1NTDA

Structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
b'TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGENGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase (nitric oxide(a))
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA02
4NAJA 2FT7A 3CVDA 2Q9OA 2XV3A 4GP5B 1L9OA 2IDSA 4P5SA 1JZHA 1NIFA 1PZAA 2B3IA 2X87A 1TEFA 3KW7A 1TKWA 5E9NA 1V55B 1PLAA 1W6WA 3S3CB 1R1CA 1QLEB 2UXGA 3EF4A 3UADA 6PAZA 5D4HA 4PCYA 2R7EA 2X88A 2XVBA 3AZUA 3FPXA 3NSDA 1BXUA 2P80A 1JZFA 2WO2B 3QPKA 3N55A 2YAQA 4AKQA 1ET8A 2GC4C 4HCGA 4YSQA 1M57B 3S3BB 1OOWA 2HZHA 1GS6X 1OF0A 2FJSA 2VMJA 5I28A 1WAEA 4HZ1A 2PPFA 3WKQA 4BDVB 5AFAA 1AZRA 1KBWA 1DZ0A 5B7EA 2BP0B 3G5WA 3V9EA 1SFDA 4BXVA 4YSCA 3PPSA 3TASA 3FQ1A 4A2GA 4HCIA 2DV6A 2MTAA 5LDUA 1BYPA 2XUWA 4MFHA 4E9TA 2ZWNA 3EH3B 2FT8A 3PCYA 2QDVA 4G72B 4BWTA 5A7EA 3AG2B 4YVNA 4YVUA 1V10A 1JZJA 3NJGA 2PPAA 1ET5A 3OMAB 1IUZA 2UXVA 4NB7A 3V9CA 1A4CA 2I7OA 1NZRA 4BXSV 1NPJA 2XWZA 4GP8B 4RH4A 1ZPUA 5B1BB 2I85A 1CYXA 2FT6A 3BVDB 1AS6A 1QHQA 4W1TA 3FPYA 4A2DA 1CYWA 1ZIAA 4E9SA 3OMIB 4Q8BA 2Y69B 2LLNA 3X1BA 4A2HA 3D12B 3T71A 1IC0A 2BW4A 1WA0X 2VM3A 5B7FA 4YSOA 4A67A 3IN0A 2XU9A 1A3ZA 2B08A 4DP1X 1E30A 4GP4B 3X1EA 2XV2A 1J5CA 5I6KA 1PY0A 3QJQB 2QT6A 5I6MA 2EIKB 5EHFA 3N2JA 1L9QA 1XB6A 2BZCA 3ABKB 3GYRA 3NSYA 3S3DB 2OJ1A 2UX7A 2UXTA 1M9WA 2VSMB 4DP7X 3UAEA 1GS7A 3MX0B 1J9TA 2A3TA 4DP6X 5AZUA 1OV8A 3NYKA 2UXFA 4W9ZA 1PZCA 2YQBA 3EHBB 2YAHA 4DPAX 2FNWA 2JKWA 4YSDA 3CDZA 1AR1B 4UANA 1CUOA 3ERXA 4TXVB 1JXFA 3NJLA 3NJJA 4BWWA 3T6XA 4KNSA 2GC7C 2HRHA 2GHZA 1JXGA 3NP3A 1KCWA 2UX6A 4KOCA 2XX1A 1NDTA 1YLBB 4AX3A 2QPDB 2XV0A 1PF3A 4HCFA 4GY4A 1TEGA 3HB3B 2WO3B 3PAZA 3TU6A 2IH9A 3GXUB 1XB3A 2BP8A 2IDUA 2PCYA 3WKPA 2J5WA 1KBVA 2IDTA 4E9YA 3ABLB 1E5ZA 3S8FB 3MBWB 3X2QB 1SFHA 5B1AB 1GW0A 1IBYA 1J9RA 3FSZA 4AI7A 2BWDA 3OM3B 3JTBA 3T6ZA 1MZYA 4E9XA 1PAZA 2IWFA 1E65A 1GS8A 3SQRA 3AG4B 4AZUA 4YSSA 2DY2A 1RZQA 3TBCA 2HRGA 1KGYE 1NIAA 2GI0A 2HLEB 1CC3A 1ZDSA 4KO6A 5I5MA 3PXLA 4X4KA 4CSPA 1E5YA 3DIVA 2NRDA 2BHFA 2W88A 1GSKA 3DKHA 4DP2X 3CG8A 4ZK8A 1A65A 3UGEA 2CBPA 3FQYA 1NICA 1SF3A 1SHXA 4A68A 3WI9A 2PP9A 3CDZB 4JHVA 1EHKB 2H5UA 2GIMA 2YXVA 2PP7A 1BQRA 1VLXA 3EH5B 1AOZA 3OMNB 3FU8A 4WTQA 2EILB 3T6WA 1AZNA 2IWKA 4A2EA 3QJVB 2AZUA 3NJNA 6PCYA 3AW5A 4GXFA 3WG7B 1BQ5A 2YAOA 4P5RA 3ZBMA 4N8UA 1JERA 3IEAA 5PAZA 2FQGA 4BK5C 3NJMA 5ANHA 1AS7A 2CJ3A 2J57A 4UF7C 1ASPA 3NP4A 2QDWA 5I6OA 4F2FA 4G70B 4DPBX 3OD3A 1ASOA 4AKOA 2BP8B 2IAAC 2CCWA 3FSAA 1NINA 3QQXA 1ET7A 2EIMB 2PPDA 4KO7A 1GR7A 3CVBA 1OCRB 4HHWA 5F7BA 3NJFA 3QJSB 3FU9A 5B1KA 1OE3A 2XYBA 2AFNA 1T5KA 4YSEA 2FQEA 3EH4B 3CVCA 1HAWA 2BW5A 1AQ8A 1A8ZA 2WSDA 3C75A 1OE1A 2AVFA 2BZ7A 1L9PA 1KV7A 2IDFA 2R7EB 3AG3B 1OE2A 3FQ2A 2HXAA 3FU7A 2ZOOA 4G7QB 3T6VA 4HALA 4E9WA 2DYRB 3ASNB 1X9RA 4KNTA 3FS9A 3QJUB 5PCYA 4DPCX 4JKNA 1PLCA 2VN3A 4GYBA 2HX8A 1JVLA 3WNIA 4Q89A 4QKTA 2YAPA 2XLLA 4CSZA 3ZDWA 2FQFA 2RACA 1SDDA 2EIJB 2IH8A 1W8EA 2CAKA 1AACA 5I26A 5B3SB 3NT0A 3QJTB 2AANA 1BEXA 4FAAB 2I7SA 4BDVA 4E9QA 1BXAA 1L9RA 4E9VA 2OCCB 2BP0A 1BYOA 1V54B 2EINB 1FFTB 1ZDQA 4G71B 2YAFA 4DP0X 1SNRA 3S8GB 1A4AA 1XB8A 3NJKA 3JT2A 3BQVA 1J5DA 2PP8A 4DP5X 4DP4X 4N4YB 1NIBA 4JHUA 3X1GA 1N70A 4L0PB 1N68A 4EF3A 1PLBA 1ADWA 1BAWA 5TK2A 1JVOA 4A66A 1AS8A 1ETJA 1WA2X 1KDIA 1URIA 3H56A 3SBRA 3T9WA 1NWOA 1FA4A 1A4BA 3ABMB 3FT0A 2XXGA 2IDQA 4DP8X 2GSMB 4NERA 3UACA 1B3IA 5B1JC 1AIZA 2DWTA 1MG3C 1BQKA 2BWIA 5AKRA 1SHWA 2BO0A 3WIAA 3TA4D 1L9TA 4G7SB 2MRYA 4KO5A 2PLTA 3CZUB 2AZAA 2GBAA 1RKRA 3TBBA 3ZIYA 1MDAA 8PAZA 2QPEB 1AZCA 3ABGA 1L9SA 1AG0A 2VSKB 7PAZA 3FU7B 2YAMA 5I5JA 2W8CA 1HFUA 5B1JA 1ILSA 3ZX1A 1AAJA 4PAZA 4KOBA 2DWSA 1PMYA 1NWPA 1SDDB 5F7AA 2J55A 5D4JA 1AG6A 3NSFA 7PCYA 4G7RB 3KW8A 1MG2C 1IKOP 3IN2A 1GYCA 4YSUA 1EZLA 9PCYA 2VM4A 4YL4A 1AANA 4E9RA 2PPEA 1JZGA 1F56A 4F2EA 4HIPA 5I5IA 5TK4A 1NTDA 3OQRA 3SBQA 1SF5A 1M56B 4UAHA 2YXWA 1JZEA 3UAAA 4YSAA 2PCFA 4DP9X 4K9JA 3X1NA 4HAKA 1XMEB 1ZV2A 5IY5B 3PAUA 1RCYA 2PPCA 1ZIBA 1I53A 5FC9A 1ID2A 1GY2A 2Y1AA 3FYEB 5D4IA 4AKPA 2JFCA 1AZUA 3PAVA 1RZPA 3DTUB 2XX0A 4FA7B 2IWEA 1NIDA 2H47C 2YARA 1NPNA 4HHGA 2ZXWB 5I6LA 1PCSA 3SBPA 4WKXA 2N0MA 3FSWA 1IBZA 2FQDA 2FWLB 3U25A 5B7MA 1CURA 1J9SA 2FTAA 2VW6A 3IE9A 5I6NA 3GDCA 2HX7A 1WS8A 2TSAA 1WS7A 2TSBA 3H4FA 1PZBA 1JXDA 4YSTA 1ASQA 1UATA 1AZBA 3NJIA 1DYZA 3WNJA 1QNIA 1TU2A 1J9QA 2YAEA 4A2FA 3AG1B 3HEIB 3QJRB 4YSRA 1KYAA 1WA1X 1GY1A 4KO9A 3PLYA 2VW4A 2Q5BA 2GB2A 4KNUA 1KCBA 3NJHA 3RYMA 3NSCA 3FSVA 1NIEA 1BXVA 1ILUA 3AY2A 1SJMA 3FYIB 3X1FA 2H3XC 4QLWA 3ASOB 2CUAA 1W6LA 2JXMA 2ZONA 4F7KA 1FWXA 1PNDA 1OCZB 2HX9A 1HAUA 2J56A 2E86A 4M3HA 2CALA 1PNCA 2DYSB 2VW7A 1X9UA 3UABA 4M4RB 1KDJA 1MZZA 5I6PA 3L45A 4ENZA 3H4HA 2P80D 1JZIA 4YSPA 4BWUA 2XXFA 2OV0A 1E67A 1JOIA 1OCCB 1OCOB 3IBOA
chains in the Genus database with same CATH superfamily
1KCSL 1RK1B 4UV4H 3SPCA 3EHBD 2Y25A 2DLGA 4FQPA 1JK8B 3HTLX 5LUMA 3EBHA 3TH4T 1EFXA 1VZIA 1NIFA 2YUZA 2CK2A 5AVYB 1OGAE 3QC5X 4BGLA 3O6KL 4IKNA 3VYPA 3ZTJH 1TF4A 1UQSA 1ITBB 3EF4A 4WO4D 3MODL 3VFNA 3UADA 1OD9A 4LRIC 4H1LB 2X6UA 5BZDB 4J3OD 2R59A 3O45A 1G0XA 1ZLVK 4EN3A 1HHHB 3QUXB 4QRSB 4JFFB 3QFJB 2WO2B 4NT6A 3BE1H 4LLYA 3QIBA 3QZLA 4H5SA 4QWWD 4F37F 2FEEL 4S0SD 1S7QA 3SKJL 1IC5L 2X4RB 4GXUN 2QQLH 1JD7A 3OKDB 4QD2E 4ZODA 1S9XA 1C1EH 5B1CA 1T2QH 4QRUB 2D7TH 3NFPA 5IBLC 5IB1A 5C7ZA 3WE1A 5C9JB 5IEKA 5GRVL 1O75A 4UBDC 3L95A 1U91A 2BP0B 2MKWA 3D3VA 4MHHG 2Z34A 5CEYB 2VXUL 1JPTL 3FQ1A 1OB0A 2ORBH 4N2OA 1P1VA 3O3DB 1LEKA 2V7NA 2FT8A 2FBOJ 4NI3A 4LL4A 3AG2B 4NZRH 2DICA 4FTVB 3VFPA 5C1MB 4DO5A 3NCJL 2R56L 3F01A 1BFSA 2HTKD 4KFZC 3FCGA 2WXFA 4URTB 4BXSV 1CFSA 2EVHA 1EAOA 1YEGL 4WTZG 4HK0B 5I1KL 3A0OA 1KB5L 1NL0L 3BWUF 4NWUH 4KXCA 4G80B 3GHBL 4Z5RB 3RL1A 6CGTA 3L08A 1JGVH 3ARBC 2FLBT 2RHEA 3OQ3B 3P11H 4OV6F 4UM8A 1PLGH 3FUEA 3T71A 1NFDF 1G9ML 1OW0C 2G60H 3CLEL 3IJHA 4LKXA 3LY6A 3LKOA 5B7FA 1N5YH 5EIVA 2VDLB 4PRPE 3NFNB 2AJ3B 4HLJA 3T2OA 1PFOA 5E7BA 4PJCF 3T8XA 1C12A 4OCMC 3DHUA 3C8KA 3IJYA 2VRKA 3R1GH 1B9ZA 4R6UA 4Y7OC 1OIOA 4BZ1H 2J8OA 2VR5A 3W11D 5MHSE 3FCTA 4PRHD 4QXTB 4KXBA 3WJLC 3ROOA 4QHMB 3TBVB 4EN2A 1VACA 2TRHA 5IOPB 3RPBA 4KH9A 3MLXL 4ES8A 3ULUL 4P46D 3NACH 2BNQB 3MOBH 5JW4R 4I48B 1PZCA 4A7SA 5L4IA 3WV0A 3APCA 3D9AL 2VR7A 3FTXA 5BZXA 1MLBB 1TYJA 1PU0A 1T83A 4O2EA 2P5WE 1U58B 4C58B 1BV8A 1U2HA 4ZMVA 2WYHA 5BJTA 2G3XA 4WI4A 1OTSC 1YHPA 3HC2A 3GB7A 3ZTNH 3ZT5A 5K1JA 5L8KB 1HKLH 1M7IA 3FULA 1U8LA 5IUCA 4KGLA 2WCGA 5KBNC 2LVCA 1FBIH 4U0RC 3KPSA 3K91A 2ZCLL 4F7PB 4JANA 2BHUA 1EDQA 5DJ2A 3QEQD 1H0DA 5TDPA 1GZQB 5E4EC 4AYFB 5D4QA 2WLLB 4JDEA 2J5WA 4X5RA 3Q3GA 1HIML 4TUUA 5F7FA 2BMKA 2KZ1B 4U1NB 4ZUWA 5DZVA 3VFUB 5KN5A 5J9PB 2IMNA 4IGBD 4L37B 3TS8A 1FE8L 4FLHA 4FL4C 3PRZA 4LFHD 1ODUA 1IAKB 4K3DH 5GGUB 1ZLUH 4FABH 3ECVA 2B1OA 2HFGL 1XF5B 1XQ4A 2Z93B 1HU8A 5C3TA 5IGXL 3QUYC 3O6FB 3D85A 1OM9A 3FHQA 4HD9A 3FO2A 4QRPE 4YGAB 2XBZA 5HHOB 3ARFD 3RFZA 4M1CD 4TMPA 4S1SH 3HE7A 3MBXL 1I1AC 2VSCA 4L23A 1WZLA 1MW3A 1NAKL 1TMQA 4RGNB 2GI7A 2BSRA 5C0GA 4ZFOL 3VWJC 5L2KA 1I7ZA 4OFVA 2C1OB 4ORGB 2EDNA 4HUWA 2UY6A 4QRRB 3JUYA 4U2ZA 2VQ1B 4MA8H 4OIAA 5IT2H 2XG5A 3ECBB 1FN4B 4XNQA 4QHNB 4S11A 2AJUL 4X5PA 4ZFFB 3ETBF 3I6LD 4GQZA 4DUVA 1EHKB 2GIMA 5DT1L 2JXMB 3UX9B 1F58H 3VCLA 5IW6B 2TAAA 4NZ8A 5DUPH 1DVZA 2MQGA 4OZGE 3W3BA 1YSOA 1KCSH 2YMXL 2ZOUA 3UIZA 4L9LA 3UBXG 2AZUA 3NJNA 1P7QA 1ZLWK 2JKIS 4PJXF 5F72S 5BQ7B 3PDDA 4HIJB 1TXKA 2EIZA 4P5RA 3WHXA 4G42B 5EFIB 3T2NL 5HPOA 3OGOE 3O6KH 1S2EA 5DSCB 1MEXL 1CFVL 5JQIB 2D8KA 2XN0A 3HHSA 1UFGA 3DSNB 5ICZA 3MODH 1F4YL 1IAIM 5LN4A 5ICXB 4XVUC 1TLMA 5H2BA 2VOTA 1AYRA 4NQUA 1S7RB 1HCYA 1SJXA 5I0VA 1KPUB 2EIMB 1EDYA 4LSSL 4NDMB 3BRDA 2M8XA 4KKZA 1M1SA 1AGCA 1TNNA 4NQVA 4MJ4A 4EI6B 1QLRB 2BSTB 3SKJH 1IC5H 4EJ1C 1FPTH 4HAFA 3L3HA 1AD9A 2YD9A 3G5ZB 5I71B 3S5LA 1KV7A 3AG3B 1N67A 4MDJA 1DBKL 2ZSVA 3ZGHA 1B88A 3BSZA 3V0AC 3IXAB 3R06B 2VXUH 4MJ6B 4G8EB 3P77B 1JPTH 4OAWA 4YK4B 4AM0B 4HOWA 5D1ZD 3UJTL 5E8OA 2YEQA 1MRDL 3G5VB 3HZMA 4QKTA 3MRKB 4XMZA 1S9WB 1SDDA 1Z5YD 2EZ0D 4F57L 3BFOA 1RH8A 3JWDH 5IWLC 4P2QD 5ADPL 2IPKB 2APXA 1DVFB 1PX4A 3NCJH 1KB5A 2WBKA 2R56H 2WD0A 4Q14A 3NT0A 2BWQA 4MXQC 1YEGH 4RIRA 2Q6WB 3BUDA 1AHKA 3PWPE 4HJUA 5I1KH 4HIXL 1WICA 3DRQB 1NL0H 4GKOA 5EMYA 2AK1L 4NC2B 3GHBH 3U4AA 1K5NA 3DUSA 1S7SB 5C92A 4GKNA 1BAFL 2CPUA 1PSKL 3BRGC 2NSQA 5I16A 4FJ6A 5E08H 1NIBA 4FQXD 2DRUA 1N70A 1G9MH 2D03L 2LTQC 3CLEH 3M1BA 4AIZB 1FYTE 1RY7B 2QGDA 3VX0A 5ADOL 3ZTEA 5IBTL 4E42B 3FQWB 4XBEL 3OLDA 1YMMB 5IB5A 2CHDA 3FQNA 3IRZA 4HIHA 4BH8A 4YGVB 4C47A 5FYLE 5C0FA 2NY0B 4HULB 4JO4L 1QQDA 2V2WA 4LCUB 2W9DL 2BCKA 2TRYA 4GPVA 5IMLA 3IDYC 3MLXH 4GIOA 3ULUH 4PJGE 1B0RB 2ZP9A 2NW2B 3H9HB 2A4EA 2Z7WA 3EDEA 4HP5A 2EDJA 2G0LA 4Q2ZB 4QAWA 1XEDA 3D9AH 3K2KA 4M6NH 1T1YB 1U8JA 5I5JA 1N18A 1MW0A 4OBSA 1KULA 1TTFA 3N91A 5E4AA 5AVVB 1GJIA 5DJYB 4S2SB 1AH1A 4F8OA 5GS3A 4PW4A 3MUJA 4Y2DD 1C7TA 2YRLA 2P1YA 5E6ID 3JV0A 4X4ME 1OOAA 4IM8A 4N6RB 2P5ED 4R4BA 1JV2B 4LCWD 5F7AA 1AG6A 2C9RA 2R9HC 1Z9SB 3FB8B 4CW1B 1KWGA 4A7QA 3GRGA 4JN2A 1GYCA 3HG2A 1ZVYA 4YL4A 4C8XA 3KVQA 5DJ6B 2VXQL 5EO0A 2I24N 4HEPA 1HIMH 1YUKB 3R18A 5J1AB 5I1EL 3E6HB 4B9IA 5JOPD 3Q2VA 3PL6A 5E24E 2PYED 4X6CF 3ABZA 1FE8H 4HIIB 1XMEB 2F7IA 2PPCA 1JMXA 1KPVB 2G9HB 1XH3A 1O7DC 2AXGA 4P5TC 5J57B 1U6AH 4PJ5A 3B3IB 3NDYE 4X6DA 5BRQA 1BW8A 2AXHA 4D0BB 4AQAB 5IGXH 2XX0A 4ISVA 5FYJU 2HVKA 1BD2A 5DJ0B 3JTSB 4PV9A 1BWWA 4WKXA 3CBKB 3MBXH 1J9SA 3ARDA 3WIFB 1NAKH 4WW2F 1L9NA 3DC0A 1PZBA 3U7YL 1A9BB 1TVBA 4KROD 3QZPA 1TYRA 3J27A 3VDCA 1PW3A 1UATA 3VH8G 1T3FA 4Z7OE 2F53A 1AO7D 4H20H 4HIEA 2ZWSA 4LF3B 2YA0A 1XF3A 2F8OA 2JQAA 5CGTA 3MLPA 1FNLA 3B6SA 2X42A 2VXTL 4ETYA 3K6SB 3L5XL 1MHEB 3EO0A 3ENEA 5DT1H 1T04B 5LQBL 1D5XB 1L6PA 4KHXH 3L4YA 4PJ6A 4KITB 4I87A 1EEUA 1UVQA 3GEFA 4KRNA 2R1XA 4QRFA 1IKFL 1W16A 3FSVA 1MLCB 3PDGA 4WI0A 4X7TA 5AOLA 4WCYL 1RJYA 3WJMB 4XTRD 2F61A 5CEXB 2QPUA 5F3HB 3L5JA 3T2NH 3EOYG 1SVZA 1MCQA 3Q1SL 1DANU 1CFVH 1MEXH 3IK2A 4P2OB 3DX8B 2R2CA 1W6LA 1G9NL 1XAKA 1F4YH 2BSEA 1V3KA 2B59A 1OLZA 4N0CC 3VWKD 2NUTA 1GCFA 1PFCA 4LSSH 4NYLB 2E86A 3X14A 4A39A 3MRBA 5MERB 3BP7B 4HGKC 5ALBL 4M4RB 4JFQA 3DMMD 4O51B 1HZLA 4P99A 3VFGL 2X4UB 2P80D 1R3LB 3BD4A 5EOCJ 1FO0L 2OV0A 2CSPA 1NOAA 3CBJB 2A4CA 3ARSA 1DBKH 2MWCA 3NJVA 3UPRB 1JWUA 2RB8A 3QZMA 1KN4L 2WB7A 1S9VA 4BQ6A 2IDSA 3MRDB 2H9GB 4CMHB 2OSLA 3HI5L 3UTSE 3VE0B 8FABA 3UJTH 5E9NA 1VEPA 2I9TA 1MRDH 1AOHA 4N86A 1N8OE 2UXGA 4F57H 1S9YB 1LD9B 1M71A 4PSRA 5ADPH 4UQEA 1RD6A 5CSGA 5D4HA 3KYOA 25C8L 5I6XB 3RRQA 3GSOA 4R96A 4PS4H 1OAJA 2R29A 3PGDA 5J89A 2ARWA 3QO1A 5GZOC 1NCTA 4HIXH 3HZVB 4Y88A 5KVFE 1IV8A 4MDRA 1TDQA 1M57B 2XWXA 4HG4K 2HWZH 1A14L 1BAFH 4X83A 5I19L 1PSKH 3AMLA 4WDIB 1XXFC 2Q7YB 2FUQA 1T1ZA 3IFNL 1KYOJ 3RY6C 2AV1B 2ISDA 3RVTD 2NLJB 1PZ2A 1D6VL 2D03H 4MCZA 3ZKQD 4PI0A 5ADOH 3V9EA 1JHTA 5IBTH 1SMDA 1Q94A 1T1WA 4XBEH 1IFRA 3RDTA 5JYMA 1SJHB 1HT6A 1NCGA 2NZIA 4RDBA 2X2IA 4MFHA 2NXYD 2Y6SC 2ZWNA 3P4NA 1UH2A 5AG8A 1ZXQA 1SUHA 3H9YA 1I8LC 3B2DC 3F7YB 4ONHB 2APBA 2C34A 4HC1L 2WTRA 1ODAA 5FOJA 3PUCA 2EDQA 3QO0B 4JO4H 1NZRA 1HZHL 3MFGB 3O6FC 2GIYA 2W9DH 2VR4A 3RWCB 5T3XE 1TETL 4S10A 5D7LE 1XV8A 3ET9F 1N3NB 4B7LA 2Z8WC 3MNVB 2DF3A 3DETC 3GIVA 4FGMA 4HJTA 4RGNC 5FM4A 1EHLL 1ZANL 2A83A 5DURD 1W91A 4WGVB 5AB0A 1MJ8L 4D3CL 4TNWF 5DFVC 3L3OA 1S5HB 1USQA 4ZRGA 1HHJA 4Z7VE 4O58L 3RZCC 4LLDB 3VA2C 3IJEA 5K33A 2K6YA 2AK4A 4PJFF 2WKOF 2J6EL 2CRZA 2JKRM 3WNLA 4GP4B 3DK2A 1IKNA 2UUDH 2VXQA 2G2RB 2MFNA 3GUTB 5AW6B 2HTLD 1J5CA 2BVUA 4OCYL 5A7BA 4HHAA 3BN9C 3VI3E 4KRPD 1N9PA 3EYQC 4EIBA 3N2JA 5AKTA 2BZCA 4CC4A 4PJHB 5D7KE 2VXQH 2UXTA 2JKJA 3PP4L 1KXTA 4QGTA 3T4YB 5I1EH 1FORL 4MQTB 2BNRA 1OWWA 5L2JB 2YQBA 2VC2B 3CFBB 4LSQH 1IEBB 3P02A 2XN9D 4JDZB 1OKEA 4Y4KD 4YUEL 2A74B 3NIDE 4MCMA 4TXVB 3U4EB 1XGUA 1HHKA 1BPVA 3T6QC 3QUKB 4OLWL 2NY3B 3QORD 4HAGA 4GJTB 1GIGL 3DPBA 1U3HB 1OVZA 2J8UF 3RJOA 5JHDE 4J3OG 3O3EB 1PF3A 3C6LA 3VU1A 5AW4B 3CFQA 3LRSA 3NJXA 4LSPL 3RNKB 3KL5A 1KN2H 4YWGL 4GUCA 3U7YH 4JFTA 5DS8B 4PBVC 1R24B 2IDUA 3RUGA 2C3WA 4EI0A 3QR0A 5AVWB 1NGXA 4IHOB 4XVOA 4N0FB 2VXTH 3Q8CA 1HWWA 1DN0B 3L5XH 3NZUA 4FFWD 4F7TB 3CZGA 5DWPA 1P7HL 2XFGB 1DVFC 4GSQA 3GMOB 4QHPA 1M7XA 4M61A 1WFIA 3LKQA 4NRYA 3T6ZA 2XI9A 3HB3D 5DGQA 3CSBA 1PQZA 4XBGB 1IKFH 2VAAB 3D3VE 3V52L 2D7MA 2VSDA 3KVDD 4KTGA 3FH8A 4WCYH 4ZXBA 5I1DB 3ROLA 5AW1B 1AKJA 2X4SB 4KY1H 3TYGL 3Q1SH 1YDPB 4U7MA 5E94A 3V4UL 4AW7A 2F7OA 3AMKA 4JRXD 2Q8AH 1O9WA 3AREC 5DHMC 3IXTB 3UMNA 4RNRB 3U0WL 2DQ6A 3B2XA 2F08A 5INCB 4KV5E 4JUTA 2JE8A 4OVUA 4PJFE 2P44B 1U8HB 1FO0A 4OGAD 1E90A 2DL2A 3DVGA 5DI8A 4GUOA 3WDJA 3JTTB 2PP9A 1W2KT 2X6VA 1VFAA 3QVAA 3REWB 2HJFB 4K71B 3VFGH 4Q9QL 1QWHA 1PGRB 1FO0H 4NZJA 2DEXX 2E9JA 1HOCA 4A6YL 3OMNB 3QNZB 4PJAA 4PJIB 2OR8A 2UY7B 2PYFA 3CMOL 4FXGA 1KN4H 2ZX6A 4AEFA 5KW9L 4DKFL 3HI5H 4AMXA 1RK0A 3U1QA 2KH2B 3TEZA 2DMGA 2YD1A 3MRIA 3DGGB 1JS4A 3IDXL 1J5HA 5F6IB 5CLXA 1RUMH 3WENA 4G70B 1YY9D 4Y2OB 3BHBA 25C8H 3V6BR 5HI5D 4QEGA 1MFDL 4Z3GA 1CDHA 4XMTA 3RJQB 3OKMA 2IALB 1KGCD 2QVTA 5F44A 1IBDA 2BS8A 1E4JA 2RFXA 5GGVL 2WYIA 5E23A 2ZKMX 4F8LA 5LKNA 2OXGB 3CVCA 2NPLX 3ME0A 2BW5A 5JZ7C 4MD0B 2WSDA 3ZZQA 4PG2C 5I19H 5FGRA 3IFNH 3UAJA 4XP4L 1QA9A 2DIEA 3QFDB 3ZIMA 1FGVH 4L29B 3NZHH 4NUJB 1D6VH 2ED7A 4NKIL 1NGQL 3PFUA 5EO1A 3T1FB 1F42A 2F54B 2HG5A 4BQ9A 4H2AA 4OF3A 1MSPA 1CO1A 3MMEB 4HC1A 2HX8A 1JVLA 2P49B 3KPSE 3PJSA 4Q6IB 5DYOA 2XWDA 2RACA 4GUQA 3WUZA 1TIUA 4LVNC 3U2SA 4WWKA 1NAMA 4UZUA 1DQDL 3C8DA 4HC1H 4N9GB 3WYRA 3LPFA 3EFFA 4LFHG 2XZZA 4UOW0 5F0PB 5IVXF 1QSEA 1GTFA 2CDGB 4WY7L 4AZ8A 1BYOA 1V54B 4U3SA 3T65A 1TETH 1NLDH 1SXZA 1PYWB 1SOKA 4JFYA 3FB5A 1J8HB 3K6OA 2UV3A 1EHLH 4P5KA 1OANA 3VM7A 5DD0L 3BQVA 4NUGL 4EO5A 4HDIB 1MJ8H 3LEXA 4YLBA 5JW4M 1XF2A 2GJZA 4XXWA 1M2OA 2J6EA 2C3HA 4M1DL 3D34A 4GIAA 2QSCL 2YN3A 3BPNB 1HEHC 3Q5YA 4O58H 1KXVA 4FQLH 3GC3A 3OLEA 1DVTA 4H40A 4HISA 3T0AA 1ND0A 1X5MA 4KVNL 4XXDA 3HZYB 4PJ7A 4OCYH 3LXAA 3ZMRA 4NCDA 2PXYA 3VXRB 1JF5A 4HJGB 2EO1A 5L2KE 1MFUA 3QJFB 1YA5A 1HK6A 1YPZB 4MDIB 5EULV 5DR5L 3OAZH 4M29A 4Q9RL 3PP4H 1NEUA 1A6ZA 1L9MA 1FORH 5EU7E 4CN6A 3JV5A 3U0TB 1UZ8A 1ZJBA 5H35B 3VXMA 2JTDA 3MREB 3EHBC 4P2OC 3RWJB 3UJJL 4AITA 3IF1B 4Q9BA 3SBWC 2QPEB 1RUPL 1J8RA 1MOEA 3HI6L 4JDTL 4YUEH 4D9LL 4GAFB 2XA3A 3P73B 5D1XE 4NPKA 3TIDB 3BQUD 1M53A 1XTMA 2COQA 2PYEB 4XOBA 2WQSA 4OLWH 4RBPH 1NM4A 2KQMA 2XQYA 3N1GC 1GIGH 3ULUF 1WV7T 1JDCA 4H8UA 2KZWA 4E0RA 2EVJA 1RZJL 1WGVA 5A2LH 3BO8A 1SOXA 3QWNA 5HGBA 1UXWA 2VLRB 5AWNL 4J3OC 1KTLA 1NMCB 4I4WA 2DYPD 4I0PA 4TVUA 1DDHB 2VL4A 3ECWA 4LSPH 5D96B 1PKOA 5EBMB 3N50A 4QWWC 2CH8A 1E9QA 4YWGH 4DEWA 3UP6A 4ODWB 1BZQK 2EABA 4UQ2B 4D9QD 1LO4L 3MRRB 3G6JE 4MRCA 4JB9L 5HHVH 2OSYA 4MAUL 3OQRA 4GT7A 1Q9OA 4LHQB 4FEIA 4OIIL 3CFNA 2FO4B 4PRBA 1ZHKB 1QKZL 1DO5A 3D2UB 2J88L 1IGJA 2EACA 2J3SA 4PRAB 1AO7B 3E2HC 5I6XC 2JFCA 2D7PA 1Y6KR 1MH5B 2B9AA 3PAVA 4F3FA 4EZMA 2VABB 1K8IA 4IRJA 1RAMA 4L48A 5LBSL 3FRPA 3V52H 1WIOA 2CJUL 4HWBA 2PCPA 2YFOA 1ADQA 3IMUA 1XWVA 2HTKC 2PWFA 1T1XB 3V4UH 3KPOA 5AW5B 2AABL 4ZDHA 4DSYA 4GO8A 1XZWA 2WIIB 3IJSB 5C09B 5BXFA 3DPDA 3U0WH 3NVQA 1G0YR 4MB1A 3D7PA 1HILA 3U9WA 1GZHC 4OLUH 3DX7B 3TO4D 2G5UA 2ED9A 2P8PB 1DJZA 3VDAA 1A6WL 3NUKA 4NENB 4GSRA 4NPJA 4MS6A 4OCSH 4QO1A 3GUFA 3OWRA 1WA1X 4YFLI 4XPTL 4C57C 4X98B 2VW4A 3BLBA 4HH9A 4LK4A 3U1SL 3CVHH 5SWSE 4A6YH 4IU2A 4B53A 4XNUL 3UO1L 4PVBA 3CMOH 4KMQA 3CIQA 1KIPA 1DQQB 5D2NB 5KW9H 5GS0D 2FE0A 1AGBB 1E2WA 2GITB 3DGCR 1EAPB 1VESA 4Y19A 3IDXH 2H3XC 2B9BA 4D0CB 4MJIB 1KXHA 3OB0H 3W57A 3LEYL 2OYLA 3UBGA 5F89B 1MFMA 3ULUE 5I15L 1MFDH 2XKSA 3DARA 1LQSR 3JWOC 3L1OL 1WFMA 2DYSB 2C7FA 5F7HA 1QFPA 3UABA 4D7BA 4FERA 4F7EB 3US1A 2E27L 4QNPE 4AYSA 2Q20A 3S4SA 3GLDA 4KKAD 3HVNA 4L3EA 4NOFA 5TPWL 2NX5A 3KGUA 4XP4H 1OCOB 4CMMA 3QXWA 5JHLA 1F86A 1NGQH 5IB2A 4FC3E 3K5RA 1VRSA 2OBGA 1K4CB 1PZAA 1XR8B 5IIEA 4L18A 4H2CA 4PRIB 1PZUB 1R1CA 2JSFA 1XSKA 4RAUA 3TT3L 1A1OB 1WZAA 1DL7H 1DQDH 3Q9PA 1OB1B 1JAEA 4TLKA 1H5BB 2G4GA 1KT2A 4YE4H 3EXJA 1ZT7B 1DBML 4BHUA 4WY7H 3SGJA 1UKQA 1XH1A 1YVLA 4NUMA 4QJ4B 3NSDA 1BXUA 3BUPA 3PQYB 4DZBB 4QHUB 5JR1L 4J8QA 2QQNL 5J4MA 4AW4A 1KYFA 2Y7SA 2K4WA 3VJ6A 1R9FA 3ES6B 1HC1A 2X41A 5DD0H 4OUUB 4NUGH 5D5MA 2UZYA 3DXAE 4PJ5E 3ARFC 1WAEA 1KJ2B 1MFVA 4M1CC 4M1DH 4X6DE 5E8DL 5AAMA 4MD5B 3WKQA 4BDVB 2RQ8A 1OP5K 2QSCH 1FSKB 1DZ0A 3BCFA 1UH4A 5J0BA 2F7PA 3G5WA 2G3ZA 1BD2E 3F84A 1U9KA 3JBG7 4ELMF 3DURB 1O6SA 5F1IB 1XD1A 3FB6B 3D0VB 4P23B 4KBPA 4KVNH 3VFOA 2APSA 2LFEA 43C9B 3EH3B 3LN9A 1DP0A 2MCG1 1TMCB 5FLVA 3E6FA 2MKLC 3FZUD 4YFEA 3V9CA 4UOJA 5DR5H 3H6JA 3LQZA 3NQKA 4GW4B 3RQ3A 3V0JA 4Q9RH 1ZV9A 5I0WA 2KUTA 1T7YA 4V1DA 3QE5A 2AKRA 1KJ3L 3UJJH 2Q7AA 1RUPH 1ZPLA 3HI6H 4KK8D 4JDTH 1WHOA 3LV3B 4D9LH 5ID1B 4GQQA 3CDGA 3OMIB 4HZLA 3EF7A 4PRPD 2HT2D 1LVEA 2WXRA 2Z7ZA 1XZ0B 5FHBL 4DAGL 3R0MA 2BW4A 3HE6B 5E8PA 1RZJH 3NOIA 2XIBA 5DK0A 4UOZA 3IN0A 1G7QA 5AWNH 4JFEA 4L8DB 1H6TA 4KKQA 5MHSD 4K71C 1F1DA 2F74B 2GJPA 2VDMB 3FL7A 3SE6A 4ZQKB 3QORB 2OQJA 4ANVA 1S46A 1SYSA 3KBHE 1EBAA 4J3SA 4NZTL 4GAYB 3QJQB 1V5JA 3MRGB 1PTZA 3QCVL 1LO4H 4YJZL 1LNUB 4JB9H 1OL0A 1GAFH 1MUJB 4MAUH 1P9MA 1YNTB 2L4OA 4FQHA 4MXVF 1KPRA 1VGEL 4QR7A 2P5WD 3GXNA 2P26A 3D30A 1I8KB 2EXTA 3OVUB 2A73A 4OIIH 5F6IC 1A7NL 4ODHL 3FONA 5LBSA 4BFEA 2J88H 5D1ZC 2RH0A 5IJKA 1IIKA 4IS6B 4GXVL 3QIUD 5DJDA 1IEAB 5FYJL 4BWWA 4L8CB 2PTTA 2OSXA 3V4VH 4DUXA 1HJCA 5LBSH 2PTVA 4OZHF 4CNIA 2CJUH 3V5DA 2GY7B 4K7PY 4JG1L 3CPLA 4AX3A 4YHYC 2R23B 4U1HA 2XSKA 3BH4A 4NUPA 2XV0A 4L1BA 3GSWB 1YMHB 3HB3B 2FEEI 2AABH 2DM7A 5FV2A 1NQBA 1QWNA 3OAYH 4F8TA 3REVB 2WOBA 5DFAA 5IWLA 5EUOA 3AACA 2PCYA 4Z9KB 3FQUB 5DCCA 4AUYA 3LZLA 2V2TB 2FLMA 1KBVA 2DQIL 1MVYA 3VXSD 1RLWA 4JRXB 3QJHB 3N06B 3U9PL 5LAPA 3CMGA 1A6WH 1CFNB 2RD0A 3ISWA 1F97A 3HW7A 4Y5VC 5IROD 1NGYA 3X2QB 4XPTH 4XPFL 3VFVB 3IFPA 5HYFA 3U1SH 3QDGB 4EI5B 4XNUH 3JTBA 2NNXA 3CFEA 3NCXA 1INEL 1HI6B 4L1LA 3EFOB 4X99B 2EE3A 1MREL 4CBZA 1CTOA 2L3BA 4DFIA 5J5EA 2FHFA 4JKWA 2OZ4L 1U8IB 3UTTA 1VADB 2ESVE 2H0FA 2XTLA 1E8YA 3GZOA 4KTEL 2HRGA 2JKNA 5A2FA 2O6DA 2R27A 3LEYH 1ZLDA 3MLTB 4DJMA 2IGFL 4Z78B 1QBAA 5I15H 1P2CB 2J1YA 1JXKA 2DQCL 2OMTA 4IU3A 1QLEL 3ZPDA 1GKOA 3H1ZA 3L1OH 1NICA 1SF3A 4OY9A 5DHVH 3B2MA 5KOVC 3C60B 3JYBA 1MKFA 3MRJA 4B50A 5CU5A 2E27H 5J6HA 3WIIL 2YXVA 3CFKB 2XN1A 4XVSL 2OMXB 1SGKA 3U1PA 5TPWH 1DCEA 2Q2EB 5LGJB 2C9XA 5TQ2L 3Q43A 5DA4A 3LIUA 3MVSA 4Y2DC 4NJAH 3LB6D 4WKZA 3SY0A 3QNXB 3TFBA 1GW6A 4JLRB 3OHXB 5EN3A 2ZICA 3KYAA 3BUTA 2OULB 5ES4B 2AK4E 4KK5D 4Y4HA 3TN0D 2C26A 3TT3H 4UF7C 3WMPA 4J3UA 2XTJD 4L3AA 3BZ5A 4I3SL 3SDDB 2OTWA 2ZP8A 3TBTA 3KPNB 2BSDA 3OX8A 4ODUB 2CO7A 4I2XB 1JK8A 1OF2A 3PHSA 2XDHA 2DJSA 2E6PA 4ZMQA 2DKSA 2Z31B 3TA3D 3LKRA 2BNRE 4JFPA 4YSEA 3TH3T 3MRNB 5JR1H 1HX0A 1NMCC 5D96C 4DVBB 5GHWL 2FJUB 3ULSB 5I18L 3WTWA 4KNSA 3GBML 5CP3A 4KJYA 4OCNC 4LASL 4NP4L 5E8DH 4H1LA 3RVVD 2ADGB 5HVHB 5BZDA 1E5AA 5I1JL 3KWXA 3B9KA 4FF9A 4JPQA 2M2DA 3D5OF 4NKOB 1DVQA 1HHHA 5CP3H 2WVVA 3QUXA 1QSFD 3K6DA 4JFFA 4QRSA 1R3JB 2UWEB 2XY2A 3GLZA 4KROC 3SDXF 3GMPA 2WZ6A 4J4PD 5D7HA 3FU3A 1F4AA 2HMID 3PWPD 1U21A 2HFEB 1XO8A 3UGUA 4YHOL 1ZWIB 4QRUA 4MKMA 3RUGE 4DKTA 4OZFB 5C9JA 2R1WA 3SSGA 1U33A 3CSTA 3QR1A 2BP0A 5F3FA 4DKDC 4IBQA 3K5SA 1KJ3H 1FYTD 5I8KH 1YAZA 4ETQB 2DQUL 3O3DA 3P4LA 3O11A 1YJDL 4WHTB 3VSVA 4XTRC 2O6FA 2JLPA 1UUSA 2H3NB 2WVUA 4FTVA 5BZWB 3N1QC 4PLOB 5FHBH 3MV9D 3T2LA 3FTGB 1JL8A 2VH5L 4R7DB 4NFCA 5HYEA 1FZOB 2YD5A 1DFXA 4HK0A 5TK2A 4AE1A 1JVOA 4A66A 3T3PB 3CQFA 4M43L 2FR4A 3A5VA 2CGRL 1QP1A 3KWWB 4I1NB 2P5PA 4NRZA 4E41B 4A37A 1IGIL 4NZTH 3ZE1F 4JMNA 2R4SL 4K8RL 2IDQA 3SOBL 3QCVH 4WU5A 4R4ND 1B3IA 5HYQA 5DS1A 1INQA 5E1IA 3SGDH 4L4VA 5EDXA 2DYPB 1VGEH 3V7AE 3S96A 2Z8SA 2VDNL 4NBZB 4FQJL 3FFDB 5EU3B 1A7NH 4ODHH 3NFNA 8PAZA 2X3CA 1OY3B 2FWOB 4AQOA 2X89A 1JI2A 4KRMB 1GC1C 4ZBJA 2BX5A 3VI4F 2MNJB 2VSKB 3ARGD 4NNYB 3QUMB 5DD1H 5FLUA 4PJAE 3WNKA 4BQCA 2IO5A 4GXVH 5FYJH 2AJXL 2Y7OA 1W0VA 3V5HA 1H9DA 1I8UA 3EJJX 2NY2D 4GRLB 5DQ9B 2YHGA 5LG1A 4BFIA 3TBVA 4YBLC 5CAYB 2E9GA 2WVSA 5IOPA 4QHLB 3N9GL 2VLME 3HZKA 1F4WL 2BNQA 3EXLA 3B7UX 3WO3B 1N0LB 1QD0A 1RZ8B 1LK2B 2E5EA 2ZKWA 3IDIA 3KCPB 4AL8L 3E0GA 3QZBA 4N8CL 3WXWH 4QGYA 1MG2C 3IN2A 4OW6A 3CPUA 4YSUA 1AANA 1U58A 4E9RA 1KLUA 5IJVB 2DQIH 3SDXE 1MI5B 1NTDA 1NCWL 3U9PH 1WFOA 1T2JA 3NCYS 5FEBA 2QJDA 5CN3A 2IH3B 4G59C 3QH3A 3CFTA 3IJ8A 3X1NA 4XPFH 4OQTA 3LZRA 5E56A 2GW5A 1DHKA 2E6QA 4QYAA 2Y1AA 2OCJA 4EVNB 2OZ4A 3ZK0A 1GZQA 4G8AC 4PGCB 2BC4A 2VN6A 1AZUA 1INEH 3HKFA 2EUXA 3IMRA 3SE3C 4WSGA 5JW5A 1NIDA 1XSIA 2OZ4H 5A2AA 4HHGA 2J25A 4KTEH 4I88A 3LXUX 4U1NA 1T7XA 3AUWB 3VFUA 2FTAA 4L37A 5IQNA 4NEHB 5DXWA 3H0TB 4XBPB 2IGFH 2X5PA 1IAKA 1IGFL 5BS0B 3WKML 4EDXB 2DQCH 4RWYL 2VN7A 3KLAA 5ICYB 2CO2A 4HG4J 1QLEH 1XF5A 2Z93A 3LKPA 4Z76A 1IRAY 5KVMC 1MHHB 1IX2A 3O6FA 1I8MB 5A1AA 4P2CG 5C70A 4FYQA 5HHOA 3WIIH 2F5AL 1BA9A 1GY1A 2NNAB 4XVSH 1YN7A 2WINB 4Z3JA 5TQ2H 3UCRA 4OJYA 3HG5A 5E1AA 1F41A 2YPLE 4QDGA 3L8QA 1R17A 2C1OA 4PG9B 2HTLC 4M9PA 1BVLA 1FF5A 3CZSA 1J88A 4AK1A 4BKSC 4QRRA 3MYJB 4KRPC 4N8VB 2VQ1A 5DMYA 3IMBA 3EUDA 1OGAB 4JO3L 3VI4E 3ECBA 1I3RB 2BVQB 4H44C 4ZFFA 1NCOA 3QDJB 1EUUA 4MLSA 5DUBA 5IHWA 1S5IL 1SN0A 4PJ7E 2JXMA 3T0EE 5IW6A 4RFOL 4I3SH 2J2ZB 5G4NA 1H3TA 2WK2A 1A9EB 2PTUA 3QJOA 5F88A 2J56A 3WNMA 4FA6A 5BO0D 3SQBA 4GEJA 5IFJA 5IKCB 4I77L 1I8AA 1COBA 2CA3A 2ZWYA 3FFCB 1ACXA 3AXLA 3VD5A 2Y72A 5BQ7A 3VXME 4JFZL 4HIJA 4JQXA 3VD2A 4MX7B 2WQXA 4G42A 1MVFA 2YK1L 4PTUB 5EFIA 3QORC 3TGXA 2AEOA 1YC8A 4J6IA 5DSCA 5GHWH 3DV6B 4YSPA 3UTSD 3OKYA 5I18H 1QVOB 2X4QB 3DSNA 3GBMH 4ANWA 2WKLA 1J5OL 4LASH 5ICXA 5ABAA 4F1SA 5C3LD 5DFTA 1FVCB 2GUOB 1A4JB 5I1JH 1LE9A 5HYJB 3SD5A 1NANH 3HNTL 4JRFA 4P5SA 3LHPL 3NQIA 2AQPA 3VA6A 2W0LA 4XH2A 4EI6A 3KR3L 2BSTA 3ZVVA 2ICWJ 3D39E 2ALAA 5F21B 1U93A 5HDWA 4E5XG 3G5ZA 1ETA1 3OAUL 4YHOH 3FJTA 4C56E 2EE0A 2X88A 4JVPA 3UJIL 2LABA 3V8OA 3AU1B 4D2NA 1OT4A 1THCA 4YR6B 3NFSL 3IXAA 2E9BA 3P77A 4G8EA 5EPMB 4AM0A 4UDTB 4NJ9L 2E7DA 1IL1B 1NEZB 2CHNA 4NNXB 3HB3C 3CGTA 4NGHL 3VNZA 1U8PB 2DQUH 5AW3B 4ZO6A 2QHLA 1YJDH 1S9WA 3QDHA 1PL3A 5D6DC 3MNZA 3LMJL 2IPKA 2ERJB 4JHZA 2E46A 3NAAL 1DVFA 1I1FB 2F5BH 3RGVD 1FL6A 4WJ5A 3F6JA 4BSWB 3SYPA 1F6AB 4YDZA 3QQDA 2Q6WA 2DV6A 2EDOA 5H37A 4M43H 4BINA 4GB9A 1GTNA 1I3UA 2CGRH 2W92A 4TUKL 5JIIA 2X2HA 1MCEA 5C0EB 3VM5A 2WXLA 2GK2A 3IJ7A 1P5UB 1IGIH 5T3XD 4TNFA 4OGAC 4EI5C 2R4SH 4K8RH 3S2AA 2WO4A 1XCWA 5CO1A 4MA1C 3EGSB 3NA9L 5D7LD 1QX1A 3MN8A 3H3PL 4U6YA 5HI4D 4EQ3A 3AM8C 3T77A 1JBJA 1E42A 1E28B 4BSVB 2I85A 2NXZD 3BKCL 2VDNH 3F3HA 1QLFB 4E42A 2B20A 3KLLA 1C9SA 2KL6A 4FQJH 2DB8A 4LEOB 3QHFL 2D0GA 1XMWA 3MFFA 1CYWA 4PREB 2YKKA 4E9SA 5E8NB 4CKVX 2P5WB 4AYMC 4YGVA 3BT2L 4ZFZB 2AJXH 3OXRB 5J12C 3HS0B 1QI4A 3R4DA 3L9EA 2Y4SA 2E6JA 3THML 3C60C 1YY9C 4LCUA 2P8LB 4A67A 1ACZA 3N9GH 5D7KD 4Y19E 1B0RA 3H9HA 2NW2A 3WTSA 5DYFA 3SO3C 1WWBX 4TSBH 5DK3A 4F7CA 4WSKA 3SN6N 4Q2ZA 3ULVL 4N8CH 1PY0A 2F8IA 1T1YA 2XACC 3IWVA 5IHBA 4M8QB 2DD8L 5EOCL 3UAEA 3OHXC 5DJYA 5HGHA 1NCWH 2XTSA 3MPCA 4MB5A 4JQIA 2AXJA 4S2SA 5BZZA 2CNZA 1AXIB 4YSDA 5EN2A 4AQ1B 3CDZA 1EFXD 2ZKYA 2OMNA 1WHPA 4L3EE 4GS7C 4JJ5B 4N90E 3SGEI 1E9OB 2NX5E 2AMGA 2RGSA 2Z7YA 4MVBD 1UJTA 1Z9SA 2VZTA 1SHMA 1UKSA 4CW1A 1WPCA 3DA0A 3EOAB 4KKLC 4XNBA 2CIIB 1Q9LA 2GC7C 3F7QA 1F3DJ 4YHKL 4QRPB 5CBEB 2PCFB 1GGIL 3E6HA 5D7IA 4EN3D 1TEGA 2GJ6E 4GUPA 4EOWL 2XWRA 5KSAA 2XG4B 1HNYA 2R39A 1ZA6B 2I5YL 3MV7A 2G9HA 1KPVA 3VD7A 1IGFH 3WKMH 4RWYH 5HVHC 3VFMB 3DVIA 3FOMB 3B3IA 1F11A 2VC2L 3ZGIA 4HYTB 1HH9A 4AQAA 1KGUA 3NEOA 1Q4NX 4E9YA 3PPEA 3SKOB 3TEYA 3OKLA 3JTSA 1U3NA 4U6XB 1W80A 4J1UA 2F5AH 4B9CA 1OZUA 3D3VD 5F3BB 1TQWA 2LV4A 4K9EH 3K0YA 3WIFA 4OZGB 5JO5B 2BWDA 3MR9B 3QXDB 5JHBA 1A9BA 4UQAA 2IV8A 5MEPB 1Z32X 1E65A 3B8YA 1HYSD 4LPYA 3HAEB 4JO3H 5LGHL 4RWHA 2YXFA 1OGPA 1S5IH 1J86A 3GI8L 4IJTA 4WW1B 3RVXD 1T04A 3FCSB 4RFOH 4OFQA 5HYIA 5FA4A 1D5XA 5A6LA 4FHBD 4U31A 2BHFA 4PMEA 4WTXA 1EIBA 5HVFB 2H32A 4I77H 1W0WB 1W72L 2LU7A 3WHE0 3BQUC 1TQTA 4JFZH 4V1DE 4LDLB 1DEEA 2HA1A 2OZNA 2YK1H 5F3HA 1NPUA 1SXCA 2H32H 4Z1PA 1IQDB 4HKXB 1CYGA 3DX8A 4HLZH 3TVMD 2FL5A 1J5OH 2X70B 3FU8A 2UVEA 4RZCB 4X9YA 2IWKA 1A7BA 3L4VA 4O2FB 5AW7B 2IAMB 3HNTH 3LHPH 2QSVA 4NYLA 5A6MA 4PY7B 4Y89A 5MERA 4JFEE 4F15B 3BP7A 3KR3H 2X1PA 2FH6A 4TRPL 2C3XA 2BS71 3IKCB 2X4UA 3FBQA 3GLEA 4R5VA 3OAUH 3RL2A 1AXTL 2VLKA 1JGLL 3QXVA 5CZXD 3UJIH 1GYWA 4LAQH 3NFSH 4WNSA 1KCRL 3D4GA 3QP3A 2D0FA 5IW3A 4ALAC 3MRDA 2H9GA 2XYBA 3VE0A 4NJ9H 1UD8A 5SX5H 1TT6A 5EV7A 5EEXA 1C5BL 4FEMA 4U33A 4NGHH 3WLBA 1RZFL 4NQEE 1QO3A 4KFMA 1S9YA 2IDFA 1LD9A 2V7HA 1B0IA 4Z7QF 3LMJH 2DLTA 3TU6A 4B95C 3KPSD 4M62L 2OMVB 3NAAH 4OI9A 5M7QA 2FVNA 4IIQA 1WISA 3ESMA 1BQHA 3QJUB 4JZOB 4BE6A 2EECA 3O3UN 4NN7B 3JT0A 1OSEA 3BVTA 4IKKA 2K0RA 3HZVA 4TUKH 1WYJA 2XLLA 4FN0A 2CPCA 2I26N 1BWMA 2EIJB 2IH8A 3DRTB 4I89A 1H9VA 2CAKA 5D1QE 3SCMB 4BKLB 3NA9H 5FR3A 1AACA 3H3PH 4U3CA 3HRZC 5BPPA 4XHJD 3QNYB 5DGRA 2AANA 4YDNA 4FAAB 2NLJA 4HMEA 1CE6B 3ZE2E 5DQJA 2AGJL 3CFUA 5CSZA 5T3ZL 3BKCH 4JE0A 2X1WL 4Y1AB 3F58L 1ZE3C 1ROCA 2NTFB 3LOWA 1F3RB 1SJHA 3S8GB 3QG7L 4L1SA 3QHFH 2OMYB 2VMFA 4X9HA 3UZQA 3JT2A 5DA0B 1AQKL 3KPRA 4X42A 4ZMTA 1H6FA 5IHZB 5I76B 5C0AA 2WAQA 2H1XA 3F7YA 4ONHA 3HE7D 1CLOL 5GRXG 3QO0A 3DOSB 3KMDA 4FFVD 5L2KD 3ZR6A 3UTTE 2GG1A 1U8KB 1G1KA 3KPTA 1URIA 5ANME 4LP5A 2BIPA 2WUCL 1N3NA 2X6BA 5EBWB 5KYYB 3ULVH 3FQTB 1QEWB 3MNVA 3QEHA 4R5XA 1FHGA 2AS5M 4G1EA 4JDVA 1B0GB 3LKSA 3T4AA 1F90L 4XN8A 5EOCH 1RLBA 1ZHLB 2BO0A 5I8OL 4DPRA 3W1ZA 1PD0A 3O0LA 4K3EL 4FNSA 4FQQB 1P7QD 5LBVA 4M5YH 2WMPA 1WK0A 3FHAA 3GUTA 1PCXA 2YXMA 5AB9A 4HSAC 2YAMA 3IMVA 3V8CA 5I75B 2W8CA 3AY4A 4X6EA 3UBFA 3BKJH 4N68A 3K74B 3LSOA 4JGJA 1S4IA 5GQBA 1U41A 4YHKH 3VFSB 2VT0A 3RVWD 2VLLB 2Z35B 5IHUL 3QUGA 3H8NA 2A0LD 2QGBA 1E5CA 1FNEB 2FIKA 2OK0L 5AL0A 4JZJB 4EOWH 4JGNA 4B9FA 1XL6A 2X2JA 2J55A 2I5YH 5B38B 2IH1B 1E50A 3KW8A 3LH2L 4HKJB 2A74A 1PZSA 3MDJA 4RGOL 1BIIB 4ZT1A 4Z7OB 3WLWD 4O4YL 5JXAL 3SBQA 5FYKL 3ZKSD 1JTPA 1U3HA 1QHOA 4J23A 3V2AR 2Z1PA 3BN3B 5TH2B 2F19L 3BH9A 2MPAH 3MLRL 3T8VA 2ZF9A 3O3EA 4HAKA 3PV6B 1T89C 3SY6A 5AOMA 5AYUL 1A64A 3RNKA 2H2SC 2K9UA 3ARRA 1LO2L 1AMYA 3ZO0A 4RX4A 5DS8A 2KBGA 5HJBA 1R24A 3CVIL 4A7GA 1I4FA 2OMZB 2R8SL 3SYAA 1UYWL 3L9BA 4BIKA 2F18A 4HGMA 5HHQB 3FZUC 5D2LF 5CLWA 1NPNA 4U1SB 3SZ6A 5LGHH 3ZN6A 4IHOA 3SGKA 1J1PL 3A23A 1O9ZA 3EYVB 4S1QH 1DN0A 3GI8H 4NPYB 1LE5A 1CURA 1RURL 4CVUA 1FC1A 4FCHA 3DHMA 2ERJC 2WQ8A 3O9WA 1NKRA 3A24A 3GMOA 4JG0L 2K9FB 4FS0A 4TYUA 1X4XA 4WK2B 2WSPA 4KK8C 1W72H 4XBGA 2VAAA 2UVFA 1E4WH 5I1DA 1IBFA 2HT2C 1OSZA 3CJJA 4O02L 4YSRA 2HJKA 3HC0B 4OD1L 4U2YA 4NC1C 4WI8A 4JFSA 4CC1A 4MJJA 4OTXL 5B39G 3N0AA 3B1UA 1WP6A 2H7WA 1RJLA 3QISA 4RNRA 4XX1E 4L3FA 2Z4TA 1C08B 1NCJA 5INCA 3TC9A 1JGEB 1I7TB 3NSCA 1UHVA 1KGXA 4UINL 5LGKA 1VKXB 4L3CB 1VDGA 3VYNA 1U8HA 2EEDA 4NQCA 2E3VA 1JGUH 1ZT4B 2JVUA 3CSYB 3NEXA 4KKPA 4KU1A 4TRPH 4QLWA 1UJ3C 3REWA 3AS2A 1X5FA 2HJFA 4CSTA 4F7KA 1VFBB 2L7UA 3NCYP 3PGFH 1AXTH 3RY5A 2VXVL 2ZUVA 3HS0C 1JGLH 4PJIA 3BEVB 2UY7A 4L4VE 4QHKJ 4HUXA 1KCRH 3OWEA 2CO3A 2PABA 4K23L 4L8SB 1B2YA 4OQ1A 1C5BH 3GMQA 3WAJA 5FYJE 3Q0HA 1RZFH 1L7IL 4MMXA 5EIIB 4JR9L 1JV5B 1ERNA 3ILPB 4FXLA 4IJ3B 5D72L 5HJDA 2WXKA 4JL2A 3UXFA 5TE6L 1GHFL 4M62H 4Y2OA 4UQDA 2W59A 5CCHE 4F33A 2IALA 2XV3A 2ZXQA 1Y6MR 1E43A 1HS6A 4U4IA 1GJUA 3DJRA 3L17A 1V55B 5KSBF 5H4ZA 4AQ1C 2OXGA 2SEBB 2O6CA 3RGVB 4MCYB 2KLSA 1I1YB 4LGSB 3PL6D 3S48A 4GINA 5B3NA 3E38A 1A6AB 4YQXL 3US9A 3ALXA 2PKDA 2NZ9D 4NUJA 5JNYB 3T1FA 1VERA 2NTSP 2F54A 2AGJH 4RMUA 1UXSA 1SOSA 5T3ZH 1NGWB 2EDRA 2QV2A 5B8CA 1A1MA 2RTTA 4TQPA 3MMEA 4Z23A 4YSQA 3MJ6A 2JNZA 2AERT 3C6SA 3QG7H 4Q6IA 2GT9B 5EU4B 1EK3A 2OTUB 4TUOB 4GRWF 4XO3A 1D5IL 1A9VA 3O4LD 1JP5A 3ARDD 4Z7VB 1CLOH 1KBWA 2IQAB 2CDGA 1UB6A 4DW2L 4XCNA 4LNRB 4F8QA 1BYPA 2ARJQ 1OLLA 2WUCH 2XUWA 2F53D 3DJSA 1LP9F 4CJ1A 1J8HA 2QDVA 5A7EA 3HLKA 3VI3B 4WHYG 4YVNA 5MENA 1E7VA 3NJGA 2PPAA 4PJEA 1UWEL 1AXSB 4HDIA 1SQ2N 2E8YA 3CK0L 1F90H 2AQ1A 2YUXA 3KZ8A 3C6EA 4U49A 3GWJA 5I8OH 1N8ZB 3T0WA 4X8XA 2QKIC 5F1NB 4F7MB 5B1BB 4MSWB 2WANA 3I50L 3CQPA 4K3EH 3QRFM 3I6KB 3P4MB 4DT2A 4QXWA 1KJ2L 2Q87A 2VIRA 3BDYL 1HH6B 4PCSA 2EIBA 5CZKA 2Q2LA 1G1YA 3SPVB 2XFXB 2W95A 1X6NA 2B4CH 3ATBA 4N2DA 4XN5A 3VXRA 2Y69B 4KK5C 3X1BA 3AXIA 3QJFA 1T0MB 3TN0C 3UBHA 1YPZA 2VQTA 2Z0BA 5E5MB 4MDIA 2BHYA 1UA7A 1K5WA 2XTJC 3C2AL 2C7UB 4YSOA 4Z95L 5JW3H 5JHDB 2YQ2A 3FCUB 5IHUH 5DJAA 5BV7C 3ZRSA 1HSAB 2CKNA 4RCAA 2JJSA 5H35A 2OK0H 3FW6A 3MREA 3OZKA 5CD5D 5CGMA 4XC3L 3VFNB 5E2UL 3IF1A 1C5DB 1PX8A 2FX7L 3WEBA 3LH2H 3TA3C 3P73A 3TIDA 3DIFB 2C3VA 2JWYA 3O45B 4RGOH 1BQLL 2I69A 4JUSA 5K9OA 3B43A 1EMTL 4O4YH 5IQ7L 5JXAH 4LLYB 3QIBB 4H5SB 2EUVA 1S7QB 3RVVC 15C8L 1MNUL 1SM3L 5I1CL 2VLRA 4HJ0D 3CH8A 4DPAX 2IC2A 1AR1B 1F45A 1CUOA 4O5LL 5AYUH 1S9XB 5EBMA 4NC0B 1EWHA 1X4ZA 3NFPB 1LO2H 3L2LA 2A38A 4WI2A 4J4PC 2ITFA 4ODWA 4UQ2A 3CVIH 1EAJA 3D3VB 2VDML 3MRRA 2R8SH 3AGVA 2HMIC 1UYWH 4TTDD 2AJZB 4URKA 2E74C 5C3IA 3ZUCA 4XMKL 2QPDB 1J1PH 1BXXA 3CX2A 1IC7L 3T3ME 5I8CA 2FO4A 1BSIA 1MAKA 2GSIB 4JQVC 1Y1UA 3D2UA 3VFPB 4TM9A 5AOIA 4O02A 4BK4A 2BP8A 3WKPA 1KY7A 1P4LB 1MH5A 4PJFB 4NN7C 2VABA 4XB8A 3U30C 1T22B 4WWID 1FVDA 1NC2D 2ZWZA 1XBRA 1E5ZA 4O02H 3ISRA 1X5ZA 2J12B 3F7PC 4K4KA 3GMRB 4K94C 3ZDZF 4HEMA 2ZG1A 3RI5K 1T1XA 4OD1H 3SCMC 4OTXH 1XGQB 3RDTD 5E95B 5C09A 1MCDA 3ORJA 3BH8A 6TAAA 1TQUA 3IJHB 3I75A 4LKXB 1FNGB 3HFFA 4M93C 2NNFA 4PS3A 4UINH 1WZ1L 4LSUL 5JPNB 3QS2A 5E2VH 3UG3A 3DX7A 3AG4B 2QVIA 1TJHH 4BA8A 1TPXB 4NENA 5C2BL 1C12B 3IJYB 3C8KB 5DLLA 1Z7JA 4UNUA 4CSPA 2ICEC 4PB9L 4U1GB 3O2VL 2ZX7A 3JV6B 3G6AB 3FCTB 1GJWA 4KTDL 1SXBA 5JORB 4WEBL 4XMXA 1DQQA 2ZNXA 1VACB 3A21A 3ARGC 5D2NA 4K23H 2IOOA 2PO6A 5ECJE 5G4OA 4PR5B 3WI9A 3U2IA 3BAKA 2GITA 4X4YB 2BP3A 1EAPA 4WV1C 3ETTA 1ITCA 4JR9H 1XGPB 2AK4D 4WTQA 1GGCH 3FMGL 4IMLA 4O2EB 5TE6H 1GHFH 2O6EA 5F89A 1A3RL 4IDJL 3CSGA 3ZRFC 3GSVB 1M7IB 2QV4A 2ZF8A 5FAAA 3SGDI 3MV8B 5CF3A 4UTBL 2QVMA 2VDOH 3NJMA 5CN1A 1WFTA 3NEEA 5DJ2B 5J3HC 2EEAA 3GJFH 2BNRD 2WJ7A 3FQ4A 4YQXH 5IFAL 4DFHA 2CRMA 5GGVY 3P2BA 1QFUL 3ZL2A 4OR1A 1K4CA 1B4TA 3EIFA 5F7DB 5KN5B 4JZJC 4PRIA 2ED8A 3WS3B 4A7TA 1IGMH 4KK9C 1A1OA 1AE6L 5A3ID 1L9PA 3FU7A 4XN1A 4ATTA 1OB1A 5JQHC 2JJVA 1H5BA 3C6LD 5EU5A 3V6OC 2NYKA 5D93C 2FSEB 3D85B 5HYSB 2OAAA 3FO2B 4NCC1 2BSBA 4LU5L 3ZDZE 4B9JA 4DW2H 1EEQA 2XT1B 3PQYA 5D7IE 3RFZB 2CHWA 3ARYA 4ZZFA 3HE7B 4WAFA 3PJNA 2WSKA 1UWYA 3RWIB 4LT7A 2YQ3A 3ES6A 4MQXD 2IPUK 3BP6A 3MV7E 5C0GB 2EP6A 1I7ZB 1UWEH 3Q8BA 5L2KB 3N04A 3BWAA 3L1GA 1S78C 3CK0H 1KJ2A 2N01B 4HUWB 2XXCB 4MD5A 3VGDA 4BDVA 5IV2B 2OJZL 2HVJA 2O5YL 2OCCB 3HS8A 4KMTL 5I23A 2DWEB 5HDRA 2XG5B 1NCDL 2JKXA 3I50H 1RUKH 4G71B 3MRPB 1KJ2H 3BDYH 4NBYB 4P05A 1SNRA 4P23A 5JUEL 4ZXBD 3MJ7B 1ORSB 4KI5E 5D1XB 3L3IB 2G4EA 2OFQA 2ZX5A 3AQXA 2ADYA 4L9LB 4YBQC 1UTDA 2C4FT 5E9AA 4IMKC 1P7QB 1JDAA 1IZKA 3C2AH 4GW4A 4Z95H 2EIZB 3V4PL 3LHAA 4E9LA 4P2RA 3TONA 4J8RA 3H56A 1XCXA 3RWEB 3DVFA 3B83A 1LO3L 1MFAL 3HHSB 1A7OH 3MLZL 1T4WA 2QL1A 5E2UH 4JO5A 2WW8A 4LP8A 3CHXA 5H2BB 1YEFL 2XXGA 2ADFH 3MXWL 2VO5A 3G6JB 2QSQA 1BQLH 4JHAH 5EBLA 3N85L 1X7QB 1XZ0A 3IGFA 3WIAA 1L9TA 1AGCB 2D73A 3HE6A 4NQVB 3V6ZA 4X0KA 5FUZL 15C8H 1AGDB 1MNUH 1SM3H 5I1CH 5AOJA 5JXED 3AROA 4L8DA 4DHLA 4WO0A 3WUWA 4ZQKA 4IQHA 4O5LH 5CUSH 4XNXL 4MDJB 5ESAA 2EEXA 4QRTA 1HFUA 3V0DA 3H85A 3MRGA 3UC0L 2WNGA 4UM9B 4N2KA 4OV5B 1LNUA 3QRLA 4U7SA 4JFHE 4OAWB 4L8SC 5DZJA 4IRSB 1YNTA 1CL7I 1R33A 3OL2A 4KDTC 1N12A 3L7EA 4XMKH 3PABB 3HZMB 1I8KA 2FAUA 2Y5QA 1IC7H 1SDDB 4TVPD 3SJVB 1GGTA 4IJ3C 3APMA 3V0FA 3VTMA 2MSPA 3QS3A 3MCKB 4A1RA 3L4ZA 5E8EB 5AKVA 1JTOA 4OFYA 1KMGA 2VLKE 5BUGA 4L8CA 1DSFL 4RIRB 1MHCB 2J1KA 3W56A 4F8NA 3UAJD 5KS9A 3B2PA 1NANI 4YSAA 2R23A 1K5NB 3DHPA 4YAQB 3RGVC 3P54A 4ZMWA 3PAUA 4GKNB 1RCYA 1YMHA 3GSWA 5SWSB 2A9ML 1GYUA 1R5IB 3O2DL 1ID2A 2YO3A 3LN4A 4BSJA 3M1BB 3RIAK 4NAQA 4JFVA 4XXCC 3U36A 4XO5A 1WUZA 1OXYA 3ARUA 4WWKD 2V2TA 1WZ1H 2QBWA 4LSUH 5K9JL 1IARB 1PD6A 3QJHA 2JB6A 3T8MA 4APQB 1HQRA 1IAMA 2AV7A 5HI4C 1QSED 5G4MA 5AB1A 1IBZA 2FQDA 2NCEA 4UQCA 3UZEA 4BE5A 2DJMA 3OTTA 5C2BH 2DH3A 4EBQH 1UM5L 3QNFA 2CIKB 1Z9LA 4BH8B 2PWGA 3GDCA 5CMAA 4R2GD 2J4WL 3QDGA 4PB9H 2GBTA 3O2VH 4EI5A 2P8MA 2O30A 4KTDH 1QQDB 3GD1C 4WEBH 3WFCH 4X99A 1E40A 2BCKB 3GK8L 4U1MA 3WNJA 1SLVA 5IMLB 3BSHA 4L1HA 4HSQA 3CN0A 4LSRL 2Y7QA 3ZSTA 5L8JB 1U8IA 3HEIB 1J48A 3UTZA 4M56A 3MGOA 4L8BA 4RDQF 3O3BB 5E70A 5I74C 1QW9A 3K4AA 3KPRE 3ZHFA 2GB2A 3FMGH 4B5EA 5C0AE 4NQDA 3MLTA 1A3RH 2FJHB 5EF0A 4UTBA 4IDJH 1P2CA 4FG6D 4N28A 5KWYC 2KT6A 3IU3A 4UT7L 2PXYD 3ULVE 1KGIA 1NIEA 3LYRA 4UTBH 4I18A 4AVIA 1DE4A 2HB0A 4ZMOA 1ES0A 1SJMA 3C60A 2Q3XA 3ZKMD 4HS8H 5DEGA 5LN8A 1HL5A 2CUAA 4GBXA 5KANI 1GSMA 4OF7A 3VXMD 2OMXA 4FNUA 4XVJL 3CU7A 5DZ9A 5IFAH 4LQFL 3K8KA 1NBYB 5LGJA 3MBEB 1ZLWH 4XCEB 1ZMYA 1Z0NA 4DGUA 3NA4A 2EEFA 4MD4B 1QFUH 5AAWA 4JLRA 4WTZA 5DS2A 4B9KC 1GMEA 2X9YA 1MJJA 4FOMA 4MA3A 1XH3B 1HL4A 2AXGB 1AE6H 3DXAB 3HKZA 4PJ5B 4GG6F 2O26U 3AB0B 5ILTL 2FLRT 2I32A 4X6DB 3SDDA 4EN3C 3KPNA 2EDKA 1GOGA 2HVKB 1BD2B 3QIBC 3B9EA 5F7UA 4AJYV 4LU5H 4ZFOB 4ZYKB 4PV9B 2Y6TE 4UU9A 2Z31A 3WELA 4R4FL 5LCVL 3Q05A 3DUHA 3MRNA 3S5LG 1AR1C 4F1ZA 2EIEA 1G7MB 3JZ7A 4LOVA 4G6JL 2X4NB 3WO4B 2DLFL 4C83B 9CGTA 3VG9B 1U30A 4MCNA 4FXKB 1T3FB 3AZUA 2IFFL 2ADGA 2OJZH 3M17A 4B0MM 2O5YH 4HIEB 4JM2F 3GTTA 3N1MC 4KMTH 3MX0A 5D8JH 1XF3B 1NCDH 1I9RH 4PGDB 3CD4A 3N42F 5CGYD 2CDFA 5C9KA 1QTPA 4KKBD 2UWEA 4IRJD 5LG6A 1AQDA 3KPQB 5JUEH 4UBDD 2GQHA 3Q7JA 3V4PA 1HYSC 4ZMYA 1J12A 3RZWA 5HDBE 3TL5A 1XVSA 5TD4A 2R1XB 5ETUB 1G94A 2OR9L 4OZFA 4WI0B 3RVXC 5E7FA 2ICCA 1RJYB 3V4PH 2DM4A 4ABUA 4M8UA 4UIKL 4LL9A 4OLYL 5A16A 4MB3A 4R0LA 3LQAL 3FN3A 3MQIA 1K8DA 1IE5A 1LO3H 1MFAH 3EZJB 3MLZH 1Q9KB 4XP5L 1CZ8L 4QJ5B 3PCYA 1H8SA 5AYQA 2B59B 2FX8L 4HCRL 1JZJA 1YEFH 1XSJA 3SYQA 2NUTB 3MXWH 2H3NA 3N6YA 3N85H 3VFRA 4IBTA 3X14B 4KI1A 5JPNC 4LGRB 1ZPUA 4R7DA 3ARBD 1PKQA 3HBGA 4NAMA 2B15A 3B5GA 1TZIB 1TPXC 4JFQB 1AY1L 1WAAA 3K71A 2W0KA 3ZY7A 4E41A 4XNXH 4OGQC 1TJIL 4D8OA 4KJPD 4JZNA 4Y19D 2V5TA 1ZLUK 1JWUB 3W0WD 5E0QA 3UC0H 4A2HA 4JFOB 2FH8A 3NPSB 3WFDL 1DLHA 1IBGL 1MVUB 1HHIA 3TM6A 4NQCE 4A55A 3ZYIA 3P9LA 2QVFB 2JF1A 4OZ4A 3QI9B 3X1EA 5JTWA 4C4KO 2N0KA 1M71B 1YYLH 2FWOA 1T83C 2H2PD 3A6OA 2ZOLA 3KYOB 2V5YA 4RESB 3GSOB 4BUGA 4ELMB 1L9QA 1W9XA 4JKMA 4AQEB 4R96B 3NSYA 1HHGA 4L3ED 2XNAA 4GO6B 3PGDB 4N90D 1LMIA 5FOBB 2NX5D 1EVTC 4GRLA 4EZLA 3O2DA 5GS2D 1R34A 4M5SA 2V9TA 1OV8A 4B9GA 5L88H 3CTTA 2YAHA 4OZIF 2XJLA 5F1KC 3BYYA 5LBGA 1OTSD 1OT2A 2A9MH 4PIRF 1LK2A 1E4KA 3SIKA 2WB1A 3FAXA 3NJJA 1OP4A 4G2AA 4HEPG 5KTEL 2GK0B 4MCZB 3T6XA 3V4LA 2HRHA 2EH8L 3S3JA 5IJVA 5K9JH 1JHTB 1T1WB 1NDTA 5C07B 5B21A 2ZYSA 2ESVB 2IWGA 1IAOA 3BYTA 1YEIL 1JI1A 4E2OA 4GY4A 4ZAKA 2HKHL 3P4NB 1UM5H 1E6JL 5DZPA 2DJUA 2VDRL 2WCPA 2IBBA 2J4WH 5T3ZE 3PV7A 2LAAA 5IBUB 5HGDA 2L7JA 4AC2A 2YPVL 4LSRH 2MQ0A 3RFZC 4LHUB 5MI0C 3UZVA 5DLML 3LVEA 4XNZB 3HE7C 3QAZC 4H13C 3MBWB 4MNQE 1J9RA 1NOLA 3BKML 3QCTL 5FUCE 3TCLA 3H0TA 4KUCF 5DRXA 5LAXB 5BS0A 3HUJF 1HHJB 4TL5A 4EDXA 1MFEL 4J3WA 1LWRA 4UT7H 4WHDA 3IJEB 2H8PA 2XPYA 2AK4B 1R5VA 4AG4L 1I8MA 4F91B 2E76C 3OGCB 1RP9A 3I6GB 2GPZA 4KXDA 3VFTB 4PS8A 5D1XC 2G2NA 4HOZA 2NNAA 5MENE 1C5CL 4XVJH 4X4KA 2R2EA 1EEZA 2WINA 4L9LC 4LQFH 4OZHB 4PJEE 1TZAA 3EJZD 5C0IA 1CE1H 3IRPX 3L54A 4GQ9L 2QR0A 4PLNC 4ICWA 4C55A 2EVIA 1OGAA 3ZQWA 5K59F 3T2QA 2BVQA 1EXUA 1VLXA 3FUJA 3QDJA 3C5JA 1AOZA 1V3MA 2P3YA 4JFED 3L13A 5ILTH 2A0LC 3VXTA 2ZG2A 1Z66A 1BBJB 2ZX8A 4A2EA 3QJVB 5LCVA 2IAND 2FD6L 3EGDA 4HWUA 4FJZA 3KL3A 3IEAA 3FFCA 4XVUD 4R4FH 1IM9B 5LCVH 3WLWC 1OQOA 4HXBH 1NMAH 5I6OA 3DV6A 5FYKE 4E36A 1QVOA 4G6JH 1QFOA 2DLFH 1ZCRA 2K4AA 4NS0A 3RUGB 4CBPA 1MAML 4LVEA 2IFFH 1L3WA 1FVCA 2GUOA 4HF5L 1GR7A 4XN7A 5DQDL 1IFHL 5HYJA 1NGXB 4PWEA 5GRUL 3EBIA 4FLRA 5F9AC 4ZTEA 1OSYA 4QY8A 5FFOA 2VLRE 1J7VR 3CHPA 4HS3A 3IGUA 1I75A 3E3QE 1ZK5A 2JCCA 3S37X 3NN8B 3LKQB 2HRLA 1TTCA 2HXAA 3GRWL 4NRYB 5CFHA 4HALA 2OR9H 1PQZB 5KZCD 1C7SA 4ZXBB 4Z7AA 2X9WA 3E1F1 4YR6A 2X7LB 4UIKH 4HCRA 4OLYH 1AKJB 1CDBA 3LQAH 5EPMA 1G9MC 4G6ML 4XWGL 1NEZA 3PWNA 4KY2A 4XP5H 1CZ8H 3SHSA 1L5GA 3ZDWA 3V0IA 1U8PA 3G7TA 4HCRH 2P24B 1D5ZA 2Y1ZA 1YN6A 5J13B 2JK5A 3RIFK 3H7LA 4HJJL 5F8RC 1FO0B 3WGUB 4DK3A 5B3JE 4APQC 3DVGB 1UCBL 4MZRA 4BYHA 3CIAA 1F6AA 3O4OB 1AY1H 1G84A 4JJHA 4XE0A 4M4PA 4HEME 2XHNA 3AS1A 5ISZE 1HOCB 3VSQA 4CADA 1P5UA 4PJAB 1TJIH 4K5LA 1B90A 1P7KB 5IBUG 3G6DL 4DP5X 5KBMA 5KAQF 3WFDH 3FAWA 1IBGH 3KPPB 1RK0B 3IGLA 4PV1C 1G43A 4BSVA 2ITEA 5SV4A 2KQNA 1NWOA 1UUNA 4L5FL 4JRYA 4LEOA 3Q8AA 3BHBB 4PREA 2R2HB 5E8NA 1KGJA 3LS5H 1PBYA 4YHLL 2VDPH 1BQKA 3OXRA 3SDXB 5D2NE 4G7SB 4RDQG 5CGBA 4KO5A 4JPWL 2WOYA 3CZUB 2RFXB 2EEBA 4FFZL 5IG7B 3B9AA 4XT1C 4AGQA 3DO7A 1S7UB 3ME0B 4FLOA 5IR1A 4PM1A 5E03A 4H25A 2E75C 1JWSB 2Z91B 3RGHA 4NHUA 4Y4HD 4DWHA 4U3XA 5KTEH 5EO1B 3I9PA 1S7TB 2EH8H 1QASA 2GFBA 4K15A 4M8QA 4X5WA 3KBFA 1IEHA 3PL6C 3WDIA 4LLUA 2GAZA 2R9HD 3GM8A 3VACA 35C8L 2VNCA 1GOFA 4TULL 1YEIH 5J06A 2HVBA 2LU4A 2NZ9C 3QR2A 5CHNB 1F13A 2HKHH 3PJSB 5DYOB 4ELDA 1EO5A 4N2HA 2VDRH 1FAKT 3AB0C 4JJ5A 3KWUA 1MCNA 1BZDA 1E9OA 1BJ8A 5D5MF 2ZXEB 3EOAA 4U6VL 5C08A 4M7ZB 5TK4A 1BLNA 1KNOB 1KIUA 2YPVH 4NWTL 4U3SB 1NBZA 4UAHA 1A6VL 3WGVB 5DLMH 1G9EA 1DVYA 2PCFA 4QRBA 3ARDC 5F9WB 3B9KD 1BDYA 4XP1L 3NIFE 5JQ6L 3BKYL 3BKMH 3QUXD 5HHNA 1I53A 1TVDA 4JFFD 3UEQA 3LEXB 1XF2B 1NFDA 1UOKA 3WO4C 4G8GE 2LAGB 3VG9C 2YPLB 2YUVA 2G5BA 1MFEH 2MOQA 3VFMA 3FOMA 2Y5TA 2QFPA 5C71A 2H47C 1H3WM 3RHWK 2YARA 4MAYB 4AG4H 1J5IA 3VI4B 3HRPA 2YD0A 4XXDB 2HRPH 1CXIA 3P4OA 4PJ7B 5F3BA 3T0EB 4OD2B 1C5CH 5DHYB 3WTYA 1WS8A 2NT0A 4OZGA 5DVOA 3STBA 2FIRT 3MR9A 2ZZUT 1ASQA 4L4JA 4L1TA 2Y22A 3QXDA 4NNPL 4R97B 2VZOA 1EJOL 4GQ9H 3PNRB 2YRBA 2EC9T 1FNSL 2YSSA 3VXMB 4FTVD 5E2JA 1JNLL 1Q0YL 3P3UA 1N10A 2Y1YA 4WFFD 5INDA 3UO8B 3D51A 3RPIB 4KNQA 4B9PA 1BZ9A 2WQRA 2ZKHL 4WW1A 3VG0H 3O41A 3VNYA 1MWAL 3FCSA 4YHZL 2RALA 2WY3B 1ANUA 3U2JA 4ADGA 3EDFA 2FD6H 5CD5C 3V7AG 4BFFA 3FUHA 3LRMA 1G7HA 4NM8L 1UXWB 4P2RE 4KWUA 5L9DL 2Q7NA 2A9AA 2BZDA 3FC8A 4O9HH 4L4VD 2ZAIA 3D39B 1DJIA 4I0PB 3HBPA 3DBXB 1UB5A 2GEEA 4HKXA 4IDLA 4ZFGL 1FNFA 2ZWKA 4C56B 1PNDA 2X70A 4OLXL 1E3XA 1MPAH 2YLKA 4WFGD 1HAUA 1S8DB 2JELL 2X89D 5SX4H 3QARA 4HF5H 5DQDH 1IFHH 5EG6C 3EADA 2IAMA 2A6KB 5GRUH 3RTQA 5CEZD 3GRWA 5DHEA 2P46B 1EV2E 3EJYD 4HUUB 1JZIA 1PDKB 4TTDC 4TQIA 3D69B 5F96L 1KV3A 2BNQD 4XAWL 1NFIA 4F3FB 4KDVA 3AWFA 3O2WL 1OGSA 4IRJB 3FQXB 1JZHA 3TIEB 3FTYA 3T04D 3STLB 4ONFH 2AJYL 5EU6A 2VDKL 1EXGA 4G6MH 4XWGH 2E4TA 1TLKA 2ZX9A 4GT0A 5C0BA 4UQ3B 1GGUA 5FKPA 3BW9A 1HWHB 4F5CA 4J2XA 3L5IA 1RZ7L 4DTGL 1NMBL 1HILB 4KAQL 2OMVA 3IU4L 3BLKA 3RX9A 4HJJH 4N22A 2VXSH 1TENA 3CVHB 4OCWL 4A6YB 2ODHA 4JZOA 3RDTC 5KS9E 1HNGA 2DQFB 1UCBH 1KXQE 1R47A 1BJMA 4AKQA 1WD8A 1XD0A 5K5YA 3G5YA 2V8LA 4HH9B 4QIRA 3S3BB 3U0PB 3H3KA 2B77A 4IU2B 3IAPA 2HZHA 1BFVL 2V33A 5C86A 3G6DH 3N43F 4PJXA 1K3IA 4HMCA 4BRJA 2OPCA 3QNYA 5IB4A 3EOTL 2GCYA 4WO4A 43CAB 1CE6A 3N3EA 4DKEL 1Q1PA 1TJGL 4XNZC 1NOFA 4YXKL 4Y19B 3RP1A 4D9RE 2YUWA 4Y1AA 1XEUA 1KCKA 2XKUA 2YJQA 2NTFA 2I9LA 3PXHA 4L5FH 3O6FD 1T0NB 2OMYA 3CDYA 4NHCH 2BPBA 4FFZA 5HHOD 3RNQA 3L4TA 5I76A 1AC0A 4J3OH 4FADA 1QRNB 1T6BX 4YHLH 3L2NA 4R8WL 1FFQA 3NCFB 3DOSA 4RGND 4KXZH 4FFZH 3ZL4L 3RWFA 4ZSOA 1IKNC 4XMUA 1U8KA 4B9YA 1MCWW 3S4SB 4PWGA 4L3EB 3AGWA 4QRRD 1FL5A 5EBWA 3APNA 1QEWA 4CC4C 4CMMB 2Y7LA 5FPIA 4NQDE 2XOTA 3ZDXE 5IB2B 4QF1B 1B0GA 1IC0A 4HQQL 1R19A 3N44F 4M8RA 5IIEB 1ZHLA 4LE8A 4PTTB 1G6RL 3QC6X 2LHAA 35C8H 4TULH 5TF1H 3EYQD 3CHRA 2GJ6B 4LIQL 3K0WA 1KZYA 4N1EA 4M9OA 4QYOA 2XQYG 4D0DA 3IB4A 3CHOA 4ZO8A 3IETA 4JO8A 1CBJA 4U6VH 3MJGX 4DP7X 4LAJH 4NWTH 3VXQB 5A3IC 3UYOD 1ECZA 2L7QA 4OM1L 5IQ9A 2Z35A 2FYVA 4OKVB 4XP1H 3MJ9L 2P48B 3VJ6B 3KBEA 4RRPM 5JQ6H 2EXWD 3BKYH 3KWVA 4JKKA 2UZYB 1EHXA 1Z5LA 2W0PA 5B38A 4HKJA 4NO5A 4X6BB 3LDBC 1NC4B 1FG9C 4PJBF 1BIIA 4PCTA 3VXNA 2CWRA 4XN2A 5ABZA 3DHJA 3MUY1 3VFOB 2QADB 4Y4FB 3PV6A 3M8OL 2H6PB 1DUZA 1JDDA 3E6FB 1JCKA 1BZ8A 5CILH 5T5FL 5ABDE 4P46A 3FRPG 4W9LC 3LQZB 4NNPH 5FDWA 1G9NC 3CH1B 4ZXBC 3NIGE 5DC0A 3Q2CA 1EJOH 4UYPA 2OMZA 2W60A 1FNSH 1A6PA 2L8AA 4V1DB 1MWAA 3V0GA 1DVFD 1JNLH 1Q0YH 1SN5A 2AKRB 1XIWA 2EQDA 2V5RA 3VTAA 2ORBL 3WN6A 5HHQA 4M3KB 3C5ZB 3EYVA 5LHDA 2CBTA 2J21A 2Y07L 1SJEB 2ZKHH 4NPYA 3CDGB 4HZLB 1MWAH 4YHZH 3TYFB 3W5NA 1J11A 3MUZ1 2NY5L 2ATAA 5D7EA 3PG2A 3LZPA 5E8PB 4IMKA 2ITDB <