1NTDA

Structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGENGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase (nitric oxide(a))
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA02
2BZ7A 2YARA 3NP3A 3NYKA 2YAOA 3RYMA 2IH8A 3NSDA 2IDUA 2TSAA 3EH4B 4YSCA 1EHKB 2ZWNA 2QDWA 3BQVA 3IN0A 2MTAA 1AIZA 2IAAC 2J57A 1NIBA 2QT6A 2PLTA 4WKXA 1NPJA 3OQRA 1B3IA 6PCYA 3UABA 4BK5C 3G5WA 2NRDA 5I5MA 4KNTA 1ET7A 1T5KA 3QJRB 3QJVB 4GP8B 5EHFA 4E9YA 3L45A 5E9NA 1J5CA 5B7EA 1GS8A 1AZCA 4G72B 3EH3B 4KNSA 2X88A 2XWZA 1SF3A 2HRHA 2YAPA 2WO2B 3DKHA 3S8GB 4CSPA 1NIAA 2RACA 3AW5A 1JZJA 2VW4A 2BP8A 1J9QA 1ASOA 2FQEA 4DP1X 4DPCX 5B7FA 2DY2A 1WAEA 4E9RA 2FT8A 3HEIB 1AS8A 2IDQA 1OV8A 1JZHA 2ZOOA 3IN2A 1PLAA 1JXDA 1JXGA 1KBWA 2LLNA 5AZUA 1PMYA 2J56A 1HAUA 2GBAA 2A3TA 2XVBA 1DYZA 2YXWA 1GY2A 3UAEA 2BW4A 2VN3A 3NJMA 4YVUA 3SBQA 1L9OA 3CVCA 1SNRA 4A2FA 2EIMB 3QJSB 1KCWA 1BXUA 3TA4D 1KGYE 1OCCB 1ASPA 2JXMA 1TEGA 1AQ8A 1MZYA 1X9UA 1M57B 4BWTA 4G70B 3NSYA 2XV3A 2YAMA 1F56A 1PZCA 1V55B 1ILUA 1J9SA 1I53A 4P5RA 1RZQA 4UAHA 4BDVB 1JOIA 4E9TA 3QJQB 3HB3B 2PP9A 1URIA 2CALA 5B1JC 3TBCA 1AOZA 2UX7A 1R1CA 3PXLA 4A2DA 3FQ1A 5I6OA 1DZ0A 1NTDA 3GYRA 4CSZA 1CYXA 2X87A 2Q5BA 1J5DA 2XU9A 3CG8A 2FNWA 4GXFA 4DP6X 1AZBA 1J9TA 3NJLA 3X1GA 2P80D 3ABLB 1AG6A 1L9PA 2HLEB 2DWTA 3WIAA 4DP4X 2QPEB 4Q89A 3NT0A 3CVDA 1CC3A 2DYSB 4GP5B 1PAZA 2XV2A 2OV0A 4PAZA 2CUAA 1CYWA 2XYBA 3OD3A 2FQDA 3S3DB 3X1NA 4QKTA 1M9WA 3NSCA 1NWOA 5FC9A 4M4RB 3PAUA 1E67A 3CDZA 5I6NA 4KO6A 4DP9X 3NJFA 1QHQA 3WKQA 5AKRA 1PNDA 4NB7A 4BWWA 1JVLA 1JXFA 2IDFA 2TSBA 1AANA 2B3IA 5D4HA 3ERXA 1QLEB 2JFCA 3FU7A 2BP0A 1TKWA 2IH9A 3KW8A 3AY2A 4G7QB 2DYRB 4X4KA 1M56B 4DP2X 1NWPA 2R7EA 4AKOA 1PLCA 1W8EA 1PCSA 5D4JA 3ZIYA 4YSSA 1AZUA 2AVFA 2VW6A 2E86A 1KDJA 2FT7A 1NINA 3UGEA 3QJUB 3X1BA 1ZV2A 2EINB 2EIKB 3GDCA 5TK4A 1SDDA 3NJJA 3IBOA 4N4YB 4NERA 1MDAA 4Q8BA 4YSDA 3NSFA 5PAZA 1MZZA 5PCYA 2PP8A 3MBWB 1GW0A 2YAEA 2XLLA 3ASNB 3N2JA 2XV0A 1AS6A 3FU8A 2W8CA 1N68A 4YSTA 2PCFA 3OMNB 1RZPA 3FQ2A 1ZIAA 1NIDA 5IY5B 1X9RA 2UXFA 3AG1B 5B1BB 4YVNA 4BXSV 5B3SB 1VLXA 2VSKB 1RKRA 2YAQA 4G7SB 3AG4B 1AAJA 2PPFA 4W1TA 3QJTB 3V9CA 1N70A 1OCRB 1WS7A 1NDTA 2GHZA 3FU9A 4BXVA 1A65A 3CZUB 4GYBA 2J5WA 4JKNA 3H56A 3IEAA 4MFHA 1XB6A 2J55A 3TASA 2PPCA 1PZAA 1BXAA 1KDIA 2QPDB 2XXGA 2EIJB 2UX6A 4EF3A 1L9QA 2FJSA 1ID2A 1IBYA 3ZX1A 1BEXA 5I6LA 5A7EA 2HRGA 3FT0A 3ASOB 5D4IA 2UXTA 5I5JA 4HCFA 2W88A 2YAHA 2XX1A 2BW5A 4YL4A 3QQXA 3UADA 1V54B 3FS9A 1V10A 1GS6X 2HZHA 2BZCA 2GSMB 4YSEA 3WG7B 1OCOB 1XB8A 4BWUA 4AZUA 4E9WA 2H3XC 1W6WA 5I26A 9PCYA 3NP4A 3T9WA 3FYIB 1BQKA 4FAAB 2OJ1A 5I6KA 4YSUA 5I5IA 2UXGA 1JZGA 1OE1A 3FSZA 2PCYA 4DP7X 4HCGA 1AZRA 1A8ZA 2I85A 1YLBB 3WI9A 1BQRA 4K9JA 3WKPA 3X1EA 4P5SA 4HAKA 4KO5A 1L9SA 3PCYA 4E9VA 4L0PB 3QPKA 2VM3A 1IC0A 4HHGA 5I6MA 1ASQA 1OE3A 2H5UA 2CJ3A 4W9ZA 5B7MA 3H4FA 1XMEB 3TBBA 2FT6A 4HIPA 2FWLB 4E9SA 1A4CA 1A4AA 3NJKA 4PCYA 2BO0A 4M3HA 4TXVB 2YXVA 1NIFA 5ANHA 4HHWA 2B08A 2XXFA 3SQRA 3FYEB 3OM3B 4DPAX 3IE9A 1GR7A 2VW7A 2P80A 1W6LA 2IWFA 1QNIA 3NJHA 3AG2B 4KNUA 1HFUA 3MX0B 2UXVA 3WNJA 2CBPA 1SHWA 5F7BA 3T71A 4F7KA 1PLBA 1SDDB 1SFDA 5LDUA 1TU2A 3ABGA 1NZRA 4HCIA 4DP8X 5B1AB 3X1FA 1OF0A 1ETJA 1JVOA 5AFAA 2I7SA 2MRYA 4N8UA 2GI0A 1AG0A 1SJMA 3JTBA 3OMAB 5B1JA 4DP5X 2BHFA 3H4HA 3UACA 1ILSA 2CAKA 4A67A 1NICA 1KCBA 2IDSA 4YSPA 1WA2X 3T6ZA 1JERA 2IDTA 3FSVA 1PNCA 4YSAA 2WSDA 8PAZA 5I6PA 1BXVA 2IWEA 4YSOA 3T6XA 4YSQA 1AS7A 2HX7A 4DPBX 4ZK8A 2PPDA 3OMIB 3FQYA 3CVBA 4G71B 2XX0A 2YAFA 1J9RA 1MG3C 2ZONA 4AX3A 4A66A 2BP8B 1E5YA 4KO9A 2ZXWB 3NJNA 3V9EA 1GYCA 1ADWA 4AKQA 3ABMB 2I7OA 3U25A 4G7RB 1AR1B 2AZUA 1A4BA 1IKOP 1WA1X 1ET8A 2XUWA 2BWDA 3C75A 4WTQA 3AG3B 2AZAA 3PPSA 1JZFA 2FQGA 4RH4A 2EILB 3ABKB 1SFHA 1CUOA 3T6VA 1JZIA 2QDVA 5I28A 3EHBB 1BYPA 2FQFA 3X2QB 3SBRA 1TEFA 2WO3B 3EH5B 4YSRA 4UANA 1KBVA 1FFTB 4A2EA 4E9QA 3FSWA 1WS8A 3NJGA 3S8FB 1PY0A 1L9TA 2GIMA 1E5ZA 1RCYA 5F7AA 4HZ1A 2PP7A 3PAVA 1OE2A 3FSAA 2VSMB 1OCZB 1GSKA 4KO7A 1HAWA 1ZIBA 2HX8A 3D12B 2GC7C 3GXUB 4FA7B 3FPXA 3S3CB 1E65A 3BVDB 4NAJA 4ENZA 1L9RA 3DIVA 1ET5A 2VM4A 2YQBA 4E9XA 1FA4A 1JZEA 2PPEA 2VMJA 1KV7A 4KOCA 5B1KA 3S3BB 1AZNA 1ZDSA 3ZBMA 1AACA 2PPAA 2GC4C 2AANA 4QLWA 2H47C 2Q9OA 2Y1AA 2Y69B 1UATA 4HALA 4UF7C 4A2HA 3CDZB 3UAAA 4JHVA 3KW7A 1E30A 1PF3A 1SF5A 4F2FA 7PCYA 4BDVA 4AKPA 4GY4A 3TU6A 1WA0X 2BWIA 3FPYA 2DWSA 2JKWA 3PLYA 3EF4A 3FU7B 1SHXA 2BP0B 1IUZA 1FWXA 2AFNA 6PAZA 4A68A 1NIEA 4F2EA 1GS7A 2DV6A 2HX9A 2R7EB 2GB2A 1BQ5A 1BAWA 3ZDWA 4AI7A 2N0MA 2CCWA 1BYOA 1IBZA 2IWKA 3JT2A 1PZBA 4KOBA 1NPNA 3SBPA 4DP0X 1EZLA 3T6WA 1GY1A 1ZDQA 4JHUA 1OOWA 2FTAA 3DTUB 3PAZA 1KYAA 2HXAA 1MG2C 4GP4B 5TK2A 1CURA 3N55A 3NJIA 3WNIA 1XB3A 4A2GA 3AZUA 1ZPUA 1A3ZA 2OCCB 7PAZA
chains in the Genus database with same CATH superfamily
3RVTD 4FGMA 2AJZB 4KI5E 5DLMH 3EO0A 2R15A 2L0DA 4MQ7A 4N2NA 5C0GA 2H41A 1WAAE 4YSCA 3AT8A 3NFPA 3E6HA 1DBBH 2AABL 1O5DT 5FWQA 2BNQD 5FCUL 2J8UA 1U95A 1CLYH 5L6YH 5D5ME 5C8JB 5CD3B 3QDGA 4LL4A 3QC5X 3RJOA 1B3IA 2XZCH 3FT4A 3ARRA 1MEXH 3ZRSA 2DLTA 3QDMB 4OFQA 2GTZB 4M43H 1E4XH 4LLVB 4HZLB 4FADA 3IWUA 4MMXB 5D1QE 3AAZB 3EH3B 5ESVB 2VRKA 3MLYH 4KC3B 2WO2B 4OVVA 1Z9OA 3LPFA 1KXQA 2VDQH 1U92A 3M7FB 2XFGB 3BIKA 3UPRB 2B14A 2H1PL 4ZZFA 4BZ1H 1M05A 1WFTA 2XBDA 4NQTA 3BP4B 4R96A 4R4FL 1WAEA 3TWCH 3ULUE 1YNLL 4ELKA 2AV1A 4R9HA 5I1GH 4LT7A 1JXGA 1BIIA 4X7FC 3NQIA 4E5XG 2F19L 2D7MA 3W2DH 3ZDXE 2YXWA 5CAYB 1E9QA 4OQTH 3NCYS 1C5CL 1JPEA 3QNXB 4F8TA 1A6ZB 1KCWA 3NDYE 5DJDB 4A7QA 1OCCB 1SLXA 2CO7B 5JA9A 4W68A 5J6HB 1MFBH 1UZ6F 2EC8A 3APMA 3US1A 1S7UA 4NQDE 4TN9A 4HEPG 4KK8C 2FYYA 4N2BA 4UQIM 3LV3A 3TC9A 3DTXA 4DERA 1CFMA 1JAEA 3UC2A 4LCUB 2BP5M 1NCDL 1H3UA 1BAFH 4HIIA 1OO2A 3FJTA 1HHKA 2F61A 5F3HB 2UZXA 1IRAY 1DL7L 5F21B 4AZ8A 5DRXA 5BS0E 1RZ7H 1JWUB 2M26A 2IXQB 4WV1A 5DLLA 5T1LD 3CZSA 3QXTA 3D85D 4PLOB 1JSYA 3V2AR 3MJGX 4JDEA 2P80D 3RPIB 2BY0A 4GKNB 2BSRB 4X7CC 3JTSA 5IW1A 4NNPL 1Q9OA 1LK2B 1REIA 2CO2A 3OKMB 3SYOA 2LR4A 1BDYA 2YSTA 1HI6B 3E9UA 4P2QB 4PWHA 2AEWA 1U8HA 2F54A 3LPGA 2FQDA 2MHAB 4G59C 4X4ME 5H2BA 3S3DB 5KYWB 1ZE3C 1NFDF 2Z31A 3TYFA 5AVZB 1BECA 2G0KA 3KCPA 4XT1C 2V2WB 4CC0A 3Q5YA 4PJ9C 1PYWB 5C3LD 2HPOA 5HGGS 4BWWA 3WJLA 4YHPA 1VZGA 2VN7A 2TSBA 1AANA 4HCRL 5IQNA 3D18A 3ERXA 3PGFL 2DQDH 5D2LB 3MREB 3TN0A 1DEEB 3BVTA 3MNZB 5F7UA 2ATAA 4WCYH 3MLUH 4RGOL 1EXGA 2YN5A 3OG4B 5KYYB 1YAZA 4H1LA 1FFRA 4UB0L 1OB0A 1A7RH 1CDUA 4R4BA 3MRCA 4WO4D 1D5BB 1AJ7H 1T4KA 3MJ9L 2P5EA 3MLXL 3PNWB 1M2VB 3FCBA 1A7QL 4MCYB 3MMEB 5E8PB 3MTXA 2ZNXA 4OF7A 3PS6A 3JVGA 4YWGL 3TZVB 4L3EA 5DS8A 3CHPA 5DVOA 5BV7B 1MZZA 1H6UA 4X4XB 5F70A 5LQBL 5CO1A 5CXPA 4OF6A 4FXGC 1IT9L 5DQDH 1WICA 3AM8C 5I18L 1ES0A 2C3XA 3MGOA 1H8LA 2PCFA 4MZRA 4KKZA 1KG0B 4UQAA 5KW9H 3P40A 4PD4J 5E8EB 5J9PB 1X9RA 3L3KA 3CFJA 1FFOB 2L04A 2DLFL 5E5RB 5E03A 2ZSVA 3OSKA 1TDQA 4JKLA 1NLBH 5DJ6B 2P8MA 4QYOA 2ZF8A 5LCVH 2C4XA 1N8ZA 3HI5H 1XR9A 1AAJA 5HHOD 1I7UB 4X9GA 4PJ8A 4BWUA 3KLHD 3QJTB 3NEEA 2KZ1B 3FO9B 1WEJL 4Q9QL 4R0LC 4XMKL 4NDMA 4Z3IA 3FU9A 1X6NA 2ZIDA 5CR8A 3D39E 1XIWA 2BRRL 1FFQA 4DFHA 5IB2B 3WIFB 1AFVH 3MR9A 4ODVL 4XVUC 1BXAA 2I27N 5C0FA 5JR1L 1NC2D 5LGYA 4QOKE 3IAGC 2YBRB 5CKAA 1IU1A 2VLME 3UG5A 2LGNA 1A6VH 4OV5B 1S7RB 4Q6IB 1ADQA 1NFAA 3HG1B 1E5BA 4H40A 4GXVH 3VMOA 4LASL 1HHJB 1YPZB 3G08B 3DSNA 1YEHH 3NRFA 4PJHE 4E2OA 4N6RA 3UADA 1O7SA 1P1ZB 2E47A 3FS9A 3RVVC 1OOAA 3GMMA 1VDGA 1T0NB 4F92B 5GHWL 1GOHA 1AXSA 1GTNA 1F41A 1T5XA 4R3SB 5T1DL 1PQZA 4ZX6A 4GIAA 5FW7A 4BK5A 3PV6B 4XVOA 4JJ5B 4OZGE 3LKPA 3WEXA 3FYIB 3T04D 1ZT4A 1JPST 5GZNA 4XE5B 1RPKA 1R5VA 3GMRA 4UOJA 5G55A 3B9KD 2UXGA 4M8RA 4KI1A 4WI0B 1TQCB 5BUAA 4GUOA 3CN1A 3LEVL 4KTDH 4PJIB 4PSPA 2JB6A 2K1MA 1FDLL 4HQQL 1MFCL 1YG9A 4N2MA 1INEH 3LQAC 2NY1B 4UIKL 4DZ8B 5E6ID 5IHZB 4LVEA 3DIFB 5E6SB 5IMLA 3K2KA 3W5MA 4HHGA 2OXHB 4EI5A 2GJPA 4OLEA 4JR9L 4TSCL 3H4FA 1KIQB 4NOBA 1QPPA 5ECGA 1YAIA 3G6JA 3ABZA 4F7EB 4XCFH 4N90E 4BQ9A 4PG2C 1YHPA 2AW2A 1J05B 2WXFA 2B1AL 4ENEC 3VXSB 3LKSA 4Q56A 2AP2A 4FI6A 4XPTH 4FX5A 3ISRA 1A1OA 4QXUL 2D31A 3WLWC 1O9ZA 5BV7H 3IE9A 5IJVB 5IROD 3CWGA 4TSAL 1CCZA 5L7XH 3O3EB 3B5TA 1I1FA 4MCNA 1GAFL 4O51A 2E6PA 1A9EA 1DQTA 1F0LA 2PF6A 1QBLL 3NQKA 2YWZA 5HYSB 4OZHA 3T71A 3V10A 4LQFL 1J18A 2XZQH 5MHSD 4GLRH 5G2NA 2MNJB 1KNOB 3H9SA 3ABGA 4IKKA 5IR1A 4ZNEE 2E9GA 5JLZB 1D9KA 1X5KA 4M4RA 5DHVB 4N1HB 4OI9A 1D2OA 1VACB 3DX7A 4UQ3A 3QDGD 1ZLDA 4WWNA 5BZDA 4AIEA 3B7SA 3OMAB 3FT2A 5EF3A 4PHXA 1FGNL 1UCBH 2HYMA 3T2PA 3K71B 3OAYH 2FAUA 2VLRB 3L3HA 1WA2X 3CX5K 1N64H 4OH2A 5IFJA 3CD4A 2WSDA 3KBEA 4GMSH 2ZX9A 3MN8A 1PIGA 2AMUA 3PGDA 2Z3FA 3RIKA 5C6PB 5AW0B 5C86A 2F7RA 4PJ7F 2YAFA 3SE8H 2JK5A 4Y7MA 2P8PB 2NYYC 3CBRA 1GGYA 2K8MA 4MD0A 4K5MA 4KO9A 3LZRA 5D7IB 2R1WB 2IAMA 5AYQA 5SWZB 1MJ8L 3GI8H 4Y5VC 3KJ6H 1GYCA 4O2EB 1HILB 4NGHL 1HJCA 1W80A 3L6FA 3A67H 4NPYB 3CSTA 3BW9B 1GMIA 1TG8A 4ZAKC 3OAWA 4FQ1H 1OEZW 1B4JL 3DA0A 1FNLA 4XC3H 1OAYL 2OS7A 3SDCB 1DUZB 2AK4B 3UZVA 3MBWA 2FL5A 3FL7A 3A4DA 3LZNA 3M7OA 4MYPA 4M03A 3MV7A 4OJDH 5ENWA 5DCCA 1PKQB 2VMFA 4GBXA 3ZY7A 2QGEA 1XL6A 2VDNB 1GGIL 2QV4A 3L5XH 3I6GA 2FIRT 1WC7A 3QUYD 3C8DA 1S8DA 4AUYA 4G5AA 5ITFB 3GXMA 4Z95L 4LP8A 5L2KA 4ZOBA 4ICXA 3CVHA 4HIHB 2Y9RT 4ODWB 1A4JB 4G5ZL 5EN3A 4DQOL 5JXAH 3CC5A 5EZPA 1RMFH 1QFWI 3V6ZA 2R39A 2QQNL 3QUHA 2VSMB 4MLIA 2WD0A 1AQKH 2EYSB 3HZYB 1W72B 5I16B 2VDKB 4I2XE 4FFZL 3BVVA 3EF7A 4IOFD 2VLJA 5JW5A 3S3CB 3HTLX 4Z3JA 3CXHK 3DIVA 4KK9C 3GUFA 1OGAA 1DVUA 2BNUB 3ZHDA 4Z78B 2B77A 1ZA3A 3H2WA 2DJ4A 1KV7A 2QVIA 4LPVA 1MRCL 1JV5A 4GI8A 1B4TA 2OL3B 2IANB 4JQIL 1S9XB 5I8CA 4WI2A 2EYRA 2UWEE 3K72B 3LIZL 3Q2LA 4L29A 5HYIA 1HK6A 1T1XA 3OAZK 2F54D 3QGVA 2ARJQ 2H47C 4Z6AT 2QVMA 5C0IA 2Q0ZX 4UF7C 3S35X 4TL5A 4B3VA 4BHUI 2BVTA 2HWZH 1J9CT 2XZAH 2Z31D 1E30A 2J6EL 1NFDB 3GQFA 4NN5C 1KLFB 2P7TA 2KERA 3O8XC 3O11B 1FCGA 1XGYH 4GIOA 2NMSA 4XNAA 4OGZA 3WENA 4AVIA 3RUGA 4HOXA 3RP1A 3E9TA 5CHNB 5L4MA 5CWSB 4D9LH 3GTTA 3NESA 3UYPA 4O02L 5IB5A 2C4FT 2HT3D 4L2LA 4K0OA 5AALA 3TN0D 4KAQH 3RDTB 4OB5H 3EUUA 4XXCA 5EWIH 4Z77A 4KV5F 1FC2D 2QQKL 1PZSA 4FJYA 2O6EA 5ID1A 5IOPB 4OGQC 1S78C 1ZA6B 1U6AH 1FIGL 1PZBA 3PP4L 1UM6L 2IH3A 2P5ED 3MBXH 3RWDA 2H9GA 4YDIH 1U3YA 3QI9A 5C0BA 1DVSA 3BUTA 4ZYKA 1G1CA 1TJHH 1NUGA 3G5VA 5DD0L 5FO7B 3D4ZA 4ADJA 4BSJA 3JQOB 3QRBA 3SJVA 1DFBL 1KSRA 3RWCA 3RZCB 2YLHA 3BAKA 1CU4L 2XFXA 5TK2A 5ADOH 4L3ED 4PS4H 4HKJB 4JN2B 2Q2LA 5C0CA 5J4MA 5HDOA 2GY5A 2WHVA 1FVDB 4R90H 4X83A 2BXZA 4B7LA 4QLRA 3I3BA 3ZL2A 4PTTB 2NR6A 4I1PA 4PP2A 5JW4N 1JWMA 3F05A 5E2VH 4EVNA 3VFVA 4Q9RH 3TCTA 5KVEL 2VDNH 3KJ4B 3EYUH 3J07A 4I48A 2X4TB 1DJYA 3IM1A 4M29A 4DT2A 4XO4A 2B59A 2VITA 1BCIA 1V7MH 2VC2B 2AHIA 2WLLB 4H4NA 4TPRH 3O6FB 2IAAC 4GS7B 4PJ8D 5HHPA 4OZFG 2R69H 3N5AA 4YL9A 1K2DB 3V0GA 2C3VB 1EFXB 4E41A 4G9FE 3MLWL 5C0JB 2JMRA 4WIQA 1XIWD 1MVYA 4G42B 4KZ0A 3BAEH 5LBGA 5I1KH 4NKDA 2VDKH 2E74C 5TDOA 2NUPA 3A6CH 4G72B 4D0DB 4LP5A 4D9RD 5HI3C 3IBEA 3BH4A 4DGVL 4KUZH 4NPJA 3RBGA 5IGXH 1QFUH 3WIIH 1SMAA 2YGVA 3BAJA 3G04B 2DLGA 5DD6B 4N5ED 5JIKA 1IJ9A 2BJMH 3C09B 5C3TA 3OB0K 1NIAA 3FQRB 4ETQA 5L88L 3TNMA 3BAIA 4UU9A 3CXFA 1KN2H 3ARFA 1QUNB 5T3ZH 1AGCB 3VGEA 4B50A 5DRWA 4NRYA 1UJ3B 3IGLA 3IGAA 3LCYA 1QRNA 4LSUL 1CLZH 3S37X 1MCWM 5FO8B 1KEML 1QWNA 2FWSA 4K4KA 3I6LD 1YQVL 3S37H 3CVCA 2FHBA 1DQJA 4ZUVB 4ERSL 3MOBL 5DK2A 4KJYB 3UG3A 1IIKA 1LDPL 4V33A 4QXGL 5EU3A 3TH4T 2OSLA 2FBJL 4F80A 6FABL 1AGDB 1UT2A 3QUXA 3FQNA 4KX8A 5TQ2L 1OP4A 4EI5D 4BDVB 3QUGA 1H9DA 3BXNA 5FO9A 4MS8C 1I1AA 3HB3B 4KXZI 3LB6C 2W80C 3EOAA 1TJIH 4OKDA 5E4EB 5FEBA 3TBCA 4FKKA 2O6PA 1ZXQA 4R7VA 2GITB 3T3PF 1KXTB 3VTAA 4NNXB 3PXLA 3DETC 4A2DA 1UXSA 1CDBA 2YMTA 2BVOA 3GMPB 4NENB 1FVEB 5EOTA 4JY6A 4FZEL 5HHMD 1MI5E 1TPXB 2FNWA 4W9GC 3VB8A 3CLFL 3ABLB 1R3HB 5I73C 1UKTA 2K3HA 4L4VA 4TUJA 5E6UB 3D51A 3IWVA 3KL5A 1JHLH 3OKLB 5JPNB 2DQUL 4MJ6B 5H4YA 1OXYA 5D7SL 1LEKA 4PJ5A 4PREA 5I1IL 1XBDA 1NWOA 2IALB 3H9SD 4Y1AB 5EPMB 4TQEL 1D9KD 2E46A 2UVEA 4MDJA 3SDXF 2NY6D 3HA0A 3QQ9C 5GGVY 1I7RA 2X4NA 1MQ8A 4UT9H 1I8IA 1MRDH 1PS3A 4FFWD 1QLEB 1UEYA 1ZTMA 1CXFA 2BP0A 3I6KA 3VW3H 4NRXA 4NN6C 2EXWC 1RJZA 5CBAB 2GCYB 2XT1B 1CMOA 5F8QC 5HHOE 3FFCE 1E4XI 1MCNA 1O9VA 1CE1L 2I07B 4X9HA 3B6SB 4HW6A 4HJIA 1KDJA 4JO3L 4HK0B 4POZD 4PJ7B 1T22A 1O6VA 3AS0A 4LSSH 4DCQB 4X6EA 4G8FA 3SPJA 3U30B 3X1BA 3IKKA 1QBAA 3BUPA 1KTRL 4C8XA 2IAMD 3F58L 1RK0B 2YD9A 1RVFH 4D9QD 4H2AA 4LNRB 2ORBH 3FUKA 3MV8B 1GZPA 3CSBA 1EJ8A 4NUMA 3K8KA 2MEJB 4KKAD 4LSQH 2CHWA 4CJ1A 3S96B 1E27A 4RWYH 1GW0A 2HFFA 4L1BA 4WFED 2YAEA 4YDVA 1YMME 4HBCL 4CW1B 2DM3A 2V3DA 1VZHA 3K6DA 4KJPD 5EZLA 2QMKA 3LRSA 5IB3A 2YD4A 2VZTA 1GCYA 2QADC 1GXEA 3GMNB 3MV7D 5BW7A 4GBXD 4MJ5B 5C0DA 1NPUA 1RH8A 1YEKH 3RBSA 4GQPH 2ICEA 4NQVA 2X9XA 1C1EH 5CU9A 3WUWA 1OK8A 1VESA 5H8DA 5L2KD 1HH9A 2DMCA 3G3LA 1NMBH 2DTMH 2BHUA 2QKSA 3D5OF 1SN5A 3WHE1 2D3LA 5GS2D 1JMXA 3QCVL 4GRLB 5DYOB 4QHLA 2J5WA 2AQNA 5K33A 3I02A 1AH1A 3CGTA 4OIAA 4PTUA 4PR5A 5AZ2L 3W3BA 2J55A 1P4BL 2CCLA 2FEDD 3H6AA 2QPDB 5EBMA 3V9FA 3R7QA 1OGAD 4EUPA 3V0AC 2BOBA 4U4BA 5F0JB 4TTGA 4RGND 3HNVL 1N18A 3OKDA 3B2PA 1TZ8A 2WLJA 4YXLL 1BEXA 2AQ3A 3GBML 2N7AA 5DFWH 1M2OA 3PE9A 4RMWA 1T04A 3DHMA 2W88A 3QUMH 1H3TA 4TKWA 3W1ZA 3DBXA 4JY5H 1A2YB 4MXQD 3UPAA 1N6QL 4LF3A 2PYEA 5F1OB 3IB4A 5DA0B 2ZP0T 4BQCA 1VEMA 2QSCL 2I9TB 4E9WA 1DVFA 4JPWL 3IXTA 3MXWL 4UAOB 5JPMC 3IPBA 4HKBA 4M3KB 3O2VH 4MASA 3IDYC 2HRPL 5DI8A 3U1QA 3U0WH 1NBVL 4LO9A 5TJWK 3ESUF 1QLEH 5FYJE 4FNTA 1OE1A 1UM5H 1GYUA 5BZDB 3ECQA 1AZZC 3W39A 3H7BA 1SDYA 1YLBB 4RFNB 2J8UE 4NX0A 3QDGE 3FCGA 3FCTB 5HJGA 3L9RA 1PG7X 4I1NB 3ZYOA 3RHWF 2JELL 1ZLSH 2Z9TA 3V4PA 4LOEA 3WHXA 5D7JC 3QI9D 5C0BD 2R2BB 1A4CA 3F00A 4ZTPH 1I9JH 2FO1A 1LWRA 1OAXL 1PG7H 2YGNA 4Q4IA 3SJVD 4IRZL 1KB5A 5CZXD 4YXHH 3FCSB 4OFPA 4QF1A 4OGYH 3WUZA 1E7UA 2B08A 2ITCA 5C0CD 3MRGB 3DLQR 2VSDA 3AABA 3GRWA 1HWGB 2R56H 4AGNA 3VFSB 4APXA 3NACH 2BVQB 1GGUA 2NR6D 4U0RC 2X9ZA 3VGAC 3CX5J 4BSVA 1IBGL 1TCMA 3D50A 3MX0B 1OKEA 2UXVA 3GEFA 3OKEB 1TXKA 2QEJA 1SHWA 1QMUA 3H0TA 1BEYH 1FQ9C 2WOBA 3HUJF 4GUPB 1HIML 3C5SA 1QVOB 5CSZA 4N3UA 5C6TH 3MRJB 2DQ6A 3HI1B 4QJ4B 3EJRA 1T1ZA 2OX5A 2EIDA 3KPPA 5GRWA 5E5MA 4G43B 4E41D 1NICA 1QYGH 1V7NH 4PRNB 5TE7L 4KQ4H 4I3RH 5DJZA 3SIKA 5AOKA 3HHSA 4ZS6C 3E1ZA 4K7PY 3THML 5JMOC 1Q1JH 4N2KA 2HJKA 1MXGA 3O41A 4YSOA 4DPBX 1XGRA 1K5WA 3FQYA 3CQFA 2EXYD 3B1UA 3CVBA 4J4PC 3N6YA 1J9RA 1M1SA 4X8XA 3INUH 1PKOA 1RZGA 2BCKA 2QV2A 3U2SB 2WCPA 5AW9B 2EDHA 4HWBH 5DO2C 3ARFD 4G8GB 4TLKA 3QDAA 3U0PB 3K2MC 4ZQTA 2XTJC 2WXLA 3OHXC 3ABMB 1UUSA 4J3TA 1QRND 4FZ8H 3U4EA 3WFZA 1SJHB 3HZ3A 5EEZA 4JVWA 5I1AA 2CKBB 3L3DA 5MI0B 3WU1A 3DVGA 1F11A 2FQGA 2W07A 1QFWL 2NT0A 3CCHB 2FD6L 2WBJB 3BEVA 2F54E 3EHBD 3CZLA 1KBVA 3CXHJ 2X2JA 3HC4H 3TFKC 4L8SB 4OKVA 4LEOB 3QUXD 1RCYA 1B9ZA 3P4MA 1DVTA 2FX8L 1OE2A 3GJFK 1F3DJ 1CFQA 5IJKA 2EUWA 1F58H 1I1AD 4TVPE 4TMPA 2QPSA 5C09B 5JQ6L 3WTWA 3C60B 2HT2D 3HR5B 1HAWA 1EO8L 4BZYA 2WVSA 2WYHA 3T3PB 5EIIA 1GIGH 2AXJA 4IKNA 1AC6A 2B4CL 3FOLA 2P5EE 5GS1C 3FRPA 1NGQH 2YA2A 2VMDA 1N9PA 4LIQH 1OAQH 3HC3H 2BHYA 3TCLA 1ZGLB 4FC3E 4YHNA 4KTGA 4YJZL 1UT9A 2HG5A 1FAKT 2VDLB 3LDBC 4U6YB 2D0FA 1UWEL 3EYFA 5IFAH 2E7LC 2R69A 1ZXKA 4PJ5D 5DD3H 2CRYA 1Q9KA 1JJUA 1WGVA 3MA7B 3NZUA 3K8LA 2AXFA 4ODTH 2DI8A 4MWFA 4KDTC 3SDXB 5IMOB 3FPYA 4P5MA 1FN4B 4Q14A 5DJXA 4DKFH 2CDEB 2VN4A 4QCIA 4P2RB 5LG1A 1CIDA 1K8DB 3KR3L 3RLSA 4I87A 4LARH 3OPZL 2HX9A 2GAZB 5KAQG 4EDXB 4NM8L 4K94H 4AM0B 4A63A 4XGZB 2HRLA 2OMVA 5FHBL 4XWOC 1BYOA 1DQLH 5B38B 5GGUB 1NPNA 3FTUA 3JWDH 4ODHH 2Q86A 1K4DA 2BSSB 3FK3A 4P07A 3P0GB 2GI7A 1TTFA 4JW3A 4Y16B 3CHXA 3D2UB 1A6WL 3MJ7A 4K15A 1P4LB 1WK0A 5T5NG 1XF3A 4QD2E 4EI6B 4D9RE 3ES6B 1YECH 4M62H 3MRFA 4MKMA 5FYKE 3TV8A 4KH2A 4B95C 4JMNA 4FMFA 1U3HA 1ACYH 3BGMA 1KCVH 4LDEB 3WNIA 5G4MA 4A2GA 5IMMB 3U6XA 4LSTL 4S0HA 2WINA 4HC1H 5AAWA 1MIML 1JGVL 1DBKL 3WXWL 2AV7B 2BSCA 1J8RA 3TO4A 5EU4A 5JTWA 4P5TA 2J12B 4ZO6A 3MCKB 2V2TA 4IRJB 3INOA 4WNQA 5ADPH 2V37A 4G6JH 1D5MA 4MD4A 4RRPG 3SDDB 3IN0A 3VA2C 3VM5A 4G83A 3BSHA 4JLRA 5INCA 1MIEH 1F4XL 4M7LH 3BZ5A 1T1YA 4WKXA 4Z8FH 3MV01 3U9PL 3I84A 1ZGLP 3PQYB 1T21A 4LU5L 4HS3B 3UABA 3HHRB 2B39A 2FZ3B 2NRDA 3FB5A 4NQEA 3PHAA 1AHWA 3Q1SL 4RFOH 1WV7T 3F7VA 1RP9A 2OSXA 3L45A 1J5CA 4AEEA 4HWNA 4H5SB 4XC1H 2YD7A 4Y5XA 4LPWA 5DD5L 3EO9H 2VXTL 3RY5A 3V0VB 1A6AB 2C26A 3K91A 3MHZA 4XI5C 4FFYH 3RU8H 3BN3B 1KFGA 4PWIA 2KHAA 4KBPA 1UCTA 1LILA 3MRQB 1ACCA 1OB1A 4P23C 1PY9A 2VW4A 5IWLC 4WU7B 5HPMA 4DPCX 3W37A 4ADGA 3EFDH 1QX1A 1R3LA 4AUJA 2VDLH 2ZX8A 4X5RA 5ERWB 4UT7H 2PYED 3JWNH 4MQSB 2YMXL 3JV6A 4YHIB 1HDMA 4RAVB 2WVVB 1KBWA 5AB1A 2LLNA 5K39B 1PMYA 2X2YA 1DVFD 3IAPA 4G2AA 4MAYC 5DD1H 2EJ1A 1OSPH 2ZP8A 2WNWA 2VO8A 1BD2A 2PW1B 4ZMOA 2BM3A 4TNWK 4QRSA 3DURB 1P5UC 4AW7A 2SODB 3H9SE 1NC4B 3IDMA 5EBWA 4A2LA 5HDBE 1SGKA 3E8UH 4TULL 2IFGA 1BIHA 5GRUH 1SYSB 1AIFA 3CVHL 3QQ4A 4JE0A 3QR0A 1RP8A 1I8UA 3IJEB 2O26U 4QGTA 2HKFH 2CO6A 4P04A 1G5GA 1T20A 2R23B 4PFEA 1UACL 4UMGA 5ACLA 3UTQB 1AOZA 1G9NC 1KPUA 3BGAA 4P9ML 4AC2A 2W60A 5EIQA 2E4TA 2YSSB 1T66D 2J2ZB 4JPIB 1U8LA 5D9SA 4FNLH 1CYXA 4DK5A 2F1EA 1NKRA 2VR9A 2X1OA 3NGBB 5DLML 3VB9A 3NJLA 1TCRB 4W9DC 5T1KA 1B4RA 1FJ1B 2CXKA 2ZPKH 4D9QE 3FTGB 1HKLH 1WBYB 3S36H 3G5XB 2JJVA 4PY8I 3U82B 1CLYL 5L6YL 3L7EA 4NC1C 4AQEB 3X1NA 4IU3B 4N8CL 2LQRA 2XZCL 4G6AD 4WFEE 3VI4F 4BCXA 5E9DA 2L7JA 2PWFA 2XWJB 2C4FU 3KDMA 2JIXB 4X5LA 5JPMB 5GSVB 3WJMA 2E76C 1E4XL 1I3VA 1R3JB 4NB7A 1IGJB 3IDYB 2FJGA 4GEJA 3UG4A 3ZRCC 3FQTA 3PHQA 1GZHA 3SE3C 4ZPVB 1JDDA 1HHIA 4HUUA 2XBTA 4DGYH 2NY5H 2VDQL 1BOGB 5EUKB 2QBWA 4BE6A 1KGUA 2DYRB 2VLLB 3HC0A 5FV1L 3VXOB 1IE4A 4XN2A 5I0DA 1QTYT 4ZSOA 3UBXG 5I8EA 3TWCL 1S7VB 4UYPA 4IMLB 3P77B 4ODBD 1RZIA 4NHCL 4J2QA 2ENQA 5I1GL 4C57C 4HKZB 5LB1A 3TXAA 1HOCA 3W2DL 2F53A 1ZLWH 4UWQB 5CGMA 1OGAE 1KTCA 3QEQB 4N2DA 3V7AE 4IDJH 5PAZA 1FNEB 5CJXC 1JNHB 2JKTM 4FG0A 4XWGH 1D5IH 1BX2B 2CO4A 3SDAA 4ZFFA 4OLYH 3MRHB 3VGAB 2C9XA 1C7TA 1HJBC 4PJDA 1AD0A 4Z7VE 3M1BB 3WNNA 3EJTA 1T7ZA 2R83A 1BAFL 3BD4A 3BH9A 4K7PX 4NO5A 1HZKA 5IQ9B 3UGUA 3L4YA 4YC2C 5IEKA 4ZJ9A 3D33A 1WCBB 1MW0A 2ZE0A 4GIPD 4OM0H 2Y6SD 3BQUD 1RZ7L 4LE8A 2P24B 5I66A 1MNNA 3ZE0F 4JFPB 3VXRB 4XVSH 3RPBA 4CSSA 3IXAA 3KGTA 1D6EA 2J8OA 5AYUH 5I19H 1AQMA 3VWJB 3H56A 4F7CB 5IEHA 1S9VA 43C9A 1S9YA 3SKNB 3WKML 5DHYB 5A2BA 1F86A 5E1AA 2MIZA 4XP5H 3EAKA 4PM1A 3SKOA 1RUML 3V5HA 3EJSA 3L3GB 5D1ZC 3Q6GL 5C0NC 3TLRA 4P48A 4MNGA 5FGSA 3NJXA 4F1SA 3FT0A 1MCWW 5E1GA 2E0PA 2XQYG 3HS8A 4MZ2A 2EKSA 4QT5A 2YPLE 4XCCH 4A6YA 4GG8A 2WLKA 3FT3B 4FQHB 3MGAA 5DSCB 4YGVA 5D8JH 5C7XH 4DW2H 1T7XA 2GSMB 4ZX3A 4HJEA 2ZYHA 2MPAH 4EI0A 1R4XA 3FF7A 4KRLB 1Z0MA 3VFNA 1JGDA 2DQDL 1BWMA 4I5BA 1ZSDB 2GUOB 2LLGA 3CAFA 3MLUL 5F7LB 4M6OH 4ZMVA 5L8KB 3ARYA 1TNNA 2I9LA 2N59A 2LOEA 1BV8A 2OMBA 3UC0L 1A7RL 3DIDA 4YO0B 3QXDA 4JKKA 1JZDC 1NAKL 4W9EC 4Q7DA 2I85A 1A1NB 2BXYA 2FB4H 2Z92B 1OARH 1H8OA 3EGDB 5D1XC 4GW4A 4O9HH 5T3ZD 3WS3A 1E4KC 5ESAB 4TLTA 4K3GA 2BIIA 1BVKB 3HG4A 4N3TA 3SCMB 3WS6C 3T1WA 1CDJA 3WMSA 1WH0A 5JDSB 4WJ5A 4ZTOL 4JFXB 1AMXA 1A4AA 3EDEA 3CSGA 4GB9A 1ODUA 3QZWA 4AIOA 5FM4A 1U4EA 5DQDL 5ANHA 1U3HD 2P8LB 4NQCA 5A1AA 1LP9A 3MROB 4BH7A 1LYQA 1IGCL 2GT9A 3MUY1 4HV8B 2NY3B 1JGUL 4JFYB 5E0QA 3HKFA 3MYJB 4NSKA 2VE6B 4F20A 5CCHE 5KW9L 1QSEB 4I0PB 4MGXA 2ETWA 2YC1A 3TO4D 3G6AA 4P5TD 3V7MA 4PJFF 1G94A 3TBYA 4JY4B 5LCVL 3HI5L 3SO3B 1XHHA 3DXAD 1ZLUK 8FABB 1U9KA 4PRAB 1NH6A 1WDAA 5IW3A 3CK0H 4Y9FA 1MCQA 4GW5B 4PJXB 2K6WA 2X6CA 5C0RH 2GTQA 4OZIA 1NCAH 1YC8A 1X5FA 3LPPA 4J3SA 4KZCA 1AGBA 3U83A 4NQED 1ILSA 2ZOUA 2CAKA 2ROXA 4OJAA 1NEZB 5CZRA 1CL7H 4OSUH 4YDLB 2WUBL 1W91A 4JZJB 1A6VL 4QGYA 1KPRB 4N0CD 4D0BA 4GXVL 1D7DA 2WUCH 1YEHL 3TA3A 3D07A 3UTSD 4WI9A 1A3LH 2VOTA 2CMRH 3GIZL 2G75A 2YK1H 2Z7YA 3QRLA 2YN3A 1E5YA 5GXBB 2VRAA 2WZPA 3PHOA 3UOAB 3ETSA 3HLKA 3V9EA 3O6FD 2L7EA 2XV6B 3DK2A 3U25A 5EFIB 2NXYC 4Z3GA 3RFZA 3EXJA 4UBDC 3BT0A 4WW1B 3RNKB 1QR1B 5MENB 2VL4A 1BD2D 2GBTA 1A22B 2MJWA 2J72A 4KTDL 1CICA 5I9QC 2A6DB 3GLAA 5F9WB 1FG2A 2KKQA 4QTHB 5F96H 4FYRA 3UZQA 4HWEH 2MCMA 3GM0A 3MRDA 4UM9B 1HE8A 2F7IA 2EIBA 1KB9K 1COBA 4GINA 1FFTB 1MREL 4D7PA 2P9RA 4XCFL 1E5ZA 1H3PH 2B1OA 4FI8A 4JFOA 1MCOH 2D7OA 1W16A 4H8VA 4CN6A 4XPTL 1BVNT 5ICZB 4OF0A 1X5HA 2B20A 4OLZH 5IVXF 5AL0A 4E9LA 3EFFA 1SVZA 3GPSA 5IOKA 2CLZA 2A77H 5T1JA 3ME0B 4NZUH 5LGHH 3TH3T 1GC1H 3CFKA 3GIVA 3RGBA 4X7SH 1TMQA 4M8QA 5L7XL 3VFMB 3ZXAC 3EBAA 1EEYB 1NCWL 5CJQH 2EZ0C 5C70A 4F9PA 1OTUD 3BEWA 3ULVD 5BQDA 5JHAA 3V5DB 2CBOA 3B2XA 1U93A 1JZEA 4XCEA 5T1KD 4MNQB 2YEZA 1C8QA 4KOCA 2XZQL 2Q7NA 2VAJA 4AYBA 4TUUA 2FH6A 2XRAL 1NMAL 4OQ1A 3WO4C 2XTSA 3D52A 1T1WA 1ZS8A 3OVUB 4ZFOA 1HEJC 4WHYH 3FSOA 4A2HA 3UAAA 2NY0B 3P73A 5E9DD 2DQCH 2OSWA 3VI4B 1WD8A 5D2LE 1L0PA 3KVQA 1QQDA 2X4PA 3V4VB 1WTLA 3T2QA 4F58H 1GHFH 1V27A 2CJUH 3QFJB 4DKAA 1J0YA 4J3OF 4MJIB 4HPYH 2P26A 4RIRB 3UP6A 1FNGA 4A7UA 4D0CB 4H26B 1J0IA 3ZTJG 4UINL 4AVHA 1M53A 5L2JB 1GJUA 1IJNA 4GO6B 2DD8H 3N04A 1NGYA 1QFOA 5A2CA 4NQXA 5I1LA 2JI3A 2NZIA 1G7IA 2O5NA 3OSVA 3FQXA 3KJ6L 2R2CA 4YHOL 3VE0B 1LE9B 1EHLH 5EO9A 4HISA 4A7GF 3A67L 1XF5A 1RZKH 2VJ8A 4Y4KC 3V0WH 4FQ1L 2F5BL 2E6QA 1ZLVK 2XBZA 4LVNB 3BUYA 4XC3L 3UXFA 3DO7B 4FQXA 5JIMA 1KB5L 5IB1B 1MG2C 4X6BB 2NYZA 4AYMC 3PJNA 1HXMB 4HU2A 4QYAA 1INQA 1WFJA 3BJLA 3N55A 4MD5A 5ID0B 3FUEA 5JW4M 1PJWA 3O4LB 4GAAA 4CMMA 3SDAD 4J39A 2VDPB 1VGKA 2VKWA 2VR4A 5C1MB 3C5JB 2BNRD 1T6WA 5I24A 3LYRA 3WTSA 2IH8A 1RMFL 3QO1B 1IFRA 3SQBA 4XPBL 4G7VL 5AOIA 3SPCA 5JHDB 1KBPA 4TYUA 5FOBB 5KBPA 4XMVA 2CGRL 2WXPA 4X5PA 4UIMA 1FPTH 2G3NA 4RVBA 5D2NB 3SE9H 5EEWA 4IGBB 1IVTA 3OX8A 3JSSA 2OXGA 3AXLA 3F85A 3QJFB 5IBLD 3SYAA 2HLFD 2AAAA 4AE0A 5FUOL 3FN3A 1A7BA 2YA1A 1T5KA 5EHFA 1PG7W 5FECB 4KKCC 2ZXQA 4KITB 1WZKA 5E9NA 4XN8A 5GJSL 3HG1E 4P3WA 3VACA 1JZ3A 1YPZE 4KMTL 2HH0H 1IGMH 2ICWB 1DBJL 2P5PA 3FU3A 3SGJA 1ORQB 2HRHA 3NCMA 2W5PA 4JO2H 4KQ3H 5HHXH 3QJOA 3DKHA 3WGVB 3NBNA 1Z9PA 1CYGA 3BVWA 2XA3A 4WEBH 4WY7L 3CN2A 3SGKA 2BCMA 4HUXA 2HWZL 1TVDA 2A74A 2XWTB 2ENJA 4K8RC 4XHQA 4ZUTB 2D0GA 2X7LA 1AS8A 1XGYL 3L4XA 4G80B 3S35L 3KXFA 3DGDA 2WLIA 4IJ3B 3AGVA 1EUTA 3QIUC 4D9LL 4JPKH 5FDWB 2EP6A 3V52L 4KAQL 4LCCC 1XF2B 3FTZA 4OB5L 5CLWA 4H8WH 5EWIL 4GQQA 5F44A 3ZJAA 1EEQA 43CAA 1EA9C 2IGTA 2WMPB 1U6AL 5HY9B 4JM4L 3O0RH 2IPUK 4R2GB 4YDIL 2YAMA 3LXBA 4P4KB 5F7EH 1ILUA 3KWWB 2Y5TA 3GGWB 3BP5B 3QUZA 1TJHL 3FDWA 1BLIA 1NCTA 2XG4B 3PUUA 4M93C 1IFHL 4JRWA 5ADOL 3KPOA 1S7TA 3TYGH 5A2JH 3EG9B 4IS6B 3K74B 1HHGA 2QTEA 2QQLH 5CILL 2OTPA 1NA8A 2OTWB 3U36A 2OI9B 4R90L 2YD1A 3GYRA 2YKLH 3VWKB 2Q5BA 4NQCD 4UTCA 1I1CA 3IDIB 1MCJA 4UILH 5DJAB 1AG6A 1XVSA 4B9IA 2AKRB 3DHJA 3RX5A 4Q2ZA 1ONQA 3RX8A 1NCHA 3FMGH 3MA9H 5MEOB 2VDPH 4GP5B 4PAZA 3BUQA 4X5XA 3KWXA 4WDIB 2IH1B 2G4GA 5KZCB 2R1YB 1B2WH 1IMHC 3BN9C 3W0WA 3CUPA 1A47A 2R69L 4UNIA 2C9PA 1VAHA 2MFNA 3NCBB 3PAUA 1R5IA 4HFWA 1EBAA 4LLMA 4X8JB 1IQWL 3BAEL 3Q2WA 4QRUA 1UWYA 4V1DA 4ZXBB 3WKQA 5JA8B 1KIPB 1CE6B 2F18A 2FEEI 2VB5A 2YBGA 3A6CL 4HWZA 4UI2A 4NI6A 1W0YT 4KUZL 3PWJB 3QIBB 5IGXL 2WXIA 1QFUL 1MHCA 1J87A 4JVPA 3VRJB 3WIIL 2G0LA 3M45A 3LH9A 3F6LA 4YE4L 3AY2A 4QXWA 5SWZE 4KTEH 1KN2L 3BPCA 2DYPA 1F3DH 2HUHA 25C8H 3I50H 4JZNA 5EZIH 5KJ4A 3TA3D 5T3ZL 4Z7UA 5EU7E 4PUBL 3TWYA 3NK4A 5KSVA 1SPDA 3A4AA 3CPLA 5I30H 1KCUL 3KH3A 4LMQE 2WZPD 1ZV2A 1KULA 1MWAH 4X6DF 1YMHB 3FT1A 4LVOC 4GW1B 2AK4E 5J11B 3U6XS 1P7KA 1SDDA 3MZGB 5DJ2B 1O5PA 1KN4H 4K23H 2RH0A 1UADC 3S37L 4JREB 5LBVA 3FUJA 5KUMA 1BOYA 4FOMA 5I6XC 2KBGA 3EZ8A 1UZ6E 2IIJA 4U1KB 3NSXA 1OSEA 4QTFA 1OP5K 3IT8D 2G2RA 2VISA 2XV0A 3N2JA 5LUMA 2GSIB 1B88A 4JM2F 4ORZC 3VD5A 1CICD 1FNAA 4HS6A 4IEFA 5TH2B 1AXIB 1BJ1J 1TYEB 2OFQA 5AWNH 1Q0EA 1AD9B 4FCHA 2KUTA 2QSTA 4MXVE 1E43A 5AOLA 3S4SB 4FL4C 3N9GH 5D1QC 5AL8A 3MKKA 5B3SB 4JZOA 5K9QG 4WJKB 4XMPL 3ILQC 3QYCA 1KFAH 2H6PB 1P4IL 2GHZA 2DS4A 1ECZA 3IJSA 4U1LB 4M7KH 1WFMA 4L1LA 1AP2B 3ULUC 3KM1A 1SBSL 2WQAA 2IANE 4K71B 4APQC 4ZDHA 5T3ZE 1JGEA 2V9TA 5DEJA 1H3XA 1JHLL 3MUGA 4MRBA 1P7HL 5CJ8A 3OV6A 3TGXA 1L9QA 1NFDE 3ZX1A 4X5QA 1KGCD 1LXMA 4Y2DC 4DWHA 1LLAA 4BGLA 2EH7H 1D5ZB 3LHPH 4F33A 2BW5A 3D7PA 4UDUA 3UL4A 2F68X 2NXYB 5HGBA 4NAQA 5AYTA 1MRDL 4LLUA 5D70H 3WG7B 3IRZA 1A7OH 1W6WA 4HAFA 3TX4A 3VW3L 4XHJC 5H35A 4Y4HA 3RWIA 3E1F1 1NGWA 4W9JC 2C1PA 3VXMD 3MRLB 4XMWA 4E5XA 2YD8A 1AE6H 2IC2A 2PWHA 2WVTA 3DXAE 4G82A 3RX7A 2AS5M 1K85A 3QYNA 4HD9A 4DK3A 1EH9A 3T77B 3JV4A 3WKPA 3X1EA 4JO1H 4Y0GA 1TVBB 2GYSA 3ESMA 4OD2A 1WAPA 1ASQA 1BQHG 4GT0A 3CFBB 2ORBL 4HEPA 1UOWA 2AJXL 1Z5YD 4JJHA 1RD6A 4LSQL 1WFOA 1BW8A 4JG0H 4OGXH 1LMKA 5DJCA 1ZSHA 2WQSA 4NFDA 4RWYL 2YZ1A 3PGCB 4P46B 4Z1PA 1UD2A 2GKIA 5HP5A 2YXVA 1FYTA 5T3XH 3HJEA 3S5LG 3Q8BA 3UTSE 2V7HA 4UM8B 5GPRA 1CBVH 3RE0A 5F71A 3ULVL 5EEUA 1XCXA 1YEKL 3CFCH 3JTTB 1UXWB 3T0EB 3TBVA 5ANMB 4AT6B 4JG1H 2Q8BH 1EXUB 4IU2A 4D7BA 3ZKMD 1HYSD 1G7QB 3BDBA 1ZJBA 1IM9A 3WNJA 4J1UA 4HIEA 3HE7C 2D7PA 3BLKA 3O4OB 4MMZC 1U3JA 5LDUA 1NZRA 2WYIA 1DEDA 1DQIA 1R3KB 2APSA 3F12B 4UTBA 3KL3A 5E6ZA 5B39B 1HL5A 5T5NF 2BLFA 2YEQA 4Y5YB 3P4NB 1MN4A 2ZUYA 4NO0A 3JT0A 1K3IA 4YSPA 3TH2T 4NT6B 3GMLA 1EGJH 2EDLA 2XHNA 4Y4FC 5K93A 1UB6A 1R6VA 4XAKD 4NN7C 4C83A 1BXVA 3CE1A 1CTMA 3QUML 4I9WD 2A9MH 4Z7NB 3JWOL 1RPQA 5E7FA 2VNCA 3IFPB 2BP8B 2H0FA 4IRJD 5HJDA 1VKXA 1IL1A 1G7PB 1Z0NA 3ZZQA 1BM3H 1OZTG 1QUPA 1SXNA 3MLZH 2P52A 4IRSC 1KB9J 4B96A 1AYOA 1UWXH 4OM1H 2WQUA 1UENA 1UG9A 3P02A 4M7JH 4XCNB 1A4BA 4R4NC 3IFLH 1WA1X 3F6IA 1Q9LA 3FUDA 3T1FB 2BWDA 3ARTA 3K2UH 3PL6A 3UO1H 3WE6B 3AU1B 4I0KA 1EK3A 2B1HH 4U6HA 3QDMA 1JZIA 2GTZA 4OFDA 4FNRA 1JDAA 2VT0A 5BRZA 2UZYB 3OKNB 5E9DE 1E8XA 1N5AA 5ALBH 3WTYA 3N1QC 1C08B 3WMPA 3EDKA 2V7NB 2BIPA 1GGBL 3LD8C 3QUZD 1L9TA 3NCJH 3GJEB 4ZTPL 1I9JL 1S7SA 4MSWA 5BUPA 1PG7L 4MA8H 2FIKB 3PAVA 3FTWA 3TVMC 3QWOA 1L5GB 1HEZA 4OGYL 4FYTA 4KK6D 4GRMA 3PABA 2IPKB 4HUVA 4MDRA 3NDZE 3WJJC 2R56L 1O6SA 2GC7C 2PYFB 4NRZA 5CZVH 4HGWB 4FA7B 4X0KB 2WJ5A 5C0AA 3T65A 5HI4D 4AQ1C 1ET5A 2YQBA 1BEYL 3FB6A 1HCVA 3IJ7A 4L37A 4IBSA 3F64A 3RKDD 4LB8A 5B1KA 5IIEB 3QJXA 5LNGA 1E5UI 5EMYA 3RIFK 2IG2H 1M4KA 3GSQA 4UV4H 5DEGA 5J6HA 5C6TL 3OJDA 4XAWH 1OHQA 1N3NA 1YEDB 3W0WD 3BKYH 1RURH 2F8IA 4XXDA 2X2UA 2VR3A 2PO6B 4ETYA 1FFNB 4H8PA 4WEUD 4Z7WF 4KQ4L 4V1DD 5F1KC 1TSRA 2BNRE 4BELD 4ZNCD 1HT6A 3CFDA 1W0VB 1TKWB 4OLWH 2CR0A 1AQHA 2CLVA 4PJ7E 4A68A 3AITA 2E9IA 1CGUA 2DF3A 1MFUA 1CR9L 2R7EB 3UJJH 3INUL 4LHUB 2CDGA 3L3OB 1HS6A 3OMZA 1GTFA 4AI7A 4EAEA 1CL7I 2QZ5A 3VXUB 3F2LA 1I7ZB 4PCSA 1FCCA 3MV8E 1QATA 4F8PA 2JE8A 3ZHLA 4KOBA 2I60L 4WSGA 4QR7A 1DBAH 1HI6A 2Z34A 4DVRH 3IDGB 3OZ9H 4QRFA 4HJUA 3ROOB 4M56A 5KYWA 4X6DB 4N2AA 4J2XA 3MO1A 1DE4A 3DTUB 5KVGL 4ZFZB 4Z3TA 4HJSA 3L9BA 4DEWA 3Q44A 3GTVA 1RJLA 3CZGA 3VFGL 3IF1A 2NTSP 2G3XA 1FAIL 4MNGE 4PV8A 2RAMA 3QXAA 4AYSA 1A6UL 4FI7A 3BP7B 3HC4L 2HTKC 3VG9C 4AV5A 5D71H 5A6MA 4JM2B 1QFPA 3MREA 5I1CH 3O9WB 3BPOC 2YKKA 1AGEA 3GJFB 2N3JA 3A6OA 1F58L 1EHKB 3IMTA 4QWWD 5JNYB 1N59A 3FULA 4L9LC 4WWKA 5BQ7B 1OTSD 2E4FA 4L8DA 3D08A 3M86A 5ICYA 4WAFA 2WLMA 3VFWB 3RILA 3EYVB 1NPJA 4JDTH 2YEVB 1UKSA 2WTPA 3G5WA 1OWWA 1UGNA 3RZWA 4HJ0D 1H15B 1SM3H 3BYTA 3RA7L 1KCSH 3QJVB 4K9EH 2BWQA 4LIQL 1TQUA 3KLAB 1OAQL 4W4OC 2EO1A 4FEMA 2WK2A 3RGVD 3WE1A 3HC3L 4KNSA 5IW6A 1R0AH 2Y3NA 2FX9H 2HSIA 4JKWA 5TE4H 4TSBL 2HFEA 2R2HB 3BIAX 3HE6A 1IC4H 3SEPA 4CBPA 4EDWH 5IFAL 3V0DA 2WYZA 1Z3RA 3DX1A 3MLRL 4KU1A 4M1CC 3BISA 5EV7A 2IQ9L 4GKSB 3DMMB 3K4ZA 1NGZB 3AREB 2DW5A 4KHXH 4NQCE 2GBVA 4DKFL 5J3HD 3ALPA 5DMGD 5EBLB 1LP9E 4YHZL 1PZUB 4NQUA 1D6VH 1YY8A 1I7UA 4TTDC 1GVIA 3VXPB 3F5WA 1IM3B 4YK4C 3FO9A 4EJ1C 4LVHB 4CC4A 1DQKA 4Y4HD 3BRDA 5FDYA 3SBQA 3VWJD 2WXNA 3RTQA 4KV5E 4ZT1A 1T0MB 1O9WA 4MB3A 5ICXB 3TA4D 4MYWB 5KYNA 4WSJA 4XB7A 1AQ8A 1DQLL 3EOYG 4UNTA 3K6SA 4X98B 2IBZX 2G9HA 3JWDL 1KJMA 3QEUB 4ODHL 4X99A 2KZWA 4BWTA 3EDFA 4C4UA 1TTGA 4WZ9A 5C9JA 5D1QB 3VD3A 1ZEAH 1MWAA 3HZVB 4P06A 4F2ME 1YECL 1I8LA 4GUCA 4UQCA 3QJQB 1HHJA 2NX5A 4G8EA 4JAMA 3L1GA 3RJDA 3U4BH 4BH8A 1FSKB 1ACYL 1MFAH 2CALA 2NNXA 1P1ZA 3CSPA 4LIQE 1U2YA 2Y2YA 1CDHA 4OAWB 2GTWA 5A2LH 1I3GH 2ZCHL 4APQB 2DKMA 1FYTD 3WDHA 4Y2OA 3LX9A 4NI3A 1P7QB 5AVWB 5EA0H 1H8SA 2BK8A 2O4EA 4FDWA 3UTOA 3RVTC 3R1GL 3CBJB 4H25A 4G6JL 2FNBA 5CCGE 2FEEL 1I9IH 1IM9D 4H8HA 4OFKA 4JHAL 1MIEL 4FYSA 4QKXB 3OD3A 1TU2B 2ZF9A 4DAGH 4ZFOL 4MA7H 5FB8B 4DZ8A 4BCZA 2JVUA 4PGCB 2ZOLB 3DIFA 4NQDB 4NP9A 1U8IA 2PTTB 5F88B 1MCBA 4RFOL 4FFVD 1VFUA 2Z4QA 5KTEH 1ODAA 1T0PB 5HGAA 4HDIB 4HK3N 3STZB 4NYLA 4FXKB 2IDFA 5ISZA 1I8AA 1ACZA 1OD7A 4O2FA 4NO0D 4PRDB 1Y18A 5FUZH 4YR6A 2H32B 3SODB 5BS0B 7CGTA 1M9SA 1PLGH 4G8GE 3BD5A 4DP2X 1AQDB 1DN0B 5TQ0L 3ZIYA 2J8HA 4FQLH 5DZNA 1BQSA 3EFDL 2A9NL 3HNSL 1WT5A 2E86A 3OKOA 4I18A 2DLEA 5AUMA 4JUTA 5ABAA 4CU6A 3SBWC 1MCEA 3D09A 1H9VA 5KSUA 1RZ8A 3MLSH 4XNMB 3OGOE 1BZ9B 4Y9GA 3MJ8A 5IHHA 1G6RH 1OSPL 3GBLA 1IGYB 2WYTA 3ARBC 5KSAC 4MB1A 4WFGD 4WQOA 3RWEA 4ZD3L 1QHPA 3D25B 2Q76A 2ZAGA 1U91A 4F8LA 3T4AC 1DDHA 3FB8B 1KT2B 2FGZA 3WN5C 1L0XA 5BJTA 1HKFA 3PL6D 5BZZA 1E9PA 1F4YL 2UYLB 2BSTB 2Y5EA 3E8UL 2KS0A 4OUUA 5GRUL 4CVXB 4N0FA 5IKCB 1RY7B 1I8KB 5JORA 1JHTA 3FQ2A 5BRZD 1LGVA 5LKNA 1F90H 3WTXA 2IJ0C 1YSOA 3LN9A 1FGVL 4UUJA 1JGIA 3GSVA 3QORC 3EYSH 3WOVA 5DK0A 1XH3B 5KVDL 2YAQA 1M7DA 1QRKA 3AG4B 3VXME 2WZ0A 4LBEB 3DJ9A 2X6UA 4F1ZA 5D7IA 3HMXH 2FLBT 3BAWA 1XGPA 2BIHA 4PRBB 4FNLL 2OMZA 2E8ZA 2DWXA 5HYQB 5L8LB 4BXVA 3O81A 4OZFA 4WW2C 3UMTA 5C0AD 1TOXA 1XB6A 2ZPKL 4I7ZC 5HBBA 5LN8A 4F7PB 1DUZA 3JWNE 2J6WA 5KVFH 2F9BT 3VSUA 1K3ZA 2XXGA 5BMFH 1XGQA 4UM9D 5AVRB 1IBYA 1QOKA 3HRZC 4H44C 4TNVK 4MQXD 1YEJL 4U6VH 2UY7A 4JGUA 3QNZB 1JHKL 2AXGB 3SDXE 1NGXB 1G7JB 4JKMA 4S10A 1V54B 1V8HA 1XTMA 4MZIA 1V10A 1AO7B 4X4YB 3MCYA 5H37H 3GMQB 4FG2A 3TBSB 5FCUH 1XB8A 3T4YA 4WK2B 4DGYL 1EGJA 1FORL 3MNWA 4M1DL 4JPVH 4Z7WB 2D03H 3BPLB 3NABL 1W72A 1H0DB 2Q6WB 2GJ6B 4AGOA 5MERA 3KYKH 1QZ1A 2W0KA 3D39B 2C9SA 1XF4A 4J8RB 1XO8A 2PCYA 2F6AA 1E8ZA 1XAUA 2M2DA 4JFZH 3RVXC 3STLB 2VABB 3DRQB 4NFCA 4QTIL 4HAKA 5CEYB 4UDTA 3EDJA 4W93A 3PCYA 4E9VA 3CQPA 3AWEA 4JBSA 5F8RC 1R46A 1Z32X 2EDJA 2UZPA 2EE0A 4U3SB 3DGGB 4E42A 4W9ZA 2EUZA 1DJXA 2PXYC 4HIPA 4IDJL 4E9SA 1DO5A 1CF8H 4XAKE 3ZT7A 3NCYP 3CU7A 3MRNA 4NKMA 4PJHB 1TYRA 4KKQA 4XPAL 1D5IL 1K72A 2HTLD 3OKYA 6TAAA 4JG9A 4I9WE 1WFNA 3FUMA 3ECBB 3SQRA 4MJID 1KPVB 4DN4H 1KCKA 3ARDC 4DSYA 1PEWA 3MRRA 1MDTA 3E6FB 1KC5H 5JOFA 4Q9BA 4BA0A 3QDJA 2Y72A 3U48A 1JPTL 2DM4A 1IO4C 1OAZL 1NEPA 3PQYE 4HUNB 1JIBA 4YZFF 2W65B 3QQ3B 4OM0L 1RPUA 5IV2B 5MEQB 3B8SA 4WWKD 1I8MB 1DVYA 3F01A 1I4FB 2QZQA 2EDBA 1NCDH 5F0PB 4PG9A 5HGHB 1QEWB 4XBPA 5AYUL 2WXRA 4HOWA 4P5KB 1P6AB 4FG6D 1P5VA 1RJCA 2ZD0A 3OWRA 4K5NA 5FO7A 4EZLA 3T0DA 1ZVSA 4XP5L 1DHKA 4RFEB 4B0MM 3JUZA 3O3BA 2XN1A 1SN2A 3O4LD 2OMUB 4HA1A 4DJMA 3QIWC 2Z93A 1BFVH 4KROC 1RK1B 4LK4A 1AS7A 4JRXB 1XGTB 1THAA 3MRKA 5DGQA 2XOTA 2FWUA 4RRPM 3UEZA 3HE6D 4DNLA 1BPVA 2V2XB 2JJTC 3BWAA 5IQLA 5C7XL 4DW2L 1ZS2A 2BRQA 1KTBA 3H42H 2MPAL 4YFEA 4QHMB 1B9KA 4HETA 1XZ0B 4XXWC 3Q5OA 3Q9PA 3EJZC 2WLLA 4M6OL 5FYJU 1TMCB 4IIQB 2ZX7A 2AJVH 4PJ9A 5J12B 5KS9A 4DETA 2E27H 2DIBA 1EFXA 3B9KC 3RTQD 2FB4L 4E68A 2AJSH 1F1DA 3W0WE 5C3IA 4O9HL 4BQBA 3P9LB 4Q52A 4QY8B 5B8CB 1V5JA 4MCMA 3ESVF 2Y5QA 1KY7A 2R0ZH 5E6IC 1PW3A 4QJ5B 1EO7A 1YUHA 5F7KC 3FQRA 3N43B 4KKBC 4GO8A 1A6TA 3MLXH 4YUEL 2NX5D 1A7QH 3MPCA 3MJWA 3GD1C 3P11H 4KKLC 5F6IB 4ELMF 1AGCA 2HA1A 1B0GA 5DJ8A 5E2TH 3ZZSA 5DDHA 4LGRB 5AW7B 4YWGH 4KRPB 3NJVA 2G3MA 5BXFA 3FH5A 4N2IA 1OP3H 5HHQA 5E8OA 4E9XA 5LGJB 2ADJB 3HUJE 4FXGA 2BPBA 2GSGA 2JF1A 3AM8A 2X1XR 2NY2C 1HWHB 1H3GA 1K5NB 2VLKA 4K07A 2H1LM 2G5UA 5CMAB 2PPAA 5C0RL 2DWDA 2B7DT 2A73A 2AANA 5GS0C 5DMYA 5F1IA 2DLFH 4UZUA 1AGDA 2CIIB 4HF5H 3E7JA 2Q20A 1XL4A 4BDVA 4NNYA 2ICCA 1I85C 3CFQA 5DWUL 3TBWB 2B16A 3ATAA 2ATPB 4GY4A 4R0LA 5IQOA 1QTSA 4XMKH 3KGRA 2CBTA 5KN5B 4WI5A 5ISZD 1SHXA 4PGEA 3FFOA 1HNGA 5LAXA 2MCG1 2WUCL 1NUFA 3OB8A 1U8PA 1LD9B 1A3LL 1CT8B 2X4RA 1F3JA 2CMRL 3K4AA 1FVEA 1IQDA 2YK1L 3S0PA 2DBJA 5JR1H 2FRGP 3B34A 2NDGA 2IWKA 4R5VA 3HPJA 5F9JB 1HINL 1CLOH 2ODIA 3C6LB 4LSVH 3AFLA 5I75C 2NCMA 5CN3A 2N4IA 5EC2B 3BKCL 5JW4Q 3DUSB 1IARB 5KYUB 1EDYA 5TDPB 1FZMB 2DQFA 1MELA 3Q8FA 3TCXA 4BINA 1Q0YH 4E36A 3AUVA 5EO1B 1LTXA 1XEDA 5EPMA 4OJFL 1KYAA 1YYCA 3EYQD 1IX2A 4L8BA 2CA4A 4HGKC 1K9TA 1KTDB 5KJRL 4JDZA 1A9VA 3VFPB 3OL2A 5I1HL 1WJ3A 1I31A 3GKZA 1JYWA 4ZOCA 1TZIB 2AJYH 4I0CC 1E3ZA 2GFBA 2B15A 5HVGB 4DKEH 4O2CB 3QZPA 1JVKA 3QUYC 2FBOJ 3PYCA 3L5WA 2FLMA 4HQQH 1TTAA 5C2UB 2J8UF 2BNQB 2ZWNA 3SY0B 3TURA 5JMRA 5I82A 1RULH 2A77L 2C1OB 4HIXL 3PUCA 4NZUL 3CSYB 4TSCH 1KJVB 3B37A 2Z35A 4M6AA 3GBNL 1BHGA 4UTBL 3K5RA 2FJFA 3DYMA 3ILEA 5T3XD 4PG2A 2BVYA 1SEQH 5CJQL 1W0WB 2B1AH 3EGXB 1ET7A 3RIAK 1YYMH 3DI2B 3NFNA 4AJYV 4F27A 5EU5B 4I3GA 1GL4B 3VSQA 3DPDA 4F15C 1QKZH 1WBZA 4LKCA 1OT4A 5HI5C 2X0UA 3GSXB 5D55A 1QSFA 3ZYZA 4TSAH 3AB0B 2A1WH 3IKCA 5SV4A 5ETUA 4EOWH 3B43A 3BYYA 2R2EA 3OAUL 3D4GA 3QPQC 4ICWA 1EHXA 3EFOA 2B5IC 1GAFH 2SEBA 5F7NC 4MJ5A 1DUYA 4DP1X 5FK9B 4KK5D 1ZK9A 1GGCL 3ARQA 4LQFH 4G6FB 3QJHA 4WO0A 3ROLA 4ZI8A 4F58L 3DOIA 1KY6A 4WHCA 4ZODA 5C0EA 5TF1L 3CTTA 2GBAA 2FWOB 2F74A 2HN7A 3FRPG 2W92A 3AWFA 5JUEH 3OXRA 1FGNH 4N2FA 4WKZA 3A47A 1L9OA 1RHHB 3HS0C 5C6WH 1E4WL 2GK0B 4K3JL 3IJHA 3MOQA 4O02B 5IZ7A 5C92A 1ASPA 4PYHA 1YN7B 1VPOL 1TEGA 1EHLL 4RDQF 1T0OA 1HNYA 1PJ9A 3D34A 3R0MA 1RZKL 5GGRB 4PLNC 2XV3A 1PZCA 1FLRH 3GSUB 3VXTB 3F7RA 2WXHA 2D7TL 1G6RA 3QULA 5FYKU 1T3FA 1IGTB 4LLWB 1N8OE 4P5RA 4N8VG 3G5YB 3L4VA 1A2YA 2WP3T 4Y5VA 5B1JC 3FQUB 3NCEB 3ML9A 5IF0A 5DVLA 4M6MH 1QSEE 5T1LB 4B5ZA 3DDGA 4N26A 1J8KA 4P49A 4OV6F 4NHUA 3D85B 4ZAKA 3MSPA 4H20H 2R0WH 3N06B 3FH8A 5SWSD 3CG8A 1OAYH 2ZG2A 5J7CC 5I1DA 1BVNP 2J4WH 4DH2A 4S1SL 2IF7A 3HRZB 2OYLA 2LE9A 2BMKB 3NCFB 1MLBB 3QDJD 1Z9MA 1KWKA 3IDJA 1SJEB 1W2KT 4N22A 2ZUQC 3EJUA 3SE9L 2XYBA 3RL1B 3KLLA 4Z95H 2ID5A 5DQJB 2A6IB 4DQOH 1E67A 1CQYA 1JTTA 4KO6A 5J1TC 3PWLA 2ADFH 4YDKL 4P2OC 2OK0L 2Y6TE 4FKHA 5JO5B 4HH9A 4L1SA 5L0QC 2HH0L 4HIJB 5BRZE 2CSPA 1XIWC 2D9CA 3C8KA 3ARWA 2MPVA 4KGJA 2JFCA 1J86A 5GQBA 4QNPF 4JO2L 4KQ3L 4EXKA 3FCSA 4JHZA 4S1DC 1ZWIA 4TLUA 3MLTB 3T0ED 3GZOA 4DZBB 3N85H 1HEHC 3DNKA 4TS6A 4X4KA 1E8YA 2D9QB 5D4JA 1Z66A 2OQJA 4U1IA 3AT0A 4OCRH 2BVQA 5IK3B 4FNUA 2FUTA 3CDGB 4WO4B 4DO4A 4KXAA 3EIFA 1EAPB 1FG9C 4PRHD 4EIGB 5IG7B 4N9GB 3LIZH 3MV9D 1N7ML 2L3BA 3KLDA 1VJSA 3NJJA 2C9AA 4NERA 1UHVA 1KIUB 4PJAF 3T8XA 3V0JA 2YQGA 2J6EH 4H8WL 4MCZB 4Q6YA 1YA5A 2XKUA 5F93C 2APFA 4PJ9D 1U4FA 5CEXA 3O8XA 4EKJA 4ONGH 2D2CC 2QLVB 2BZDA 1A8JH 5F7DA 4G43A 4U1HB 3S48A 3R06B 3D3VA 3N1GC 3MRPB 1X44A 4O02H 2QPUA 5F7EL 1M3IA 1QW9A 4L3FA 3QDHA 2H0JA 2NQDA 4QRPA 1PZ5A 1C5BL 2K70A 3BUBA 2QQKH 2D3VA 3TYGL 2WCGA 2IPTL 4U2ZA 3G5ZB 4WHDA 4XP4L 2QQLL 2PUQT 1FIGH 4EI5C 1RKRA 1FL5A 5EZOH 5ABZA 2OTUB 1ZLVH 4PRPA 5D96C 5DMIL 1Q0XH 4RRPA 3CIAA 2NW2A 3GSRA 2YKLL 4GXUN 4MA1C 4FHJA 1JYXA 2D4FA 3OC8A 3TEWA 2E9BA 1CZ8L 4UILL 2JI1A 3U0TA 1IVLA 2QKIC 4O58H 1OP9A 1SJHA 3FMGL 3Q3GA 1AHMA 4YIQB 1J0KA 1PX3A 3TASA 1JPGA 4DGIH 1B2WL 1DLHA 3HZKA 4PIRF 1JNLL 3HCVA 3IFOA 1B6DA 5FF6A 5G4OA 5A7EA 1IKFL 2VLKD 2Z91B 1CFTA 4FLHA 1RLBA 3ZTJH 5KVEH 4W9CC 2XX1A 5EOQH 4EN3C 1SYVB 4L0ZA 1G7MB 3SKUD 4HGMA 4MHHI 3QFJE 3AUWB 4MJIE 4AYFB 3LVEA 1QEXA 3SO5A 4AENA 2XKSA 5E9AA 3MFFA 3AJ7A 5F89B 5C09A 3RL2A 3B9KB 4OLVL 1MJUL 4KTEL 4PI2A 1YRKA 4XNZC 1IGFH 5EZIL 4IKJA 4XVUD 3IK2A 4DGVH 3KYMA 5I30L 2WTRA 4FHKA 4NUQA 1JK9B 5E6IB 5J1AB 3BAXA 3BSGA 4KO5A 1MWAL 2WNGA 3APNA 2EH8H 3KEHA 3UTZB 3WNMA 1DJGA 1XGUA 1N4XL 2CNZA 3G6JF 4PMEA 4K23L 1M6OB 4UT6A 5AVSB 3WFCH 2IQAB 1XMEB 3O4LE 2BOCB 3RVVD 4F8OA 5BVPH 3AQXA 3I6SA 3C2SA 1XR8B 1CDYA 4HHAB 4KKAC 3FO1A 3LH2H 3MCG1 3QNYB 3LEXB 2E59A 1NLDL 5E95B 1SXSA 3RB7A 2IWFA 5ITBL 1QNIA 3MV11 4UOW1 4QO1A 3BUDA 5D2NE 1BG9A 4OZHF 3MOBH 1NBQA 5B4MD 4CBZA 5C0GB 1LDPH 1MUJA 2Z8VC 2X4QA 2AGJL 4QXGH 3UDWC 1G9MH 1F6AA 3O45B 4ZW6A 3E6HB 3ZE0E 4U1NA 2DI9A 2WBWB 1KFAL 3MCLL 3T6QC 5A2FA 3AVEA 2J8UB 1U95B 1OSYA 5LWYL 2WBXA 1E50A 5EF0A 2CUHA 5TQ2H 2JQMA 3QDGB 4XTRD 4NZDA 4M7KL 1JVOA 4XPGL 4YEFA 2EEXA 2B3RA 3FT4B 5K9KA 1TZGH 4EQ3A 1OSZB 4ENED 3ARGC 1BVLA 1D5RA 4HLZG 2OZNA 5L4FA 2XXCB 4Z0XA 3WLWD 3NCCB 3II1A 1QSFD 2LTQC 2QLYA 1XCWA 2RR3A 1U92B 2DN7A 4BFNA 2NX5E 3UAFA 2XX0A 3BIKB 3D0AA 2A6KB 1FH2A 1M05B 4CC1A 4RBPK 4R96B 3UBXA 1BZEA 4MLSA 4ELKB 2AV1B 2VXSL 1U3NA 5AVXB 2OP4L 1ADWA 2VWEE 3EBHA 3ML8A 5D7SH 5I1IH 1BIIB 5KSBF 2DBLL 2ADYA 3BWUF 1TLKA 2X70B 4TQEH 2Y7MA 1E9QB 1AE6L 5AVUB 1RJYA 3SE6A 4PBXA 1RSFA 5E1HB 3VFOA 1Q9WB 1UT1A 3FFDA 5GRXG 4IBTA 1YZZA 4KQ0A 1JFQL 4POUB 4JO1L 2NSQA 3VAEA 2FQFA 4GJTB 3QUYB 1S7UB 4Q6KA 2OM5A 2WO3B 5IM7A 4JGNA 1BBDL 1BZ7B 4NXKA 2FYYB 2EXSA 4XNBA 2OA9A 1U0QA 5CCKL 2Y7NA 3LV3B 1CE1H 3DTXB 3C5ZC 1EPFA 4JG0L 4JO3H 1T2XA 1JNJA 1G7LA 1CQKA 1M42A 1NJ9A 3ARED 1HHKB 2X09A 3AU0A 2YD6A 4RDBA 4JHBA 5ISZE 1FHGA 3GXTA 4W9KC 5T3XL 4R7DA 4XR8C 4KFZC 1H5BC 3F58H 3GK8L 5E00A 4AZ8B 2LW3A 1B0IA 4WEMB 2WIMA 3GKWL 2HX8A 1LO5A 4WV1B 1CFNA 1VEOA 3CFCL 4PW4A 4QRRA 4JG1L 2Q8BL 4ZAKD 3KBFA 1UVQA 2FSDA 4JDEB 4PJFE 3PWNA 5CF3A 2FHCA 4KJWC 3JTSB 1CTOA 3L08A 1Q9OB 2B5IB 3VNZA 1G9EA 2W9EL 1U8HB 2F54B 3UROR 3ZBMA 4CILA 2GC4C 4QLWA 4TV3A 4GT7A 2WV3A 3H3PH 2Z31B 3TYFB 4ZUWA 4GG6A 4YFLF 5TGBA 3BWZA 1TVHB 3KCPB 2XQYA 4TNGA 4F2FA 3TU6A 3QCVH 2DM2A 1EGJL 3RUGF 4AMXA 4MDIA 3WY3A 1MKFA 4YHYC 3D18B 1T89C 3VFTA 5ES4B 1OHZA 5EOCL 2KPNA 3Q01A 2ISDA 3L48A 3TN0B 2A9ML 2YSSA 3CIQA 2FUQA 5AZ2H 1NKGA 5GRVK 3BO8A 3ELAT 2WKOA 3ORJA 3WTVA 4HSQA 2OYKA 3EGSA 4H1LB 1P4BH 4KK9D 1OT2A 3US0A 2N0MA 1T2JA 3K6NA 3LRMA 4R4BB 3S3PA 3HNVH 1T7VA 5T3XE 1T4KB 3QHTC 2P5EB 3OQ3B 4OM1L 3SBPA 2AEQL 2HKHH 3IFNH 4M7JL 3J27A 3IFLL 5JIHA 1Q4NX 1N6QH 1GY1A 2Y22A 4AQEA 2F7OA 3X13A 2QHRH 3K2UL 3PAZA 4L3EB 4LCVA 4WGWB 5DS8B 3RTLA 1VFOA 4L18A 5JPMA 2F15A 3O8XD 3P1VA 5HD8D 2HRPH 2VL5A 4MMXC 1NBVH 1ES0B 3L17A 2PCFB 2YARA 4Y2LA 4AXWB 2FECL 3MI6A 2XC8A 3OZKA 3S7GA 5EH1A 4ESKA 3B2MA 2VLLA 4ORGA 3L3KB 5DZOA 3CFJB 4PS8A 4QRPD 4H0GA 5IVXE 5LN4A 2ZSVB 3LSOA 5KYXB 2P8MB 5DWPA 4QYOB 3NIGF 2IGFH 1S78D 4LLQA 4LLYA 1XR9B 4B9FA 4PJ8B 3FUNA 3R8QA 4LHQB 4PRPD 5D7JA 4FRWA 1J1XL 4NDMB 5L0QB 3BVNA 2CM6A 3RWHB 1XIWB 5IBUB 4FLRA 3ZTEA 3FRUB 3QBTB 3QSKB 4IOSA 4HULB 3MR9B 5E8DH 4TNVF 3APDA 4RMVA 5T33L 2JTDA 5C0FB 4FQJL 3NTCH 2IFFL 2IG2L 4YBQD 4OFYA 5B21A 4L0YA 1WIUA 4JPQA 1DCLA 2DQTH 3W9DA 1JS4A 1IBGH 1MHHA 3DSNB 3RRQA 3CJJA 1YNKH 4N6RB 3NIFE 5TE6H 3EJQA 1WGOA 3KYNB 3GMMB 4ATTA 5BNXD 2IDQA 1AXSB 5SWSE 3ZO0A 1T5XB 2EDYA 1JXDA 1PQZB 4QXVA 1BFOA 3WEXB 1I9RH 3LKPB 5DZAA 3BSZA 5KBNC 3BE1L 4JFPA 3GMRB 1R5VB 2OULB 3KWVA 4MX7A 3UBXI 1CFBA 4GAJL 4PD4K 5C07A 3WL9A 2XI9A 4BFKA 4L3CA 3SPHA 1QWUA 3W82A 3THMH 3BDXA 3TL5A 2GW5A 2JB6B 2NUTA 3SKNA 1WHPA 4KTYA 1DBAL 2X4SA 3H1ZA 4H1LH 2R29A 4PY8J 1G7HA 5I1JH 4R8WH 5IMLB 3OZ9L 4J4PA 4MMYB 3UAJD 4EI5B 4L3AA 5SWQA 3HG5A 3GFUA 4QRQA 5D72L 5I71B 3G6JB 4GSXA 3WBDA 1L6ZA 2K7QA 3OHXA 3LKSB 3T0EE 5DSCA 3NIDF 2ZXGA 2FDBP 1A1OB 2CUIA 2D31B 3ARUA 5HHMB 4CSZA 2EEFA 4WTXA 1UZ8A 3UTPD 1J5DA 5I1CL 1IEAA 4GXFA 3MLVH 1JD9A 4PRHE 4QRTA 5SX4H 4ANWA 2DWTA 1I1FB 2BC4B 3MV9E 3O2WL 4GAYA 2FD6H 3L7FA 3BWSA 4Q0XH 3H8NA 4O51B 2WSPA 4M7LT 4YO0A 4OZHB 2R1XA 1FO0H 4MAUH 4PP1C 4EE2A 2F5AL 4K5LA 3TT1L 2P1YA 3H9SB 3BT2L 4B7IA 5IR1B 4JDTL 5HDBB 1D9KB 4UQEA 2H8PA 3B5HA 2YPVA 4M4RB 4EO5A 3VSTA 1SM3L 1ZTXE 2NY6B 2W81C 3DX7B 3IYLW 1KCSL 2FX8H 3IU3A 4UQ3B 1CGWA 4F37F 5J0BA 4MS8D 3FT2B 5BOJA 3CH1B 1BVKA 3LB6D 1KB3A 3CFTA 5INDA 3TZVC 1YQ2A 5JDSA 5BV7C 1KF9B 4M61A 3L3HB 3S3JA 5HSFA 5J13C 2Q87A 5IFJB 3CMOH 2BP3A 2OMYA 5K9JL 5TE4L 1A4KA 3DETD 5GS3A 5DURD 1HZLA 3HAEG 3KW8A 4XZUA 5EN2A 2EXTA 3PGDB 1ZHBA 3MROA 5GS1A 3L1OH 1Z9SA 2ARJA 1SQMA 4MD0B 3QPXL 5EUOA 1ADQH 4FQQA 3TTSA 3H85A 2ATKA 2IAMB 5J6GA 1D6VL 4LNVA 2E7LA 3KD4A 3L6FB 4IBYA 4PRAA 2WN3A 4KX9A 1WVZA 1OAKH 1HL4A 3ZKXB 3K0WA 4GW5A 2QFPA 3E80A 4PJXA 1U8QA 1KXVC 3QQ9D 4F7MA 3QE5A 3DX3A 1MCKA 4KDTA 4Y19A 3UZVB 3MBWB 4F3FA 2FL5B 1NEUA 4PS3A 2VLKE 2H0EA 5A43C 5JW4R 3MV7B 1NCIA 2E9WA 3KR3H 5ENWB 4FA8A 3FU8A 4GBXB 1ZEAL 1Q94A 1UOVA 1WC7B 4NM8H 1L9NA 4Q6IC 5L2KB 3CVHB 1Z9NA 1CD1A 2X3AA 3LNHA 3CC5B 4BXSV 2A6JB 1CGXA 3APFA 3V6ZB 1R5WA 1VFBA 1PEZA 4FJ6A 4B3EA 2AMGA 1S5IL 2C5DC 3Q48A 2EYTA 4KJQC 5CZKA 5EA0L 1FF5A 5AW4B 1T66C 1N10A 3GLEA 2VLJB 5JW5B 1NMCB 1X4YA 4QRRD 3K46A 3ECUA 4AQAA 4PYGA 1OGAB 4PJGA 1JZ4A 1TQCC 1ZA3B 1I9IL 4RGNB 2KLSA 1O7VA 4MVBC 3W9EA 4MA7L 2QADD 1IGIH 2NY1C 2P43B 5I8CB 1L7TL 1EVUA 2EYRB 2JKSA 4L29B