1Z9SA 2DQFB 4RFNB 3H42H 5DMYA 4JPKL 3H9ZA 3A6CH 3RVUD 4M7LT 1BLNA 2EZ0C 5GZND 2IQAB 1JJUA 3STBA 2XZCH 1SJHB 1ZXQA 2R29H 3QDHA 5TH2A 2AJVH 4ODUB 3C2SA 3ARXA 1G6VK 4X7TA 3SCMD 5DURD 1RIVL 5MEPB 5IG7A 3DV6B 1I9IL 5DLMH 4ZS7L 3KYKH 4KI5D 4L4VA 3LN5B 5T5NF 3ZT6A 2HT3D 5E0QA 4JM2F 3GSVB 4NQCB 3REVB 4Q2ZB 4NSKA 4KMQA 5C0RH 4MWFB 1JTPA 3GMMB 3IXTB 1O5DT 1K4CB 5DD6B 2D4FA 4LOUC 1U93A 1UWXK 1Z3GH 4FG6D 3WFEL 3QNXA 3V6OC 2O26U 1MCLA 1T0PB 4GRMA 1DEEB 4NOBA 4WW2A 1OTUC 3IXAA 3ZYZA 1NGPL 3TLRA 2Z31A 5JOEA 1KN2H 2EDEA 1N6UA 4RAUB 3MFGB 3WJLA 4TSBL 3W9EB 1N59A 3L6FA 4WW2C 4XPAH 4R0LA 3BJ91 1F4YH 3FMGH 2YD2A 2GJ6B 5EZIL 4Z76B 1YNKH 4BZ1H 3WJLC 1LDPH 4Y4FA 4DKFL 1XF1A 4R0LC 5SWZB 1TVHA 4N5UA 1U6AL 3OX8A 3CXHJ 1ES0A 1U8OA 3ARPA 1T2XA 3TC9A 4Y4FC 5K9KB 4LSQL 2VDMH 2Q3AA 4LHUA 3SPVA 1X5AA 2G75B 1ZT1A 1AP2B 2P4AB 5FYJU 4PTTA 4U3XA 1I3UA 1XEDA 4YUEH 4F37F 5IEKA 4MA8H 4ZSOE 3LS4H 3KPRA 5DMGC 1MCNA 2HTLC 4U6TA 5CP7A 3KR3L 5EO1B 1KEML 3NZHL 1YEGH 1HKLL 3HLAB 4KV5F 4EI5C 2VN4A 3AREB 3QDJA 3WYRA 5D1XA 2HYMA 2GQHA 1I7UA 1XAUA 4Q9RL 3CDCA 4J4PA 2PTVA 5D1ZB 2J5LC 4OCYH 1I85A 5D1XC 4KKAD 3KHQA 4H5SA 3BZEA 4HKJB 4PLJC 3AU1A 3BX7C 4HMEA 4H20L 4PJIE 3QR2A 1I1FA 4J4PC 1I85C 2AK4A 1C7TA 4NT6B 1NMCC 3PXHA 3MX0A 4JJHA 1AIFB 1QKZH 4XC3H 5BS0A 4YBQD 5D7KD 1VGEL 3ZHDA 4LIQE 3GMNB 3MA7A 5B22A 3HZMB 1CFVH 4U1LB 4NNXB 4O51A 2X1OA 3PWPE 2BSSA 3OWEA 1NCTA 3BKCH 4OZIA 1QLFB 1DVFB 2R2EB 3G5ZA 1A6AA 4UAOB 3U4AA 2XPGA 5JW4N 3RUGA 3TCXA 5B39A 3V7AG 1JFQL 2Q6WB 4XMKL 1TQBB 4RX4A 1BD2D 4KDVA 3STZB 3TIEA 5L8KB 4I0PD 3CVIL 2DM7A 2GT9A 3QRGL 4JN1H 1A7PH 3QFJE 2HJKA 4WY7L 5A3ID 4WUUD 1AY1L 3NA4A 4DGIH 1QG3A 3RVXC 1EH9A 1DBBH 1Z2KA 2W9DL 3CDGA 3H9SD 5ITBH 3J7HA 4IMLB 1FVCB 3ZYIA 3QEHA 4IDJH 5C2BH 1A6TB 1MQKL 5T1KA 3CXHK 1BQHB 1TETH 4OZFG 2NY3D 1Q9WB 4OJFL 5KJRH 4TUKL 1UJ3B 1T22B 4LDOB 4CMHC 5DD1H 4ALAH 1H0DA 4YIQA 1PX4A 1YYLL 2C4XA 4ORZC 4PJAE 1NBZA 5MERB 2VABB 4U0QB 4LVNB 2I5YH 3IFLL 3CLEL 2A83A 1ZLWH 2ATKB 5EA0L 1BZ7B 5F21B 3LKQB 4PJHE 1NDGA 5SWSD 2QQQA 1KCUH 3R8BB 5D2NE 4UV4L 5E8NA 1P84J 2OL3H 4JG1L 3DSFL 1RMFL 4FQIH 3QIWC 4JVPA 4V1DE 4UU9B 2XY1A 1XR9A 3S5LG 1VDGA 3LQZA 2OK0L 3ULUE 4KUZL 2P45B 1FNSH 1VFBA 3QAZC 3Q0HA 3WUWB 4APQB 1BFTA 3ROOB 3UTZB 1IT9H 2XZAL 3IDGA 2AGJH 5IGXL 1FN4B 1KEGH 2VITA 3RWJB 1LP9B 2D7MA 1JUFB 5IBTL 5KVDH 3KYOA 2ADGB 4J3XA 1C5DA 2D7QA 4NO0D 4NOFA 5TJWK 3RWDB 3GRWL 1F4XH 4MAUH 2XQYK 3LHPL 2FZ3B 3VRIA 4O58L 3VWJB 3TIDA 4YZFF 2VDKH 4HGKC 5CIPB 2OSLB 3FO1B 3T09A 1OT1A 4PJDF 3DV4A 4P5TD 2GY5A 5TPWH 3AAZB 1AFVL 2FRGP 2IBBA 4HWEL 1UH3A 2KL6A 4X7EC 5CD5C 3NCMA 3EYSL 4QXGL 3NTCL 3BOVA 3L1OH 4F7EA 1FNGB 5A40E 4LLMB 1C5CL 3SJVD 3KS0J 2BNQD 4BFGA 2NW2B 2Z4QB 3PGFH 1NANI 3RY4A 1D5IH 3ZTNL 2V17L 2ZSWA 1HZHL 4GXVH 1C1EH 5C07E 2APVA 1A1OA 5DDHB 5DJ8B 4R2GC 4LKCB 4L8BA 2L4OA 4WRLA 1U92A 5MI0B 1MF2L 3ARYA 4M3JA 4NYLA 5KVMC 2WBJA 1KF9B 3MV7B 1KB5B 2ZOKA 3RHWK 4HBQA 2VXUH 4PJ9B 4IHOB 1VEOA 3QG6B 4P2QE 4Q58C 2VXVH 2FEEL 4P57A 4XT1C 3MBEB 2WBJC 3VW3H 1NFKA 1BGXH 4NWUL 2WP3O 4YFLI 4EUPA 2ENYA 1P84K 3JWNC 1NGQL 1YN6B 4AL8L 2V7HB 1FYTE 1R3KA 1KPVA 3M1BB 3AB0C 5JLZA 3IB4A 3SDXB 4N0YL 1FGNL 1PKOA 3QEQD 3UPAA 3QXDA 4C4KT 4R7NA 4K9EL 4UTAH 2NY2D 2ARJQ 1H3PL 2XA8L 3T1FB 5GGQL 3LEVH 5IFAL 4WUKL 1FG2B 4P9HC 2YUWA 4Z6AT 5F7WC 3OPZH 3K7UA 3PXJA 3DX8B 4LSPH 4L3EE 5I1EL 5DJ2A 2ZUYA 4WI6A 4UQ3A 1DBML 4X4XA 3GSRA 4K23H 1P6FA 1W8OA 4MNQB 1VACA 2WWKT 2K7QA 5EO0A 2F5AH 3IJYA 3BPOC 5CEYA 5KN5A 5AZ2H 1FZMA 4F3FA 5IF0A 3MLXL 3QDGE 4JFEA 3L9RA 3VXRD 1G84A 3GSOB 2FJGB 4LSTH 3U7WL 2H32B 4M8QA 4Q9QL 4L8DB 2W0LA 2CUIA 4L3CA 1IGFL 4WDIA 3HE7D 1MWAB 3MCKA 2EE9A 3A6CL 3LZFH 2AK1H 4KVNL 1D6EB 3F7YB 4Y2DD 4NKMA 1MCPH 5GRYA 4MJID 2O61A 1QSFB 4MNGA 4UBDC 4H1LH 4WJ5A 3LSOA 1QBMH 1CICB 5HHNA 3WMSA 3PGCA 4XH2A 2V2WB 3LOWA 3U7YH 1JPSH 4BQ6A 5IMMB 1TENA 1U8JA 1SJEA 2LU4A 4ZUUA 3VE0A 2NX5E 3V7AE 4ZTPL 1CFQA 3WO4B 3JVGA 4HKBA 3T04D 4KY1L 4JFHD 1AKJB 2BSED 3F12B 3QWQB 1GOGA 5GZOC 2G5BB 3RVTC 4OIIH 2PN5A 1XZ0B 2HFGH 3JVGC 3V6ZB 1CXHA 4XWOC 5T1LD 2NY6B 3BDBA 1GZQB 4E41D 4A6YL 4QRTB 4H26B 4PIRF 2C4FT 2WM0A 1KN2L 1F8TH 32C2B 1MRCH 5KG9B 5I1LB 1C16B 3DX6B 5C08E 4PRIB 1HHJA 1QFWI 5C09B 3L5XL 5DHYB 1HIMH 4Y19A 2RR3A 1D3CA 1YNKL 2OP4L 4BZ1L 3CFEA 2IAND 3MA9L 5HY9A 1VFOA 2AW2A 4YFEA 4HXBL 3MV9D 3GO1L 1MJJB 4LLDB 4S1QH 1T7ZA 3VXMA 4OZGF 3WHE0 2VNCA 1S7UB 4M1GH 4I9WE 2W0PA 2D0GA 3QUYA 4R7DA 2Z8VC 4YHZL 3ILQC 2UWEB 3NN8B 2EDTA 4YBLC 3ARBC 3B9KA 3MRNA 3QXVA 2AJZB 3BXNB 4PTUA 3NPZB 3LS4L 4TTDC 2R1XA 4OZHB 5F6IC 3V7MA 3QIUA 3IU3A 1OF2A 3JV5A 1RUAL 1IFHH 4LAJH 4BH8B 3IVKA 4FP8H 1XR8A 2ZPKH 4OD2A 1MHHA 1JMXA 3MRHB 1CLYL 5FA3A 3O4LD 2XQBL 3QIUC 4XVJH 1I4FA 2DBLH 1LEGB 2NY4B 4OCYL 4YHYC 2LE9A 3QZWB 5SX5H 1U8NB 4XPHL 1YUHA 3KLAA 1C5BL 1ZHKA 4PJIF 4JFYB 3RIFK 3X13A 4AT6B 3C9NA 1X9QA 2HLAB 3CPLA 3C8DA 4QCIA 3S35H 1RIHL 5ICZA 2IPUG 4HX1A 3WL9B 5I30H 4AG4H 1JK8B 5F9OH 4XAKE 5JW5A 3LKNA 1NCBH 3RWHA 1KUMA 3E2HB 4OFPA 4OCWL 4MHHG 1G0YR 4LLQB 2XNAB 4LVHC 5DR5H 1HOCB 3BSZL 1XGPA 7FABH 1I7TB 1ZLUH 4P2RB 4PJBA 2YBRB 4MA3A 1OPGH 3QHZH 4OLZH 2XT1B 4MXWL 1HN1A 5IB1A 2X6MA 1T04B 4Z7VE 1MHPH 43C9A 1KNOB 1DUYA 1I3RA 5TFSH 5A43C 1FFPB 2J12B 1U8KA 1DDHB 2F53B 4Y1AB 4JN1L 2JCCA 5EZLA 2A9NH 1UWGH 2IH3B 4TVPL 3WJJA 3HG1A 5IMLB 3BEVB 4GJTB 4DGIL 1HCFX 2IH1B 4HFUH 2VWEC 4GSDL 5IROC 5I76A 1DBBL 4R4BA 3VXQA 4QLRA 2VQ1B 4L9LB 5E6ID 1VSCA 3MMEB 4NGHL 3WJJC 3LKOB 3JXAA 2CR6A 1TZHB 4K7PH 3BKMH 1A6ZB 5KJRL 5IB4A 2XTJE 1PDKA 3EO1B 3D48R 3L7FA 4PY7B 4OCLC 4XP9H 1ZAGA 1IM9D 4ZMAT 5K9OA 1RZKH 2FWOB 4PJEE 1NL0H 1BREA 5FGBA 1AXIB 5IP4A 5GRUH 5D5ME 2B2XL 3GI8H 2XN9B 4PJHF 5GGSB 3RWFA 3WFHA 2BHZA 3HKFA 1HXMA 1IGTA 1LO0L 3BISA 3N1QC 4I18A 3V5KA 5B8CB 3TJHD 5C0AA 3NIDE 1HEZB 1I7ZA 2DM4A 3PWNB 4F58L 2QL1A 5FGBC 2AXJA 3SDAB 3WFBH 9CGTA 2I9TB 4PGDA 1E4XI 2J3SA 3HRZA 2BRRH 4I18C 4MVBD 5F9AC 5T1DL 5C0CD 3BP7B 1KTLB 1G7PA 2JJVA 5HTSA 3BEWA 4UIKL 1CBVH 1IVLA 3VJ6B 1CN4A 5EOQH 3IGAA 1IT9L 4G9FB 2A6DA 1KEGL 2RCSH 5JZ7D 3FOMB 3CLFL 5JO5A 3L3GA 1G9EA 4FQ2L 1KSRA 1DQMH 3RY6A 3MOAH 1OHQA 5FUCC 4HUXB 4U6XB 3DYOA 3S96A 3KXFA 2I07B 3MOQA 4NKQB 3QQ4A 4M6NH 4RFOH 5TGBA 1Y0LA 3O6LH 3RY6C 5I1AB 4RIRB 3NCBB 5BV7C 3RKPA 3SKOA 1IZKA 5F89A 4WFGD 4WWKA 1QR1A 4PPTA 3PV7A 4OFYD 1WAAA 2EDHA 5EOCH 4RMVA 3OTTA 4GRWE 5EBMB 1HINL 2BSRB 5BZDA 4WWKC 3EOTH 2Y23A 2D0FA 3O4OC 2VRAA 5D7IB 3L1OL 1T1YA 5C0NC 4NKOB 3BVNB 1BF8A 3DUUB 4Y8AA 3LKSA 1TQCC 1CFTA 4GBXA 1A6VL 1FFOA 1IEBA 3RVVC 3PGFL 3BO8A 3QIBD 3QWRA 5FF6B 4LPXA 5CHNB 1I1YA 3K8MA 3STLA 1C1EL 5F9WB 4ZQKB 4KTDH 5C0IA 2ARWA 3RZCD 5GRJH 3G5XA 4AIZA 5LCVL 2Y36H 4EDWH 1RZJC 4G8GA 2MSPA 4XMPH 3IDJB 4U1GC 1U3JA 2CLVA 4X7FC 1WBXB 2FX7H 3EO9L 3MRCB 2LQRA 4HJJH 2VXUL 3THMH 4J3WA 2VXVL 2BFVH 1OGAD 1P7QB 3VW3L 1IAOB 5HHVH 4MB5A 1BGXL 1MJ7L 3QQNA 1UKSA 4HEPG 1KLGB 5EU7C 3TN0D 3I75B 1U2CA 4CVUA 5A16A 1I1CA 1BQUA 4DZBB 3MRPA 4WGWB 2HLFC 3QDMB 3MODL 4BELD 3UTQA 3QUKB 2Y5TA 1UA6L 1MH5B 2FL5B 2DTML 4ZSOA 5FCUL 1UH2A 4P9HL 5D1QB 5EIIB 1YEHH 1T1ZA 3ILPA 3T77A 1JPTL 5FYLH 4AM0A 1MFEH 3R4DA 4JY4A 5IW6A 2WWMC 1I8IB 3P40A 1I7RB 4I3SH 1MPAH 3I2CL 3MLTB 4CRPA 3HFMH 3KPSD 4EOWH 1G0DA 3ARDD 2NCMA 3NFNB 4X6DB 2YMXH 1RJLA 1U58B 5FKAA 5HPMA 4H88L 2GW5A 1J05B 3BP6A 3PL6A 4I0PB 4YHOH 1X5ZA 5GGTH 1CDUA 5EU4B 4LVOC 3VFOA 4LSTL 1A02N 4PJFB 1EGJH 4ORGB 1P5UA 2YPVL 1CF8L 2QADD 3HAEH 3O9WA 5HYJE 5I8OH 4X99B 2EDNA 4D9QD 1FZJB 3MFFB 2BVOA 4GKZA 2EIZB 5FA4B 3OKOA 1CGUA 2A1WH 3OR6B 3NFSL 4IIQB 3O9WC 5CZXC 25C8L 2DS4A 2EO9A 1ADQH 1KJ2L 3LZFL 4X5XB 5IJVB 2F54A 3HPJB 3RJQB 3VWKD 4FTVD 2R2BB 1NEUA 1XIWA 4LRIC 5C86A 2IMMA 3SDDA 4PGCA 4CN1A 4BSWB 3GI9H 3MRJB 3JTTA 3S34L 2PF6A 1FZKB 5I6XB 4LK4A 3U7YL 2KDGA 1XIWC 2DYPD 2X40A 1JZ6A 2CUMA 3NACL 4U1HB 4KK5C 1JF1A 1I8LA 1BECA 2W0FA 5GGVY 3KG5A 5HBBA 5IR1A 3CU1A 3E8UH 1EEZA 4KKCC 3QP3A 2ED9A 5AD0B 12E8H 4NZTH 1B0WA 4PREB 3TWCL 1WLHA 2CK0H 4OLYL 5D71H 1F5WA 3IDUA 1UVQA 3WIFB 1MFDH 5MENB 1VERA 3SGDI 2MHAA 3H8NA 1G9MH 1MRCL 1BQHG 3JTSB 3TNNB 4NNYB 3T4AB 3T2OA 3TO4A 2JKXA 4P46C 4R6UA 1UXWB 4V1DA 5F3BA 3D3VD 3EOBA 3TO2A 5DVKA 5EORH 2A77H 3QFDA 3BIKB 5D2NC 3TO4C 1MFAH 3VH8A 4AH2A 2VLJA 3EYFA 4L4TE 4S1QL 1J1OL 4Y4HC 1NUFA 1LNUA 1P2CA 1UWXH 2ZUVA 3Q1SH 4JFFB 4RGMC 4M1GL 4U1NB 3ULUC 1ZEAH 2ZG2A 1OGTA 1J11A 1CG9A 4PLKD 3TA3C 5BCAA 4LGSB 2BNRE 3F5WA 2E6QA 2H6PA 2Z35A 4F33B 1NSNH 4P23A 1N8ZB 1X5HA 3WUWG 1E6JH 3UTTD 1LE5B 4UTBH 4OGXH 2NR6D 1FRGL 1ITCA 1FCCA 4MQXD 3EYVA 2NY5C 4P23C 4M4RA 4J6RH 3SE8H 5DJCA 1VGKA 4JM2D 4ZNEE 1MFCH 2E3VA 4FP8L 2UY6A 4D9LH 5C6PB 2X89A 5I1KH 2DQUH 3GMPB 5IVZA 2ZPKL 2X1XR 4UB0H 2GHWB 3RHWF 4X8JB 3SHSA 2DBLL 1ZSDB 2F9BT 1G7HB 3FOLB 1QEWB 3RDTB 1J8HE 1U8QA 4PV8A 1EJOL 4NZRL 3VXSA 1QFWL 4KJQD 4RAVB 4YFDB 1K6QL 4ZAKA 4N9GA 3PGDA 5IVOA 1IAKB 5HDQL 3L3JA 3WEXB 1L6XA 1NBYA 3FRPG 3CSPA 4RFEA 4Y7MA 4HSQA 3S35L 2ZCLH 2P5EA 4O2CB 2KKQA 4ZAKC 1LQSR 2J7LA 4AG4L 5I30L 2E6PA 5C07A 3SOBL 4U1JB 3WIHH 1JRHL 4XRCA 5I17A 3V5DB 2Y06H 3IDMB 1G7MA 3QEQB 5DR5L 4XVSL 4UQ2A 1OTTC 1G7IB 3OKEB 1WIOA 3O45B 4PGBA 4ZUWA 3V5HA 4ODHL 1OPGL 3ETBF 3EGSB 3MV8B 2VC2L 4OLZL 4P2OD 4Z7VF 1WJ3A 2OQJA 3TPKA 5KOVC 2AV1A 3DRQA 4FQCL 3U0WH 5IB2A 4EKXA 3DJ9A 3DVFA 4OFKA 3SE3C 4KROB 1EPFA 1MLBB 5F7KC 4Z5RA 2VXTH 3E1F1 2R1WB 3C09B 5HYEA 3OL2A 3TCLB 3Q6GL 5I1GH 3CFDA 3L3HA 3VFPA 2WQRA 3U6RB 4X6CB 5SWZE 2IGFH 4NQEA 4YHPB 3LIZL 4OKVA 1T5WA 1DQQB 1T4KA 1ZVSB 5D8JL 1FORL 3VXNA 3N1PC 4LAQH 4R90L 1V7NH 3Q6FB 3CZFA 4PJEF 2I60H 3W2DL 5D5MF 3GI8L 3RRQA 4G8IA 2M2DA 3T0WA 1A7RH 3CK0H 1S7RB 1R3LB 3ARTA 4JFQA 2FB4H 1UGNA 4Z7UA 3BQUD 3RUGF 2XY2A 4S0TD 4XPGL 4IMKC 1NEZB 4HUNB 4LQ1A 2BVTA 3BMVA 1YEKL 5J3HC 3IFPA 4G43A 4FXKA 4OT1H 3I6KB 4QRSA 2PYFA 1CXEA 5EOQL 2J8UA 1I75A 5A1AA 3H7BA 3A6OA 4YX2L 2IFFH 2NY0C 5CWSB 3UO1L 1E4WH 2VN7A 5DSCB 2WSKA 3K2MC 4RISH 3UPRB 4M5ZH 3MOAL 3TZVA 5BV7L 1JZ3A 4EQ3A 1NMAH 5KW9L 2P7TB 1F02I 4M6NL 2BZDA 4C56A 1VKXA 2MQ0A 4UZGA 1KIQB 5E8PA 1Y18B 3TZVC 2NXZC 2YUXA 3MV01 3RTQA 4GRLD 3WIIH 1KJMB 5E99H 5AAMA 2OMNA 3QEUB 5FO9A 4GOSA 3FFCE 1MOEA 2Z92A 5F7DA 1LVEA 2HMIC 1OP3K 4Q6YA 3RTQC 3AS3A 2Q86A 2YA0A 3SY0B 2HKHL 2XKNA 4JQVA 4MAYC 5IHZA 4OGYL 1N2RB 4UT9L 3GBNH 2X2YA 4ZFGH 3REWB 4HBCL 3DETC 3ORJA 4D3CL 1K8IA 2Z93B 5LGHL 1AR1C 4OZFA 4G9DB 3U4EA 2VXQH 1MFBL 5C0FA 5J0BA 4LCWD 4KTDL 3KPQB 1UM6L 3UJIL 2XIDA 5GRJL 1YY9C 5EU3A 2Y36L 1FG9C 1L7IH 2R9HC 3CFCL 3GBMH 1YMME 4K3EL 4HJJL 3BYYA 1ZGLP 2AEQL 4W70A 4XNXH 3CC5B 5CP3A 2PUQT 2VKWA 3EJYD 4MQ7B 2XFXA 1MI5B 1RZIB 2ADIA 5K9JH 1SYSA 3GSQB 3S5LA 4ZUVB 1QHOA 2D9QB 1AO7A 3KPLB 1NBVH 4AYFA 2V5TA 3N9GL 3LEXA 3RIFF 1M05A 5EBWA 4ZO7A 3SKJH 5HD8D 2ERJC 1F3RB 4K8RH 2ZZUT 3MOBH 3VGAB 2OI9B 4TSAH 4B5EA 1FL5B 3L3OB 35C8H 5KVGH 2WK2A 1VESA 1YEHL 5T3ZD 4GS7B 4NRXB 1BF2A 4ZOCA 5DQ9A 3M07A 4J12A 1YMHB 4KHXL 3DXAE 1MVFA 4NKDA 4O4YH 4PRPD 4NWTH 1XF2A 3PWUB 4CN6A 3HFML 3PIQB 2PW2B 2YSSA 2IAMA 2ATPA 5JOFA 4ZDHA 2YD6A 1IL1A 2P5WE 4UIMB 4LBEA 2YMXL 2ZUWA 1IGMH 2VLRB 2IAMC 4OIBA 4FXGB 4X98A 2J6EA 5GGTL 3D9AH 1MIMH 4EI6A 1EGJL 4AEIH 5K59F 4LL9A 3PWLA 4LIQL 2VQUA 5I8OL 4BFBD 5JW4M 1P4LA 3UJJH 4Q97A 5FECB 4U31A 5JORA 1X5IA 3QQ3A 1J0YA 2ZUTA 3JV0A 5D93B 5INDB 2IADA 5HI4D 3FQRB 4PUBH 1MJ8H 1A2YB 1KXQE 3L5WA 3O8XA 1IQDA 4LLYA 4WI2A 2X4OA 2HAZA 1AH1A 3MRRA 1D6VH 1T6VN 2PXYA 4NQXB 1ZE3C 1WITA 4UT6H 2W38A 2WUCL 4Z7WA 3O8XC 4GFTB 1WZ1L 4LQFL 4X6EA 1RZ7L 3IDYB 2JELH 1DSFL 2PXYC 2WANA 3UAJD 4AEEA 3KPOB 1J9CT 3O41A 1IMHC 1H3TA 2OZ4A 5IB3A 3ULVC 3SQBA 3HZVA 3D2UB 3HI5L 2CKBA 5JPNA 2VR4A 1CXKA 5AYUL 4FNLH 5TDNA 2A6IB 1W72L 3AC0A 5DZOA 5H37H 4PGEB 3ZDYE 5CJOH 3C5ZD 5E8DH 3CCHB 1I8MB 4NZTL 4YHLH 1XGQA 2QHLA 5D71L 1MNUH 43CAA 2UY7A 3KS0H 3QO0A 1PQZB 4F57H 1BIHA 5HGHA 4KKLC 5DHVH 2XTJC 3OG6B 5TH2B 3GHBL 1G9ML 4XNYH 1JV5A 5DWUH 4TUOA 1DE4B 2V5YA 4PJGE 4F9LA 2DIJA 4MCYB 1F4HA 2ICES 5DQJB 5FKPA 4CU8A 3QPXL 4PJCF 3ULUL 3MNZA 4DN4H 3N85H 4YDIH 4JG0H 4PP2A 1IM3B 4PJ5E 3BZ4A 1OCWH 3P9LB 1S7VA 5DT1H 1B0GA 2P8MB 3FAXA 4Y16C 1ZEAL 2H9GB 3E6HB 3D25A 2DIAA 3FFDA 4K3JH 2B7DT 2NY5L 5FYJE 3U0TA 1L9NA 4MNQE 1AHWA 1NSNL 3QUZA 3CD4A 1QRNA 4A6YB 3DO7A 4JDTH 1E6JL 1J5OH 3AXLA 3QIBB 3PJSA 3LB6D 5GRVK 5GISL 1DLFL 2YEZB 4M1CD 3QQ9D 1AHWC 4NJAH 5F1NB 1BQSA 1XGRB 3QUZC 4J6RL 4MD0A 1CFSB 4R0LB 3SE8L 1TVDA 3VXUE 4XI5C 2BX5A 1TXKA 1HQRA 2DQUL 4JM4L 1T66D 5IVXB 3CMOH 1FFNA 1S5HA 2CDFB 2BY0A 1SJVA 4S1RH 5C6TL 4OZ4A 1Z5LB 5F1IA 4WWID 3GMOA 4LLUB 3CSYB 5DD5H 1S9WA 5D7JB 3GKWH 1OAXH 2P49B 2QQNL 3BT2H 3R1GH 3UEZA 2BK8A 3EOAB 3GJEA 1ZK9A 5DEGA 1T6WA 5DC4B 3SPVB 3U2SA 3DROA 4FQXC 2CDEA 3VXOB 3WXVL 3A67H 4QYOA 4X6BB 3ULSA 5DRWA 4EI5B 1FCGA 2WIMA 3DVNA 3ARFC 3T0EA 3NABH 3ZYJA 1I8KA 3OR7A 4KMLB 5DYOB 5SV3A 2FBJL 3CXDH 2Y06L 1CDGA 3QDJB 1CFNB 4JN2B 3ZSSA 1J0HA 2J5LB 4QRQA 5I1CH 1CDCA 1R3HA 1MCHA 2ICWJ 4QOKD 3KHOA 1F6AB 2APXA 3S6CA 1AJ7H 2E5EA 4RQQA 3AMKA 1X4YA 3HNVL 3GSXA 2PO6A 3FQNB 1VADA 1UZ8A 1ZV5A 1IGJB 2GJZB 5IFHH 1J10A 1NMCB 4ZS6C 3SO5A 2AS5M 3BZEB 1T0NA 3ARDB 1ZT7A 2APWA 1R6VA 2Y5EA 1I1FB 4PRHE 5C0BE 4MHHI 2PO6C 4J1UA 1A9EB 2HTKC 2WAHA 4DEPC 3PQYE 2X4SB 1BVKA 4PRAB 5FYLD 1R5VA 3CFJA 3GIZL 2IGFL 4K07A 3IFNL 4NDMA 1NGWA 3MREB 4MA1C 4OZIB 1TCMA 2BMKA 1A6AB 3D39D 3WS3B 4NRYA 3LQAC 5I18H 1EFXB 4LAQL 1BX2A 5B39B 2I60L 1FPTH 2AABL 4Z18A 3VWKB 2EICA 1EVTC 4Q0XH 2QHRH 2JLLA 3ARGC 1JYNA 1NJ9A 4DN3H 4LF3B 4RMTA 3OJVC 3HB3D 5BXFA 4WVRA 3ZT7A 1I1AD 3C5JA 4XBGA 4XB8A 5HYJA 5F7NC 4TRPH 4CMHB 3G6DL 3PWPD 4OT1L 1PW3A 1SM3H 5D70H 3GM0A 3AUVA 5EFIA 4OB5H 3S36X 1TLKA 5H35A 3ARZA 4M6MH 1K2DB 4NQDB 2X4NA 3UTSD 1TPXC 1H0DB 4M5ZL 1S5IH 1JE6A 3ES6A 4KXZI 4PP1C 1NMAL 1UQSB 3QIWB 1A22B 4QRPB 1BP3B 3KDMA 2ZCKH 1MAKA 3Q5OA 1JGEA 4JY5H 4NRZA 1A21A 2ICEA 3B83A 4ZFZA 4KRPC 3QAZB 3TT1L 1ULVA 2DLHA 4X9IA 2YA2A 1HDMB 3BUYA 3QUMA 1MFNA 2CR3A 4POZC 3GB7B 1S7XB 1PVHA 2DLEA 4QRRA 5CBEA 3JUYA 2PYEE 3OHXA 2F74A 4LNVA 2CPCA 2XRAH 3S88L 1NAKH 3UXFA 3EJZD 1CDHA 4OQTA 2MQ3A 4ZFGL 3SGKC 1M7DA 4RSVA 3K46A 3KYOB 1C5DB 2H3NA 3JV6B 2VXQL 3V6FB 1RY7B 1QOKA 5IHUL 5JDSB 2FO4B 4O2EA 3I3DA 5MP6H 4I1NB 3VRIB 2HFTA 4XXDA 1L7IL 5JIHA 2Y72A 3DGCR 3DV4B 4N8VA 5DEFB 4JAMA 1ORSA 3SKUD 4GUPB 4ZD3H 5J9PA 4C57C 5E2WL 2BSTA 5ELIA 4JY6B 4L4TA 1G7JA 2DKMA 1NC2D 2YPLA 4NJ9H 1LO4H 2DMCA 3WE6B 5GS0H 1KTKE 4Z0BL 4DKAA 1ZA6B 4JRXB 4RRPG 5HHOA 4ELMB 4X0KA 1SY6A 1A8JH 1NBVL 1FVEA 1T7XA 2FGWH 2X4UA 4DUWA 5HI3D 1YJDH 1WAAF 4NCDA 4ENEC 5CS7A 3I6GB 4K8RL 1MAJA 3MOBL 4JQIH 1X6NA 4KI5E 5KVGL 1UYWH 3T65B 4L29B 5D7LA 3GM8A 4L8BB 4E42A 4G80B 1NGYA 3C60D 1ZLSH 1ZHBA 2K1MA 2WBJB 4YDKL 2ZOKB 1Q9OB 3MRKA 2ADFH 4JPWH 4HQQL 2E7CA 1GOHA 4P57B 2IQAA 5CILH 3SBWA 4RFNC 1FO0H 4ODUA 5DD3H 3AB0B 1U3HD 4M48L 3U4BL 5ID1B 5MEPA 2C3VB 5H94B 3SBWC 3DV6A 1R3KB 2CK2A 3IF1A 3QCTL 4GMSH 1KPVB 2DF3A 3LN5A 1KPUB 2AV7B 3T3PE 3GSVA 1JI1A 3VDCA 5ADPH 2JTDA 3LS5H 4PUBL 3RVWD 1U8MA 1MJ8L 1RFDL 5B38G 5DD6A 1CD1B 1KJVB 1JHLH 1D6VL 3BPOB 4WTZG 1DEEA 4UQ3B 1BMGA 1QFOA 4O5LH 1I9JH 1CE6B 4P3WA 4RAUA 5F44A 3DBXB 3W9EA 1FJ1B 3QNYA 3V0WH 3RA7L 3GHEH 3RX8A 1XF5B 5HGAB 2VDPL 2O5XH 1X5GA 3L9RB 5EG6C 2GJ6A 3N0PB 1YC8A 5KS9E 1CE1H 4WHYG 3FT3B 4KRLB 5F96L 1BPVA 1V3KA 5SWZA 5CJOL 3ZDYF 1P7KB 1HYRC 1V3JA 4YHLL 3JZ7A 1BVZA 4F9PA 2GFBB 4HXAH 5K9KA 4NC2B 4F57L 4KC3B 4LCUB 4AIOA 5KAQG 4IRSD 4NKMB 1KJ2B 2G75A 5MEOB 5I1JH 4KJWD 1QNZH 1NFDE 4M7KH 3UZVB 1AP2A 2O61B 1E28A 4U2ZA 4F9PC 5DWUL 2R0LL 1YYML 4JRYD 1G1YA 5FGCE 3L3IB 4PJGF 1P5VA 2BERA 3OAZK 1HSBB 4MGXA 5ESAB 3LN9A 5EO1A 4L8SB 5EUOE 1U3ZA 3N85L 3ABZA 3V0AC 3AREA 4G6KH 5D7KE 4N68A 3CAFA 1OCWL 4LARH 1DN2A 1HI6B 3NOIA 5C0GB 2XWTB 1W0WB 3AREC 2Z8SA 4HG4K 1B6DA 3IU4H 2ESVD 1NEZG 5B4MC 2RGSA 3NIGF 4HKJA 4X80L 1BD2E 2X1QA 2AEPL 3MCG1 5SX4I 3MUJA 3DTXB 4PFEA 5D2LB 3W0WE 4NT6A 4JGJA 3TVMD 1AIFA 4WUUE 5EOTA 5JHDE 3H9SE 4YQXL 2AQ2A 4G7YH 2FX8H 1UXSB 4X9HA 3HZMA 3CFEB 4U1LA 4NNXA 4PJXE 2JB6B 3AROA 3VI3E 1NGXB 2R2EA 3VGEA 2K3TA 2IQ9L 1JVKA 1SBBA 3F62A 4ODWA 3ARBB 5HYSB 4HT1H 1QP1A 1D5ZB 2Q6WA 2H41A 2D03H 4UAOC 2HRLA 3A67L 1EUTA 2BOBB 3STZA 5BO1H 5C08D 2FATL 3WSQH 3HC3H 5SWSE 3RQ3A 1F90L 4NNPH 1UT9A 2JIXB 5E8EB 5L2KB 4JZOB 3X11B 4KK8D 5LG1A 2XACC 4IMLA 1FVCA 4J3TA 5JIIA 3QIUB 5ISZB 1A6TA 1PYWB 1BQHA 4EVNB 5I1CL 1Q9WA 3CNKA 3QUXB 4YHYB 1RVFL 1MHHB 1IC4L 4DWHA 1S78D 5FA3B 1UJ3A 1T22A 1T5XA 3O11B 1AJ7L 4WHCA 4ODSL 1QZ1A 4L4VD 2J1KA 4D9RD 3KWWB 2NNAB 1MCWM 5MERA 5IFHL 2VABA 1UJ3C 4DFHA 2ATKA 1BZ7A 3SKNA 3LKQA 3OZ9H 5I71C 5GGSY 4U1IB 5HDOA 1OTUD 1MRDL 4LVHB 1CLZH 5GS1B 1OL0A 3BJLA 4GG6E 4UU9A 1N6QH 4J2XA