1NTDA

Structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGENGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase (nitric oxide(a))
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
source organism Alcaligenes faecalis
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA02
1J9QA 3UADA 3CDZB 1M9WA 3FYEB 3X1FA 2AANA 3ZBMA 1XB6A 3EH5B 2Q5BA 3NJFA 2B08A 3T9WA 2J55A 3TBBA 2DY2A 3RYMA 2X88A 2VW6A 2OCCB 3OM3B 1UATA 1JZGA 1ASOA 2NRDA 3FYIB 2N0MA 3QPKA 1A4BA 4NAJA 1NIDA 3EF4A 1GS7A 1CYWA 1PF3A 4DP1X 5I28A 2YAHA 4QLWA 3T6ZA 1L9OA 3SBRA 3X1NA 2HLEB 1JERA 2TSAA 1OOWA 5EHFA 2CALA 3IN2A 4DP2X 3UAEA 1AS8A 2JKWA 2QDVA 4K9JA 4CSZA 3FU7B 4QKTA 1JXDA 4GP4B 5I6NA 1V55B 2IH9A 1BYPA 3KW8A 1V54B 1IUZA 3S8FB 1NWOA 2XLLA 1ZIAA 2OJ1A 2BZ7A 4KNUA 1JZEA 2W8CA 4KO7A 2EIJB 4A2EA 1L9RA 2BW5A 5ANHA 1AOZA 4A66A 1ZV2A 3NJHA 1BXUA 5TK4A 3T6WA 1PZCA 1AR1B 3QQXA 2GIMA 1ILSA 3NJIA 5D4HA 2ZXWB 1L9QA 1SFHA 2I7SA 4YSOA 3T6VA 4YSCA 2J57A 4HCFA 1SDDA 1A8ZA 1KDJA 1AANA 3ZX1A 1W6LA 1PY0A 3FSAA 3ZIYA 4DP8X 1NPJA 4N8UA 1OE2A 2HX8A 1SNRA 3OMIB 1GSKA 1BXAA 2BP0B 2FT7A 1N68A 4W1TA 5I6PA 2FWLB 1BAWA 2VM4A 3FU9A 2MTAA 5B1KA 2ZWNA 4F2FA 1OCRB 1PZAA 1JZHA 1OCZB 3OD3A 4AKPA 2YAPA 3PLYA 3UAAA 1QLEB 3FSWA 1EZLA 2PP7A 1XMEB 5D4IA 1WA0X 1PNDA 3TBCA 1AIZA 1NZRA 2EINB 3AY2A 3V9CA 1PCSA 3FSZA 1AAJA 3FQ2A 3TU6A 1AZCA 2FQEA 1MDAA 3TASA 1OCCB 3ZDWA 2PPDA 4GP8B 2VW7A 1SF3A 3WIAA 1OE3A 4YSQA 2VM3A 1GW0A 3NJJA 3IBOA 3DTUB 2UXVA 1JVLA 1OE1A 2DWSA 2YAMA 2R7EA 2I85A 1V10A 1NWPA 1NIEA 1E67A 1GS6X 4KO9A 4PCYA 1BXVA 4A2GA 3IN0A 3NSDA 3FPXA 1AQ8A 3SBQA 1MG2C 2BWIA 1ID2A 3BQVA 3PAVA 2QT6A 2LLNA 1CUOA 2AZUA 3DKHA 2ZONA 1DZ0A 3EHBB 3GDCA 2GC4C 3CDZA 1ET7A 1E5YA 6PAZA 4DPAX 4HAKA 1A65A 1KCBA 1N70A 4G7RB 4PAZA 2BZCA 3PAZA 1L9PA 3ERXA 5F7BA 1JZIA 1ADWA 4ZK8A 3FT0A 2CAKA 2GHZA 1WS7A 2VMJA 2FQDA 1IBZA 4FA7B 2J56A 4BWWA 1AS7A 2PCYA 3GYRA 2OV0A 4P5RA 1J5CA 8PAZA 3KW7A 3JT2A 3NJNA 3HEIB 1RCYA 3OMAB 1QHQA 4A2FA 4KNSA 1NPNA 5B7FA 1J5DA 1AZUA 2HX9A 2HRHA 3SBPA 1HFUA 4GXFA 3FU7A 4YSDA 2RACA 3WKQA 1KDIA 4HALA 1ZDSA 2WSDA 3FPYA 1FWXA 1ILUA 1SF5A 4A67A 2TSBA 1XB8A 1WS8A 2EILB 4HZ1A 6PCYA 5B1BB 4UANA 2PLTA 1J9RA 1A4CA 5I6OA 4WTQA 1E65A 1M57B 2XV3A 3SQRA 2VSKB 2HZHA 2YXVA 4DP6X 1AACA 1SHWA 2H47C 9PCYA 1ZPUA 1PMYA 3FSVA 3AG2B 4YSRA 3PCYA 1NIFA 2W88A 1GY2A 2YQBA 3ABLB 4A2HA 1OF0A 2FJSA 3NJMA 3U25A 3FQYA 1AZRA 1CC3A 1FA4A 4AX3A 4E9SA 1QNIA 2AZAA 7PAZA 1PNCA 1TKWA 2IWEA 2UX7A 4MFHA 4GY4A 2BP0A 2H5UA 2FTAA 1I53A 1JZJA 4W9ZA 4Q89A 4DP7X 1F56A 1IBYA 1B3IA 4E9QA 3AZUA 2A3TA 2HXAA 1NINA 4G70B 3T6XA 5FC9A 5I6KA 3D12B 2CCWA 2QPDB 3GXUB 1FFTB 3H56A 3WKPA 7PCYA 1MG3C 4EF3A 2XWZA 1RKRA 1ASPA 4BDVB 4E9RA 1WAEA 4G7SB 1M56B 4M4RB 5B1JC 4TXVB 3UACA 5I6MA 2YXWA 4YSTA 5I26A 3WNJA 2XXGA 1AZBA 2Y1AA 1IC0A 4AKQA 1PLAA 2BO0A 3CVCA 3S8GB 2Y69B 4DP4X 5TK2A 4G7QB 3TA4D 3BVDB 2JFCA 3QJRB 1SJMA 1IKOP 1BQ5A 1PLCA 4YSEA 1L9TA 1NIBA 2GBAA 2PP9A 5PCYA 2BP8B 3C75A 4FAAB 3WNIA 2IDQA 1AG0A 4GYBA 3ABGA 1E30A 4E9TA 5A7EA 2FNWA 2PPFA 3NT0A 4E9XA 3ASOB 3ABMB 4M3HA 3OQRA 5AZUA 1L9SA 1WA1X 4BWUA 4DP9X 1R1CA 2PP8A 4JHUA 3N2JA 3NJLA 2YAFA 4JKNA 3AG4B 3UGEA 1BEXA 4YSAA 2UXTA 3AG1B 1TEGA 1VLXA 3CVBA 2BWDA 5B7MA 1X9RA 3AW5A 3PXLA 4BWTA 2AFNA 3FS9A 3UABA 4DPCX 2GC7C 4RH4A 5B7EA 2YARA 2VSMB 2PPCA 3NSYA 4KOCA 5B1AB 1NDTA 2PPAA 1MZZA 1HAWA 4A2DA 2XUWA 2YAOA 3WG7B 1W6WA 3HB3B 3JTBA 1OV8A 4E9VA 2UXFA 1SFDA 4HIPA 1XB3A 1CYXA 2HX7A 1ETJA 1AZNA 4BXVA 5F7AA 1JVOA 2XX1A 4HHGA 2DV6A 4N4YB 4HHWA 3CVDA 4ENZA 3NSFA 4GP5B 2FQGA 3NP3A 3IEAA 2XV2A 1HAUA 2IWFA 1DYZA 2E86A 5I5JA 5D4JA 2YAEA 3PAUA 5IY5B 1TU2A 2VN3A 2IAAC 5I5IA 1GR7A 2GB2A 2UX6A 2XVBA 2BW4A 1KBVA 2FQFA 3QJSB 2PPEA 5LDUA 4YSPA 4DPBX 1WA2X 2EIKB 4KOBA 4KO6A 3WI9A 4AI7A 1A3ZA 1RZPA 4DP0X 4YSUA 1KCWA 4HCGA 3EH3B 2GSMB 2EIMB 2ZOOA 1BQKA 1OCOB 3X1EA 4G72B 4KNTA 2B3IA 2QPEB 2CBPA 1KBWA 2JXMA 4Q8BA 4YL4A 3QJQB 1BQRA 1T5KA 3V9EA 3QJUB 1X9UA 5I5MA 1PAZA 3S3BB 2X87A 4WKXA 1KYAA 2DWTA 5B3SB 3IE9A 3OMNB 4P5SA 4NERA 4E9YA 1JXFA 3S3DB 2DYRB 2IDFA 2H3XC 3FU8A 1BYOA 4BDVA 1JZFA 2I7OA 2XX0A 3H4HA 1SDDB 3N55A 1NTDA 2WO2B 5AKRA 3CG8A 1TEFA 2P80D 3L45A 4E9WA 1KGYE 1JXGA 1ASQA 1GS8A 4AKOA 2AVFA 1PZBA 2DYSB 3FQ1A 3ASNB 3QJVB 4DP5X 3NJKA 1CURA 3NJGA 3CZUB 4NB7A 4F7KA 3G5WA 2IH8A 1GYCA 1A4AA 1ZDQA 4YVNA 1J9TA 4YSSA 4F2EA 4BK5C 4KO5A 2IDSA 2HRGA 4CSPA 2FT8A 3NSCA 1RZQA 3QJTB 2XXFA 1ET5A 4L0PB 3AG3B 5PAZA 4AZUA 2J5WA 3H4FA 1JOIA 4G71B 3X1GA 4BXSV 2CUAA 3DIVA 3MBWB 2XU9A 1ET8A 1GY1A 2XYBA 2CJ3A 5AFAA 2BP8A 2YAQA 4X4KA 4HCIA 3X2QB 3NYKA 1SHXA 2IDTA 4UF7C 3ABKB 1AS6A 2VW4A 3EH4B 5B1JA 2R7EB 2IDUA 1ZIBA 3X1BA 1NIAA 4A68A 1W8EA 5I6LA 1NICA 1PLBA 2UXGA 1EHKB 3MX0B 3PPSA 2GI0A 4UAHA 2Q9OA 1AG6A 1URIA 2BHFA 2IWKA 2QDWA 1E5ZA 3T71A 2WO3B 2P80A 3NP4A 3S3CB 4YVUA 1MZYA 1J9SA 2FT6A 2PCFA 2MRYA 2XV0A 5E9NA 1YLBB 4JHVA 1KV7A
chains in the Genus database with same CATH superfamily
1FZMB 5KYXB 5GS0D 4MJIB 3QNFA 3QEQE 2DRUA 4IKLA 4Z7UA 5LCVL 4XP4H 3HHSA 2BZDA 2X6UA 3T9WA 5AZ2L 3ZTNL 4RA0C 3NSJA 2PYEA 2B0SH 5AW5B 4ZS6C 1B4RA 2XV6B 4M7ZC 5E00A 1H8OA 5IFJA 2NY0C 4BHUI 4EAEA 5FLVA 8CGTA 5GRUH 2NSMA 3OWRA 3POCA 3NG5A 4DN3H 4WFEE 4XPGL 4IMKC 3RJQB 4QUOA 4LSTH 5CKGA 3ZKND 2UZIL 1BMWA 4Z7VE 3L7FB 2VDOB 4LZKA 4ELKB 4N6RB 4OCNC 2E9WA 5IR1B 2VGLM 2QDVA 2XQYG 4FQHA 4GIPD 5DQ9B 1GZHC 1BZ7B 2MHAB 4OM0H 4G1MB 3QO0B 1I8LC 2EICA 4RAUA 3OBAA 4GFXA 4XPFL 1R33A 1WCBA 4KKAC 3EFFA 2QSCH 3TZVA 5GRZA 2KZ1B 3HNSH 5CBAA 5HTSA 3UGXA 2WLIA 3D52A 4XO4A 2OJ1A 4FFZL 4LE8A 4W4OA 2W8CA 3JTSB 4P5TA 4Z7OB 3PHQA 1M71A 5CMAA 4OJDH 4XCEB 4AC4A 2KS0A 3GRBA 3LN5B 4PLKD 4XBPB 1ZKAA 4U1LB 4KAQH 3HTLX 3MCLL 4GIAA 4ODHH 4ONGL 4R8WL 1CDHA 3U7WH 4C47A 4J23A 4UU9B 2AJUL 1HN1A 1NH6A 2OZNA 4KTEH 4H8WL 4PGBB 5FO7B 3O4LA 3V8CA 3WBDA 4HCFA 3FFDB 1KDJA 3OLDA 1C08B 1FGNL 4GXUN 5H2BB 4AV4A 3ZQ9A 3VXRE 4V1DB 4HFWA 2G5UA 3WL9A 1A7NL 4XVJH 2ZIDA 1LWRA 3REVB 5F3HB 5C0AD 2C4XA 4POYA 4M1DL 3HZYB 3N50A 4JFFE 4MJID 2G75B 2D9QB 4QXGH 4I1RA 1NBYB 3WFZA 3FUNA 4QYOA 4LDOB 3MNZB 2KMWA 2Y25A 4JO2L 2NUTB 4ORGB 3IJ8A 3FSWA 2YGVA 3SGDI 5DC0A 1NCBL 2PWDA 1E27B 1QUPA 5CXPA 2WZ0A 1RP9A 4KHXH 4RZCB 3X3FH 2UVFA 3FSZA 3QPXL 4S11A 1T89C 4TQPA 2JE8A 3VM7A 5I18L 5EZLB 1T6BX 4XBEH 4NT6B 2FQEA 4QAMB 4U1MA 5IEKA 4W9HC 2J8UA 5FECB 2OP4H 4JJOA 1A7OL 3P4OA 4LDCA 4GW5A 2BNQA 4FKKA 1OE1A 4YFLI 3L81A 4UNUA 4EOWH 1M42A 1AJ7H 5D2LF 3W5NA 4MXQC 1E67A 3MA9L 4M61B 1OAKL 3ZJAA 3D6GA 1KBKA 2OTWA 4KY1L 1WBZB 4FL4C 4U0RC 3LKNB 5CHNA 1XH3A 5I16B 3EYFB 5JHAA 4GRWE 4UIMA 4BK5A 1CFNB 3REWB 3HBPA 5EC2A 1QLEL 2WVUA 1QEWA 2F7IA 2F19L 2EADA 3BESR 3RZWA 1VB9A 2ZWLT 4YBQC 2P26A 5D4QA 5B38B 7FABH 2P5WA 1AP2A 2EIZA 4TL5A 2CLRA 1UJ3C 1SN2A 3FTWA 4MJJA 2XG4B 2BZCA 4MAYB 5FO8A 4S0HA 3MUY1 5IJVB 1OT4A 4CMMA 2VKXA 4BV1A 1IBZA 1XH2A 4PP2A 4V1DD 1XIWB 2J56A 3JUZA 3QHZL 1QOKA 3QZLA 3UJTH 4K73A 2J1XA 1OZUA 5FGCE 3ATEA 2QHRL 3KGRA 3AABA 3FHAA 4C56A 3T65B 3ZR6A 1JNHB 2Y7MA 1U95B 3OMAB 1DQDL 5CS7A 2X05A 2BS71 3D5OF 1L3NA 1TFHA 4GXFA 3APDA 4FG6C 1N5AB 5D7IF 1AQKL 5K9QG 1HWWA 2XQ0A 2Z8VC 3UYPB 2DQFA 3LAFA 5SX5H 4N2AA 3SN6N 1JYVA 1A0QH 1FNGB 3KLDA 3OC5A 4HLZG 1IMHC 2V17L 3DRQA 3TO4B 3HG2A 1NDMB 1AGCB 2CNZA 1YN6B 4WI6A 1IX2A 3D1MC 2QSTA 1WGVA 3BW9A 3OG6B 1IBHA 4L4TA 4JKLA 4WWKA 3V6ZB 2P9RA 3CUPB 3WJLA 3MV11 2DW5A 5HI3D 3V0WL 3TF4A 1DVFA 1KIUA 3CXHK 2X4NA 3I2CH 2H26A 3V4VA 5H94A 3K7UA 1GZPA 2DMKA 3AG2B 3PCYA 4OUOA 5DC9B 3S7GA 4KZCA 3UAJD 1IILE 3ESMA 1GL4B 1A7BA 3PQYE 3ECVA 4N0RA 5GQBA 1S7RB 5JHMA 1U8QA 3FQYA 5B39G 3N41B 3F84A 3NQIA 2RMNA 4OJYA 1KLFB 5F6HJ 1IAIM 4Z3HA 1I1AC 2BP0A 3G6JE 1I53A 2AEOA 5DMKA 1T2XA 1R24B 2C9VA 4PJFB 5FV2A 4MJ6B 4TVUA 1QBLL 4AXWA 2JSFA 2EUXA 2Y07H 1G6RA 3EJRA 3Q9PA 4HXBH 1CTOA 3OKDB 3RVWD 1SHSA 4AVJA 2HTKC 5I66B 3KG5A 2PYFA 3T3ME 1XIWD 1EWHA 3DMMC 4P48A 5JPNC 3ET9F 3FCGA 1G7HA 3WKPA 5BXFA 1T4WA 2XWZA 4XWGL 1Q9OB 2XKUA 3F64A 2EDKA 5GS2D 1HU8A 2CUMA 3IWVA 2CBMA 5IB2B 1N5YL 4POZC 4HKXB 5HHOE 2ZOWA 2O5YL 2C5DC 3VW3L 2H1PH 3GSXA 1RH8A 4UDTA 1LTXA 1KJMB 2YMXL 2FBJH 2CDGA 2WIIB 2V6HA 4AH2B 4FC3E 3HRZB 3ZR5A 1H6TA 3M88A 1PQZA 2EXWD 4L2YA 1HSAA 4G1EB 5TK2A 2WM0A 3TO4D 4GMTH 5I1HH 3ULVC 1N64H 4K3EH 3ECQA 2P42B 2BVQA 1II4E 5AW3B 3V79C 1KXHA 2OSLB 5JXEC 3GZKA 2XIBA 5IMOA 2WYIA 1C8QA 3MOAH 5I75B 1E30A 2JI3A 3MODL 4E9TA 3IFPB 1YSOA 4LSDA 5M94B 1EPFA 4ZMWA 4RAHA 1FIGL 2EAEA 3WMQA 3NJLA 5EZIL 2A38A 4LPTA 2YAFA 4PREB 2Q7NA 4P46D 3BH9B 1JMXA 4PJHA 4LCWB 1Y6MR 2Q6WB 1X9RA 2CA4A 1Q1JH 2Z31C 3LEXA 4L3EA 4X0KA 3MRHB 5DZLA 5C0ND 3VSTA 1TENA 4Y5VB 4HIQA 3H7BA 4XAKD 4ZSOE 4AZ8A 2R1WB 4HFUH 1RUKH 4Q6KA 1MRFL 1JPFB 1CK0H 4DK5A 1OCWL 1ZLWH 3HFML 4MJ2A 1SFDA 1I9RH 2CKBB 2HWZH 4MXWL 2P4AB 4MA7H 4ODSH 1A9EA 2ZJSL 4MQXD 4DVBA 2ZUQB 3A3YB 5GGUA 1ZSDA 4BXVA 1USQA 1MUJB 4Y88A 1JVOA 3FT1A 1ZLVH 4FP8H 4LRNL 1E2ZA 4GSDL 3P0YL 5D1ZC 4PSPA 12E8H 1HOCA 3SY0B 3UYOD 1U8MA 4GBXC 2FQGA 4Z7WE 4ZTPL 2XRAL 4PRPA 3U9PH 3ULUE 4H8QA 3GSVB 1J1PL 4IBUA 2XKSA 1D5MA 3FRPG 3P0VL 4LASL 3S37X 1BVNP 3U9WA 4RGNB 1CF1A 4DQOH 4MQ7B 5KVFH 1JGUH 2H7WA 5MENE 3FAWA 3BKCH 4HEMA 4JRYB 1WITA 3WJMA 3VFTA 5LDUA 4AGNA 3L4VA 4B96A 1ZRUA 3L5XH 1WZKA 4L9LA 5T3XL 3KVDD 3RIFF 2FGZA 4HCGA 5FCSH 3WHXA 2YZ1A 2EIMB 2GTWB 3LEYL 5B8CC 1A8JH 1I4FA 3IVKA 4NUGH 32C2A 1PYWA 1SVBA 1A7PL 1YN7B 3L95A 5KBMA 1T5KA 1E4XI 3ZE1B 2XCMC 4MXVF 1MLBB 2ORBL 3UJJH 2EYTB 4BQ9A 4D9RE 5C0FB 4FYQA 1DBKL 4PRHE 2XI9A 4Y2OB 1ZTXL 2WUBH 3RI5F 4Z0XA 4AC2A 5F7YC 5CN3A 4LCWD 5F0MB 5LN8A 2D03L 1D6VH 3IU3B 4JGUA 4J3BA 5FWRA 3THMH 5C0CE 5CLYA 3STLA 3B2DC 5HGAB 3KPMA 1UWXK 2P80D 3AREC 3D0LA 4JJ5A 4QJ3B 4M4RA 1A1MA 4WVRA 1D5XA 1U2CA 3BVWA 2UY7A 3QXDA 4ZI8A 2DEXX 5FEBA 3NJGA 3ZTJH 2OSYA 5D72H 2DLTA 4AQ1B 5HD8C 2OULB 5IWLA 3L7EB 2VL4A 3OR7B 4HIJA 2VO8A 5EO1B 1G7MB 3MMEB 5E7FA 3UXFA 2VISA 3ORJA 2EE2A 1CLZL 1CGXA 5E08L 2FEEI 5TDOA 2ETWA 1FFNA 4AYEC 3PUCA 4HKJB 4M5ZH 4X9IA 4J3OH 4Z7VB 2XXCB 2NCEA 1E4XL 5K9OB 1D9KA 1GGYA 3BT2H 2XU9A 1Z3GH 1BZ8A 5TPWL 3L54A 1M7UA 1HHGB 3CN1A 1AGEB 4YBLC 4TUJA 4P4KA 4L5FL 1QSEB 2OMXA 2A7BA 3OKEA 1G9ML 1A6UL 4LVOB 3VFMB 4PRDA 3SYPA 1R5WA 1T5WA 2C34A 4RGND 2R69H 4P04A 1WYJA 2XBTA 3DJ9A 5B1JA 5JR1H 5KUKA 1QRNE 1P7HL 5F6IB 4B3VA 2UXGA 5H35B 1EHKB 3DX6B 4JRYD 1PSKL 3QWQB 4RFOL 2DWEB 2MJWA 5FUZH 3H9YA 4AQ8A 4LESA 1NCCL 3TVMB 3VQ1C 4R4ND 1QFOA 2R0LL 2FEEL 5TF0A 1JZ4A 1A66A 5JQIB 4HS3B 4LSSL 3PWPE 5T1LA 4L3CB 4AMKL 4EMZA 3DHMA 4P9HC 3QCVL 5KVGE 5JZ7D 2ZP8A 1CB4A 1FRGL 3DTXB 3EO0A 3KXFE 3QEHA 4HU2A 3ZYOA 5C3IA 4FQ1H 3VXRB 1K3IA 3RYMA 1SYSB 4NAJA 3G5YB 2X4QA 1EBPA 2CMRL 2PTTA 4PJIB 5SV3A 4PW9A 1FFOB 1PX8A 2EKJA 3FMGL 2XWXA 3MRNB 4YXHH 3NA9H 3WFCL 4HPOL 1J05B 5AOJA 4OV5B 2V2XA 3UGUA 3T6ZA 3MREB 1BFOA 2X6CA 4TN9A 4ABVA 2CM6A 4WW2B 3RVVC 2HLEB 1JERA 3IETA 1D5BB 4GI6A 5FK9B 3MBXH 2P8PA 4BCXA 4DP2X 5CSZB 3FQXB 3BISA 4P2YA 5BZZA 3QR1A 4Z3EA 4Q6IB 2W9LA 3Q6FB 4BINA 3GMPB 4DEPC 3RWGA 1V54B 3KPQB 2AXGA 3EJPA 3P0GB 3BDYH 3EADA 4LQ1A 5T1MA 3V4PL 2ZG2A 3LPFA 1RD6A 3PF2A 4LHUB 1I8IB 3GHBH 1NCGA 2F7RA 4K55A 3MXWL 1QSED 3UZQB 5EC1B 3WN6A 1HWGB 4KBPA 4NKMB 5DD6B 5E9DB 1QWUA 3KPOB 2KDYA 5CR8A 1DQJA 5C0DA 3TOPA 5HYEA 3LIUA 1BVLB 2ZCHH 4NM8H 5CJ5A 4EN3B 1CGTA 1HH9B 4OBSA 5KSVA 4MCZB 2IPUG 2DB8A 5IP4A 1MFEH 5EBMB 1U93A 3BYTA 3BVTA 2BCKA 1Z5LB 3TVMD 4RZKA 4MZ3A 2JELH 4R97B 3U36A 2E8YA 4TULL 4K7PH 2YOAA 3QQDA 2GK0A 4Z95L 5I15L 4TV3A 2MCAA 4R2GB 5FW7A 5LO7A 5HGDB 5F3BA 5GSVB 5F44A 3ECWA 4B9ZA 4HJJL 4JFEA 2YEVB 2WCSA 4NP9A 1A6PA 1QFWH 1ECYA 1QLEB 3CFNA 4PI0A 3VCLB 1XMEB 1HQRA 1VACA 2DTML 1PNDA 4LVEA 4OJFH 3F58H 5T33H 3F7YB 2AXHA 3T0EE 2EYSB 2YC1B 2ZG3A 1UXSB 3RKDC 4WWPA 4R0LB 4QIRA 2GTZB 5LB1A 4LKCB 5E2VL 4UV4L 4NENA 4UDUA 3IB4A 3PRZA 4KKBD 5F88B 1FSKB 1KJ3L 2HT2D 5FOBB 1JK8A 4XPHL 4B9GA 3KPRA 1SY6L 4Y9GA 4ZX6A 4NZRL 1CF8H 4BFIB 4Z3FA 1A6ZA 2HPOA 4KO9A 4GS7B 3SBQA 1ID2A 1CD9B 1DE4A 4PJBF 5DUML 4WCYH 1AFVH 1WHOA 4GAJH 3ZTEA 1FORL 3L4TA 5HHNA 5CIPH 4Z78B 4LHUD 3EHBB 4ZMLA 5HDWA 2ZUVA 4AYID 3EBIA 3FO9A 5E9DD 1H9VA 1XD1A 3MBEB 4ELMF 4RA3A 4U6XA 4PS4L 4P99A 4Y8DC 4EN3D 5F71A 2EDNA 5AB2A 3BKJH 1JZIA 5DLML 4HW6A 3EGSB 1UUNA 4F80A 3WIIH 1LDPL 1ES0B 1QTYT 5J6HA 4LSPL 4JHWL 2O61B 3D05A 4TLTA 3H42H 5I1EH 2HYMA 5CBEA 2WHVA 2IOOA 3OKKA 5E1AA 4XNMB 4GAAA 1U8OA 1UFGA 3EBHA 4G6ML 5E9AA 4ZXBB 4OB5L 1PCXA 2WD0A 1OF2B 1XH1A 3MRLA 4A7QA 3RTQB 4R2GD 3KAAA 1YYMH 5B7FA 4AYFA 4EKXA 1BZOA 1BQSA 4QLRA 3SBPA 3T3MB 1LP9A 1YMHA 1C1EL 4MMZA 2PR4H 1B2YA 4S0SD 1B0WA 2AXJA 3VWKC 1L7IH 2JKLA 3QI9B 2BNUB 3VFGH 4MNQA 2DH3A 3QDMB 1NAMH 1WBYB 4PJXE 5T3ZL 1U3NA 2EILB 2QVKA 3V55A 2WWKO 4ZQTA 5I1KL 5K9KA 1G43A 4NQDB 4Q9CA 3QFDB 3UERA 1TJHL 2OK0H 2ZF9A 2VE6A 1TCRB 3N5AA 4NJAL 5IUCA 1WE5A 3R4DA 1HZHH 2I5YH 2QR0B 2X4SA 4U1IB 2Y6SC 1J8SA 1GMIA 3ESUF 1PW3A 3FB8B 3Q3GB 5JO5B 1HYSD 4IMKA 1DVTA 3S35L 2VDKL 3GUFA 1Z5HA 3UTPD 3C5JA 1PEWA 5I23A 1N67A 4WKZB 2W88A 4OQTL 1FP5A 3MCKB 5DMGC 2FO4A 4L29B 1NCDL 3LPGA 3BP4B 4K94L 3NJMA 1M05B 1DBJH 1ZLEA 2LE9A 3HBQA 3O3DA 3BO8B 2XA8L 2VDLL 1GZHA 1ZS2A 2HSIA 1QNIA 5G4OA 3EHBD 1I8LA 1GJIA 1A7RL 1S7VB 3BJLA 4UM8B 1DL7H 5JLZA 3RGBA 5E6IC 4CUCA 3MBED 3MYJA 3FN0H 1PG7L 4NN7B 4YH6A 4DP7X 5EO0B 1F56A 5AVYB 4ELMA 1T0MB 1J18A 5C97A 3HOGA 4U6YA 3LH9A 3UH8A 4U1KA 3ZDYE 3IKCA 2HA1A 1G87A 4PGEA 4GSQA 3ZTCC 3NIDF 1YEKH 4CVWA 4PS7A 1SOQA 3ZYZA 2ZUWA 5E7BA 1MFNA 3DK0A 4NRXA 2I9LB 4XHJD 2CCWA 3IPBA 1FFTB 4OCRL 2W0KA 2WSPA 1R3JA 7PCYA 4ZXBD 1F86A 3PWUB 4QHNB 4XNXL 1KELH 5AKVA 4KDTC 1Z6JT 2R2CA 3T2NH 1WAEA 5JPMC 5ICYA 3RTLA 3NTCL 3N43F 3QORD 4TRPL 3ZTJG 1FUNA 2AJVL 4W6XB 4X6FA 2ISDA 1LO3H 3KWWA 1OPGL 2A1WH 2XZAL 1IKNC 2HJFA 4A38A 1AZBA 2OMZA 3AT9A 4Y9FA 3T77A 4CADA 3K5RA 4DKEH 3QI9D 4L1BA 1SN0A 2IWGA 2VR8A 3QDMD 1NUGA 5E1GA 1XXFC 2Y69B 4YHNB 1TOXA 4GG6F 4NQDD 1BZ9A 1MQKL 4MWFA 4XP9L 1JN6B 1R47A 4Z7WB 4NGHL 1MREL 3CBRA 4IDLA 1UD5A 3WUWA 1W2KT 2EIBA 2MQ3A 4FTVA 5E03A 4XRCB 1T89A 3J27A 2BP8B 3PGDB 3K6FA 2IDQA 2LU7A 2Z91A 2CGRL 3BEVA 3G5VA 5MENB 3IWUA 1F4AA 3NZ8B 3C9NB 1JJUA 5DGQA 1ZA6A 1JWUA 4YC2C 5I30L 1G7LB 2NNCA 2OXGA 3FO1B 3HBGA 1L9SA 3KYOB 3OQRA 4TSAL 1KXVC 4K3DL 1KIRB 4K07A 1UZ6F 5D7SH 1A4JA 5KAQG 4RMBA 4Z8FL 5H4ZA 4Y1AA 3ARWA 3BAXA 3HC3L 3NDYE 4BK8A 3AJ7A 4LLDA 4PLJC 3EFDL 3GJFK 4PG9A 2L4OA 2CO6B 5HYIA 4O02B 1TZOA 3CVIH 3TTSA 5BO1H 3U0WH 3ESOA 1L5GB 2BOBB 5J9PA 2A9NL 3UTTE 5KJRL 3H9SA 2H3KA 2PWEA 3O9WC 4ZOEA 3QCTH 4A1RA 3CFMA 3DSFL 4WGWB 1K5NB 5DK3A 1YY8A 5AUMA 3RNKA 5E8PB 2H6PB 4L3FA 4NO3A 4NCC1 3MV9B 3HUJB 2OTUA 1IT9L 2Z8WC 3BPLB 4M43H 4XMZA 1BM7A 5DT1L 1QR4A 4Z1PA 4V2BA 4JG0H 1ETJA 4PTTB 4NO5A 1JPSH 4YDVB 1Q1PA 3RE0A 1X5AA 3P4NB 1N59B 2BVPA 2EE3A 3U46A 5L0QB 1TYJA 4EO5A 1JUFA 4TSCL 3VM5A 2Y2WA 4HDIA 4ALAH 1A7QL 4RMTA 4G6JH 1XBRA 1CE6A 3BP5B 1ZGLM 2XV2A 3WFHA 3MQIA 1F45A 3ZZQA 3SJVE 1MHEA 5JXAH 1GZQA 4HK3N 3VH8G 4WO0A 3VFRA 2VDPH 2V2WA 3PAUA 5ITFA 3C6SA 3QDJA 2E7BA 5JW4R 2BHZA 4XOCA 5D1QB 3ZKNC 4ERSL 1D7CA 3IJHA 5DD0H 5SWSE 3ARPA 3W37A 3SO3C 5DCCA 2OKMA 4FN0A 1U2YA 3D39B 1EEYB 2QGEA 4HMCA 4KO6A 1JRHL 1A3ZA 43CAA 3ALXA 4R4FL 2A6IB 5MEPB 1IVTA 5DD5H 4G3YH 2XHNA 5DQJA 2NTSP 4N9GB 3S4SA 4QRSB 3ARBB 4JZNA 1QA9A 5CGBA 5HYFA 2G3NA 3UBXA 1KB9K 1H5BC 5I1LB 5C3LD 2K0RA 4WNQA 3MRBB 3DHPA 2A77H 5BJTA 3TIEB 2VQ1A 5BVPL 4DCQB 2IV8A 3GSQB 1IBGL 1TMCB 1IAII 3SOBL 3CXDH 3FU8A 1BEYL 3MKGA 5EBWB 5AZEH 1U3YA 3H4HA 3N55A 4BDVA 3CFKA 1HSBA 2XC8A 4FHBD 4PLKC 4IU2A 1J8RA 4UMGA 4YWGH 3DUUA 2R2EA 4MLSA 2CQVA 2NZIA 2BSRB 3FT2A 4XNYH 2QQLH 6TAAA 1DLFH 4RFNB 1KPRA 1I1AA 3KPSE 4H26A 2VKWA 2BM3A 1MJ8H 2HVKB 4ZT1A 4A37A 1EHLH 3S9DB 3MV9D 3NCCB 4KO5A 4ETQB 3TC9A 4WEMB 4NO0A 2CDFB 2VERA 1BAGA 5DTFB 5I8OL 5PAZA 2E8ZA 2E9GA 1KJ2A 4Y8AA 1YNTF 4LSUL 3CH1B 3ZDZB 5TF1H 1OM3L 5F8RC 1MFDH 4MJ5B 2AITA 5AFAA 3DMMA 2XTSA 3I9GL 1N7ML 5JPNA 2TRHA 2XKNA 4AGLA 1IAIL 4KUZL 1FNSH 3IDMA 4YXKL 3DX9A 5F9DC 3X14B 2XDHA 2OSWA 4WI0B 2VDRB 2A9ML 1O7SA 3GZQA 1IEHA 1PL3A 1JTOA 2OTPA 3DV6A 1CLYH 1E3FA 2O5ZH 1ZIBA 1RLBA 2W91A 2FYYA 5D1QD 3VQLA 5E6YA 2WN2A 4HUCA 1CG9A 5FYLH 4M6NH 3D39D 4LEBA 1OM9A 3UYRL 2RFXA 2WWKT 4E9LA 5DMYA 3OV6A 5ACMA 4L4VB 4HJUA 1KN2H 3GM0A 4QRUA 2MRYA 3AFLA 5I5MA 1R46A 3I85A 5DUPL 3ARBD 4FMFA 2YA1A 5HHVL 1DQIA 1JPEA 2AANA 2JKRM 3MU3A 3UO1H 1HL4A 4GKSB 2DJ4A 4H44C 3NJFA 2QKIB 4LNRB 4X4XA 5JXEA 1CLVA 2OSXA 4X6EB 3RIFK 5C09E 4GW4A 1FIEA 3V4PB 1IC7L 3BVNA 4WFFD 5CEZH 4TL4A 3BCFA 1JFHA 4JAMA 3VRIB 2F8VA 1MH5A 3VFOB 1MCDA 4MD0A 2RCSL 3QWOB 4MCMA 4N28A 1JF5A 3KZ8A 3VX0A 1TVBA 1WD8A 2G9HB 5HJ3A 2GVYA 1XBDA 3H55A 2EE0A 1TSRA 1L0XA 1YMMB 3RI5K 1PKOA 3JTTA 2Z31A 3LKOA 1MJUH 2F61A 1VZIA 1XGRB 3ARGB 3B6SA 3JV4A 4HEPA 4URTB 3UAEA 1Q90A 5E0QA 1G84A 4G6FB 3MLXL 1XDTT 4ZUSA 3KDMB 1EMTL 2BP5M 1VPOL 3MXVH 1BAFH 4IM8A 4Y5YB 1ZJBA 2BSBA 3MFFA 1KBPA 5CD3B 3O6MH 4Z3TA 3NK4A 4QOKE 2EEAA 1YNTA 4H5SB 3HMXA 1YEHL 3VXUE 4P9MH 5I73B 4HX1B 2EIJB 4X6CA 4M00A 5BNXD 5E1IA 1AQHA 1RUQL 1KJ2H 3ARZA 3QRLA 3ISWA 2EZ0D 5D1ZA 3SPJA 5JORA 2EDOA 1PZCA 1KEGH 2X3BA 1A14L 5L4MA 2NOYA 2H0JA 4GBXA 1YQVL 3UC2A 1MCIA 4JUSA 2GSIA 5DJXB 1F1GA 1MHCA 5IW6B 4TF4A 4OZIB 1ACXA 2YA0A 3PP3H 5C6TH 4A7GA 1ID5I 4L4VD 5LGKA 1BV8A 4M7LH 4AT6A 1WD9A 1OE2A 1KNOB 3DPBB 3GTVA 2GABA 3PABB 3OMIB 5HHXL 2Q87A 3UAJC 4X4ZA 3H3BC 1XSJA 1RZJL 2FLBT 4HG4K 2I9TB 2VM4A 1UXWA 1CDJA 4ICXA 4LFHD 3SPVA 5B1KA 1CI3M 1CPUA 5B8CA 1XR9B 2OZ4A 1PD1A 3SKOA 3T0VA 3GMOB 3KNBA 3OLIA 4XX1G 3ULVH 3T4AB 3GGWB 4V33A 1VCAA 2Y7SA 1YEIH 3QVAA 1KTDA 4YHOH 5DK2B 5J1AB 2VLMD 3PIQB 4R6UA 3JV6A 3A6CH 1MCSA 3SGEH 3P3YA 1A64A 3AXLB 3TASA 5GS1B 2NNXA 5JTWA 2AP2A 1YMMD 5SWZE 4W9FC 2DI8A 2X41A 1WIUA 5KS9B 1RUAH 2CO2A 3ME0B 3ARGD 4CVXA 4N6QA 3AREA 5IVXE 3RVWC 5C2BH 5D71H 1AD0A 1XIWC 2H0PA 3GJEB 1SRDA 3MRCB 4G6FD 1F1DA 2DIBA 3UMNA 1FE8L 1XF5B 5ICUA 5GGRY 2W81C 2BWIA 2OX5A 1PDKA 3G04A 4KK5D 1BZDA 5CWSA 1GGIL 1CUOA 3DPDA 4F3FA 4LLYB 4D7BA 3SDAD 4JGNA 2XFXA 2WWNA 3B83A 1SYVB 3UG5A 5EOCL 3VFSB 1U4EA 2YD7A 4JG9A 2ADYA 5BOJA 5HYQA 2ICEB 4NWUH 3CZNA 4KPHL 4P2RB 5IVZA 2EXWC 2FL5A 1CR9H 1OANA 4KTDH 4G7RB 3TO4C 3PAZA 3OKMB 3LS4H 1KPVA 5BO0D 1CL7H 1OALA 4NFCA 4N2MA 1ZTMA 2FHBA 4MX7A 1I8UA 5L7XH 1NGQL 4CVUA 4G83A 3VFWB 1TQVA 1PZ3A 1QQDA 4XCCL 2CJUH 5IHWA 4PWHA 3SZ6A 2ZWKA 4BWWA 2NTFA 2BDNH 2UWEF 3S37L 1G9EA 2VDKB 3VI4A 2F6AA 4OCWH 4TVPH 1WTGT 5JUEL 4TUKL 2GJ6A 3EIFA 1RCYA 3GXPA 4U1NA 1NM4A 4KNSA 4UT9A 4QXTB 3I9PA 2X4TA 2ZP9A 1JL8A 3UZVB 1NCOA 4CN6A 1BX2B 1DDHA 5AQ0A 1RPKA 4P46C 4R7DB 5FO2A 1DQQA 2TAAA 5EULV 2YSSB 5C0NC 5CZVL 4DK6A 1KCSH 1UADC 4XGZB 3BPCA 3ULSB 1ZVSB 4E0RB 5CP3A 1MAJA 3BFWA 3WY2A 4EUPB 2EDHA 2YUXA 1DLHB 3II3A 4HIXH 1QO3B 4NQXB 3MJ7B 3PGFH 1G0DA 4NZJA 1R3IL 4KV5E 2RD0A 4MQXC 5GRJH 5IZ7A 3FSVA 1QI5A 2X9ZA 4H13C 1U36A 4IIQB 5C0JB 1NIFA 3LN4A 3MUGB 3I75B 1C12A 5EORL 4P3CH 3K8MA 5BMFH 2X53A 3GBML 2FEDD 3GSNA 2XG5B 2KH2B 3GMMA 5EU6E 3TYGL 1GYAA 4PU2A 2AI0L 4GNKB 1M7IB 5DFTA 4UNVA 2AQSA 1EANA 1SOKA 1G7IB 3ETTA 3HRZC 1TMQA 1Y6KR 4JN2B 4DKFL 4P2RD 4O2EB 2W60A 1XF4B 5T3ZD 2BRRL 1KB5L 3NN8A 4U1GB 3WUWG 3ELQA 3LEVH 2HXAA 2FX7H 4G7YH 4NIYE 2VDML 1HIMH 5F7HA 2V9RA 1JFQL 2UYLA 4MHHG 4XP6L 3TO2A 3D12B 4OF0A 5FDWA 4GQ9L 5FKPA 2NY7H 4O4YL 4OM1H 3LKPB 4Z7UE 2V7NA 5LGHL 3CSYB 1LEGB 2V5MA 5F9OL 2WXRA 3MV8A 4F7EA 5IEHB 1AH1A 2GSGA 3OF6D 4V2CB 2ZOLB 1K8IA 2PYEE 3APCA 2CLZB 1WJ3A 2ICWA 2NY5L 4TNGA 2R23A 4ZMOA 2WQWA 2NNAB 4ZX5A 3KYMA 3FL7A 4HWBA 1SJEB 2XWTA 3AM8C 3VD0A 5DEGA 1G7JA 1SBBA 1I9IH 2K1MA 1WZ1L 3I6KB 4UT9H 3F62A 4YUEL 2OYLA 5F7MC 1W8NA 3BVDB 1DBMH 3CTTA 4UQEA 5L4FA 3GHEH 4ONHB 3FBQA 5TE4L 3LHPL 4P9HH 2IANA 4BKLA 2DM7A 4LP4A 1HJBC 2YK1H 1M7XA 2ZUQC 3D7PA 4DVRL 4S1RH 5CP3H 3UPRB 3RILA 1P9MC 5HPOA 1OSPL 2PPFA 4RGMB 1W72A 2CJTA 3CWGA 3NIFF 3OKNA 4YHPB 4ZAKB 1K8DA 5JIQA 4MCYA 3W39B 1Z9SA 1A6TA 3ECUA 2J71A 2DQHL 2YXMA 4OIAA 4HYTB 5CM1A 3CX2A 2WYTA 3IE4A 3VGAB 4L3AA 2CZNA 3AQZA 4HS6A 1XEDA 4GG8B 5AALA 4HH9B 1JZ5A 1VADB 3AW5A 2EDDA 2I32A 4HUUA 2AFNA 5ACLA 4Z0BH 5EU5B 2RIKA 4DPCX 5B7EA 3O4LE 3PE9A 4O2CB 4OR1A 4RGNC 4PRBB 2AV1A 4YHZH 3HPLB 4KOCA 5GJTH 3EYVB 4W6YB 1UOLA 5DLLA 1HAWA 3T6QC 1W6WA 4LPUA 4PB0L 3PS6A 3QXVA 3NRPA 4B5EA 3S4SG 5E8OA 3IGAB 3KLAB 1XB3A 4LARH 3TBWA 3UBXG 2HTLC 4CVZB 1YYLH 4R4NC 4LL4A 4NI3A 2NYZA 1G4RA 3QDGA 1ACCA 3T4YA 1C5CH 4L48A 3AADB 2OMYB 5F7AA 3A4EA 5FCUH 2BFGA 1DFBH 3HC2A 1IGYA 4ILDA 1YEDA 2CM5A 3IS0X 4LAQH 5JZ7C 2XVKA 4LLQB 5HHPA 4LOUD 5C8JA 3ZOAA 1TJGL 3QNZA 1S78D 4QKXB 3FT9A 1RIUH 3FAXA 4MAUH 1IKFH 2R0KH 4M1GL 4OLYH 1J9CT 1EDYA 2V3FA 1MW0A 3I6GB 3CHOA 1BM3L 2J8UE 1JNNL 1E5CA 4L8SB 3ISYA 3F05A 4HETA 2UX6A 2XVBA 3BRDA 4CAGA 5KG9B 2AMUA 2BNQE 4HHAB 4PMEA 3KPPB 4GEJA 1T7VA 4HWBH 3VWKA 4AQ1C 4L05A 4AK2A 1XAKA 3H3PL 4A7VA 5KSUA 2CBTA 3V7MA 4AM0Q 3BWUC 2MCPL 3LPWA 5T8IA 3MCYA 4ZAKD 5EPMA 2HJLB 5AKSA 5A2JH 1FAIH 2Z7WA 3MPCA 3KYNA 4TNVF 4OGYL 1A02N 4XC1L 4NBXB 4UV7L 5B3SB 3UPAA 2DQ6A 3FHEA 4FLRA 4JO1H 4OIFA 1CFBA 2XN0A 4RX4D 4ZUTB 2P5WE 3A6BH 2UZYB 2ZOKB 4OT1H 2XQYK 2IDFA 1E3ZA 1U8CA 1AMYA 1HI6A 1IGIH 1W72H 4W9LC 1CU4H 2BIHA 3HE7B 1KZYA 4LVOC 1EEZA 4WY7H 4ZUUA 5I71B 2FSEA 1OSZB 2IPTH 5C09B 4YS4A 3MRFA 1CBVH 2FWUA 2R56H 4LGPB 1B2WH 2G30A 1BLNB 4GRMB 1U9KA 4OCSH 2WCPA 1OB0A 1EVUA 4HOXA 5E6IA 2RA1A 2VXTL 4ADJA 4Q9QH 1QFHA 1W0VB 1RFDH 3TVMC 5D9SB 4C56E 4CN1A 5AOZA 3LS5H 4KHTH 4LF3B 4Y0GA 4EI5B 2K4AA 4UQAA 5IF0A 1MWAA 5FGSA 3DXAA 5GGVL 3WO4B 3D0AA 1YC7A 1S8DB 2XWBB 2MNJB 2Y7NA 3RGVB 1IM3B 3DO3A 1V3MA 4ZDHA 5CCJA 3HAEB 2CUAA 1O9ZA 4HP5A 1NC2A 4UNTA 4XT1C 1UB6A 3U1SL 4OZFB 4ABWA 1FN4A 4KDTA 5K1VA 2IDTA 5DJ6A 5JPMA 1FGVH 4YLCA 1KYUA 1AYOA 1S4IA 3AVEA 5CILH 3IFNL 4HJTA 3UIYA 1J7VR 1U8IB 3BPOB 3CFDA 2WINA 3INUH 4L4TE 5IREA 1WRFA 3BZEB 4GO6B 1IKNA 5I6LA 4WW2C 4HWZA 4KMQA 3VXUB 5LGJA 5J12B 4H8WC 4KKBC 4RFEB 5INDB 2QDWA 1GGTA 2I07A 2HT2C 1AVAA 3ARFB 1J8HA 3BH8A 4E42B 1RULH 4LIQH 3NP4A 3ZT7A 4K15A 3WHE0 2LLLA 3B37A 2ZX8A 4Q6IC 2FT6A 3HZVA 4FQQB 2HN7A 2XQBH 3NCJL 1ZA3A 2YBRA 4PJDB 5AD0A 1U8LB 3EH2A 4P59L 1S9YB 4QRTB 5FYKE 1OQOA 3GNMH 1KGCD 2BERA 4I9XA 5E4EB 3P1VA 2Q2LA 2F7OA 4JJHA 1CS6A 2AF2A 2ZNWA 3CGTA 1NIDA 3JWDH 4YXLL 5KVDL 4FX5A 1SXCA 3HE7D 1N4XH 3FQWB 1KXVA 3RZCB 1SMDA 5J6GA 3QUMA 4XNUH 4AY0A 3EOBA 2BIOA 4QLWA 5D7EA 3OGCB 4EN3C 2H9GA 1UM6H 3PYCA 3R7QA 2KT6A 3HHMA 3L2LA 3WNOA 2G2PA 2J25A 3MJ8B 3CDGB 1FZOA 2EEFA 5IBUG 1OGAA 2VC2L 5C0BB 3IN2A 4K71B 2HFFB 3GLDA 2CH8A 5CN2A 4R97C 4OFYA 3O9WA 2EDEA 2A9BA 3FOLA 3FU7B 4WI5A 5K9JL 4XBGA 4ZMZA 4GP4B 4XC3L 3AWEA 4MLIA 5JOFA 4I3SL 1HL8A 4XMPH 5SWZB 5KVFE 3RGVD 1IM3D 4R2GC 3O0RL 2J6EL 3HLAB 3MYZA 2AAAA 1IQDB 3IDNB 1S9KC 5F7DB 1CVSC 1CZ8L 5D7IE 5H37A 2BZ7A 1X5GA 5GGRA 5E23A 1MWAH 1HCVA 2E6JA 2DQIH 2EC8A 1FL3B 5I17B 2CR0A 1RERA 1ICTA 2PETA 2JJTA 2WLJA 1NDGB 5D8JL 5HVHB 4I77H 3FCTA 2Z35B 1BPVA 2X4PA 1TZHB 3X3GL 1WISA 4R0LC 5CR1A 1L9QA 2WXKA 3T2OA 3W9EA 1DUYB 2PN5A 2WXFA 2V5RA 4FLQA 2O6EA 4KI5E 1FFQA 1AMXA 1FSKC 3ARFD 1PY0A 1ERNA 3KEDA 4Y2NA 4DP8X 2JJUA 4A6YA 3QQ9D 2XN9B 1HYSC 2IG2H 3DJRA 4FQ2H 5EG6C 4JDTH 4KQ4L 1XGUA 4HBQA 4GS7C 3VQ2C 1BDYA 3A5VA 3P2BA 5EIVA 1NFIA 4ODWB 5IHBA 2ZPKL 1BXAA 2MTPA 1LO5B 1PBYA 3D18A 4PJHE 1S7QB 4W1TA 1WFUA 3KE0A 3SKMA 1NMAL 1G0YR 4ODUB 5AVTB 5KAQF 3DGGA 4L3EE 4B27A 4MYPA 4NHCL 2BSSB 3EHBC 3LQZB 2BP3A 4G7VL 5FA4B 3VXTB 2DQTH 2F18A 1MFCL 4KKCD 3UTZB 1GXEA 4UB0L 4K5NA 3MBEC 1YJDL 2ZSVB 3IDXH 1MVFA 1H5BA 1QPKA 5C1MB 3RLSA 1AKPA 1CDUA 3K71A 3LIZL 5EEXA 1X5KA 3WIHA 1DJZA 4MA3A 3VXPA 3ZKSD 4HAFA 2WBXA 3GTNA 3PHOB 5DRXA 3S5LA 5C0BD 2UXVA 1B88A 1N6UA 4XHJC 2B1HH 2K78A 2HJKA 4I5BB 4UQ2A 4FCAA 4J6RL 3FB6A 3VXNA 1E8WA 2DQDL 3SKNA 2PTVA 4ZXBC 3QRGH 3L3HB 4PJ7F 5D7KE 2Q7AA 2I60H 3C60B 2D31B 3PAVA 3U6XS 2OBGA 4PRPE 5IHZB 2E4FA 2JB6A 1F8TL 4A39A 2AZUA 4U2ZA 2Y7QB 3S3SA 1RHFA 1SOSA 1FZMA 5C0AA 5KYXA 4MJIA 1VGEL 5GGTA 4A7TA 4DW2L 3QI9C 4TTDD 1NEZG 3QB7C 5IK3B 2QLVB 4HEME 4LKXB 3G7TA 2BK8A 2E27H 2G2RB 3BDXA 4FI8A 3P02A 4HAKA 1A65A 2BHUA 4M9PA 4PAZA 1VJSA 4X9GA 1XWVA 3GDBA 1OB1B 2GHZA 1NLBH 1XEUA 1ETA1 4ZO8A 3V5DB 2MNWA 1TITA 2XN9D 1AY1H 5CZRA 5L6YL 1BHGA 5HGBB 4KU1A 1AXTL 3L7FA 4ELKA 3IU4H 5BZXA 4NZTH 1FDLH 5IR1A 2VH5L 2CIKB 1YHPA 2OMUB 1IFHH 5AW4B 2LABA 1JDAA 5DQ9A 3L4UA 5LVEA 4LPXA 1BZ7A 1J0HA 2MHAA 4G1MA 5D55A 3QO0A 3RA7L 4HALA 3BGAA 1WF5A 4FADA 1FWXA 1XV8A 1ZXKA 2XT1B 1TLMA 3TBSB 1N18A 1UURA 4HZ1A 4NN7C 3V0HA 2YBGA 4Q9BA 3AXIA 5CJQL 5B1BB 1EUTA 1CGSH 4TS6A 3JTSA 1KB5B 2X1WL 3FB5B 4JFZH 4D9QE 1E65A 1N3NB 4XCEA 1I82A 2FE0A 2WIMA 2X2UA 5JIKA 5DJ8A 1A3RH 3LN5A 4U1LA 1S3KL 1TVHB 4BFFA 3WIHH 4UU9A 4PGBA 5FO7A 5FFLA 3DHUA 3C60D 3FFDA 1IEBB 4J5VA 2GT9B 3C2AH 1C08A 4PJ7A 3S97C 4GPVA 1WG3A 5H2BA 3NAAL 3BAYA 1TQCB 4H25B 4V1DA 1CC3A 3SQOH 5I5RA 2DF3A 4NLHA 2IBZY 5FM5M 3MHZA 3REVA 1JVKA 5F3HA 2DMGA 4FXKB 2N7AA 4Q2ZB 2G75A 3G5ZB 2P5EB 4UM9B 2GQHA 2FUQA 1NBYA 2H5UA 4ZZFA 2IF7A 1HE8A 3MNZA 3MUUA 1N2RB 4F2MB 3AZUA 3VFVB 2NUTA 1V3JA 2Z7ZA 1F41A 4ORGA 3QK0A 2JNZA 1G1YA 4N25A 5TFSH 3T6XA 5GGTH 5CEXA 4RNRB 3S88L 1E27A 3B56A 4RZCA 1IE5A 4M02A 2HKHL 3O4LB 4KWUA 5EZLA 4GT7A 4PR5B 3P9MB 3TN0B 1VZGA 1MCNA 4F15B 5FECA 3ZDXF 4E9RA 3QNXB 1YEEL 3QCUH 3WEMA 2ZT9C 3OJMB 1JGDB 3OXRB 4QDGA 1RZKL 2WGNB 2ZWYA 3T0WA 4KVPA 4S2SA 3WKNA 4GIOA 3O6KH 4M61A 5I1CH 1IC0A 2VDOH 1GKEA 5GGQL 3UAJA 1D6EB 2X0VA 3CVCA 1WBZA 4ZW6A 1LO0L 3LKNA 5EB9A 1A5FL 2J20A 3DVFA 3EYFA 5I16A 1MEXL 1CFNA 3REWA 4LCYB 4O5LH 3QJRB 1OKEA 1IC1A 3D2UB 5D7JB 5B38A 1F4HA 3L3KB 3WLBB 1NIBA 3AS2A 2XBZA 3MCG1 1DBBH 4H0GA 1NCIA 3E2HB 3BPLC 3P4OB 2XG4A 3VMOA 5IT2L 1M1SA 5DZ9A 5D96B 3BDBA 1ZWIB 4MDJB 4Z7NE 1ANUA 4Q14A 5L0QC 4YFEA 1MXDA 1E5UI 2YPVA 5HHME 3BSGA 1XIWA 2WJ5A 2VXUH 3UGEA 3IAQA 4OQ1A 1DQKA 5K1NA 1ZVNA 2P5ED 1IZJA 3KLSA 3T65A 4M7KL 1U95A 3FUEA 3DX8B 4ES8A 3JV5A 2ENPA 3VA6A 5EOQH 1PKQB 5KUMA 3T2QA 1KXQA 3ZZSA 5D1QC 3WS3B 1N5AA 5BZWB 2EDYA 3L5JA 3WG7B 3FN9A 3JTBA 4KH9A 3KMDA 3CXFA 5FO8B 3QNYB 3UYPA 2A9DA 4KROB 4X0NA 4HBCH 1FNGA 3VGDA 1MFAH 3O3BB 4UBDD 3WOVA 2XTLA 3TO4A 3TN0D 1NDMA 1E9QB 1AGCA 1KYOJ 2YEZB 3ARBC 1H8LA 4WFGD 2HP4A 2DI9A 3FCSB 4JFEE 1P4BH 4S0TD 3V6ZA 4DGVH 2DEWX 2WQVA 4JHAL 4N4YB 2C7FA 4HHWA 4JX0A 3V0FA 5K33A 3NSFA 4AWJC 4DGUA 1NANI 1K4CB 3QR2A 3T0XA 2OXHB 2KPNA 3O3AB 2HFEB 2ZAHA 2J21A 1QBAA 3Q01A 4I18B 2DQJH 2WLHA 2A9CA 4F8PA 2GITB 1JHKL 1GKOA 2VN3A 1G9MC 1S7RA 3K6OA 4S1QH 5IY5B 3SQBB 1V7MH 5F0PB 2GB2A 2AJSL 4P46A 2PWGA 2EDWA 3D2UD 3KPRE 1D5IL 1AQDA 5D7JD 1KLFA 1D3CA 4ZS7H 4RFNC 2A73B 2ZX6A 2YD5A 5BVJB 1R24A 5C08E 3MNWB 3MJ9A 2ZOOA 3HZMB 3R4RA 4PJFA 3Q06A 4MJ6A 2B3IA 4A7UA 3PXJA 1DVFB 3V4VB 4LVHB 4WSKA 3OKDA 2WOBA 5I66A 1SQ2N 5D2LB 3VAEA 1RSFA 4NJ9L 3UJIL 4I85A 1DEDA 5F0JB 4B9CA 1Q9OA 1IL1A 4XX1E 3DARA 4YO0B 1HESA 5IB2A 2EZ0C 2JK5B 3U4BL 4HKXA 2YPVH 1ASQA 4UTBA 3TH3T 4DP5X 1ZSHA 3L3IB 3WU1A 1KJMA 2B7DT 4IRZL 4E68A 2IH8A 2P8MB 1MJJB 4Z7QE 1ZDQA 3HRZA 2VDNH 2EO7A 5C92A 5GS2H 4KROD 1OAJA 3L48A 3N40P 4G1EA 3JSSA 1J88A 3QYCA 2NW3B 2CO1A 1PZUB 3FRUB 2L7EA 3ENEA 3SDYL 2SEBB 3TFBA 2ADIB 1EJOL 4X5LA 2J5WA 5KTEH 2FATH 1LP9E 1U3HB 3FH7A 2OSLA 2QKIC 3K74B 1QUNB 3CPLB 4MNQE 5IHUH 4APQD 1FLRL 3SE9L 1Q9WB 3IFPA 4DZBB 3RWIA 5ITBH 3US0A 3QZWB 1AS6A 4EBQH 2R7EB 1BVZA 5D7IB 2EVGA 2BSCA 4PREA 3WFDH 3BH9A 1PLBA 2CUIA 4LCWA 3IMUA 4N24A 2Q6WA 3AM8A 3HI5H 1DJHA 2IWKA 4NWTH 3MRHA 2WO3B 1QACA 3ARGC 1FC1A 4BRVA 2P80A 3WY3A 1N6QH 4WFHD 2BVQB 3NCBB 3JWOL 3SKJH 2HKFL 2R1WA 4Y5YC 4KK5C 1JPFA 3FYEB 4KKNA 5FUOH 2NQCA 3B2VL 5JYLA 2MCMA 3B8YA 1LO4L 2CKBA 4UYQA 4G82A 1KCLA 1RK1B 3SDAC 5I1GH 3N9GL 3GJFB 4IEFB 4ZOBA 4HD5A 2V0AA 2YXFA 5I73C 1P9MA 4LPWA 5ISZD 1MUJA 4PLOB 4ELME 3ESPA 1INQA 1NGPL 2DKSA 2WNXA 4ODXB 1FNAA 4TNVK 3DV4B 4EZMA 1T7YA 2MQ0A 3H8NA 5EZOL 4AEHL 1NMCB 1JWMB 5MERB 1P5UB 2YZ8A 2G2NA 3GSVA 1ITCA 2R29L 5DF0A 5EHFA 3FCBA 5CINH 4AZ8B 1X5FA 3V6FB 3PNWB 3L3JA 5I8KL 4MQ7A 2CDEA 4F7CB 4R26H 1G4MA 4HGWA 4JRYA 2DPKA 1BPLB 5ID0B 1U3HD 3HFFA 3QR0A 4TUOB 4PBVC 4U4BA 5F7EH 4WI7A 2ATKB 1BQUA 4CN4A 2VLRB 4DNLA 4JVWA 4U6VH 1ZGLB 1RMFH 1GIGH 1YN7A 1F4XL 2VUOA 4A66A 3H2WA 5ICZB 1MLBA 3WXWH 2EYTA 4NKOB 5C0FA 1A6WL 3CMOL 3S5LG 1V3LA 4Y2OA 5HSFA 5DD1L 5GS1C 2X6MA 1UWFA 1U2HA 2VSCA 2I7SA 3QPQD 4FTVE 4YSOA 4ZO9A 2J43A 3UP6A 4AYDC 3IU3A 3LB6D 4NP4H 5TE6H 3RWDB 1Q72L 5DJ0B 3ZX1A 3UTSB 5HGAA 3F6JA 4FNTA 3WJMB 4MTMA 2I26N 3F7KA 4FKEA 4K5OA 4F33B 2QADB 4Y1AE 2WQUA 2XXMB 3QUGA 4AQ1A 4F8NA 2HB0A 3L7EA 2FEDC 2IOMA 2LOEA 3OR7A 5EO1A 5I6PA 1G7MA 1PYWB 3ZUCA 2Y6TE 4HCRA 4F2FA 2H6OA 3OD3A 4F9PC 3RHWF 2IDCA 1EZLA 3H9SE 4BZ2L 4HKJA 3QUYD 2ICEC 5K9OA 3TBCA 3DI2B 1E8YA 3FULA 3AT0A 4NRZB 5LCVA 3EDEA 1BJ1J 1IAMA 3ILQD 1HHGA 1LDSA 2AABL 2EE9A 2QMJA 1MDAA 2W07B 5I1JL 1VEPA 1AGEA 3NIDE 2FIRT 3UBFA 5LG1A 1QSEA 1EZUA 3LMJH 2ITDB 3VSVA 4YHLH 1QSZA 4WNSA 3VFMA 3DTUB 1CDYA 3QXDB 4LRIC 4UNIA 4FG4A 2DBJA 4FF9A 2I85A 3ARXA 3MLUL 4ODVH 5H35A 1RUML 3DX6A 1AQ8A 4UAOB 3WAJA 2DWEA 3LZNA 2QV4A 2D7QA 3BQVA 1FQ9C 4NNXB 4WTZA 4G8EB 5FYLE 4K94C 1FFNB 1CLOH 2FJGA 2KLSA 3TVMA 3W38A 5BUPA 3QEUB 4JCLA 2VLRD 1PGRB 1UCTA 2H4EA 3CQFA 4HS3A 3HPJB 4L3CA 1TZGH 3QDJE 4FQLH 2HRPL 3SIKA 4LEXL 4ZUVB 3RWFA 2JJSC 2NYKA 2RALA 3D06A 2WPGA 4HUXB 1E5YA 3DTXA 43C9B 1OZTG 4ZPTB 4DPAX 3GT6A 1ZT1B 3IFLL 2H0FA 4FFZA 2BXZA 2YD9A 4IRSD 3ASWA 2ARJB 3G5YA 1O7VA 1R5WB 4U3SB 5AOIA 1E9OB 4PJIA 5EO9B 1T0NA 1FFOA 4I87A 3UTSD 3MRNA 4WK0B 1P4LB 1E7UA 5JIDA 3HRPA 2GJJA 1CE1H 3CFCH 4BHUA 1J05A 4OV5A 1TVDA 3FT3B 5AYQA 3MREA 3Q8CA 4IIQC 4WW2A 3ZMRA 2FX8H 2J4WL 2QADD 1DQVA 1UZ8A 1D5BA 4AYSA 3BT0A 3N91A 2EJ1A 3DURB 4OIIH 4J8RB 1GC1L 5FK9A 5TQ2H 3KCPB 4NN6B 5CSZA 3FQXA 4HXAH 2HX9A 4KKPA 4OTXL 4GH7B 4YSDA 4Q6IA 3Q6FA 1FG2B 1VCBC 1FG9C 3GMPA 4GQPH 5LLIC 1CQYA 5HDRA 5I2IA 2ZYRA 3KPQA 1QFUH 3RBSA 4HLEA 2MOGA 4I3RL 5F6HI 4OLVL 4I9WD 1QKZH 3F3HA 4U1GC 1FO0B 1TTCA 4NLAA 1UCBL 5BRZD 4M48H 3TYFB 4LHUA 1I8IA 4EVNB 1A6VH 4XXDB 4KTYA 3SDCB 3UZQA 5EC1A 1U33A 5E9DA 4NKMA 3EGDB 5DD6A 3MTRA 2R1XB 3KPOA 1BFOB 2HZHA 3IMBA 3WTSA 1BVLA 3ZO0A 1Z9PA 1CXLA 4EN3A 3GI9L 3RIAF 1HH9A 4LL1A 3Q2LA 3DHJA 2J2ZB 4A2HA 2ED6A 4WLCA 5EBMA 2BIQA 1DN0A 5HJGA 1GJUA 3C09B 5HDBF 1Z5LA 4ANUA 1QVOB 4LOUC 5T5NG 2Y3NA 1UM4L 1S78C 4X7CC 4OZGF 2GI7A 5HPMB 2L3BA 4RWYH 2UZIH 4MFHA 4KKLD 1XZ0B 5HGDA 1ZK9A 3L5HA 1P6WA 5GSVA 2W9DL 3HG0A 4P4RB 3BIKB 3MRJB 4HUKB 3JYCA 4QXUH 2WLMA 4JM4L 1AO7B 2F1AA 4XMXA 1SXNA 3MLTB 3VCLA 1IC5L 4FYTA 4XPFH 4OU3A 5I6KA 4EPSA 3ULVE 5KSVB 5EIIG 5J11B 3E9TA 3F7YA 2QPDB 2EYSA 2IPKB 2YC1A 1A4KB 1UXSA 4R0LA 4FFZH 2WUCH 4FZ8H 4BGDA 3GI8L 3X12B 4LKCA 4RGMC 2PNDA 2X70B 4ZAKC 2KBGA 4EDWH 1KC5L 4G8FB 2X1QA 5F88A 2P44B 1D2OA 1RURL 5FKAB 5FOBA 3QQDB 3BX7C 1D2PA 3UACA 1DTUA 3VFPB 3RJOA 4G42B 3VGAC 4KUCD 4R8WH 1JXKA 1NL0H 1UZGA 1XR8A 4ONGH 2FUTA 3IDYB 3VD5A 3AXHA 5DWUL 3G9VA 2AJUH 2L0DA 5K93A 4H8WH 1F18A 2VUYA 3RJDA 1CI5A 4ZMTA 2B9AA 3IDJB 4QHMB 1FGNH 4RESB 3I9IA 4LSVH 3MGAA 3L9YA 3SDCD 3DSNA 1QAWA 1SJMA 4J39A 3MBEA 3MV7B 4M1DH 4JR9L 4LLUB 1E3XA 3VI3F 4YHML 5PCYA 5HVFB 4UILL 3B43A 3WO3B 4WI8A 4G9DA 3C8DA 3PV7A 3WNIA 5EEUA 2WZAA 4EI0A 1MF2H 3KVPA 4OD3L 4FABH 2TRYA 3EGSA 1R3KB 4L1SA 3MN8A 4WHTB 1ES0A 1QFWM 2D0FA 2X6VA 2O61A 1NCBH 1FL5B 5C08B 4XNMA 2COQA 4JKNA 1FZKB 3F7VB 4YHKH 3ZTDC 3M17B 4ZXBA 4IQHA 3AG1B 3CVBA 1OF2A 1IGFL 1RHHB 3H6AA 2NT1A 3O45B 1NPUA 3QORA 4TVPE 2QJDA 4PJGF 4B5ZA 1NCAL 4L8SC 2CBQA 4Q6YA 2YJQA 1AO7D 3OR6B 5I0YA 4OI7A 5G4MA 3TCLB 4OFQA 4KY2A 1DSFL 2D0GA 3HG3A 4E9VA 3QI9A 2BNUA 3ZE2E 3QDMA 3WKMH 1LK3L 1WBYA 5AOLA 1I7ZA 1QABA 2J1YA 3TS8A 2EH7L 1CYXA 4NQDA 3QFDA 2MNUA 3B2PA 1V8HA 3C6LD 4PCTA 1QLEH 2WLNA 3IMRA 5E1AB 4B7IA 1JNLL 3PL6B 4U1IA 1CDCA 2QR0A 3SGDH 2FGWL 5I0XA 3FB8A 5JO5A 1JYNA 3RURA 4WKZA 4AYFB 3MCKA 2FD6H 3MR9B 1I9JL 3HE7C 4L29A 4TOYL 5ALBL 3BP4A 1HDMB 2WKOF 3Q8FA 1M05A 4N8CH 5I71C 4MB5A 3WTYA 1H9DA 3BO8A 4X7DC 4ANKA 4WO4D 2DJSA 4FULA 1UXMA 2YUZA 1S7VA 4UM8A 2CLVA 3MV7D 5TDNB 1VESA 2YGPA 1L6ZA 1P69B 4C4KO 2XN1A 5LXGH 3J8F7 3BLPX 2CRZA 1DQDH 5EO0A 3MROA 4UTAL 1T0MA 1OP5H 3VI3A 1CXIA 4JFQA 4JPWL 4M7ZB 4Z76B 3WO4C 4KXBA 2O93L 3ATBA 4NKIL 4YL4A 3RGVC 5JOPD 3C12A 3SPHA 2V7HB 1VF5C 2I9LA 5IQMA 2JQZA 2ZWZA 3O6FB 3NACH 2V3DA 3OMNB 3NZHL 4FFYL 5C08D 3BAEH 3DO7B 2J3SA 2V17H 4D0DB 4J3WA 3PWUA 3TTYA 4PJBB 2I7OA 4QHNA 4ZO6A 3AB0B 1OHQA 4N0YL 4K9EL 1FBIL 4QJ4B 4FQJL 3BPOC 4TQEH 1WFTA 5L8JB 2B1AH 5J12C 5SX4I 1CURA 3QG7L 4P57A 3R0MA 3ARFC 4JZOB 4AIZB 3W57A 1UA6H 4XP4L 1NSNL 4WEUD 5DA4A 3VI4E 4PGEB 3DI3B 3QQ9C 2GJ6E 1JHLL 5A2KH 1JN6A 4NC1C 1BCIA 3GMRB 5HDQL 2X2HA 1HZKA 2XOTA 4G71B 4RDBA 3WV0A 3PL6D 2YGNA 4HK0B 2WB1A 4XRCA 2M8XA 4MA8H 2VAJA 3N42F 2BP8A 4DN3L 1MFBL 3PGDA 5E4EC 2AXFB 5F7LB 5DS2A 1AGDB 4LSTL 2EYRB 2AEPH 2J1KA 3NZ8A 3C9NA 4KKCC 3U4EB 4ZMAT 1QBLH 1G7LA 2PW2A 3FO1A 3KYOA 2X44D 4PJCF 4AV5A 2CHDA 3RZCC 1KIRA 3IJYB 5BV7H 2OMZB 4JFYB 5DVPA 1QBMH 2IDUA 1TQUA 3OXSA 2WKOA 1W8EA 3NZUA 2GAZB 5F3FA 2CO6A 5I1DB 4O02A 1AHMA 1URIA 2QSCL 4H8PA 3Q1SH 3HNSL 1H6UA 1J48A 4K71C 1E4KC 1L5GA 1H3WM 2GJZB 1MZYA 1TEYA 2GIXA 5DUBB 4DERA 1N5YH 1TFPA 3PJSB 1G94A 5E4OA 1K5NA 3VW3H 4AG4L 3CDZB 1H19A 1M9WA 1MFUA 4PJ8B 1NOFA 5E8PA 3O3EA 2H6PA 2YMXH 3G5VB 3EH5B 1SGKA 4AGQA 2OAAA 3O6FD 1RZJC 3MV9A 3HUJA 4FQCH 1JWUB 4QHUB 3U7WL 2NRDA 1Z9NA 3D09A 4PTTA 3IGLA 4OFKA 1EXHA 4HJGA 4KTEL 3EF4A 1GS7A 1P1VA 3P4NA 1N59A 4TTDC 4HF5H 5HVHC 1KXTB 1FYTB 5DJDA 1DP0A 3M1BB 1ZHLB 2BIPA 1EAPB 3OB0K 3AS3A 1JZ3A 3BP5A 1OP3H 4NDMB 1MAML 1OAQH 3MODH 2CR6A 4QXGL 1AS8A 2JKWA 5DR5H 1IGCL 4KK8D 4Q0XL 3MV8E 5EZIH 5D1QA 4ZFGH 3TA3B 1HXYB 1WPCA 4JEGB 3NIDB 3LPOA 4PJ5B 1J12A 2APFA 3D39A 2RH0A 3LZFL 1SXZA 3W9DB 4KHXL 1OSYA 2D3JA 3RVUD 3X3FL 2F15A 2A6IA 1HXMB 2JCCF 1G1OA 1ZLSH 4P23B 2BVPB 4XBEL 4RMSA 4QRSA 3ARBA 4FMVA 3ULUH 2OP4L 3NJHA 4HDIB 1GA2A 1W16A 3AC0A 3HFMH 3MRBA 3QQXA 4RBPH 3TIEA 4EOWL 4MXWH 1GSMA 1MHEB 2IANE 4Y4KB 4DCQA 3GSQA 2ZJSH 3T6VA 3VFRB 2QGBA 5EBWA 1KMGA 4ZFOL 2XA3A 3LNEA 2YJLA 1RJZB 1BBDH 3R19A 4FKHA 2Y36H 3OAUL 4PV9B 5I19L 5EZOH 4GG6B 1WICA 4HH8A 4QGTA 4DAGH 4GSDH 4Y2DB 3BOVA 2WXIA 43CAB 5F70A 3UOAB 3C60C 4D8PB 1HEZA 4X4MA 3M1OA 3QG6B 4O02H 1TQTA 4PJ8D 3TBYB 2HVKA 4N90E 1UACL 3T04D 2DLIA 3GMLB 3F7RA 1A21A 3P0VH 2I24N 1OHZA 1QA9B 3SPGA 4HSAC 4ETQA 2XETA 1ZV5A 4M7JH 2CDFA 5DTFA 3GMNB 4X7TB 4ENED 2P3YA 5LBSA 3DDGA 4ZD3L 1X5HA 1GPOH 3QDHA 3MLZH 2QMKA 2C1PB 5EOTB 1YUHB 2EINB 1PCSA 3CH1A 1AZZC 4OFIA 5ALCL 1FYTD 1ZVHA 4N26A 4MJ5A 3EJCA 4JFDB 3TU6A 3GUTB 1S7XB 2OR9H 3WAKA 5EFIB 3UJTL 4WI4A 4P3DB 1B6UA 3G6AB 3MLVL 3EO9L 3X14A 1ZXQA 3QDGE 5HY9B 4WI0A 2LU3A 2W95A 2ESVB 4P2QB 4XO5A 5LWYH 2P43B 4UIKH 3FF7A 2ORBH 5FB8B 4YE4L 3O2WH 1MPAL 1NWPA 4ZTOH 2VRAA 3QIWB 1DBKH 4QHLB 4XCYA 3TA3D 5IQ9B 1MG2C 3QXWA 4RRPA 3ELAT 1J1XH 2D7PA 2OCJA 4PJ5D 1EAJA 2ZUSA 4NO0B 2ZTBA 2D03H 1INDH 2BVUA 3BD3A 3UTQB 3QZPA 4L4VA 2VJXA 1A0QL 3DKHA 5H4YA 5CO1A 5E56A 4P23D 3EYQD 1QLRB 2JCCA 4LIQE 5EU3B 2GC4C 3HS0B 3N3EA 2FH8A 2E59A 1ET7A 2IH3B 2GYSA 1AGBB 2EH8H 3P3RA 4KGJA 1JGVL 4G9FB 4JL2A 4IOIA 4GKSA 3DROB 3RX8A 2QKIA 4LNRA 1MW2A 4X6EA 4WK4B 4Y4KD 4BBWA 3F04A 4YAQA 3V4PA 4BQ6A 1DANT 1DJGA 1X7QB 2A99A 1FVEB 2AK4B 3AWGA 3VB9A 2R4SH 4L1DA 4O9HH 3VRIA 3BZ4B 3VFOA 1UT9A 3QWOA 1E4XH 4AMWA 5IQ7H 4YPGA 4I0KA 4Y2DD 3RGHA 2NY1B 3B3BA 2AXWA 4FJYA 3GYRA 4P5RA 2OPCA 4JQVC 2OJZH 1YMMA 3B2UD 3E3QC 4A63A 4JPKH 4L5FH 4C4KT 2I69A 3ARGA 1XGRA 1AZUA 1TQCC 2VN7A 1A6UH 4G6AD 5IOKA 2RACA 3KDMA 4KVNH 1FI8C 1LJMA 4LCVA 4FXKC 4Y5YA 4W4OC 3WE6B 4BUGA 1PSKH 1XB8A 4GW4B 2CKNA 5CD3A 4HXBL 4C54A 3SDAA 2QVFB 5LQBH 4JFDD 2YMTA 4H5SA 4BCYA 1NQBA 3CVHL 4HX1A 4Y19D 4PGCB 2QSQA 2R0LH 1LQSR 5LBSH 3SE3C 4HLJA 3MRKB 1EAOA 1TVBB 4MGXA 3RHWK 3DXAE 4AMKH 1NKOA 3INOA 4J3SA 2ESVD 4P2QD 4QHKJ 4XNZB 4DEWA 2F53E 4UBDC 1FRGH 3JTTB 3TN0C 4S1SL 2OFQA 3QIWD 3LKOB 4F15C 2H1PL 4EXKA 3ABLB 1AKJB 1OF0A 4XOBA 3D48R 3H1ZA 5DJXA 2WLZA 1BOGB 2FBJL 4ZUSB 5IW6A 3BC9A 3L1GA 4OZIA 3N1QC 3U25A 3GPEA 3MGTB 2VDRH 1EJFA 2XIDA 3FMGH 4PPTA 3I6LE 3SZKC 4CNIB 1SY6A 1EV2E 2KHAA 3OLEA 3ZYJA 4HPOH 3RVTD 4GMTL 1PNCA 3DPBA 4KX7A 3TJPA 5I1HL 3PABA 4LHJB 4K3EL 5AL8A 4AJYV 3OJDB 2O5XH 4FERA 4PHXA 2WLYA 4G9FD 2I9TA 3WHE1 4TLKA 5KVEE 3C5XA 5LBGA 1T21B 1XR9A 1J8HE 3LXUX 3GMOA 5D7JC 2AK4D 3GGWA 4R5XA 1KWKA 3QYMA 5DK2A 5FYJU 5J1AA 5GSRB 3PIQA 5CZXD 3F2LA 5EF1A 4LEEA 3NUKA 2L8AA 2GSIB 3E2HC 2NY1D 5F1SA 1LD9B 3AXLA 4EKJA 5FAAA 5D96C 2E7MA 2PR9A 3S96B 1ZPLA 1JD7A 5KS9A 3MXWH 4AT6B 3ZSTA 1Q1JL 4G7SB 3ME0A 5DUJA 3TFKD 4HPYH 2YD0A 3BHBB 2NNRA 3GJEA 4QO1B 3M7OA 2ARWA 1XF5A 4FNPA 4LGRB 5HVGB 3T3PF 4BFGA 4L8DB 3UC0H 1RUKL 5E6UB 1FNEB 1CK0L 4OW6A 1CXEA 2O6FA 2K6ZA 1IZKA 1TDQA 1KCVH 4UOW0 3KGUA 4LLYA 4N9OB 1I9RL 2G3XA 2D2CC 1A22B 2X7LB 1OGAE 5B39B 5E94B 1AXSB 2X1OA 1TLKA 2CWRA 3VFSA 4W9DC 1F2QA 4F9PA 4KZDL 2EP6A 1BOYA 2ICEA 1UOKA 4FP8L 1KOAA 3Q7JA 5D5MF 4P2RA 1SBSH 4KROC 3VU2A 1WWBX 12E8L 3ZE0E 1RJYB 3OKMA 2W1NA 3DYMA 1X4XA 4HJJH 3WDIA 1AKJD 5I1AB 2YA2A 1KLUB 5AZUA 4DP9X 3VFWA 2PP8A 4OSUH 1RI8A 4DGIH 3GRGA 4LRIA 3UZEC 2Y2TA 3TJEH 4DQOL 3AT8A 1COBA 2VM9A 1JZ8A 5FIEA 1JGUL 4C59B 3RIAK 1KBGH 3BKCL 5B7MA 1L0PA 4OQTA 4I18C 3SE4C 1RIHL 3O6LH 4PH8A 4M03A 3OF6A 3L5XL 4QXTA 1WZLA 1KJ3H 1NGXB 1BX2A 1NDTA 1J0ZA 1I9EA 1SY6H 3D8MA 1KEMH 3B7UX 3HB3B 4NUGL 4X9FA 3LXBA 4AENB 1IGML 3IDIB 2C4FU 2JJSA 4YBLB 4OZHF 2OI9B 4XVSH 4XGZA 3UJJL 2JF1A 3RX9A 1ZVSA 3ULSA 4E0RA 4EUPA 1FORH 4A04A 1DLHA 35C8H 4P5MB 1QO3A 3THML 4LVHC 4NQXA 4K5LA 3MJ7A 2CHWA 3VRLE 1WAAA 3A6OA 5FDYA 3JBG7 2M26A 1WUZA 4IIQA 5C0JA 5D70L 4MB4A 2X4TB 2YQGA 3MUGA 3I75A 2YD4A 3Q43A 3P73B 2PABA 2XG5A 4LSPH 3WNPA 3TESA 4IBQA 4NQQA 2PWHA 2BW4A 4ABQA 2K4WA 1M7IA 5DFWH 4G6MH 3BPCB 3SY6A 4LSRH 4M5ZL 3U6RB 1G7IA 2X28A 4NQEB 4O2EA 4LL9A 1LE5B 4I0PB 1QBBA 1I1FB 3BT2L 3EH3B 1Z3GL 1QI4A 3S0PA 1HCYA 1WUNT 2B5IB 2D7NA 2QPEB 4E5XB 2Q20A 1C1EH 1BQHA 2CHZA 5IHHA 1U3HC 4KQ0A 1LHZA 1XX9C 5JQ6H 2X87A 4KFMA 5C0AE 4MJIE 3T8VA 5T3ZH 2R69L 3LKPA 5JR1L 1JXFA 3CSYA 3S3DB 1LEGA 3D30A 2EDFA 3GSNB 2YFNA 2NUPB 5FUZL 2WO2B 3CG8A 2EACA 3WNLA 4TKWA 4NJAH 1L0QA 1JXGA 2CLZA 3VGBA 5FPIA 4AJVA 3ASNB 1VFMA 4IS6B 2EEBA 3QPQC 5I8EB 4NBYB 2NNAA 2VRQA 3HB3D 5EZPA 1SJEA 3LB6C 4F7KA 4OVVA 4HS8L 1EDHA 5GRVL 3I6KA 1NCDH 1O6VA 4K94H 3GBDA 2OW7A 3CH8A 2FT8A 5TTRA 1KFAH 4ONHA 2F5BL 1ET5A 4D2NA 4L0PB 3FQTB 4ZO7A 5HI4D 4WW1B 1A7RH 1BECA 3MBWB 4MDIA 5E2TL 2Z1PA 3NA9L 3PP4H 3S8WA 1JD9A 2UWEB 3OKOA 2F74B 3UPRA 2FHFA 4EUPH 4F7EB 1E7VA 4YHPA 4ZAKA 3HHRB 1TIUA 3CN3A 4XMLH 5DSCB 2YD2A 2QFPA 4UT6H 5TDPB 3MNMA 2E3VA 3MBXL 4Z7OE 2HCZX 1SLUA 5IIEB 5B3NA 1EVTC 2VW4A 3DNKA 3EH4B 3KYMB 4KMTH 4U49A 4RX4A 1HC1A 5ERWA 3ILQC 4TQ8A 5DEGB 1GGCH 3MX0B 4PIRF 4IJTA 1P5UC 4OCRH 4UAHA 4GG8A 4HH9A 3QE5A 1VADA 1FV1B 1GHFH 4AW4A 5K59E 2PCPB 3ECBB 4NQED 4MQSB 5EU5A 1UC6A 1EHAA 4I0PD 1JGEA 2EDRA 2P24B 3BDYL 5ICXB 3HPLA 3I74A 4YVUA 1EFQA 1RUPH 3EYVA 1JG9A 1MRDL 2IANB 4PJ7E 4TRPH 1GMEA 2XZAH 1T1YB 1UWGH 3GHBL 4V1DE 2FEJA 3MNVB 4PP1D 3X1FA 3MJWA 3D69B 2Q1EA 1XB6A 1J0JA 4G6KH 4XXWC 4BFEA 2J55A 1RU9H 5AOMA 4NM8L 2ZCHL 3TBBA 4CVZA 4JQXC 2WNKA 2H41A 2YIHA 3EJYD 3L3GB 3MZGB 2F9BT 2OMYA 4BD4A 2X2IA 4XP9H 2WTRB 1FH2A 4NGHH 1T3FB 4XCFL 4IK6A 3MRDB 4LLQA 4X8XA 4NM4H 3TNNB 1YJDC 4XNQB 2X4RB 3EXLA 4KDVA 2O5NA 2JELL 3D07A 1L9OA 2DJMA 3ZKQD 1P4IH 4K7PL 1XGTB 3NFPB 5DURB 2CGRH 3VD2A 5I8CB 4CW1B 2IADB 1BLIA 3I6GA 4UQDA 4MZRA 3VTMA 2X38A 4PJAF 1BVKB 2ODHA 4ONFH 5F1IB 4TSAH 1TQBB 4L8SA 5IB1B 4Z8FH 1IGTB 3ZY7A 4HHAA 3A67L 2QADC 3KPPA 4LU5H 1QFWL 4FE9A 4XN4A 1VHPA 3EFDH 4OKVB 3VTAA 4PCKA 4XO9A 5ILTL 3IJEB 4OJFL 3F58L 1EDQA 5T33L 3S36X 1SQMA 2RQ8A 4BUHA 2VR4A 4YGVB 4FLOA 2HJLA 3D34A 2WXGA 4X7FC 4XPAH 3Q5YA 4QY8B 1IC4H 2FDBP 5DHDA 1GAFL 2DTSA 5IOPB 1X7SA 2GIMA 3ETSA 4ZUTA 1CF8L 2UZYA 4H0HB 4U1HB 2ZOKA 1IT9H 3PUUA 5DT1H 3C08H 3TWCH 1MIMH 1TTFA 4C4UA 3HE7A 2Y9RT 1AFVL 3HNVH 4WCYL 2OQJB 3F12B 4GAJL 1QTPA 1YNLH 1OSZA 3VWKB 2ICES 2XJKA 4JM2D 2P45B 4GRMA 2VN4A 4UAOC 3QSKB 1U3JA 5EA0H 5MEQB 2WGXA 5AG8A 1KY6A 3NH7H 1AGFB 1W0VA 5D9SA 1C5BL 3ARDB 3ESNA 2ZWNA 4N8VA 4FGMA 4LF3A 3ZRSA 5CLZA 4G8GB 2JKJA 2YKLL 1PX4A 3KGSA 3NIFB 3V52L 3BKJL 1ZLDA 1S8DA 2D3LA 2XWBA 5D4IA 5IG7B 3RGVA 1IM3A 1KXQE 4KKLC 3WIIL 1AIZA 3BN9D 5IKCB 3HAEA 4ZMYA 4TVSa 5I1EL 5AVRB 5IFHH 1OCCB 4R4FH 2PPDA 3ZL4L 2JVUA 4OZFA 2OJEB 4PY7A 3WIAA 4L4JA 2FSEB 5BQDA 3US1A 5AYTA 2FH6A 3IXAB 1OY3B 1S7UB 3L4XA 3PDGA 3I84A 1YYML 1U8IA 3P4LA 4HWEH 3BZEA 4DZ8B 1IIIA 4U7MA 2V9TA 3SGKC 5BVPH 3E7JA 4WWOA 5AWNH 1BD2B 1U8KB 5INDA 4DUXA 1L7IL 1BEYH 4NN6C 3ARFA 5IF0B 4E42A 1MCFA 5D2NB 1NAML 5GGVY 4P05A 1YAZA 1K3ZA 2R0ZL 5E6ZA 2F53B 4YK4B 4B9FA 4FQQA 2NSXA 3WCYA 3CJJA 1N0XH 4PJDA 4U1SB 1KYOK 2OK0L 1U8LA 4JFHD 3FH5A 1S9YA 3FUFA 1EGJL 4H88H 3HI6L 2I5YL 4QRTA 5ADPL 1FN4B 3U79A 2Q3ZA 4MVBD 1TJMA 4N0CD 4RDQF 2D3VA 2VOTA 5TGBB 3SDCC 4DO6A 3CVHB 2IEPA 3BWZA 1L6PA 2WINB 2FBOJ 3GMQB 4PJFE 5I8OH 4DQAA 3KEHA 4XAKE 2DEYX 2IALB 1YVLA 3HZ3A 3IMSA 5LGJB 1A3LL 1DJXA 2ZXBA 1L9NA 3GBLA 4XP1H 3ZHKA 1DBJL 3OGCA 5KBPA