1GGIL

Crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin
molecule keywords IGG2A 50.1 FAB (LIGHT CHAIN)
publication title Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
pubmed doi rcsb
source organism Mus musculus
total genus 47
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 1993-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL01
4YEFA 3TN0B 5C0RL 4KMLB 5DTFA 2ZUQC 1AGDA 3U2SA 3ARPA 1YYMH 3RZCB 2ADGB 3T4AA 3FN3A 3M45A 1TZGH 1LEGB 1T83C 5DJ2A 4N8VA 1A5FL 2Y07H 2F54B 3PHOB 5KSVB 1MFCL 3N85L 4M7LL 2QSVA 1E28B 4LAQL 3TT3L 5DK2A 4QOKD 4BH7A 1SJXA 3SQOL 1YQVH 1FFOB 2CSPA 4KK6D 1X5JA 5FYKD 3F5WB 4P2OC 1F3JB 3L9RB 1XIWB 5F6IC 1KCRH 2APBA 1OSZA 1DN2A 1U8QA 3QJFA 4HIIA 4M8QB 2R0WL 1U8PA 1OAZH 2XPGB 1X5YA 3L5XH 5ELIA 3FRPG 2A74A 3FT2B 5GGVL 5HGBB 5A1AA 4Z95H 4XPBL 3BKCH 3VMOA 3WFCL 4M7ZC 3QIUD 5GS0H 2A83A 3O3AA 4CJ0A 1KV3A 4XBPB 1A6VL 3EAKA 5JW3L 2C4FU 4X7TB 3TN0C 4QHNA 3STZA 4WFFD 3SQBA 4GQ9L 4EDWH 4WY7H 5HPOA 3ZDZF 1G9NL 4PJGB 4P49A 4ZFZB 3E8UH 1UJ3C 3RNKB 3L5WA 4HS8H 3RWGB 2V2WA 1AGBB 4HFWA 3I6LE 5ESVB 1HSAA 3QG7L 1X5ZA 3S35L 5I8KL 2C1OA 2QQKL 4JKPL 2VC2H 3DV4B 4TPRL 1VFAB 4AQOA 3KPOA 1FDLH 5JW4Q 1XGPA 3BQUD 4BQBA 1XIWC 3B43A 3MCLH 4X9IA 2HYMA 4S2SA 2EIEA 2DIJA 3MRDB 4C54A 1PYWA 3MZTA 3WKMH 5KSBF 1UZ6F 2WMPA 3UAJD 5ISZA 5D71H 3WDJA 4JKLA 3D69A 3T0XA 3UCRA 1KIRA 12E8H 2CRYA 4NRZA 3QDMB 5T1LA 4ZPTB 4PY8J 3QCUH 2PO6A 2DQGL 4XZUB 5LCVH 1U0QA 1ZE3C 1UXWB 5FECA 1HZHH 3VCLB 1T5WA 4LLVA 1A0QH 1JNLL 4YHIB 2QHRH 3V2AR 5D6CB 4P3CL 1IAOA 3B3IB 5LGJA 1P6AB 1IGTB 4ERSL 3CFEB 4G9DB 4CW1A 43C9B 4XNXL 5DMGD 3HE6C 3IAPA 1RU9H 4KDTA 5IFAH 4DQOL 1NBYB 3HG1D 3UJJH 2HVJA 1ADQL 2ICWJ 2APVA 4HUNB 3A6OA 2BMKA 1HQRB 4X6CA 1VKXA 1W72A 2HMID 3PV6A 2H8PA 3RIFK 1MLBB 2DD8L 4QRQB 5CJOL 4FP8H 4MVBD 3BRGC 1PY9A 3GI9H 3VGAB 4KRPB 1MFEL 5IK3A 5IB4B 3CX2A 4NZJA 2DKSA 2D2OA 5GS0D 4ALAL 3OKDB 1KOAA 1QFWH 1H15A 2VLRE 4P2RE 3LN4B 1JF5A 5FGSA 1OQXA 4YBHA 3I6GA 1D5ZA 4JB9H 2VIRB 3O9WA 5C7XL 1HHJB 2BRRL 4QO1A 5HI4C 5CD5D 3OKKB 4JGUA 4DK6A 1I9JL 1JV5B 4LLYA 4NDMA 3G5VA 2HT2C 4OV5A 1AQDB 4LDLB 3LEVH 3O8XA 4ONOA 4NKOA 3ZSTA 1U8JB 4E5XB 1ZSDA 1MHEA 5T3XE 1PKQE 1HK6A 1MJJA 3W11C 4KJWD 5FDYA 5IFHL 4JFFE 1MCWW 1JGUL 1LP9B 1E4XL 3FZUD 2YEZB 3H9SB 1CQKA 4G6FB 1VFUA 4PJ8D 3SJVE 2FYYB 4RWYH 4OLXL 4WFGD 1FAIH 2OTUB 1T7YA 4OLWL 5F71A 3HZKA 4NBYB 4A6YL 4PP2B 1AP2A 3SKUD 4HIHA 3QDGE 2PKDA 4A2LA 3M17A 5C0FB 4J2XA 2HLFC 2BXZA 1EEUA 4F8QA 1FVCB 1FPTL 2D4FA 3MV9E 3LPFA 4F15C 5IT2L 3IU4L 5FA3A 5DC9B 4I77H 4WW1B 5H35A 2XXCB 2NR6C 1E4WH 3N1MC 4M6NL 4NFDA 1MF2H 3S3JA 2YKLH 1AD0A 1FZOA 3QUXB 5KVDH 5DWUH 1V3JA 4P2QA 3TYFA 4GAYB 3T04D 4HS3A 2ZWLT 4QRSA 1ZEAH 4ODUA 2ESVE 1XGTA 4JFPB 4G43A 2AEQL 4X6DA 5AEAA 4RMTA 2C3VB 4LKXA 3CSBA 4PJXE 2I25N 3L1OH 2PN5A 4I18B 1MJ8H 2YN5A 4DCQA 1JPGA 4M61A 4KHXH 4WO4B 4KK8D 5L2KD 4QHUA 3HC3L 4TVPH 3ZYJA 5DLML 2V9QA 25C8L 4NQVB 1OPGH 2VQ1A 3RAJH 2FBOJ 1FIGH 4F3FB 1G0XA 2Y36H 4X9BA 3QI9C 2OBGA 5C07E 4ODWB 5EZJB 1FFQA 3G5XB 1EBAA 2EO1A 3AXLB 3LKNA 2I9TB 3I3EA 3C8HA 2YRLA 1KCSL 2MQ0A 3HAEH 3MGOA 5IUSA 3TNNA 3HI5H 1I1AC 4HS6B 2EDHA 4X98B 3QUZC 1VPOH 3PNWA 2I27N 3GSQB 3C9NA 4G8GD 3FFCB 3OAYK 1XAUA 2CIKB 2MCPL 2DI7A 4NQCD 2Y6SD 4YZFF 1C08A 3KR3L 3L7EA 1DEEA 1DSFH 3G08A 2CGRH 1TQCC 1KIPB 5KZCB 1I85A 3TP4A 1X5KA 2BDNH 2PYEA 3PDOA 5JO5A 3L3OB 4FMKA 4PLOB 3IDNB 2NLJA 4HUXB 2FJGA 1IJ9A 5DGRA 2FEDD 2NY6B 3MC0A 2JJUA 3QIWA 4I18C 5ANMA 1SBSH 4P3WA 2DJSA 3IDJA 4ZS7H 1MWAA 4Y4HA 4WO4C 5D5MA 3WFEH 5IIEB 4TUKH 1CFNA 1NC4D 2EIZB 4UAOB 2DTML 3UBXG 5CJXA 4RSVA 1V5JA 2E27H 1FGVL 1EPFA 4WV1B 4JFQA 1BBDL 2G5RA 5EA0L 1TJHH 4JR9L 2HG5B 3HR5A 1XH3A 4R3SB 4OZFG 5A2JH 1BMGA 2VR9A 1QFWI 1WIUA 3QDJB 4PB0L 2UVEA 1OGAE 4FMFA 1KCUL 4FQ1L 1BWMA 4KI5C 1Q9KA 1BZ9B 5C0CE 1T83A 1XGYH 4MXQC 4OKDA 4TVSa 3HC0A 2K7QA 5MEPA 2H26B 4MJIE 5FUCC 5SV3A 1ZT1B 3ZKMD 4HUWB 3NIDE 3CUPA 1NDMA 5FYJU 2LFGA 2R1WA 4XH2A 5CLTA 1CLYH 4JANB 5DVOA 5AUMB 4WU5B 1X4XA 4P2OA 4V2CB 5I1AA 5BOPA 4XCFL 3SDCB 3QNXB 1HHHB 2NY6C 3GSNL 3H9HA 4WVRA 4I5BB 2FHBA 2BFVH 2YPKB 4O4YL 1JPTH 4HXBL 4PJAF 4X6FB 1YMMB 4TVPD 3U7YH 4U1JA 1BVLA 4UAOC 3DURB 4GG6B 3HNSL 1FZJB 1IGCL 2B1HL 2VLLB 4WV1C 3ARBB 5FHBH 4CADA 2JJSC 1ZK9A 3VXSD 4LCWE 1NEZG 4OJFH 1IC7H 1YEHH 3TN0A 5F7EH 2AK1L 4Z7QE 3GBNH 5CZKA 3M8OL 4P5MA 5CZXD 1OP3H 1EERB 4K7PX 1OOAA 4UINL 5L2JB 1EJOH 3ARZA 1AKJD 3RZCA 1DLFH 4JO3H 2F8OA 1MRCL 1OT1A 5FCUH 3ULVF 1LEGA 5ADOL 1OQOA 4P59L 4DN4L 3PHOA 4M02A 2NY5C 5KSVA 1LK2B 5HVGB 3K81A 1E28A 5GHWL 2VOTA 4GW4B 2DJUA 4Z5RA 3TVMC 1F4WL 3N9GL 4MA7H 3KWWB 1Z9MA 4XHJC 1UB6B 3BPOC 1FFOA 4NN5B 5BQ7B 3GJFK 4WUUE 5SWSD 1INDL 5D93B 3F5WA 4PJFE 5F8RC 3L9RA 1XIWA 2ICEB 3SDCC 2VXVH 3NFPB 4YXKL 2CUHA 1NMAL 5DYOB 1U8NB 4AEEA 3TM6A 2XPGA 4NFBA 5FKAB 5IEHB 3KXFD 2Q3ZA 3SGDH 4W4OC 1CFTB 3BKMH 2IH3B 1A6TA 2CDGB 5HGBA 5IMOA 5TQ0H 4N1CA 2VLKB 4JHZA 1ZS8B 1B4JL 4ELKB 4LVHC 5DSCB 5T1KB 2FX7L 2JCCA 5ID1A 3ARBC 4N0CD 1INQB 1MEXH 4XBPA 5IG7B 4OBRA 2P5ED 5E9DB 5JQ6L 1A7NL 4X7TA 5M94B 4PJ9B 4ZSOE 1D5MB 4D0DB 2GUOA 4NQDD 2VZTA 4XC1L 5F88B 2DMKA 3ZMRA 4OCYH 1DFBH 3O4LD 5DUPH 4HWNA 4PY8I 4UI2A 2OXHA 2IFFL 2AK4B 3D39E 1JRHL 2NY2D 3RNKA 3V0VB 1WTLA 3RWGA 2XWBB 1RUML 3GMPB 4PJ5A 4YFLF 1HHIA 1AGBA 4U3XA 3HE6A 5ESVA 2FECL 3UTQB 4X80H 4PGDB 5D1XC 1N0LA 5IW3A 4NN5C 3CAFA 2AJVH 4Y19B 3DV4A 4D8PB 1HKLL 3VH8G 5JHDD 1VFAA 2QTEA 2D7QA 5D93C 2NX5D 1JF1A 3K1DA 2X4TB 4MZ3A 1LILA 1H3TA 1P7KB 5C70A 1EFQA 2ICWI 5BS0D 4D9LH 1KC5L 3S9DB 1KJ3L 4R26H 2UZIL 4RMUA 3BH9B 2EC9T 3DO3A 1T3FB 1EZVY 5FOJA 1UFUA 3U4BH 3ZYIA 4ZPTA 1EMTH 4JN1H 4OCWH 3QO1B 4XZUA 4PJ9C 2G5BB 5EU6D 1AR1C 3RWJB 1UXWA 3MJ7B 2IBGA 1KLFA 3T0ED 2BNRB 1AR2A 4LARH 1E0OB 1N2RB 1R3HB 3VXRB 4FABH 4YHIA 5C3LD 3TV3L 5D6CA 4L1HA 3FOMA 3B3IA 1PLGH 1LEKB 3WNLA 1A2YB 1NFDE 1IGTA 3BISA 3CFEA 4G9DA 4IOIB 5C09B 2XWJA 43C9A 4JRXD 4P9HH 3HI1B 1WBXB 3CFJA 4Z7WA 3UPAA 5IHUH 3AS0A 5L9DL 5TFSH 2AEPH 1GC1H 3VXUA 4DGVL 3H42L 3PE9A 4M43L 4PG2C 2CR6A 5SX5H 4DOHE 2X70A 2EICA 3GIZL 4LPTA 5IW1B 3THML 3V7MA 1KULA 4WGVB 3V0AC 1IFHH 1GGYA 5BOZG 1FVDB 5IB4A 1EHXA 1BQLH 2I60L 1RMFL 3OKDA 1OLZA 4MNGB 5SX4H 4QRRD 4W6YB 2YRPA 2B2XH 3CC5B 3GNML 3PJSA 4XNUL 1TENA 1QFPA 3EZ8A 1I7ZB 4JPVH 4JJHA 1V7MH 2VIRA 1IGFL 1HHJA 1WT5C 1RY7B 3OKKA 1ZVSA 2R1YB 3EOTL 1JV5A 2ZKHL 3MV8E 1U3HD 3VJ6A 5C0RH 4X9GA 1I8MB 1AQDA 4PJHF 4IMKC 2Z8WC 3TBYB 1U8JA 3HZVB 3S5LB 4NHCL 4V1DA 2OLDA 3RL1B 5HHPB 4J8RB 1MFCH 3N85H 2H32B 2Z92A 4M7LH 4HAFA 2YEZA 3H9SA 3SO5A 4LAQH 2DYPB 4GS7B 1YEJL 2OTUA 4XCEA 1U8LB 3OPZL 5T3ZL 4ZFFA 4WTWA 2XQBH 1WIPA 5I76B 3WNPA 5KSBE 1UZ6E 1MCBA 2YK1L 4N8VG 2R0WH 3JWDC 1MCOL 3FONB 3HHRB 4G7VL 3SGDI 1X6NA 1ZT7B 5IQ9B 6CGTA 5DFWH 4XRCB 1ZANH 2R23B 4XNMA 1D9KB 4BZ2H 1KSRA 4XPBH 3HZYA 1M6OB 3WFCH 1FVCA 3BYTA 3VFRB 1YN6B 4WW1A 4H88H 3RL2A 1MY5A 1A6VH 2KUTA 4KK9D 4GQPH 4RRPG 5DQDH 2JJWA 2CQVA 1Q0YL 5L8JB 5LAXA 3PV7A 1I3GL 3DX9B 4GAYA 4CMHB 4F9LC 2ZG2A 4R2GD 5GRUL 2H9GB 2AJXL 1CLCA 2MJWA 4M5ZL 1OSPL 4HPYH 2C3VA 4LCCB 4GS7C 1RK1B 3CDGB 3QG7H 4I18A 1INEL 1W72L 3GMLB 3S35H 4GSDL 5I8KH 4NGHL 2QQKH 2J3SA 2OI9C 3CZFB 4JKPH 4WO4A 3K4AA 4TPRH 3PUCA 1AIFB 4U0QB 4U7SA 3K4ZA 3P4MB 5KSAC 1CIDA 3DXAE 3NAAL 4NQVA 1J8HB 5ICZB 5C0AD 4F3FA 3Q5YA 2DDQL 1QHOA 2I07B 4Z8FL 2FCBA 2QR0A 4ODWA 3G5XA 5AZEL 1CE6A 5HHXH 3AXLA 3C5JB 2GSGB 2I9TA 4TNWK 3V6ZB 3P9MB 3BP4B 3V7AG 1M7DB 1AD9B 1HEZB 4CGTA 1JPFB 4HS6A 2DQGH 4HQQL 4KMQA 3O6FD 5HI5D 2XN9E 3FFCA 4NC1E 3MBEB 5EO9B 4OUOA 3QDAA 2CIKA 2FATL 4N0UE 1XCQB 4JE4B 4JFEA 1QA9A 4MNQD 1JNLH 4CMHC 2ZUWA 5LKNA 5JLZB 4WCYL 1KIPA 4P3CH 5B22A 3L3OA 4UTBH 3IDNA 4ERSH 2JE8A 2WQ8A 4XNXH 4LCCC 2ZOKA 5EC2A 5T1DL 1P7QA 2E7LC 3LV3A 3QUYD 5E7FA 2VLRB 1D5IH 2ED8A 1KTLA 5IIEA 3E2HB 5D7JD 1MCHA 2EIZA 3T3PF 3L95A 1NAMB 2NQCA 4RAHA 4WV1A 2DD8H 1KFAL 1BIHA 2XWTB 3W81A 1ZT4B 5CJOH 2DLIA 3ZKNC 2PTVA 2MHAB 4M3KB 4ZXBD 2HG5A 2V2TB 1MFEH 3KPLB 4R3SA 4FFYH 1CXLA 4JY6B 4ALAH 4YJZL 4PYHA 1JI1A 1PKQB 3QDJA 5SX4I 3MRGB 2MCG1 5CS7A 3P73A 3MSPA 1O5DT 1SVCP 3VXMB 4KY1H 1BZ9A 3WS3B 5IVZB 5C7XH 4AEFA 2BRRH 4J3UA 5F7MC 4PJDB 3WD5H 3MBEC 4RCAA 3O6ML 4WTZA 1DQQB 2W60A 4XAKD 3TVMA 3ZTNL 5JPMA 2FZ3B 2E7BA 3G6JF 4X7DC 5AUMA 1EFXA 4WU5A 4RZCA 3RGVD 1SEQL 4L3EE 4YXHL 2G9HB 3PWPE 1G6RA 3MXWL 3SDCA 3QNXA 1BLNB 3WMSA 4I5BA 1DZBA 5A2IH 3F7RA 4U1SB 2YPKA 4W4OA 3KPTA 1U8OB 1IBGL 2FH8A 3E2HC 4X6FA 1YMMA 2Y72A 5F6HI 1A3RH 2HT4D 2R39A 4GG6A 1FZJA 3KYMB 2ZJSL 4P2CG 3N50A 4HGKC 2VLLA 3AUVA 5HYJB 3SOBL 5A2KH 3ARBA 2HKHL 4K7PL 5KVMC 1LO0L 2IBZX 3FT4B 4U6VH 2Q86B 4U3HA 3EYSL 1K6QL 2X89A 2XQYG 1ZLUK 4JGMA 3DYPA 3C08H 3P4LA 1CD0A 5DJ0B 3ZHLA 5L2JA 4JFXB 1J0IA 3D2UB 3T8XB 2XTJE 2X4PA 3U9PL 1S9WB 5IT2H 3BESR 4WEBL 5CGYD 1SBBA 1LK2A 4YZFE 4M6NH 2X42A 1IGML 4GW4A 5BZWB 5HY9B 3HE7D 5I19L 3KWWA 5D7LE 5TH2B 5BO1H 3O6LL 5D1XA 1UB6A 3TH4T 2XA3A 4S1QL 5BQ7A 3OG4B 1RJYB 1W8NA 1ZA3A 3MOAH 1HSBB 2XA8L 2FO1A 2BVYA 2ICEA 3SDYH 1OW0C 1NCWL 3NFPA 5C07B 5DYOA 1P69B 1U8NA 1PAMA 2AEQH 5FKAA 5IEHA 1CFTA 4ZTOL 1MWAL 2IH3A 2CDGA 4HLJA 2EKJA 3KPRD 3MCKA 4KJPC 4PV9B 2VLKA 2VUYA 3GI8L 4QXTB 4EN3B 1ZS8A 3SKMB 5DSCA 4RBPK 4FQXB 4ELKA 5A2LH 5T1KA 3KPPB 3MFFB 3Q6GH 5ESQB 1WQVT 3HC3H 1INQA 2ZZUT 1QG3A 5DLMH 5D1QC 5E9DA 1H0DB 1HH6B 4PJ9A 1GHFL 5E6ID 1D5MA 1JTPA 1XR8B 2O61B 5B39B 3ARFD 4KTYA 2DWDB 3PHSA 1TDQA 2AK4A 3WUWG 2VXUL 4TUOB 3OKYA 4NKMB 2XWBA 1O7SA 3TYGL 2MPAL 2WUCL 3WN5B 4OIIL 4XMLL 3Q48A 4B0MM 4WI3A 4QWWD 2VAAB 2MCPH 3FB7A 5MP6L 4PGDA 4U1IA 3BPNB 4TNVF 5CKGA 3KR3H 3K46A 1QSVA 2UY6A 4Y19A 1U8MA 4D8PA 3N1QC 2K7PA 1I8IA 3GJEB 4PG2A 3IFOB 1P7KA 5KOMC 1BFSA 2OR9L 3TESA 4PJAE 2R1XB 4UDUB 3MV7E 1FL6B 2WBKA 3WNMA 3B2UD 2V7NB 3QB7C 2ZCKL 1OGAB 5L6YL 4AENB 4EN3C 5IGXL 1XEDA 4HIXL 5CIPH 5EO0A 3OJDB 1U92B 1BAFL 5IESH 5C0CB 2DTMH 1AO7B 1FGVH 3QO1A 4XC3L 2KKQA 1WT5A 3DX6B 3W0WD 3LVEA 1BBDH 3RWJA 2FDBP 3MJ7A 5ECJE 3U4AA 2BNRA 3DGGA 1N5YL 1N2RA 3QHZL 1KEGL 3ULVE 4IMKA 4UT7L 3FO0L 4PB0H 4FQ1H 4LRIC 4F37F 1A2YA 1IGYB 1YNKH 4IOIA 3LS5L 3GM0A 3T65B 2F5BL 5GIRB 2HRPL 3SDXB 1WBXA 2R4RL 3BPNC 4FQJL 3PQYE 1TITA 5IVNA 3MJ8B 4KRNA 3BAEL 1DLHB 5EUOF 1G7IB 1M4KA 4X99B 5I0DA 4FNLL 3VWKB 5IW1A 4GRWH 1TTGA 5INCA 3GO1L 1F90L 3KPMB 3GSNH 1E4XI 4K23L 5DGQA 5HHOD 3C60D 3CCHB 1MVUB 1FVDA 1A7BA 4K7PY 3LQZB 3HMXH 2YRZA 4YQXL 4HXBH 3NTCH 3KAAA 3U36B 3CC5A 3HNSH 2B1HH 1I7ZA 3UTPE 1FBIL 3ARGB 3OV6A 2YPLB 2R1YA 2EYRB 1WJ3A 5DHYB 4UT6L 2VISA 4HWBA 4PLJD 2DICA 4UV7H 3WHE0 1CU4L 3Q6FB 4IDJL 5A3ID 3TIEB 1ZLVH 3K2MC 3P4NB 2P1YA 2EE6A 4WUUB 2ARJB 1UQSB 4PS4L 3TBYA 4EQ2A 1ZV5A 1OTUD 3HZVA 3S5LA 1MRCH 4F9LA 5J3HD 1T1XA 1KYOJ 5ADOH 3UTSE 3RL1A 4J8RA 1UM6L 2H32A 3ARVA 1VGKB 4XI5D 3AM8C 2B8OT 3IFLL 1U8HA 2DYPA 5GHWH 5I1CH 1F4WH 2N4IA 3N9GH 3QEQD 1IE5A 3UTZB 1LMKA 2BNQD 1INDH 3VWKC 1BBJB 5I76A 3VFOA 4ZSOB 2WWMC 1NMAH 2WNGA 4XP4H 3FONA 4EBQL 3NCFB 1ZT7A 2VZOA 2VQUA 2J8HA 1D9KA 1X5FA 2O5YL 1B4JH 3VFRA 2NY7H 2FX7H 3LOWA 3ARGC 3TGXA 1YN6A 1F4AA 4OD1L 1FC1A 5JQ6H 3LZFL 1A7NH 4ZOBA 4JAMB 2W9LA 2NY3B 5J1AB 4UNTA 4XC1H 3QP3A 1I1CA 4Z76B 4TN9A 5J6HA 2IFFH 3DROB 1WAAA 3DX9A 1WICA 1JRHH 5I18L 1LO4L 4OZIF 1JWUB 4NZRH 1RUMH 2VL4A 1Q0XL 3DX8B 2H9GA 1T1ZB 1JYNA 5DD1L 3T2PA 2MKWA 4LCCA 3ARED 1RK1A 2E7LA 3GMLA 5CZVL 1C1EL 1FRGL 2H6PB 1A1OA 3BGAA 1WWWX 3H7LA 2IPTL 4X8JA 4OF7A 3ROOA 2X4SB 4L8BB 5ICZA 3WFZA 2I07A 5HJ3B 4KROD 1CFQB 5E1HB 3A67H 1KC5H 4J3WA 1MHHB 1KJ3H 2UZIH 3RVTC 2GEEA 1CDIA 3CIQA 4N0FB 3P9MA 3BD4A 5CSBA 3MNWB 3UX9B 3BP4A 1N5AB 5A2FA 3SHSA 5J56B 1M7DA 4NWUH 4I0PB 1AD9A 1G9MC 1SJHA 1HEZA 1JPFA 5DHVA 2ARJQ 2NY3C 3ZT5A 1S9VA 1YUHB 2Y5TB 4U7MA 3OKOB 1WCBB 1PD6A 4PJHE 3MBEA 5EO9A 3TA3B 1VFOA 3FCTB 4MHHI 1XCQA 2EDOA 5TDPA 5BJTA 3CFBB 3KPQB 2JTDA 5JLZA 1FIEA 1QKZL 4M00A 5TJWK 2ARWA 1JUFB 3ALWA 2EE9A 5BCAA 4TNVK 4H0GA 2X4RB 4HKJB 2VLRA 4P2RA 3DIFB 1WIOA 1P1ZA 3FTGB 3TO4B 1TTFA 4NKIH 3G6DH 3LS4H 4DGVH 3H42H 1NAMA 5FA4B 3O3EB 3HMWL 1CTOA 1A6PA 2XWTA 3GIZH 1ZT4A 3NACH 4NKQB 3CJJA 1N8ZB 5F89B 3N1PC 4GOSA 2V2TA 3KPLA 3QUKB 4XMKL 5GRVL 5CEXB 2I60H 1RMFH 4HBCL 3WLBB 3RBGA 3RBSA 1PKQA 3MRGA 1MI5B 3FN0L 4I0PC 4LEXL 3ZE1F 4WFHD 5KS9F 1TVBB 4UB0H 4LCIL 1NH6A 2LE9A 2JK5B 3WS3A 1Z6JT 1DQTA 1FNAA 3SJVA 3EOTH 3BDYL 2R2BB 4ZUWB 5FO7B 4H1LH 5JUEL 4PV8B 2ICES 3RUGF 2FZ3A 5H8DA 3I6KB 2NW2B 5C0JB 5KSBB 4TTGA 3B9KB 3QDGA 5DR5L 4ZPVB 2BHUA 2G9HA 4LOUD 1OW0A 1T5XB 3RX5A 1BLNA 4LVOB 5J1SC 3BEVB 2C3WA 5EO1B 5IROC 4U1SA 3ZE2F 1F2QA 1U42A 1QBML 1B2WL 3QWOA 1U8OA 4R4NC 2DL9A 3BXNA 3TO4C 2XRAL 4PBWD 4GW1A 3TO2A 5GQBA 1KLUB 3KYMA 4G9FD 5HYJA 3N1FC 3D85D 1EA9C 5T3ZH 3F8UB 5JIIA 4YHYB 4N9GB 2GCYB 4NQUA 5D1QA 3B9AA 3FT4A 1ZLWK 1MCJA 2YK1H 5DUBB 1MCOH 5FIEA 1VADA 4G7VH 1CGTA 3D0LB 4V2BA 2H2SC 2YXMA 3QXDB 3WJJC 4PYGA 4JFXA 3D2UA 4ZYKB 1NUNB 1S9WA 4FXKB 2ESVA 1VACB 1IL1B 3MACL 4PJXA 1S9XB 2DJ4A 3MV11 4WHCA 5HY9A 3KJ4B 1BOGB 2IAMB 4MDIB 5EBLB 4O5LL 4S1RH 5I30L 1A6WL 1Q0YH 4ONFH 5TH2A 3WJLC 1FL5B 3VXQB 1ZWIB 2HFEB 1R24B 1JP5A 1I3GH 1RJYA 1JRHI 2R0KH 5EIVA 3DXAB 2P24A 1T7WA 4FHBD 2VLMD 1HSBA 3EJYC 4NBXB 3H7BB 4KTEL 1KPUB 5C6TL 3TJEL 5H2BB 5GRUH 2EC9U 4LVOC 5C07A 4M5ZH 1OSPH 2FECI 4Z7VF 1LO2L 2CO7B 1NLBL 3T3PE 2DI9A 4DKFH 3MNVB 4PV9A 1INEH 1W72H 4GSDH 4EN3A 1YEGH 2HT3D 4IIQB 5M7QA 3U6RB 3SKMA 4FQXA 3KPPA 4ZS6C 3F7YB 3QFDB 4XWOD 4YHYC 5ALBL 1UYWH 5IEKB 4UOW1 3NAAH 3ME0A 4NC2B 2XN9B 3MRIB 3MX0A 3MNZA 1HH6A 3K80A 3VG9B 3WS6A 1XR8A 1UC6A 2O61A 4D9RD 4CBPA 5B39A 4XP6H 8CGTA 1ITBB 2DWDA 3GJFB 5H94B 4LKCB 2NXZB 5IWLA 2YUVA 4MNHB 4NKMA 2AXHA 3WIHA 1JZ2A 4LRIA 3SBWC 1DQJB 2NY5L 1L7TL 2BJML 32C2B 5I1EL 3WN5A 1AGCB 4NO0A 5EFIB 4HQQH 4WW2F 5LGKA 1B9ZA 2NNAB 2NZIA 4PJIF 2IAMC 2VAAA 3G6JE 4MWFB 2GTZA 3L3IA 3MREB 3QXWA 4FXGB 4IOSD 1CL7L 1EEQA 3QEUB 3ULUF 1EIBA 3GJEA 4WCYH 1G6RL 3T08A 3IFOA 4Q0XL 3KPSB 1B6UA 4CMMB 2R1XA 1KYOK 4UDUA 2HJFA 1FL6A 4P5TC 4OUUA 1AJ7L 2V7NA 1OGAA 4AENA 4Y7MA 5CMAB 1WBYB 3OAZK 3OXSA 5T3ZD 3OJDA 4DW2L 1U92A 4AMKL 5C0CA 2VXTH 3F12B 4KV5F 4K3JL 1EVTC 4NC1C 5HHME 2W59A 2R2EB 4HHAB 1KFAH 3DX6A 3VG9C 1MUJB 4MJIA 4X9HA 4Y8AA 3T2OA 3VMNA 1OP5K 4LPUA 2PO6D 3IDYB 3REWB 5FGCB 2H1PH 4NQTA 5ESAB 4KKAD 4L3EB 4QYOA 3ZE0E 1KN4L 3MRPB 1IGYA 2VLJB 1ORSB 3ELAT 3DRTA 3T65A 5DA4A 5SWZE 2P5WE 5GIRA 4OCSH 2A6KB 3AGVA 2VR4A 5D96B 4Y4HD 5FF6B 3SDXA 3MXVH 4BQ8A 3O6MH 3AM8A 1CFBA 4NN7B 4AQ1B 5I15L 1CF8H 2QSQA 2CDEA 3ZTNH 5EOCH 5CJ8A 3FO9A 1IM3A 2GAZB 4R96B 1KPRB 4LCWA 5FM5M 2IBZY 3VWKA 1KB5B 4YXHH 3SKJL 4D0BB 4OLVL 2DQTL 3R0NA 2AV7B 4XP9L 3KPMA 4FG6D 3Q1SL 3CCHA 3EKCA 2XTJB 3U36A 4WTZG 3FFDB 4QHLB 4ZDHB 3RWEB 4PJBE 4QHMB 2JB6B 2X1PA 3SOBH 1FSKB 4PLNC 3ARGA 4OLEA 3WNNA 2AEIT 4F7TB 2HKHH 4K7PH 2EYRA 1LO0H 1IAIM 4HIJB 4XVUD 1H3WM 4JFDE 1XF5B 4OGXH 1TCMA 3Q6FA 3TIEA 1HXYB 5HGGS 3P4NA 4KU1A 1VEMA 4P0DA 2ARJA 3O9WD 4WUUA 1UQSA 3QAZB 2FB4H 4PJFA 3PXJA 3U9PH 3SDDB 4ZQKA 2A6IB 5IHZB 5DRWB 1OAQH 2E9JA 1VGKA 3O8XD 3EYFB 5B4MD 3ARYA 1CGSL 1IGMH 4NN7C 4YHLL 4TSCL 4MJ6B 2H2PD 5I19H 3GSWA 3WKNA 2EDNA 4S1QH 1L9NA 3UTZA 4K3DH 5DQ9A 5J13B 2XA8H 1XF2A 2DOCA 1BBJA 4RGMB 4ZSOA 3QCTH 1ZMYA 1FG9C 1LK3L 3QXVA 2MTPA 3MRCB 2XTJC 1MWAH 3D39A 4GMSL 1NSNL 1TQBB 2C5DC 2VDKL 3MRBB 2XQYK 1BFVL 3GI8H 3PHQB 3TNMB 3X11B 4XWGL 1S5HB 5DEGB 3MLYL 4G6JL 5JA9A 2F8VA 3L5JA 4M6MH 2DAVA 1G6VK 4RIRB 4JCMA 2CUMA 5HI3D 4JAMA 1DBKL 1GHFH 4L4JA 5J1AA 1HNGA 3P0GB 5MHSE 4Z76A 4XCCH 5CBAB 1JYWA 4NOBA 3DROA 4NYLB 4MA3A 4MLSA 1HHGB 2VXUH 2IADB 3SDDC 1GIGL 2HH0H 1BHGA 1JWUA 4N8CL 4NQEB 1FYHB 4OM1L 1U3JA 3B5HA 5F9JA 4F7MB 1T1ZA 4P2QD 2WUCH 1JN6B 4OIIH 4XMLH 1CG9B 4PJGF 4HK0B 3RY6C 4IRSB 2GITB 2VDRL 4U31A 4LSRL 5EUOE 1IKNC 3BKJL 4FQCL 1BJMA 1OT2A 5FKPA 2OZ4A 4RGMC 1VB9A 4L8BA 2PTUA 4WWKB 3WFBL 3QFJE 1KCVL 3FAWA 5HJ3A 3JWDL 4WFGE 3VXTB 5LXGL 1DBML 4OF6A 3QDHA 1MHHA 3O2VL 1TQBC 2KZ1B 5DC4B 3HPJA 1JGLH 3QSKB 2ZCKH 4N0FA 5E56A 3TH2T 3TZVB 5L6YH 4JFZH 2CO6B 2NYYC 3BE1H 4HIXH 5DI8B 3P11H 4YR6B 1N5AA 5T33L 4I0PA 9CGTA 3V6OE 4HWBL 4E0RB 1VFBB 3NPSB 4R4FL 3DI3B 2R2HB 1YUHA 2Y5TA 1WCBA 1JGDA 3GKWL 1F8TL 1XF4B 2GTWB 2DQDL 2M8XA 1EJ6A 1N5YH 3PDDA 1YEDB 3LKRB 4PRPE 5JORB 1EUTA 4DKEL 3CFBA 4QHKJ 3QHZH 3KPQA 3OJMB 4XGZB 4UT7H 2ZUTA 2PCPB 4XP5L 2GJ6D 5I9QB 5DFVC 2NTFB 4R8WL 1EEZB 1JUFA 3LS5H 4OD2B 4FS0A 2F5BH 2HRPH 2BVOB 5IROA 4HKJA 4YAQA 1DQLL 5DJ6B 2R4RH 3V0WL 1EO8L 2DTSA 3GBMH 3R06B 5DD6B 4FQJH 1J12A 1CD8A 3TO4A 3W9DB 4J23A 3B5GA 5CD3A 5E8DL 1E6OL 5FA4A 3CSPA 4FNLH 2BY0A 4PRNB 3O3EA 3QIWD 3MV8A 4GLRH 1N8ZA 2FHCA 5F89A 1PQZB 5JPNB 4WNQB 3ULVC 3QUKA 2C1PB 5CEXA 1JZ3A 4YQXH 4Y4KD 3WJJA 1NAKL 2QQLL 4P23C 5KVGH 1DBJH 4IOFD 3UTSB 4LVEA 1U2CA 4JO1L 4M7LT 1TVBA 1GPOL 1FBIH 2JK5A 4QCIB 5KN5B 3BD5A 3WFDH 4F7PB 4UT6H 2WUBL 2R2BA 4MA1B 4ZUWA 1IGIH 4IDJH 3QQ4B 5EORL 1S7SA 2IMMA 5FO7A 2JF1A 3D1MC 2J8OA 1LO5B 4PV8A 4YUEH 4OZIE 4LU5L 3WJLA 3F58H 3I6KA 4UT9H 4DKAA 1OP9A 4G8GE 4ODXB 2NW2A 5ENWB 5I9QC 5C0JA 5KSBA 4WI2A 4FZEL 4ZPVA 1EUUA 4ONHB 3LPWA 2K1MA 3ULSB 1T5XA 4IS6B 5JZ7C 2OTWA 3BEVA 3G5ZB 4NZUH 1R3LB 1UM6H 5EO1A 4KH2A 4Y16B 4KZEL 1NL0H 3IFLH 3G6AB 2VZ1A 4P2OD 1JYVA 1OF2B 4ETYA 4HMDA 1LP9F 5TPWH 3S5LG 2VXSL 3GRWA 5DJZB 2GCYA 5F7UA 4L29A 5JOPE 2EDBA 1QHPA 1AC6A 1H8SA 5FYKU 3LKSB 2OMNA 3ZHDA 1MFAH 4ZMAT 4EBQH 3D0LA 5DURD 5GRZA 5FEBA 3CDYA 5IB3B 3QXDA 3VFSB 3AMLA 4ZYKA 5F96L 3TN0D 1VACA 5DUML 3LEXB 3SBWA 4OD1H 4PD4J 4AIZB 1IL1A 4ORGB 1CDJA 3LZFH 1S9XA 2CKBB 4MA1C 2P47B 5J1TC 3RKDC 3AS1A 2IAMA 4MDIA 5EBLA 2XTLA 1AGFA 3QCVL 3VXQA 1HOCB 1ZWIA 3LKPA 1R24A 5E08H 3DXAA 5I18H 1LO4H 1ZGLB 4IRZH 1F4YL 1KPUA 1Q0XH 3F7VB 5IBLC 1UWXH 2B4CC 4F7EA 5DD1H 3LB6C 5GGUB 5F7KC 1VGEH 1Z9SA 3MNVA 1XIWD 5CZVH 1FRGH 1IEBB 1NAML 2VABB 2IPTH 2CMRL 3F7YA 3L3KA 3QFDA 5E8NB 2DQCL 1N59B 5AZ2H 5IEKA 1KT2A 2XN9A 3MRIA 4PJHB 5DK0B 5SX5K 3B9EA 3QEGL 5D72L 1FJ1B 1U8KB 4N0UA 5KBNC 5T3XL 4JRYE 5ERWB 4APQB 4HCRH 3GJFA 4P46D 2IFGA 3ZE1E 1H5BC 4RDQF 1AHWB 4KWUA 1F42A 4JZNA 4MNHA 5DO2C 2PUQT 1G9NC 2GY7B 1I75A 1DQJA 4NT6B 3EYOA 2J5LC 1V8HA 5GZNC 1Z3GH 1AGCA 1MAML 3VFVB 4E41E 3RUGE 1FYTB 4HLZG 4MAYB 1JHLL 3CK0L 4FXGA 3SGKC 5C9JB 5HYFA 4G6KL 4PJ5D 1I3VA 1X5LA 4QTHB 5F9AC 2OMBA 3NCMA 4CVZB 2A9NL 3DSFL 3HE6D 2GK2A 1QKZH 2YPVL 1F13A 3ZE2E 3KPSA 2ZNXA 1A3QA 4OGYL 1FP5A 4CMMA 3QIBB 4TSBH 3EYQC 2MMXA 4KPHL 1DBBH 4OTXH 4HK3N 5GSRB 1W0VB 1WBYA 1EHLL 3B83A 3FRUB 3O2DA 3KXFE 1CGVA 2D7NA 2XNAB 5E2VL 4KKCC 3AFLA 2R2EA 4AIXA 3HMWH 4ONGL 1F45A 4ZUVB 5IHLB 4G6ML 2QKIB 1S7RB 4APQC 1CR9L 4XMKH 3SDAC 1RJCA 4X7SL 5EZOL 5KSUB 3REWA 2LU7A 3KS0J 4YDVB 4NQDE 5HI4D 4L3EA 3PWPA 3BZ4B 2HTKD 1ORSA 4ISVB 4LL9A 3MLVL 4JPKL 5KW9H 2DM7A 2A6KA 3BDYH 5FF6A 3VXNB 4MAYC 4Y4FB 4L3CA 1F4XL 2AP2A 1HQ4B 3CFKB 5TF0A 2YA0A 5JUEH 4LLQB 1QRNE 5I1LB 4R96A 2ITCB 2CPCA 1KPRA 1YNTA 5EUKA 2HLAB 3SGEH 1N3NB 4D0BA 4Z7VE 3QIBC 2AV7A 1PG7X 2RFXB 4LP5A 4PJ7B 3OKNB 3RDTB 4L4TD 5F1OB 3K1KC 1QBMH 3VXUD 4TULH 5FFLA 1I9RL 3EDEA 4JG0L 2XRAH 4WUKL 5LBSL 5K9KB 4PY7A 4ZDHA 4QHMA 2JB6A 2VDQL 5MEQB 1QPXA 4F7TA 3CMOL 1CFVH 2W9DL 3I2CL 4HIJA 4YXLL 2HLFD 2X09A 3U0TB 2WBJB 4MMXC 1XF5A 2IPKB 3EFFB 1LHZA 4GFTB 4I48B 3ZO0A 3J7HA 4DFHA 2CK2A 1HXYA 1P4IL 5C0BB 4LEOB 3IDUA 5CEZH 4OFKA 2V6HA 2A2QT 3WIHL 5E8EB 1B3JA 3NCJL 3OJ2C 3SDDA 4YHKL 1Q94A 3JVGC 4PTTB 3MLWL 4PJIE 1RK0B 3FT3B 4QRPE 2XV6B 1F5WA 3EYFA 1DBAL 4Y4FC 2EDWA 3RY6A 3S98A 4ZO6A 4MJ6A 5ETUB 4EUPH 1QO3B 2AAVA 3IXAB 4V1DD 3ULUE 5I30H 4KDWA 5TDNB 1IKNA 5F7FA 4KTEH 3H9SD 4G6FD 4ZOAA 1XT5A 3TJEH 3WSQL 1ZXQA 1F58L 3VGFA 4R97B 2EYTB 2C9AA 3OB0K 5D6DC 1XCTB 3S37X 1ZHKB 3MRCA 4Z0BH 5CJBA 1LO2H 2EEBA 5DJ8B 5J11B 3VD4A 2PYEE 3MRBA 4KV5E 2DQHL 3PHQA 1MCLA 1BEYH 3X11A 1A7OL 4OLUL 1S5HA 3QI9D 5ALBH 3ZKXC 2IMNA 4LBEB 4MSWB 4OD3L 1J5OH 1CI5A 3G6JB 3DBXA 2CRZA 1IQWL 4YDKL 3L3JA 5D7SL 4ZUSB 3FO2A 1OCWH 3C2AL 2Y06L 3L7FB 5CBAA 1HCVA 3DLQR 1JZ7A 4NYLA 1I1AD 5C92A 2IADA 3S36X 4EQ3A 3IJSB 4I3RL 4NQEA 3QUZD 1U91B 5KAQG 1RJZA 3UTTE 3QJHA 3OWEA 2NY5H 1L7TH 4PJAA 4F7MA 1CLZL 4GRLC 3MV7A 2VDPL 1JN6A 5I1EH 3QRFM 4HK0A 3NPZB 4QNPF 2OM5A 2GITA 3MLSL 1WWCA 5B8CB 1OD9A 5B39G 1XF3B 3RJDA 3ABZA 1A7RL 4I13B 4XVSH 2XT1B 3PG2A 1ODAA 4ODSH 1G6RH 3L3GB 3QIUB 4HEME 4OZHB 4Q0XH 1LE5B 2R0LL 2YWYA 1FGNL 3VXTA 4EDXA 1BP3B 4WO4D 5J11C 1A3LL 2A6JB 3WLWC 1X5XA 4R6UA 3TZVA 4JFOB 3MGTB 1F2XK 5TDOB 3RRQA 3VGDA 1BF8A 4YR6A 4AMKH 1RPQA 2XI9A 4NM8L 4K3JH 4JJ5B 5GRWA 1QZ1A 4E0RA 1REIA 5AWNH 1VFBA 1XGRA 2R2HA 5FYLE 5I75B 2YD9A 1UCTA 5CEZD 5JXEC 1JL8A 5CEYA 1XF4A 2GTWA 3PQYA 4HJGB 4BK5A 3HA0A 1YEDA 5JORA 4NUGL 2ZSWB 4IHOB 1CVSC 4P4RB 1CXHA 3C6LC 3FHAA 4N5EC 1BM3L 2PCPA 3U30C 4DVRL 5EIIA 1KN4H 1JNJA 5T5NF 1K8DB 3BQUB 2IBBA 1RZGB 1FFPA 3IDXL 4JFED 4PGJA 3LHPH 4NM4L 1RUPH 1CE1L 5B8CC 5E5MB 4PD4K 5DJ6A 3LQAC 5CWSB 1XZ0B 5KZCD 1U6AL 3R06A 4LFHG 3VD3A 1RUAL 5I15H 2F54E 1NMBL 3W9DA 5DVNA 6FABL 2R4SH 4KVCH 4HSQA 2NY6D 2V5RA 3SKOA 1P7QD 3IKCB 4OLVH 2Q76B 1FCGA 3NMEA 1GGBL 3Q1SH 4WNQA 4G7YH 2C1PA 4OZGF 2NY4C 4RNRB 1LNUB 3ZSSA 3IYLW 1TPXC 1FVEB 4HFUH 4ZUTB 4YBLB 2ZUSA 4DN3L 3UTSA 1G9ML 4LPYA 1L7IL 1T21B 4QCIA 5KN5A 5CP7B 4MD4B 3UYOD 5I75C 4I3SL 4F7PA 3DRQA 3QDJD 5F9OH 3QQ4A 2E5EA 2DQEH 5F1IB 3IFNL 4X4XB 1LO5A 5GGSA 1IKFL 3DYOA 1MCKA 4ODXA 4J6RL 4ONHA 4PJGE 3P4OB 3MRKB 3RVXC 4L4VD 3TVMD 1SYVA 1H3XA 1R3LA 2EH8L 4XHJD 4Y16A 4QRUB 1CGSH 1EFXD 1NC2B 4MJ5B 2X4UA 1A22B 4M93B 5GGQL 2OZ4L 2YXFA 5F7WC 3SDCD 2AABL 2DL2A 1GZQA 2PETA 3D48R 3ARDB 1RJLB 4N0RA 5DJZA 5J6GB 2FX9L 4KQ4L 4NNXB 1YMMD 5D7KD 5D8JH 2FWOA 3UROR 4JLRB 3LKSA 1GGCL 1T04B 3ILPA 4ODVL 1A64A 2R56L 1AQKL 3ARBD 3VFSA 2EDQA 2VDKH 1BFVH 2VH5L 3FKUS 2EKSA 4U6XB 1UH4A 4XWGH 1I3RB 1KG0B 2X89D 3LEXA 4G6JH 1VCAA 4AIZA 4BQ9A 4ORGA 4D3CL 5JW5B 1Q1JL 1TLKA 3KYNA 1DBKH 3A6CL 5DMGC 3QDME 4LLMB 3H9YA 5LQBH 1HILB 2ORBL 1BREA 1HOCA 5GZOC 3SGKA 1GIGH 1JHKH 3U0PB 3QFJB 3QQ3A 5IJVB 4OM1H 4HXAL 4MCYA 3F7VA 4UIKL 5T1MB 4RAUA 5D1XD 1EVUA 4LHUB 5GGUA 3V95A 4YFEA 2VDRH 4WI4A 3HPLB 4LSRH 2KQMA 3FB8B 5FM8A 1CL7I 3BKJH 2VDOL 4FQCH 4M62L 1S5IL 1M7IA 5E8NA 3ARDC 1N59A 3NFNB 5F3BB 5BV7C 1J1PL 4Y5VB 1F97A 4PJHA 1KCVH 4XT1C 5DK0A 2HTLC 2NW3B 2DBLL 2J6EH 2VLKD 1FJ1A 2FD6L 1U8KA 4I4WB 3RWIB 4PRPB 1X7QA 3K8KA 3O2VH 1UM4L 4PJCF 1I8KB 1JHTB 4ODTL 5ERWA 4APQA 3SDAA 3MRMA 5E9DD 2CLRB 2D7TL 4L9DA 4PJ9D 1QRKA 3QHFL 5TQ2L 5T33H 1LO3H 1AR1D 3NIGF 2QHLA 2CR3A 1C5CL 4L8SC 4HWBH 1IQDB 4R4FH 2AK4D 3BN9C 3VFVA 2HWZL 1WBZB 3GKWH 1PGRB 1F8TH 1JNHB 1DUYB 2DQDH 1YPZF 4MAYA 2CIIB 4KI1A 5DDHB 5C9JA 4DKEH 2ZCLL 3GHEL 1GJIA 4QTHA 4CVZA 2ZPKL 4L8DA 4XP5H 4LNRB 4KMTH 4LQFH 4R8WH 4HW6A 1MVFA 5D9SB 3QIBA 1MCDA 3VFNB 1G84A 3D3VE 4RGNE 2WQRA 3K3QA 5CBEB 4HKZB 1DQLH 2QADB 5GSRA 1W0VA 1CD9B 3V0WH 5HGHB 1EO8H 5D2NE 4AT6B 1DQMH 3O0RL 3K4DA 3EW3B 1LP9E 3FRUA 2PYFB 3V6OC 3ET9F 1ES0B 4Y1AE 3GRWL 1E6OH 1V3KA 3BP5B 3DVGA 1T20B 3HRZB 2X4QB 2XKSA 4ZUVA 4FZ8L 3QULA 2HFGH 5IW6B 2QKIA 1S7RA 2PW1B 5JOEA 1OWWA 4OZIB 3D25A 1U8IB 3BGFC 2ZSVB 4G8GB 5KSUA 1QD0A 2F53D 4YDVA 1NAKH 2QQLH 4NQCB 5EWIH 2B20A 5IQ7L 3SCMB 3DECA 4JO1H 3EO9L 3R8BB 4ISVA 2W92A 3VFWB 1QBLL 5E2JA 4U1KB 3BUYB 3JVGA 4LMQI 2WUBH 4GJTB 4Y4FA 3O6KL 4H25B 4JPWL 5EORH 3CFKA 5GGTA 1HQ4A 4QTIL 1PG7L 4AG4H 1EDQA 4LU5H 2QJDA 4LLQA 1S7TB 1YJDC 1AXTL 1JGEB 2ITCA 3PP4L 3W9EB 2HLAA 1NC4B 3IRZA 4FZEH 4BSJA 4PJDF 1N3NA 1X9QA 3S96A 4MA8L 3RDTA 3OKNA 4HIEB 3ECBB 3EO1B 5D6DA 3ALPA 4HJJH 3CVIL 2QADC 2YS4A 1T0MB 1MCSA 1R3IL 3QHTC 5A16B 3OAUH 4R0LB 2XY1A 1FZMB 4O2CB 3WUZA 5K9KA 4ZAKB 2CKNA 4DZ8B 1QSEE 3ROLB 2WIMA 1DUZB 1NGQL 1WFOA 3U0TA 3M1BB 2IPKA 4I48A 2GT9A 5C0BA 4LEOA 3IJHA 4HV8A 2YC1B 3T77A 3WHXB 4MCZB 5E8EA 4LVNB 2JJTC 3ARSA 3RWCB 3SCMC 3UBXA 3VWJC 1ZVYA 4S11A 5DHVH 3K0WA 4PTTA 3OXRB 1TNMA 1RK0A 3L3DB 3FT3A 1NCDL 4RAVB 4LIQE 4GRLA 5F3HB 3TCXA 2EDJA 4K3HA 3BT2L 4TQEL 5ETUA 4L5FL 4OZFA 4KI5E 5GSVB 1OAUL 3QCVH 5TDNA 5EZIL 4AEIL 3S37L 4ZODA 5IBUB 2X4NA 1JFQH 2LU4A 1F4YH 5I1GL 3U0WH 2DYPD 5FK9B 3MLZL 4XPTL 1QUNA 2GY5A 1XCTA 4JRYB 2FEEL 3EYUL 4CVXB 2AJSL 3MQIA 5DJ8A 5KS9B 3C5ZC 3BMVA 5GS1B 5KSAD 3O2DL 2WSKA 4B50A 3SE8H 5HD8C 4ZAKC 1NAMH 4YDLC 2C4XA 3HAEB 2LV4A 1AKJB 5ITFB 2P8MA 4LBEA 4MSWA 3RUGB 2ICCA 3HLAB 2VXQL 5I8OH 3CU7A 3S36L 3G6JA 5D72H 2K9UA 5EBGA 2Z8RA 4BZYA 3DO7B 3MOQA 5T3XH 1Z5LA 2DLHA 5JMRA 5M95B 3L7FA 3T09A 4YGVB 5DJYB 4LVNC 3I6LD 2YBRB 3C6LA 1NCAL 3IJSA 3KDMB 3OKLA 4S1DC 2P43B 2IGFL 4CDHA 1XF1A 5AYUH 3UDWC 1G9EA 1BD2D 4P57B 3VFMA 1E27B 1TCRB 5B8CA 4PRBB 1XF3A 3CK0H 7CGTA 3KXFB 5ALCL 4LRNL 1RUQH 5A43C 2X41A 4G6KH 1UJTA 4PREB 4DKDC 2DLTA 3GEWB 3NN8A 5I74B 3DSFH 3LIZL 3FHQA 3OKEA 4UILL 1LE5A 5MEOB 4GO6B 4YNYB 2P5EB 3HCVB 4KPHH 3G9VA 1T0PB 1FNFA 2A6JA 4UOW0 3S6CA 4NQDB 2GJJA 4JFOA 1EHLH 1TZHB 4YPJA 1CDUA 5CZXC 3O4LB 3ZKND 4OM0H 5SWZA 5E2VH 2P5WA 4JJ5A 2YUXA 4NZTL 4ONGH 1UVQB 3GSXB 4G6MH 3IDIB 4HJGA 2XFXB 1CR9H 1GGUA 2JB5H 2ZSWA 4X7SH 2W0KA 1KENL 1QRNB 2GFBB 2VITB 1A6ZA 2MWCA 3W39B 3BGMB 3EDKA 1U36A 1K8DA 1K4CB 4G3YL 4NUJB 3NABL 2NX5B 4JPKH 1RZGA 5EC1B 3PWLA 2L7UA 4HDIB 1SJVA 5E5MA 5IBTL 2JIXD 5BS0B 4M7KL 5CWSA 1XZ0A 1F4XH 2ZNWA 3LD8B 1WZKA 1F3DJ 4OLYH 5FGBC 5I74C 2APFA 1HH9B 3RGHA 2VDNL 1CN4A 4JFDA 5ACZA 4P2RD 3IKCA 3PGDB 3NGBB 3LRSB 2XICA 4H8WC 4RNRA 1WF5A 4GAGL 4ZUUB 1VFMA 5EU6B 1FNGA 1I9RH 1FVEA 3GGWB 4ZUTA 3FMGL 1WC7B 1FN4B 4ZNEE 4WUKH 3VH8A 4DVBA 5LBSH 4WW2B 2VDQH 4QRPB 1T21A 4MD4A 1DQDH 4EOWL 3I2CH 3GMOB 4YXLH 5T3XD 1T2JA 3RNQB 5LGHL 4XPHL 3MLXH 1J1XL 1NGYA 4JRXB 1RFDL 1P4IH 1AI1L 4JFFD 1E6JL 4KC3B 3PWUB 4LGRB 1NGWB 3WIHH 3FQXA 4KQ3H 3E6FA 3SJVD 3NCJH 2FNBA 4ENED 4YHKH 1NMCB 4UOJA 3P4OA 3WO4B 1EHAA 3MLWH 5KANG 7FABH 4NCC2 1DBAH 1LE9B 4QRUA 1NC2A 3MUJA 3QDGD 4F8TA 2E6JA 4PRIE 4ZFGL 4JREB 3VXOB 3UO1L 2DKMA 3CMGA 3KNBB 3NIFF 4QRRB 3ARDA 1DVFB 1RJLA 4CU8A 4F57L 5L88L 2DI8A 3WSQH 2BOCB 2R9HC 1F58H 3NGBC 3EGSB 4NNXA 2EDFA 3MV9D 4Y19E 4KJPD 3GHBL 3ULVL 3EOAB 1YECL 1T04A 2I9LB 3A0OA 3NFSL 4U1GB 5HXMA 1M71B 1NCCL 3FL7A 2F74B 1RZFH 4NJAL 5HGDB 3BH8B 5D1QD 4WW2C 4Z77B 4U6XA 2P7TB 1WEJL 3BWAB 4OLUH 1I3RA 1C5BL 1KG0A 5ID0B 1RVFL 3U1SL 4Q9RL 5JW5A 4OD3H 4L8SA 3M07A 3NVQA 4K2UL 3D2UD 3RTQC 3ULUC 5EUOA 4LLMA 3U79A 2MQCA 2JELL 3QISA 1HILA 1IQWH 4YDKH 2ESVD 5D7SH 5E94B 2BVUA 3AS2A 2LQRA 3C2AH 2Y06H 4HUUA 5I8CB 4DAGH 4MB5A 3MRHA 4P9ML 1OAYL 3G5YA 4BKLA 1NMCC 3U0PA 3QFJA 4HWEL 5DRXB 2BNRE 4U6YB 1MCWM 1CDCA 3WO4C 3O3BB 3GB7B 5I73B 3DUUB 5HVFB 3VXRE 5T1MA 2VDPH 3DMMC 5JA8B 5J9PB 4MYWB 4LHUA 5E2UL 4M6AA 1MJ7H 2C3GA 3HPLA 3FB8A 2N7AA 5C09E 2ENYA 5C07D 1A7RH 3BW9B 2WK2A 3V4VL 4Y4HC 1DVFC 2VKWA 2VN4A 1QFOA 1IGJA 3KPNA 4Y5VA 4OZGE 3UZEA 1FLTX 1FGNH 4I4WA 4EN3D 4PRPA 3L6FB 4LDEB 4XNQB 1D7FA 4HX1B 4NQSB 1I8KA 5F1KC 1A3LH 1JHTA 1GH7A 1G7JA 5CINH 4TSAL 4ZD3L 2CLRA 2AXGA 3OG6B 5IR1B 1CXFA 3NZHL 4O2FB 4U3CA 4MNGE 1IQDA 4J12A 4HK3J 4H20L 4DGYH 1H3PL 4R2GB 1WBZA 1Q38A 1LD9B 4NZDA 1JNHA 4ZFOA 1DUYA 3LH2H 2CIIA 4NUGH 4M1GL 1CDHA 5DDHA 1JK8B 4NO0D 1BM3H 1HCFX 4DVRH 3TJHC 4LNRA 5L7XH 2FIKB 3BPLC 5BW7C 2B4CL 5D9SA 3VFNA 5CBEA 5C0AB 3LRGA 4JY4B 4RRPA 3V5HA 1R3JA 2L7JA 4AT6A 1RUAH 4RQQB 2OJZL 2VDLL 4N0YL 6FABH 5DS8B 3VRIB 1LDPL 1ES0A 3BP5A 4QXWA 1BPVA 4KTDL 5EBWB 2UVFA 1C7TA 1T20A 1RIVL 4PUBH 4TRPL 4DJMA 1OGAD 2X4QA 1MNUL 5IW6A 4XB7A 2QV2A 2PW1A 5FO9A 4Z7OF 5C0CD 4OZIA 1R5VB 1U8IA 1S8DB 2ZSVA 4G8GA 3AU1B 1D5XB 2IPUK 4DN3H 4NQCA 1F6LL 1ONQB 3LEYH 2JJTA 1MJUL 4MJID 2EE2A 3LN9A 3SCMA 4X0KB 1G9MH 3VWJA 4MNQB 3RZCC 5F97E 4ZO7A 3VFWA 1L7IH 1MCFA 2XZAL 1S7VB 4U1KA 5FYJE 3BUYA 3MROB 1SM3H 1A8JH 5E6YA 3V5KB 1LVEA 2ED7A 3FQUA 3IFNH 4CU6A 4RGOL 5FDWB 3QUYB 1S7TA 1JGEA 3LKQB 4I9WE 4OF0A 3DTXB 3RVVC 5F44A 5DA0B 4J6RH 2KDGA 1TTUA 4DEPB 5C08E 1WAAE 2P49B 2EH8H 4HIEA 2OR7A 3ECBA 5GS3A 1T0MA 3AVEA 5A16A 4LCWD 2A0LC 4S10A 4R0LA 4ZXBB 3C5ZA 3MCG1 3VWKD 1FZMA 4UIMB 2G2RB 4KUCD 2DQJH 4O2CA 5GGQH 3WIFB 2Q8BL 2WWMD 4ZAKA 2AABH 1QLEH 4HH8A 2EXYC 1J8KA 4PJCE 4KQ4H 3M1BA 5GGRY 1GYAA 1LGVA 1GGCH 3IU3B 1J8HE 2R56H 2YC1A 1AQKH 3ARGD 3WHXA 4MCZA 3NIGE 2YD5A 2VH5H 5F70A 3RWCA 5INDA 2XKUA 1SJEA 3L3DA 4RAVA 3UDWA 4EIZC 4WUUD 3RGVB 4D3CH 5F3HA 1Q1JH 1HINH 3QA3A 3MA9L 1UKQA 3A6CH 2VTFA 4QXGH 2ORBH 3MLTB 1AY1L 5GSVA 3LMJL 3QRGL 4S0SD 4HMCA 2B5IB 1N6VA 1C16B 3FQWA 4R90L 5FK9A 3VFUB 4DEPC 4BFGA 4XPGL 5ACLA 4DK3A 4JRYA 4YHOL 5DZOA 1CGYA 3C6SB 5DJAA 5KS9A 3X14B 5GS1A 2MFNA 2Y5EA 2UUDH 4U7KA 4M62H 4C55A 1S5IH 1KJMB 4D9QE 1AKJA 3OAYH 3D39D 5ITFA 4C57C 2Q6WB 4E41A 3MOBH 2DB8A 2X4OA 1YZZA 4G8IB 3RUGA 2AEWA 3HLAA 4YK4B 2DBLH 1A6AB 2AW2A 2FD6H 1UM5L 1DJSA 3DO7A 4EI5B 2FGWH 4YGVA 4HWUA 5DJYA 5MI0B 2YBRA 2D7TH 3HE7B 4LLDB 3KDMA 5GGSY 4UU9B 2KBGA 3KLHD 2NY3D 2O5ZL 5F1NB 5TQ2H 4J3VA 3RGVC 2OP4L 3D3VB 4RGNB 1C5CH 5ITBL 5GGTL 4GAJL 4XMPH 5D2NB 2AXFB 3F65A 3VXME 1D5BB 4B53A 3X12B 3KXFA 4Y1AB 3GHEH 2B5IC 4PREA 4PJDE 4NHUB 3KPRB 3QZWB 1NCNA 5FGBA 4MZ2A 35C8L 3IFPB 3ZTJH 4KAQL 5JXAH 5MEOA 5GGVY 5GPRA 1I8LC 3HCVA 4PGZA 3D18B 5E2TL 3R8QA 1OARH 5E6IB 2D4DA 5IJKC 3VGAC 4NQDA 4KRPC 5ICYB 4Y5XB 3IVKB 1TZHA 3ARFB 2YD4A 3O0RH 1ACZA 1SMOA 2RB8A 3IXTA 4LPCA 4OQTA 4I2XB 4YK4C 2OQJB 2IJ0C 3IDIA 5HYJE 4AEHL 4EI5C 2XFXA 2WIIA 2CLVB 3QNYB 3K7UA 5MI0C 3TEUA 3LDBB 4I0PD 1QRNA 2BY3A 2GFBA 4QT5B 3U9UB 3X3GL 3OX8A 3BGMA 3W39A 5IQ7H 4Z7VA 3VI3F 4KKNA 1K4CA 1SQ2N 3MRRB 4RGNC 1MAKA 2NX5A 1NBZA 1QBLH 4HDIA 2D3VA 3OL2A 5AG9A 5D2NC 5EU5B 1N0XH 1U3ZA 1NFIB 4ESKA 4QTIH 1PG7H 4EVNB 1QSEB 1OLLA 3WUWA 2XG5A 2H3NA 1HH9A 3PP4H 4UUJA 5C0DA 4F7CB 5D2LF 3KYOB 4JZOB 5C0EB 3QQ9C 5DC0A 4R4ND 3PGDA 3TO4D 4JM2D 3JTTB 1G7QB 3LRSA 4MA8H 2ZUXA 2FJHB 3W0WB 1I1YB 4ZUUA 2FLBT 3C8KB 4GKSB 1R3IH 5EU6A 2VZSA 3T0BA 2A38A 1WTGT 4TUJB 3GGWA 1WC7A 1FN4A 3MV8D 3GUTB 2P8LB 4WW2A 2B0SL 2ILLA 3U7WL 4PJIA 3CSYB 4QRPA 1GAFL 1QFWM 4J1UB 1E4KA 2GJZB 3BIBX 4PTUB 3GMOA 5CUSL 3P0YL 2H2SD 2A6DA 4LLWB 3OR7A 4PJEB 3RTQA 3EFDL 3LDBC 2NZ9C 3QUXC 5K33A 1NGWA 1D6VL 4OGAC 3OF6A 1G1YA 4BH8B 4CJ1A 5DRNB 4MB3A 1MSPA 2YHGA 2ZUVA 1BFTA 2BXYA 4YHZH 1NCDH 2A77L 4RMSA 2GJ6E 3DMMA 2AJZB 3NCEB 3QNZA 3LQAL 3BD3A 1LE9A 3P0VH 3W2DL 3BT2H 4TQEH 4HT1L 3EJYD 1KGCE 5HHOB 3C60B 4QEGA 1MHCA 2UV3A 5EZIH 3VXOA 3S37H 4QRRA 1DVFA 1XGUB 2D31B 2GI7A 5DJXB 3U82B 5I1GH 2BOCA 2F8XC 4IBLT 5IB1B 3VDAA 5DJDB 1OTSC 2I9LA 3EYUH 1M71A 2O93L 2F74A 3VRLF 2BSED 4M5YL 4ZS6D 5HGDA 2IQ9L 1T6WA 3BH8A 4ZOEA 5JR1L 3RWHB 3UTTA 4Z77A 1T03L 1A1MB 3ARTA 1PEZA 2P7TA 4KKLC 5ID0A 1RHHB 2HKFL 3D5OF 4AZ8A 2VL5B 3E3QE 1BQHA 2VXQH 3S36H 3QG6B 5CJQL 1AO7E 1Y6NR 1SY6A 3HN3A 5E94A 1WFNA 4L8CB 1SYSB 5I8CA 4HPOH 4OF5A 1NCAH 5DRXA 3QEQB 4U6YA 4KFZC 2Z4QB 3O3BA 3DUUA 2IAMD 5BW7A 1B88A 5LWYL 5J9PA 1IC4H 5I1DB 1Q72L 3C60C 3FB5B 4WFEE 2EEDA 4FFWC 1DL7L 4LRNH 5CIPB 3KJ6L 1QVOA 1NGPL 3SDXE 4MQXC 2XZCH 3LIZH 1F3RB 1WWAX 4P5TD 1I1FB 3BO8A 4K7FA 1P9MC 3L6FA 4XNQA 4GT7A 4NQSA 3T0DA 4N68A 4BFBD 2YN3A 3HNVL 2WINB 3HTLX 3KLDA 2XN9D 1TZGL 1RIHL 2FLRT 2Y07L 3IETB 5IR1A 1FAKT 2ADGA 4O2FA 4NZTH 4GMTL 4Y2OA 4NKDB 1LD9A 5B3NA 5SWQB 2F54A 1T2QH 2XXMB 1YY8B 2YPLE 3AREB 1KENH 1CK0L 1UWGH 3STLB 4HUKB 3MYJB 1VA9A 1JK8A 5H37H 3H8NA 2FIKA 1OAZL 3L5XL 3EYVB 3NABH 1RSFA 1T1WB 1UGNA 3MRFB 1F3JA 5C0IB 4WHYG 4EJ1C 4M8QA 3BKCL 5IBTH 4M7KH 3D9AH 3AB0B 3NIFE 3CVHH 4Z7UF 2PR4L 3FT2A 4MAUH 5DS8A 2D03H 3VRIA 1QSFE 4FOMA 5BV7L 1F11B 2EH7L 5EBWA 5HGAB 4PG9B 2ENSA 3U46B 2Z31D 4Z0XB 4WY7L 4EDWL 5KVFH 1X5HA 3ILQC 4U1LB 1OGTB 1S8DA 2X9XA 1D5XA 3AU1A 4GRMB 3FMGH 1ONQA 4Q9QL 4PJGA 3V5DB 5E00B 4X0KA 4ZFZA 2FL5B 3PP3K 4HF5L 1WWBX 4EOWH 3LN5B 3V5KA 5LGHH 4XPHH 4PRIB 1G7LB 1J1XH 1DTUA 3PWPD 1RFDH 5HPMB 1E6JH 5F7HA 1PDKA 5FDWA 1J0ZA 4MDJB 1NJ9B 4JN2B 4UBDC 3DTXA 4CVWA 1R0AL 3FO1B 4NN6B 5D71L 2V2XB 5C0NC 3MRDA 3AB0C 3TWCH 1MPAH 3DHMA 4UIMA 4I0KA 2OR8A 1S78C 3UTOA 3ZDYF 1V05A 3B2VH 2RJMA 4F57H 3ESUF 5L88H 2XTJD 4F2MB 3QDMA 1L0YA 3IF1B 3BFOA 3GHBH 3ULVH 2FEEI 3IU3A 4IMLB 3HI6H 1T89C 2QHRL 4NJAH 4MXVF 3ES6B 3VCLA 4C83B 3C8DA 4HWZB 3GIVB 4BK4A 1UKTA 5GJTH 2A1WH 1WEJH 5D7LD 5J12B 5JW4N 2AGJL 2L0DA 2AQ2A 1QFUL 1S7UB 3U1SH 3RVUC 1RU9L 5IFAL 3RGVA 4POYA 4ZFOL 5IV2B 4K2UH 2JELH 2D7PA 2ADJB 3P3YA 3SDDD 4HKXB 1RV6X 5CP3A 3HUJF 1NBYA 1YJDL 4JY5H 4JPIB 1C16A 4HWEH 1HQRA 4OZGB 4GH7B 3VFUA 3LKOB 3OZ9L 4FP8L 1N6QL 3D85B 1CXKA 1S7WB 4NN6C 2LVEA 4U6TA 3MLPA 1MLBA 1I8LA 4QRQA 3BN3B 3C6SA 2V17H 5E2UH 3QBTB 1QFWL 3X14A 4PBXA 5IJKA 3UMTA 2Q87A 4DFIA 2IWGA 3V6FB 4LPWA 3LN4A 2Q6WA 4G8IA 5AD0B 3GK8H 1A6AA 5F7DB 1DN0B 4Q97A 2NYYD 3U2SB 1M1SA 3I75B 2YR3A 4EI5A 3LEVL 4LHUG 3ZDZE 4HBQA 3DWTA 4TSAH 3T4AB 5I1JL 4ZD3H 2UZYB 2MSPA 5DJ2B 5F1NA 5DD3L 4E5XA 3NZHH 3D3VA 1R6VA 1MI5E 4H20H 5D2NA 2AXFA 1A5FH 5MENE 1LP9A 3X12A 2QQQA 2R69L 4Y1AA 3MGAA 2X5PA 3MV7D 2F15A 2FYYA 3TT3H 3KPRA 3QZWA 1G0YR 4K3EL 1BVKB 5JTWA 3SQOH 3CFDB 2B4CH 4PP2A 1CCZA 1WFTA 4XBEL 3D18A 1U95B 5FXCH 1PSKL 5E4EB 5E6IA 5ICYA 3IVKA 4O00A 2DRUA 5C0FA 2OJZH 2VDLH 4N0YH 4WENB 5SV4A 1ORQB 4LCYB 1Y0LB 3O3AB 3ZT6A 5GGVH 1LDPH 1PJ9A 4N1EA 5JW4M 4KTDH 3ULVD 1Y6KR 4QHNB 1RIVH 1BWWA 1MNUH 3W5NA 1MELA 4U1NB 4HKBB 2AQ3A 1LQSR 2WANA 4P23D 4AK1A 1T22B 2VE6B 5JW3H 2CLVA 1PY4A 2AQ1A 1YQ2A 3QNYA 4QT5A 4H1LB 3NCBB 4FXLA 4XBGB 1HYSC 3QUXA 2BVPB 1K3IA 4GQ9H 5DQJB 3DARA 1G9NH 1U3YA 1MJUH 4HAGA 1AXIB 3PQYD 5C08B 3MRRA 3ARRA 3MJGX 4PIRF 2XZAH 4BELD 4JO4L 4RFOL 5I6XB 3L1OL 1KIQB 4JFPA 1NFIA 4X4MA 4RGOH 3CFIC 3KPOB 1XGPB 4EVNA 1QSEA 2XYCA 1T1YB 5JZ7D 3RAJL 4F7CA 3KYOA 4PJCB 5C0EA 1ZLUH 2APTA 3UTPD 3JTTA 1G7QA 3HRPA 2FJHA 3W0WA 1I1YA 1G7PB 3C8KA 4GKSA 2DS4A 2IC2A 4K55A 5CGMA 1KIRB 4R7DB 4TUJA 2O5XL 5EZJA 2P8LA 2Q8BH 1D9KC 1EAPB 2PO6B 4U2YA 3QWRD 1YPZB 1VPOL 4PJ7F 2GJZA 4ACPA 4PTUA 1A9BB 4O58L 4LLVB 3DNKA 3QQNA 1DSFL 3EJZC 1S7XB 4HH9B 4WI8A 4X98A 4M9PA 3INUL 3GSQA 2CGRL 2OL3B 4BH8A 5MERB 2BDNL 3BEWB 3BP7B 5DRNA 1G1CA 4JZJB 4OBSA 3RKDD 3SN6N 5I6XC 4XNZB 1BJ1J 1SBSL 2AJZA 2Y4SA 4ZS7L 4RBPH 4HUXA 1WK0A 1RZ7L 1FCCA 2BMKB 4X6CB 2Y25A 5HHOA 3C60A 1AY1H 3T4YB 3UPCA 4DQOH 3LMJH 5IBLD 4M1DL 1UT9A 5HYEA 1KXQE 2W65B 1ADQH 3KLSA 2EZ0C 4Q2ZB 3LB6D 4R90H 4Q74A 1XGUA 5DJXA 2YD7A 5EPMB 4XPGH 5IK3B 5DJDA 4H8WL 1QOKA 2L4OA 4YHOH 5C2BL 1P9MA 3KPSE 3BUTA 4NWTL 3RWHA 3WDIA 3MZGB 3I6GB 1D5ZB 4OQTL 1OB1B 3O9WB 4X7EC 1RHHA 5IBUG 3REVB 1H3VA 3A6BL 3CDFA 3SKNB 1WZ1L 4LLYB 5EG6C 3G5VB 3QG6A 3RKPA 1EGJA 2J4WL 2Z35B 3G04B 4XVJL 4YFLI 5J06A 4L8CA 5DO2D 4W4NA 3O8XB 1SYSA 1I9JH 1BF2A 4NKOB 1CLYL 3VA2C 2H26A 4N5UA 5GZND 1MJJB 2BK8A 4JZJC 1ZT1A 2YMXL 4HUWA 2O5ZH 2Z4QA 1Q9OB 5F7YC 4POZD 1EEYB 3HAEG 4JANA 1K85A 2OP4H 2BFVL 1MCCA 5FGCE 2Z8SA 5TF1L 5ITBH 3SO3B 3QH3B 5GGTH 5IFHH 5I1DA 3WFHB 1HHHA 3H3KA 1JIBA 2VLJE 5F7NC 1JGUH 3WBDA 1E4XH 4RFNB 5DVLA 5D2LE 3HZKB 5FHBL 4OLXH 3EYQD 2NCMA 4PFEA 3DURA 1I1FA 1IC7L 1YEHL 4OLWH 2ZG1A 3M17B 3GZKA 2R29L 5F7EL 4DUXA 5HDQL 4A6YH 4K9EC 3AAZB 1HWHB 4OQ1A 5E2TH 1FNSL 3KHOA 1DLFL 1UB5B 2WINA 3GSUB 4JO3L 4KKCD 1RAMA 1A1NB 1TJGL 5FCUL 4C56E 4NO3B 4OZHF 3CX5J 1UA6L 2W91A 4FRWA 4B7IA 3D0VB 3JWNC 4KK5C 4APQD 1FPTH 3ULUL 3SDAD 1AD0B 3IU4H 1FZOB 4YBQC 4NKDA 2GHWB 5SWQA 3BYYA 4AEHH 2HVKB 3WEXB 1YY8A 3STLA 4KZDL 1H8NA 1CGWA 4GUPB 1VEPA 2BSSB 3MFGB 3EYVA 4G43B 1T1WA 3MRFA 3SO3C 4LKXB 5C0IA 5TQ0L 4OZFH 1ZHNB 3V4UL 3MBXL 4ZNEA 3HMXA 4RFNC 2BVTA 4QHUB 4N90E 1MEXL 3QIBD 3DJ9A 5HGAA 2ZG3A 5KJRL 4PG9A 1EH9A 4Z0XA 3VRLE 5I1KL 4OCYL 2D0GA 4BZ1L 1IEAB 5IG7A 3VMPA 1G0DA 25C8H 5DUPL 2ERJB 3LKNB 4U1LA 1OGTA 4Z7QF 3I9GL 4D0DA 5F88A 4GRMA 1T89A 3SPVB 3TNNB 3V5DA 2B0SH 2QLVB 4UNUA 5E00A 3U7WH 3Q2CA 2FL5A 2XG4A 1GAFH 3V0VA 2GJ6B 1KCSH 5CUSH 3P0YH 1SY6L 4X80L 1B6DA 3GMPA 4PRIA 1JNNL 1G7LA 3I3DA 3L7EB 5IMKB 5D7IF 3UTQA 1D6VH 4YIQB 4K8RC 4MDJA 1NJ9A 4JN2A 4Y4FD 3DI2B 3FO1A 1T7VA 4NO2B 2X4TA 5DEFB 3JV4B 5ANMB 4LDOB 2A77H 1LEIB 4X4ZA 1W2KT 4NQEE 4X4YB 3GKZA 1QR4A 3W2DH 1B4RA 4HT1H 1CFNB 3BRDA 2LU3A 5FYLL 4OCWL 3BH9A 5DZLA 4LK4A 4Y4KB 2YZ1A 4FQXC 1T3FA 1QNZL 2VMFA 2PW2B 1BZQK 1B0GB 1XH3B 2ZUQB 3ARQA 5FO8B 1VEOA 3EHBC 3WS6C 5EA0H 2G5BA 4M5YH 3MR9B 2IQ9H 4JR9H 5JR1H 1PLGL 4HWZA 1KN2L 5J0BA 1CT8B 1R3HA 3VXRA 4KJQC 5IWLC 1S7UA 4PR5B 4P9HL 1KCUH 1LEKA 4NNPL 5MEPB 3KHQA 3F6IA 5C09A 3WN5C 4FFVC 5IHUL 5EB9A 4HKXA 3CUPB 5E4IA 3HI1A 4XH2B 4PRHD 4GRLD 1FORL 2MNUA 2JKXA 2OJEB 4OZGA 1FG2B 3LKOA 3SE4A 1VERA 3H9HB 4OI9A 1BQLL 5LWYH 2RQ8A 4XCFH 1BQHG 1Q72H 1IC5L 1S9YB 3RP1A 4JPVL 1DL7H 4Y4KC 3V6FA 4O4YH 1GRWA 3E3QC 4MNGA 5EOQL 4FQ2L 1IGCH 5AD0A 3WLWD 5F7DA 1DN0A 1YY9C 1Z9LA 3I75A 1J11A 4P5MB 4DZBB 4OFYD 4GBXD 1UZ8B 3HB3D 5A40E 1UJ3B 3HNVH 1I8MA 1BGXL 1MRFL 2AK1H 5D1ZB 1GSMA 1RIHH 1JZ6A 3M8OH 4EXKA 2E7MA 5JXED 4UINH 1NFDF 3SEPA 4JKWA 4GMTH 2XIDA 4Z5RB 3C6LD 2Q7NA 4P59H 4N5ED 5HHPA 4DN4H 5K93A 2DWEB 2CXGA 2IF7A 1QSFB 1PX3A 4NJ9L 1CK0H 2D9CA 3UBXI 2XQBL 1Q8MA 1BVKA 3CFDA 1U8LA 2W0FB 3RPKA 3KYAA 4JHAL 4XPAL 2RBLA 1ZANL 1A6TB 1U95A 5IMOB 4W6XB 5HHMD 2VO5A 4YXKH 4BZ2L 3ZDYE 5D70L 1WZLA 2JCCB 5HYQB 5IQ9A 5ID1B 1ORQA 2PR4H 4LCYA 1Y0LA 3H9ZA 4XRCA 2R23A 4P46B 4H88L 1MHPL 5BV7H 2EH7H 4JM2F 1M6OA 2DQIL 4JFHE 1T66C 2NY4D 5DQDL 2GUOB 4U1NA 4HKBA 3UPRB 1T22A 3BSZL 4MXVE 2VE6A 4ZO8A 5SWZD 4H1LA 2P5WD 4XBGA 2BVPA 5D1ZC 5DQJA 2BOBB 4Q9QH 4WI6A 4PJ5B 5C08A 1HHIB 1KTRL 4HPYL 4HF5H 3HE6B 3MLUL 4CN4A 2DLEA 1KIQA 3HUJE 1CICB 4ORZC 3TFKC 4FTVE 2NMSA 1TJIL 4MQSB 1A02N 1BD2E 1R5WB 1NBVL 3RVXD 1JF1B 3CDGA 4W81A 1T1YA 4D2NA 1ZLWH 3DHJA 2DQFB 3H3BC 4PJCA 3CZFA 5HYIA 1HKLH 1AIFA 3C2SA 1R0AH 2HFTA 4OCMC 3P4MA 3UZQA 2D0HA 4BUGA 5HHXL 3MUGB 1J8HA 3QR2A 4KKBC 5DK3A 1G7PA 2E9WA 3H3PL 43CAB 4NSKB 1UWEL 3I3BA 4R7DA 4JFDD 2EECA 4H0IA 1FV1B 4P4KB 4LASL 4F9PA 2BZDA 1KJ2B 2CDFB 4P46C 3C5JA 1EAPA 2GSGA 3DX7B 3CNKA 4WI7A 4XX1E 3V6ZA 1YPZA 1I1RA 4YHNB 1ACYL 1A9BA 1I9IL 1MLCB 4RWHA 1UEYA 1OD7A 2X2YA 3MA7B 4HH9A 1S7XA 4YPGB 4M03A 2FRGP 2OL3A 4WDIB 4JFYB 4Y2DD 5MERA 2EYSB 3FOMB 4LSQL 3BEWA 3BP7A 4UTBL 2WLZA 1JZ4A 4JZJA 1AC0A 2W07A 2XWJB 3AROA 4PP1C 3O45B 1T2XA 1L0XA 2AGJH 4JDVB 1QFUH 2VKXA 2BSTB 3TV3H 3CX5K 5GRXG 1F02I 1CICC 1D5IL 5GZOD 3CFJB 1PZ5B 4Z7WB 4L4TB 3T4YA 3E1F1 3VXUB 1YJDH 3BDXA 1G7HB 2W65A 1FYTE 2X1XR 2X70B 4Q2ZA 5JIKA 2AS5M 5L9DH 1T7XA 1NC2D 5IFJB 3OZ9H 3I84A 1L0QA 4JO2L 5EPMA 1N6QH 1ND0B 4M43H 4FFYL 4YE4L 4M6OL 3THMH 3B9VA 5HDLA 2MHAA 4GXVL 2E3VA 4HGWB 4P4KC 2W0PA 3ARDD 3PJSB 1KCLA 2VJXA 4CKVX 4F15B 1ZOXA 4KY1L 2IANE 3UC0L 4JY6A 4JKMA 5MHSD 1OB1A 2HTLD 4NCC1 4X9FA 1RZKC 1ZVSB 2O26U 3REVA 1B0RB 3SKNA 3ARWA 3GNMH 3WD5L 4XNUH 2HTKC 1PZUB 1YNLL 5MENB 3VJ6B 3VXMA 3R4DA 4Q58C 5IVZA 1IGFH 3G04A 2Z35A 4PJDA 2ZKHH 3JV5A 3IJYB 5E2WL 2Q8AL 1J86A 3TA3C 5I1JH 1DQQA 1NBQA 1D6EB 1WCQA 4V1DB 4F37K 1URLA 1Q9OA 3BN9D 1ZVHA 1EEYA 1BQSA 5DD3H 2Z92B 5E8PB 2LABA 1MREL 1P4BL 4NHCH 3OAZH 3QH3A 4LQ1A 4LLUB 4A2MA 3ORJA 3WFHA 3QFJD 1A3RL 1JVKA 4XCEB 2R69H 4ZFFB 5I71B 4GKZB 4F80A 1YEJH 4LHUD 3S8WA 4BQ6A 4K3EH 4U6VL 1ERNA 3OPZH 1OP5H 3QI9B 3C08L 3AAZA 4XBEH 5LG1A 2J8UF 4XNMB 1PSKH 3BRFA 1W8OA 2Q86A 3HZYB 1UB5A 3GSUA 1A1NA 5LJYH 3FQTB 4NO3A 4PJ7E 4JRWA 4LIQL 5DJ0A 4PRPD 3ZHKA 1CLOL 3RL2B 5ILTL 5BRZE 1I1AB 1N6UA 3T8XA 1BX2B 3QZWG 1PW3A 3D0VA 2XOTA 3QUZB 4HC1A 2PNDA 4WGWB 1GL4B 5BO1L 2HVKA 3WEXA 5LAXB 5KG9B 3MOAL 5EU3B 3T0AA 4GUPA 5BZWA 2W1NA 1TQCB 2BY1A 3SDYL 3QPXL 2BSSA 5C0BE 1J0HA 2IEPA 3B9KC 5HHNB 4JO4H 4RFOH 5J8OA 1ZHNA 4RMQA 2AJXH 1BVZA 3V9FA 3Q6GL 3EOBB 1QP1A 5I71C 2ZOLB 1JZ5A 1KEML 3DETC 4M3JA 5CHNB 4QXTA 1JI2A 4NGHH 2QADD 3MFFA 3WXWL 2QR0B 5ESQA 1I7UB 4IRJB 1IEAA 2JJVA 1AGEB 1CE6B 2AERT 2J7LA 4YX2L 1H0DA 2DDQH 4Z8FH 3HZMB 3OR6B 3O2WL 5FUOL 2O5XH 3SPVA 5I1IL 5AZEH 1BQUA 2UUDK 3OTTA 1OAXL 3T1FB 4TUOA 2GJ6A 5GISL 5JW4R 5KVEL 4Y89A 4MMZC 3UEZA 5L8LB 1EGJL 4O58H 4ODHL 4RDQG 3SCMD 4JFEB 1QA9B 4EUPB 3VWJD 5IMKA 5TGBB 3INUH 3KJ4C 4YIQA 1MCIA 2FATH 2BVEA 4JM4L 2C7UB 1MFNA 2CJUL 2QSTA 2BVQB 5CJ5A 2ZOKB 4BUHA 4NO2A 5DEFA 5EC2B 3JV4A 1P7QB 3LV3B 4PLKC 4QOKE 1LEIA 1UACL 2C3HA 4X4YA 4UTAL 1KTLB 5JOPD 1RZ7H 5IESL 2LAGB 5FYKE 2B39A 5T1DH 3L95B 4M1DH 4IIQC 4Y4KA 4QLRA 2PW2A 1AO7A 4IRJC 1B0GA 3C5ZD 1K8IB 3N0PB 4H8WH 5ISZD 5C2BH 2E9IA 5HD8D 5FO8A 4ZAKD 4OZHE 15C8L 4EZMA 2BC4B 3MR9A 3Q0HA 3P73B 4NWTH 5T1LD 3PL6B 4D94A 1CT8A 1YNKL 4OQTH 2NXZC 3E6HB 4PR5A 4WFFE 5J57B 3A6BH 1WZ1H 4RFEB 4XCYB 1K3ZA 2W60B 4L4VB 3TVMB 3GMRB 4WJ5B 2J4WH 4XVJH 5D2LB 5JPMB 4S1DD 3BPOB 1NCUA 2MOVA 1EFXB 4RZCB 5IM7B 4J4PC 2OJEA 2YMXH 3MJ8A 3O3UN 1G6RB 1FG2A 1DLHA 4BJLA 1G7IA 3JWOC 4X99A 3B9DA 3B5TA 5TF1H 3RVWC 1SEQH 3HMXL 3U83A 2Z8VC 3NTCL 4JDTL 3MXWH 1RIUL 1S9YA 4C56B 1MVUA 2LVCA 4LVHB 3LQZA 1IBGH 4JRYD 2NY1B 2EDXA 4K94C 3RZWA 4UV7L 2ZJSH 1U58B 2R29H 5HDQH 3TIDB 1ED3B 2YPLA 2NXYB 4DZBA 2D0FA 1E4JA 5DHYA 1JPSL 5B3JF 1UZ8A 1FNSH 1UJ3A 2X4PB 3EYSH 3JSSA 4E41D 1TJGH 1K6QH 3PL6C 2ZUUA 5D1ZA 3IDYC 5I8EB 1UA6H 1YC8A 5C2UB 2HJLB 3ULUH 2Q20A 4WEBH 5I1CL 1BFOB 2D7MA 5D7IE 2DWEA 5D1XB 5JHLL 5D96C 4EI6B 1QSFA 1V7NL 3EBAA 3I50L 2PF6A 5CILL 3SY0B 1ZA3B 1IZJA 4KZDH 1J0KA 4MHHG 1ZHBB 4MS8C 5F6HJ 3F7PC 3FB6B 3O6LH 1RZJC 4X5XB 4XP4L 4LCUB 2W0FA 3HG1E 4M7JL 3ZYOA 1UEMA 2FX8L 1T4KB 1OTTC 1NCWH 3MCKB 2NY0B 3IDMB 3MBXH 3V4UH 4MJ2A 1GOHA 2NY7L 5HYQA 4ZTOH 4ODBD 2VSDA 1FO0B 4TNWF 2NY1C 4P46A 2A73B 5F72S 5KJRH 4YHML 3EDF