1GGIL

Crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
215
structure length
215
Chain Sequence
DIVLTQSPGSLAVSLGQRATISCRASESVDDDGNSFLHWYQQKPGQPPKLLIYRSSNLISGIPDRFSGSGSRTDFTLTINPVEADDVATYYCQQSNEDPLTFGAGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG2A 50.1 FAB (LIGHT CHAIN)
publication title Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, 50.1, in complex with its V3 loop peptide antigen.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immunoglobulin
total genus 47
structure length 215
sequence length 215
chains with identical sequence M
ec nomenclature
pdb deposition date 1993-04-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1ggiL01
3A67H 2DMBA 4M7ZC 4XPGH 1CLZL 2O5ZL 3GSQA 2X4TA 5D71L 3KLDA 3M1BB 5EN2B 3RNQB 1LD9A 1NFDF 4L8CB 2CIKA 3RWCB 1KB9K 4ZNCD 5A16B 3LV3A 3QUYB 5I16A 4J2XA 2BVYA 2EE2A 4RWYL 5D7IE 4OI7A 4KJQC 5IFHH 5C0ND 5E95B 4JHAL 2LU4A 4F37K 2DIAA 5E8OB 5TH2B 2OL3H 5CD3B 4LCYA 2OM5A 4POZD 1NLBH 5HGDA 2FX7L 3MODH 2V5MA 1K6QH 4YDLB 3K8KA 2BVOA 4EI5D 4MLSA 3H7LA 5IHBA 3GMLA 3P9MA 4M1CD 2PW1B 4WFFE 2BRRL 4HWBL 2JIXD 3TNNA 4Y2OA 2D0GA 1KTLB 1I3UA 2EYRA 4ODWB 1OGTA 4N8CL 4PJAF 3LD8B 3MV01 5E94A 3D3VD 4YGAB 1HI6B 1S78D 2X7LB 5E0QA 2BY2A 4JFXA 2V5SA 3TZVB 3I2CH 5C6PB 5FUZL 3W2DH 3HE7B 5ID0A 4RNRB 1UB5B 5EOCJ 1LO2H 5KSUB 4PJHE 1DBBL 4Y16A 1H3VA 1QUNA 2DLFL 3OGCB 2V5TA 1RZJL 1R3JB 3ARGC 3T04D 2D3VA 3UPRA 3EOBA 3GUTB 1BFSA 3DETC 3BAEH 1I8IB 5I66B 3OSKA 3RIFF 2BVQA 2DQEL 4PJ8D 1L0YA 4LSSH 2NXZB 1OTTC 3OKEA 1F4WL 3GMRA 2WM0A 2X4UB 4LPTA 2E5EA 2N7AA 2W91A 5DRNA 5BRZD 3ULVF 3T0EB 2K7QA 2WBWB 1EAPA 3QXVA 1ITBB 4OD3H 1HH9A 2G75B 5C0CD 3GSOB 2R4RL 3IDXH 4YQXH 5EO0A 4L8BB 3MV7B 4RQQB 5TPWH 3T2QA 2BY1A 1QFWI 4N8VG 5JLZB 1V3LA 3KPNB 1FNSL 2W9DH 3WFBH 5FO8B 3THML 3O11B 3BZFB 5HVWA 4WEBH 4IBLT 4LFHG 3STLA 3MMEB 4IDLA 1RZ8A 1U2CA 3B4NA 4HK3N 3MXWH 1CGUA 3H2WA 1NC4A 5D72L 4ZSOA 3MLZL 4WWKB 4N0FA 1J8HB 3GSRB 1BBDH 3NACH 1J86A 1KBGH 3GBMH 5HPOA 1KJVA 1UT9A 4QRQA 4I13B 4GG6E 2O5XH 7FABL 3D39E 2AS5M 2DLIA 1FLRL 4JFED 1LEGB 3CLFL 3GM8A 4NJ9L 4GKZA 5GZOC 5CLTA 1C7SA 2HVKB 3P30L 3DRQA 1NAML 4ETQA 4F7CA 1A47A 3MRHA 1RUKH 4Y2DD 1OAYL 2N7BA 1FIGH 5I75B 4QRRD 3BPCB 4N0CD 4K7PY 2RFXB 3AC0A 1XF5B 5T5NF 4ZO9A 5DJDA 3LSOA 5IBUB 1TJGL 1JHTB 4O2EA 5HYEA 3MTRA 1U3HD 4KPHH 1KYOK 1E27B 3OJ2C 4OFYA 4HKJB 4L9LC 2XG5A 1K4CA 1REIA 4APQA 5DRWB 2A83B 4Y1AA 1HWHB 2X9YA 3FCTB 4O02H 5EUOF 3T1FA 3ZDYE 3VWJC 5EO1B 1OWRM 2CQVA 3QPXL 1KELH 4LVHC 1UZ8B 3PL6B 2FBJH 4PG2C 1GPOH 4MJIB 2VDOH 2C7UA 2O5YL 1D5XB 4IMLA 3MRMA 2D4FA 5EDXA 5E4EC 2X89A 4BA8A 4GRWE 1JGLH 4LOUD 3AS2A 4QXGH 4G8IA 5HHOD 2XZAL 4BFIA 3RL1A 5E99H 4JKKA 1AE6L 4P2RA 3QIWB 4MXQD 4RGMC 1MCHA 3CFDA 4P59L 2EDTA 1QVOA 1KT2B 1XGTB 4XP1H 4ZUVB 3DTXA 2HAZA 5HVFB 1ADQA 4E41B 1TCRB 4Y5VB 5I1EL 3I02B 3BIBX 4MJ5B 2Z8WC 4FQQA 5DMYA 1AXTL 4HSQA 1WEJH 1HILB 1M05A 3FQTA 4HGWB 5HDBF 2ZCLH 3JVGC 1ZWIA 1CQKA 5F7HA 1RUQH 15C8L 4DOHE 4R0LC 4P57B 4G6KL 3VG9C 5F96H 3NGBC 2GFBB 3OL2A 3RVVD 4ZAKA 4HS3B 4XP4L 1MJJB 1DLFL 1G7MA 1NGPL 1ZT1A 3PWPD 4N9GB 5DFVC 3C6LA 2NZ9D 1B6UA 5MERB 1JGVL 3SDDA 3RWFA 1NEUA 4JRXB 1BD2D 1YEGH 3L5XH 5JORA 4P4KA 4JO3H 4YPJA 4OF0A 2EO9A 3NH7H 1A6VH 4MNGE 1FNLA 2Y06L 2UV3A 1PKOA 2V5YA 3BSZH 3SDAA 4NM4L 2JB6A 1A6ZA 3MV8A 2IANB 5HHVL 4YO0B 5T1DH 5CEXB 2HTKC 2V2WA 4HZLB 3HZKB 4LSTH 2OK0L 3SY0B 3WNMA 3MRPA 4JDTH 1WQVT 4JPIB 2AK1L 3TWCH 4QWWC 4X7TB 3HFMH 2AJZB 1CXFA 4LAQH 1XGUB 3LEXB 4LSUL 1FGVL 1CICB 2CDEA 5CBEB 5CGMA 3FQXB 3QISA 2VKWA 3RZCB 2QQLL 2VERN 4LLDA 4D3CL 3BP6A 5JPNB 5KSVB 3QUZC 5BS0E 3HCVA 4V2BA 4TOYH 5EBMA 4FQJH 4JZJC 3H9SD 5GJSH 5C08A 4TQEH 3MRDB 1TQBC 4R4BB 3DX8A 4TVSa 3WHE0 2BC4B 4YHZL 1FO0H 4YDLC 2OTUB 3QUXA 1A6AA 3ARFB 1JPTH 3QI9D 3SO3C 1KLUB 2C1OA 2HH0L 4PS4H 1G7IB 5HGHA 2NR6D 1I1AA 3UTTD 2UWEF 2ZJSH 3MOBH 4Q97A 4MVBC 3ZYZA 4Z77B 4NUGL 2F8VA 3ZSSA 2BNQA 4MA7L 3O3AB 5JPMA 4D0DA 3IVKB 1HCFX 5I1GH 2HFGH 3AREB 4Y4KD 1HQRA 4QLRA 2NQCA 4KGJA 3UZVB 4DW2L 1Z9LA 1TXKA 1JGEA 4JFDA 2HA1A 4XXCC 4M4RA 1I1YA 1R3LB 1L9MA 4Q9BA 3WIFB 4K3DH 5IB4B 4EJ1C 4KWUA 3VCLA 1YEDB 3KPSD 4OCRH 2HTLC 4P23D 4XPBH 5IUSA 3D69A 4MAYB 1YYLL 1I7TB 3QO1B 1AR2A 1KLFA 3GJFA 3SGDH 2B4CL 5JOFA 2VIRB 4XC1H 1PLGL 1TIUA 1ZSDA 1MCQA 4DFIA 3GBNH 5IT2H 4H0HB 1IGFL 3EAKA 4S0SD 1AJ7L 3S35L 4U1NB 4LMQE 5JIKA 3QEUB 4I2XB 4X6EB 3S34H 2DQJL 4DZ8B 1EO7A 1MFDL 1F3JA 1T0PB 3RWHB 1NGWA 3T0EC 6CGTA 4ONGL 2DAVA 2CRZA 1ZGLB 4BSVA 4MXVE 5TF1H 2BK8A 2YWZA 2PYEA 1B0RB 1XCQB 2XTJC 3FOMB 1VSCA 3VXNA 5D93B 1YNLH 4YHNA 2E7LA 1S7VB 2F54A 1HIML 2BJML 3VFWB 4KXZH 2CSPA 3PWNA 4JFZH 3F7QA 4IRJC 2ZUQB 5HYJA 1HSAB 2VWEE 4OCXH 4NQXA 3U4BH 1IE5A 3SCMC 4KJWC 2YOCA 3QXAA 2YK1L 2APFA 3ZE1F 3U82B 1U93B 4WWKC 2QSQA 5C7XH 5J12B 2G60H 5L2JA 3IFNL 4MA8L 4RAUA 5JHLL 1UG9A 1YY8B 5F44A 2H41A 1U8PA 3OKDB 1AR1D 1NC2B 1AQKL 3U46A 2J6EL 1CU4L 5DYOB 5F7EH 4O58H 3LKPA 1UM4H 5DSCA 3X13A 1AXIB 1AXSA 4HGKC 3QEQB 3IYLW 1KC5H 4TSBL 1U41A 2Y07H 4AIXA 1MHPH 1XH3A 4ZSOE 2XWTB 4XNUH 1D6VL 1M71B 1FBIH 4U1IB 5I75C 3RP1A 1OF2A 3WL9B 5MENA 4YFEA 2AXFB 4K7PH 2OJZH 4JVPA 5IESH 5EN2A 2CKBA 4LSDA 4O2FA 3TCXA 1RMFH 4U1KA 2AJYL 1MHHB 4KHXL 4HPOH 1GHFH 4NQSA 5C0NC 4HUWB 5J3HD 4YNYB 5A3IC 1SMAA 4ZFFA 4POZC 2FJHA 5DJ0B 3KYMA 3SBWA 2W65A 4OGYH 5TH2A 4FZEH 5GS3A 5TE4H 4EI5C 5MI0B 1CXLA 4PV8B 4M1CC 1N5AA 1X3DA 4Z7WA 3QQ9D 2PW1A 1B3JA 4LIQH 5HGBB 4QRPD 5GRYA 1C12A 2ILLA 4V1DA 2OXGA 3V0VB 5FM4A 4TRPH 2NY5H 1D5IL 2BHZA 4R26L 3HNSL 5DEGA 2V7NA 1IJ9A 3UJJL 2X7LA 4Y1AE 4MS8C 3PABB 3BP4A 4Y5VC 1A7NH 1NGZA 1P7QB 2BNRB 2GEEA 2ZG1A 4PRPD 1A6WH 3HMWL 4MAUH 4AYFA 5T1LB 4MHHG 1RZKH 3TT3H 1T0NA 2ID5A 4WW2F 5E4IA 3OGCA 4WI7A 4FS0A 1CFTB 3I50L 4PJDB 4MD4B 4PJ8C 4YAQB 3PWUA 1OP3K 4FQIL 4WO4D 4M00A 3B8SA 4WUKL 4U1GC 4L4TD 4P2RE 2AEIT 1D5MA 4PUBL 3BWAA 2PW2A 1CFSB 2X1OA 4ODHL 3HI5L 2APBA 3Q48A 3A6BH 1DVFB 1T03L 3O4LD 4QGTA 3ZDXF 1PEWA 1VA9A 4ZOCA 3NIGF 1XEDA 1WGOA 2FL5A 2MQ0A 3IT8D 4N0UA 4ELMF 1MJUH 3RKDC 2DQGL 35C8L 2P8MB 4NN7B 4WGVB 2A1WH 1G7PA 4FFVD 4Z0BH 1IGCH 1QBBA 4RQQA 3PUCA 3V7MA 4WVRA 1NBYA 1CLYH 4LLWA 2AJSL 5J1SC 1J5OL 2J8HA 3IKCB 4LQFH 5E70A 5KSBA 1F4XL 3RDTB 4G9DB 3RIFK 3FONA 4RFNC 3SE9H 2PXYB 4DVBB 2A9NL 2WP3O 5FO9A 5FYJU 1G7JB 4YXLL 1SHMA 1MJ7H 4PB9L 3PXJA 5GIRB 3GSRA 3L7EB 3U2SA 3RY5A 2IBGA 4DFHA 2FB4H 2EXWD 4HAGA 3V5HA 4S2SB 3KHQA 3ZTNL 3MV8E 2FIKA 4S1RH 4OZHA 5TE7H 1D5ZA 4GMSL 3IDMA 4NP4H 5IQ9B 2D9QB 2PR4H 3BUYA 4I0PB 5DMKB 2HVKA 3QWQB 3P4NA 2CGRH 5KVEH 1PEZA 4N0CC 5KANI 1OAKH 1UKTA 4X7SL 4J3OC 2AKRA 3D1MC 4ODTL 3TFKC 4H8WL 1NGQL 4XCEB 1OAXL 5F21B 2VZOA 3PWVB 3MV9B 4TTGA 4DKDC 4QY8A 1E28B 4HQQH 5FOBA 3V7AE 4ZFGH 3JUZA 3MJ6A 4PJHF 5D7SH 4JR9H 3GO1H 1VEOA 2H1PL 5C08E 4K8RL 4UOJA 5ENWB 3CU7A 3KPOB 1H3GA 3WLWC 3FCTA 3L95B 4PV9B 5LWYH 3MNWB 2VDQH 4NDMB 2OL3A 2EIZA 3AREC 3PL6A 4LOUC 3F7VA 3S37X 2HLFC 4TYUA 3IFOA 5DJ8A 2CJUH 5AAWA 1MVUA 2V17L 1MCBA 2B5IB 2ZUWA 4K3JL 3MA7A 4MXQC 2ITCB 3CFEA 5EH1A 3UO1H 2KBGA 3WBDA 3ORJA 1P6AB 5BOZG 1T3FB 3LQMA 3IRZA 5D7JD 1B0WA 1KT2A 2BNQE 5GS2H 3MUGA 3UDWC 4OD2A 4FQCL 4XMLL 5F7WC 3WXVL 4KGLA 4XRCB 1S8DB 2FO4B 4WIQA 3KXFB 4JFDE 5D96B 1MCLA 5EA0L 2BHYA 3K4ZA 1MREL 4XPFL 3QPQD 3IAQA 1KLGB 1A8JH 4EDWL 3ARXA 4NKDB 1T80A 1I3RB 1ZHKB 1Z9SA 3E6FB 5B39G 1Y18A 2H2SC 4NO0B 3RVVC 4JHBA 5IWLA 1GXEA 1N6QL 5J9PB 1A5FL 1X5XA 2AJVL 2IPUK 3R8QA 3N50A 5ACLA 5IEKA 2NZ9C 3C6SA 2PF6A 1XGPA 2ZUQC 3D25B 1QLFB 4GG6F 3QEHA 3PGCB 3V4PH 2CKBL 3DLQR 1PY9A 3LOWA 4JPWL 4JRYA 1SVZA 1JYNA 4X99A 1LDPL 4G8EA 2WNGA 4LLQB 4TVPH 3DGGB 3DIFA 3H9HB 4PTUB 1JE6A 4L3AA 5IB3A 1H3PH 1YECL 2BVUA 2PYEE 4JY5H 4NRYB 2GTZA 1DDHB 3HUJA 1OSPL 3W0WB 3CGTA 4EQ3A 2F54E 5DI8B 4YO0A 5I6XB 3TV3L 3BE1L 1OT2A 4Y5XB 1R0AH 1N6VA 5HYJE 4XBPA 5F88A 4CJ0A 4JPIA 3DX6B 5EOCL 2R69H 2RCSL 1YNTB 3T77B 1NEZA 4I3SL 2P42B 1E6OL 4W4NA 2WLYA 3CK0H 1HXMA 3LZFL 1L0XA 1FNEA 2FJFB 5IMMB 3FQXA 3OR6B 1A4KA 4P49A 5C07A 4NQUA 4Y5YA 4W4OC 3ZDYF 3RZCA 5KSVA 1KFAH 1ZXQA 4JFHE 3DSFL 5IVNA 1HCVA 2G5BA 4OF8A 5GRUH 3TO2A 1TZIB 1Y6NR 1MFCH 4OV5B 4P46B 3VH8B 3MACH 4CKVX 3CUPA 4GRWF 4OCWL 4PY8J 4OF5A 1F6AB 4PRBB 2BC4A 2VABA 3O0RL 1L7TH 4WUUD 3QCTL 5IW1B 3ARDD 3HNVH 4P2OD 3RTQD 1IKNC 3QI9C 5I9QB 5MENE 1JTOA 4LSPH 2DYPD 4QRUA 2BMKA 2NR6C 3WFCH 2NNAA 5D5MB 3MYJA 3SKOA 1UB6B 3T2NH 5K93A 4XBEL 2Q7YA 5IOPB 3ILQC 2VR4A 3O9WA 4D8PA 5E5UB 4JKPL 4J4PD 1PSKH 1IARB 2HN7A 1B88A 1MRCH 4Y4KC 1BQLL 5IIEB 4L29B 5F93C 3QUMA 4LNRB 4M62H 3VE0B 4IOIB 2ENYA 2GIYA 1ODAA 5F3BB 1C16B 4Z7WE 4F33B 4JQVC 1JWSB 2XN9A 1MCNA 3SE8H 4PRDB 4LLUA 3WIFA 3LMJL 1F97A 4M4PA 4V1DE 3VFOB 4UV7H 1T0MA 1GCFA 2HFFB 2BVEA 3L9RA 4UV4H 3GRWH 3CFKA 4DEPC 4HH9B 2VN7A 2Y25A 1CXEA 1LK2B 1YJDH 1LEIB 5DK3A 3LQAH 1UM6L 4PY7B 4NZUH 3TT1H 5FECB 5GS1B 4K3GA 1MCCA 1TFHA 1DQLL 3H9YA 4Q2ZA 4DZ8A 1BWMA 2LU3A 2VXSL 4D0BB 1VPOL 3BX7C 3NPZB 4UT7L 3WNKA 3STZA 2PUQT 2DQCL 2XT1B 3AAZB 1IC7H 5FM8A 4OQ1A 1YNKL 4URTB 3WFDL 2PYFA 2FSEA 3O6KH 3UTSA 1AHWA 5HHNB 2J4WH 3HG1A 1UH3A 3LCYA 3TIDB 4U7SA 2OI9C 43C9A 4N9OB 4DCQB 1S7VA 3S96A 2W9EL 5FA4B 1T1YB 3IDJB 5IF0A 3GMPA 1JCKA 4XPGL 1HSAA 2XQYG 3QQ3B 3RPIA 4DKEL 1GGBH 5L2KB 4N0UE 2VC2L 1FFNB 3MFGB 2Y9RT 5HPMA 3RGVB 4NRZA 5I1IH 1LO0H 3RWIB 5JW3L 3MRGA 5IFHL 1NC2A 3MZTA 3HC3L 3BRFA 2ORBH 4UUJB 3Q5YA 3MODL 4OFIA 5KSBE 1BVLB 2MJWA 1K6QL 2DM4A 1ZLUK 2EDBA 1JNNH 4B0MM 3BZ4A 2R2EB 2NX5A 2YPLA 1DQDH 1FZJA 5DHYA 4FFZL 2XA8L 1L4IA 4C58B 4NO2B 5IB5A 4ZOBA 4OGXL 1VKXA 1QLEH 2COQA 4DGVH 5BXFA 5F7FA 4OZHE 3L5WB 1LO4H 2H8PA 1YQVH 3I2CL 5INDB 5BV7C 2A6IA 1TVDA 5GRWA 4J3SA 5DF0A 4OJFL 4YNYA 2P8PA 1A9EB 3H6JA 3SO5A 1P1ZA 1I9JH 1K8IB 3G6DH 5JHDB 3QQ9C 1MF2H 5F7YC 3BAEL 2K3TA 5D2NA 1LE9B 3FQUA 1NCNA 1RIUH 3DOSA 1FO0A 3L5JA 1QBMH 1X5AA 1I4FA 4GRLD 5HGBA 3MLTA 4HXBL 4NNPH 3A6OA 2D31B 2NY3B 2JKXA 1MLCA 5GSRA 1AO7D 5C0BA 1BEYH 3FRPG 4Q58C 3HKFA 1DCLA 1ZT4A 2HG5B 1CF8L 4L3CB 1URLA 3FO0H 1G9NL 3N9GH 4JDVB 5KW9H 2OR7A 2GSGA 2OSLB 1S7RA 5GS0D 4QT5B 5EU6A 4MXVF 1MY5A 1P7QA 1TZGL 3IDXL 4YQXL 5TPWL 1JRHH 4X83A 3C08L 4X5LA 4NRXB 5J1TC 2CLRA 3F5WA 2W9DL 4WO4C 9CGTA 4O4YL 4YAQA 4JREC 4XNQB 3CVHA 3RJDA 2RAMA 3PHOA 4WEBL 4U1JB 1M4KA 4Z7UA 1J05A 2W60B 1VFAB 3I6GA 5I71B 4MNQD 3MRRB 3TBWB 1DQMH 1CFSA 3HPJB 4Q0XH 5EOQH 1WAAA 1VHPA 1INDH 3NCJH 4AT6A 2GSIA 1U8OB 3NACL 4H5SB 4MDIB 2EDJA 2NLJA 2UVFA 2VL4A 3QRGL 4JO4L 1UXSB 2O5XL 3L3GA 3MLXL 5BJTA 3C60A 4FFVC 1CFBA 3MRLB 5E2TH 3RL2B 2VLKD 2EE6A 2HKHH 4LARH 1I7ZA 3TBTA 2P8MA 3VG0L 1JN6A 1IGMH 1Q1JL 4WHCA 4MJ6B 1YMMB 4KMQA 5ELIA 2RBLA 5EC2B 2JELL 3QIUD 4R2GB 1RUKL 4L8SB 1AP2A 3MJ7B 4YDVA 3DYPA 4PP1D 1YY9D 2YZ1A 3N1MC 2DWEA 2XZCH 3IETA 5T3XH 2KQNA 3CNKA 1UFUA 3DUHA 4KAQL 4NQCD 2R0LH 4JRYE 4WU5A 4LU5H 4AQOA 5MHSD 2EXWC 5J13C 1BOGA 1S7WB 3CH1B 3UMTA 3MROB 1ZK9A 3HUJE 4NKQB 4E5XB 1ZEAH 1O0VA 1YEFH 3E3QC 4G5ZL 3V6ZA 1OY3B 4PRHB 3HR5A 3QUML 1FAKT 3SKMB 5D1ZA 1S5HB 3G08B 1HOCA 4GQPH 5F9OL 3L3OA 4O02L 4TUOB 3V52L 5IHLB 4YPGA 3S5LG 2FBJL 4PJCB 5J06A 3CXHJ 4NO3B 3TBVA 5T5FL 2WUBH 3FQWB 4PFEA 5EWIL 5DUBA 1XR8B 5E99L 1IFHL 2Q20A 4JAMB 2IADB 1RZFL 4BQ8A 4XP1L 2A0LD 4D9QD 4EUPH 4E42A 5C07E 1EK3A 5K9QI 3FMGH 2OQJB 4NJAH 4OZ4A 1E28A 2WW8A 4DN4H 1GAFL 1YN6B 3F7YA 4YXHH 2GJZA 4PREB 4HIJA 3L95A 4PV9A 4Z18A 5ACZB 3VWKB 1OB1B 3V6BR 2JCCB 4JN1H 4XWOD 1U6AL 1CL7H 3QWOA 1QFPA 4HIHA 2WMPA 3BKJL 5F96L 43CAB 5D7JC 1AD0B 1KG0B 1KCVH 1GC1L 5HYQA 4KHTH 3HC0B 2D4DA 5CP3H 5DMIH 3QDAA 3QR2A 2V9QA 1I9RL 4R4FH 1MQKH 3QDJD 2OZ4H 3IXTA 4F7EB 2WSKA 2BY0A 5B4MC 3MRQA 4CMMA 1CT8A 1S8DA 3RVXD 4HG4K 2FO4A 5ITFB 1A6VL 3D2UB 3QPQC 4G7YH 2EXYD 3BGMA 2XN9E 1JWUA 3LPFA 1HINH 3TBYB 4RMRA 1DEEB 1OAZL 1ZAGA 3K1DA 1KLGA 2ZZUT 4WWID 2R2BB 2K9UA 4JDTL 4W6XB 4G9FD 3HTLX 4RAVA 1XGQA 2G5RA 3HFML 3BQUA 5E6IA 3WUWG 5J9PA 2X4RA 5AYUH 2WIMA 5ESQA 3HZMB 3GHEL 4M3KB 1QLFA 3PGCA 1LGVA 3HZVB 3IJHB 1LNUB 2H6PB 3DGGA 3AGVA 1UWEH 2FH6A 5FHBH 3UTSE 1OGAA 2KKQA 2QADD 1DDHA 4S11A 5IW3A 4TOYL 2X05A 3HG1E 2P44B 4FQJL 2QR0A 5F6IB 3WMSA 5DC9B 3GB7B 5GJSL 1R5VA 4TQEL 2ICEB 4QEGA 3OKMA 4GBXB 5I15H 3MUJA 2J5LC 4J6RL 1FO0L 2NY4B 4K71B 5JXAH 4PGEA 2EEBA 1JPTL 3RVWD 3VD7A 4Z95L 1QEWA 4MMZC 4XTRD 1JUFA 2WQ8A 1BBJB 2FJFA 3AM8C 1UACL 4P2QB 5IMMA 3LVEA 4HPYH 1PG7H 32C2A 4NWTH 4PBWD 4HT1L 1NGYB 1VGKA 3LKSB 2ARJB 2DLTA 2EYTA 1H0DA 1F4YL 3O3EB 2AGJH 4YHLH 4HUUB 5IFAH 2L7UA 4P2OC 2IQAB 3CVHL 5GGVH 2VLME 4LASH 4K3DL 5F89B 3G5ZB 2NX5E 1RU9H 2YPLE 4Y4HD 5JXED 2FHCA 4RZCA 3UYPA 3VXRB 3LKRB 2DQTH 2C5DC 2IAMB 1MCKA 1OSZB 2W1NA 3W5NA 1GZQB 4PRIB 4GW1B 4OD1H 1WCBB 2CDFB 4JZNB 5IT2L 1CCZA 4J4PC 4YHKH 1W72A 5DD6A 4QHUB 4X7EC 2YMXL 3QCUL 4K9EC 3S34L 1VACB 2EH8H 4FQLL 1WVZA 3ZKXB 1EEYA 4L29A 1BVZA 4P5KB 2DIJA 4LNRA 3IRPX 4KDVA 5TF1L 5D2NE 1Q9LA 3TH4T 3WDIA 3WHXB 1JWSA 2F53B 1KCSH 1QRKA 2PNDA 1OP5H 5F3HA 3SN6N 1QLRA 3NFNA 1INQB 3VFOA 4UDUB 5LCVH 4PYHA 4FXGB 1X4ZA 4JFZL 2HFFA 5C0BE 2HLAB 3DGCR 4X6CF 4HH9A 1C08B 3O3BB 4FFYL 1LEIA 3U4BL 1T89A 1T21B 4AZ8A 5KAQG 5C7XL 1V7NH 2VH5L 3FQRB 5EU6E 5FUCE 4QXTB 5GS1A 2FD6H 1BECA 2DM3A 4YK4B 2BDNH 4KK5C 3S3PA 5FF6A 3BXNA 3BGFB 3QJFA 2X5PA 5ISZA 3VXOB 1IGTB 4Y8DC 1HE7A 5F7EL 2BSSA 4O58L 1WSST 1BQHA 3ARGA 4LSRH 1NCBH 3QP3A 4Z7UE 3QWRA 1R5IB 1X5ZA 4R2GC 4MQSB 3ULSA 4DCQA 1MHPL 5I1JH 4XNUL 4PJFB 4LRNH 3GK8L 1WAAE 1MPAH 5DS8A 1T1YA 1SBSL 4C56B 3MOAH 1U58A 2CUMA 2X4QB 3QQ3A 3OXSA 5DJYB 1R3IH 2AJ3B 2HFEA 3ZT7A 4OLWL 4K7PL 4KRMB 2OJZL 1FJ1B 5L2KA 5HGGS 4E9LA 1NBVL 5IESL 2XXMB 1HK6A 4ZUUB 3UC0L 1TDQA 1IM9D 4HPOL 3U6RA 2GK0B 3VFNB 3DYOA 2JJVA 3L3IB 2Y7QB 3OKLA 4DKFH 3BKML 3H7BB 1MFAH 3C8DA 4OGYL 4R90H 4FZEL 3P9LB 3DUUA 1U91B 2VLRA 4M5YH 2OLDA 3WDHA 2P5ED 3PHSA 1AGBB 4MNHA 3P4MB 4U2ZA 5AZEL 2XPGA 4YBLB 3VD4A 2BZDA 1Z0MA 4PJ9D 4DKAA 4OZGF 4LCWE 4HUMB 2NY5L 3UZQA 5CILH 2X4NA 2ICES 5TDOB 3V0AC 1R5WB 2ZOLB 1MQ8A 1MCWM 4XX1G 5GJTH 2DQIL 1TVHA 4OSUH 5IHZA 4HW6A 5INDA 3KLAB 5D9SB 4AENB 1A6WL 4OF3A 4Z7NE 3EJJX 3DMMD 2CXGA 4Z7WF 2ATPA 5AZ2L 1S7UB 2M2DA 3TT3L 4HUVA 1A9EA 1MLBA 3DUSB 1NFDB 2AV7A 1ZLWH 3DVNB 2VLJB 5EZIH 5IV2B 3IAPA 3U0PB 5JTWA 1IGJB 2R23B 4YEEA 3UTZB 2WLZA 4ZPTB 1U3HB 2BOBB 5LVEA 1ZHNB 3MA9H 3A6BL 4EN3A 1KN4H 2BNUB 4UZGA 4L3CA 4ZUWB 2EDFA 5GS0C 2N4IA 5GRVK 3DURB 1JV5A 1P84K 1YYML 2D7NA 4QT5A 3DI2B 4FNLH 3LRHA 1A1MA 2A1WL 1CXIA 3O6FD 4P48A 2DI8A 3VWJA 2O93L 1NCWH 5F9DC 1DSFL 4P3DB 5DT1H 1KXVC 1UJ3C 1X5KA 5ICXB 4PJAB 1SEBB 2ZSVA 1XF2B 2FEDD 2R0WL 4F7TB 2O61B 3FRUB 1EFXD 4TNWF 3VA2C 4Z7VA 4LIQE 2GUOB 5C0FA 1HQ4B 3VXMB 4LQFL 1M1SA 5SWQA 2W60A 5E8PA 2FYYB 3GRWA 3MRRA 4WI6A 1QPPA 3CSBA 5BO1L 1LWRA 4A6YH 4KKCD 4H5SA 2Y5EA 1NDMA 3W9DB 4YE4L 3AS3A 2FB4L 1XCTB 2D9CA 1T04B 5T1KD 3MRLA 4WEUD 5KTEL 2IBBA 1JP5A 5TE7L 3RWEA 3QIUC 4NP4L 2AQ1A 5KSBF 2PR4L 2X4SB 3P3YA 1EXUB 2DQUH 1BGXH 4ODUB 1PZ5A 1QO3A 4PP1C 4CNIB 2BX5A 3DHMA 3AS1A 5KVEL 2EDNA 3LS4H 1RK0A 3MJ7A 5CHNB 5J0BA 4Q74A 3C8HA 4GFTB 2KPNA 4HWNA 4F57L 2WANA 3QNYB 3VXUD 4OZHF 1BD2B 1HDMB 3QO0A 1SY6H 1W72L 1L9NA 5DVLA 4JHWH 4U1SA 1F4HA 1OGAE 1RZ7L 4HQQL 4CADA 4OZFH 2AQ3A 2HT3D 4JKWA 5D7SL 4JR9L 4PRHA 4YZFE 3CPLB 1WFNA 1A22B 5IEHB 4PGDA 1X5HA 2PCPB 4XAKD 2VDQL 3ALWA 3Q1SH 2IMNA 3EO9H 3FFDA 1JWMA 3DXAD 1S9VB 1JBJA 1VCAA 3VXTA 2A0LC 1HN1A 1XR8A 1T2XA 4FP8H 2IAMC 3W39B 4YDIH 5A43C 3FFCD 4UINL 2R2HA 4KUZH 1BVKA 3QUZA 3ULUD 1BP3B 1IL1A 3TYGL 3MCKA 3QJHB 2J88H 1X5IA 2A77H 4IJ3B 2KZ1B 5B38G 1WZ1H 2NYYC 3ROLA 4XWOC 3BRDA 5I17A 3EO0A 2I9LA 1OB1A 4GS7B 5EPMA 3WKNA 4ZPVB 3TN0B 3O3DA 4HC1A 1GOFA 4HFWA 4K7PX 3QDMB 4G8FB 1ED3B 4ELKB 3WYRA 1E4JA 5EUOB 3VFGH 3AUVA 5CIPA 5FB8B 1C5CL 4GKSB 1G7HB 2E7HA 3KPPA 3V4PL 3V6OC 3LKOA 2NY0D 4MCYA 3X3GL 3ZKND 2EDEA 3RVXC 3DX7A 2EXYC 3HAEG 3P11L 2VAAB 4JY5L 3D2UA 1ACZA 5EZOH 1ZVSA 4OUUB 2HFTA 4KK8D 4FA8A 1T5XB 2DN7A 3MREB 4IIQC 5ERWA 5FYJD 2IPKA 3EZ8A 1NGXB 5FEBA 1A2YA 1KF9B 3PQYD 4S1DD 1IC1A 2DMKA 1IEBB 1LO3H 3TVMB 2YUWA 2AQ2A 1EZVY 5C09B 4AM0A 3UJIH 1OCWH 5DHVH 1LVEA 1V8HA 3HZMA 3RHWF 3CK0L 3HUJF 3T8XB 4DAGH 5I1LA 3FT3B 1WUNT 3ES6A 3FT2B 3EJYD 3PP4L 2QADC 4B50A 5ISZE 3IFPB 1EO8L 1UCTA 2CO6B 4BZ2H 5AG9A 3EYQD 1KFAL 1HEZA 4QRTA 5GRUL 5IG7B 4DZBA 1MFCL 4F7MB 1RHFA 3MACL 3NCYS 3TO4D 2GT9B 2R8SH 4G6JH 1M6OB 4LLMB 3ETBF 4GBXA 3VI4E 2IWGA 4KMTH 4Y19A 1QSEA 1QSFA 2FATH 4RGNB 1ULVA 3HNVL 5CKGA 1FL3A 5GISH 4IRJA 1OAUH 1TQCB 1JFQL 3V5DB 1PW3A 3SCMA 4LLYA 3T2NL 2YA2A 1A9BB 2D7TH 2FZ3B 3LHPH 2P8LB 3MLSL 4TVPE 1HYRC 3TIEB 2BOCB 4AEEA 1IGYB 2GJ6D 1PSKL 1YEIH 2PN5A 1MRCL 3KJ4C 1CTOA 5H35B 3LQZB 4IS6B 4M62L 2VLRE 4GKNB 5DJXA 2ARJA 5IW6B 3OAUH 1NJ9B 5E2JA 2H3NA 3O3EA 5SWZD 1NUDA 4J3TA 1DUZB 4Y4HC 5JXEC 5F97E 4G8GE 3WXWL 3WN5B 4C83A 3L3HB 4UV7L 4ZD3H 4WCYH 8FABA 4LHQB 3GRWL 4FG6D 3QFDB 1XZ0B 5CBAB 3VW3H 3FN0H 3BPLB 4BM7A 2YC1B 1B4RA 4EUPA 4NZUL 5DWUH 3GHBH 2HT2D 4GJTB 2ZUTA 4F80A 3VFSA 2Z31B 1XGYH 1H5BC 1CTNA 4RFOH 4NFBA 4X7DC 3LAFA 3C5SA 4BQ6A 4P5KA 3SDCB 1BF8A 2OBGA 3L3DA 1BQSA 1IAOB 1S7SB 5E2UH 3OKKA 5EBWB 4EI5A 2UWEB 2VXTH 2HRLA 4GRMA 3VDAA 3QULB 2F53A 2JIXA 1U42A 4L3EB 3U30B 1W0VB 3E8UH 1INQA 1BQHG 3JTSA 2ERJC 3HA0A 4FXGA 3U4EB 2HLAA 1JF1B 2P47B 1RZGB 3D3VA 3OX8B 5ITBL 4ZXBD 2P5WB 4AIZA 1UADC 3VFUA 2VDRH 1J10A 1IC5L 4PJGA 3JV4B 5B8CB 5CP3A 3PNWA 1RVFH 3MUZ1 1EA9C 5C0JB 3QG7H 3IB4A 2CLVB 3GSNH 2OZ4A 2IJ0C 4GLRI 5AYQA 3QT2A 1CDCA 5BZDB 1MH5A 5I1IL 3VFTA 4CMHB 1RFDH 2PO6B 4HV8B 4ORGB 4Y0GA 3IDIA 3ILPA 2J12B 4Z7VE 1AGEB 1EHLL 4JY6B 4PJ8A 3BW9A 3QDGE 2XQBH 1FFQA 1AIFB 3KWWB 4KY1H 4OLUH 1JNNL 4MA3B 2EKSB 4YBQD 1CIUA 2ESVD 3ULVC 3HLAA 3WS3A 1DQDL 1C1EL 5ID1A 3BP7A 4JVUA 4GLRH 2X4QA 1P6FA 4GXUN 5I8KH 1JK8A 1IVLA 1CDHA 5IQ7L 2H32B 4DGVL 1UM5L 5C0CA 2X4OB 4HKBA 1LO4L 3WHE1 3QCVH 1YQVL 1I85C 3CVIH 4UT6H 2GK0A 4PJBA 4LL9A 2Y7QA 2X1XR 4TULL 5FDWA 3P0YH 5EORH 2D03H 5FKPA 1FC1A 5JDSB 5EO9A 4GOSA 1OPGH 2HVJB 1MF2L 4ZFOL 3BH9B 3OB8A 4FOMA 1CIDA 3DARA 4HC1L 5KG9A 3SJVB 1RIUL 3BP5B 1NSNL 2ITDB 3ARBD 4PJ9C 1NMCB 3P4MA 2HJFB 3P9WB 3WIHH 4JCMA 4NNPL 3CDGA 5HJ3A 3S4SB 1BM3H 4DGYH 3UJTL 4NZTH 3WIIH 3IFLH 1RULH 3KYOB 3KVQA 4B53A 3FO0L 3MRBB 3N9GL 4NKIH 5KW9L 4RRPA 3O41A 3R8BB 4O5LH 3ZL4H 4JFEA 2NW2B 4NN6B 5C70A 5AG8A 2WV3A 3DMMC 2FIRT 1KPRB 1AGCB 3VXPA 2UZIH 2XRAH 1A7QH 2L4OA 4XWGH 2VQUA 5SWSD 1JRHL 4Y2DA 1XIWD 3GGWA 2B2XH 2BXZA 2WP3T 4AK1A 3GFUA 5KZCD 2FECL 4QRRA 2C3HA 4LKXB 5CSZA 1WWAX 3DVNA 4U0RC 3U0PA 3MOQA 3OAZK 1G0XA 4QNPE 1N3NA 1IQDA 4X5XB 5DGRA 1DQML 1U3HA 2BOBA 1FVCB 1YEHL 1F6LL 4UIMB 2BNUA 4MCZA 1CLZH 2O5ZH 3N1PC 4ZUWA 5IKCB 1JHLH 5D71H 2BFVH 2EKJA 3CSPA 3O6FC 2NW3A 3DURA 5E2TL 1FL6B 4PJXA 2C3XA 3BPOC 3OR7A 1EV2E 2FEDC 4WDIA 4Z7UF 2DIBA 2EZ0D 4PJAA 1DANU 1SEBA 4FQHB 1CQYA 4JHAH 2O61A 1F6FB 1WAAF 5TDPB 1INEH 1GOGA 3KPLA 2FX7H 4KQ3H 4LGPB 3D0LA 3UX9B 3KDMB 4JM2D 2XZCL 3SGKC 3QBTB 5T3XL 1OVZA 2R0LL 3OZ9H 3BIKB 2VE6B 4KKCC 1QP1A 2Z92A 3MNZB 3H8NA 4JFFD 4Q9QH 4EI6A 4LU5L 2BRRH 1CDGA 4WW2B 5C6WH 4NQED 2OP4H 5CSBA 3TPKA 3IDYB 3GI9H 3UDWA 5IB2A 4N8CH 4UTBL 4D2NA 1IKFH 2VLLB 4KK9D 3VXSD 1MRDH 2R0KH 1T04A 4JY4B 2BSTB 3BEWB 3X12B 1JGDA 4G6ML 4XH2A 5FUZH 2X4SA 3SHSA 2YPKB 4QHMA 1T1ZB 2DLFH 3M07A 1KCUH 1MCSA 4LVOB 1RZJH 4YHPA 5CHNA 3ZHKA 1M7IB 4QOKB 5L0QB 5HD8D 3M17B 1QR1A 1ONQA 4UNUA 5GSVA 4B41A 3PWPA 4UB0H 3UROR 2DQEH 4POYA 4XGZA 5C0DB 2FR4B 1BD2A 1HDMA 2GKIA 3L6FB 1F4WH 3C5JB 3CZFB 1A7PH 4KVNL 4QCIB 3WFZA 1I7UA 3FMGL 4TSAL 1DZBA 3TA3D 4NJAL 4ZG1A 2QSCL 4Z7NF 4DN4L 4ZS6D 1ORQA 5DC0A 2IEPA 1Y0LB 3QAZB 4Y19E 1QSEE 2PCPA 1QSFE 5B22A 3B9KD 2R4RH 3MR9A 4D9RE 4JN1L 2YD4A 5GGRY 3CFBB 5IHUL 1CL7L 3L3JA 5T3XE 4ENEC 1D9KD 5DD0L 4YWGH 3UTPD 3MBEB 4LDEB 3P77B 2WBJD 4KHTL 1TENA 2WBKA 4N90E 1RUML 4NN5B 3JWDC 5DMIL 3TESA 4GRWH 1EFQA 3W39A 4Y4FD 4GW5B 4Z9KB 4R4FL 1N26A 1N4XL 1FZMB 1QRND 2OZ4L 3MLZH 1KB9J 3ULUC 1J1PL 8CGTA 1I9IH 3NCBB 4W4OA 1TLKA 3H9SA 4K7FA 1T5WB 3O4OB 2A6DA 1RSFA 5I74B 4G7YL 5JO5A 2XWBB 2ZSWB 1JPGA 3ARDB 3B3IA 3RTQB 4H20H 4NJ9H 5C0IB 5IMLB 3RWJA 4UI2A 5TDNA 1IKNA 3QI9A 1ZT7A 3P30H 1LO5B 4PJHB 2X9XA 3UTTA 1ED3A 5ICYB 1FAIL 2V6HA 1EERB 4M93B 5EUOA 1X5FA 2NY0C 4WHTB 4EXKA 4GKSA 4Z76A 3ZKNC 2I27N 5INCB 3LEYL 1UH4A 5B8CC 4R3SA 3ZE0E 1U9KA 4HJJL 4Y4KA 1TJGH 1DQTA 1FZKA 5DTFB 5FHBL 3MXVL 4KK8C 3JUYA 5IFJA 1HHGB 3IJSB 2F53E 5E56A 3KPSA 4P23A 1T5XA 4S1DC 3DO3A 2VR5A 5EIIA 2X42A 4HKZB 1HNGA 5D7LD 1E4XL 4JGUA 3QPXH 3QIBB 3D3VE 3JV6B 5ANMB 1WIPA 1IEBA 4PJGE 5JXAL 1IZKA 3CSYA 3C2AL 1FZOB 4YGVB 3EJYC 4A6YA 1AE6H 2H26A 3IGAA 5D8JL 4YZFF 1SYVB 4M61B 4Z5RB 2FJGA 4HPYL 1WZMA 5KOMC 4KROB 2ZKHL 1QSZA 5FM5M 5I1EH 3G5VA 3TO4C 4FQXD 3B6SB 3Q6FA 4GG6B 3F58L 2AGJL 4YHLL 1Q9KA 5IFAL 4QHLB 1VEPA 3D39B 3UTOA 5GGVL 2F58L 4LASL 4OKVB 1RU9L 1M7DA 1FNGA 3WO3B 15C8H 3GMOB 2DQTL 5BRZE 4POUB 5DQJA 3NCCB 4BZYA 4HIIB 4U6XA 1XF3A 5C0CE 1A9BA 2NXYB 3FB6B 4ODSH 1SY6A 4YHKL 5IJKC 4M5ZH 5MEQB 4KMLB 4PJBE 5CWSA 4XP4H 1DLFH 1NGPH 4AG4L 2QQKL 4OZFA 1ZV5A 2EH8L 1JGVH 3PIQB 1Z6JT 5IBUG 5CFHA 4K55A 3E0GA 5GXBB 4PRAA 1I8MB 3CFIC 2Y06H 4HMDA 5K33A 4NM4H 4BELD 5HHVH 4LMQI 5J6HB 3WN5A 4FG6C 5LCVL 1PX3A 1CE6B 2YUXA 2AEQL 4PLNC 3UEZA 4NPYA 2CRYA 2ZPKL 2HT2C 4JFEE 4GRWB 4U3CA 3TH2T 1RK1A 1EEQA 4M9OA 1ETZB 5KOVC 4EDXA 4LF3B 1U95B 1KYOJ 1NKRA 1CFNB 2W0FB 2FD6L 2ICWA 2ZP0T 3D85B 2OXHA 5IM7B 2X1QA 2ZOKB 1PG7W 5GHWH 5FO7B 3CJJA 3HE6B 2QQLH 4QRRE 1A0QL 1S7SA 4UQ2A 5TFSL 3NPSB 4MHHI 4ZO6A 2QKIA 3X3FH 3GMNB 4I18C 3ISWA 5HHPA 3KPMA 5LKNA 4QRPA 5MEPA 4P5TB 3P73B 5H2BB 4WY7L 4KK6C 1NAMB 4ZXBC 2Z93B 5I1AB 25C8H 1MPAL 3S36L 4YHZH 4MQXD 1JF1A 4Y16D 5EUKB 4J3WA 5D1QB 3LB6D 3PDOA 4DOHB 3CC5A 5E8EA 1FQ9C 3T0VA 2JJSA 1T7YA 3X11A 2DKMA 1WFTA 4PJXE 2W92A 4NKMB 4ONFH 5I8EB 4PRPA 3IDYC 5I30L 1ES0B 2E9IA 4Q7DA 4BH8A 4U7MA 5FGCE 4LHUD 1MIEH 4PJAE 3Q6GL 4ORGA 4O9HH 12E8H 1KJMA 3VI4F 3Q2CA 4WO4A 3BISA 1NCTA 3MGTA 5HYSB 5FKAB 4L4TA 4KJPD 5BW7C 3IDUA 4F2MB 4MNGB 2X1PA 4YBQC 4HWZA 3MO1B 1J12A 1I9EA 4LVOC 6FABH 2Q6WA 1N8ZB 3O4LA 3MNVB 2W07A 1J1XH 1HHJA 5DHVA 4HX1B 4WFED 5CILL 1PLGH 3BYYA 2Z4QA 1T83C 4WTXA 2E8YA 4JLRA 4PJIE 4M9PA 3V4VL 1IGFH 1IQWH 1YC8A 2GK2A 1AJ7H 2A73B 3S35H 5IK3A 5D6DA 4WI2A 1MFDH 1HHHB 3V95A 3TYFB 4QTIH 5D1XB 4LCCB 1EHAA 4CL7A 4ONGH 4M6MH 1R6VA 4OI8A 2FLBT 4MWFB 2HVJA 3MRJB 3ARBC 1V7ML 5BS0B 1DL7L 3IJYA 3PWPE 4WU7A 3GBLA 3SJVA 5KSAB 2VXVH 1CDIA 1X4XA 3H3PH 4WTWA 3SKNA 3T2OA 1BD2E 1AD9B 2BJMH 2V5RA 5EU5A 4JFPB 1X5JA 3REWB 4MJ4A 4Z7OE 1LE5A 4N5ED 1I7RA 3GSQB 1EVTC 4HS6A 3MRBA 2X4TB 4NZDA 2OTWA 4C59B 4H0IA 2YK1H 4R7DA 1LD9B 1H3WM 4TN9A 3IFNH 3LV3B 2B8OT 5I16B 1NCWL 4WI9A 4YHOL 3TBSA 3WJLC 1HH6A 5DT1L 1B4JL 1DUYA 4M43H 5C2BH 2HJLA 1KTRL 5DA4A 3G5YB 4MB5A 1AQKH 2MKLC 4LCYB 3LN4B 2J6EH 1HHIA 2LVEA 4LKXA 4R6UA 4FTVD 4APQD 1BIIA 4TSBH 3GMLB 3P9MB 4RMSA 5DURD 1D6VH 1PG7X 3FKUS 4JQIL 3WFEL 3TNNB 5HHQA 1UCBH 5I73B 2E27L 2X89D 3H9SE 2EYRB 3O8XB 1OGTB 3K7UA 5E94B 5HHXH 3FB8B 1JPFB 3SE3C 1FL6A 4JFXB 5DJCA 5A1AA 2EZ0C 4Z7VF 3U36A 5ICZA 4KHXH 5T1MA 1MCPL 5ID0B 2QQNH 1BGXL 1FCCA 2YD6A 2AEPL 4FQHA 3BVNB 2B1AH 4JM2C 3UTTE 5T3ZD 3LS4L 4HUKB 5TDPA 1OOAA 5EUOE 5D7JA 3BYTA 2VB5A 3OB0H 4CU7A 2BVQB 4YHMH 3BIKA 3BDXA 4AMKL 4WW2A 1RI8A 2PETA 1SY6L 2NY2D 2IBZY 4KK9C 4JHWL 5ADOH 1FH5H 3GMRB 4R26H 1A6TA 3GSNA 4KTYA 2EDOA 3KLSA 5DRNB 2A74A 1MFEH 3KPSE 4ZAKD 2MCPL 4JFYA 5SX4I 3W82A 1EAPB 2F19H 5I19H 1HH9B 1ACYH 3D0VB 4PGJA 5EO0B 2YPKA 4HK0A 4LPUA 2R56L 1CXHA 3EO9L 2MHAA 1R3KB 5HD8C 4X9BA 5F8QC 3I50H 1OP9A 5TF0A 4FQIH 3DVGA 1IM3A 4WUKH 3STLB 4FP8L 4FZ8L 1RZ8B 5F7DB 4F9LA 3U9PL 1NC4B 1T1WA 3OKOA 3L6FA 4ODHH 4ZS6C 4N0FB 4BSJA 5BV7L 2NXYC 3IU4L 5SX4H 5BVJA 1BZ9A 1KJVB 3FTGA 4QRQB 4G3YH 5JQ6L 2J88L 2IQ9H 2V7HA 3B9KC 2C3VA 1WZ1L 4QGYA 4N8VA 35C8H 1T6VN 1AGDB 2JK5A 4GKZB 1D9KC 4QNPF 5GZND 3DRQB 4GKOA 4OQTL 1CGVA 4F7CB 3WNOA 3MRHB 2WBJC 5GZOD 1J5OH 4HS8H 4ONHA 4Y4FC 3DI3B 3WIHA 3R0MA 1F4XH 5HHMD 2R9HD 3VXQA 3AM8A 3OGOE 4GW5A 4CUCA 2A9NH 3EYFB 3BPNB 1KB5L 2EICA 3DV6A 4PB9H 3EOTL 5C9JA 3LSOB 1T5WA 4MMXC 1FG9C 1K4CB 5EZOL 4Y1AB 1U8HB 4WUUA 2E7MA 3ARDA 4P2OA 3HE6C 3RTQA 4GMSH 5C0RL 3T1FB 3MRCA 2DYPA 5C0IA 3NPSC 1QKZH 4PIRF 2C7UB 4PJHA 4IMLB 1LO3L 3MRMB 5C3TA 4P5TC 1EUUA 3KPRD 1G7LA 4YC2B 4IHOA 5J8OA 3UJIL 1OCWL 1VFBB 4BUGA 4C57C 4G8IB 2GHWB 4RMQA 4BFIB 4X7SH 1U8KA 3RL1B 2DQDH 4ODTH 4DAGL 3ZYJA 4J4PA 3IF1A 5INCA 3SOBH 4UIKL 1OAXH 2ENSA 3CFDB 1QVOB 5ESAB 3DTXB 3E2HB 5IP4A 1NANI 1FN4A 1MVFA 1I1RA 2VZUA 1G6RA 1KIUA 3FAXA 4FQQB 2Q8BH 3BJ91 4QRPE 1D5BA 3PWLB 1NFIA 5EU7C 2R8SL 4GH7B 1M05B 4Q6IC 3FQTB 2EH7L 4KMTL 4RSVA 1J0HA 3WKML 1W0WA 1ZWIB 1MI5D 4JFOA 5DJAA 5GISL 5ANMA 1XR9A 3FB7A 1OAUL 4KI1A 1NH6A 2AI0L 4K3JH 2Q3ZA 4PB0L 1BX2A 2D7TL 4PRPE 4YGVA 4EOWH 1MEXH 4P0DA 4NGHH 3LHPL 3C5ZC 2VXUL 4NZRH 1SYVA 4M61A 1G7MB 2ZCKH 1ZT1B 3LDBC 3C6LB 4MD0B 1YEIL 4FQXC 4NSKA 5C0AD 3SDDB 3RWFB 5FHAL 4L4TE 1D3CA 5JORB 1NL0H 4XMLH 4P4KB 3OAUL 1P9MA 2YD3A 3B6SA 4AEIL 3AY4C 2VQ1A 4MJ2A 4X6BA 1I8LA 4GG8A 5JOEA 3SDAB 5EA0H 2JB6B 3AB0B 1A6ZB 1MREH 2I60H 3MV8B 4LCCC 5B39B 3O4LE 2P7TA 3FO1A 4G6AC 3CFJA 4OCSH 2V2WB 4ZD3L 4WCYL 3JBG7 3HRZA 3MRPB 3UBXG 5HVHC 4KKAC 1BFVH 3OJMB 4HIIA 1WC7A 3FN0L 1N6QH 3I3BA 1A5FH 2AJVH 4NZJA 4J7RA 1GIGH 2J8UA 4ORZC 3PDGA 2CDEB 2D2OA 2NY1B 3ARUA 1JZ2A 3PIQA 4RFOL 1KPVB 1LDPH 3FB5B 2P5EB 4GAFB 4LLDB 3BP6B 3ECBA 2VDKH 5E2UL 1YECH 3HCVB 2EDRA 2VXTL 1ZA3A 5EBMB 5GGUA 2Z0BA 3QUYD 5C08B 5LJYH 1PX4A 3TV3H 4I9WD 3DX8B 5D70H 2ZUUA 1J11A 3KJ6H 3H9ZA 3VFRB 2RIKA 2VDRL 3QUXB 4JVWA 1A6AB 5EOCH 3ZE0F 3ULUH 2RCSH 1RVFL 3VGFA 4IMKC 3W9EA 2C1OB 2XKNB 5HGHB 1PFCA 3QG7L 1CFNA 3MLYL 1I1AB 3GSNL 5IVXA 5IM7A 2X6MA 5DUPH 2BNQB 1OD7A 5LGKA 3O3UN 2YN3A 4D0DB 3U7AA 1SJEA 1WT5C 4OIIH 3DSFH 1MIMH 5FUOL 3DPBA 1HQRB 4GRLA 4PJGF 3TZVD 1JGEB 4JFDB 4FXKA 3P73A 1I1YB 4MQXC 2K1MA 3HE7D 4OCWH 4YFLF 4MD5A 4Y16C 5DD5H 4F3FA 1AO7A 4KY1L 3LKQA 4YHYC 1UGNA 3GNMH 3RNKA 3LB6C 4XCCH 3U7YH 4H1LG 3D69B 3QCTH 1EHXA 3M8OH 4NHCH 3N06B 3GJFB 1ZSDB 2E8ZA 4MA1C 4HLJA 5DVNA 4S1SH 4RAHA 3RY4A 1BOYA 4XBEH 3QCVL 3CVIL 3N85H 2GAZB 4UT6L 3ELAT 4X6CB 2VWEC 2F74A 1UJ3A 4JKPH 1N2RA 1F3JB 5EORL 1NGWB 3K1KC 3DJ9A 4BSVB 5CGYD 1OPGL 3FAWA 1BREA 2PYEB 4TUJA 1JZ4A 3T0ED 4MNQA 3VXNB 4YHNB 1MOEA 3BZEA 5EIQA 5HDQL 2F54B 2XTJD 3MV7D 4IEFB 5CCKH 3MNVA 3PWNB 4DWHA 1BM3L 4DGYL 2D0FA 1FV1A 3WIIL 5I1HH 4PJBF 1RULL 5HYJB 5T1KB 4NQXB 4NKIL 1FYHB 3QXAB 3ZL4L 1CLCA 5E08L 1A3LL 5L2JB 4U1MB 2XY2A 5E5MB 4RAUB 3PF2A 2UZIL 1DQLH 2XRAL 3QIUA 4WWKD 1A7QL 4XWGL 1J8HD 3FN9A 4XXDA 1VPOH 1QYGL 2Y4SA 1NCCH 1U8PB 4UT7H 2B2XL 5I1KH 3U46B 3L3KA 1TPXC 3MRJA 3LKPB 4NQCA 4F15C 3X13B 5DSCB 1AXSB 1FSKC 3MLUL 3VH8G 1U3YA 4YX2L 1XH3B 5DLMH 4EKXA 3W5MA 4N5EC 2W9EH 1TZHB 4LKCB 3ZE2E 1N5YH 1OF2B 5MENB 4K9EL 4OLYL 4OCLC 2VXQH 1JHLL 3EDDA 2BFVL 3LKNA 4DKEH 5E24E 2ZUXA 5C0EA 4XCYA 3JWOC 2CKBB 4NC2B 2VC2H 4O2FB 4F58H 3HPLA 1OLZA 3WNPA 4U1KB 1G6RL 3GSVA 4NQSB 5DQDH 4OZGB 1OLLA 1SJHA 5JW3H 5SV4A 4BUHA 5DRZA 1JTTA 3G5YA 3HC3H 3PGFH 4ZFFB 2FJHB 4YUEH 3KYMB 4APQC 2W65B 3C9NA 3LN4A 5A3ID 1U8LA 1QG3A 1INEL 1JL8A 2DWDA 3MRIA 4KQ3L 5E2VL 1E4KC 1N5AB 4K3EH 5SV3A 4J8RA 5KANG 2FX9H 4OBRA 4Z7WB 3OZ9L 4R9HA 4PJXF 4Q9QL 3PL6D 1C12B 4MJID 4V1DB 2CIIA 2IALB 4ALAH 2OP4L 2YEZB 5CZVL 5C8JA 4FFZH 2XA8H 1AY1H 3GI9L 3O8XA 5ESVA 3RVTC 3U7WL 4OGXH 4HHAA 4N8PA 1IKFL 5JMOC 3FO2B 1MRDL 2R0KL 3FB8A 3MGOA 5DEGB 1JPFA 3RX7A 2V7NB 5B3NA 2YA0A 5FGRA 4WUUE 3QIWD 4XNXL 2VZTA 2YD1A 2YHGA 3BP4B 2YD7A 1NGZB 4MS8D 4E41D 1JMXA 1OL0A 4OJFH 3ZHDA 1MHCA 1FLTX 1T0NB 3BVNA 1KCUL 2F8OA 1IGIL 4OGZA 4ISVA 1BWWA 3OKNA 3BGAA 4R97C 4U6VH 3PWUB 5BVPH 5E2WL 2A6KA 1YPZE 4UB0L 3HS0A 3QDJA 5DQ9B 1D5MB 2NY2C 4P9MH 4HEPG 5TE6H 3I75A 3BWAB 4HXBH 4MDJA 2PW2B 4PJIF 4OGAC 2HWZH 3EFDL 3T0XA 4MB4A 1A7PL 2VUYA 3EBAA 4NCC2 5IMKB 4ZAKC 5J7CC 1CF8H 2DB8A 1G9NH 2EDLA 4GUPA 4NO5A 2FL5B 1KCRH 3C6LC 1HKLH 1KCKA 4N0UB 4C54A 1G7PB 1YEEH 1TZGH 3D0VA 2AJXH 4G9FA 3RKDD 5ANME 4JRXD 4QO1A 3C08H 3C09B 1R3KA 4XP6L 1NBYB 4FMFA 1A3RH 4LLWB 4O4YH 4YWGL 2C26A 1U8IB 3CCHA 4LSVH 4Z7OF 5KSBB 2IAND 1OAQL 3OWEA 5F7DA 3FONB 5JOPD 3VGAC 1FFPA 1NCUA 1CGSH 5FO9B 5DK0A 5ETUA 1I9IL 2X09A 4JRWA 1WF5A 3U2SB 4U3XA 3QRGH 4JO4H 1BJ8A 2LTQB 4RBPH 3V5HB 4KRPB 4LLAA 3MLXH 4YJZL 2I5YH 1S7TA 2FIKB 4OZHB 2XY1A 3VG0H 3VD3A 1D5ZB 5GZNC 1CICD 3O2VH 1MCWW 3CFCL 3EW3B 3IDMB 1Q1JH 2XZQL 3UP1A 4H20L 1II4E 4OZIA 3BUYB 1AGDA 3DV4A 4XP9H 4KTEH 5IVOA 3K8MA 1ZLVH 3REVA 3RZCD 2JELH 3O45A 2XG4A 3P4NB 4NBZB 1H8NA 5GGRA 2R9HC 4CN6A 5C71A 5EU4A 2MQCA 3QHTC 5F9WC 5A40E 2AKRB 5GS0L 4KAQH 2J8UE 1Q9WA 3B2UD 3EYFA 3OXRA 3TFKD 2P49B 2XI9A 3ARFD 3GSUA 4QY8B 4YDKL 5E7FA 1I1AC 5FOBB 4G5ZH 4J23A 3EYOA 3A6CL 5J56B 3BIAX 4F8TA 3S5LB 1AFVL 3QUMH 1ZLSL 1U8HA 4R7NA 4Y4HA 5JXEA 1Z2KA 5F9OH 4KDWA 3V52H 2OL3B 5DJ6A 2EIZB 1KN2H 2J6EA 2Z91A 1EEZA 3WLWD 3VDCA 3F7VB 4JN2B 3PHQB 3BI9X 3IFOB 5DJ8B 2CRMA 4NBYB 5T5FH 3ARED 1MVUB 1VFBA 2HLFD 1KEGL 3LPWA 5EWIH 3MA7B 3CFEB 1RHHA 3ESVF 5IVXE 3V8OA 1IFHH 4X7CC 1BZQK 1O7VA 1RZFH 4XVTH 5ESAA 4MAYD 4X9GA 1H5BA 2Z8SA 3K2MC 3MUGB 4OD2B 2PTTA 2BVPA 2H9GA 1GAFH 1AGFA 4MZ2A 4XCFH 3PWLA 5F72S 1OTUC 1AO7E 3GM0A 4HJGA 2UUDH 1CE1H 1BJMA 1U6AH 5CEZD 3OV6A 1Y18B 3S97C 3BKJH 2E7LC 3TJHD 5KVGL 3IS1X 2AW2A 4XPAH 1GC1H 2H2SD 4ODSL 4HFUL 5IEKB 4M5ZL 1BJ1J 3C6SB 1XGPB 3QEHB 1I9RH 4MD0A 1BZ7A 4JRYB 2KH2B 4X99B 4G8EB 3DIFB 3ZT6A 5IB3B 3W11C 1J0IA 2GTZB 3HUJB 3KPQB 4MNQE 2UY7A 1ZHLA 3V8CA 3EOAA 3KGRA 4LVNB 3VRJA 2YUVA 1KIQA 5B39A 3CMGA 3AXLB 4R96B 1OAZH 1NC2D 4U05A 4GXVH 1MCRA 4Y89A 3F12A 4XBPB 4XPHL 5F88B 1QFUH 2X4PA 1UZ6E 5ADPH 4F7PA 4J1UA 1IM9A 4X8XA 1NEZB 3QEQD 4HJ0D 1HXMB 3GHEH 1C5DA 1I85A 3WNLA 1FNEB 3BT2H 1GSMA 5GHWL 1A4KB 1KPVA 3NABH 5C07B 3EO1B 4Y5YB 3FB5A 1UXWA 2P5EA 1EH9A 2JTDA 3QUYC 4LDLB 4NQCE 4QKXB 2G5BB 3TO2B 4UTAL 3X3FL 1HSBB 1ZANH 2MKWA 1JF5A 2RHEA 1OWWA 3CUPB 4FFWD 5MHSE 3SBWC 2ADGA 3UYOD 1CBVL 25C8L 4J6RH 2VABB 1TTFA 4U3HA 2NY6B 4JM4L 1I8KA 4M6NH 3VFRA 4QRUB 2BMKB 1S9YB 2NNAB 3MYJB 4LVEA 3SKOB 4PR5A 2XKNA 4ONFL 4NNYB 4Z95H 3SGDI 3DMMA 2Q7YB 2VITA 3O9WB 3Q0HA 4D8PB 1UACH 1MIEL 3LD8C 4UBDC 4O9HL 1TETH 12E8L 3ILQD 2HN7B 4X9FA 4BKLB 1UJTA 4HT1H 1F11A 3JTTA 2OJEA 3TZVC 1GGUA 3QUMB 5MEOB 3HE7C 5C1MB 1R24A 2NTFB 4D9QE 1F4YH 3LN5A 3LIZH 4QF1A 1N59A 2XN9B 2BNRD 1P7QD 2BCKA 3CVHH 4LLUB 3OAYK 4FQ2L 1FDLH 1T7ZA 2YBRA 4P9HC 5CJ5A 6FABL 5T1LD 1T0MB 1IEHA 3L9RB 1J1XL 1DQJB 4XNYL 3CFKB 1W0YT 3GIVA 1NAKL 4QYOA 4C4KO 5GRJL 4KXZI 1WBYA 3CXDL 2NXZC 2APTA 3O6FA 4H25B 1IQWL 1JNLL 5GGSY 2GAZA 4RIRA 4HG4J 5BQ7A 3BO8A 2YMXH 3QCUH 3UPCA 4X6CA 4Q2ZB 4B5EA 5CGYC 1DVFD 3OG4B 1T4KA 4FQLH 4QTIL 3STZB 1P7HL 4M6ML 4N0YL 2CDGB 2PYFB 2FSEB 1YN7A 3I84A 3UAJD 3UTSB 3RU8H 1AHWB 3HG1B 2EIDA 4LK4A 2VXVL 3QDJE 2EDDA 4PD4K 3H3PL 43C9B 1E6JL 1KGCD 3ZTJG 3S96B 1FNHA 1K4DB 2VTFA 1PVHA 4KJYA 2F15A 4KFZC 3PJSA 5IF0B 2R0ZL 3GMPB 5T1KA 4FFYH 3HI1A 3RPIB 5E00B 4PTTA 2R1XA 3RDTD 4NC1E 2C4FT 3Q5OA 3UPAA 1L0QA 4ESKA 2VH5H 4U1MA 3ZT5A 4X6FA 2PXYD 4JANB 5E5MA 5HPMB 4NRZB 4G9FE 3O81A 4RA3A 5C2BL 4M43L 1JMZA 1QBLH 2WAHA 3MRGB 2MWCA 3AS0A 4OLXH 2DL9A 4YR6A 5DXWA 2R1YA 4X4MA 1ZHBA 3RY6A 3V0WL 2IMMA 3GK8H 2QTEA 3BZ4B 4I0PD 3CZJA 1TZHA 4LKCA 2NX5B 1UCBL 2YPLB 1FZJB 5DHYB 1SBSH 4PJ7A 3QNXB 4JCLA 5IB5B 5SX5H 3GMQA 1VKXB 4X6DE 4OLWH 5HHXL 5BXFB 1NBVH 5CZXC 4RDQG 2H8PB 3UC0H 3IDGB 4RISL 4ZQKA 3STBA 5K59E 2A6IB 1J0KA 4BK5A 4OZIE 4OZGA 1FPTH 1RJZA 4KTDL 3MV9D 4D9LH 2QQNL 4Z0XB 2APVA 3BKMH 2P8PB 4X7FC 4CVXA 3EOYG 1KOAA 2B1AL 2DTMH 2VSCA 1P1ZB 3OBAA 4ACPA 1GJIA 3ZLQC 5DD3H 4RMVA 5D2NB 4LPCA 3PL6C 3FQUB 3FFCA 5KJRL 1FO0B 4X8JA 1HYSD 4YHML 1I4FB 5AZEH 4HULB 2DBLH 3MLTB 4NCDA 3VGDA 2IALA 4ZOAA 1MLCB 5GSRB 2YEZA 4YIQB 5ADOL 1FH5L 4YBHA 5C0BB 3HC4H 1ZT4B 2ADJA 2F5BL 2OCFD 3QIWC 3FO2A 1U8MA 2ZCHL 5DJZB 5J89A 1G7QB 1MFEL 4PJEE 2DQIH 2GSGB 4LRIC 1S7RB 2F19L 5EU6B 1MWAA 4G7VL 5I19L 5FGBA 4KVCL 1ACYL 2FWOB 5FYKD 3UCRA 1FNAA 1A21A 5AZ2H 5F7LB 4I4WB 1G84A 5I2IA 4BFBD 2CLRB 3F5WB 3IDNB 3ULVL 1J9CT 1KJ3L 3MRFA 2WWKO 3KXFD 3CVHB 3PHOB 3DNKA 4LGRB 4Z7UB 1J05B 2WIIA 5DQ9A 3FRPA 3I6GB 2LQRA 3MUY1 3NTCL 5IWLC 1EHNA 3HB3D 4QTHB 3HAEH 2LU7A 4G80A 4NO0D 4AT6B 2GSIB 5IMKA 4OT1L 1KJ2L 2NLJB 4G3YL 2MPAH 2IQ9L 3L3GB 5BJTB 3C60B 3VA6A 3QQNA 2A2QT 2Y5TA 1YYMH 1I7ZB 3EHBD 3TBTB 3ZDZE 1OP5K 1BF2A 1JN6B 2KL6A 1PAMA 4GW4B 4NWUH 4DK3A 1TMCB 1DSFH 1BQUA 4G43A 2R1WA 3B5TA 1MAML 2R0WH 1HZHH 4NOBA 1AP2B 2ZUVA 3DHJA 4YDVB 2NZIA 3W0WD 5MI0C 1AQDA 1U8IA 4HS8L 3ZE2F 3RWGB 2O26U 5I8CA 4ZODA 2DWEB 3AROA 3IETB 5E5RB 1ZS8A 1W8NA 2LAAA 2ADIB 4WU5B 1WBXA 4X5WB 1U3JA 5BO1H 3KNBB 2J8OA 4QHNA 1BOGB 4U1HB 1T22A 4LCWB 1Z5LB 5B3JE 4YE4H 3TO4A 3V6ZB 4XBGA 2AJUL 1CICC 5ALBH 3HR5B 5KTEH 5EC1A 5D1ZB 1NUNB 4TPRL 5AWNH 1HOCB 3INUL 3RZCC 4F37F 3L3OB 4ZFZA 4JDZB 1F3DJ 1QKZL 1TJIH 4YPGB 3TBVB 1WBZA 4P46D 3B2UC 5DUBB 2AK4D 2GJ6A 3T4AA 2DQDL 3S35X 5DVOA 1JI1A 4F57H 3B43A 3SOBL 1KIRA 3ARFC 2VDNL 4E42B 1W72H 4AL8H 3WD5L 4HCRH 3O2DH 2VL5A 2P5EE 4H88H 4IRSB 5SWZA 1SMOA 4OZ4B 1WTGT 1RZ7H 3VI3E 2QL1A 4QHKJ 4LP4A 4WTZG 2VR9A 2Q8BL 3F7YB 3S5LA 2GJZB 1H15A 1CYGA 4HIJB 1F8TL 1P53A 1A6UH 1NLDL 3MLRH 1X44A 5JR1H 3MRNA 4L4VB 1WFOA 1YPZF 5F1IA 2W59A 2OMNA 4JN2A 3PHQA 4PPTA 3QWOB 3T3MF 4HIHB 4EOWL 1MEXL 4NGHL 5HYQB 1UVQA 4MAYC 4KV5E 4NZRL 3QUKA 2ZCKL 2HJKA 1P84J 5EFIA 4UINH 3IXTB 3D9AH 3MRQB 4CVZA 1NL0L 4CMMB 1CT8B 5T3ZH 3RQ3A 3TYGH 1ZLWK 4X4ZA 4I18A 4LCUA 5B4MD 3SKJH 2EDWA 3BGMB 1JWUB 4ZO8A 4X98A 5A2LH 3NZHH 4M6AA 2I60L 4OI9A 4E0RA 4OAWA 4WV1A 4ZXBA 4OCSL 3TJHC 5D93C 5IVZA 1BFVL 3F8UB 5EZJB 2X2YA 4RAVB 1XGQB 5E6IB 3BQUB 5M94B 2X4RB 1MCJA 5ESQB 4PP2A 1C5CH 1GIGL 1TNMA 3HAEB 2ED7A 1NCDL 4X6CE 5JZ7D 2AXGA 4KH2A 3X3GH 2ADFH 1ZVYA 5J12C 1U92A 1J88A 4HUXB 1CLOH 3P11H 2VDKL 1OGAB 5L2KD 3KPQA 2BP3A 3FT4A 3TP4A 5BW7A 2QR0B 3HMXH 2ESVA 2MTPA 2E9BA 1IILE 1A14L 1R5VB 3RGVD 3OKMB 5GRXG 3AXLA 4R96A 3E6HA 4DN3L 1P4LA 3QG6A 5D70L 3WUWA 3G04A 2XWJA 4FN0A 3JWDL 1CK0L 2J8UF 3KJ6L 4JQXC 4NQVA 4WFGD 2OR9L 4HJ0C 3GMMA 5JQHC 4FMKA 4PGEB 4N5UA 5F7MC 3ULUL 1T83A 5FCSH 1DE4A 5CZKA 1QEWB 1MCDA 2HT4D 1JUFB 3RKPA 1IEAB 1XT5A 3PP4H 3QHFL 3T0AA 32C2B 5DUPL 1MWAL 2ZNWA 3EO1A 1EO8H 4OIIL 1VGKB 1MIML 1Q94B 4FFWC 3BEVB 3V9FA 2EYTB 1HSBA 3VXUE 2X1WL 4X4ME 5L9DH 1H0DB 2IH1A 3MLWL 3MBXH 5DD5L 3GNML 5DVKA 1Z0NA 5T5NG 5I1DB 4XCCL 5TQ2H 3U7YL 5IVXF 5LG1A 4NNXA 4PJ7E 4RZCB 3M8OL 4NHCL 4M7ZB 1WJ3A 1AH1A 1S9YA 5JHDD 1JFQH 2D7PA 4S1SL 4XAKE 4HEME 1Q38A 2YXMA 4I0KA 4ZYKA 1WWBX 4NNYA 4X4XA 2W38A 3N85L 3MLSH 1YUHA 5SWSA 1W72B 4OZGE 1XIWA 5DD6B 1RUAH 2NY3D 3H42L 5FYJL 3WJLA 5DGQA 4V2CB 1EJOL 5MP6L 4BKLA 3BZDA 1EEYB 1Q9OA 2IPUG 5K9JH 5MEOA 1T7VA 4M02A 1Q9LB 2NTFA 2VKXA 3FFCE 4M7LL 5F3HB 3IKKA 1QLRB 1ZVHA 3WO4B 3WXWH 3NFNB 5CCKL 1XF4A 4GAYA 3G6JA 3ULUE 5E8DL 1DQJA 4OLEA 5I1HL 1KENH 3MQIA 3BRGC 4ZNEA 1T2QH 2RQ8A 3VD9A 4M1DL 2NY7H 4H25A 1LK3L 1P4IH 3V4UH 1DVFC 2YD2A 3GKZA 4OIBA 3ZZ1A 2HMID 2QLVB 5FF6B 5F1SA 1NCCL 3BXNB 3C60C 3GZKA 3UAJC 5I1KL 3QJFB 5H94A 3Q5TA 3RIAF 5ISZB 4KK5D 3MJ8A 4JM2A 5FYLD 1DN2A 4NN7C 5HDLA 5J4MA 2CDGA 5M95B 4KKLD 2BSSB 2XFXA 1BQHB 3ARGB 1Q72H 1UZ6F 4JFFA 4N1EA 3FO9B 3ULSB 3K2UL 1P7KA 4NQEA 1YMMD 5DLML 1K4DA 1LQSR 3RA7H 1DR9A 4JPVL 4R2GD 3CAFA 5DS8B 5ITBH 5DEFA 1N5YL 3VXSA 1U58B 1DBML 3ZKSD 3J7HA 3RDTC 4PBXA 2A9MH 1IC5H 3OXSB 4BH7A 2VXQL 2HFEB 2PXYC 5E00A 2JB5H 3WLBA 5FYJE 4H26A 4F58L 1CD1A 2C4FU 4NM8L 1A1OB 4JANA 3PWJA 5DQDL 3U6RB 1MFBL 3OKLB 3PGFL 4YUEL 4OFDA 3TPUA 5DZNA 1EHLH 4LEXL 3RUGA 5KN5A 3DUUB 4PRHD 2VLRB 2EIEA 3OMZA 4OFKA 2VDPH 4I0PC 4K3EL 4ODBD 2FX9L 3SDXF 4MNHB 3LH2H 3LPGA 2XPGB 3TA3A 4PGCA 4G8GB 3HZYA 1NDGA 3QZWG 2Y36H 1EGJH 4ALAL 3UTQA 1GZPA 1C1EH 3QNXA 1AY1L 3NCEB 3CX5K 3OAZH 2X4NB 3K0WA 3U0TA 3QA3A 3ARWA 5IQ7H 3RWDA 1UM5H 3B9KA 5DJ2A 1TVHB 4PJ5B 3IDGA 5IHZB 3G9AB 1KIPA 5E1HB 3B9VA 4I77H 4Z0XA 5C6TH 2ATPB 2KQMA 4RX4D 4CRPA 1D9KA 4TULH 4JHZA 5HGAA 1X6LA 3EFFA 4HUVB 1MLBB 1QFHA 3BDBA 2WBJA 5LAXA 4MSWA 4RDQF 4U6VL 2AV7B 2DLGA 1HYSC 1JRHI 5BVPL 2GJ6E 4HC1H 4Y4FA 3BDYL 3OHXA 1NSNH 1QRNA 3MFFA 3JWNC 3VWKD 4DUXA 2FECI 2MSPA 4P9ML 5TE6L 4KU1A 2B5IC 2HWZL 1C5BL 1RIHH 5CIPH 4XCNB 4YIQA 3UJTH 4NT6B 4OCYH 5SWZE 4EN3B 3KPTA 2CR6A 1UC6A 4KZDL 1CDUA 2YR3A 5DJZA 5KVDL 4AEFA 1G7QA 4L9LB 1KCRL 4XNZB 4KRNA 4LDOB 1HKLL 4BZ1H 1JV5B 1A1MB 3BHBA 1YEEL 2FWOA 3VWJB 2AJXL 3TNMB 4LVHB 3FHQA 1TVBA 1PYWA 4I4WA 2ZSVB 5D96C 3IDNA 4P9HH 5E4EB 3MGAA 1RJYB 3P4OB 1A3RL 1RZKC 3D2UD 4Z7VB 1UWXH 5C0FB 4ZUSA 3R06A 1N0LA 4LSVL 3QDGB 5SWQB 5E8PB 2EDQA 3HB3C 2QHRH 4RGMB 4LPVA 1CGSL 3TCLB 4BQBA 1Z9OA 5I1CL 4QTHA 1YEHH 4IM8A 1NDMB 3NFSH 3V6FA 3EHBC 3EUUA 3G9VA 4YHIA 2I5YL 3VRIB 4PG9A 2YWYA 4Q6IA 3O2VL 4GW4A 4JGMA 3RWEB 4XHQA 1SYSA 4MXWH 1P2CA 4XP9L 2Z35A 4KTEL 4NUJA 1PZ5B 2WZPD 1QO3B 3FOLA 2DM2A 4UOW1 4IDJH 4KUCD 1RK0B 5I6XC 1OT1A 3VG9B 5FV2A 3WFHA 4UDTA 3RWGA 1NMAL 4M1GH 4Y5XC 1S9WA 4KI5D 3OF6D 4X6DF 2ADIA 3MCLL 4X5WA 3SQBA 1KTKE 3S4SG 3HI6L 2NY4D 3LEVL 3QO0B 4D0CA 3KNBA 1KUMA 5K59F 2ARJQ 4OZIF 4U1HA 4U1SB 1X7QA 3FJTA 4LCWA 1Z5LA 4UTBH 4CADB 1PKQA 3LRGA 1CFVH 2ESVE 4FQ1L 3QXWA 1FFOA 1BMGA 5HI5C 4PGDB 3QXDB 3CMOL 4G6MH 4P2QD 3H0TB 4PGBA 1KN2L 4JDZA 4O2CA 4NHUA 5FK9A 4P46C 1C8PA 2GW5A 3FFDB 1JWMB 3T65A 3L7FB 4HWEH 2W0LA 4DGIL 3ZMRA 4P3WA 3VXTB 5DR5H 5AD0A 1CL7I 5I9QC 4GXUM 1KEMH 3WCYA 4ZOEA 4XVTL 4PJEF 3VXRD 2IAMD 4KVNH 4TSAH 2R2HB 5EZLA 4IRSA 2QSCH 2DICA 4YFLI 4PRID 1BVKB 3QUZB 3S88H 1IL1B 4XCFL 3QXUA 3MCKB 4P5MA 5LGHH 4JZJB 2UY6A 4OLZL 2E6QA 3CLEL 3OPZH 3ROLB 1FG2A 5I17B 1TQBB 3EO0B 4PBVC 1CE1L 2I9LB 4L4VA 2YPVH 4TNVF 5EPMB 2NYYD 1CWVA 1T1XA 3O3DB 5IHUH 4ZFOB 1BFTA 1K5NA 3D48R 3ALXA 3IAGC 5KVFL 5J6GB 1JPSL 4HFWB 1KXTB 1FVDA 1Q0XL 5DD0H 5D7KD 4G6FB 3WO4C 1EBPA 3SO3B 4IMKA 3BH8A 4XPAL 2F53D 5JIIA 4AY0A 4I48A 5SWSE 5CIPB 4U2YA 5E8NA 4Z78B 1RUMH 3QH3A 3KPPB 3ME0A 4XZUA 3LKOB 4DVRL 4Z7QE 1N4XH 1T89C 2YUZA 3NN8A 4MCYB 3Q3GA 2YD9A 1F2QA 1J1PH 3ZDZF 5B38A 3DX7B 2Z9TA 1WT5A 4ZDHA 3OJDA 4XHJD 5GS1C 1AC0A 2B0SH 1ZVSB 1FL5A 1NMBH 1JF6A 5K9OA 4CAGA 3WV0A 3G6JE 5ERWB 2IPKB 4S10A 4GXVL 1A2YB 1EIBA 2CPCA 1J8KA 1QFUL 3PV7A 4K2UL 4ZNEE 5EZJA 5ADPL 4F8QA 4AM0B 4X80H 2YS4A 1E4XI 1AKJB 1FAIH 1WCQA 3B2VH 5JZ7C 4LHUA 4ERSH 3O2WH 4XVSH 1SM3H 5B3JF 2F5AL 3HAEA 5I1LB 3LEYH 2V2XA 3BT2L 3ES6B 4CN4A 4C56D 3PP3K 5KS9A 1MNUL 1ZKAA 3NABL 1K3ZA 4HJJH 4I5BA 4HUXA 1HEZB 2AVGA 3MXVH 1P4BL 3VU2A 1Q0YL 4QRTB 3RGVC 5CJXC 4DZBB 4JFFE 1ZANL 2XTJB 5DK2A 4NQEE 4LLVB 1MCOH 1GGCL 4Y19B 1QSEB 1QSFB 1E4XH 2DLEA 4Y7MA 1RURH 3QEGH 3VXSE 1FL3B 3LRSA 4M6NL 4S1QH 4IRJB 3B5GA 4GQ9L 3C2AH 3SCMB 2HT4C 4H0GA 4LLYB 1TTUA 2D7QA 4BQCA 4GAJH 3VI3F 5D8JH 1IEAA 5JIHA 5TGBA 1FIEA 1TETL 1LP9A 4CJ1A 4MB3A 4M7LT 2ZKHH 3G6AB 1QFWH 3RUGE 1KULA 4DUWA 5JA9A 1Q94A 5DJXB 5ABDE 3BEVA 1U0QA 2H3NB 2DI9A 3AU1B 1EAJA 3F58H 4U7KA 3LIZL 2V2TA 2ATKA 1VFMA 2F58H 1FDLL 3MYZA 5I1DA 4HK3J 5E6YA 4C83B 2H45A 4EVNA 3QNZA 2YD5A 8FABB 4KV5F 4PRNA 2FX8L 2UZYB 2I9TB 4HBCH 5FIEA 3O6LL 4GMTL 1K8DA 3ROOB 2VLJD 1TJHH 4BK4A 5C0GA 1DQQA 2NY3C 3GSXA 4EUPB 1F4AA 4O00A 4EN3C 1KTDA 4HCRA 1WV7T 3O2DA 3VFSB 4AH2A 4AG4H 1YDPA 2QQKH 3OG6B 3UTPE 3DX9A 4XNZC 4FTVA 5HYFA 3C5SB 2UZXB 4L9DA 4LCIL 3L3DB 3RBSA 3OKKB 4EI5B 3RU8L 4GRMB 1UYWH 5AUMA 1QRNE 1E4KA 5HI4C 2JIXB 1JNHB 1NBZA 3JTSB 4XX1E 4P2CG 3U9UA 1N6UA 3D3VB 2IG2L 4AIZB 1DFBL 3VFUB 2AEQH 1RJCA 2DJSA 4PJGB 5I71C 3PNWB 2ZPKH 5E7BA 3VXMD 1FCGA 4B7LA 1YJDC 2HMIC 3LQAC 4HKXA 4JJ5A 1VGEH 2EC9T 1MH5B 3VFTB 1QBLL 5GGSA 4KKLC 2GI7A 3IDIB 2E9WA 3I9GH 3ILPB 5CEZH 1T66D 3K81A 1A0QH 4OLXL 1C7TA 5I76A 5TFSH 4PJ8B 2AERT 3BW9B 4U31A 1ZGLP 1XMWA 3FO9A 5DRXB 4K3HA 4U1GB 4M7JH 4WY7H 1DLHA 4L8SC 3ABZA 4AIOA 3HLAB 1QHPA 3S36H 3WS3B 2QV2A 4NYLA 5ID1B 3BP7B 3ULVD 3M45A 5BRZB 1JK8B 5D7LE 4HMCA 5EU7E 5C0CB 4HKBB 5JW5A 1S7QA 4NKOA 4JO2H 1A1OA 4OB5H 5I30H 1FPTL 3K4AA 2PKDA 4D9LL 4PJBB 2PTUA 3Q6GH 3HRPA 1WWWX 3BFOA 3NOIA 5FDWB 5GRVL 1XF1A 2DTML 5FKPB 1CFQA 2LAGB 3HMXA 3RIAK 3EZJB 1XAUA 1IAKA 5EO9B 4PJ7F 5F1NA 5DD3L 4K94C 2GQHA 2UYLB 5KG9B 1GYAA 4JZOA 1XGRA 4X4YA 4RFNB 3VJ6A 2DBLL 3KR3L 4QXUH 4M03A 5FAAA 4G8GA 1MHEB 2J7LA 3CDGB 5HJ3B 1QPXA 3PGDA 5KBNC 2H2PD 3HC4L 1JHKH 2I07A 1PKQE 4OUOA 2VZ3A 4UQ3A 3O41B 4YFDB 4JFEB 4QRSA 3V4VH 4OTXH 4PJ5A 1HXYA 3GSWA 4W70A 3VXPB 3D87B 1FGNH 3RVUD 4Y2DB 3TJEL 2AP2A 3GGWB 1MCIA 2IFGA 3ULUF 5HY9A 1HWGB 4QRRB 4KZEL 3VWKC 1V7MH 5CSZB 1DL7H 2DI7A 2XACC 2GITA 1SBBA 2FEEL 1N3NB 1IQDB 3VMOA 3TN0D 4XCNA 5CJOL 5BZWA 1T6WA 2LFGA 4NT6A 5JW4R 3QDMD 4MCZB 2E6PA 1CG9A 3CDCA 2MPAL 4L9LA 2NW3B 5CJ8A 4ODXA 4PJXB 1K85A 3OR7B 1L7IH 4L4VE 4NWUL 4WDIB 2DBJA 4YHOH 2BRQA 5H37G 3TNMA 1B4JH 5FGCB 3KPRA 4M6OL 4PG2A 4U6YA 1HZHL 5HHOB 2Z8VC 4MX7A 3VFPA 1RJYA 3P4OA 5HYSG 1QQDA 3KPLB 2G9HA 3D0LB 2IC2A 1NUFA 3QDGA 1Q8MA 4RFEA 2EE3A 1R3HA 3KYNB 2Z92B 5DZOA 3TCLA 4EI6B 4JQIH 3WFEH 4U1LB 4UMGA 3F65A 3TVMD 2E27H 3V5KA 5C09D 5IB2B 3O6ML 3K74B 2OS7A 3S7GA 3T08A 1F42A 4I3GA 5FDYA 5ALBL 3VRIA 4PJIB 3WEXA 1MI5A 5AWNL 4YXKL 3DO7A 1JGDB 3EYUH 4XH2B 1MUJB 1MCPH 3EYVA 1I1CA 3JVGA 4BSWB 5A2IH 1TJIL 2AEPH 2Q86A 3ARRA 5F6IC 4PYGA 4R0LA 4QHMB 4YHPB 4KI5C 2VN4A 5H8DA 4GBXC 3ARQA 2VSDA 1QR1B 1ONQB 3UBXI 5GSVB 3PWPB 3GIZH 2NY4C 4K71C 4ODVH 2NPLX 3S37L 5CINL 5C0AA 4XGZB 4RGND 3JWOL 2WUCL 4XNMB 4AMKH 5KS9E 4AL8L 2BHUA 1SVCP 1PQZB 4HCRL 3O2DL 5FV1L 1I7UB 1BFOA 2UVEA 4H88L 1J1OH 2M26A 4LAJH 3MRKA 2X70B 1ORQB 1AI1L 3G5XA 2CK0H 2CLZB 1VENA 2ICWI 2MCPH 4L1DA 3QXDA 1A6UL 3MLRL 3MZGB 1JPST 4WFEE 3H0TA 5JR1L</