1GGIL

Crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A 50.1 FAB (LIGHT CHAIN)
publication title Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 47
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 1993-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL01
4HJ0D 3OQ3B 4KUZL 4WFED 3WFEH 2D3VA 4WO4A 3C2AH 1YNTA 3LEXB 5T5FH 4EVNA 4CJ0A 3ISWA 3GSRB 1KPVB 5IK3A 1BBJA 2PXYA 4Z9KB 1MRCL 1XFPA 1R6VA 1D5ZB 2LFGA 3V52H 5D2NC 3K74B 4Z7OF 3U6RB 4PTTB 2Z8VC 5FUZH 2DQFA 3T08A 3H9SB 3OZ9H 3K8MA 4YFDB 4MAYC 1QA9A 2B1HL 1P84J 2GY5A 2BNRD 4I9WD 4NT6B 1JI1A 4KUCF 1T4KA 3SDXA 5F96L 4HMCA 1KJ2H 2RFXA 4K2UH 2AJVH 4LPCA 5CD3A 2APWA 4ZXBC 2QADB 2PCPA 4YR6A 4RRPG 1Q9KB 2O26U 4U6YA 3MROA 4D2NA 2FO1A 2NY5L 4ZUTB 4HULB 3PF2A 2VXUH 5CKAA 5ADPL 4RGOL 1FG9C 3RI5F 2R4SL 4RGNE 5HYJE 4LCCA 4MB3A 5GIRA 1HI6B 1Y0LB 1XGTB 1UB6A 1VACB 4OCLC 4TVPL 4JQVA 4S0SD 1JWMA 3DECA 4XMKL 3FT3A 1T83C 5JNYB 4I3RH 3TA3D 4CJ1A 1S7UA 4X5WA 1D5XA 4IRZL 1L7IH 1OARH 2GSIB 3H6JA 3O4LB 4Z0XB 1Y18A 4JHAL 2BNQB 3T8XA 1A9EB 3QDGB 1WBZB 2IALB 2D0HA 1QBLL 4PJ9C 1NGZB 3NGBB 2YRPA 2DTML 3W0WD 3MJ8A 4QY8A 1LDSA 3OGOE 4WFEE 1MFEH 1UVQB 3O2VH 1E4JA 1FRGH 1A1MA 3Q0HA 4HBCL 2XY2A 3VWKC 2DRUA 5KVGL 5DJ0A 1NCDL 1T04A 1GJIA 4JFYB 4NKMB 4JFHD 4MNQB 1UWXK 1YN6B 4MD5B 4PLJD 5BW7A 3FN9A 2H6PB 4GW4A 4LMQI 3QUZA 1OP5H 1EK3A 3REVB 3U7YL 4I0CC 5HY9A 4HKJA 1IQDB 3S88H 4CGTA 1RIUH 3AS3A 2BNRE 2EE2A 4I9WE 4U1JB 1REIA 3ARDB 3V9FA 5BJTA 2ZWLT 4EDWL 2FL5A 5E2WH 4LFHD 1FVDB 3D48R 1F4AA 2R1WB 1T0MA 2IH1A 1NJ9B 3O8XA 4WO4D 3QHZL 3KHOA 4YGVA 3O3BA 3BPNC 2R0KL 3Q5YA 5JXAL 4LRNL 2E6PA 4TTGA 4N0CC 4MQXD 3RJDA 3S35X 1EZVX 4F15B 1CXIA 3CAFA 1T1YB 1M7DA 2XFXA 3VA6A 5D9SB 3CVHB 1I9EA 3IRPX 4WUUD 4I0PC 4Z7VB 5A40E 2ZOKB 2F53D 5D6DA 1BF2A 3QUXC 4ODSH 1U3HA 3PWNB 4PY8I 5F89B 4GW1A 2VERN 2OZ4H 2AV7B 3O9WB 2IPUK 3VFPB 5D1ZC 2QV2A 5EZIH 1SJHA 5CBEB 4LVNB 4X7FC 3DTXB 4FRWA 1T5XB 3O6FA 3AFLA 2GW5A 1U8NA 1KB5H 3L3KA 5FO7B 3K3QA 1VPOL 3JZ7A 2VZ3A 3SDYH 4OTXL 1HOCA 3H3BC 5HI3C 1PYWB 3LRSA 2NW3B 3W0WE 1FYTB 3PIQA 4O2FB 5DJ8A 5GGTA 2HKHL 1P4BL 4HS3B 5T1MA 4M5ZL 1A8JH 2ADIA 5CFHA 1GOGA 3LZFH 5LWYH 5BV7B 4MAYD 2AXFB 4BKLB 4GXVH 1RJLA 3H0TB 4JFHE 1T7WA 4P5KA 5FECA 3S97C 1KTDA 2MHAB 3MGOB 5L7XL 4MCYB 3MUHL 3RA7H 4XPBL 1H3TA 4ZXBD 1JBJA 3MRHA 5IBUB 4RA3A 1UKTA 5T33H 5E6IB 5D5MB 3LOWA 5T3XL 2D7OA 4P4KB 4W4OA 5CZVH 3T3PF 3NZ8B 5DHXB 4HKXB 2DICA 1JE6A 4XP6H 4X0KB 2PYFB 1E4XH 3F6LA 1HK6A 4JKLA 2QLVB 2SEBB 4PY8J 4P23A 2OJEB 4O2EB 1NUGA 3RVUC 1XGRA 3UTSD 4H5SB 5IMLB 1TNNA 4R26H 4R90L 2VITA 3KYOB 2W1NA 3N0PB 3VD9A 3EFFA 5JIHA 4RNRA 2MJWA 3NIGE 1OHQA 4YE4L 3ARED 1ZT1A 4KY1L 1NLBL 4KROB 4WUUE 5JORA 5KVDH 3EGSA 4H20H 2F53E 3VXNA 4J3TA 3QDJD 2YA2A 5C0FA 4UV4L 4X4YA 4L29B 5KN5A 2P45B 5AYUL 3S6CA 1WV7T 1INEL 5KG9A 4K3GA 3FOMB 3HNTH 3WL9A 4P2QD 4I3SH 4OD3L 1RJZA 4PJ9D 3U1SL 2HKFH 3UDWC 2OI9B 3SDCB 2YSSB 3O8XD 1N2RA 1NDGB 2AERT 2H9GA 3ARPA 1M6OA 4YDJB 5I16A 4UTAL 4AM0B 2RCSL 3C60C 1R3JB 3OKLA 4M93C 3VWKD 3JVGC 2J5LC 3REWA 4QO1A 3BQUB 2XN9D 1MFAL 3QIWC 2D03L 3VGDA 1BVLB 2OQJA 4P9ML 1F5WA 5D2NE 3QA3A 3RIAF 1MIML 5L88L 1DUYA 3V8OA 3HZVA 1DBBH 1HIMH 1YC7A 1W72A 4CUCA 2R29H 4PJBA 2PUQT 4WVRA 5A2FA 2NXZB 1KULA 2JJTA 3F5WA 3GK8H 5FKPA 3FRPG 2KDGA 1ES0A 3DV4A 1MWAH 4JFPB 5H2BB 4PLNC 1P7QB 3NAAH 3IJSB 2C9AA 4GRWF 4P2RD 5D7LB 3JWOL 4LKXB 5FV1L 2FGZA 1PG7H 2CIIB 4LLMB 1X4YA 4JRXD 5C0BA 4CBPA 1BEYH 1AJ7L 2ADJA 2XQYG 1OGTB 2NTSP 4N0CD 2XRAL 4PV9A 3E3QC 2HJFA 1IZJA 2NY5C 5C70A 2DQGH 3BP6B 3L3OA 4RFOL 1NGYA 1Z3GH 4GRMA 5ANME 1DR9A 4O58L 1NANH 3BEWB 4I0PD 4N0RA 3G5VB 3MACH 5B3NA 1XEDA 5ESQA 1I8KB 2Q6WB 3UTSE 2YZ1A 3ALWA 5HGAB 5I66B 1FVEB 3DUHA 1T1WB 2X09A 4O5LL 3VFRA 2VL4A 1JPSL 4HS8H 2FSEB 4OCXL 5EOTB 4OCSL 1AHWB 3QDJE 1LO4L 3WIHL 4BH7B 3WFHA 2CRIA 2DD8L 2FGWH 2FR4B 3NA9H 2VIRB 3RWEB 3QXUA 1KENL 4QYOA 1WQVT 4P4RB 4BZ1L 5DHVA 1A6WH 2OJZL 4P2QE 1ZVHA 4F3FA 5HI3D 1T21B 1WAAA 4ALAL 5MERA 2BMKB 2FO4B 2ILLA 1MAML 4P23D 1KB9K 3VFVB 1JF6A 1PX3A 4GQ9H 1MCRA 2VE6B 3RNKB 2X4NA 1JHKL 4LVHB 2M1KA 1RZJH 1NCNA 5CUSL 1LHZA 1ZOXA 2EC9T 3I84A 4PD4K 4PJXF 2XN9E 2VYRE 3ARFA 2R1XA 1ZSDA 1NEUA 2ARJB 5DD6A 1CDCA 4G6KL 4JDZB 4PJ5A 1JUFB 4OGAC 5LQBL 1YN7A 4GG8A 1NLDH 3P4OB 4YFLI 4Z0BH 3QH3A 2LTQB 5ESAB 2E27L 3RTQC 3SGEH 3IAGC 4FQLH 1SM3H 1UZ8B 3O2DH 2AI0H 3OWEA 5DI8A 5SV3A 4KAQH 4MSWB 2HFGL 4P2RE 5ERWA 1KJMB 5DQ9A 2ICES 5F6IC 2EDJA 4JRXE 1FN4A 1RFDH 3TVMA 1F4XL 4HCRA 3MO1B 3RVUD 4M5YL 1KSRA 5TDNA 5KW9H 1BQHB 1F42A 1GPOH 3VGHA 5I1DA 4X9GA 5J1SC 3NPSC 5JXEC 1HQRA 2JCCF 1KEGL 4P2OA 1T6WA 4RGMB 4W6WB 1X5KA 3MRQA 1FLRL 5BZDB 4IRSC 2XXMB 3CDGB 3ZTNH 5IW1B 3DWTA 3MLTB 5JTWA 2VAJA 3FB8A 5C0NC 3EYVA 2VH5L 4B53A 5TE7L 1BD2B 4F7MB 2BRRH 1C5DA 4L4TD 1RURH 2JELL 4YBLC 2IANA 4WWKC 2NW2A 5I1GH 5B39B 4NOFA 5BXFA 1TLKA 3OTTA 2YC1B 4NWTL 3C9NB 4ELMF 3C60D 4UIKL 4KVNL 5FM8A 4G8GA 3BRGC 3BP4B 3HS0B 5KSAB 3LB6C 4JO3L 3OAUH 4KJYA 1UWXH 2D4DA 4LSTH 3NIFF 3KXFD 1BVKB 3INUH 4HG4J 4ZAKA 2LAGB 4ZDHB 3DI3B 2DB8A 1U8QA 1IAIM 1ZWIB 4IM8A 3TIDA 1U91B 2YEZB 1CFVH 5FUCC 1GRWA 4CKVX 4YC2B 5DMGC 5EOCL 1JP5A 2PTUA 1YEJL 4QGTA 4EDXA 1OWWA 5FO8A 1UM5L 4HSQA 4NO0B 1MCLA 1F4HA 4QRTB 3PDDA 1E4XI 2VMFA 4C56D 5INDA 1L7TH 4N90D 2HLAB 1V7NL 2CR6A 1IL1A 2P7TA 1QR1A 5ILTH 5ETUB 1CICA 1EEUA 4NZRL 4P5MA 4MMZC 4OI7A 2XT1B 1UGNA 5DDHB 1VGEL 4GUPB 4DKEH 3C6LB 3QUYA 2DKSA 3O2WH 3RWIA 4FFWC 2APXA 4JGMA 2BVOB 5I8EA 4OLVH 1S7QA 1J8KA 3B3IB 1QFUH 4M9OA 5IBTH 1EXUA 1E0OB 3GSVB 4NRXA 3UPRB 1DP0A 2EYSB 2XWJA 4R4FH 1YEKL 1EGJL 4L4TE 3SCMA 5B8CA 3CXDH 4HIEA 1KIQA 1JGDA 1NC2B 1Z5LA 4HUUB 4RGNB 4X6BA 4G3YH 2WINA 2NY7L 3UXFA 3TVMD 2ZCLH 3MRCB 3VGBA 1QSFD 4OM0L 3SE9H 1A02N 2RAMA 2K3TA 2E5EA 1OW0C 4XBGB 3GIVA 3MR9A 3STZA 5EBLA 3KXFE 3EYQD 4OCNC 4X7TA 2LV4A 3QCUL 3RRQA 5K33A 3EO0A 1NCBH 3RTQD 3QEGL 5E56A 3EFDL 3BWAB 2D7TL 3GGWB 1A21A 4HGWA 4I5BB 1EAPA 3CFBB 3MRIB 1A2YA 1DN0B 5DHYA 4HZLB 3VRIA 2AJZB 1OCWH 3VWJC 3JWOC 5HHVL 2W9DH 4JFXB 1J8HD 3EDEA 3HCVB 4LK4A 2R15A 4WDIB 4LNRA 4LHJB 3VJ6B 2BCKA 4C56E 2FH8A 3P9WB 1NANI 4N90E 3IKCA 4GRWH 4XNYL 4LAQL 5CWSB 3SE4C 1XH3B 5KSVA 4JQIL 3T0VA 3WLWC 1T0NA 1YPZA 5JXED 3V0WL 4GMTH 5DMYA 1EJOL 2WBJA 2DQIL 2BNRB 4IRSD 2GEEA 3DXAD 2Y4SA 1FV1B 2MCPL 3RU8H 2E8ZA 3HB3C 3SDXF 3LHPH 5B3JE 1OGAB 4WWKD 4HFUL 3QIBC 4TPRL 3LD8C 5I8CA 5DFTA 3WFDH 4NQTA 1ZVSB 4AEHH 3K2UH 1DQLL 1AP2B 3O0RL 3TWCL 4XRCA 1W0WB 3HFMH 1N64L 1WUNT 1CFQB 3MNZA 3OKEA 4OZ4B 1ADQA 1WZ1L 3ARGC 5F9DC 2VRAA 4LSQH 4BQ9A 4OF6A 4G9FA 3W39A 2FX7H 1QSFE 4XAWL 4G43A 4K23H 4KGJA 2QKIB 4KKNA 4J6RL 4MA1C 4PJFA 1J0HA 3MRJB 3U46B 3QUYD 2BSRA 5CJXA 1QBBA 3TA3B 5DUBA 4FQJL 4AH2B 2J6EA 5DMGD 3OXRB 5BCAA 2JJSA 3L1OH 3SGEI 3BRDA 1AI1L 5HGBB 4GMSL 3RNQB 4X4ME 1F6AB 5IEHB 2DQHL 2YPVL 3GEWB 1OLLA 2X89A 4XVJL 3WS3A 3KPSA 5T3XD 1NAMA 2GCYA 4OLYL 4ODHL 3W0WB 4DQOH 3NZHL 2KQMA 4RA0C 1EZVY 4ODWA 2X4TA 3GMMA 5IM7A 4WI8A 1DQML 4LQFL 3DLQR 3ES6A 2CUHA 1J8HE 1LE5A 1OF2B 4RZCA 3ZE2E 3EO9H 4Y5YA 2X9YA 3V4VL 1KTRL 2A9ML 4K3JH 4RBPH 3PGCB 4OD2B 4CAGA 3MQIA 1R3LA 2VSCA 4FFWD 1HH6A 4LEXL 4S1RH 5DC9B 2I24N 2YD7A 3CCHB 3CFJA 2ICWB 4KTEL 1BOGA 5E70A 1YQVL 3DXAE 3G6JE 4APQA 1RSFA 2CH8A 1YMMD 4DKFL 2DLEA 4YDKL 1EBAA 4PJCA 2ARJQ 1RUKH 5CSGA 4P99A 4HT1H 2XZZA 4WO4B 5B22A 1YNTB 1I4FB 1PG7X 3VMPA 4EVNB 3ALPA 4EKXA 4FXLA 4HWBH 4LDEB 4RISH 1MVFA 3KYKL 1WZLA 3ZSTA 1I3GL 3TH4T 4DWHA 5M95B 4Y19A 2F53B 3CZJA 4YJZL 1AXTH 3UJJH 2R2BA 4PREB 3QEUA 3CFDB 4KJQC 1N5YL 4LEOA 3IB4A 4WNQB 4N0FB 2NLJB 1RUPL 3L95B 2A9NL 2ORBL 1WBXA 5FUCE 5D7IA 2ZSWB 5HDBF 4MJ2A 3BT2L 4YPGB 2F74B 3BVNB 3VWJD 2HJKA 4U6YB 1N5AA 5FV2A 1BWMA 2CXGA 2VQTA 4MDJA 3LEVH 3CSGA 4DVBA 3E6HA 3EW3B 5F7EH 1S5IH 5T3XE 2NX5D 4X4XB 1MOEA 4KK5C 5D2LA 5FKAA 7FABL 4WU5A 1F4WL 4UQ3B 5BMFH 1TNMA 3RQ3A 2F54A 5GJSL 4JKPH 2A73A 1CFBA 4ONHA 2I9LB 3KPPA 3ABZA 4UIMA 5DS8B 5ICXA 5TFSL 5D1QA 3TM6A 1JWMB 4U3CA 3TO4C 2HLFC 4PP1C 3SGDH 3QBTB 1UJ3C 4DTGL 3HUJA 3MRMA 1KC5H 1N59A 4HJJH 1MCWW 1C7SA 4X5WB 2DM2A 5EUKB 2V9QA 2XXCB 3HB3D 2VZ1A 3IF1A 4BK4A 2BVTA 2YD3A 4NKOA 5HYQB 4ZXBB 2G2RB 1GZQB 1Y18B 2R2HB 3QIBD 3L5XH 4XXCC 4NBXB 4FS0A 4MD4A 1K6QH 2Y06L 1EMTH 1T3FB 1YMME 2FZ3B 1U8JA 4Q9RH 3GSWA 1KCUH 5F9WC 4WEMB 5FGBC 4Z8FH 5ANMB 3S37H 5LGJB 3ARGD 4NNPH 3QDMD 3TF7C 1PKOA 4U49A 5DZNA 3U36A 3FMGH 1A1MB 4KHXH 3UTSB 5DJ0B 3GI9L 5JLZA 1DCLA 2FB4L 3OSKA 4ONGH 1DQTA 3VD7A 4MXWH 2NZ9C 2HA1A 3AREB 4EUPH 4XC1L 4GW4B 4R4BA 3T2PA 1JPTL 1YPZE 2H32A 4QNPE 3QDJB 4HKJB 1OOAA 4IIQA 3F7VB 5DK2A 3RJQB 3BP5B 3WUWB 4NN5C 3PJSB 2YBRA 3S3PA 5F7DB 3GNMH 1XF3B 2E7LC 5HVHB 4P2QB 1K4CA 2FL5B 3ETBF 4HKBA 4PJ9B 3QSKB 2VDQH 1CF8L 3O8XB 1TZHA 4Z7UE 4A2MA 1N0XH 5F3BA 4KTDL 1BBDH 3ZSSA 5GS1A 4HLZG 4YWGL 3RWFB 2NX5E 3TT3H 2GY7B 1VFAB 2P5ED 5E8PB 3SE3A 2VO5A 1EJ6A 3X11A 3V6FB 1KCKA 3L3DB 1MRFH 1S9XB 4Y19D 1LK2B 4XNMA 3BD3A 3F58H 4M02A 2IG2L 2W07A 2MPAL 5IUSA 2Y36L 3SY0A 1JF1A 1QNZH 4K8RL 5CEYA 5ACZB 5DSCA 4PJBF 4IMKA 4YHOL 4TSCH 3B2VH 4XCCH 1UM4H 2GFBA 3EOBA 4Y5XC 4YK4C 2FATL 4MDIA 4GW1B 3SGJC 3DVGB 3MJ9A 4KPHL 3BIKB 4P2RB 1SJHB 2EDEA 4RDQG 1P1ZB 3H2WA 5DR5L 1JHLH 3T0XA 1U8NB 4JRXB 3KS0H 3BPNB 1FPTH 3OB0H 3L3IB 2RHEA 5GJTL 1QLFA 3LRSB 3ZKXB 1Y6MR 4DUXA 4JFZH 1ED3B 1UH3A 3QDME 4I0PB 4X6DE 5JQ6H 5AG9A 1EHLL 2WIIA 2V2TA 5F7WC 4WUKL 1FBIH 3BAEL 3S5LA 3MV7A 4U6XA 1QKZL 4UDTB 2WUBH 2P8LB 4M6OH 1N0LA 2VQUA 1K2DB 3ULSA 4UBDC 1H3UA 1U8LA 5FECB 1CFTA 1XF2A 4F9PC 4YNYB 1IM9D 2ICEB 3RUGE 3AC0A 3OF6D 5EA0H 3IGAA 4ELKB 1FORL 4ZFFB 3CSYA 3TCLB 1X5GA 5F6HJ 4KK5D 4EOWH 1WAAF 2ERJC 4P23B 1EA9C 5C0RH 1KPRB 3BO8A 3HE6A 3NFSL 1TZGH 2VITB 1DZBA 3EFFB 1YNLL 2P5EE 3VDAA 3TO4D 2HLFD 4PP1D 3G9VA 3G5YB 3WEXB 1TJHH 4Y19E 5ELIA 2X9WA 5C0FB 1CE1H 4X4YB 5DWUL 1INDH 4JCMA 5D7KD 1AFVH 5GGSY 1P2CA 1UACH 4XVSL 4C57C 3HC0B 3O3UN 4NHUB 1Q9OB 2X1XR 1U58A 2HVJA 1RJZB 5FA3A 3PWLA 5EFIA 4NZUL 3D9AL 4XBEH 5C0CA 3KPQA 2H9GB 2P44B 3F7YA 2MKWA 2YUWA 3FN0L 3OKLB 1CXEA 4OF8A 3TZVC 3ZLQC 3N9GL 2EH7L 1IGIH 1U8MA 1DUYB 5GRJL 3HNSH 2EKSB 1DBAL 1P7KA 4U1MA 3QNZB 1AGFA 3SDAA 5E8DH 3DV4B 3Q5TA 3QEQD 2BZDA 1CE6B 4M9PA 3ECBB 3VFGL 4QTHB 1CG9A 3GSNH 5FA4A 4PLOB 4L4TB 1SMAA 2ZG3A 2F8XC 1CWVA 4X7SH 4AQOA 1H5BC 4EN3A 4M6NH 5GQBA 3SDDC 3DSFH 1RK0A 4PJDE 5I0ZA 3C60B 2HJFB 3KYMB 4M93B 1T6VN 4JM4H 4ONOA 1DBJH 4QHLB 3UROR 4AG4H 1I1FA 3Q48A 4GRMB 3KXFB 5TQ0H 1GHFL 1UA6L 4R8WL 4Y4HA 4YGAB 5DUMH 4JG0L 3SGDI 1IAMA 2ENYA 1SY6A 1XT5A 5SWQA 3G5XA 3PXHA 3V4UH 2LABA 4H1LB 2CLRA 5EO9A 1YC8A 2R4RH 1IAKA 1B88A 4PD4J 3WFHB 2G5BB 3QJHB 1JGLL 1EO8H 1AD9A 3I50L 5D7KE 4Z78B 5DXWA 4ZSOE 4RMUA 4OCRL 5DHVB 1YEEL 4K3HA 5BQ7A 4IRJD 4AT6B 1WEJH 3DIFB 4F3FB 3UZEA 3SKMB 3VFWA 3OGCB 5MERB 4C56B 1CLYL 4A6YL 4S1SH 4IHOB 1LK3H 4OIIL 4Z7VF 4Z18A 1G0YR 3P4MA 1T7XA 3JTSA 3ZE1E 4AIOA 3BZ4A 1LQSR 4PYGA 4UBDD 5IQ9B 4PJ5B 3IAQA 4V2BA 1HHHB 1G7QB 5HHOA 3BIAX 2H3NB 4Y1AA 2JF1A 1CFNA 4N1CA 1NGPL 3G04A 4JM2D 1BVZA 4Z95L 1NGXA 2WQ8A 3B6SA 5E95B 3QEQE 1U3ZA 4NPYB 3U0PA 4HPYL 4Z7WA 5DD5L 3H9HA 5DI8B 2VXTL 2GJ6A 2BY1A 4GKNB 2R69L 4Y4KC 5DQ9B 4FQIH 1IC7H 1GH7A 3TVMB 2VUYA 3DURB 4JO2H 1QSFB 1KT2A 4PG9B 3HAEG 5SWSA 3GBLA 4RAUA 3QXAA 4O51B 1A3LL 1EEZB 4WIQA 4P2OB 1IGCL 2CLZB 2PYEA 4JFFA 4IOIA 1TVHA 4FP8L 5FOJA 3MV8A 1YYML 4K7FB 3VDCA 1J1PL 3RTQB 4K8RC 1MEXH 1B6UA 3TNNB 3T2OA 3WYRA 1RV6X 1LDPL 2FYYA 1XGQB 4LCUB 2UWEA 4O9HL 3FAWA 4FG6C 3TYFA 3PP4H 5HDQL 3GM8A 1F3DJ 4OKVA 2NW2B 5LGKA 5BXFB 3IRZA 3GJFB 3OJDA 2V9TA 4HEME 5F6IB 3G5ZB 2YMXH 2YN5A 5CHNA 1J8HB 1GCFA 4N68A 4KU1A 2DN7A 5BRZD 3MLUL 3TZVD 3M8OH 4HXAH 5CJBA 3MLZL 1PVHA 4OQTL 1SEBA 4A2LA 1FP5A 4ZNEA 5GSVA 4L5FH 3T0BA 3AS0A 3ZE0F 3NPSB 1T83A 3ULVL 1U41A 3BZDA 5MHSD 3QCVH 2OMNA 4F9LC 3G6JB 3DXAB 4XNXH 4UQ2B 3TIDB 1RZ7L 3ZL4L 4YHLL 2HFEA 5ENWB 2ED7A 1EFXA 3GHBL 4JQXA 4YBLB 4BUHA 4KZDH 4WWKB 4EDXB 5C07D 5IT2H 2X4OB 3WFCL 4IDLA 2DQTH 1YNKL 4NO2B 2D31B 3CMGA 2VDMH 4UB0L 4NBYB 1N3NA 5KJRL 4GXUM 4MA7L 4ZFOA 5GS0H 3Q1SL 2FX8L 2P7TB 1A7RL 3S37X 4G8IA 5HHPB 3KWWA 3UBXA 3MYZA 3LKOA 3FQRA 1CICB 1WBYA 1U8PB 2F8OA 1MCDA 4NRYA 1TCRA 3ZDYF 3BUYA 3GMPA 2ADGA 3PHQA 3QUYB 2IQAB 4HF5L 4JGJA 4M7ZC 4PJFF 4C4KO 2EDYA 2QSQA 1BM3L 1DLFL 3R8BB 5F3HA 3T3ME 4R97C 5I8EB 5FYJL 4MS8C 4L9DA 1QYGL 4XI5C 4TUOA 4PRNB 3T2NL 1XCTA 2OM5A 2EDWA 1S7QB 3KPLB 4OZHA 1F6LL 5L9DH 4X7DC 4JZOA 2EEAA 4MX7B 4ZUSB 4OZGE 4UTBH 3RBSA 3VGEA 2FBJL 3VFTA 1Z5LB 1RVFH 2BOCB 4FQ2H 2GK0B 4YXLH 4N0UE 1JNHA 4ZG1A 4RIRB 1MI5D 4YUEH 1SYVB 5DFWH 3AM8A 5EU5A 5BRZE 1CGSH 1P6FA 2EYRB 4HLJA 3QUXA 5AZEL 1A7OH 5D72H 5DVNA 2EDFA 2W9LA 4X7TB 4RX4D 1PLGL 1I3VA 4EI6A 4XHQA 5I0DA 2NY0C 5KTEH 3GMLB 4ZPTA 5MHSE 3MBEC 4HCRH 4RMRA 1CGTA 4OF0A 5K9KB 1ACZA 4Z5RB 4GSDL 1YMMB 3EOAB 3NIDF 4NWUH 4Y4FA 1EAPB 2YK1H 3ESVF 5AUMA 3C6SA 5I8KL 1AQKL 3U7WL 1QO3B 1KN4H 5DHYB 1CLZL 1OAQH 3VRIB 3WNLA 3E6FB 2AEQL 5HPMA 4Z6AT 2ESVA 5DLMH 5C07E 5JMRA 3D39D 1R3IL 2EDLA 4H26B 4RDQF 4LNRB 3RX8A 2UZIL 1DVFC 2E9WA 4NQXB 4LNVA 1IGJA 2BCKB 3U0WH 1H15A 5IFJB 1ZS8B 4M7KH 3IKCB 5EO0A 2ZNWA 5F9JA 2VN7A 1KXVC 3ILPB 1EX0A 1YPZB 4N5EC 2BSTB 2F58L 4P48A 2B4CH 4I13B 2XTJC 5C08A 4L8BA 4RFEA 1PEWA 5J06A 1QPXA 4HIHA 2C1PA 1G6RA 4FFYL 2GQHA 4WHYH 4FG6D 2A6KA 3AAZB 5A16B 2P8PB 2L0DA 4Z7UB 5DMJB 4FXKA 3LKPA 3QISA 1MELA 2PW1A 1ZLSH 1YYLH 1FVCA 5E24E 3IKKA 8FABA 5E8NA 4XRCB 3OX8A 4MJ5A 2NX5B 4DGYH 1F3JB 4NGHH 4MJIA 4NJAH 4JDTH 1YECH 1RUMH 4R0LC 5ID0A 3FO0H 5FDWA 1ZGLA 1MI5E 3HRPA 3PHOB 4NKIH 3WUWG 2Q7YA 2EIZA 4HPOL 4M48H 3SPVB 5L2KA 4ZTPL 3H42L 2C3VB 4WW2C 1YEDB 3WLBB 2BSRB 5LCVH 4NQCA 4CNIA 3W82A 4DJMA 3NFNB 5DT1H 4WU7B 1N7MH 4JB9L 4YO0A 2J88H 1MLBA 2YD6A 3QIBB 3LD8B 4TYUA 1CR9H 4M62L 3NCCB 4ZUUA 4NFCA 1D6VH 3HZYB 2YXMA 2GCYB 1DBMH 1V3LA 4OFKA 4WJ5A 2ZG2A 3T0WA 3GB7A 2Q8AL 3UBXG 3ARGB 3QDMB 3D39E 2F8VA 1LE5B 4XC3H 4NHCH 3VDBA 1ZLVK 4LHUD 4RAVA 3BP7A 3GSXA 4MA1B 5C0JA 3F12B 5KOMC 3ZTJG 4ZNEE 1CL7L 5TQ2H 3OHXA 4CN6A 3HG1D 1WITA 1HH6B 1RUQH 3JWDH 2B0SL 1MQ8A 4L3CA 4DGIH 4MS8D 4L8SA 4JEGB 1NGQH 4J7RA 5HHXH 1HHGA 4KI5F 1QRKA 5JOEA 1ZA6A 1J1XH 2XZQH 4KVCL 5BV7H 4P46A 4M61A 1E27A 4G8EA 5JMOC 3NN8B 3V5DA 5TE6L 4OJFL 4Q0XL 2ESVD 1I85A 2L7JA 3IFOB 2VZVA 1JCKA 35C8L 2RR3A 3BIBX 4XGZB 5EORL 4O4YH 5LAXB 1PSKH 1P4IH 4UU9A 3EUUA 1S9WA 1ZV5A 3RWHB 4B7LA 3I02B 3VFSA 4LPTA 5FYJU 5IB2A 1G7IA 1JGVL 2P5EB 5ESVA 5JPMA 2Z31A 4Y19B 4S1DC 3C08H 4MQTB 4XX1G 3T0EC 4L3AA 1EIBA 4R3SA 2R2BB 5GGUA 3FQTB 3QEUB 3BKJL 1W2KT 3IETB 4ZODA 4LEOB 5C08D 5IMMA 1BFTA 3ULVC 2NY0D 3B83A 3MOBH 4K7PH 3RZWA 4LARH 2G60L 3MRRB 3MBED 4GKSA 4YDIH 5IF0B 4I4WA 5TDOA 3VXTB 4U1KA 5D7IB 1Q1JL 4YXHL 5EIVA 1HILB 3MUZ1 1M05A 2M8XA 5KSBE 3OAZK 2IADA 5IHZB 4R96A 2YKLL 3OKYA 4P3DB 4OBRA 5I1IL 3PWPA 3TN0A 4HIXH 2BRQA 1DVFD 4MZ2A 5D2LB 3H3PL 4AIXA 2YD5A 5FKAB 3NACH 1P5VA 2DBLH 1A6UH 4N5ED 1JF5A 2DQDH 2R56H 3AY4C 3DMMC 5K9OB 3X3FL 4UIMB 1CCZA 2PR4H 5L2KD 4XMLH 2V2WA 3JV6A 3O3DA 1R3HA 2ADFL 1QFWH 1BLNA 1VFBB 3HUJB 5CSZB 3RWJA 5SWZD 2P4AB 4XBPA 2BDNH 2CRZA 3HG1E 3IF1B 1IM9B 2X9XA 4KQ4H 3KYNA 3KR3L 3GUTA 4DZBA 4PJHA 4PJDB 1HSAB 3QXDA 4P2YA 4J3UA 2NCMA 3DVFA 1ZHKA 3KLSA 3MMEA 3EYOB 5JPNA 5CLWA 1C5BL 3HA0A 4D3CL 1K3ZA 4WHCA 1WFTA 4WI6A 3VE0A 4MAUH 5C6WH 1CVRA 5JLZB 4RMQA 1NGWB 2H1PH 4KDWA 3H3KA 3TO4B 1WICA 1A5FL 2QHLA 4PR5B 4R4BB 1BGXH 5I71C 3J7HA 4X80H 4TSBL 4JKKA 5D7SH 5C08E 2EKJA 2VLJA 2IQ9H 2DJUA 3WFZA 1BAFH 5HYEA 2A77L 5I18H 4RFNC 3CFCH 3I2CL 1GIGL 4HLZH 2JB5H 5IVXE 1UB5A 4HIJA 3STLB 3UYOD 5EU4A 1QHPA 3HPJA 3MLRH 1R5VB 2HP4A 5E4EB 1MJJB 3X3GH 2YUVA 4C58B 3HPLA 4FFZH 5EUOE 1UXSA 32C2A 3X11B 5T1DH 3MGTA 2CO6B 2BXYA 2X7LA 3RDTA 4XNMB 1J88A 3FONA 1VSCA 1SJXA 1I3UA 1JF1B 2ICCA 2XKNA 3QQ4B 3IDNB 3QUMA 3HMXH 5JW4N 4KWUA 4QRRD 1LEKB 3QEQB 1GGIH 2GFBB 1A7QL 1ZLUH 1K5NB 4QT5A 3ZYZA 4FQHB 3LPFA 3LVEA 5SWZE 5DYOA 5KS9F 4F7CB 1GC1H 3RGVA 4UT9H 25C8L 4BK5A 5DMKA 3FO9B 4XPHH 1DE4A 3P9LA 3CLEH 1I9JH 2XIDA 4KRLB 5FCUL 5CIPA 2X40A 3CNKA 1BIIB 3E8UH 4LSVH 2KZWA 3T0ED 4ZFGH 1VEMA 3S5LB 4U6XB 1TTGA 2P8MA 3EOTL 4AENA 3AXLA 2HRPL 3ULVD 3QO0B 1A47A 5F97E 4AQ1B 1U8LB 4Y5XB 2CDFA 4YK4B 4HDIA 5DA4A 3QQ3B 4XNUH 4Q6IC 4KKBD 4ZO8A 4K9EH 1TZIB 1ZE3C 1FNEB 4G6JH 3L5IA 5E2WL 3JUYA 4IRJB 1ZLWK 2R0ZH 1JV5B 3HMWH 1IC1A 4MA8L 3VFUB 1LO3L 5EB9A 1A9BA 4DZ8B 2P1YA 1AGCB 1JFQL 4L8CA 2GUOB 5IESL 1W0VB 1K8IB 2EECA 4PUBL 5DD1H 1KCVH 5IB3A 5CINL 3X17A 1AGEB 5C7XL 4J1UA 4QHNA 3LKQB 5DJDB 4KHTH 3O11B 1QFWM 3IDGA 4DN4H 2KBGA 3O45B 2I9TA 4G7VL 4M7LT 4OT1L 4JM2B 5FYJD 1XF1A 3L7FB 4QRRE 5CJQH 3EYFB 4PLKC 4FQCL 2HVJB 3BPCA 2OZ4L 3D25A 3MFFA 4Z7WF 5EZIL 4HKZB 4M8VA 5LJYH 1DLHA 4Q9CA 1KB5L 2H32H 2DQUH 3P77A 4LGSB 1A6TA 1JGUH 3WJJC 4LU5H 1CI5A 3MRPB 3GO1H 4LLUA 5F1SA 1JNJA 1B3JA 1VKXB 3GSUA 5CZKA 4AIZA 5F9AC 4LHQB 3T0EE 5IVOA 1NAKH 1R5WA 3A67L 4U1MB 4GXVL 1GAFH 3NABL 1AGFB 4ODVH 1U6AH 4X99B 3ULVE 2QL1A 3HC4L 5IWLC 4QXTA 4F33B 2F5AH 5E5RB 5ID1A 3LS4L 5IV2A 1CG9B 2X4UA 4JFED 3RA7L 4KK8D 3DVNA 4OZGB 4DGVH 2UWEF 4HQQL 4B41A 2FDBP 1DN2A 4M7JL 3IU3A 1IGTA 4XP1L 1XGYH 3FB5A 3GSOB 4N0UB 5AD0A 2GJZB 2AXGA 3NCFB 1YY9C 5BRZB 4XP6L 3LAFA 2I60L 2QQLH 4X6FB 1ZLVH 2W65A 5ICYB 1I1FB 3L3GA 3CLFH 1S7SA 3M1BB 1NMAH 2C1OA 3MJ9H 2H26B 2L4OA 3ZKND 3U79A 3MBXL 4G8FB 3B5HA 1FLTX 4KMTH 1QFWI 5LGHL 4N8CH 5IGXL 4RMWA 4GBXC 4HV8A 1RZKH 2XZAL 4LP5A 3ARWA 4JG1L 1IC4L 3SBWA 3VW3H 4HUXA 4OM1L 1IAKB 4YDVA 1MQKH 3G08B 1OAXH 3I3DA 3WXWH 3TH3T 1H5BB 5C07B 5FYJE 2WP3T 2VXSH 5BQ7B 1I8LA 3I85A 2B5IC 4ZUVA 4MYWB 3MUY1 1CGYA 1FGNH 2QSCH 1G7HB 4WFGD 1RU9H 2WWKT 2UUDK 3LSOA 3WJLA 1MCFA 1JGEA 2YZ8A 4I1NB 4NM8H 4PRDB 1KCSL 5GGRY 1VADA 2A6IA 3K7UA 5IP4A 3BKMH 4JY6A 1G9EA 2L7UA 4UDUA 2DIBA 4NZJA 5J4MA 1AXIB 1U93A 4CVWA 4XPTL 2C3XA 4LSUH 5C0IA 5ISZD 1CFNB 3GK8L 3OAZH 1MH5A 2BSSB 1CT8B 5MEND 4WWID 5HVFB 1MVUB 5ALCL 4U05A 3VXQA 2BHYA 1B4JL 4YHPA 3PQYD 1UWEL 4JFEE 1D3CA 3T09A 3KLAA 5F7FA 3HAEH 3B8SA 4PGJA 2QQKL 1JWUA 2Q8BL 1MI5B 1PY4A 3QAZC 3TT1L 4PFEA 2AJYH 1Z3GL 1D6EB 3LKNB 4P5TC 1NKRA 4CRPA 3MACL 2YN3A 4UAOC 3UPAA 1YY8B 4L3ED 3SQOH 5ACMA 3K80A 5I17B 5E6YA 1JN6B 3TV3L 1T22A 4K7PX 4HS8L 3Q3GA 5FM5O 3TYFB 4HWUA 4U1LA 5KSUA 3GBNH 1IGYA 4OKVB 4UILL 3V5KB 1KJ2A 1MFCH 2FGWL 3OJDB 1IGFL 3NA9L 3D39B 4PRBB 3HC3L 3BEVA 4R7DB 5CHNB 3DRQA 3UYPA 4NP4L 2VJXA 3MZGB 3HZMA 1IM3A 4RMVA 2VSDA 1NC4A 3VXSA 5DJCA 4WFGE 4LLYA 3GMQB 3N85H 1HKLH 4GQ9L 1O7VA 1PZ5A 1RZJL 3RVXC 2CXKA 3RY6C 3MUGA 4Z76A 4PJEA 3T4AB 3N1FC 4QRQB 5DK0B 1F6FB 1A1NA 4PP2A 4MD0A 4PRAB 4QTIH 5EDXA 3A0OA 1FIGH 1R24A 3WUZA 3HNVL 5E1AB 1A22B 1EFXB 4GAFB 1NMCC 4PJAA 3ZYIA 1MNUL 2BVQB 5ISZE 2VLKD 3LV3A 4LMQE 1NFDA 1U3YA 2DJSA 4FQLL 2XNAB 5MENE 3ROLA 1Z9MA 4FZ8L 1FNAA 4DN3H 4XTRD 3WD5H 3PQYE 3TYGH 1YY9D 1NL0H 4OFIA 1S5HA 5I6XB 2R9HD 4H25A 2A74A 4PJGA 5LKNA 3RL2A 1MCOH 4LCIH 3DX7A 3MRNA 4JCLA 5H37G 5I15L 1R3KB 4HWZB 3LN5A 3QPXH 2EXYC 4ZOEA 2NZIA 5LXGL 1GPOL 3QYCA 1Z2KA 1RJYB 3LDBC 1VFMA 3BUYB 2ADGB 3PHQB 4GBXD 5DQDH 2Y7QB 5JW5B 2UYLA 3WE6A 1CGUA 1IEBA 1J1OH 2OTUA 5IEKA 5KSBB 3HLAB 1WIPA 1RZ8A 2MSPA 4L3EE 5I1JH 3WO3B 1EUTA 5IFHL 1AGBA 1Z9OA 1CIDA 3D69A 4JN1H 4U6HA 3QWRD 3TIEB 5B21A 4BSVB 5L2JB 4C55A 1ZANH 3PABA 2EDNA 3VFTB 4Q9QL 4FNLH 4QRPD 3ARQA 3O3AB 1JNHB 5EC1A 3MOAH 3P9MA 1HQ4A 5IJKA 1J0ZA 2VNCA 2ZSVB 3DV6B 4LHUB 3OAUL 1PX4A 1U2CA 4M7ZB 5AZ2H 1NEZB 5L6YL 3HG1B 1J0IA 4EI6B 2GTWB 3SGKC 2KPNA 1CU4H 4NJ9H 2DLTA 1CFVL 3C09C 5INCB 1MCBA 4JRYA 3QG6A 2AGJL 2J4WL 2R8SL 3O6KH 2GSGA 2IF7A 4NQEA 1WVZA 2MQ0A 2PTVA 5ADOH 2ESVB 2VDRL 4JPKH 1JPGA 2VLKE 1S9KC 5JO5B 4YQXH 1T1XB 1J9CT 4J8RA 3QULB 1LVEA 1OM3H 2AQ3A 1ODAA 3RX5A 1HYSC 1L7TL 1V3JA 1BWWA 3E2HC 4M7LH 4U6VH 2GTZB 2JIXA 4P5TD 1N6UA 1BJ8A 5ILTL 3C8KB 3MRKB 1CK0H 4NKDA 4KXZH 3L5JA 4MCZA 5C08B 3VRJA 4RFEB 1PW3A 4BFEA 2Q20A 3GJFK 4JDVB 5B3JF 1XR9A 2NY0B 2C1PB 1G6RB 1HDMB 3MBEB 4L1DA 4NRZA 3WKMH 1A4JA 3NGBC 4PJ7A 1FZKA 4PGEB 5HGHA 5D71H 5GSRB 2FIKA 2EZ0C 1ZHLB 5IVXB 3K46A 4IMLA 1MJ8H 4X5XA 1E6OH 1NMBL 4FXKB 4RWYH 4LAJH 3PL6C 5EBMA 5IBTL 4NQVA 3I6KB 4LKCB 1FVCB 4HX1A 4Y2DC 8FABB 5E8NB 3WIFA 2N56A 4YBQC 1AO7D 5IHLB 3LEYH 1NKOA 4UINH 4YH6A 1DVFB 4NZTH 1F4YL 5EUOB 3HTLX 1U95A 4PG2A 4G3YL 4QRPE 4Y7MA 1H3WM 2ZCLL 1BP3B 3SE9L 2YS4A 1B0GA 2Q7YB 5L2KB 4QXWA 3SN6N 5GRYA 1FL5A 3CFKA 4CMHB 1OD7A 4AY0A 4DK3A 2BOBB 3BZFB 3QUKA 5E2VL 4ZNCD 2DM3A 5GRUH 5DK3A 1G0XA 4JVWA 3GRWL 1AQDA 1LP9A 4PJHF 3UJIH 4BM7A 5F1KC 2ATKA 1JJUA 4PJ8A 1KIRA 3K81A 3M07A 3OKMB 1CBVL 4X7CC 2EO9A 1D9KC 1N4XL 3ZE2F 4OI8A 2VLLA 4NUJB 1S3KL 1ETZA 3ZTJH 1IVLA 4GAGH 4A6YB 4R0LB 2EXYD 3WS6C 5AWNH 3QIUA 5HYIA 1S7RA 2B2XH 5KBNC 1FZJA 1ZT7B 2W38A 4WW2B 3DO3A 3MLSL 5DQJB 1JTTA 5JDSA 4HXBH 4P0DA 1OT1A 2Z91A 3THML 3P11H 4WV1C 4WHTB 1U8IA 4LVNC 4L8SB 1QLEH 3PGDB 1FSKC 2XG4A 1FH5H 1WISA 3B2UC 4DFIA 5I76A 5FHBH 4LBEA 4FTVA 2F9BT 1MWAA 1XR8A 1SQ2N 1E27B 3CC5B 2CLVA 2DLFH 4JPWL 3GBMH 4AEHL 3NFPB 4LSRH 2LU7A 3QHFH 4HUWA 1WFOA 2F15A 3ZKQD 3HFML 5DRNA 1AO7E 1M4KA 1MJUL 5E08L 1B0WA 3VH8B 1G7IB 1CIUA 1GL4B 2EDOA 1IT9H 5ESVB 2FBOJ 1E4WL 2W9EH 2JIXD 1RHHA 2X4RA 5GRWA 2VQ1A 3FB7B 1CS6A 2FX7L 4E41D 5IB4B 4TRPH 1ITBB 3MNVB 1MCJA 1RZJC 1F58H 1MUJA 2BSED 1KNOA 2K7QA 4QRRB 5TDOB 4X5LA 4P4KC 4U1KB 3P3YA 43CAB 3V6BR 3CIQA 2CKBH 5CMAA 1KTLA 3L1OL 2P49B 1FCCA 2AKRA 3LMJH 3ZHDA 4EXKA 1T03L 1DQQA 1E28A 1FC2D 3BGFB 3IFPA 2WWMD 5M94B 1QSED 2ICWI 1JNLL 5EZOH 4DQOL 3V6OC 5DD3H 2E9BA 1OAUL 3VXMA 1HYSD 4M8QA 1UQSB 2A6JA 2KZ1B 3PWJA 4YHIA 3CUPB 4Y88A 3KAAA 3T0EB 3EO9L 3MODH 5CEXB 3KLHC 1KELH 3JV6B 3RZCC 1R3HB 4UMGA 4CW1A 5DRWA 3P40A 1PKQA 2IMNA 1VGKA 2BY3A 2HH0H 3TJEH 4X6CA 3VXRD 4LSSH 2Z35B 2OI9C 4XZUB 4JHBA 2EZ0D 3MYJB 3QFDB 1JTOA 3O3EB 2I07A 3GUTB 1I1RA 1P69B 4U1SA 1HZHL 3PL6D 4ENEC 3QXDB 2R0LH 2VDKL 2CK0L 3FCTA 4Y2DD 5DRZB 4O2CA 4YBQD 2AP2A 2PTTA 1RUKL 3O2DA 5I30H 1IBGL 4KDVA 5CP7A 1PG7W 3T77B 1J0KA 1RHFA 5FK9A 4NDMA 1XGPB 3TBSA 4GG6E 2QSVA 4KMQA 1M71A 3CFEB 4L9LA 5C0GA 1KOAA 2NXZC 2UY7A 1HN1A 1FL6A 3VXPA 5AAWA 4L4VA 3S3JA 2DAVA 4FHBD 3UTQA 5C09A 3PWUB 4S2SB 2DMKA 43C9A 4YAQA 3WNPA 3BJLA 2ICWJ 3D3VD 1UYWL 5E0QA 4E41E 2AJUL 4OD1H 3WXVL 5FF6A 4NUGH 5MEPA 3S98A 1HHIB 3HI1A 3LKSB 1UB5B 5IW6A 1D9KD 2B1HH 1R0AL 4KV5F 2ZCHL 4XHJC 1LNUB 2YPLA 3HPJB 3OKOA 4H1LH 4PJIA 3I6GB 5F96H 1HHKA 1OAKH 1QSEE 2IH3A 5E99H 5GGVL 1S7XA 4KUCD 5EPMA 2MOVA 4NSKB 1UXSB 32C2B 4KXZI 1UEMA 3P73B 4RSVA 3V6ZB 5BMFL 3VCLA 3FONB 4JKPL 3MCKA 3QQ9C 4Y5VA 3FOLB 3AU1A 2HT3D 2NY5H 5I71B 1QBML 2DQEL 3QUMB 5B38A 1ZA3A 4PGCA 5ADPH 3B2UD 1C5CL 3S36X 3GSQB 5IFAL 2R4SH 5TGBA 4JFEB 2OL3A 1EHAA 2IAMC 3KPRA 3VXRE 1R5IA 1I1CA 1M1SA 2A1WL 4AZ8A 3QNYB 5DMKB 5FYLL 1DE4B 4TVPH 1SJEB 4XMKH 1NFIA 1DBKL 2VABA 1FNSH 4Q9RL 1NBZB 1IEAB 4D9RD 3BXNA 4J3VA 4X6DF 3DETC 4IRZH 5FM4A 3W11D 5C8JA 4Z8FL 3VXUD 1GOHA 4NNPL 4N8VA 4S11A 4X8JA 5H35B 3DX6A 3P4NB 1QBLH 2E7BA 4L4JA 2DTMH 3WHXA 3AXLB 4FXGB 2CDEA 2V7NA 4HS6A 3MRBA 4ONGL 3X13B 4MXWL 2FEDC 3RIFK 4NFDA 4P4KD 4QWWC 3RUGF 4N9GA 1FL3A 1FFOB 3PV6B 3R0NA 1PD6A 5C0EA 4HBCH 5KVGH 3D3VE 1NCDH 1O7SA 3GMRB 1KJ3L 5D8JL 5C1MB 5C0DA 4JPIA 3MA7A 3H9ZA 4F7EB 1OAYL 3DOSA 5L0QB 4JE4B 4E5XA 3U7YH 4Z7OE 1OSZA 5ICZA 4OCYL 1N0XL 3MRDA 1I7UA 4U1HA 3GKZA 1BBDL 4RGMC 2YOCA 2VOTA 4ZFZA 3KLHD 3GJFH 3SKUD 3RZCD 2QQNL 4Y16C 4OCWL 2J8UA 5EZJB 2R0KH 2BY0A 5JXAH 4JLRA 1MHEA 4QCIA 2DWDA 4F7PB 3TLRA 4Q6IB 5ISZB 4J4PC 2W0LA 3B2VL 1UM4L 5MENB 2VR4A 4ENED 4EBQL 1INQB 1ORQA 4CL7A 3SO3B 3BPCB 3UTZA 1TFHA 2Y9RT 2ZUYA 1PDKA 1B0RA 1T89A 1YEGH 3CXHJ 4FFVC 2CGRL 1NCCL 1VFUA 1P4LA 4D9RE 2GAZA 2NXZD 2QR0A 1I1AA 1I7RB 3BPOC 1S9YB 3VXUE 3MA9H 4PTUA 3QB7C 5IMKA 5JQ6L 2P46B 1FBIL 2EH8L 1R5WB 1P7HL 4OTXH 4L3EB 1LO5A 1RZIB 4HH9B 3PP3K 4M6OL 5F44A 2HKHH 2AEIT 1MHCA 2VDLL 3V7AE 3QWOA 2A83B 3DVNB 3LQAL 4JJ5B 3IFLH 2IJ0C 2RJMA 4XP5L 3ZHKA 1X4ZA 4HIIA 4I48A 2LVCA 3B9KC 3EZJB 4XHJD 1ZHBA 3FT4B 5AD0B 5HYSB 4HHAB 3EZ8A 2AXGB 5I9QC 4GW5A 1BZ9A 3AMKA 1NDMB 3CK0L 3V6OE 4GS7C 1S7SB 4MB5A 2ZUUA 3CU7A 3C6LC 4G7YL 5C0RL 5I1HH 1UZ6F 1G7MB 3NCJH 1ZKAA 5T3XH 3IDMA 1YZZA 1G7PA 3QQ9D 5B38G 5CBAA 4YEEA 5DJYA 1LD9B 2EDRA 5IMOB 1A1OA 3MRGA 4PJEF 1HINL 3OJMB 1S7WA 4HV8B 3TO2B 4HK3J 1BFOA 3ZYOA 1PEZA 3NA4A 4U7MA 4EI5A 4JO1H 5CIPH 4YDVB 4HG4K 2IAMD 1CE1L 5DTFA 4Z7QE 5E94B 3NCMA 4TNVF 5H94A 1NUFA 4PJAF 4R90H 2VLKB 1K4DB 4RGNC 3MPCA 1UACL 1I1YB 1GXEA 4YE4H 2W60B 1NLBH 5CCKL 2OS7A 4ZUVB 3VFMB 1XGUA 3DETD 2HTKC 4UV4H 5CJ8A 1DEEA 1LEGA 4N8VG 5AYUH 4OUUA 4V1DD 4PJGF 1INEH 4BFIA 3ME0A 1Y6NR 4ZMAT 5FGRA 1KIPA 4OD3H 2AK1L 2BHZA 2PO6A 4GBXB 4PRIA 1JRHH 2FEDD 3C8HA 1QLRB 3IXTB 4G6ML 4UTAH 3SJVD 4QWWD 2RCSH 4QKXB 1JPFA 2IPUG 3HZKB 3QEHA 2D03H 1GGCL 2HRLA 1FNFA 4XPAL 5FB8B 1MIMH 2X10A 5L88H 1J0YA 1DJSA 5EWIL 2JB6B 2B5IB 4E42A 5FGCE 2AAVA 1G9MC 4HC1A 4M6NL 4CU8A 3L9RB 4QRPB 3A6BH 1C1EL 1Q9WB 3BW9A 3OAYK 4YBHA 1JWUB 4LCWA 1JZ6A 5F70A 3L3JA 4YHNB 2IGFL 4NC2B 4NQDD 2QHRH 4KRPD 1F02I 3OV6A 4LLVB 4HWBA 2D4FA 3JWOH 2JLLA 1YEFL 2Z8RA 3GIZH 4Y16D 4X98B 1I7ZA 1NCUA 4LLWB 1C16B 2BHUA 1E6JL 4UV7H 2CRYA 4J4PD 1BJ1J 1ZHNA 1XF4B 2AW2A 1F2QA 3VG0H 5BOZG 1ND0B 2VLRD 3T3PE 1OAZH 4O58H 2E7HA 1C7TA 1P53A 3RPIA 5DJXB 5GGTL 4BSJA 5CS7A 2OCFD 3BHBB 4OLWL 4RCAA 4WGWB 1EO8L 5T5NG 4JZJA 4U3HA 5DVKA 4E0RB 2MQCA 2N7AA 3BEVB 5MP6L 2BVPA 4WEBL 4O5LH 4FFVD 3PV7A 1IE5A 3CD4A 1WEJL 3L5WA 4G9DA 4OCXH 3DMMA 2AK4A 1IM3B 3QAZB 4QOKD 2ZUTA 4OCSH 3MXVL 5AYQA 2XOTA 3JXAA 5I1AB 5DJCB 2P42B 1HYRC 2DD8H 4V1DE 3FB6B 1XIWC 2WBKA 1OQXA 1IILE 2B8OT 4P5TB 1T5WB 3VFOA 2HVKB 4BZ1H 3FQNA 2OJZH 3NVQA 4UAOB 1HEZA 4XH2A 5IROA 3SKOB 5MEQA 4LGPB 4PP2B 4F8TA 4MD0B 4TULH 4ALAH 2VDNL 4OF5A 3ARTA 1CLOH 1KBGH 5J9PA 1MAMH 1R24B 3UTTA 1JMZA 3SJVE 4HWNA 12E8L 5CP3A 5CUSH 4PJ7F 1WCBA 5EO1B 1UM6H 5DUPL 3B9KD 3RVWD 1N8ZA 4FQXC 1UCBL 5T1KD 4G6KH 3AVEA 4JY4A 1AO7B 4QF1B 4XCFH 4H25B 2A74B 2IPTH 3R06B 2E27H 3DHMA 4UNVA 5D1XA 3ZZ1A 1U8HB 4DCQA 4NO5A 1K85A 2NNAB 3LN5B 1DTUA 4JO2L 4NQDE 4NCDA 3T3MF 3B5GA 2PO6D 1FZOA 4K55A 3UPCA 3D18B 4C83B 4HUNB 3D0LB 1AIFA 4ONFH 1F4XH 2APTA 4EUPA 2N1KA 2R2EA 3IVKB 4M5YH 1NMCB 3NH7L 4WO4C 1MEXL 1HCFX 3QJFB 1YEHH 4XWGL 4WENB 3VD4A 2VLRE 3D69B 3KDMA 4U6HB 3U30C 2PXYC 1KEGH 1LP9F 2HTKD 3PABB 1FLRH 1A14L 1W72L 4QRSA 5D7JA 4LCWD 3N1GC 5EU6D 5JW3L 5EC1B 1Q94A 2XWTB 3Q5OA 2VH5H 2XPGA 4QGYA 5HGDB 4LP4A 1QQDB 2JELH 2V7HA 4KJWD 4NC0B 4QOKE 4ZS7H 5ALBH 4Q2ZB 3LDBB 5KVEH 4OF3A 5E8EA 3T65B 2QEJA 3MRFB 4L5FL 5HHNB 4NWTH 4LLQA 3FQWB 3ORJA 4H8WL 3T1WA 4FQPA 4KVNH 4P2CG 4UIKH 1MLCA 5SX5K 3SKJH 1FO0A 4ZPVA 3UAJC 5C9JA 4NM4L 4JO3H 4G6AC 3ULUL 2PNDA 2GSGB 4NQEB 4KZDL 2IEPA 2WUCL 3LQAC 3IDXL 2Q86A 2DQTL 4LCCC 4GAJL 4GG6B 3P0VL 2OLDA 1KB5B 4PJXE 4JQVC 1AKJA 5GS0L 1OLZA 1BQUA 4OCMC 1QZ1A 2JIXB 2ZUQC 1UM5H 4NKDB 1NQBA 4JVUA 1OGAD 4E41B 4MCZB 4JREC 4U1NB 2NPLX 1K8DA 4I18A 2Y25A 2Y72A 1I8MA 4XVUC 4TUKL 5HPOA 2Z93B 3I3EA 1AXSA 3C09B 4OSUL 3UYRL 1A4JB 4BH8A 1QFPA 2FIKB 1RULL 1NCAL 1U42A 4IMLB 4NNYA 4X5XB 1HNFA 2ITDA 4NZRH 4GQPH 1VGEH 4R7NB 2FEEL 4PRHD 3PNWA 1X5IA 1TENA 2C4XA 5FYLD 1KJVB 2KUTA 3HE7A 1QSEB 3O6LH 5BW7C 3D85A 3D87B 3LQZA 4FQ2L 4NIKB 3E2HB 3AREC 3BI9X 2X4SA 2JCCE 1AE6L 1YMHB 4YXLL 1XIWD 3QUZC 1KLUA 1BZ7B 5EU6E 4YUEL 3WNMA 2X1PA 3CU1A 1CYGA 1YEKH 1CGSL 2OTPA 1CD1A 1JRHI 5E9DD 4PRPA 1A7OL 3PP3H 5D72L 2UY6A 3GMNA 2O5ZL 4ETQB 4FA8A 5HVHC 3IJYB 1MCEA 2NY7H 3MLYL 2I27N 3VXRB 3GMOA 4MA3A 3HRZA 3BH9A 4X6CF 3O8XC 3QUKB 2I5YL 4DW2L 4HCRL 1S9VB 3UTPD 4ZUWA 4ELME 3DYPA 3PL6B 5J6GA 1AQDB 2VL5A 4FQXD 4ODXA 2ATKB 4PJ8B 3D2UA 3KNBA 4Y2DB 2I25N 3QCUH 3FFCA 2VLLB 5DLML 2BNUA 3QEGH 4PGBA 5D6DC 3EFDH 5C2BH 2D7TH 4ODUA 5JHDA 3GKWL 2XICA 1U3HC 1DUZB 2FLBT 1ZT4B 3Q6GL 1C08B 3R8QA 4M7KL 1N6VA 4F80A 4ISVA 4EUPG 1KXQE 5JDSB 1FJ1B 3FRPA 4XXDA 4YIQA 3LN4A 2X4PB 5F8QC 5FIEA 4BELD 1OGAE 3D3VB 4N5UA 3O6FC 5I76B 1JWSB 3EYUH 4XNYH 4LAQH 4LBEB 4G80A 5TDPA 4JQIH 5JUEL 4D8PA 2PXYD 4GRLA 2X2YA 3V0WH 5LG1A 3GSNA 5EZLA 3ZKXC 4NC1C 2NTFB 2OXGA 4WFHD 1D9KB 4WI7A 2DQIH 4F7TB 3U9PL 3OKNB 4JJHA 1YYLL 2W0PA 3N1PC 4PRHE 1X5ZA 5FYLE 2MCPH 5DMIH 4PJIF 3ALXA 4UOW0 4NGHL 1EH9A 5E8OB 4KDTA 4HFUH 4UOJA 4TPRH 1I7TA 5KANG 3QZWG 1GOFA 2C7UA 2VQ1B 1A6VL 3CSPA 5IJVB 2P24B 1A4KA 1CLCA 4XPGL 2DQJL 3HI5L 4WV1B 2CPCA 1U92B 1U8KA 1MUJB 5E5MB 3UAJD 1CXKA 5JOFA 1N64H 2Y23A 1KNOB 4M1DL 5E9DE 1FSKB 1NUNB 4G6AD 5KSBF 1RK1A 1WZ1H 3BDYL 4FQQB 1DDHB 4W4OC 4G42B 5CMAB 4GLRH 3M17B 5ITFB 2P5WA 3H7BB 3W9DA 1T7YA 4P23C 5FYKH 4OZFB 3UTPE 1RZFH 2BJML 4OI9A 3DROA 1FG2A 4P49A 4DOHE 2EDDA 4FQJH 4NN6C 2JJVA 1T7ZA 2FCBA 4HUVA 4YZFF 1AI1H 4GMSH 4YHKL 3VXUB 2M26A 3KPMB 4O02L 3PWJB 4YHIB 4XVJH 3OXSA 5TE4H 3MJ7A 1Q0XH 4OLYH 3G6DL 4ODHH 3RWCA 3NZHH 3LY6A 2J7LA 1NH6A 4XVUD 5DRWB 4MMXC 1PKQB 3P2TA 2MFNA 5F1NB 1VGKB 4LQFH 5IBLC 1RUQL 1HSBB 1TXKA 3EO1B 5F21B 5DEGA 1NGQL 3V4VH 4OLXH 3C5ZA 3VFNA 2H8PB 5HHXL 3D0VB 2LQRA 4CN1A 3EYSL 4HFWA 1J1XL 1I3RB 3QFJA 4O2CB 3O4OC 2R1YA 1ORSB 3PGFL 4LEXH 4HUKB 3ARBA 4WFHE 3KPNB 2D7MA 4KTEH 3S34H 2F5BL 1YQVH 3QUZD 1FFNA 5JHDD 2WSKA 1XCQA 1P4IL 3MV9A 4DKFH 4YDKH 4JRWA 1QRNA 2JJTC 4M43H 1FL6B 3BWUC 3RZCB 1JYXA 3MLPA 1EV2E 2F19H 4OGYL 4CVZB 3C08L 3SDXE 2J8UF 2IPKA 4YAQB 1CTOA 2X70A 4H8WC 3MOBL 5TH2A 3VXOA 5D6CA 1OWRM 3IT8D 5IVXF 3KYKH 3QNXA 1I3GH 3BGMA 5MEPB 2OK0L 1EEYA 1KN2L 1T20B 1X3DA 3ULUC 3JBG7 2IBZX 4B5EA 1IARB 5IB5A 3CX5J 2HN7A 3QI9A 4HW6A 3OKOB 3O41A 3I6LD 3U0TA 1IAIH 4UT7H 2ORBH 5T5NF 1U3HD 2IH3B 3BT2H 2HT2C 2FWOA 2Y07L 2CDGA 2DBLL 2EO1A 5GS0C 2BC4A 2Y5TB 4W6YB 2XA3A 2XWBA 3IJHB 2R56L 5JW4R 4M6ML 1ZXQA 1G7LA 1VA9A 1PQZB 4XMLL 3SKNA 1KLGB 2APFA 5GHWH 1G1YA 1ZA3B 3O6FD 1LE9A 7FABH 5F7NC 1V05A 5EN2B 2BDNL 3WSQH 4JANA 3BSZL 1Q0YH 5GJSH 5FO9A 1R5IB 5FGCB 1ADQL 3WDJA 1F11A 3LKRA 1S7VA 2P43B 5TFSH 3U2SA 4NO3A 2DYPA 1NFIB 3BPLB 1IC5L 1VERA 5C8JB 3S4SA 5DJ2B 4WI9A 3TBWA 3ARFC 4CMMB 2J6EL 5EBWA 1RIHL 4TNWK 1II4E 3DRTA 2GT9A 2Y06H 4ZTOH 3DX6B 3VGAC 5JHDE 1MCPL 2IFFL 1T1ZA 3AMLA 1QEWA 4BSWA 4AL8L 3QDAA 1J12A 3MRBB 1F8TL 1AD0B 3C5JB 1NAML 1EERB 1BGXL 3LEXA 3WN5A 3LPGA 4N9GB 1FL3B 1JZ4A 2BERA 5EOCJ 3GSRA 2IAMB 5C86A 3IU4L 2H45A 2ITCA 1KPVA 4X80L 3GI9H 2AJSL 5IVNA 5JR1H 1D5ZA 3TVMC 3BN3B 1LWRA 2O5XH 2NXYB 1JPTH 3H9SA 2JB5L 3FQXB 1OSZB 3UEZA 1OSPL 2PF6A 4YHYC 2JJWA 4V1DB 4YFEA 2A6DA 2XZCH 3L6FB 4NT6A 3EYQC 4P2OC 3MLRL 3FFDB 5F7LB 1A6ZB 3I6LE 3MGAA 4JR9H 1QRND 3TH2T 4GOSA 4OB5L 1CF8H 1IFHH 2IBBA 3TBYA 1Q9KA 4EIZC 4BA8A 2BP3A 4JLRB 1MHEB 5HDBE 5SX4H 3SJVB 5IBLD 5ACLA 2DWDB 5EIIB 4ZUTA 4LGRB 1EHNA 2VLMD 1GGIL 2HWZL 1Z9SA 4JFDA 3UTZB 3BZEB 1HI6A 1D5IL 2MPAH 4XMPL 1J11A 1Y0LA 1XGTA 4K8RH 4E9LA 5GPRA 4NC1E 1VACA 1FHGA 3TPUB 2YD8A 1AR2A 4ZAKC 5JNYA 5DJ6B 3QCTL 4NQDB 2MCG1 4KRPB 3U48A 3V0VB 4LOUD 2GSIA 3KLDA 5DR5H 2OBGA 4Z0XA 4GKOA 2DS4A 4Y16B 2BNQA 1CD0A 4GRWB 1A9EA 3QDGA 1WBZA 1NGZA 4NQSA 5GJTH 4PY7B 1LO5B 5C0BD 1FFRA 1WWWX 1MHCB 3TCXA 1GGBH 4GLRI 2VLRB 1Q72L 4OV5A 1RIVL 1XZ0B 4JO4L 4XNUL 1EHLH 1D5BB 4QHUB 4BQ6A 4WUKH 3BH8B 3BAEH 3ULUD 3RWDA 4JFYA 1HXYB 3BE1L 4NKMA 4MNQA 1YN6A 4MD5A 4I77L 4W68A 1H0DB 1YEIH 3RHWK 3UTOA 2H6PA 5GS2D 4GW5B 1BZ9B 1CICC 4QOKB 3REVA 1XMWA 2HT2D 3T1FA 3JV5A 4ZD3H 4ACPA 3QUYC 2IMMA 1FGVL 2OL3H 3BPOB 4U1JA 2ZNXA 4JFOA 4LIQL 4LPYA 5GS0D 3ARDA 3EJZC 1FORH 3O6MH 3WNNA 1FVDA 2V5RA 1WFNA 1QRNE 2GJJA 3MRGB 1KCVL 2H41A 3W2DL 1NJ9A 2V5MA 3FHAA 2C3WA 4ORGB 1KPUB 5I1CL 3NFSH 2M2DA 5CEZL 5CJOH 3SCMC 1DQDL 5B8CC 1I8IB 1BZQK 4D94A 4OLUH 1T1YA 1M7XA 3B9KB 1YNLH 2VLME 3TNMB 1D5MB 3CVHA 3K1DA 5T1KB 4Z7VA 1AY1L 3S4SG 2ZOKA 5I9QB 4M4PA 2GITB 4PJXB 2HJLA 5FM5M 3PWNA 4RQQB 3ARFD 4ORZC 4GS7B 5IOPA 1L0QA 1PZUB 4BFIB 3TBTB 4PJ5D 4Y8AA 4K3EL 4XVSH 5F89A 4PJBE 2AV7A 3O9WA 1B4RA 5CBEA 1OB1B 3GO1L 3DTXA 3D9AH 1T5XA 2PO6B 4IS6B 3W9EA 4FABL 5IR1A 4Q6YA 5FO7A 4UT6L 1GAFL 4ODVL 1U6AL 1PYWA 5E1HB 2NW3A 1FYTA 2EDQA 3N9GH 4O2FA 5CGTA 4Q58C 2EH7H 5C0BE 3FQUB 1FNHA 4HS3A 4QXGL 5GRJH 4P59H 1H3PL 1DBAH 4E42B 1T2QL 3ULUE 2AXFA 4BKLA 1XGYL 2JCCB 2QQQA 1B9ZA 3H0TA 1IAII 4LCWB 5EU6B 4P2OD 3VFGH 1LEIB 2WBJC 4WW1B 5E6ZA 2MHAA 1EHXA 3KJ4C 4MCYA 1KGCD 2QQLL 3NOIA 3CSBA 4PBVC 5GRZA 4JAMB 1P6AB 3MJ9L 5HVGB 2AEWA 5E6IA 2FHCA 3TEUA 1OTUC 1E4KA 2YR3A 2IAND 3NZ8A 1MF2L 4HKXA 1WTLA 1OPGL 5I8OL 4N8CL 1WIOA 3DSNA 1IKFH 3MLVH 5BZWB 4ELMB 3V5HB 2SEBA 4LPVA 1P9MA 3VW3L 1IJ9A 2OJEA 4G8GD 4O2EA 5F93C 2VXQL 1UA6H 4H5SA 4R8WH 3H9YA 5IMLA 1WAAE 4JG0H 3KYOA 2WMPA 1YUHB 3JTTB 4MXVF 2DIAA 4ZAKD 1JVKA 2VKWA 1YDPB 3KPTA 4L29A 4MNGA 3PDOB 1JGLH 1FNGB 5CJXC 2GI7A 3I50H 4NM8L 3FOMA 3LQMA 3F7RA 4OCRH 4PJ5E 2JJSC 1YEEH 3BISA 3BKML 5MEQB 3DO7B 3ROOA 4MQ7B 3SDCA 5T1LA 1CLYH 1QD0A 5T3ZL 1FAKT 4D0CB 4A6YH 1NDGA 3UTTB 1FZMB 4YDJA 5ECJE 2FECI 4WHYG 3IDIB 3QRFM 5F9OH 5IHBA 4OIIH 1TDQA 4PBWD 3BQUA 4YHZL 1BVLA 4PRHB 1N8ZB 3IDJA 3AB0B 2DQCL 1F90H 4JY4B 4Y5YC 3DYMA 1CICD 3A6CH 1C12B 3CMOH 1NGPH 1J18A 3MNWB 3EDJA 4X4ZA 4LF3A 5D1XB 4Z95H 1XIWB 5H2BA 5L8LB 1P7QA 2BX5A 4LVOC 4HPYH 3WFBL 1IEHA 3EJZD 5DD5H 5IB1B 3B5TA 2VXTH 4TQEH 3B9EA 1KGCE 5D7LA 5E9DB 2R69H 1KCLA 2CIIA 4LLMA 4H0HB 4M4RA 4APQC 5SX4I 4LRIA 1TJIH 2MKLC 2W59A 2AEPH 1DEDA 5CD5C 2IANE 3BOVA 3SCMD 1CXHA 4CVXA 1MCQA 3CH1B 2FJFA 4HZAA 3MV11 3R1GL 4FQXB 4U3XA 3VI4F 4DOHB 3CPLB 1A3LH 3BEWA 4HJGB 3G5VA 1IGCH 1RY7B 4G8GE 1MFCL 4ZOAA 4D9LH 2Q6WA 4FP8H 1YYMH 1J1PH 5HGAA 3DX8B 4QRSB 5I66A 1FVEA 1T1WA 2XPGB 3CVIH 5I1LB 5HDQH 2V7HB 1AHWA 4BH7A 3LRGA 2FR4A 1HKLL 5C92A 1XAUA 2VIRA 3WHE0 3RWEA 5GGRB 4CU6A 5I2IA 4P4RA 2O93L 4HC1H 1JNNL 2G75A 2IWGA 3MLUH 4ZPVB 3RAJL 4OZFG 3MLZH 2BMKA 4D0DA 4K94L 3HMXA 2DDQL 1RMFL 4PB9H 4Z77A 3VFVA 3RNKA 3U30B 1WWCA 2VE6A 5IK3B 1BBJB 2PXYB 3BFOA 3KHQA 3ULVH 4OV6F 4GAYA 1QP1A 2Z8SA 3KGRA 4XP9L 1SBSH 2ARJA 2DQFB 1MIEH 2AABL 3BJ91 2NMSA 1LO0L 2LVEA 4JDZA 1VESA 1JUFA 5IKCA 2WBJD 3TYGL 1G7JA 1QA9B 4YHLH 5D1QC 5IBUG 1SY6L 3P4OA 1MREL 3GHBH 4LCIL 1QHOA 5ESAA 2OR9H 4I0KA 1T4KB 2NYYC 3SDXB 1EBPA 3WFCH 1A0QL 2RFXB 1UZ8A 3QP3A 5CD3B 1OTUD 2WIMA 2PCPB 3GM0A 4I18B 4MSWA 4YR6B 8CGTA 4UB0H 2G5RA 5KJRH 1KJMA 4M00A 4MA7H 3Q1SH 2EDHA 2FX8H 5C0AA 3MROB 1A7RH 1J1OL 4TOYL 4BH8B 3GFUA 4RMSA 1OTTC 3MO1A 4QHKJ 1ZEAL 2AJXL 1HE7A 4LCCB 4G9FD 4HF5H 3QRGH 5GIRB 1U9KA 1DLFH 4M03A 3MLWL 1UB6B 1U36A 4HWEL 1ZANL 3JV0A 5BZDA 5GXBB 2FX9H 3CDGA 3FT3B 4M1CC 2ZUXA 2X4SB 5IW1A 3MLTA 2ZUQB 1KLUB 5CP3H 1S7UB 1D5XB 4OZIF 1BD2A 4F7MA 4IIQC 4YHML 4KI5C 2ZPKH 4JREB 1BIHA 3LS5L 2FBJH 3T8XB 2X89D 2YC1A 6FABH 1HWHB 3KPSD 1WT5A 1A7PL 1UG9A 1J5OL 3BP4A 3HS0A 3MJ8B 5KSAA 4QY8B 4F8QA 1V7ML 4IJ3C 1IKNA 2B1AL 5AZEH 1BVKA 4ODXB 2E8YA 4MQSB 5E4EC 3O6KL 4S1QL 5GS1C 1T04B 1PLGH 5ADOL 1F3DH 3SE3C 4ZDHA 3UO1L 2XY1A 2BNUB 4YQXL 1ZWIA 4PGBB 2EE6A 3ZE0E 3QUZB 5JHDB 2YEZA 3V4PL 4GSDH 3K4AA 1W8OA 2R23A 1OM3L 5HY9B 5I8KH 4KKLC 1AQKH 4IMKC 2R39A 4WCYH 1KTKE 3U7WH 3D6GA 1CLZH 5CILL 4M7LL 2HFTA 4ISVB 3VI3F 4APQD 4NO0A 5BJTB 1OT2A 3LN4B 1R3IH 5CD5D 4UNTA 2UZIH 1T0MB 2IH1B 7CGTA 4JY5L 1QSZA 3KPOA 4YGVB 3O3BB 1BFVH 2HLAA 1URLA 3LN9A 2DI8A 5DD0L 3BKCL 4UNUA 2F58H 1NCWH 3GSNB 3V7MA 1M7DB 2XFXB 2D9QB 5DDHA 2VC2H 1FO0H 4G9FE 3LEYL 1U3HB 5D70L 5F6HI 5TPWL 1WIUA 1JK8A 4IEFB 5IQ7L 4U1IA 3SE8L 4PJFE 4YLQT 3B43A 4LSPH 3B3IA 3GSVA 3UPRA 3LIZL 2ID5A 2C3HA 5A2IH 4KKAD 2X1WL 3O6FB 2UVEA 1GGUA 3L3KB 1NC2A 4HUUA 4JGUA 4P9HL 5C0AD 5HYJA 4IRJC 3KPSE 3MRCA 1HOCB 4ZFOL 2P5WB 4FN0A 3PIQB 1T80A 5DJ8B 5DURD 4ZTPH 3H42H 4U7SA 4XBGA 5T1MB 3HE6C 4QXUL 5KVFH 2RB8A 2ADIB 2F54D 2KL6A 1WF5A 4YDLC 3RY5A 5D1QD 1RJLB 4JB9H 1TETH 5DJZA 1FE8L 4ZS6C 4QHMA 4GAGL 4P5KB 2NYYD 3BWAA 1KTDB 4M62H 3GGWA 3OXSB 4I5BA 3MJ7B 3UZQA 3RWCB 3MRHB 3MRIA 4JM2C 1DN0A 4PIRF 4HZLA 2ZJSL 2AJZA 2VB5A 3FL7A 3NIDE 3V79C 1ONQA 2Z4QA 4C59B 4JFXA 3HCVA 4HAGA 3P11L 1BQHG 4WDIA 5DRXA 1OTTD 4PJCE 3KJ6L 1A7BA 3VJ6A 5DFVC 5CEZD 5FHBL 5CWSA 2ATPA 1QBAA 1XH3A 1XGRB 3NCBB 4NN6B 4GG6F 2DLFL 2B0SH 3GBML 3QPQC 2EDBA 4RNRB 2Z9TA 2W91A 2BNRA 2E7MA 3HAEA 4M1CD 1ZT1B 4LSRL 5MI0C 5JORB 2HG5A 3RVTC 3EGSB 4FMFA 3VXNB 1FV1A 5B39G 1I9RH 1DFBH 4QEGA 5KN5B 4KI5D 1QRNB 2ARWA 1A6AA 4WY7H 5KG9B 5DEFA 1Z9LA 5TE6H 4OJFH 4Q0XH 3QR2A 3WL9B 35C8H 1JTPA 1MCNA 2ZKHL 1JZ3A 1AP2A 4DKAA 5D7IE 1W0WA 5TH2B 4EN3C 2CUIA 1N2RB 1CFQA 5I16B 1JGVH 1M6OB 4U31A 4N0YH 2BK8A 4K94C 4MVBC 3O4OB 3REWB 5D2LE 2OQJB 3U9UA 2QKIA 5IB5B 1KG0A 3QA3B 3U46A 2G60H 3MRJA 3HZVB 1W72B 3ZDZF 4Y4HC 3TA3A 2F54E 4PJBB 4AH2A 5DD3L 3OXRA 1Q1JH 4KKLD 1G6RL 3F5WB 5FKPB 5HGBA 2CDGB 1ES0B 3D1MC 3RNQA 1CD8A 1F6AA 4TN9A 5IEHA 3HUJE 5KS9A 2YKLH 3MXWL 3WIIL 1ZVYA 3UC0L 5I1IH 4LIQE 3W0WA 2WZPD 1FAIH 5C0BB 4URTB 3H3PH 5K59E 1GVIA 4JPVL 5HYJD 2ADJB 4PV9B 2HH0L 3HR5A 1NPUA 4JVPA 3X3FH 5EIQA 1S7VB 3L3OB 4NO3B 1NGYB 5CEZE 4OD2A 2ADFH 4CVUA 4DUWA 2CRMA 1J86A 3P30L 3BDBA 4WTWA 5ESQB 3MV7D 4Q97A 1LGVA 5GISL 3TBWB 4F58H 3ESUF 5C6PB 3KR3H 2ICWA 3VFRB 3IS0X 2GT9B 2NY6B 1BFSA 1T1ZB 3RI5K 1QEWB 1JZ2A 5HJ3A 5CZXC 4KI5E 3HN3A 2E6JA 5A43C 3ZMRA 1I4FA 1C5BH 4QYOB 3WN5B 5T3ZD 1TJGH 4D3CH 3DHJA 2ITCB 2VDOH 2ZUWA 4OD1L 2XG5A 4ODTL 1KIUA 3HE6D 2X4NB 4OGXH 4WUUA 1A5FH 4WFFD 3UZVB 4NUGL 2F53A 4J3XA 3CZFA 4PREA 3CFDA 4JFQA 4RMTA 4TSBH 3ARFB 2R1XB 1ZSDB 2A6DB 5DD6B 4WNQA 4ZS6D 4N0FA 2NLJA 4POZD 1TCMA 5HHQA 1PBYA 4KGLA 1YN7B 4GG8B 2VTFA 3QG7L 3L95A 3VGAB 1OAKL 4HD9A 2A77H 2R0WH 5E99L 3QH3B 5FUOL 2ZSWA 3OJ2C 3I2CH 1GIGH 4YPGA 2F74A 1MFNA 5AAMA 1WSST 3BVNA 3TBYB 4BFBD 1KLFA 4TTDC 1WWAX 2NY3C 5JHLL 1BQLH 2B7DT 4LLAA 4X4XA 5ERWB 5C0CD 3IDYC 5DFVD 5HVWA 1OQOA 1FN4B 5D2NA 4JFDB 4P3CL 4UQ3A 5TDNB 2I9LA 4XPFL 5KANI 4MAYA 5DS8A 5I1DB 3QPQD 4YHYB 2VXVL 3VG9C 2GIYA 1A7QH 1HQRB 2E6QA 2HT4C 3RVTD 1FNSL 1DSFL 2VDPH 5EUKA 4XNQA 4BQCA 3MRQB 3MV7E 4AMKL 3SDAD 5HYQA 4ZXBA 25C8H 2G2RA 1GZQA 1BMGA 2R2HA 3FB8B 3EYVB 5GGQL 2CR3A 2ED9A 3VD5A 1G0DA 1C5DB 4JQXC 2FZ3A 2IANB 4NQSB 5D5MF 5HBBA 4PB0H 5FCUH 4EN3D 1O0VA 5M7QA 4Y2OA 2CD0A 5ANMA 3BKYL 5LGJA 4OV5B 3U7AA 5CLTA 5T3ZE 4P9HC 4G8GB 2CQVA 4U0QB 3K4DA 4X7EC 4MVBD 4PGDA 5I6XC 3UTSA 4MHHG 4YXKL 3BMVA 3EOTH 5E7BA 4KJYB 3RWDB 4AEIL 2HRPH 4F57L 1KFAL 3AREA 4ZAKB 2BFVL 1ERNA 4WFFE 4Y4HD 3WNKA 3QDJA 3T1FB 1U8QB 3F7VA 2X44D 4GFTB 3BP5A 3WUWA 3PJSA 4JFOB 2DMBA 5F7DA 3NTCH 1XF3A 4P2QA 3FRUA 4PJ9A 4Z7QF 5FO8B 1KEML 5I75C 1N6QH 4MA8H 1LO3H 5EOQL 2OP4L 1JFQH 3T04D 3VWKA 5INDB 5IESH 1UWGH 4UZGA 3RWFA 1VFAA 2A38A 2XN9A 5C0CE 4EZMA 1CL7I 4PUBH 3W5MA 1IL1B 5E8PA 5CINH 4DK6A 1QR1B 5C7XH 3V6FA 3L3DA 1S9XA 1IGMH 1JYNA 1LK2A 1MAKA 3AM8C 2HJLB 1JI2A 4P5MB 5ACZA 5IOPB 4G7VH 1PFCA 4NOBA 4OT1H 2EXWC 1YEGL 3RWIB 4NBZB 4LFHG 4FQCH 4KQ3L 5HHOD 3DVGA 3BIKA 3BRFA 4Y1AD 5CZXD 4P2RA 5JDJA 1P1ZA 5IR1B 3W9EB 5F1IA 3MA9L 1EXUB 4JRXA 4NRXB 5H8DA 4Y4FC 5KS9E 2XWJB 4POYA 4KZEL 3I9GH 2GJ6D 1CN4A 3L3IA 4JN2A 3SCMB 3KG5A 5B8CB 4HIEB 4EJ1C 1KIQB 1JGDB 1U8OA 4X6BB 1ACYL 2WINB 3S35L 3VRLE 4R2GB 1ED3A 4OAWA 4WHDA 4XNZC 3EDFA 2Q3ZA 4I0PA 2VUOA 4DVRL 3IFLL 5EC2A 4TSAH 5SWSD 3A67H 1MPAL 4GXUN 3NABH 4UDTA 1U0QA 3MR9B 2P8LA 3GIVB 3STZB 5EBLB 3HC4H 1K2DA 1O5DT 3CX2A 3LS4H 2PYED 4JFFD 1LILA 3QUML 1QVOA 3VGFA 3EO0B 3U4EA 3MV8D 4YNYA 4HQQH 3U4AA 5D96C 5D1ZA 3DUUA 4M7JH 2ICEA 4XP1H 5K9JL 2X6MA 4HGWB 1WGOA 3NCJL 4TTDD 3TPKA 5I1HL 5KVMC 4ERSL 5E2TL 2NY3D 4ELKA 1A2YB 4ZFFA 3HI6L 3RIAK 3HR6A 2I60H 3TCLA 4S0TD 3VD3A 4IDJH 2A2QT 1KPRA 4JO1L 1UENA 3MBXH 2CKBA 1JYWA 5LGHH 5BVJA 5IGXH 5HD8C 5KSVB 3BUTA 1T0NB 1YJDH 2XZAH 4JG1H 1NSNL 2HT4D 3G5YA 4ZOCA 3WEXA 1IC4H 2WBJB 3KJ4B 4OM1H 4OLZH 3F6IA 3QQNA 5K9QI 4MNGB 4CMHC 1MFBH 1DL7H 3HC0A 4NHUA 5JIKA 1Q9OA 5KAQG 1EFXD 5HHOE 5DC4B 4Y1AE 5I8CB 3ROOB 4J2XA 3QXWA 3G9AB 5T1LB 1JRHL 4MJ6A 4XVTL 3ARZA 3S7GA 4Z7WE 1KCSH 2GJ6E 1SYSA 1Y6KR 4HH8A 3MNZB 1CXFA 3OKEB 2D0FA 1LMKA 2J12B 4R4NC 3IDJB 2O5YL 1CGVA 2BVUA 4G9FB 3W39B 3CDCA 5J89A 2EKSA 4G43B 4XPTH 5JIPA 1QUNA 1L0XA 5D93C 5SWSE 4W4NA 4PJFB 5I19L 3QNZA 3A6BL 4LF3B 4F2MA 5E4IA 1CE6A 5DUBB 5ALCH 3ECBA 4QTHA 2QHRL 3BGAA 1B4JH 2PYEE 4JFFE 4L8SC 3GI8H 1UWEH 5BVPH 4L4TA 3UDWA 4LASH 3MV8E 4P3WA 3CVHH 3GIZL 3WS3B 2UWEE 2QQKH 3KPSB 4P46C 2Q8BH 1NAMB 5ITBL 2V2XA 2MWCA 3C60A 3KYMA 4UV7L 4ODWB 2X4TB 3JVGA 3ZDXF 3GMMB 1I85C 3TT1H 5IM7B 4CVXB 4QHLA 3JWNC 3VG0L 3QIWA 2FJFB 3DYOA 3KXFA 1OAZL 3ES6B 4EEEA 3VU2A 4RZCB 1I9IL 3CFIC 4Y5YB 3QUXD 3OL2A 4RBPK 2Z31C 2EXWD 1R3LB 3TV3H 4PS4H 3OB8A 4XCEA 2DLIA 4LVOB 4H1LA 1WC7A 4UILH 5D1ZD 5E2UL 3CFJB 2AXHA 2G5BA 3QJHA 4OZFH 1BOGB 5I1EL 5EH1A 1W8NA 3MC0A 1IGFH 4APQB 4H88L 4Z78A 5LBSL 4Y4FD 3HC3H 5I2IB 1A6PA 4PJCB 4U1GC 4AT6A 3DIFA 4NP4H 2G75B 2WM0A 1SBBA 3SKMA 4TULL 4AJ0A 2YWZA 3OGCA 5BO1L 4C56A 4D0DB 1CLOL 1KBGL 3RFZC 3BGFC 1X6LA 3P0YH 4Z77B 3TN0C 1OD9A 4IHOA 2X1OA 3EAKA 4GAYB 4PV8A 2UVFA 2W0KA 1EPFA 1UM6L 5IQ9A 5IKCB 4JHZA 1HHHA 1G7QA 1G7JB 1DANU 4XCFL 3HNVH 2IPTL 2H3NA 3WV0A 3EJYC 1MNUH 3L7EA 2V6HA 1SEQL 5HYFA 4NCC1 3MRLA 2N4IA 4NPYA 1A7NL 1WBXB 4FZ8H 4HEPG 5GRVK 1FFPA 4KKBC 2RQ8A 4GKNA 2HJKB 4OZHE 1N5AB 1G9NL 4ONFL 5C0AB 4MDJB 5I15H 4DVBB 3E6HB 3DURA 1KV3A 1QSFA 4PG9A 3X14A 5DURB 2Q87A 5LXGH 4MJID 1RUAL 2FHFA 1YEHL 4WU5B 5HD8D 5A2KH 3NMEA 4O51A 2F54B 2OYPA 1EEZA 2A73B 4ONHB 3KPPB 2CLZA 5ICXB</