1GGIL

Crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
b'DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A 50.1 FAB (LIGHT CHAIN)
publication title Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 47
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 1993-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL01
4JZOB 5F3HA 1KCRL 2DTSA 4PLOB 2NY0C 5JW4Q 2RFXA 3QWOB 4G8FB 4LPXA 4NNXA 3BPNB 3OG4B 4HLZG 4ESKA 5DDHA 2VRAA 2Q8BL 1XGYL 2AJYL 3VI4E 4IRSB 1WSST 4RAUA 4OCWH 1QHOA 4J3SA 5T1LD 3L5XL 5K59F 5JIPA 3C5ZA 1J5OH 5CGYD 1Q38A 4Z78B 2ZUYA 5MERB 1CD8A 1YEDB 5C92A 5KSAC 1MCLA 4YX2H 3WCYA 1KNOB 1U92B 3H2WA 2PYED 2APXA 1E6JH 5DEGA 1FC2D 3DUUB 3TBVA 4HUUB 4M00A 2W9EL 4LLMB 1G9EA 4HK3J 1BHGA 1OAZL 3QULB 2MQ0A 3CDFA 4XVSL 3L3IB 4LLQA 3BGAA 1LP9B 2NY3D 3U4BH 4X6CF 3UJJL 2EDBA 3E6HB 5IMKA 1YMMA 5DGRA 4KK5D 3KPMA 3T2OA 1KC5L 3BQUB 4O2CA 5B4MC 4KDTA 1S9WA 3LN9A 4P46B 4LCWD 5HPMB 3IT8D 1G7PB 4UT6H 3U0PB 3MLPA 1WAAA 4WV1B 4U1IA 5I1HL 1JPSH 2OQJA 3M1BA 4JY5H 4MJ5A 1TXKA 4LCCA 3ELAT 4ELKA 3TVMA 4KAQH 2OS7A 5TJWK 4EUPH 1CCZA 5C0BA 3SBWA 1DL7H 1QRNB 4AMKH 1QBML 2HRPH 3D3VA 3SOBL 1A9BB 3LKPA 5ENWB 3O6KH 4RNRB 4Q6IB 3WNLA 3IU4L 2PYFA 3RVXC 3VFRB 3EO1A 4GRWB 4JY6A 3QUMH 3WLBB 5DQJB 1FZJB 2EIZB 4ELMF 1PZ5B 1EEZB 3KJ6L 2AAVA 4W4NA 2AJZB 1CGWA 4TVPL 5IBUG 3O3DB 2F53E 3HUJE 1EEYA 1XF5A 1J0IA 3RQ3A 4NO3B 1FRGH 2WUBL 1LO5A 4KZDL 4KVNL 3PABB 1RV6X 5CGTA 1KCSH 5C0CE 1RJYA 2EYRA 3BN3B 3DVGA 4U7MA 3CVIH 5B38B 5GGRA 4EEEA 1SBSH 4NZJA 1VACA 1F45A 3QUMB 1RFDH 4OLUL 4M02A 3F12B 3L95B 3WL9B 2ZUVA 1I1YB 3TBTA 4XXDB 3WFDL 4XCNB 2CDGA 5F9DC 3H9HB 5L8JB 4MD0B 5EG6C 4Y16B 1TZHA 1QFPA 1S7VB 5C8JB 1ZANL 4HAGA 3GIZH 4L29B 3WXWL 2NCMA 5D1XB 4FXKA 1P5VA 2APBA 9CGTA 1Z3GL 1EVTC 3V0AC 3DO7B 4BSVA 1T1YB 1G6RH 3BOVA 3OR6B 3VD4A 3OBAA 1S8DB 4NJ9L 3BH9A 4YDLC 1QBLL 5IV2B 1SMAA 2GTWA 4OZIF 2IWGA 1SVCP 1WICA 2G60H 1RULL 2IALA 4ZMAT 1LNUA 2QQNH 2DQFA 2VLJD 1P7KB 1XIWD 3IFNL 1TCRB 4H8WH 2EDWA 4HMEA 2OLDA 3MJ8A 3HZYA 3RA7L 5DJZA 4YXHH 1MFEL 3K8LA 5I75B 3MJGX 1OTSC 3E2HB 1QFWI 1CGSH 4YDJB 1HKFA 5J4MA 1H3VA 1KT2A 4R97B 5FKPA 2EDLA 5FO8A 1H0DA 1M7DA 3WE6B 1UJ3B 2NXZB 3LQAL 1AQKL 3VG9B 4NFBA 1YEFH 4M7KL 1U8JA 3P4MA 2DQIH 4XP9H 4OD2B 5DRXA 1QLRB 3U6RB 2XNAB 1XGTB 1TVDA 4HUKB 5FGCB 4U6XB 2QSTA 1KGCE 5C0CA 4P23D 1OARL 2HG5A 2P8LA 4TSBL 1DVFA 1QO3B 1XZ0A 3B9KB 1NMBL 4HXAL 4EI6A 3PDDA 3FT2A 1Y6MR 2XQBH 4WI4A 3ARDB 1U8LA 3TZVD 2VKXA 4ZO8A 4OIIH 1NGYA 1V3KA 1BQSA 1HSBA 5B3JF 3W39A 1N3NA 1A14L 3FZUD 1T1WB 5IEHA 5AYUH 4HAFA 3I84A 3RVUD 3VWKD 2FRGP 4MXQD 2P4AB 1CICB 3C9NA 3W0WE 4AEFA 1DP0A 3KG5A 1R5VB 1RUPL 4OD1L 1AP2B 1EMTL 4HC1L 2XTJE 4N9GB 4S1QH 4WTZA 4UTAH 2YZ1A 1GGCL 3FFDB 1HZHH 1B0GA 4RISL 2VXSL 1I1AB 2BSRB 5GRUH 2YS4A 1JNLL 4NZUH 3N50A 1EUTA 3LVEA 1F97A 3IXTB 2Z35B 1NEZB 4JDZA 4X7FC 4PRNB 3NFSL 4OCYH 1HHHB 3K1DA 1A7QL 3ARRA 1KG0A 2FD6H 1NQBA 3GZKA 3RL1B 4HWZB 3U9UA 3TGXA 4JFHD 3QA3B 3H3BC 4LNVA 3CDGA 5DFVC 4JM4L 3TBWB 1JWMA 2JIXA 1UYWH 3EZJB 4UT7H 1L0YA 4WI9A 2IPTL 4ETQB 3MV7B 1YQ2A 5E9DE 5DS8A 4EVNB 5LQBH 4X99B 5L2KE 1NEUA 5C1MB 2H45A 3B6SA 4Z0XA 1RZJH 2YSSA 4YHKH 4OQTL 5FV2A 5KBNC 4CL7A 5L9DL 3JZ7A 5E4IA 4YIQB 1GC1H 4L3ED 2G5RA 4S2SB 1U42A 1BD2E 5HPOA 3V7AE 4RX4D 1IMHC 4PJIB 5DMJB 2W0FA 4PGCB 5KW9L 1LQSR 1BBDH 3KYOA 4K7FB 3FB7B 1FFOA 1KPUA 4D0CB 4DK3A 5I1EL 1WIOA 2DWDB 4HS8L 2VL4A 3QNZA 4OSUL 3MRMA 4O4YL 4OZGF 3W0WA 1U2HA 3CCHA 4FP8L 1TZIB 5K33A 1P7HL 1DR9A 2V9TA 2VH5H 2VDKL 2Z8WC 1KN2L 3RAJH 4PREA 1JVKA 2CH8A 3DTXA 3QEQB 1TDQA 3ZSTA 2XWTA 2VAAA 2JF1A 5DJAA 3EYQC 4JO3H 3WFEL 5ICYA 3AGVA 4NRYA 4XMLH 4L4VB 4IS6A 4XNXL 3RL2B 2JB5L 3LN5A 5C08D 1UGNA 3IETB 3ZDYF 1G7JA 4J1UA 3WNMA 5E1HB 1JF1A 1IAKA 3QXDA 3L5WB 5E08L 2FECI 3A0OA 2D9CA 4QLRA 4OAWA 1VERA 4PJ8D 1AR1D 1HHJA 3KYNA 4GMTH 1MIML 3DVIA 1UM6L 4L3AA 5DRZA 5HHOD 1JRHI 2J12B 1PY9A 4LNRB 4I18B 4OCNC 2HMIC 2F54B 2HLAB 4OF8A 3IJYA 4R9HA 3ULUL 1JCKA 1HSAA 4PIRF 4DTGH 3I6LE 1OT1A 4C59B 5L2KA 1QUNA 2YZ8A 5L88L 2C26A 1AC0A 5GS0H 1ZSDB 2NTSP 1MFNA 3GGWB 4P4KB 2A1WL 2IEPA 3IDYB 3EJZC 3QDJB 4Y19E 3RGHA 1BLNA 5IJKC 1MELA 4G5ZH 3BEVB 1T0NA 3VH8G 5DC4B 3VXUA 1JHKH 4NKMB 3C09C 4KRNA 5ESAA 1I3GL 3GMOB 1FFPB 3PV7A 5FA4B 2VLLA 2H6PA 3OJDA 1AXTH 2NY6D 5BW7C 2FJHB 2WV3A 3NGBB 4HIJB 4QWWD 1I3RB 4CKVX 1FNGA 3V6FA 3VFUB 2VYRE 3MJ9H 2ARJQ 5LJYH 1P4IH 5DMKA 4OGYL 1Q9LA 4P2OA 3QHFH 1JIBA 1DZBA 2XZCL 3CUPB 2Z91B 3HTLX 4MB5A 1UH2A 5F89B 4BA8A 3DVNA 2XZQH 3WLWC 3C60A 3QNYB 1QSFE 4OLZL 3SBWC 3RUGE 2J6EL 3VXOB 3HKFA 1AXIB 3LMJL 1XGRB 4PP1C 5I1CH 3KYMB 1QA9A 3NIFE 5E5RB 4FZ8H 4JQVC 4IDJL 1ZT4A 3M17A 3DARA 3DJ9A 1OGTA 3GK8L 4KHTL 3VFWB 1FSKC 1F3JA 1AO7B 1HK6A 4ORGA 4WI6A 1I8LA 5F6HJ 3RVWC 1GAFH 4JM2D 3RBGA 3VW3H 5F9AC 3X14B 4Z77A 3QCVH 5L2JA 5IBLC 3TESA 5JPMB 1ODAA 4OGZA 3RY4A 1S7QB 5DJ8A 3D39E 5D1QB 4UOJA 3GRWH 5A1AA 5D5MB 4HBCL 1G7QB 5EU6E 3C2AL 3VRLE 5IESL 3QPXH 3VCLA 4R0LA 1HQRA 3HR5B 4TOYL 1KF9B 1W72H 4KY1H 3MLWL 5IW3A 1AH1A 4HGWA 4HC1A 4PJHF 3BUTA 4PRDA 1A7PL 43C9A 5ISZE 1X4YA 1MCSA 4TQEL 1BWWA 4HUWB 4JN1H 4MA1B 3IKCA 4W4OC 4D0BA 3BP4B 1IT9L 5IHBA 4KU1A 1D5MB 3PL6B 3VGEA 3S34H 3WKMH 1UENA 4Y19A 2WUCH 1K8DB 2FHBA 2R69L 1MJ8H 3JTSB 3QFJD 2HVJA 5HDQH 1UWEH 4S1SH 5F7WC 4NQCE 5JLZB 5B8CB 4J4PC 2FWOB 4ZUTB 4G9DA 4KI5C 4Z0BL 1SEBB 2OXGA 4AQ1B 3OKOA 1DEDA 5GZNC 1JMZA 4BSWA 1W72B 1UKQA 2VB5A 1OQOA 1KB5H 2YXMA 5KS9F 5FHBL 4M8QB 4QRPB 3V0VA 1LO2L 3G5VA 3S4SB 2BNRE 5IROA 4W68A 1WIUA 3CZFA 4P9HC 1FG2B 3S96A 1DN0B 1NDMA 2DWEA 2EE2A 2N7BA 2HTKC 5B39A 4GW5A 3I50H 4KHXL 5BO1H 4XC3H 1QSFA 4OQTA 4ODXA 3SKMB 5AZ2H 4JPWL 5FYKH 3RUGA 2OR9H 4HIHB 1T7VA 4M93C 5JA8B 1T89A 2NYYD 3G08A 1BBJA 3EYVB 4JFDD 5DK0B 4ZO9A 2QADD 3DHJA 5EH1A 1DCLA 3OF6A 3VE0A 3P4OA 2JELH 3CD4A 1KPVB 4N0CC 2GW5A 1ORSA 4PGEA 3VMNA 1D9KD 2V6HA 5EC2B 35C8L 5HD8C 1TQCB 1OPGH 3CU1A 1E6OH 3D39A 3CZJA 5EU6A 4V1DB 1I85C 1DQQA 3AUVA 4GG8B 3KPPB 1QFOA 1CLCA 3H7BA 3ABZA 2BOCB 2EEBA 1YPZA 3C8KB 3VMOA 2H9GB 1OSPL 3CFJB 2J5LB 3LKSA 1X3DA 1RUQH 2R15A 1FIGL 4QF1A 2J1KA 2CKBB 3EFDH 3MRDA 2WQ8A 3ME0A 1CK0L 4EN3D 4U3HA 4K7PH 1CE6B 4ALAH 4X4ZA 2DQTL 5T1KB 3ZE0F 3D2UA 2BK8A 4QXGL 3H42H 4PG2C 5F8RC 4NQCA 4S0TD 4N5ED 3OAZH 1WIPA 5F1OB 1OW0A 2NTFA 2ICCA 3KPSB 4OD3L 4LAQL 3BRDA 4J3VA 3FQXA 2VZ1A 3K2UH 1CFQB 3MLRH 4YHYB 2DJ4A 3PP4H 1A6UH 1GGIL 3FB8A 5EZOL 4CVZB 4P2YA 3KPLA 1LE9A 4G6MH 3SY0A 2D03H 3MRHB 3JUZA 4N8PA 4XPTL 1JBJA 3M45A 1F6FB 4EKXA 4FQHA 3ET9F 3MLXL 4M5YL 3MYJA 5IG7B 3P73A 4BH7B 1V05A 5HHPB 8CGTA 1AJ7H 4OZ4A 2Q20A 1NSNH 5HHME 1R0AH 3JTTA 3MNZA 4Q6IC 2P5WE 3MJ7B 1ZLWK 5C71A 3EYOA 4LVNB 3VGDA 3ZTNH 5TDOA 3WIIH 4FFZL 1FFRA 2VDOL 1TVBA 4HWBH 4JM2F 3ZLQC 3GMLB 3QCUH 2CGRH 2LU7A 5JHDA 1GHFL 3CK0L 3MROA 4GS7C 2OYPA 4D8PA 4PV9A 2WBKA 2DDQL 1BQHA 1RU9L 5CLTA 5GPRA 3QEUA 1OD9A 4BZ2H 4MJ6B 5C6TL 3O0RH 5KVMC 1XR8B 1B4JL 1REIA 3T0WA 3P4LA 3N0PB 4TNWF 1NC2B 4JJ5B 1I8MA 5LXGL 5KOMC 1TJGH 1P4BH 2ERJB 5I74B 2B4CC 4HZLB 4WCYL 5E8DL 3HNTH 3RNQA 4E42B 1QACA 2BHUA 1ZA3A 2Y36H 3HG1E 5JW3L 3KPOB 2QSCH 5IMMA 3MLUH 2GTZB 2J6EA 3RVVC 3CFBA 2D0GA 3AXLA 5IFJA 2Q6WB 5CZKA 1IKFL 1GOHA 4G9FB 4D9QE 2IANB 3RP1A 4KPHL 2FH8A 4OCSH 1KEGL 1U8QB 3QFDA 1ONQA 3SDXB 2GJZA 3W5NA 1RHHB 1KXTB 3TM6A 3V6OA 3MA9H 3MRPA 2EC9T 1ZOXA 5D1XC 3T3PE 4ELMB 3GMNB 3F7RA 2FJFA 1EV2E 1SEQH 4ONOA 5F1IA 1J8HA 3FHQA 1FNSL 2XV6B 4LSQH 5HYJE 4KVCL 4JB9L 1MCPH 2VXTH 3BPCA 3DXAE 4FMKA 4HIIA 3WIHH 5KVFH 3O4LB 4W81A 2Q7YB 4YE4H 1NH6A 2I24N 4PJAE 1BFTA 1I7TA 4PRPB 3QRGL 4QTIH 3SPVB 5GS0D 2NX5A 3U9PL 3ZKXB 2X4UB 2R2HA 2XA8L 2P5WA 2QSQA 4NRZB 3BO8A 4YXKL 4HKJA 3VA6A 1C5DA 5I19H 1IZKA 3PWPD 5DUPL 2VXUL 2WSKA 3RVTD 2ESVD 2EICA 2F9BT 3GKWH 1S5HB 2NZ9D 4AIZB 4E0RA 1NCDH 3ARBC 3BZ4B 3PWNB 3WSQH 4AH2A 4ZODA 3VG9C 1T21A 5HGGS 3IU3B 2VITA 1ZLVK 4JKWA 1AGFB 2CK0H 3NH7H 1NAMH 4JZJB 4KKBC 5C0AB 3CLEL 4GKSB 2OJEA 1AO7D 3JV4A 4TRPL 4N0FB 5D8JL 4TUKH 1M4KA 4R96A 2OTUA 2DQGH 5D2LF 4I4WA 3LRGA 3BVNA 3O6FA 5EZJB 4JPIA 5F6IB 5F9WB 3HG1A 1FAIL 3B9KC 3DYMA 2CRYA 5JW4M 5EBMB 2ADGB 5F21B 2WINA 3VXQA 1MRDH 3SGKC 4YDIL 1AHWB 3ARFD 3BHBB 3O8XD 5ICZA 2ITCA 5HDBF 2LTQC 2MTPA 4LSPH 4OTXH 2CDEA 3BZDA 4YR6A 5L8LB 3AAZB 1CU4H 3ARVA 4PY7B 3ARGC 4PJDA 5CEYA 4NP4H 3LQAC 4JHAL 1T2QH 4XBGB 3ROLA 1RZGB 4K9EC 1FGVH 3W81A 4FQCH 2GAZA 1CYGA 1MWAH 1OB1B 4MA3B 3CDCA 4QOKA 1I9EA 1G7HB 2X4TA 3KPRB 4HJJL 4FQIH 5HYJA 2QV2A 3VXMD 3ULVC 4WWKB 2V2TA 3DXAA 2BDNH 1VEOA 3C60C 4JPKL 1CG9A 5F96L 2XKNA 4PJGB 4XBEL 2ATPB 5ITBH 2FO4A 4RA0C 1G1YA 4PJAA 3QG6A 4R7NA 5D2NB 3B3IB 3S88H 5E5MA 3UC0L 2YRPA 1IM3B 3IFPB 1L9NA 1WWAX 1EO8H 2HWZL 4LCYB 4Z7QF 2UYLB 1C08A 4G6FD 1BJMA 1Q0XL 4ZUWB 1BFOB 3LS5L 4KQ4L 3V2AR 1U8MA 2WBJD 5J6GA 5INCA 3BDXA 1NCBH 4Q2ZA 5EZLB 2P5EB 4EOWL 1S9YA 4ONGL 3RHWF 4TYUA 2AABL 5DD3H 3L7FA 5IP4A 3S35L 3TO4A 1S7RA 3L3KA 5C09E 4FFWD 5AYQA 4RGOH 1EBAA 5D7LE 1EK3A 3WFHB 3MUGB 3HE7B 2HT3D 3H6JA 4AEHL 3VFOB 5B38G 4JVWA 3JVGA 5DTFB 3PV6A 5JQ6L 5I76B 2H1PL 3INUH 3WN5B 1H15A 3I6GA 2IAMA 1GGYA 4OFYA 4U1LB 5FYKD 1E0OB 5MENE 1KJ2B 2AJXH 1RUKL 3VDAA 3G5ZA 4B7LA 1EAPB 5C0RL 4GRMA 4IHOA 4M48L 1MRFL 1MLBA 5FM4A 3BD5A 1HQ4B 3KR3H 4IRJA 5GGVH 2W60A 5EU4A 3MCG1 4P2QA 3MO1B 4LAJH 5C70A 4YXLL 5IHUH 5JW4R 3O45B 1OCWL 4LVHC 4JKPH 2F19H 3GSQB 4APQB 3DOSA 2IQAB 4M62L 1QFWH 4N8VB 2UZXB 3ZE2F 2XFXB 1F3DJ 3CC5A 1RK0A 2UVFA 3PWVA 5ADPL 1ZHKB 4MJ2A 1M71A 2EXYC 2B8OT 1AKJB 1D6EA 1I75A 4OCRH 3RWFA 1T89C 5L0QC 4L8DB 3VFNA 2X9WA 3F5WA 5IJVB 3QDMB 4L9LB 3MV9E 3QR2A 3I75A 3QG7L 3DGGB 5JXEC 5B22A 5HYQB 1BVKA 4F15C 5F9JB 5JR1H 3ZT5A 3S7GA 1S3KL 4I18C 1HINH 4J3OC 4XB8A 4NWUL 3VH8A 4PJXB 4LIQH 4HS6B 3U36A 5BZDA 5IUSA 2WLZA 4P5KB 1LD9A 3QQ9C 1CFNA 4LFHD 1AI1H 1HH6A 2IFFH 3IYLW 1TLKA 4QXTB 4AY0A 4P4KC 3H0TA 4OZHB 3FTGB 1RSFA 1QSVA 5CZXD 5TQ2H 3IDYC 4R90L 4O51A 5EULV 1J0KA 3VGAB 3VWJD 3QNXB 4BZ1H 4H88L 4PRAB 4OZIA 1JV5A 3P77B 2GITB 2NXYD 5C0FB 4LSSL 4NQEB 5AZEL 4AEIH 2B39A 4OCMC 5DJ0B 3RWGB 1FO0H 4LQFL 1J12A 2PF6A 1MQKH 2BHZA 3OKLB 1Z6JT 4QHUB 4H0HB 2HJFA 3HN3A 5I0DA 4ODSH 4R4BB 1IC5H 5LWYL 4HIXL 4N1HB 3CX2A 3ULUC 3CMOL 4Y4KD 3BGFB 2EYSB 3KPNB 2F58H 5D1ZA 4LPCA 1EERB 5T1LA 2Q76B 4YHIB 4FFYH 1Z9OA 4PRHB 2XZZA 2ZCHH 1ADQH 3RDTB 1Q72H 2AP2A 3HB3C 5EOCJ 4XPBL 1OM3H 3KLHD 1MIEL 1ZWIB 2PYEA 2PETA 3MRFA 1EHXA 4PTUA 1DJSA 1YYMH 1MEXH 3MV9A 4Y5VB 1DN2A 1MVUB 5DLML 3RWHA 5FB8A 3MRGA 2YD2A 4X6FA 1YEEH 4I0PB 2ZPKL 4RIRA 4PRBA 3KXFD 4KMTL 4PGZA 1M6OB 5IVZB 5AEAA 4UIKL 4KUCF 4OZFH 2FEEL 2V5RA 1A4JA 1H8SA 4P57A 5D1QC 2ZOKA 4UINH 5D7JD 2FX7H 4Y5YB 1C5BH 2A83A 4WO4B 3B5HA 1PKQA 3QJHA 4BUGA 3RFZC 1QR1B 3RTQA 1T7YA 1B2WH 1T20B 5IHLB 4JFFB 2MPAL 4JFEE 4LCIL 1F58L 1NCTA 4YBLB 1MI5E 3K4DA 1TFHA 5FYJH 4HT1H 3ES6A 4PUBL 2COQA 1T1ZB 1S78D 3T2NL 1YEGL 3UTZA 2Y07H 2KL6A 3PWUB 3NN8A 3LH2L 2IBZY 2VXVL 4XAKE 5B8CC 4OZFB 5I2IA 3EO9H 4UV4L 3BP7B 4I48B 3UAJC 4YLQT 3BKYL 2KPNA 4ZUUB 3E8UL 4PJBF 1BF2A 2IH1B 3SDYH 4JO2L 2I60H 3IDMB 3VD3A 3ORJA 2FEDC 1LE5A 3IKKA 5DR5H 1T3FB 3CJJA 5DI8B 5H35A 3MMEB 2JE8A 3TP4A 3WHE0 4JCLA 5FDWB 4OCWL 3PQYE 4U0RB 2FGWH 1J5OL 3O9WD 1AXSB 3BT2H 3HC4H 4W6WB 1PBYA 4YX2L 3RHWK 1J11A 2YUWA 2Z31D 3G6JE 1E6JL 2ZP0T 1DQMH 4X5LA 1NANH 4Y4FC 4ZFGH 1NFIA 4PJFB 4IRZH 1TQCC 3SGJC 3QXUA 5E6ZA 1JYWA 3BMVA 2DRUA 3FQRA 4UUJA 4PBXA 3U4BL 1CFTB 4KRPD 1AC6A 3BKJH 1MY7A 4R2GD 1EEQA 4P2RB 3JXAA 2O5ZH 5F7LB 1HHIA 4KI5E 4XPGH 3EHBC 3VFMA 4KH2A 5D7SH 4WJ5A 3Q3GB 5IMLB 5KS9B 3FN3A 4G6JH 4NN5C 4ODWA 3QWQB 4UT6L 3SKNA 3EOTH 3UTPE 1ZT7B 2GJ6D 1JPSL 4JY5L 1CN4A 2JCCF 3E1F1 1CVSC 5BS0B 4KAQL 1DL7L 4AMKL 5FM5M 4LBEA 2HRPL 4MB3A 4LPVA 2QKIA 3O6KL 3MV8E 1CGTA 4LLDB 3X12B 3QUML 3NCJH 4A6YH 1MFDL 4X6BB 4YHYC 1CTNA 4JRYE 3U82B 3QBTB 2BNUA 5DD5H 3SJVB 4F7MA 4QGTA 5LVEA 1N64H 5TGBB 2UZIH 4N0UA 2ZNWA 1FRGL 1U8KB 3PQYA 1KCSL 4YHPA 1F2XK 4U6YA 5MEOB 3QIWD 5EFIA 1K6QH 4LVNC 3CVIL 4CMMB 3EYFB 3HE6D 1P4LA 3I9GH 1SBSL 5HHNA 1BJ1J 1RFDL 1A6AA 3G6JA 3QH3B 4KK8D 4BQ9A 5DF0A 2EC8A 1PKOA 4K71C 5C0NC 5T3ZH 1JPGA 5DHXB 1OP3H 5IFAH 1VGKA 5GS1A 2NLJA 3HZVB 5FUOH 3SE3C 4Z7UF 3VWKA 4LSTH 3ZKNC 1G0YR 1KIRA 1FN4B 3REWB 3GIZL 1A6TA 3SDDB 5I74C 3X13B 4EXKA 1LP9E 5I71C 4R4ND 1G6RL 1T6VN 5EBWB 3LD8B 4K94H 3S8WA 1DBBH 4NOFA 4LHUG 3UYPA 3D5OF 1PW3A 2G60L 4X83A 2PNDA 2D7TH 5HVHB 2QQNL 4H8WL 2KUTA 3EOAB 4NO0D 1QFUH 5ITFA 4DEPC 4YXHL 1MHPH 2W9DH 1B6DA 3M8OH 5ICXB 4HG4K 4P3WA 4PJ9B 1CGSL 1CFVH 3BKMH 3IJSB 1FZKB 1QRNE 3EJJX 2A9NH 2W9LA 2VR5A 4DKEH 3GHBH 3EYUH 1RIHL 3FOLA 4NCC2 4GRWE 3S4SG 3ROOB 1YEFL 1PG7W 5T1MB 1GIGH 4DN3H 1K9TA 2DQIL 4XP9L 2C3XA 4DVBA 2CLVA 4XNMA 2MKWA 2AERT 4JZOA 5EUOF 5D93B 2C9AA 3QWOA 4G8FA 4PJHA 4L3EA 5DA4A 5CD5D 2QSVA 5AAMA 4IRSA 4RX4A 1FQ9C 2YC1B 2DM4A 2JK5B 5MERA 2H8PB 2XQBL 1MAKA 2WQRA 4OGAD 4H1LA 2X70B 3KLDA 3DX8A 1XGUB 5DVKA 5F6HI 4OIIL 4CAGA 3L3JB 1U92A 1EXUB 1WT5A 4WHTB 4LK4A 2GCYB 5J12C 2N4IA 1BIHA 1IAII 1CVRA 5I1LB 1YEIH 5AYUL 4LLMA 5EIIB 2A73B 1DFBH 1K8IA 4U0QB 2X4SB 4BELD 3AREC 1MRCH 2W1NA 4ISVA 4C56B 1LP9A 5F6IC 2E5EA 1F00I 4UTAL 4S1QL 3T0XA 1L7TH 3LQZB 4MXWH 3HZKB 1HZHL 3BQUA 1IC4H 4P46A 1ZVSB 5HPMA 4FG6D 1G7PA 3T1FB 5GRUL 3U0PA 1GGTA 4WV1A 4NZUL 3UPRB 4R7DB 4XXCC 4FTVB 4BQCA 1J7VR 2VSDA 1IE5A 1QRNA 4OCYL 1VFUA 5E2JA 4RNRA 4Q58C 5CILH 2FD6L 1BOGB 1OGAD 2VQTA 4I3RH 5DQJA 1QR4A 2EIZA 2R56H 4HKXB 4WWKC 2BVTA 2F5AH 1UYWL 3RY6A 3ULSA 4UT7L 1EEZA 3VXRD 1XCTB 2AJZA 3ZMRA 2VIRB 2OL3B 1N26A 5LQBL 1Z9LA 1I1FA 3JWOH 4D0DB 1A21A 1HYSC 3OAZK 1RUAH 5D2LB 1CDGA 1RZJL 5DEFB 4YHKL 4NO3A 3TNNB 3S98A 4R4FH 5FYJD 3BP6B 5FGCE 1GC1L 1I8IB 4EUPA 4ODUA 1RMFH 3GSVB 2CQVA 4LRIA 1GZQB 2VZSA 1MCFA 5IIEB 2NY3C 1BBDL 4ZTPH 3QUMA 5F72S 2P8PA 3RI5K 1XGPB 3O6MH 3L95A 4NKDB 3WL9A 4XXDA 3V5KB 1I9IH 4KK5C 4MNHB 3NFNA 5IWLC 3T0AA 4Y1AD 5E8PB 3MRLB 4Y16A 2A6IB 4K3GA 5C8JA 2APFA 4K2UH 2FX9H 5C07E 2VH5L 4OIAA 1UZ6F 4PTTA 5JDJA 1MJ7H 3RAJL 3WN5C 5IVXB 1Q9WB 3X17A 4GJTB 2H32B 3QUZD 3OR6A 2JJUA 3HLAB 3DI2B 2CIIB 4JO3L 4CADB 4P3DB 2DB8A 4XMLL 3ULVE 2R9HD 2EKJA 3BI9X 1N0LA 5JDSB 5IVNA 3QXAA 1NGQH 5EN2A 1KFAH 2DLHA 1G7MA 2CXKA 4HHAB 3CMGA 2ZZUT 4PJ5D 3P2TA 4APQC 3OHXB 3DGCR 5AUMB 2Y6SD 1P84K 1F5WA 3N1MC 4TPRH 2OMBA 2YK1H 3ARWA 3WE6A 1UJ3A 1T7WA 4P9MH 1A3LH 4Y8DC 4JY4B 3QUXD 4DTGL 1BX2A 4IOIB 1FVDB 1DUZA 4U1JB 5C0DB 5IB2A 1DLHA 2DMKA 3L3HB 4OD2A 3MV7E 5GS0L 3FO9B 3MR9B 3OB8A 3UBXB 3ZHDA 1TTUA 4GG6F 4L9LC 1FYTB 4RFNB 1R5IB 2CKNA 3QFJA 1FJ1B 4G80A 4PB9H 4G5ZL 1C12A 3VGGA 1QO3A 1JHKL 5FKAB 3TJHC 4PG9A 2OK0H 4W6XB 1ZA6B 4J7RA 4PJIE 3ARDA 2FHCA 5SWSD 1F4WH 5CP7B 4NQDD 1T5XB 2D7MA 3QIBB 3MJ9L 4HH9B 1P4IL 1A1OB 1DUYB 2IBGA 5KTEH 3CU7A 3QHFL 1O7SA 5GGSY 2ZUSA 3QDGB 2XZQL 1CICA 2IH3A 4NIKB 1XIWC 5HHXH 3TA3D 3AS1A 4YC2C 2Z8RA 4G8GB 2YPLB 4AG4H 4ORZC 1IM9D 1R24B 5ACMA 2VDLH 3QEQE 1P7QD 5DMYA 4JFDA 4U1KB 3FJTA 1JK8A 5I1CL 5A2LH 5GJTH 3Q5OA 1WWWX 3FFDA 4FZ8L 1FZMB 2AEPH 5E1AB 5SX4I 3UCRA 2E6JA 1AFVH 4L4VE 5I1IH 5CMAB 3MOBH 3NZ8B 1B0RB 3O41A 2ZG3A 5IQ7H 5T3ZD 5BJTB 3IXTA 2Z35A 3LEXB 1NEZA 1GAFL 4HV8A 3SGDI 3VW3L 4M3JA 1P6FA 2OI9B 4PRNA 3QCVL 3BGFC 1HHHA 5J3HD 1V7MH 4L4TB 3V5DB 3RL1A 3GRWL 4HWZA 4S10A 1TQBB 4LHQB 4PR5B 3QA3A 4P23C 3VI3E 3QPXL 5HGAB 2K9UA 3RDTC 5BV7H 3MUY1 1W72L 5F7KC 1HOCB 4K7PY 4KY1L 2WWMD 1IBGH 3TBWA 5C2BH 3DUHA 2F54E 1RK1B 4B0MM 3MV7A 3QEGH 3D25B 3QQ4B 1CDUA 2X7LA 4X98B 1ES0A 4JN1L 4EVNA 3TZVC 4TNVF 3S34L 3WKML 1HH9A 1EFXB 1FL5B 2WUCL 3BP5B 5IB4B 1MJ8L 3FZUC 5HDQL 1WBYA 1FE8H 1UWEL 2Y7QB 4S1SL 1BAFH 3QDJE 4ZD3H 3RVUC 3CLFH 3L9RB 1XF2B 2C4XA 4PGCA 2EE9A 4WO4C 4X0KA 4OT1H 5DT1H 2QQKH 5EOTB 2G75B 5IEKB 4F8QA 2C5DC 4F2MA 1KB5L 2AJ3A 2K7QA 3TCLA 3L5JA 2DWDA 2PW1A 3OGCB 4YBLC 4XZUB 3TPUA 3QYCA 4Q7DA 3I50L 5BO1L 4XC3L 4JPVH 1HCVA 4JE4B 3DHMA 5AZ2L 5FYKL 4S1DC 1CL7I 3VXTA 2DLIA 2OR9L 3QEQA 3W9EB 5HGHA 4MZ2A 1MQ8A 3P3YA 5D7IF 3IVKB 3C8DA 1PJ9A 3SO3C 1A4KB 2W65B 3RL2A 4E5XB 5DYOB 3HC0B 1BFVH 4AIOA 2JELL 4JO4H 2HFGH 2YD4A 3DROB 3U46B 1K4CA 1OPGL 1KACB 4N8VG 4KV5F 1E6OL 4G8IB 3FAXA 1U3HB 4TTDD 3JV0A 2AVGA 4LVOB 4MQXD 4U1MB 1SMOA 1QOKA 2CD0A 3LAFA 3ARYA 4WFGE 5C7XH 5D5ME 4MHHG 4M7ZB 4JAMB 1ZE3C 2ZUQB 4ONFH 4G8EA 4X4YA 4HUVA 1RUQL 1MCRA 3PGDA 3EFDL 2BNQB 2DIJA 3UTSD 1J1OH 1E27B 4K7PL 4ALAL 3GGWA 3IB4A 1VEPA 3A6CH 1ND0A 2RJMA 4LCUB 3H42L 4ONHB 4LVEA 4FQXB 4HG4J 1TCMA 1F6AB 3HHRB 2F53B 1RI8A 4NKMA 3EW3B 3K2UL 5E6ID 3MLRL 4Z6AT 2ZG2A 3PP4L 1A6UL 5FA4A 1HNFA 2CLZB 5GZOC 5JOEA 4G42B 2NY1D 1KELH 5EIVA 4ZDHB 4G6ML 2D03L 3VFUA 3FFCB 5DQ9A 4PD4K 1HDMB 2ZG1A 3DSNA 4QRPE 3CUPA 1AJ7L 3D18B 4OBRA 4YDVB 1NSNL 1R0AL 5E2WH 2D4DA 4KGLA 2JJSA 4BM7A 3CXHK 3QNYA 3ZTNL 3WIIL 4HWBL 4PJ8C 3VXOA 3ZYJA 3QCUL 2CGRL 4P5TB 1WBZA 3DRTA 2XYCA 5GRJH 4CMHC 2N1KA 1HEZA 3EDDA 3P40A 1Y0LA 4NRXB 5DHVB 4JRXB 1ITCA 4BZ2L 2IADB 3VFWA 3O0RL 2EDRA 4MAYD 4HBQA 1AO7A 4JDVB 1CDYA 1RZIB 4L8CB 1TJGL 1P4BL 5JPMA 5EO0A 3RU8H 1RJLB 2Y5TB 3HNTL 4N5UA 4M9PA 4NO2B 5D5MA 2I9TB 1G7QA 4V1DE 2Y36L 5EU3B 2QSCL 3MLUL 4ZFOL 4P2CG 3BH8A 3ZT7A 1B88A 3O8XA 2G9HA 2VDRH 3MUHL 4UU9A 2EZ0D 3ARZA 2B5IC 1OSZA 2DM7A 2NY2B 1JFQH 4HUWA 2NY6C 4OCSL 1D5MA 2I9LB 3BESR 4ZSOB 3PL6A 4M43H 5MEPB 1JZ2A 3PGCA 1K8DA 1NCAH 4F7CA 5GGUA 4NO5B 5F1NA 1AD9B 3MA9L 3TYGH 1AGEA 12E8H 3BW9B 4M5ZH 4ZUTA 1SEQL 4MX7B 1SEBA 3VXMA 3GRWA 3LKQB 5J1TC 2D31B 3KPSE 3HCVB 4QRRB 5DMGD 3LD8C 4LSQL 2A6KB 4CN1A 5DO2C 3GSOB 1MCPL 1W72A 2VXTL 4G6AC 5BOPA 5FYLE 3WIHL 5KVFL 5MEQA 4XP1H 3WS3B 4NC1C 4M8QA 2ICWB 3UPCA 4QRPA 4YE4L 2FL5A 5HVHC 4J3XA 4QTIL 3TIEA 1DEEB 3D0LB 1Z5LB 3WJJA 2WBJA 3QDGD 1YNKH 5KSBB 5I19L 3SKMA 3QWRD 4JM2C 3QUKB 3QSKB 3GKWL 1NCDL 1WZ1H 3FONA 4I3SH 3WSQL 3RPKA 2UY6A 5CSZA 2W07A 5IW1B 5DK0A 3RX8A 4LSVH 4MJIB 4PLKD 2CK0L 2WAHA 1AGDA 3NH7L 4Z7UB 1NAML 1KPVA 4AEEA 5D93C 5EC2A 4Z7VA 4Y4HD 2DQGL 1YMMD 2PCPA 1KLFA 3RWCB 4X4ME 4V1DA 4POZC 5JIKA 2YR3A 3KPPA 3IGAB 1E4XI 1QLFB 1MRDL 4M1GH 1YN6B 3SCMD 2H9GA 5ESVA 3TVMD 3QQNA 2C3WA 4OTXL 2BFVH 4N0RA 3D3VD 1CU4L 5F7NC 4G9FE 1R5WA 2XACC 2IANE 4NP4L 3LPWA 1T2QL 1ZK9A 3GUTA 1H3TA 3ILQD 3SDXE 4EIGB 4TUOA 3VXSB 1FGVL 4FQCL 2MQ3A 5E9DB 1MWAL 4K3HA 3ZKSD 4NWTH 3D85B 3GMMB 3KPSA 4FQIL 1CFQA 4ELME 3FT4B 1P84J 1Z0MA 2BDNL 3FO2B 3KWWA 1ULVA 3HPJB 4A2LA 3V8OA 4CVZA 3BGMB 4PGBB 4XCFH 2NYYC 5ITBL 1IGYA 5MHSE 3S88L 4P48A 3MRHA 3TN0C 4DKFH 3O4LE 1NMCB 2QADC 1LDSA 2J3SA 5I66B 1MFBH 1EO8L 4BFIB 3MRJA 2PUQT 4MVBC 4BH7A 3MRBA 5E56A 3TPKA 5HHPA 4PRPE 2J8UB 4DFHA 1D9KC 2C1PB 5E8OB 3EJYD 3MJ7A 1NCBL 4GRLB 1RZ8A 3QAZB 4PP2B 4YEFA 3GMLA 1F8TH 4ZS7H 4JZNB 4RGNB 5DD3L 3AVEA 1X5GA 2GK2A 3PF2A 4KQ3H 3GBMH 3GSNH 1XR8A 1K2DB 1NC2A 3EDJA 5GGTH 1KLUB 4PJ7B 3SDAB 5C0AE 4EN3C 4N0YH 4X6DF 1JYXA 1HXMA 1MUJA 3WJLA 5HXMA 3PWJB 4HZLA 3INUL 4UIMB 4KROB 4WW2F 1CDJA 4E42A 2JCCA 4N5EC 2AJXL 4H0GA 4HWBA 4I2XB 3T0EB 1T04B 2Q6WA 1KCUH 5IBTH 5IW6A 2IANA 3KR3L 5GGVL 1C16B 4CGTA 1L6ZA 4YO0A 3SDXA 5IHUL 3HZMB 4Y4KA 5JZ7D 2VLKB 1RHHA 4JKPL 2F19L 1NKOA 3VDBA 4G7VH 4NPYA 1QFWL 4JFXB 5J1SC 4Y89A 2F53D 5C6PB 4CNIB 1ZHNB 1OP3K 3UTTB 5BVJA 3KPRE 1XF4B 5JPNA 2UWEB 4OCRL 3O4LA 2FEEI 5C0CD 1SYSA 4LGRB 4PJGE 2Q7YA 5DJCB 4HLZH 1ZGLM 3BAEH 3TO2B 4JLRB 5D2NE 1DVFD 4PRPA 3SPVA 1H3WM 2GFBB 2X4UA 3WHE1 4NRZA 2CK2A 5JR1L 4YNYA 3RGVB 4C83A 5K9OB 4Z95H 3HI1B 5DVOA 3NCYS 4PJCF 2DBLH 1HINL 3LKRB 1KTDB 3OKEB 1S5HA 5LAXB 4AIZA 2P5EE 3BZ4A 3PWNA 3W5MA 4IJ3B 4LIQL 5D71H 3JWDH 4Y2OA 2VL5B 4MXVE 1AGFA 2BVQB 1AI1L 4HMDA 3IDJA 4UV7H 2IFFL 3G5XB 1WAAF 4JZJA 3QRFM 3CX5K 3PE9A 5DMIH 4N0FA 1IAIH 5TQ2L 4ETYA 4BZ1L 3GB7B 5EU5B 5A2IH 4PY8J 5EZJA 1U6AH 4ZXBB 3SDCB 4OLVL 3CIQA 5EBMA 2ADGA 4AEIL 3F8UB 5DD0H 1AHWA 1FO0L 4F33B 4WHCA 3DSFH 3KLAB 3OAYH 1MQKL 1N8ZA 3AU1B 2ZUTA 3QO0B 4NZTH 3AAZA 4ODSL 1IC5L 4BQ6A 3AB0C 1NAMA 3N1PC 2XY1A 1IEAB 4XBGA 3FO1A 3MBED 3QI9B 2EXWD 3ZYIA 1RZGA 3LV3B 2F58L 3BIKA 4FFYL 5I1DB 3O9WA 2ZCHL 3KPRA 1ADQL 1A64A 1Q72L 1HHKB 5FIEA 3KYKH 2E8ZA 1OM3L 4PRIB 4ZAKD 2Z31A 1KGCD 3RVTC 4G43B 1PSKH 5CCKH 3B5TA 4PJGA 2AK4B 2AV7B 2ATPA 3MRIB 3H9SB 4IIQC 1YYML 1MEXL 3C2SA 4ZOEA 3V4PH 1YEEL 2UYLA 3QDME 3HNVH 4ZUWA 1T83A 3MCLH 1BFOA 4FQLH 4PFEA 3QDAA 1CF8L 3D6GA 1TQBC 4UINL 2LQRA 3BN9D 2X4QA 1MWAA 2FX7L 5EZLA 1C5BL 2P5EA 3V8CA 2J8HA 1KIQB 2HFFB 4DQOH 4Y5XA 1B2WL 3W0WD 4PJXE 2GJ6A 3ALXA 4IDLA 3NABH 3ARFC 3O4OC 4GT7A 5FYJL 4HT1L 2XTJD 4PD4J 1Q9KB 3HE7A 4OFDA 3VFGH 2PO6B 4OZHE 5J11B 5DXWA 3U0TB 5DTFA 4YUEH 2Y07L 3A67H 3U0WH 2GYSA 2P49B 5HHQB 3DURB 5DJXB 3R1GH 3EO9L 4G7YH 3CXHJ 4U1LA 5AG8A 5C6WH 5T3XH 1C7TA 4NQEE 1F6LL 1YUHB 3SDYL 2I60L 4LP5A 3ALWA 1HQ4A 4KJPC 3HUJF 5FA3B 5DFTA 1N5AB 4TN9A 3TJEH 4PV8B 4O2FB 5DR5L 3FMGH 2AXHA 3O45A 3STZB 2FECL 5LKNA 2NMSA 2XKSA 3GSQA 5E9DD 1KENH 2IQAA 2HN7A 3HE6A 2GY7B 2FGWL 3MBXH 3D85D 4N8VA 4F9PA 4EI5B 2XFXA 4KKLC 4LDOB 5L2KD 3BT2L 3HC4L 3NA4A 4PRHE 5A2FA 3K0WA 3QIUB 1GVIA 3DRQA 4HFUH 2Z93B 4LOUD 4P99A 3RWIB 5HGDB 1AKJA 4HJ0D 4QHNB 3V79C 2BSTA 5DJ2B 2H26B 3FHAA 4OV5A 2MMXA 5C86A 1BD2D 3I02B 4L8DA 1DQML 4QEGA 4ZFGL 3BZEB 2IG2H 2Z0BA 4IRZL 4FFWC 4LMQE 3QUYD 5DVNA 3BKJL 5F9JA 4O00A 2NW2B 2XA3A 4N90E 4ZUVA 4BYHA 4KTEH 2O5ZL 4XPGL 1EA9C 4M7ZC 3TYFA 5D7SL 1PYWB 2NY0B 2H2SD 3UBXG 3OKDA 4G6JL 3ZZ1A 3OXRA 2V2WB 5ETUA 3EOTL 1UVQB 2MNUA 1JUFA 3VI4F 4JFFE 3T8XA 3LSOA 4QXTA 4OZHA 3IS0X 3FTGA 2Y4SA 3MUJA 5KSAB 3SDAD 4FQXC 3QNXA 1S9XA 4PRAA 2GK0B 3S5LB 2GITA 5FOBB 4KROD 2AI0H 3NCJL 3T65B 4A6YL 5C0FA 4NQEA 3MRRB 2EDXA 3LPGA 2GEEA 3PNWB 4YPGA 5DJ0A 5H37G 4NQTA 4QRQB 5DWUH 5DD5L 4F9LA 4KI1A 1A9EB 5TQ0H 4O2EB 5BQ7B 6CGTA 4QHUA 4ENEC 1NLBH 4GKOA 4R4BA 5SX4H 2P42B 1EX0A 4UBDC 2UZIL 5GRYA 2AGJH 4QT5B 3GEWB 2HVKB 1KCKA 2VWEC 1HILB 3KPNA 3SGDH 5BXFA 5L7XH 3I6LD 1HKLH 2PXYB 1K6QL 2Z4QB 4HQQH 4PRHA 3I9GL 4GG6A 3V6BR 4P5TC 2BC4B 1PLGH 4XMKH 2VUOA 4DUWA 4Y2DD 3WXVH 1IJ9A 4Y19D 1SJEB 5T3ZL 1YNTB 5IFAL 4MCYA 1DTUA 4Y5VA 1MVUA 5FUOL 4LSTL 4KRMB 3ARUA 4I0PA 4WY7H 5FEBA 5J1AB 1M6OA 4PJFE 5DEZA 1K4DB 5CZXC 1DQLH 3BYTA 4QRTB 4Y5YA 3VWJC 4P2RE 2DQCH 3WEXA 3MRNB 1UB6A 2MJWA 3D0VB 3HAEB 4K94L 5JMRA 1DBBL 1ADQA 2NXYC 1JZ4A 1DBMH 2QHLA 3C6LB 5ALCH 2GSIB 3QZWB 3WDJA 2YA1A 5KS9E 3DX6B 3RBSA 4ACPA 4JFFA 5GSRB 4J6RH 1LEIA 2D7TL 2NR6C 1QSFD 3GSRA 1QFUL 1CWVA 1MHPL 2W9DL 3BEWA 3M8OL 3JSSA 5BS0E 1CFVL 2DF3A 3BKML 3J8F7 1WK0A 5DJYB 1OGAA 2A9NL 4HFWB 4I3GA 1JHLH 4NSKB 4C54A 4DKEL 4OZFA 3GHBL 3EYUL 2WW8A 1CL7H 3OF6D 4I48A 3QCTH 5D4QA 1JPST 4ZUUA 4KJWC 3VXRA 3LRHA 2MQCA 1GIGL 4DN3L 4PS4H 3AY4A 1JGEB 4Y7MA 1NBZB 3SJVE 3D39D 3CH1B 1YY9C 3GJFH 3BZFB 5EU6D 2E7LC 1OD7A 1BP3B 1T3FA 2P47B 2ATKB 4YDLB 3CPLA 1L0QA 3VFSB 1UQSB 2BVOB 5FDWA 3EFFB 1FFQA 5ISZD 3EIFA 3EO0B 1DQJB 1AXSA 3L3DB 4HGKC 4MD5B 1XAUA 3R06B 4LQ1A 5D7JC 3BKCH 2YD7A 4NUJB 2ADJB 4D2NA 1R3HB 4NQCD 4NQSA 2BHYA 1YEIL 3GJFB 1CXKA 3MLTB 1S5IH 1DFBL 3RIAK 2D0HA 5BRZB 1MRCL 2EO9A 4GBXD 2DJUA 3DMMB 4XNZB 4CU7A 4P2RA 4YBQD 1QFWM 1S78C 2IBZX 2BNRD 3TBSB 1BF8A 1L7TL 3MXWH 3GM0A 4MXWL 4XCYB 1IC4L 3PJSB 3LZFH 3ZKMD 4OB5H 5H94A 5DD6A 1DDHA 2AW2A 1ZT7A 1S7UA 1EEUA 4NC1E 3ISWA 1RZKH 4NQXB 4U1HB 2QQLH 2P24B 1JF6A 5D7IA 5BS0A 2FYYB 5GISH 4FQJH 4XMPH 3C5JB 4PJ5A 3CSPA 2F8VA 5CILL 4RMUA 2GT9A 1KPRB 3X12A 4I3RL 3F7QA 2R56L 2NY4D 2F5AL 1Q8MA 3QUXA 1N5YH 1A7OH 3SJVA 1INEH 2V7NB 4ZPTA 3JWOL 1GZPA 1U8NB 4FQ1H 1RUAL 5TGBA 5KVDH 3MFFB 3PHQB 3CX5J 3TT1H 4C57C 4R4FL 1F3DH 5F88B 1P2CB 1RMFL 2OTPA 5MEOA 5KVEH 4L8SA 4GRLC 4EI5D 5H2BA 2XZAH 4ZTPL 2XIDA 4A6YA 1I7ZB 1ZEAH 2AEQH 5JOPE 3O6ML 5SWSA 1J05B 5DUBB 1I9IL 4DJMA 4LFHG 4ZG1A 3D69B 4WNQB 4OKVB 2VLRB 3N85H 4Z7WB 5AG9A 3DO3A 1CTOA 3HZVA 3F7VA 4MQSB 4U7KA 1Z9MA 2P43B 4K2UL 4OF3A 2FX9L 5BVPH 4LSRH 3SDDA 1MJ7L 4U33A 3X13A 2QEJA 3U2SB 1KV3A 4C56E 3FQNB 3RUGF 1HXYA 1P7QA 4IOFD 3S97C 1R3KB 1XH3A 2HKFH 1IGIH 3MSPA 3NIFF 4NM8H 1L4IA 4JFPB 3T0EC 1ETZB 2B0SH 5HHMD 3EDEA 1CFSB 2P5WD 2D2OA 4NYLA 2VZ3A 4OM1H 1NGQL 1KFAL 5CEXB 1HCFX 2X4PA 3BUYB 2YMXL 2Y1VA 5ICXA 4FTVE 4YGAB 2I07A 2G5BB 4PJ9A 2Q8AH 3RZCB 3VRLF 1HWHB 3C08H 5LGJB 2JB6A 4TPRL 3D1MC 5GGRY 3F6IA 2YK1L 5GSVB 3QIWC 4P9ML 1A3LL 4GKNA 2HRLA 2D9QB 4DCQB 1YPZF 5T1MA 3TCXA 2OP4H 1S9VB 3KS0H 4X8JB 3FCTA 2DL9A 5LBSH 5I17A 4KK8C 4RSVA 1C7SA 3P9LA 1NFDB 5DGQA 3HG1D 2X4RB 3O3AA 2EDDA 5D2LE 4PB9L 1NGZB 2AKRB 2B1HH 4WFFE 1WEJH 3RGVC 4UT9H 5D6CA 5EOCH 1AGCB 5B4MD 4D9QD 2FR4B 4XBPB 1JNNL 2YC1A 3T3ME 2JK5A 2OK0L 2Z92B 5DK2B 4Q9BA 1E4XH 4OF7A 1LEGA 1XGUA 2KZWA 4PJEA 1EXUA 1F4WL 4WHTA 5DJDA 2GCYA 3O81A 5I1KH 2IF7A 3V52L 4F7PB 2RFXB 5I1LA 4KJQD 5KTEL 1BVLB 4NNXB 5EIIA 4NN7C 2XN9B 2X4SA 1XGQA 2ZSVA 2HH0L 3I3BA 3N1QC 5HHXL 3DXAD 3F62A 4AG4L 3C5ZB 3SDCC 1JNHB 5IVXE 3PP3H 2VDLL 3RPIB 1BWMA 3LQZA 5IHZB 2P46B 4QKXB 5GJTL 3HZKA 3BPOB 2AEPL 3AMLA 2CDFA 1R3JB 2GY5A 1J0YA 1ZVSA 1AFVL 1I9JH 5I1IL 2X1QA 4GW1B 2H2PD 3TBVB 3MOBL 2HT2D 4XP5H 2YD3A 3UPRA 5IQ7L 1V7NH 4Z7QE 4R7DA 4X4XA 4FTVA 4AL8H 3C09B 4HF5H 5F3BB 3QI9C 4RZCA 4JFQA 3OGOE 1V7ML 1ZLWH 5J06A 1YNLH 1MH5B 2XICA 1BOGA 4HH8A 4MSWA 5BV7L 1QG3A 3WUWB 5EZIH 4O2CB 3CFKA 1ITBB 1IBGL 4HKXA 2IPUG 5CJXA 5C2BL 1S9WB 4MMXC 1YDPA 1XCTA 4U1IB 1A1MA 1E4KA 2VIRA 3QEGL 3ZL4H 2C1OA 2OL3A 3UTSA 1KCVL 4LCCB 4OGAC 2O5YH 4D0DA 4ELKB 2CR3A 5C0BB 5DEFA 1OHQA 3O2WH 2IAMD 3TNNA 3V4VH 3LKPB 4OFYD 1FYTE 1UXWA 1FE8L 1QQDA 1SJHB 1I8IA 1BAFL 3TF7C 5E4EC 4ZD3L 3CLFL 5C0JB 5E6IA 5D7KD 3SKOA 3MRCB 1MCOH 2YA2A 4OT1L 5DT1L 1A0QH 2QQKL 4LPTA 1XGPA 1VKXB 1F11B 5IQ9A 1WISA 3VFTB 3V5KA 3VJ6B 5F7EH 3RWEA 1IGCH 1L0XA 2Y72A 1LO3H 4UTBH 2R23A 4JQXC 4Y0GA 1BMGA 5E8PA 3MRLA 1LK3H 2PO6C 1FCCA 2B20A 4JPVL 2WBWB 3QDGE 3FOMA 2H32A 4G8GE 2YPLE 4YGVA 3HLAA 4P9HH 3SE8H 3REVA 4CADA 1U8OA 1SVZA 2GSGB 5JDSA 5AWNH 2HJKB 1BFVL 4JO4L 2HFGL 4UB0H 2K7PA 2A74B 2R2BB 3BIBX 4NKIH 4HHAA 2CPCA 4LSUH 4I8DA 4FXKB 4QCIA 32C2B 5I8EB 4IMLA 2NY7H 1QNZH 4BSVB 1B0WA 4L4TE 5C09D 1W8OA 5C7XL 5D7LD 3BH9B 4LDEB 4ONFL 4XGZA 2GTWB 2D3VA 3QIUC 1ZLVH 1LHZA 4V2CB 4IOIA 1FVDA 2IALB 5C0DA 5F97E 1LNUB 3L3HA 3CAFA 3FO9A 1A6ZA 1J1OL 3HZYB 4M93B 1F3RB 3A6CL 3GSUA 1EHLH 5MEND 1DBJH 1FJ1A 2IFGA 3AM8C 3T3PF 3WDHA 1BJ1H 5FKPB 5FO8B 1UFUA 5M7QA 2ZJSH 1KJ3H 1H0DB 2IC2A 1A7BA 5SV3A 5F1SA 1N59A 1KN4H 1ZA6A 1N6VA 3P4MB 2L0DA 3QUZC 5SWQA 1KYOK 1OP9A 3CXDH 3UJTH 1OQXA 1KELL 5DRXB 5CP7A 2R1XB 4NBYB 4KKAD 3QIBA 5DC9B 4HH9A 4JJHA 1A1OA 4PJAF 3PDOB 1DUYA 5D1ZD 1QBAA 3TBYA 1XCQB 5I1AB 2V2XB 3R4DA 5DFVD 4XI5D 3QDGA 1LDPH 2E7MA 4EIZC 3QWRA 5E2WL 4UDUB 1XZ0B 2E27H 3D9AH 4G8GA 2YPLA 4EI6B 1R24A 1JP5A 3TNMB 4L1DA 4NZRH 1JMXA 1U8LB 4FA8A 1JI1A 4LEXH 4U1KA 3MV9D 1NGYB 5GRJL 3DX9B 4U1SA 2Y6SC 1FZMA 2BSSB 5IEHB 5CMAA 1VFAB 3NZ8A 4GRWH 1WZKA 4PJCA 4CDHA 4LLUA 5CZVH 3BDYH 3CSBA 4PYGA 1PD6A 3IJHA 5BJTA 2A0LC 4Y4HA 4JKLA 4LP4A 4HK0A 1U8IB 3WS6A 5JW5B 3RU8L 4MLSA 2PXYC 3V5DA 1OAKH 3RTQD 3S37X 4ZQKB 4PR5A 4C58B 5HGAA 2R1YB 3OAYK 2DOCA 3SCMA 1G9MC 1B0GB 2VDRL 1NUNB 3K1KC 2B4CH 3QQ4A 1JFQL 1SYVB 2WLYA 4I0KA 4OCXH 2BNQE 3P4NB 5CP3H 4M43L 4JVPA 5INDA 1NCAL 2EDJA 1ZLSH 2Y7QA 3TH2T 3U9UB 4D9RE 4GS7B 12E8L 5A2JH 3QDHA 4M5ZL 2EH7H 1A7NH 4HKBA 4N68A 2QLVB 4BQBA 4NKOA 3TA3C 2JIXB 2F5BH 2X6MA 3C6LC 5DS8B 4XP1L 5TH2B 5IEKA 4NUGH 4TVPH 2BY3A 4DWHA 3OGCA 4PY8I 4JGUA 2YSSB 2YWZA 3FFCE 5E03A 2ADFH 3I3EA 1BZQK 1WBXB 1X7QA 5FK9B 1F4XH 1SY6H 15C8H 1YNKL 3FQTA 1KSRA 1ZGLP 4WWID 2W0FB 3W9EA 4DN4H 4ODBD 5J3HC 1AIFA 1W0YT 1IKNA 2DYPB 3C5SB 1WZ1L 4I3SL 4JHWH 3IVKA 2BRRH 3KYOB 5SV4A 1FFOB 5IB3B 4J12A 4LSVL 2X1PA 2DQUH 4M8VA 2XT1B 4E5XA 2D4FA 4F37K 2WWMC 5DYOA 3MRMB 4JRXE 3FQWA 3DROA 4I5BB 4ZUSA 3U46A 4KMQA 3QPQC 4BQ8A 2OR8A 3LEVH 4G8IA 1U3HA 4PREB 3W9DA 4U1MA 2VAAB 4JFED 5SWZB 1GPOH 5DC0A 5DJAB 2NNAA 1MI5D 3FB5B 4NRYB 2EYTB 1JGUH 1VB9A 4M1GL 4IS6B 3LN5B 4E41B 2BFVL 5F9OH 2BNQA 2FNBA 1IAKB 2CLRB 3WLWD 5I16A 4XAKD 4RAHA 1E27A 3UJIH 1G7LB 4LEOB 4LCUA 4ZSOE 3ARBB 4ONHA 3KYNB 2VE6B 1TIUA 3DMMC 4NWTL 4XNZC 1U8PB 4X5WB 3QJFA 3BD3A 2F53A 1C1EH 4KZEH 3HUJA 3L7EB 3IJYB 2BMKA 2ICWJ 1T1XA 1HSAB 3P0VH 4QRRE 3BJ91 4K9EH 3RVWD 3IRZA 4XCFL 5T5FH 4EDXB 5FUCC 5JHLH 3FQUB 5IBLD 4DKFL 4Z7OF 4J23A 2Z9TA 3PQYD 1UCBH 2LAAA 1HDMA 1MFBL 5HYFA 3ULVH 1H5BC 3S5LG 5A3IC 3MREA 1BLNB 3D18A 5JQHC 1ZHLA 2YD5A 2GIYA 5JO5B 1PGRB 2LTQB 3E3QE 4H25B 3VXUB 4U6HA 5KSBE 2WWKT 1P9MC 4OV6F 1F8TL 4GSDH 4ZS7L 4TTDC 3ARGB 2H6PB 3OJDB 4LLWA 3G04A 1G9NC 1YC8A 5C07B 1FNGB 5E2VH 3G5YB 3V6FB 5FM8A 1WCBB 4KQ3L 3GBML 4NRXA 2FIRT 5DMKB 2A6DB 1CIDA 4MJIE 2WIMA 3GSNL 2RAMA 5IOPA 4Z7UE 5D96C 5GGTL 4KI5D 4N0YL 4OI9A 4L8CA 4G3YH 2R0WH 3C60B 5FCUH 1RJLA 2Y5TA 5ALBH 3UTPD 4NO2A 4IOSD 3M17B 1OGTB 4Q9QH 1KCUL 5IBTL 1WZMA 3MV8D 1I4FB 2V5MA 5EO9A 1MCQA 5F7MC 4ORGB 5KZCD 2EKSA 1GJIA 2NY1C 1RJCA 4WDIB 4Z77B 1RD6A 3MBEA 4NN6C 4JRYD 1XF3B 5DJ8B 3HAEG 4G7VL 3ILPB 3VXSE 3BW9A 3VCLB 4OLYH 1HQRB 5ADOH 3QZWG 1I1RA 4HPOH 3LKQA 4QRRA 3HCVA 2R4SH 4ZAKA 3T09A 1X5IA 1W0WB 4N0CD 3S36X 3GSOA 2NPLX 5ACLA 4IMKC 1JN6A 2WMPA 5HD8D 3WS3A 1MCJA 1FG9C 2ICWA 2YBRA 1CGXA 4XWOC 3BAEL 5I1JH 4IRSD 1RQ5A 3F7PC 3WNNA 2HVJB 3K8MA 2A77H 1D7FA 1F42A 3IFOB 3O3UN 4MAYC 4HKZB 2ITDB 4U05A 3T0BA 3NIDE 4N8CH 5KSBA 4Z95L 4Z9KB 1CLZL 2J8UE 3RZCC 3QUKA 2DBLL 2CRMA 3OKOB 5JORB 1KEMH 1HNGA 2I26N 4BSWB 5D71L 5IW1A 3JWDL 4RGNE 2APTA 5IGXH 4MJIA 1OL0A 3AS0A 3G5VB 1UJTA 4LVHB 2VSCA 3V0VB 3EDFA 4UV7L 4H5SB 3N9GH 2O61A 2EZ0C 2DWEB 4PGDB 1FZOA 3NCBB 4XCEA 1IAIL 5DMIL 4PJ7E 2YXFA 4WW2C 3RWCA 1U6AL 3BQUD 3AFLA 5F70A 4ZPVB 4MQTB 4P46D 5L0QB 3S3JA 3KNBB 5TDNA 3N1GC 1QLFA 5DD0L 1YN6A 3GJFK 2CO6B 2NZIA 2EEAA 3DBXB 3QXVA 3DSFL 3VE0B 4M7LT 4I2XE 1QRND 3T0EE 4Z5RB 4NZTL 1MJJB 2Z8VC 4F15B 2HTLC 1ORSB 3QHZH 5I1GH 4LGSB 4NBXB 5JMOC 3VXSA 4ZNEE 4JFOB 5E9DA 4NT6B 2VLKE 5FGBA 3H7BB 1NCNA 3QQ3B 3C5ZC 4X7TB 3D85A 1CDHA 1NANI 1NC4B 5GQBA 4KJYB 3KYKL 3MUZ1 2NY5C 4N1EA 3VFPB 3B4NA 1RIUH 3G6JF 3BPOC 1PSKL 4O02H 4QF1B 3BGMA 3UTTE 5CCKL 4LKCB 2UWEE 3JV5A 3MRDB 1X5JA 1BD2A 3HI6H 1A1NB 3V4PL 5HBBA 4PLKC 5DK3A 4NQVB 2EDTA 1CZ8H 3QUYA 3HNVL 5TE7H 3CFIC 3MCLL 4BFIA 4FQLL 1CGUA 4BJLA 2J8UA 1JZ7A 2NTFB 2C1PA 2MWCA 4J3UA 4XAWH 4JQIH 1A6WH 3CDYA 4OCLC 4KDTC 4DQOL 2VKWA 1LE9B 4M61B 3GMQB 4Y16D 5H8DA 2YRLA 3NABL 1KYOJ 3KDMB 4FQHB 5CD3A 5DURB 4HX1B 4LCCC 1ZHBA 3MYJB 2FGZA 2JLLA 5D1XD 1MJUH 3TVMC 3ZDXE 4X9GA 1H3UA 4KWUA 1KLUA 3SDAA 3VFGL 1KJVB 3MNZB 4YUEL 3A67L 3U0WL 3SKJH 3EYOB 3PWJA 3MTRA 4UIMA 1TVBB 3OPZH 3R1GL 3ILQC 4G7YL 4HEPG 5JHDB 1NPUA 3P30H 2D7OA 4B41A 5T3XL 1I3UA 1MOEA 3MROB 3WV0A 4D8PB 3RY5A 1GRWA 1PVHA 4E41D 2DN7A 3HRPA 2WIIA 4IM8A 1HE7A 3TJEL 1I8MB 2HP4A 5ERWA 3GSNA 5DZOA 1UZ8A 3FMGL 3MX0A 4JDTH 2OJZH 1D5XB 3HZMA 2EDNA 2VLKA 4DZBA 2OX5A 4HUNB 5GGTA 1ED3A 2NXZD 1V5JA 3RNQB 1KENL 4NM4H 3SE4A 4JFXA 5CHNA 3MBXL 5IMMB 2C4FU 3LOWA 3SGEH 4LHUB 1ZHNA 2Y06H 4ZYKA 3EJYC 4Y2DA 3AXLB 1XF4A 2HA1A 2UWEA 4HFUL 5J57B 4QY8B 4PRIE 4BSJA 4K8RH 4YQXH 3L3GB 2YD1A 1A8JH 3QFDB 2AK4E 1ZKAA 1ONQB 1UXSA 2DQHH 5D6DA 5DJCA 1OP5H 3UTQB 3H9SE 3S6CA 3TO2A 4JLRA 2IG2L 1CLOH 3B9KD 5FM5O 5FF6B 1CXIA 3VXNA 4TSAH 3ARDD 4M6MH 3T08A 4OQ1A 3HI1A 4NJAH 1LP9F 5EBLA 1JGVH 1J8HB 1IC7H 4KTEL 4RAVA 1KTDA 3ARGD 3BPCB 3V7MA 2F74B 4HULB 2DLGA 2VL5A 5C07D 3Q6FA 5ACZB 1XMWA 4YHOH 1CICD 2J8OA 1R3LA 4EJ1C 3G5XA 1U3JA 2DIBA 2NX5B 3PWLB 2ILLA 3LS4H 3MLZH 1CS6A 4TUJB 4YEEA 5HGBB 1C5DB 3ULVD 3VRJA 4FXGA 1FNFA 1TZGH 2CKBH 4ZXBA 5JZ7C 3FN9A 2AI0L 4Z76A 2LV4A 4E0RB 4AH2B 4U31A 1I1AD 2UY7A 2VC2H 4Y4FB 1T21B 2VITB 2WP3O 5E24E 5DWUL 1KIPB 5TQ0L 1AY1H 3AU1A 1QP1A 1NLBL 3QO0A 3JV4B 4M4PA 3EKCA 2AGJL 5FYLH 2OTUB 3GMRB 1NBQA 1BECA 5IB1B 3LV3A 5L7XL 5ISZA 1DVFC 1HKLL 4NN5B 3IXAA 4QRUA 3IDUA 3CSGA 4HQQL 3MV7D 5I1DA 3VXQB 3SQOH 1ACZA 1HHKA 4JKKA 5ICZB 2ITCB 1PLGL 3IAPA 4XMKL 4PRIA 1IGJA 3WXVL 2CDEB 4G43A 2DMBA 2AV7A 5T3XE 3MRIA 3H9SA 4PJDB 3TIDB 2XPGB 5CEYB 5C0EA 3OKYA 2XKUA 1TENA 2PR4H 2YEZB 4WY7L 3LDBB 3PP3K 4GBXA 1A02N 1U8HB 1O0VA 3WUWG 1LEKB 4QOKB 4HCRH 2MCPL 5DVLA 4LAQH 2X4TB 1T2XA 5F71A 2BNRA 1DQLL 4JHZA 2EIBA 2W91A 3U30C 4CW1B 2V2TB 2DQCL 1KIQA 4JFYB 1CG9B 2X40A 3V5HA 3T4AA 1DBML 1VPOH 5ALCL 3P9MB 5GS2H 4L5FH 1X5XA 2FO4B 4R7NB 3QG6B 4RDQF 3NCYP 2HT4D 4KMLB 5E5MB 4J6RL 4MA8H 2EDYA 3MLXH 3UDWA 2XWBA 4XCCH 1H3PH 3ECBA 3QEQD 1Q9KA 4F57H 1MPAH 3V6ZA 3C8HA 1CT8B 5J6GB 3W11D 5FUZH 1I9RH 4Q2ZB 2YPKB 4K71B 1F4HA 1JHLL 3DURA 4L4VD 4XVUD 5DJXA 2EXWC 3P11H 1CL7L 1K5NA 3QCTL 3L7FB 2YN3A 3TO4B 5E8NA 1NLDH 1S7RB 3CH8A 3DECA 2ZNXA 4PS4L 4X6CB 4QHKJ 1TTFA 2AQ1A 5FA3A 1N5AA 4WEUD 5I71B 4XHJC 2FCBA 1S7TA 2E7BA 4KV5E 1IGFH 3PV6B 3RNKA 1JGDA 3F6LA 2F54D 5E8DH 1OAQH 1H15B 1S7SA 5D70H 1FFNB 4EI5A 5FO9B 3VFVB 4CN4A 3EZ8A 4DOHB 4GO6B 4DEPB 4GRMB 3BN9C 2Z93A 4P4KD 5J0BA 1MLBB 4MA7H 3WFBH 3BKCL 4JGMA 4E9LA 4IRJB 2H26A 3QDJD 4MS8D 4P2QB 3I02A 4QNPE 1ZVHA 3BZEA 1S5IL 2EDFA 2R1WA 1SJXA 1T22A 3MGOA 4X6EB 2XTJC 2X42A 1TPXB 2NW2A 4CU6A 3MXWL 4OJFH 1JPTH 1M71B 1PYWA 3ULVF 5J9PB 3R8BB 2HFEB 3LZFL 2OTWA 5KSVA 4OB5L 4DFIA 4MNQB 2VXQH 1RZKL 3K46A 4MWFA 2C7UB 2QQLL 5E6YA 1KXVC 5ESQB 1VFBB 5GISL 4FQJL 2CRIA 4XMPL 3I75B 4Z7NE 4YXKH 5KSAA 3HB3D 3BWUC 1J86A 2GK0A 5EWIH 4Q9CA 5C3LD 3MODH 5FOBA 5DA0B 4P4RA 5J12B 3T65A 2J4WH 4GXVH 1ZS8B 5BZDB 5F7YC 4GLRH 3VGHA 1N5YL 1A7OL 4QRQA 3MV01 3OKKB 1ACYH 1CFNB 3U48A 1INEL 2DKUA 1HH6B 2LE9A 3AREB 4CUCA 5BQ7A 3MA7A 3KPQB 4WRLA 5HI5D 4FQ1L 4AK1A 2M26A 4HJ0C 4WFGD 5D1QD 2MKLC 5KVDL 2X1WL 4QT5A 3CVHH 5KVGH 2HVKA 1BREA 2ARWA 1IAIM 3TT1L 4N1CA 2RCSH 4OZIB 1HILA 2BVUA 1J1PH 4O9HH 2X44D 3AS2A 4LRNH 5KVEL 4IEFB 3S3SA 2Z4QA 3OXSB 1PY4A 1A2YB 5D7KE 2XZAL 4PJIF 3U4EB 4AM0A 2BC4A 5I73B 1ZEAL 2AEQL 3QB7C 3PL6D 2C3VB 1YNTA 1II4E 3IDGA 3N85L 4P2OC 7FABH 3JV6B 1CE1H 4WTZG 5EOQH 3V9FA 4RA3A 3VGFA 3UAJD 4LSRL 3CVHB 5BVPL 5T1LB 1LK2A 3LN4A 2ARJB 4L9DA 5BRZE 1KTKE 1EO5A 3OSKA 4XPHH 1K4DA 2ENSA 2WM0A 3NIGE 2IQ9H 3RRQA 1BQUA 3NZHH 2YKLH 2HKFL 4QRPD 3MRNA 1IGIL 3D0VA 4NM8L 2PYEB 3SE9H 1Z9SA 5GRVK 3TC9A 4LKXB 2FEDD 2B0SL 3MRFB 2XI9A 4NC2B 4MDJA 4PTUB 4NOBA 1CD9B 1OTUC 1B9ZA 4OM1L 1I8LC 4K8RD 3DX7B 4NCC1 3HRZA 1KJ2H 4RIRB 5KN5B 1T4KB 3EBAA 4X9HA 1QVOB 2NY3B 5CEZE 5DFWH 4M1CC 4WI7A 1A4JB 2Q8AL 3THMH 3LHPH 1PZUB 1CXEA 3UTOA 4HFWA 3C08L 4NSKA 4R0LC 3VI3F 2A83B 2HJLA 3RIFK 1PKQB 2JJTA 4WGWB 3QJHB 4LCWB 1MHEA 4M7LH 4GAYB 1T0MB 2OP4L 1GGBH 5HI3C 1JGEA 2QJDA 5LBSL 3DYPA 4MNGB 1NBZA 5B21A 4HWEH 3CH1A 1NDGA 3ES6B 4V1DD 2RBLA 4HJGB 5DSCB 4MGXA 1X4XA 1X5FA 4X80H 5E5UB 3EHBD 2XRAH 3MRQB 2B1HL 1WEJL 4BKLB 3F58H 3P0YH 4UT9L 5EOCL 5I2IB 3EFFA 4JG0H 2JKXA 4OLEA 3AROA 1MNUH 1DQJA 3L3DA 1QBBA 1E4XL 3HI5H 3R06A 5D9SB 5T1KD 3E6FB 4NUJA 1HI6B 5IROC 5K9KB 3BXNA 5I1KL 4WFED 2O5XH 4YHNB 1LO0H 3TEUA 2H41A 2H3NA 2VLRE 4YHZH 3GJFA 2B2XH 1CXFA 3KPSD 4Z7WE 1UWGH 2E9BA 5IF0B 5FYLD 3O3EA 2WNGA 5MP6H 8FABB 5LGKA 1YEKH 3TBSA 5EIQA 4IBLT 2FZ3A 4UMGA 1FH5H 3PJSA 5C9KA 3STBA 1A5FH 1I9JL 1B4RA 4RWYH 4XP5L 2Y25A 4U1HA 1V7NL 1NFIB 3BMWA 2A9MH 5FYKU 2P24A 4AL8L 4BUHA 1OAYH 1B3JA 2FYYA 4HF5L 4YFLI 4UUJB 1VFMA 4HSQA 5IK3B 1BZ9B 1CGVA 1YNLL 2SEBA 1YEJH 2AQ3A 5C09A 3TH4T 5CGMA 3B2UD 5D7LA 4OZGB 5D5MF 4UQ2B 5EZIL 4BH8B 4QHMA 1A7RH 4WU7B 4ODWB 5T1DH 1AGBA 3SKNB 3ZKND 1NC2D 1D3CA 3ZL4L 1DSFH 3KPTA 3MZTA 2VLJB 1XIWB 4X5XB 5GXBB 5GS2D 2BZDA 2O5YL 4YC2B 1OTTC 4RRPG 3B2VH 5MENA 3H3KA 1WTGT 3VRIB 3MFFA 1UG9A 3O2WL 4LBEB 3V4VL 1NFDE 1EPFA 3QHTC 4DAGH 2FH6A 4ZFFB 3CSYB 1OW0C 2FB4H 4U2ZA 5CJBA 1INQA 4NC0B 3FKUS 4G9FD 2IAND 5CSGA 1DE4A 2BCKB 4RMSA 1MCOL 3KS0J 4HLJA 1A0QL 1I7ZA 4YBQC 5DHYB 4PPTA 1J05A 5DUBA 5F7EL 1IGCL 2HLFC 1LO3L 3IF1B 1AE6H 4UTBL 4F7MB 3U4AA 5KAQF 2A6JA 2OSLA 3EOBB 4Z7WA 4N0UB 2AJUH 5E8EB 5SX5H 2FLRT 5GS3A 3G6AB 5DRNA 4ZOBA 4P23B 1TJHH 1L7IH 1BEYL 1LK3L 3IDIB 3T4YA 2J88H 4YHPB 4U6YB 2XN9E 3PIQA 4U4BA 4WI2A 3U2SA 1SJVA 5MHSD 2X4NA 3O4LD 5HY9A 4P9HL 3TZVB 3SE8L 1XFPA 3MGTA 1R3KA 1Q94B 4JFPA 4LU5H 4PRPD 1JPGB 2ADIB 5ELIA 3UZVB 1JZ5A 1UKTA 3DETC 5AWNL 1J88A 5GS1B 2NLJB 4UB0L 3VWKB 1KIRB 5CEXA 4YDKH 2DD8H 4XRCA 4NKIL 3EOYG 3DV4B 4LF3A 1A6TB 4Z7VF 4LSUL 5J6HA 2ICWI 4UIKH 4YK4C 2G5BA 4OUOA 3V4UH 2DTMH 4URTB 2NY7L 1QNZL 4LARH 3ZTJG 2CJUH 4YH6A 3L3OA 5C0AD 4DCQA 3WUZA 3ZKQD 5E70A 5CJ5A 4WW1B 5ITFB 1NFDA 1UB5B 5IB5B 1EHLL 2X4RA 2ED8A 1DBJL 3V6OC 2D7QA 5C0BE 3GIVB 4TULH 3SO3B 3IDNB 2AV1A 1JF5A 2AKRA 4U1NA 1MF2H 2ZOLB 2ZJSL 1KJ3L 4HK3N 3FOLB 5A40E 1KN4L 2Z92A 3MNVB 2ID5A 1F90H 3JUYA 2X89D 4DVBB 4XNMB 3KJ4B 3CXDL 2JJWA 3UJTL 5I8KH 4MQ7A 4F7PA 1EGJH 1BVLA 3I3DA 4PJHB 4L3EB 2N56A 3KPRD 2XN9A 3PHSA 1LDPL 4WWKD 3PGFH 1MHHB 2E27L 3U7WH 3D9AL 4JEGB 5GGQH 1WGOA 1M05A 1JNHA 2UUDH 4XX1G 4NZRL 4H1LB 4LEXL 3RPIA 3DX8B 1JZ6A 5IHZA 1YJDH 2VZVA 4OUUB 1HYSD 3GFUA 3GMPA 2PTUA 1R3JA 1TVHB 4GW1A 1YY8B 3LB6D 5IJKA 5GRVL 4JREB 5CZVL 3BDYL 4HDIB 1K8IB 1X5YA 1XT5A 2P5ED 3RI5F 4ISVB 5F3BA 5ABDE 1E28B 3O6FC 2MHAB 2FJGB 4H20H 5BW7A 5I6XC 3NCCB 1MH5A 1OAKL 5FV1L 4JFEA 4LLYB 5FECB 1MI5A 4UAOC 3STLB 3WUWA 3NOIA 3OJVC 4OFIA 5C08B 1BPVA 3KGRA 2R8SH 1FP5A 2B4CL 3HE7D 2DKMA 3SEPA 1NUDA 4OCXL 4B7IA 25C8H 3ZE1E 2ZSWA 4PJ8B 5FGRA 4ZFZB 3SDXF 5FFLA 2AXFB 2M2DA 3LDBC 3OMZA 1ZLSL 1SJHA 4KJQC 5HHOB 4JQVA 2B1AH 3EUUA 1BIIA 4CMHB 5C0JA 4JFZH 2EH7L 1MFDH 1A7NL 2E6QA 1GGUA 1YN7A 3ULSB 2F5BL 4MAUH 3MRCA 2XQYK 3OKMA 4PYHA 5EC1B 4WI5A 4QYOB 1VKXA 1F11A 1G84A 2XQYG 4NUGL 3VFTA 3VJ6A 1I1FB 5TDPA 1Q9OB 5CAYB 2GQHA 5E94A 1D5BA 4APQD 1GH7A 3DVFA 5GJSH 1NGXB 3OV6A 2ADFL 2H2PC 2GJJA 2HT2C 1AD0B 4EUPB 4ODUB 4J8RA 1FIEA 3MACH 1F4XL 1SY6L 15C8L 4YHLH 3GO1H 2V7HA 3OX8B 3X11A 4DN4L 2B5IB 1BQHG 3O11A 1AKJD 2NY6B 2P8PB 4W4OA 4X7SH 4JHWL 1NGPH 2BRRL 1U95A 3TO4C 3QDMD 3DV6B 2DQUL 1RJZB 2GSGA 3NFNB 1J8KA 2DLTA 3EYSH 4OFVA 2JJTC 2D7NA 2HJKA 5TE4H 2VZUA 3Q5YA 2A74A 4J4PA 2R2BA 3TJHD 3JVGC 2P48B 4PTTB 4I1NB 3LEVL 2L4OA 1HIMH 32C2A 5I8EA 1BM3H 2DI9A 2ZUUA 3BE1H 2IAMC 1FL6A 1GPOL 1O5DT 3BWAB 1JGUL 4M6OH 3UP1A 4L3CB 3MV8A 4CU8A 2VDNH 5F9OL 1G7IB 2EH8H 4IRJC 3QXAB 5EN2B 2Z8SA 4UNUA 4JM2B 1FVCA 1G7MB 3UJIL 5GHWH 4JRYA 2X9YA 4XNYH 3V0WH 3MXVH 4NQED 4EDWH 2VZTA 1F4YH 1S7WA 3M07A 1TPXC 5JA9A 1C1EL 4KZEL 1RIHH 1G6RB 4R26H 2R29H 1WQVT 4XWGH 1BX2B 3P0VL 2EDHA 1OP5K 3O2VH 1DUZB 4K9EL 5IB2B 1DLHB 5T5FL 5IT2H 2R1XA 4PJGF 5JHLL 2PTTB 3O3BB 4J3TA 1UCBL 3PDGA 1I85A 3PDOA 5DVMA 3ULVL 3QFJB 3L5IA 1XCQA 4Z78A 5A16B 4G80B 4PRHD 1F2QA 2V2XA 5I1AA 4HWNA 1CQYA 3RDTD 1YEDA 3IFLH 1C12B 5CS7A 5E2TH 4UDUA 4XPFH 1KNOA 4PG9B 5ILTH 1YMHB 3MOAH 4UQ3B 1OF2B 3TNMA 4GSDL 3PXHA 2Q7NA 3DUUA 4HUUA 1LWRA 3DX9A 5E2VL 4MXVF 3QULA 4I0PD 3UROR 4PG2A 3L3IA 2BSSA 4JGJA 2VDMH 1VFAA 1N2RB 3NFPB 4M7JH 4S1RH 4N90D 4PBVC 5FDYA 4TVPE 3E6HA 4M1DH 2IH3B 4ODHH 4AJ0A 4G3YL 2YOCA 1PG7H 1U8IA 2R0WL 1GOGA 3HC3H 4WO4D 5JW5A 4JO1H 5FCUL 1BVZA 2OL3H 1RZKC 5ALBL 4F7EB 1OVZA 1CLYH 4NCDA 4ZQKA 3X3FH 1WFNA 1M7IB 4JFDB 3TN0B 4JFFD 2R1YA 1JK8B 4U7SA 2QADB 5SWZE 3N06B 3KLSA 4S0SD 3UO1H 3WIFB 5I73C 5F44A 1JPFB 1I7UB 1Q0YH 4Q9QL 3O41B 2NQCA 4J3WA 4XVJH 1A9BA 4E41E 5ENWA 1SYVA 4Q6IA 1D9KB 4XNUH 2JTDA 4HV8B 3NPZB 3VFRA 3P4NA 4S1DD 4G6KH 2BERA 3DIFB 4KKAC 5E7BA 3WLBA 4R3SB 1FZJA 1D6VH 5D1ZC 1PZ5A 1TETH 3HPLB 2CIKB 5JUEH 2IJ0C 5CGYC 3WDIA 5KJRH 3UZEA 2BOBB 4OLYL 5ADOL 1YQVH 4XI5C 1U91B 4P3CH 4HPOL 1RHFA 3O3DA 5I8CB 2R4SL 5CLWA 4JVUA 1T5WB 2E9IA 4EN3B 2X7LB 1MCWW 5TH2A 1ES0B 2FBJH 2W38A 5IKCB 3PABA 1Y6KR 1U93B 2VISB 2H32H 3OZ9H 1X5AA 5I1JL 3Q1SH 1HH9B 5ANMB 1ORQB 3NMEA 4KC3B 5B38A 4CBPA 2A77L 1WBYB 5KANG 5CP3A 2FDBP 1WBXA 2FIKB 4PGJA 1MLCB 1MREH 5FK9A 4N8CL 1ZT1B 3F12A 1I1YA 1U58B 3I6KB 3VXUE 2YRZA 4XCNA 3BIAX 4X0KB 2DYPA 1RVFH 2X41A 1KEML 3C5SA 3H9HA 3NTCH 2QBWA 4M6AA 2CUHA 3GM8A 4MD0A 2YD9A 1E4JA 4NNYB 3RTQC 4F2MB 5IB3A 1S7VA 5IGXL 2AJ3B 4PJXF 3TCLB 2PW1B 1JHTB 4L29A 5D1XA 3TPUB 3N9GL 4ZTOH 1BGXH 2F8XC 1SBBA 1KB9K 4I5BA 4RGMC 3DO7A 4P2RD 1T1YA 4OZHF 1UH4A 1S8DA 5AD0B 5IV2A 3VXTB 3KHQA 5GZOD 3FAWA 5HGHB 3BD4A 1SY6A 3NA9H 5SWZA 1ZXQA 3Q48A 1AQDB 3FB5A 2EYTA 2FATH 1P7KA 1TCRA 3ARXA 4O5LH 3ZDZF 2BVEA 5FYJU 5BS0D 4E41A 4HWUA 1ROWA 4YDJA 2CLRA 4GMTL 5DUMH 2IPKB 3RJDA 3BRGC 1QHPA 1K4CB 3QHZL 1DLFH 3NCMA 2W0LA 5I1GL 1G7LA 4LEOA 3WNKA 1OOAA 3ARBA 3GBNH 2VE6A 1CXHA 1NUFA 1U8PA 4X5WA 4XNQB 3SJVD 5H37H 3L7EA 1QLRA 2HFTA 3U6RA 4G8EB 2XNAA 1XGTA 4X4YB 2XXMB 4HUVB 1OLLA 1RIUL 4O02L 3PGDB 4U6XA 4F7TB 2B7DT 2KKQA 3BSZH 4EDXA 3AC0A 2UZYB 3FQUA 4QHLB 1KTLB 4TSCH 3HI6L 3WFZA 1ND0B 1XR9B 3B9KA 1YEHH 3LKNB 4D9LH 4Q0XH 1CZ8L 5TE7L 5T33H 5J13C 3SGKA 1AXTL 1CBVH 4RRPA 1NL0H 5JO5A 4H25A 2XWJB 2KDGA 4QHKI 4XAWL 1C8PA 4JQIL 1A6WL 5JW4N 3WO3B 1T1WA 3ARGA 3AB0B 2R2EB 3W2DH 3C87A 4I9WE 5C07A 2BY2A 3G5YA 5HVFB 1WCBA 4KUZH 5DQ9B 4DGIH 2A6DA 3MCKB 3SDDD 4ZO6A 1IGTB 1MJUL 2L7JA 2FLBT 1R5VA 1WITA 1AP2A 3B8YA 4N9GA 5KOVC 5HHVH 3G6DH 1NCWH 2ZCKH 3PWPB 3SKJL 2ESVB 5DO2D 3WYRA 4G6AD 3OPZL 4WTWA 3ZT6A 1WBZB 1I1AA 1VESA 2BSRA 4IIQB 5CIPH 3P30L 3DRTB 1FV1B 3F7YB 2X9XA 1B90A 1HEZB 5ID1B 5HJ3B 1Y0LB 4YAQB 2AJVH 4MYWB 1NGWB 3TT3H 1I4FA 1P1ZB 4PJ9D 4CVXB 4XX1E 1L9MA 1AR2A 1EDQA 4Z8FH 5LG1A 4WUKH 1YYLH 4JDTL 4WDIA 2OJZL 4XVTH 1PQZB 5EO0B 1XF3A 1RURH 5I15H 2P7TB 4JG1H 3U7AA 3ILPA 4NM4L 4ETQA 2LVEA 2YUXA 5IFHH 3BH8B 3ARFB 3O8XB 3O4OB 4WVRA 4X99A 2G9HB 2Y06L 5CIPB 4UU9B 1W0WA 1YPZE 1OSZB 2WWK