1NTDA

Structure of alcaligenes faecalis nitrite reductase mutant m150e that contains zinc
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
336
structure length
336
Chain Sequence
TAAEIAALPRQKVELVDPPFVHAHSQVAEGGPKVVEFTMVIEEKKIVIDDAGTEVHAMAFNGTVPGPLMVVHQDDYLELTLINPETNTLMHNIDFHAATGALGGGGLTEINPGEKTILRFKATKPGVFVYHCAPPGMVPWHVVSGENGAIMVLPREGLHDGKGKALTYDKIYYVGEQDFYVPRDENGKYKKYEAPGDAYEDTVKVMRTLTPTHVVFNGAVGALTGDKAMTAAVGEKVLIVHSQANRDTRPHLIGGHGDYVWATGKFNTPPDVDQETWFIPGGAAGAAFYTFQQPGIYAYVNHNLIEAFELGAAAHFKVTGEWNDDLMTSVLAPSGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NITRITE REDUCTASE
publication title Structure of Alcaligenes faecalis nitrite reductase and a copper site mutant, M150E, that contains zinc.
pubmed doi rcsb
source organism Alcaligenes faecalis
molecule tags Oxidoreductase (nitric oxide(a))
total genus 89
structure length 336
sequence length 336
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 1995-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ntdA02
3NP4A 3RYMA 2EIJB 1GSKA 1MZYA 1OE1A 3QJTB 5B1KA 1R1CA 1AG0A 1SJMA 3X2QB 5TK2A 4E9VA 3FPYA 5B1AB 4G7QB 1PNDA 4Q89A 4YSPA 3BVDB 1PZBA 2CBPA 1CYXA 3WKQA 3MBWB 2PCFA 1WA2X 3OM3B 1ASPA 4UF7C 3NSFA 3KW7A 3PAVA 5F7BA 3QJSB 1JZFA 2H3XC 1ET7A 5I6PA 1A4AA 2HX7A 3DIVA 3T6VA 3V9CA 1OV8A 1M9WA 4G70B 2TSAA 4EF3A 4DP9X 1J9TA 3FSAA 3WKPA 2IWFA 1KDIA 3L45A 4YSOA 1TKWA 2HRGA 2IAAC 3GYRA 2FT8A 1BEXA 4PCYA 1E5YA 1AZNA 1UATA 5B7MA 1M57B 2FTAA 2PPAA 1RZPA 3ERXA 4G7RB 4AI7A 4BXSV 3CZUB 2P80D 1I53A 2YARA 4A67A 4UAHA 1WA0X 1A65A 3CDZB 1HFUA 2BZ7A 5B3SB 4E9YA 2XUWA 1X9UA 2EINB 2W88A 2XX0A 2DWSA 3UACA 4A2HA 1GS6X 2X87A 5IY5B 3CDZA 2FQGA 2XX1A 1ZV2A 1PCSA 2GHZA 3OMAB 4BWUA 2I7OA 3FSWA 4YSTA 3NSYA 1MDAA 1JZHA 4KOCA 2IWEA 1EHKB 2DYSB 4BWWA 4E9QA 4P5RA 5I6NA 3AG2B 1AOZA 5I5MA 2RACA 1PZCA 3X1BA 1ILSA 2BP8A 1NZRA 2GSMB 3NJGA 1SF5A 4YSSA 3IN0A 1MZZA 1ZIBA 3IN2A 2FNWA 2XWZA 2GB2A 1OOWA 3QJRB 5B7FA 2EIMB 3FSZA 2AZUA 1CC3A 2YAFA 1A4BA 1NWOA 4YSCA 1E5ZA 1SHXA 4N8UA 2N0MA 2CJ3A 2PP8A 1NIEA 4W9ZA 3PAZA 4ZK8A 4JKNA 1L9OA 3D12B 1GR7A 1HAUA 4DP5X 3CVBA 3QPKA 2FQFA 1JOIA 1NTDA 3AG1B 2BP0B 3NJHA 4NB7A 2OV0A 3EH5B 2FT6A 3TBBA 4F2FA 4AKOA 3SBRA 1RCYA 2AFNA 7PCYA 4YSDA 4G7SB 2HX9A 3C75A 5I6OA 1AZRA 4KNSA 3QJUB 4BXVA 1NICA 1JZGA 2J57A 4A2GA 3WI9A 3U25A 1NIDA 1IKOP 3SBPA 1L9TA 3TU6A 1SHWA 1WS7A 3FU7B 2HZHA 3TA4D 1F56A 4HCFA 1AIZA 2Y69B 2NRDA 2QDVA 3UAAA 1GY1A 1N70A 1ZDQA 3FU7A 2FQEA 1AZUA 2PCYA 1W8EA 2W8CA 2TSBA 1ZIAA 3T9WA 4F2EA 1AACA 3NP3A 3FU8A 5AKRA 2YXWA 4FAAB 2PPCA 5I6KA 4NAJA 1JXDA 1SNRA 2XV3A 1NIFA 4YL4A 1PLBA 1FFTB 5B1JA 2Y1AA 3FYEB 4GYBA 1AS8A 2DYRB 2R7EB 4KOBA 1OCZB 4KNUA 4W1TA 2YQBA 4CSPA 2MTAA 1JXGA 3N2JA 5E9NA 4E9RA 2OCCB 4JHUA 3EH4B 2WSDA 4HHGA 2IWKA 4M3HA 5I6LA 2R7EA 3PPSA 1JVOA 8PAZA 3BQVA 2DV6A 3ABKB 1NDTA 2XVBA 1GY2A 1JZEA 4DP0X 2GI0A 1L9SA 1AS6A 2IDQA 4AX3A 3S8GB 4QKTA 4TXVB 2FWLB 4KNTA 3SQRA 2IDUA 3WG7B 4A2DA 2J5WA 1RZQA 4E9WA 3WNIA 1TU2A 3HB3B 3TBCA 4DP1X 3ZBMA 3JT2A 2CCWA 1PLCA 2H47C 3FPXA 3EH3B 2HRHA 3NSCA 2UX7A 5D4HA 5A7EA 3ABGA 1BXVA 2BW5A 2OJ1A 2GBAA 1BXAA 4WTQA 3JTBA 1XMEB 1X9RA 1PZAA 1ASOA 3NJFA 4YSAA 4KO6A 4YSQA 3SBQA 2J55A 5AZUA 3NJJA 3WIAA 5I6MA 1SF3A 1L9RA 2JFCA 4DPBX 4YSRA 3X1EA 1AANA 1NIAA 4E9TA 3AY2A 3DTUB 3WNJA 1L9QA 4A2EA 1BQRA 1DYZA 3H56A 3FQ2A 4A68A 2BZCA 1VLXA 1RKRA 4MFHA 4DPCX 1V10A 3PAUA 3NYKA 3IEAA 5B1JC 1XB6A 1ETJA 5FC9A 1OCRB 4AKQA 1A3ZA 1AZBA 4HCIA 1KCWA 3PLYA 3S8FB 3OMIB 4P5SA 2IDFA 2UX6A 3GXUB 2XV0A 2FJSA 2QPEB 1V55B 3PXLA 5D4IA 4DP2X 2UXVA 2GC4C 1AR1B 3TASA 4BK5C 2WO3B 4WKXA 1PMYA 3S3BB 9PCYA 2BHFA 3S3CB 1A8ZA 1AG6A 2I85A 4G72B 2EILB 4A2FA 1TEGA 1PY0A 1ID2A 2AVFA 2IH8A 4L0PB 2Q9OA 2YAOA 2YAHA 1URIA 4F7KA 7PAZA 3UADA 3ZX1A 2BP0A 1J9QA 1N68A 2UXFA 1BQ5A 1WAEA 3FSVA 1AZCA 1ZPUA 4N4YB 2ZONA 2HX8A 2JXMA 4HIPA 1ET8A 2BO0A 1PLAA 2HLEB 3N55A 1SDDB 1GYCA 1OCCB 5I28A 1WS8A 1CURA 1ADWA 1KV7A 1QHQA 4PAZA 4UANA 2VW7A 2ZXWB 1FA4A 3ABLB 2PP9A 2VM3A 3T6XA 4M4RB 1SFDA 4Q8BA 1JERA 1NIBA 3FQYA 4AZUA 1KDJA 1NPJA 3IBOA 2E86A 3OQRA 2H5UA 1MG3C 5D4JA 2Q5BA 3KW8A 4G71B 2AZAA 3AG4B 5F7AA 2J56A 3AZUA 2CALA 4BWTA 3V9EA 1BQKA 3X1FA 2ZWNA 2DY2A 4YSEA 3FU9A 3QJQB 1BAWA 1M56B 2XYBA 5EHFA 2XXGA 4DP4X 2VSMB 3FQ1A 1GW0A 4GY4A 4HAKA 4HHWA 3CVCA 4FA7B 1XB8A 1IBZA 1V54B 2XU9A 1CYWA 2YXVA 3DKHA 1KYAA 4HZ1A 1OCOB 1OE2A 1ILUA 3EF4A 1DZ0A 5B7EA 3OD3A 1PAZA 4GP4B 5ANHA 3ZIYA 1ET5A 2YAQA 1QNIA 3FT0A 3ZDWA 3NSDA 1HAWA 3UGEA 4YVUA 3CVDA 1J5DA 2PPEA 2X88A 2PLTA 2CUAA 4NERA 3NJKA 3NJLA 2YAEA 1IBYA 1CUOA 4CSZA 1KGYE 1AAJA 1KBVA 2PPDA 1NINA 2UXGA 3NJNA 1A4CA 2FQDA 3IE9A 1J5CA 3FS9A 2I7SA 3MX0B 4HCGA 3X1GA 1T5KA 2MRYA 3CG8A 4X4KA 5I5IA 1KBWA 1BXUA 1OE3A 4RH4A 4QLWA 1JXFA 2PPFA 2PP7A 1B3IA 2IDTA 2AANA 5I26A 4K9JA 1TEFA 3S3DB 1ZDSA 3FYIB 2BWIA 1EZLA 4E9XA 4DP7X 4YVNA 2LLNA 4E9SA 4KO7A 1MG2C 2QT6A 2BP8B 2IDSA 4ENZA 1BYPA 1J9SA 1IC0A 1OF0A 1XB3A 1JZJA 4AKPA 4HALA 3ABMB 3UAEA 3T6ZA 5PAZA 2XV2A 2IH9A 1E65A 3QQXA 3QJVB 2VW6A 5PCYA 3NJMA 5AFAA 1NPNA 5B1BB 1YLBB 4KO5A 4DPAX 2VM4A 1WA1X 1PNCA 3AW5A 2ZOOA 3EHBB 3AG3B 1NWPA 4GP8B 5I5JA 2CAKA 1IUZA 1JVLA 2VN3A 4YSUA 3ASOB 1QLEB 2QPDB 4JHVA 1PF3A 1SFHA 2BW4A 6PCYA 6PAZA 3PCYA 1BYOA 1W6LA 3NJIA 3X1NA 2HXAA 1SDDA 4BDVB 2EIKB 2YAMA 3NT0A 2VMJA 1AQ8A 2UXTA 1AS7A 1E30A 3H4HA 4DP8X 4DP6X 2XXFA 1E67A 1GS8A 1JZIA 4KO9A 2WO2B 4BDVA 5TK4A 2QDWA 1L9PA 2A3TA 1J9RA 2XLLA 3OMNB 5LDUA 2B08A 1FWXA 3T71A 3T6WA 3ASNB 1W6WA 4A66A 1KCBA 3HEIB 1ASQA 3H4FA 2BWDA 2JKWA 2B3IA 2FT7A 3G5WA 1GS7A 2VW4A 3UABA 4GXFA 2P80A 3GDCA 2GC7C 2DWTA 2VSKB 4GP5B 2GIMA 2YAPA
chains in the Genus database with same CATH superfamily
1YEEL 4HISA 4G9DA 4YZWA 3O81A 2BSTB 3EADA 5D6DA 5EIIB 1ACXA 3P9MA 2J88L 4N2LA 1IE5A 1NFDA 2W07B 4HP5A 3BRGC 4X6DF 3L3OA 4Q89A 2VDRL 3VXRD 4H0HB 1CBVH 4QOKA 1E8XA 3O6LH 3BD3A 1VHPA 3LPFA 4AQ1C 2F53B 4JFFD 2KPWA 1WZAA 5JPMC 3AABA 1QRNB 3V8CA 2E6QA 4UF7C 1OQXA 3B34A 3SODB 3L8QA 3ME0A 4JY6A 5L6YL 4LAQL 1ZT4B 4WJ5A 3TT1H 4X8GA 4RMVA 4HWUA 1RL1A 4IRSB 1KC5H 3FSAA 4A7UA 2B15A 1HDMB 3L3GA 2HRGA 2BHZA 3GYRA 2FWOA 2KLRA 3PHQA 3BCFA 2YRPA 3M17B 3ZDYF 2ADFH 1TT6A 2I32A 2OMVB 3QWOA 3DXAD 2WZPD 1SQMA 1NCDH 3TEUA 4UM9B 1FC2D 3WFCH 1A2YA 2YD2A 2P80D 3KZ8A 1DUYB 1SLVA 1G9NL 2HT4D 3LZFH 2H41A 2IANE 3PFQA 4XZUB 4BRVA 5IQ9B 5I16A 4MS6A 3C08H 2Z64C 3KPLA 1UVQB 3WD5H 2JMRA 2WXLA 4KPHL 43CAB 1IQWH 4FZEH 2K6WA 4G8GB 4U7MA 2D73A 2EDNA 4PLNC 2GTWA 3KLKA 4OV5B 4RWYH 1QSED 1F4WH 1X5YA 2ZSWB 1FNEA 1E4HA 5KSVA 1OF2A 3UTOA 5CJQH 5C0BA 1LO4H 3NUKA 2E5EA 4NNXA 3AG2B 3PQYE 1ZLUH 3WEBA 2ZUTA 5I5MA 2PYEA 2G5BA 2X89D 1CF8L 3LOWA 5HI4C 4ELME 4Z78B 1IKNC 4R9HA 2CRIA 4JR9H 1ZXQA 3FOMB 5E70A 3BH8B 1J8KA 1PG7W 1DZBA 5LCVH 3SQOL 4FMFA 4JPVH 5EU5B 2OJEB 1CXIA 2FUTA 4J3SA 3MUJA 5D1XC 3BFOA 1BFSA 4IEFB 1IQDB 1VZGA 3NIDF 5IMMA 3SDAD 2W0FB 4JQXA 1KNOA 3MV7D 3KHQA 1XR9A 2D0HA 1V3LA 2DB8A 4ADGA 3EH5B 3HI5L 5BV7H 2J73A 4F2FA 4ZUSA 2XWTA 2YRBA 3DSNB 4WEEA 3Q2CA 1KENH 4J3WA 5FLVA 2P5WE 2YUVA 2CWRA 2XNAA 3WI9A 2XQYK 2Z3FA 3OC5A 2WN2A 2BHYA 3G6DL 3VSVA 2NCEA 4NQDA 5DQDH 3FUNA 5JIPA 3MLWH 1OTTD 1LEGA 5FO7B 4DAGL 1INQB 1F1DA 3V0EA 2DL9A 3L4YA 2KQNA 1FGVH 2CKBH 4I48A 3C5XA 2PCYA 5DC9B 1HL4A 4OLUH 5DGQA 3V4VB 1ACYH 1QR4A 2HPTA 3T9WA 3KDMB 1EFXB 4IOSD 4HUVA 5TE4L 4E41B 3FU8A 2ZUVA 2J2ZB 4EN3D 4N90D 1I1YB 5I8CA 3Q2NA 1GW6A 3KLAA 4KOBA 3EOBA 4ELMB 3S36H 2WSDA 1Z9LA 4PI2A 3CZSA 4AGLA 5F1NA 2R7EA 3L1FA 1M6OA 1ES0B 2XOTA 3CLEH 5FYLE 2ZWZA 5INCB 4AVJA 4J12A 4OD2B 2C3VA 2ZOKA 1CF1A 4KVPA 4XPAL 3TN0C 3U9UA 3O6KH 3QUXA 4B95C 5EUOF 4AX3A 2V4LA 4MASA 4O9HL 1JGUH 5FDYA 1S46A 3CZEA 3NCYS 4HH9A 4F15B 4A2DA 4I0CC 5CP3A 2YOCA 4QRBA 1U91A 2AMGA 5C3IA 5J13B 4BH8A 2ICWJ 2H47C 5AD0B 3KJ4B 2WXGA 2QSCL 5K1NA 2CIIB 1DJYA 3LKSA 3L54A 2R56L 3LIUA 3LPOA 1DSWA 1DLFL 4AL8L 4WGVB 5B3JF 2EZ0C 3MRPB 4AUUA 3VFOA 3D39D 1GGCL 5I19L 4ACTA 3ZT7A 3T65A 2JCCB 2BY0A 1IFHH 4YBQD 4NPKA 5D2NA 2RR3A 3QUML 4N20A 4U1LB 1CVSC 5AZUA 3NJJA 2GBTA 1KIUA 4YAQA 5IB3A 5MEND 4L1BA 1UXSB 5LBSL 1FNHA 3DTUB 5F88B 4LCWA 2N1TE 2RFXA 1DEDA 4R5TA 2XPGA 4ANUA 2ALAA 2EDMA 4LOUD 1IEBA 3SDCD 3BDXA 1ID5I 1HKLH 5E99H 2CSPA 1M7IA 5AG8A 3BT2H 1QWNA 1AH1A 3PWJA 1FORH 4TLUA 1IAOB 3WN5C 1KCWA 3IS0X 4YXKH 1RUAH 1E28B 3FO9A 2EP6A 3K2IA 4JZNA 3TX4A 3WUWA 3SKMA 5J9PB 4ODXA 5A2AA 2KLTA 4PVBA 2VE6B 3QRFM 3I2CL 5EFIB 4WKXA 5I66B 3S3BB 1Q0XH 2AERT 3HC3L 4JM2B 5LG1A 1SGKA 1KBGH 5A40E 2MOQA 3DSFH 2IBZY 3KPNA 1LTXA 1UB6A 2HKHL 2XXMB 3BAEH 3N91A 2YPLE 1YQVL 4M5YH 4WNQB 2BFGA 4AT6A 3QH3B 1MJJB 5D5MF 4F7KA 4KTGA 1KJVB 2FHBA 3L3HB 5F9JB 1PX3A 3WE6A 3HE7C 3QHZH 1QQDB 1P2CB 4YHNB 1P1VA 2VR6A 1YVLA 4HIPA 1ET8A 4YDJA 1PZDA 3OAYK 1DJZA 5TQ2L 2XQ0A 2Q76B 3DRTA 1ZAGA 2D4DA 4N6RA 5IJKA 4KC3B 5FEBA 2MPVA 1WS8A 4L29A 1UT2A 3VWJD 5HHME 2ZXWB 4IBYA 2ZF8A 3EH2A 2DQTH 1B4JL 2CO6B 4RMBA 5E94B 1I3UA 1BD2D 1JGLH 4UQCA 1JHLH 2NYYC 4IIQA 3ZJAA 4AIZA 3RFZA 4O2EB 4ISVA 4QAMB 2H5UA 1MG3C 2JKXA 4R7DA 2Q5BA 3CHRA 3AG4B 3SE4A 5EZLA 1N8ZA 4Y2DB 1C7TA 2C3HA 2XQYA 2NY4C 1P7HL 2PO6B 4X99B 3HHRB 2P8MB 3K74B 3UJIH 4R4ND 3MV9D 4N5EC 2XYBA 3BZEA 3LRGA 4M8QB 5SWZB 4DFHA 4KKAD 4S1SL 1TITA 5DJ8A 5DJ6A 1DVFA 4HHWA 2KPNA 1JGDA 3E6FA 4GW1A 4B96A 2NY6D 4LU5H 3IDIB 3NEXA 2R2BA 4KROB 1LD9A 4KK6C 2XKNA 3DLQR 4OF5A 4GLRH 4ODTH 5JPNB 5IVXA 1OE2A 3IAGC 1CD9B 2AV7A 2Z92B 4P2RD 4ZTOL 4HCRL 1A64A 3BPOC 3Q5TA 2MKLC 3SHSA 3F7YB 4HF5L 2JI3A 3ZL4L 5F96H 32C2A 4GRLA 1S9WA 1OM9A 3HE6B 2D03H 1A9VA 1SBBA 3L4ZA 3MU3A 4YGVA 1HI6A 1L5GB 5IROD 4LPCA 4L3CA 1NINA 2VQ4A 2J7LA 1GYWA 1KB5B 3D25A 3GMMA 3H42L 4GAAA 3SJVE 3NIGE 5C2BL 1H0DB 4ZMPA 3EGXB 4AJ0A 5HHMB 4R83A 4PGBA 3ABZA 4JUSA 2DLGA 1FHNA 1TYJA 1NC4D 4QRQB 1LILA 4Y4HA 3MX0A 5JQHC 4HDIA 3HZYB 1P7QB 4FQJL 2ZCKL 5EZJA 1I8IB 4YC2B 3HG1D 3HC0B 1NUNB 3W11D 4CL7A 3B2VL 1UZ6E 3BHBB 4IBQA 4FLSA 1D2OA 5HPMB 1R3HB 3VUAA 4FKHA 3DGGB 1HZHH 1R3KA 4JY4B 1JWUB 3GSRB 4GSDL 1KWKA 4JFXB 1I4FA 3PV6B 2R27A 3S3PA 1AHMA 1YECH 2EH8L 3VGHA 1CL7H 3CMOL 1TETH 3HMXL 4GFTB 2Q3XA 3R0NA 1I9RH 3LRLA 1U3HD 5CLTA 4WWKC 4G9FA 4H25A 4W9IC 3O2DL 3BP4A 5EEVA 4ZXBD 3ABMB 2L3BA 4LLMB 3ESUF 3GZKA 5GRVL 5K9KB 2A1WL 4FFYH 1JYXA 4YNYB 3P4MA 2IGFH 4KKBD 1C08B 5IFJA 4X5LA 4Q6YA 1MH5A 3GRWH 5AFAA 2LU3A 3L9RA 4DP2X 1SEQL 3LNIA 2HKAA 2EDLA 1MLBA 3VWKA 3QG6A 3TH4T 3WAJA 2Q7NA 1SVZA 3ESNA 4ODSL 4J8RB 1EPFA 2WJ5A 3EKCA 4Z7WF 3MI6A 4QXUL 2ZCHH 2ITCB 4MXWL 4Y5YB 4TNWK 3WY4A 3ETTA 5LNDA 2VL4A 3FB5B 3CFCH 3QORD 5FHBH 3SJVB 1W6LA 3HVDA 3NIGB 3MUGB 1XD0A 3B9KC 1NBVH 1KTJA 1OAXL 4HLEA 2DMGA 4M29A 1KELH 2HLFD 1AQKH 3FTGB 3CSTA 4KO9A 1NGPH 5TK4A 1TYRA 2QDWA 4C8XA 4IS6B 4ZO9A 3CFTA 2COQA 4FMVA 1CG9A 5D1QC 3WSQH 5FOBB 2FB4L 1CXLA 1XGPB 4OZFA 1W6WA 1PG7L 1UZ8A 3LH9A 4J3OG 2VDQH 4JS7A 3NJXA 4P0DA 4L9LB 4TKWA 4NRZB 1KZYA 2H2PC 2ARJQ 3G6JE 1P6WA 1UXWB 2GIMA 4LLYA 2D7MA 2KZBA 1MCLA 4K2UL 4U33A 4Z95L 4S11A 1AFVL 4E9VA 1IGTB 3DGDA 4G7QB 4GO8A 2B4CH 3RUGE 1QEWA 5GGSA 4FFTA 5EU3B 1SOQA 5ICUA 1CDGA 4IMKC 4KFMA 4O2CB 5DS8B 5E6IC 4Y19E 3CC5B 1C1EL 2ICEA 4X9BA 2VXQA 5DRWA 4Y16A 5CEXB 1LEIA 3ARFA 2FJGA 2BC4A 2Z31C 2CGRH 1A4AA 2JIXB 2WNGA 3IKCA 3DIVA 4FULA 4H8VA 3VFPA 4IRZL 3O11A 5C0CA 4IYKA 4U6VH 4DP9X 1LE5B 4L37B 4OKVA 4LIQL 2JELH 2WWMC 1QA9A 4HBCH 4KJQC 4FP8H 5DCCA 1T03H 1WGOA 2A6IB 2CJSA 4OM0H 1A6ZA 1N10A 4GI9A 4B7LA 5FYKL 1CTNA 4PJGE 2O5XL 4UAOB 4BUQA 4FC3E 4QNPE 4HEPG 5JOPD 2A73A 5L0QC 1QAWA 5K9OB 4PD4J 1N0LA 5T3ZE 2B1OA 4AI7A 4D8PA 4K7PH 4J28A 5C09A 3FN0L 3FB6A 5D70L 1NFDF 2IV9A 4LDLB 1WIPA 3DX4A 1RHFA 2ED7A 4XNAA 2IDCA 3VXME 4PJHE 4R7LA 4XPHH 4AK2A 4E5XG 1SXAA 3U9WA 4MMZB 5GQBA 5L2KA 3VSQA 1BXXA 4H8HA 1E9QA 4C56D 4AM0B 4CKVX 2IXQA 4L5FL 2VABB 1A7RH 3WFZA 1NBQA 3QDJA 2WINB 1T7YA 4OQ1A 1NBCA 3BGFC 4TOYL 2FBRA 4AV5A 2XG4A 4HXBL 4ZI8A 5I6NA 4LP8A 1KJ2L 5HHVL 3L5WA 3S48A 4DN4H 2YEZA 4UILH 1ONQA 3HRZC 3T0AA 4PYGA 1EO8L 3RZWA 3PYCA 1JPSL 1PLGL 2BNRB 2GB2A 3PWVA 5T1DH 4E9LA 2CHNA 1CC3A 4KX7A 5I1DA 4ZMOA 3PWUB 2CQVA 1B90A 1TQTA 3GS4A 3C6SA 2EXYD 3MRMA 4QUOA 3MMEB 1C8PA 4D9RE 1MRDH 5AVYB 2E46A 1JN6B 1DLHA 1P1ZB 1NM9A 3BW9B 5LG6A 5FUCE 5LXVA 3J07A 3U30C 2GABA 4EKJA 3HI1B 5AWNL 1SY6L 4MJ6A 4PJ5E 1DFXA 2HFEB 4W9KC 4BZYA 4QDGA 4PJGB 1OAKL 5FW7A 4I3SL 5JR1L 3HB3C 2VDLL 4OFIA 4H20H 4QGTA 2JB6B 1F90H 4NOFA 4U3HA 5HJGA 4BXVA 5AYUH 2AJVH 2VLJE 1J5HA 1FN4B 1FJ1B 2EO9A 4L1LA 4FQXA 4BZ1L 4GI6A 3C60B 3MOAH 4GBXC 3SE8L 5I0WA 2FIKB 4NQXB 3VFNA 3DMMB 4ONFL 5F3HB 4PJIE 1KB3A 3CPUA 3N85L 3UZQB 1HHGA 4AY0A 5EC1A 5LWYL 4HJTA 4OY9A 5EOQH 1EMTH 2UY6A 4DVBA 5B38G 3H0TB 3QE5A 2ADIB 4PRPB 2ATPB 3CZLA 2ICES 1HIML 2ZYHA 4MHHI 5KSBA 1DBBL 1W91A 1I1AC 4WU5B 1AACA 3UOAB 4HWBH 2FHCA 5I6KA 5FYJD 4HQQH 4Y4KA 5C08A 3MV8A 4NT6A 2NW3A 1FZOB 4QCIB 5DWUL 1U6AL 5DS2A 3HAEB 4X5WA 5DK2A 4B9ZA 4NM8L 3L7FA 1F02I 5DUMH 5K9QI 3FH8A 1PDKA 3U83A 1REIA 2E0PA 1MFUA 3VI3B 4JKWA 1L7TH 4KRPB 4D8OA 1HHKA 3S0PA 4X9YA 2DV6A 1KCUH 2A9BA 2QKIA 5JIKA 3TM6A 1UASA 3VD0A 2P44B 2IDQA 4H26A 4B27A 4EE2A 2HVKA 2C4XA 4JQXC 1VEPA 4TXVB 5B8CC 3WHXB 1E27A 4PREB 3T2QA 3G9VA 2VDRH 3ZDZE 4PJ5B 4M6OL 2EZ0D 2QADC 2O5ZL 4U4IA 5SWSE 3T77A 1KJMA 3GNML 5SX5K 1N5AA 4P46A 3LXAA 2I9TA 4HFWB 3PS6A 5D4HA 4NKQB 3P4OB 1CGXA 3GI9H 1NBYA 1TMQA 4LAQH 5L6YH 5D2LF 1O7DE 5F0MB 1IC5L 3F84A 3RVVC 5IQOA 3RQ3A 5DI8B 3S34H 5IJDC 3NJFA 5LNEA 4YSQA 5I75C 1R19A 2V0AA 4J39A 2V33A 4YHML 3STLB 3U4EA 4PJIB 4ALAC 3X1EA 4P23C 4K9EL 1I1FA 3UXFA 4J6RL 3NCYP 1WE5A 1TTFA 4ZFFA 3MA9L 1G9NH 2ROYA 2GK0A 2WK2A 2XWRA 3EOYG 5EZOL 3HPLB 4L3AA 5ESAA 3VXPB 2V9UA 1UB5A 1TFPA 2DYPD 3T09A 3E8UH 1V3KA 5LO7A 5ENWA 1XGYL 2QPEB 1F6AB 4Y4FB 1EHXA 1KOAA 3OJDA 2UXVA 1G7HB 1D5ZA 5I1IL 4MBOA 2VMEA 3BC9A 2CNYA 3V0FA 1TZHB 3LPWA 4P2OB 2K1MA 4BK5C 2DTMH 3QUXC 4IGBA 2A9ML 4AH2A 3JWOC 1E4KC 1PMYA 5IM7A 3U7WL 4HIIA 1DR9A 5DD0L 5KJ4A 3DECA 2Z4QB 1RXLA 4WK0B 4RQQB 3SDDB 3ZE1B 1KULA 2W65A 3MRQA 3KYMA 2EDDA 1U0QA 3QHTC 3QT2A 2WJ7A 3ZDZB 2W9EL 1CF8H 4XCNA 2IH8A 5SWSB 4AYGA 1H8SA 3LKOB 3VFUA 1U3ZA 4JZJA 2X2YA 2Z93B 1YNTA 4Y5VB 5DUPH 1PEZA 2JXMB 3SYQA 3I6GB 2Q6WB 3NZSA 5IFHL 4GQ9L 2RAMA 5AYQA 4N8VB 1QHOA 2RQ8A 3SQOH 3FQTA 1NUGA 2A4ZA 2OMWA 3TO4B 3B37A 4HS8H 1N5YL 2EDBA 5D7LA 5FA4B 3LRSA 1W72L 4LPXA 3KNBB 2BY3A 4POZC 5K69A 5CIPH 1GYCA 1OCCB 2Z7UA 4HGWA 4OKDA 5AYTA 1QFHA 2OZ4L 2VW7A 2X09A 3QXAA 2ZXAA 4PGDB 4EI5B 4JDEB 2YBRB 4H0LC 2JQZA 2VM3A 1B88A 2HTKD 1M4KA 4LKXA 1IM9B 4RRPA 3V4PA 1YNLL 3ZO9A 5CFHA 3W82A 2NY4D 2KC0A 4WO4A 1W8OA 4AZUA 5ISZD 2XWDA 1VESA 1IV8A 4LSVH 4PH8A 5C0AE 1BQHG 3TXAA 4N5ED 3IGLA 3QDHA 4R84A 4ZPTA 3BZDA 1ROCA 5DTFA 1KEGL 5CZVL 1HH6A 3US9A 3DETC 5J6HB 2FR4B 5KSAC 2DY2A 1SVBA 4PWKA 4QHNB 1R6VA 5TDPB 1GAFL 5D96C 4PIBA 4DAGH 3G08A 4XI5D 1KBKA 2MTPA 2HA1A 1JMXA 2WP3O 5JW3H 2IOOA 5CU5A 2H1LM 1CJYA 2P48B 4PJ7B 3WIHH 2VDMH 2P5EE 2NXYD 1S9YB 3TA3B 2GJRA 4Z7QF 4RGND 3ZE2F 1S7VA 5TE4H 3IU3A 3CFJB 2W80C 3DKHA 4PTUB 4ZTPL 1DBMH 5DEGB 1DUZA 3G04B 1UH2A 4CW1B 2X4RB 2ZQKA 1XEDA 5T1JA 2ZP9A 4K94C 1D7CA 4APQD 2GI7A 1ET5A 2G0LA 4MCMA 5IB2B 1N12A 3ISYA 1HAWA 4KMLB 2H26A 3BH9A 2IALA 2FCBA 5BVJB 3LCYA 4MXVF 4NO3A 3EH1A 4GLRI 4NUQA 3ZHDA 2BIMA 4M6NH 5EBWB 3TIDB 4F9PC 4OZIA 4HAGA 4OLEA 1IBYA 3UEZA 4ZMQA 4XPAH 3IPFA 1CXFA 2HJLA 4DFIA 4KK8D 3BJ91 4O9HH 2E8YA 1KBPA 5H37H 3WFHA 5F1OB 1KBVA 3QUHA 3GMPB 4EBQL 3NJNA 2YRZA 2F7OA 3IE9A 1J5CA 3P77A 4AWJC 4ZMLA 5EDSA 1EAQA 5I30L 4LLWA 2WXPA 1KBWA 4HIHA 3BI9X 1YEDB 1DLFH 2K8MA 3NMEA 3REVB 3WY3A 4AL8H 4I1NB 2QGDA 2P24B 2PPFA 1GGCH 1W15A 5I19H 3RX8A 3ECWA 3SGDH 2HKFL 3D85B 4N0UE 3ZTJG 3QUMH 3A4EA 5DUBA 1RJLA 4ZSOA 3CN2A 1K8DA 5CWSA 1Q4NX 3SKNB 4NM4H 4H2CA 1R4XA 2A6KA 4CMHC 1IAKB 3FT3A 2GFBA 4XPGH 5AW4B 4XNUL 3VFVB 5DRZB 1SJEB 1KSRA 1N59A 2OJZL 4MB5A 4HULB 3CBJB 2G75B 2OA9A 4PJAF 1J8HB 4FI7A 4AGQA 3MODL 2VKWA 2VR8A 1OD7A 4ZO7A 2QT6A 1XAKA 5HVHB 2P5EB 5D7KD 1U8HB 1DQMH 5ES4B 5INDA 1VFBB 2QVTA 2BDNL 4HALA 2GJPA 3QWNA 5MEOB 4WCYL 3RZCB 1MHPH 2VZ1A 1NGXA 1S7TB 43C9B 4UDTA 1A5FL 4M4PA 4R7VA 3MUUA 4QI3A 4M7ZC 5E2JA 5AUMA 3MRCA 4YDIL 1CL7I 4A55A 1FZMB 2EDFA 5GSVB 3HBPA 2WWOA 4K4KA 1M7DB 2NDGA 3I2CH 3N40F 1QW9A 3ZTDC 4DN3L 2IOIA 3G5VA 3B9KD 4AXWB 3ZMRA 1PCXA 2V9RA 3BUIA 1X5HA 4AUYA 4FTVD 5I74C 2HKHH 1FV1B 1EDQA 3NZ8A 1YQVH 1S7WA 3HUJE 4J3BA 3QAQA 3X1NA 3WDHA 3I02A 4B50A 4M9OA 1ZLWK 2EVGA 3ULVL 2K70A 2VMJA 3MRBA 4HJUA 1S7QB 3FMGL 1AS7A 1E30A 1UD5A 3CZFB 1E67A 1KN2H 3OHXB 5HYSG 4G6ML 1XIWA 4NNYA 1XL6A 1UWXH 2FECI 4PMEA 2HT3C 5HYJE 1UC6A 1JTTA 2ESVB 1UJTA 1QFUL 5TQ2H 4L0ZA 1F6FB 3E0GA 2E7BA 4B5ZA 4OZHF 2IANA 1A4JB 2WVSA 1GS7A 3UABA 1Z32X 3K2KA 2OSXA 4MB4A 3GDCA 3QPXH 1D5RA 2NZ9D 2NNXA 3UC0L 1P7KA 4I87A 4NWUL 1ED3B 3CXDL 2N4IA 5E6ID 2CCVA 2MCPL 5DYOA 5FKAA 4WKZA 2WBXA 2NY1B 2Z31D 4V11A 4KXBA 5EOCL 2X6AA 4F7CB 3QIBA 2OMZB 2FSEA 2F08A 4NYLB 3IDYB 3CVHH 4OFQA 4B7IA 3PQYA 2OKMA 2WWMD 3JTTA 4ZUVB 5LQBL 4KJQD 4WUUE 3DK2A 3IDNB 2X2HA 2PETA 1ET7A 4Z77A 4F3FA 2WV3A 4S1SH 4FXGC 4X6BA 3MGOA 1ZS8A 3X14B 1VACB 3Q3GA 4OUOA 3C6LB 5HGHA 1RAMA 1KGUA 1AGCB 1FSKC 1Q1JH 3PP3K 4F92B 4WTXA 3NESA 3DX7A 3T4AB 5HGGS 2X4SA 3C87A 2OYLA 2R2EA 3D2UA 1IJ9A 4MNHA 5ANMA 3TH3T 4QLRA 2VRQA 1NCCL 3LEVL 3NAAL 5B7MA 2BVQB 4K8RL 4ZTOH 5I0VA 3O8XA 4HCRH 4IBSA 2FTAA 3UTQB 3MREB 5BV7B 1RI8A 5EULV 1MFVA 3FHEA 2C3XA 3JVFC 4HF5H 1INEL 3ZL4H 3UH8A 1R24A 1I53A 4JN1L 2X4PB 2QHLA 3AQXA 5A2IH 1I7UA 2CGZA 1K4CB 4EEEA 2G9HA 4L18A 4OAWA 1X9UA 2E75C 5KEZA 3PABB 2P5WA 4QHLB 4MD4B 3W9DB 3UPAA 5IV2A 5ICYA 1V7ML 2WYIA 4LQFL 4M1CC 4QOKD 5C2BH 3VQMA 1F6LL 4UQEA 1G1OA 1NC2B 1TMCB 4J1UA 2CKBB 1CFTA 4LNRB 4MCNA 4WWNA 3UYPA 3WLBA 3T0DA 2I7OA 4DEPB 4YSTA 1F3JB 3BDBA 2PTVA 2MOGA 4NQEE 2AJ3A 3UCQA 3TJHD 2G2RB 1CGYA 3QWRA 2JF1A 3NCMA 1AXTL 1XGQB 4DGIH 4EQ3A 3IT8D 3N40P 4LEOA 4FQJH 1CI3M 1LK3L 1QSFB 3NPZB 4EXKA 2BP8A 1NZRA 3FTVA 1KFGA 3SPVB 2ICEC 4YSSA 2P28B 3B2VH 3MLTA 1ZIBA 3E8VA 3QISA 3JTSB 3ARFC 3KS0H 3MRIB 4KITB 1BFTA 3IFOB 3QJRB 1QVOB 1KGCE 4WUUB 3OF6A 1M2VB 2VN4A 4L8DB 4GSDH 3DJZA 1MQKL 4L4VE 5JLZA 2DQ6A 1S7XA 3Q8EA 2F6AA 4CC4C 4FQIH 4H8WC 3MZTA 2EH8H 3PAZA 4FQ1L 5C2UB 1RFDH 3VXSE 3HMXH 5F8QC 1IGIL 1K5NA 1LK2A 5I1LA 1Z0MA 5G4OA 2WZ5A 3O2DH 4P2CG 1MFMA 3B9EA 2A1WH 3SBRA 3WO4C 2OI9C 2GT9A 4MA3A 1JZDC 3MLSH 5TFSH 3S5LB 2DIBA 1JZGA 3T3PF 1DSYA 1LQBC 3HFFA 4GJTB 4A2GA 1L0YA 2CBTA 5BJTA 5JW4R 1WAPA 4N3TA 4G3YL 5C0BD 2R4RL 2XICA 5TGBA 1E4WL 4MXWH 1BZDA 2PWEA 2PYED 1I1AD 1V3JA 1FNSL 4K3JL 4UNTA 5KYNA 2WXQA 1OP3H 4WUKL 2UWEE 1MCWM 3Q2VA 3FU7A 3HN3A 5DD5L 3U79A 5MHSE 1GMIA 4NQEB 4NN6B 3WTUA 1UGKA 3FF8A 1J0IA 3V0JA 1JXDA 2Z1KA 3RTQA 2VJ8A 4YL4A 1LP9B 3EYVA 3QWQB 2J4WH 2AI0L 2FB4H 3BZFA 1Z9NA 4FXLA 2CO3A 3T04D 3RGVA 2MTAA 4UTCA 4HC1A 1B0IA 5ELIA 5F97E 2B77A 1SZNA 1MWAA 3FTZA 3U82B 4BFJA 2AHIA 3HHSB 3QCTH 1H5BB 4XBPB 5TE6L 5CJ5A 5IHWA 3AREA 2NLJB 1RK7A 2QADD 1GY2A 3IJYA 4LVOB 1ETB1 4NO2B 1L9SA 2BNQA 2DTSA 4K2UH 5JA8B 4Z95H 1R0AH 1RZIA 4APXB 3FO2B 1DBKL 1AFVH 4UIKH 1RP8A 2OXGB 4JANA 3CVIH 2R1XB 3LMJL 3MRHB 3EZJB 3JT2A 2YUXA 3RVVD 2AKRA 1FAIH 4Y5XA 1OZTG 1WWAX 4NQDD 2HAZA 1C1EH 1N6QL 4LLQA 2NY7L 3PL6A 3UJJH 2YPLA 4RAHA 4B6ZA 3IJ8A 3UP6A 4QXGL 5FM4A 4IRZH 1T20B 3FT2A 3HLAA 1JHKL 4XBGA 4YO0A 5GRUL 4LIQH 2APXA 3KYAA 1VADA 1TQVA 4UT6A 1BP3B 3A21A 2QL1A 3CFDB 5FYKH 2CHWA 5DA4A 1NBZA 2QV2A 4W4NA 3ARBB 3PF2A 3QJZA 3UMNA 2UWEB 3V5DB 1CGSL 2IJ0C 4OZGF 4B5EA 3FQ2A 4Y4KC 1RKRA 2JKIS 2PCPB 4MFHA 4DPCX 3LB6D 3QCUL 1RZGA 2X2JA 3FN0H 5D70H 2V2XB 2Q7YA 3MYZA 4R4FL 1HILA 3DIFB 2RALA 4D7PA 2X41A 4N24A 3QUXD 4RGOL 5EUKB 3QZBA 3PLYA 4AYBA 4M8RA 4P5SA 3JZ7A 4ABVA 4ZX6A 2WOYA 3I75B 3MA7B 1AHWA 3ZE0F 3NTCL 1KCVL 2DKSA 3I3EA 2O5YH 2ZG3A 4NKMB 3JUYA 4DF9A 4L5FH 4P3CH 4BGLA 1ZD6A 1JG9A 2FH8A 1JPGA 2QQKH 3N41F 4OT1L 4TOYH 4UZUA 9PCYA 3OXSA 3HVNA 3AM8A 1YMHB 5BUPA 1KJ2H 5DRNA 5HHVH 3ULUE 4JFEE 4E68A 1FNFA 2RB8A 1NSNH 1OTUD 4A7QA 2DQGL 2F54E 4ACPA 2XIIA 1WICA 1EO8H 1GMEA 2DICA 4C83A 1JPSH 1PLGH 3RWJB 5I76B 2BSEA 1A4KB 1DJXA 2J6WA 3I6LD 4OLVH 2BP0A 4GXUN 3QNYB 5JHDA 4V1DD 1TJGL 3RIFK 4LCWD 2F0CA 3PREA 4YDMA 4DT2A 2MEJB 4XT1C 4BFOA 5C9JA 3HNTH 5K1VA 4DWHA 1JI2A 4GG6B 3EIFA 4XAKD 4WI4A 5DLLA 4HUXB 5AWNH 1SY6H 4Z77B 5I28A 5KOVC 5HHNB 4KK5C 1OAKH 3TVMB 2HCZX 2Y9RT 3MCG1 3OJMB 4MDJB 4ABWA 4I3SH 3VD4A 2VLKB 4XXDA 5EC2B 2VDLH 4RX4A 5FWRA 4WJG3 1BG9A 4ZNCD 4F93B 4NFDA 1AY1L 3F58L 2YFNA 4QHMB 4CSSA 2X0UA 3P4LA 5AL8A 5MEPB 4BZ1H 1RP9A 3DROA 1ZGLA 5BRZE 3CSYA 3SE8H 4XXWA 2X1WL 4M7LT 4ONFH 2E4TA 4OLYL 3N85H 4LPUA 4BQBA 1M56B 1J87A 5LWYH 1DE4A 1NJ9B 1PW3A 2WLJA 4MCZB 3I3DA 4U1GB 3MLVH 3W9EA 2DLTA 2XXGA 4AVIA 3Q8FA 1VB9A 4FA7B 1RUQL 1HIMH 2O6EA 1S3RA 3A22A 1FI8C 4AVHA 1AR2A 4G42A 1NGQL 5C0FA 1MCRA 1PZ3A 2VISA 4HS3B 3A4DA 5IT2L 3ZL2A 3L3DB 4C58B 2XBZA 3DIDA 3OGOE 2YWZA 4NM8H 4HLZG 1FNGA 3ZN6A 2LW3A 2AXHA 3H1ZA 3T8XB 4JFFE 3C6EA 4HAFA 3T08A 1M9SA 5BZZA 1CICC 3HS0A 1BOGB 3OWRA 5EG6C 3FUFA 1OKEA 2WZAA 2XZQL 3PY9A 3ZSTA 5JNYB 3O3DB 2VL5B 4MAYA 2WLKA 4LPTA 4AJVA 1HXMA 3QEUB 5C07D 4MJIB 2K0RA 4TQEL 4OVVA 4PR5A 1A1NA 2WP3T 3H7LA 4X0KA 5E8OB 1H3TA 2QQLL 5DFAA 3MVSA 3RNQA 2RH0A 4ZQKA 4M6OH 4Z7OE 1KCKA 2O5ZH 1HINL 2MNWA 2HT2C 3FFCA 1W0VB 4MTMA 4PWEA 4JO2H 4E0RA 3ZGHA 2HFFB 5T1KA 3CHSA 5BO1H 1NEZB 3ZKQD 1OANA 3KPQA 4F37F 3QIWA 1EGJL 5GZNA 1OEZW 1LO5A 1DVFD 5F9WB 1BQUA 1K72A 4MJ4A 1AGBB 2IPKA 2RD0A 4HK3N 5BRZB 4KKCD 3F64A 4F57H 5I8OH 1ZT7A 1ZHBB 3S3DB 1WUZA 1AIFA 2YHGA 2CLZA 3UPCA 3O4OB 3QNXA 4KK9C 3RY4A 4U2ZA 5K59F 4ZPVA 3LH8A 3KGTA 1IARB 4E9SA 5ACZB 1MG2C 4K5OA 1ND0A 3SGDI 3MA9H 4Z7UA 5KVEL 1BYPA 4M7LL 4GRLD 4RAUB 5IBTL 3G6JA 4F91B 4CVXA 1MKFA 3EJJX 5EZOH 1T5XB 2XRAL 3F65A 1I3GH 2XA8H 1YEIH 4XVTL 3FONA 1VJSA 1JDCA 1YJDL 3VXRB 2FWUA 1XGYH 2WXIA 5DEJA 1R3IL 4LLDA 1NPNA 1IRAY 4JFFB 2LV4A 3FRPA 4N87A 5I1IH 1LO3L 3N6YA 1S5HA 3SD2A 1PZUB 1B0RA 2A9MH 4Y19A 2BVTA 4M5ZH 1MCNA 4IRSC 2IGLA 1SVCP 5CCKL 1B6UA 3MLYL 1RZFH 1P6FA 4U6YB 4JHVA 5I1HL 1A0QL 1NGWB 3GSOA 4KAQL 4G8EA 2W9EH 5I1KL 1IT9L 3Q7JA 3MV7E 2HT3D 1WBXA 2BVPB 2CNZA 2ADGA 1T3FA 1UEYA 2BIOA 4WHCA 2QSQA 4S2SB 5IFHH 2N56A 3DXAB 1MELA 1LGVA 1CLYL 3ZTNL 1J9RA 2BHUA 4D0DB 5LDUA 1N5YH 3GPEA 1E0OB 5HJ3A 1DQQB 1KCBA 3E9UA 3HPJA 4TSAL 2BH0A 4K7FA 3VXMA 4UINL 2GCYA 4G9FD 2XFXB 1ZHNB 2OZ4H 2YJLA 3MYJB 5D7EA 4H5SB 3VD5A 3MPCA 3LKQA 3NP4A 1YNLH 2PYFA 3D87B 2VDNL 3EJRA 1TSRA 1BZ9B 2Z91B 4GG8A 3GMRB 5EB9A 1QSEB 3WFBL 2JSFA 3VWKD 3MRKB 3VTAA 4YJZL 5DEFA 5GISH 1KEGH 5CZVH 3ARGC 4N90E 1XTLA 3JV0A 4RA0C 1BJ1J 3NVQA 2XV6B 1IC4L 4NDMA 2ZUSA 1HEZA 1GAFH 5EU6A 5HYQA 1A7BA 3GS0A 2BVYA 4QRTB 1UH4A 3KG5A 4Y2LA 2VTFA 5I2IA 2PXYA 4AEEA 1F1GA 2WXMA 1H6UA 4IKJA 5H94B 1MHCB 1G6VK 4XNZC 2EO1A 2EDEA 3QUGA 5K93A 3APMA 1S3KL 3N44B 2CDGB 4ZTPH 1VF5C 3B1TA 2AGJL 5FF6A 1GPOL 4P4KA 3SDAB 2GBVA 2P46B 4U6XA 3HKFA 3MV7B 4GRMA 2BVEA 1PU0A 3BUYA 4JVUA 1KF9B 1F0LA 4LSUL 3SQBB 1BVLB 1NFIB 1T1ZB 1A3LL 4M1CD 4NPYA 1CYGA 2GTZB 3EAKA 1RUML 2BNUB 3D39E 4DKAA 3H54A 2V7HB 2UZYB 5ICZA 5B4MD 3PGDB 4Q97A 2X4OB 4YR6A 1GS6X 3U2JA 4EBQH 1Y6NR 1FCCA 2XX1A 4RFOL 4AIXA 2IADB 2IQAB 3BVVA 4ESKA 1WG3A 4KUCD 4NIKB 4ELMF 3FCTA 4QRFA 4CBPA 4Q74A 1M42A 1YN7B 1YC8A 4R5XA 2V9TA 3GSNB 4OM1L 3WUWG 4Y16D 4MWFA 2X28A 2C1OA 3ARFD 3U6XA 3GMQA 4XE5B 4DO4A 3R06A 4PU2A 5C0CD 5C0EA 1FE8L 3FQNA 3SY6A 3ZR6A 2HKFH 4RAVB 2O26U 5A2KH 1SF5A 1DCLA 4EN3B 2QKSA 3P3YA 4EZKA 4QEGA 3QIUA 3CUPA 4WV1C 1HOEA 3GUTB 3DX0A 4XNUH 4HLZH 2WQSA 3UDWC 3SYOA 5IUCA 1Y7VA 1VFAA 2J8UB 2OJZH 4DGWC 4H4NA 3EJUA 1A7OL 1OAZL 2BZDA 3F7VA 4F8TA 1EVUA 4UOW1 4WI2A 1UA3A 4ZUUB 3VFMB 4RNRA 1KWGA 2W0LA 5C09D 3DPDA 3TYGL 1X5KA 1BX2B 2OYMA 3TC9A 4FL4C 1KXTA 4LCUB 4WCYH 2W94A 3VFTB 4XP4L 2CUHA 5J13C 4MCYB 1A5FH 1A6VL 5I1AB 5L2KD 4OCSH 4JFDA 2G9KA 3QJUB 4YDIH 5JXAH 3R0MA 1R3JA 5I73C 1T2QH 2HJFA 4LPWA 1NMBL 3N1QC 3QDJD 1I8MA 3SBPA 4XVOA 1HKFA 3EDEA 3II3A 2KL6A 2B20A 4NJAH 3D39B 3LZRA 3HZMA 3W38A 3OKEA 2EC8A 2NRDA 3QS2A 4TSCL 4BZ2A 1AKPA 2PNDA 1G7LA 5AVXB 1EJFA 3LIZL 1DVSA 3Q6FB 3Q8CA 4F8PA 2TSBA 3TBWB 5MENB 3RI5F 3S35X 4JDVB 3SN6N 5ITFA 4ELDA 2HG5A 1S78D 4DKTA 8FABA 1OSZA 3BDYL 4AGOA 1BD2E 4G6MH 4UU9A 1I9IL 3VE0B 1G1YA 4XMKL 2DJMA 3MR9A 4GYBA 2L04A 3ASWA 5T1MB 3RP1A 4UT7H 3SDCB 1GOHA 3JWNH 4FNLL 3CLWA 4JHUA 1OSEA 3EH4B 4PPTA 3IE4A 3SEPA 1WBZB 4P5TA 4IMLA 3VRLE 3WEXA 4NX0A 4NQCE 3PPSA 2CLVA 5D7IE 2D3JA 3MV9E 5HI3D 1TVDA 3GINA 1KIPB 3UC0H 3QS3A 2WD0A 4NWUH 1PY9A 2XWBB 5D93C 4KKNA 4QKTA 4LCVA 2MCPH 4FI6A 3EYFA 3ZLQC 5T1LA 1U8KA 4TN9A 2BWQA 4FQXD 4WO0A 1EO5A 4S1DC 3ZKXB 5EOCH 2XTJE 1BBJB 3ZBMA 3GWJA 3VFWA 4KZDL 5KANG 2J5LB 2P1YA 5LQBH 3ARDA 2WUCH 5F0LB 1I85C 1QOKA 3NCJH 4P9ML 4HHAB 2L7UA 3ARPA 3K0YA 1F4HA 5H35B 4WK4B 2DQFB 1TENA 3NFNA 1KJ3H 4PWGA 5DHXB 3DO7B 3QARA 2WMPA 3IJ7A 1RLWA 2ED9A 3K2MC 3WIAA 5I6MA 4Y4KD 5C08D 3MV8D 1ZY9A 4QY8A 1TQSA 2G2PA 2X4UA 4E5XB 2YBGA 5CIPB 3H3KA 2EVHA 4YDZA 1DCEA 1VFUA 4FQQB 4K8RH 2FWSA 4BSVA 4R3SB 4J27A 4GKOA 3QZWG 2J8OA 4K7PY 4CSTA 1XZ0B 4N2KA 3VWJB 2B0SL 3RTQC 1INEH 4GKZB 3TNNB 1T7WA 3UIYA 1ZV9A 4G1MA 4ZW6A 3NYKA 3QEQA 4JN1H 3W0WA 1Z6JT 5AVSB 4LOFA 1BD2B 2A5UA 1DJHA 3VQ2C 1G6RL 5C0NC 4CN6A 3U4AA 5E8NB 2HFTA 3G5ZB 2NTFB 5I0YA 3SGKC 1GZQA 5IF0A 3HG1E 1V55B 2PO6C 4TNEA 3AREC 3H85A 4LQFH 2JB5L 3H9SA 3V5KB 4PBVC 4WFFD 1BJMA 1OB1A 3ZKMC 5CP3H 1AC0A 3PWPA 1GCFA 4GUPB 4P46D 1ICTA 1MHHB 3OR7A 2VDMB 4PD4K 4F7MA 5CO1A 1U8JA 2JKJA 4WW2A 3SOTA 4JNXA 2BFVL 2AK4A 1AXTH 1WZKA 2ORBH 1XH3A 2NY6B 5JPNC 1LK3H 4X8XA 2ZWLT 2R0KH 4MMYA 3K81A 2V5SA 2Q9OA 4MA1C 4PRID 1F00I 1WUNT 2ZYIA 1Z5LA 5F70A 1GHFL 1FL5B 2ZUQC 1YA5A 4P2RB 2OX5B 3MJ9A 2O30A 3ET9F 1TTGA 4FLHA 2LVCA 1G7JB 3M86A 3V0AC 2ZONA 3GBLA 4D0BB 1M05B 2OK0L 4FQ1H 2H3KA 3VTMA 3AAZA 4CUCA 1IGIH 1UM6L 2JJSA 1Y6MR 3W2DH 3C5JA 1WH0A 1J88A 4LO9A 3FAWA 2F8OA 3HJ0A 2ARJB 3OKDA 4OZFG 4FN0A 1M1XA 4PJFA 2IH1B 4WI0A 5E0QA 5B38B 1SXCA 5MI0B 3BSGA 3LNFA 2A4CA 4FABL 1MCKA 3FTSA 3KVPA 4OCRL 5HGBA 1X7QA 4IGBD 1NC4B 2JK5B 3TV8A 1AQHA 3AZUA 4G3YH 1JV2B 4V33A 1BQKA 1P5UB 4V2CB 1CK0L 1AR1D 1O0VA 1NGYB 3K7UA 3MRJA 4YPGA 3CLFL 1DQTA 3QUMB 4G8FA 3T6QC 2SODB 1G7QB 1FNSH 4K3JH 5DJ0A 4WUKH 4N0UA 3BD5A 3DVGB 2ROXA 2UY7A 1ORSA 4LKCB 4OBRA 3SBWC 1BEYH 3IJHA 5IOPB 2JLPA 3PHOA 4NWTL 3F7KA 1CS6A 2HFGL 2Y2YA 3FN9A 3F12A 3K8MA 5FW6A 2X6MA 3KCPB 1D7DA 1UM5L 2X38A 3AQZA 4OGZA 2X05A 3UMTA 1DEEA 1EEYA 4P3DA 4M6ML 5JO5B 1HCFX 1KYFA 5D7LD 2AI0H 1G7IB 3K0WA 1YMME 3FL7A 1U3HB 2YAQA 3NSDA 4ZXBB 4OCNC 4GKLA 2Y6SC 4R4BB 4UQ2B 5TE6H 1EERB 1Q94A 4JPKL 4TL5A 2V7NA 4IK7A 3W39B 4JM0A 3V79C 3RU8L 1ZTXL 3SPIA 3O6MH 2GIYA 4WO4D 1DBKH 1D5IL 1Q9KA 4FYSA 4LEBA 2G5UA 1Q9OB 3BPNB 5JYMA 3LMJH 4QPEA 3H2PA 4P57B 1UZ6F 2GAZB 5BRPA 2A99A 3B56A 4IRJA 3VXUA 1OZUA 3S3SA 1N6QH 3QORB 2YPKB 2NY7H 4Z7NE 5MERB 2OTUA 5JOPE 1MCPL 2OSYA 1VFOA 2LTQC 1XSJA 2WB7A 3BX7C 3HUJA 5EA0L 4QXGH 4BFKA 4XXWC 1I8LA 4KK9D 3W37A 3K2UL 5GRUH 1MUJA 3O6FA 5F7DA 3X17A 5I17A 1CD0A 3S8WA 1H3UA 1XCTB 3K8LA 1ZT1B 4HBQA 4X2UA 5FOJA 4X0NA 3T0WA 3VM7A 2BWIA 3Q5OA 2NY0C 3MRDB 4WAFA 1HXYA 3TF4A 3X12B 4FQ2H 3QB7C 1CGSH 3QVAA 2GJZB 4L9LC 4C56E 2NMSA 2NNCA 2KERA 3EUUA 5E4IA 4LLUA 4KKRA 5H8DA 3V5HB 2D7TH 4R4FH 3KYOA 1QFPA 4FEIA 1AD0B 1NMCB 1WBYB 1RJZA 1WFMA 1KPRB 4RGOH 3L3KA 1FL3B 4HUWB 1ZSHA 1AZVA 3CVHB 5PAZA 1MFNA 2JKTM 1MJUL 1E65A 3HS0C 3GO1L 4PLKD 3NTCH 1KCVH 4TTDD 4KXDA 2EUXA 4HPYL 4X6DB 4LCIL 4OT1H 4YSUA 1BA9A 1BHGA 2X7LB 2VITB 5HI5D 4HOXA 2AQTA 1NFKA 3UG4A 4BHUI 1R5IA 2BW4A 2EDYA 5F9OL 1LYQA 6PAZA 1QUPA 2EUVA 2DQGH 2LFGA 1I1CA 4I9WE 1MNUL 3MJ7B 2YAMA 3SKOB 3L7EB 4TUKH 2YN3A 5AW2B 1W80A 1T0NA 3BAKA 2XXFA 3HC4L 1RZJC 4N26A 3G6JF 3NCBB 1ZV5A 5K39A 3EG9A 35C8H 4PJ8A 5F71A 1P4LA 2FSDA 5ACLA 1BQHB 4OVUA 5K9JH 2BS9A 2J21A 1X9QA 1AGDB 5KJ7E 1PZ2A 3H4FA 2K3HA 2BWDA 4MMZC 4YHIA 4D7BA 1DANT 3RUGF 2P8LB 2X70B 2Y07L 2YQ2A 3AT0A 2ZTBA 2BCKA 2OTPA 3IMSA 2DWTA 3OHMB 4FNUA 1MRCH 3ARGD 3RYMA 2EIJB 4XO5A 4C56B 2XSKA 3TIEB 4R6UA 5B1KA 3K5SA 1IFRA 1ZGLP 5TPWL 1N2RB 1YPZA 2PR4L 2Y5TB 1ZLEA 1Y18B 3BGMB 3PIQB 2OXHB 4R96B 3K6SA 3LDBB 2CBPA 1D6VL 3VXNA 3ENEA 1FBIL 5GGUA 2DJSA 4ZZKA 3FW6A 1F11A 4EN2A 4PJGF 4OLYH 4ZMAT 5F7BA 4IKKA 1ZTMA 1NEPA 3CZGA 5F89B 4GW4B 3FCSA 4NC0B 5H2BA 3PP4L 5A6MA 3GKWL 4JRYA 3GK8L 3O45A 3I84A 4G70B 4JJ5A 5FM5O 5IKCB 2R1YB 3MGTA 1J9TA 5EO0A 3TT3L 2IWFA 1RUQH 3QFGA 2V8LA 3FQXB 1TKWA 1XCXA 3W3BA 2FYYB 1I9JL 1NGQH 5IT2H 4PJHF 4L4VA 1BEXA 3MFGB 4PCYA 4LSDA 2R8SH 2VDOL 1XIWD 2E9WA 2NUPB 5JXEA 4TLTA 1JUFB 4PY8I 5KYYB 4UNIA 3VXSA 2E6PA 4JFVA 1ADQL 1U8MA 4JE0A 4ZMZA 4LSSL 2IAND 2KLSA 1J11A 4OZFH 5HXMA 2P4AB 1JPFB 2A9NL 3IDXL 3QXDA 1MWAL 2NUTB 1CCZA 4XB8A 4BCXA 1ZLVH 2CJUH 2DOCA 3KLHD 3NIDB 4LSPL 3RA7H 3RL2B 3CDZB 5AZ2L 1HFUA 4LIQE 5B3SB 5IZ7A 4CAGA 1YG9A 1F18A 4ZUTA 1NLDL 2BXYA 3IXTB 5KYUB 2Z8SA 5FYKE 4IU3B 2QQLH 3DMMC 4U31A 5GJTL 2GSGB 3DX6B 3QIBD 4AIOA 5HD8C 3MRNB 2KT6A 2ZX5A 1GYAA 3PQYD 3NSYA 5IFAL 1L4IA 2CCLA 3DX8A 4MNGB 1DBJL 1ORQA 4PRHA 2VXQH 5DJ2A 4WHTB 4HWNA 1AE6L 4GSRA 5ETUA 4ELKA 2ADJB 1URZA 3B1UA 3ZSSA 1CFNA 5ABAA 2N7SA 4HK0B 2CO4A 4OGAC 1YC7A 4X7TA 3D2UD 5IVOA 2APVA 4UT6L 3GSUA 1KFAL 4L3EE 2NNRA 2Q8AH 4GQZA 4L5FE 1CT8A 4P2YA 3P9LA 2RMNA 2Y1YA 1S7UA 3O8XD 4KRPC 3UERA 4AK1A 4G80B 3GXMA 1WEJL 3D18A 3DUSA 2AJUH 1ODAA 3FNKA 4PWJA 5KVEH 3EYOB 3PAYA 5DO2C 3DV6A 3ZZLA 5IBTH 1RU9L 4MQ7B 5FUCC 5D1ZA 3FULA 3DPBB 4J2QA 5CAYB 2XRAH 3LPPA 1P4IL 4S10A 2PF6A 5AVQB 3FO0H 4ETQA 3MSPA 4XVTH 2P5WD 3CE1A 4JRFA 1YJDH 2R0ZL 3DA0A 4L1SA 3U0TA 2VQ1A 3MAWA 5EUOB 4W9GC 1TDQA 2J6EA 4W6YB 1A9EA 5IJVA 4YZFE 2H6PB 5LGYA 5I6XC 1IKOP 4F7EA 4RRPG 3IYLW 2G60L 2FX8L 1BSIA 2X1OA 1YYLL 3AXLB 3QWRD 1DL7H 1GCYA 5CP7B 5CCKH 1SUJA 4G6JH 4DGUA 1WHPA 5DSCB 4CNIB 2QGBA 1TQCB 4B60A 4KAQH 5I1KH 4XP6H 5TE7L 3ECQA 3FQWB 5EO9A 1W8EA 3BPCB 3EJYD 3IS1X 4L8BB 4PJXE 1RUKL 1C12A 4HWZB 1H8LA 2JTYA 4LCYB 3OF6D 3COOA 3B9VA 4X5RA 4R8WL 3JVGA 1IAMA 1CLYH 3UFIA 3WN5B 4ZFQA 5ICXB 3QIUC 2BSTA 2NNAA 2P7TA 3FYEB 2ZXEB 4Q6IB 5EIIA 5CEZL 5E6RB 2W07A 3EYQC 4TSAH 4R2GD 4W9LC 1GGBL 5B21A 1VCBC 3UG5A 4Z18A 4UINH 5DMKB 2DYPB 2OMUB 5E1IA 4JBSA 3DV4A 4FNPA 3AS1A 4AENB 3V6ZB 1QPPA 4CMMB 4S1DD 3ABKB 2X4QA 3UJTH 1A6WH 2VDNH 3TV3L 3TP4A 2BOBB 3GMLB 2FWLB 4YHOH 3WFBH 2ARWA 2ZE0A 4O51A 4R26L 4RGNE 3SDDC 1KJ2B 4DCQB 3FUDA 3IXAA 3ROLA 4O5LL 2GKIA 4DP1X 4HS6A 4KJYB 1QACA 4HVBA 1XF3B 2NXZC 3IGUA 1BIIA 3OV6A 1IC4H 1WFOA 4KXZH 3ZHNA 3O3BA 3ABGA 4JFEA 5E9DA 3QZPA 3VCLB 4DERA 5AAWA 5DJZB 5FYJU 4P8QA 3GHEL 4MB1A 4FFYA 4LP4A 4NKDB 5A2CA 1CLZL 1O7DC 1QYGL 4YK4B 3TEWA 5DFWH 1QBML 4M56A 5F0JB 5EZPA 1QTSA 3R7QA 2AGJH 3MRGB 2F18A 5C0RL 3RTQD 3LZLA 4RSYA 2AJSH 3O4LE 1GPOH 1FIGH 1QNZL 4S0SD 4E9TA 3AY2A 4LEXL 4XHQA 3L16A 3RGVD 5C0ND 3KMDA 3HR5B 3FJTA 4ZUWB 4XN2A 3O3AA 1L0QA 3A6CL 4PBDA 4G8GA 3P02A 1JFHA 2CO2A 3ARED 3IEAA 1OCRB 3POHA 1SLWA 3GSVB 3G5XB 2NY4B 5F7EH 3I85A 5ISZB 1UQSA 1RUMH 3F62A 3D69A 5AOJA 4P5TC 4FHBD 4EAEA 5DU7A 4ES9A 5JDJA 4IJ3C 2XFGB 3ZRSA 4RFOH 3VI4E 4XN7A 2BSRB 2FLMA 1CQYA 4Z3TA 1GZPA 1EAOA 3C9NA 4BH7B 3KVDD 4H1LA 3EW3B 4JJHA 3V0VB 2APWA 1KTCA 3BN3B 3WIFB 3PL6D 4G7YL 2YPLD 3TA3C 3GBNL 3ML8A 1TEGA 4LL4A 5I71C 3WS6C 2NXYB 5GS1B 1PY0A 4FNRA 4RGNB 1AKJA 4D3CL 1DQJA 2Y24A 3LNHA 2YS4A 1LHZA 1FL6B 1ZSDA 3EDDA 3MRLB 2XZZA 4Q56A 3WYRA 3BJLA 2BVOA 4U1MB 4APQB 7PAZA 3HFMH 2YEVB 3T2PA 4EOWL 3FSVA 1AZCA 2C8NA 4JLRA 1IMHC 2YMOA 3DSNA 3RIAF 3CFKB 3FQRB 1MVFA 4JVWA 3JV6B 4RMRA 3TYGH 4CC0A 3I6KA 1QBAA 2MNJB 3AU1B 1DN0B 2J1WA 3JUZA 1ADWA 2NY2D 4XP4H 4OF0A 2LLGA 1C5DB 2CXGA 2YD4A 5EF2A 1C16A 2K78A 3GHBL 5DJAB 4I3GA 4EO5A 1A6VH 4P2QE 4NQVA 4K5NA 1JD7A 2COVD 2XKSA 1J1PL 4OFKA 1YYCA 4OTXL 4NUMA 1GXEA 4Z7VE 3FQYA 1NIBA 1H9DA 4P9HL 4OCXL 3F05A 2E86A 1NMBH 1NMAL 2V5YA 4MQXC 4WHDA 2Z7WA 1LLAA 3KDMA 1KLUB 4HSQA 3ML9A 1XGTB 4E41A 1QLFB 3OKOB 5CMAB 5HVWA 2CO1A 2WAHA 1JSYA 3GLZA 1QFWM 1KYOJ 5CBAB 4I89A 4UTBA 1U8NA 4FLQA 4TSCH 5EHFA 3VI4B 2W59A 3QJFB 4QXWA 3ZYZA 4M5TA 1YY8B 5KYWB 4BQ6A 1TZOA 2OM5A 4C54A 5A2JH 3STZB 3VJ6B 3TBTA 1ES0A 5JHDD 1SJHA 3BDYH 4HKZB 3RKDC 1X5ZA 2Y6SD 1A6TB 5CEZD 1I9IH 4FS0A 4XMKH 3MO1B 4OD2A 2AK1H 5CCGE 1LL1A 8CGTA 4BJLA 1EEUA 1OARL 4NN5C 4FNLH 3NOIA 1XXDC 2BS71 2GQHA 5BZWA 1KUMA 4N8CL 3SGJC 1D9KA 1JF1A 5IK3B 1HZLA 1RJYA 2BSSA 1X5XA 3GSXA 4ADJA 4MLSA 4ETYA 3K71B 4RX4D 4P5MB 2JJTA 2NR6A 5TH2A 1CUOA 5JHBA 3ZVVA 3S3JA 3KLSA 3NRPA 2P43B 3W1ZA 3T0VA 3N3EA 4XVUC 1MJ7H 5IW1B 1TQUA 3B9KB 1NLBH 2X4TB 5F7MC 1SYVA 4P49A 5CN2A 3JWOL 3VTTA 5KVFL 4OJYA 4FTVB 1DBAH 1GH7A 4KZDH 1D5BA 1K3ZA 5KYXA 3LQMA 4Z0XA 2N1KA 1O9WA 5BW7A 3K3QA 2HLAA 3EO0B 4P9MH 2ZJSL 2BRRH 5GZOA 4ZG1A 3L3IB 2B59A 2K6YA 1MAJA 3BP6A 3VU2A 3OHXC 2NY0D 4UMGA 4EI6A 5E4EB 1QP1A 4NUJA 1N3NA 4Q9BA 3GQFA 4TUUA 3HW7A 4XMVA 1M71B 4LHUA 3NH7L 5ALCH 4N86A 3FYIB 3CBKB 4E9XA 1L7IL 3KGRA 4DP7X 1HU8A 4QOKE 4RDQF 3BH4A 2AEOA 3LKRB 4G5ZL 3U36A 3II1A 5J9PA 1ZLSL 4JCMA 5D9SB 1BVNT 5CLZA 4F27A 4AKPA 1NCHA 2QPFA 1M1SA 2O4EA 5E6IB 1G6RH 3CH1A 1UT9A 3BUPA 3FB8A 4HWBA 4HXAL 2LR4A 3T0EA 2Z31B 4KH9A 3ZDXE 3SPGA 3NJMA 1XWVA 3WS3B 4PVNA 2JB5H 3HUJF 3L1OH 3WU1A 4W93A 3A6BH 1MJJA 3C8HA 3OX8B 5T1KD 5L4JA 4OFYA 7FABH 3BN9C 4OI7A 2HH0H 3TWYA 2BFVH 4TSBL 1QQDA 1UCBL 2WLLA 4AYFA 1J12A 3QIWD 4HJJL 5BNXD 5AAMC 2WIIB 4KVCL 5L0QB 1XL4A 5E5RB 1F1AA 4G1EB 2WO4A 4MQTB 1S7RB 5IHLB 1NQBA 1ETZB 5BS0A 1T21B 5BV7C 2R83A 1CD1B 1I8LC 1Q0YL 3U46B 2D7QA 3MACL 2VDPB 4K94L 5DJCB 2EVJA 2WZ6A 4PRDB 1S7SA 4LZKA 1I7TA 1U4FA 3LRHA 5HHXH 2B08A 5E94A 2OK0H 1OGTB 5J11C 3T71A 5DC0A 2C9AA 4PRBB 4PP1C 1DVUA 1UM6H 1OSPL 1R34A 4I13B 4ZMWA 5C0BE 2CLRA 4ODWB 1TJHL 4YXLH 4Y2DA 5EF1A 3P9MB 4K3EH 3BGFB 1NFDB 2AABL 3BKCL 1FZJA 3CSFA 3ULVE 3L5XL 1DANU 1IBFA 4QOKB 3VGGA 4DEPC 1C8QA 2QJDA 5DUJA 5SWZA 3KE0A 1GRWA 3X2QB 3N5AA 3ESOA 5CD5C 4FABH 1FC1A 4OCRH 1CO1A 4Y19D 1OAUH 4JY6B 3RJQB 1R9FA 2GBUA 1CK0H 3MBWB 4WJ5B 1MNNA 2DH2A 3CLFH 5CLXA 4DKEH 1N6UA 3JWNE 2TAAA 3EHBD 4OGYL 3DGCR 1J0JA 3ZDXB 3L3GB 5FCUH 3PJSA 2FWOB 2YC1B 3PHQB 1PD1A 4Y7MA 2A4EA 3U30B 3TTSA 4TQIA 3RWFA 5FO8B 4ICXA 3QWOB 1UM5H 2FT8A 2ZUXA 4YQXL 2GSIB 4M6MH 3WJMA 1A2YB 3BVWA 1P9MA 2GJ6E 1A02N 4I2XE 3PRZA 4RA3A 1GYUA 4GAGH 3PWNA 4M6AA 2OMBA 3PWLA 1GJWA 3VXMD 4S0HA 1MCEA 5G2NA 4FEMA 4NQDE 4JPKH 4MJ5A 4PJ8C 3KPLB 4UBDD 1L3NA 1ZTXH 1X3DA 4ZDHA 3RVWD 4R7NA 5GJSL 5JW4N 4W68A 1T0OA 5SV4A 2ZKXA 1FNEB 1NOAA 4Z3IA 4A2HA 5KSVB 1I8IA 1OF2B 5L8LB 5C0BB 1QWHA 1MAML 3HC0A 4KWUA 3IDJA 3K6DA 2YD3A 4NNXB 3S88L 3F6IA 2PYEB 1I1AB 5L8JB 2G5BB 5EU6D 1R3HA 3ATEA 1MREL 3KCWA 4BWWA 2PXYD 1MCPH 1JWSA 3QQ3A 4NN6C 4OGAD 3UZEC 2WUBL 5IHUH 1UWGL 3K2UH 2W91A 3FF7A 4M7KL 3EJZD 2D3VA 5BUGA 3WE1A 1CDHA 4NXKA 5LLIC 2I07A 2YGNA 5C6TL 3WEOA 3PPEA 4CJ1A 3FFOA 2AZUA 1FVDB 5A2LH 5B39A 4TVUA 5DO2D 5IBLC 5HDRA 4P4KD 4JMXA 1H5BC 2DQMA 1A7NL 3QJXA 4LDCA 5K9KA 2Y0SA 1BECA 1THCA 3B3IA 1KNOB 3Q48A 4ZK8A 1XR9B 2W9DH 4JKNA 1L9OA 4LVOC 4JPWH 4AGNA 1CLOH 3X11A 3ZPDA 3CVBA 4NQCA 4ZUSB 3D4YA 4XWGL 2QADB 3TJEL 1MVUA 3EFFA 3CFMA 3S35L 2RIKA 3MDJA 4Q9RL 4LXFA 4J8RA 4OF3A 4GO6B 3VRIA 2XNAB 4OLZH 2ITCA 2VLJD 5JW4M 2M1KA 2FBJL 1VA9A 2EACA 4NQTA 4RBPK 1MJUH 4YSDA 5D2NE 4QHKJ 2YA0A 2UWEF 1NICA 2J72A 3K5RA 5ITBL 4NQDB 3MUGA 3LKNA 1HTYA 2EIEA 4W9EC 1LEGB 5I75B 4LCIH 2XN9E 1EHNA 4LCWE 4XC3L 1LJMA 2VIRB 3C12A 4I48B 2WWNA 4MJHA 5F9OH 3BUQA 2YD7A 4ZFZA 4HUVB 2QVFB 2FQEA 2YGOA 1MNUH 3D05A 3QIUD 5IW6A 5I8CB 1IC7L 3B8SA 3ESVF 3EYQD 3HC4H 4N25A 1FF5A 2QFRA 3EOBB 3MJ9L 4DOHE 1G9ML 4JN2A 3THML 1Y1UA 3PGCA 5J7CC 4YDVB 5CUSH 1JL8A 4KNUA 2R7EB 5F1NB 1M6OB 3NABL 5DRXB 1TVBA 1MIEH 4KDWA 1XAUA 2Q3ZA 3HI6L 2ZOKB 3EO9L 3FU0A 2AS5M 2Y07H 3QUXB 4TMPA 3CNKA 3DBSA 3GTTA 1FFOA 5EU3A 4EUPG 5LHDA 1NAML 1NDTA 2VZTA 2IQ9L 4MMXC 1U91B 3CC5A 4IU2A 4QXTA 4XCCL 2X0VA 4BH8B 4JG0L 4DP0X 5CEXA 1FPTL 3N0PB 5LBSA 2PTTA 4G43B 2F7IA 3LKSB 4MZ2A 5KVMC 1T22B 1JZ2A 2NY5C 3ZKND 1D6VH 4PG2A 1FBIH 1HSAA 4N28A 3IJSB 4E42A 3VFOB 3KPRA 3T65B 3MCKA 4HMCA 3ATBA 5D2NB 3ARYA 4WI3A 3PP4H 3GKWH 3M88A 3GK8H 3GBDA 1KIUB 3LAFA 2Y2WA 5IB3B 1IEAA 1T6BX 3GT6A 2NY3D 4YSAA 4EZMA 2XZAH 3DTDA 4V1DB 3KD4A 4PV9A 4F1SA 2J55A 3MLZL 2RFXB 2ENJA 2HVJB 1G4MA 3IRCA 4KXZI 3WDJA 2VDOH 3QR0A 1B4TA 1ZLWH 1IEBB 3M7FB 4MXVE 2Z7YA 5GS3A 2XA3A 3EFOB 1Z5YD 2KDGA 3LPGA 3I9GL 5IMOA 4A2EA 1BQRA 1ERNA 4JE4B 3ZUCA 5C8JB 1S6NA 4JFWA 1YEGL 3PWJB 4JFZH 4AM0A 4HC1H 2A9NH 3IDXH 4P5TD 5C97A 1MWAH 1PVHA 4ZOAA 5KSUA 1ETJA 5KSAB 4DOHB 3U7YL 3FO9B 4LSPH 2PW1A 4JZNB 3WUWB 3O0RL 5AZ2H 3SKMB 1F45A 4ODXB 4YDKL 3QO1A 4FMKA 5D96B 3QUZA 5EPMA 5IR1B 2VRAA 5HHOE 5T1LD 3ULUF 3EJPA 4A37A 3VMOA 4YLCA 1KXVC 4YDNA 5GJTH 5IVXE 4OGXL 3TASA 1G84A 4A2LA 1FRGH 4B9YA 1T1YB 3KPNB 4EJ1C 1UB6B 3BXNA 5IFAH 5ILTL 3ARDD 3MJGX 1PBYA 4G72B 3ULVF 1OGSA 1DBJH 3Q44A 5E8PA 4RIRA 4AT6B 4JCLA 3T4YA 5HYIA 4Z8FL 4RETB 1A6UL 1CB4A 1Q9LA 4QHPA 3WE6B 3ULUC 5AAWC 3CQQA 3HI1A 3WOVA 4PN6A 1JXJA 4UT6H 4YDJB 3UADA 1KFAH 4CADA 4Z7QB 2VR3A 3DRTB 1Z1WA 4LVNC 1WAEA 4X4YA 4N6RB 1YMMA 3AS2A 1WEJH 3IETA 4L29B 1KB9J 3N55A 2HLEB 3U0WL 4NQUA 3ZQWA 3RILA 2EUZA 1FN4A 1FJ1A 1YEWA 2XWEA 3QEQD 3W0WD 4Z9KB 4BK8A 1LWRA 5C07B 3RFZB 1P4IH 4IIQB 5ECGA 5TD4A 4AIZB 4ISVB 2FIKA 4KJPC 4MQXD 4R7DB 4QYOB 3V0DA 5EZLB 1N8ZB 4KQ4L 4Q8BA 3CMGA 3H9SD 4N2MA 2APBA 2QQNL 3PWPD 4PRPA 1YUHA 3HZKA 3NN8A 1PZSA 2G60H 2DM2A 4PWHA 4CMHB 3PE9A 1SEBA 4NENA 5CHNA 5DJ6B 5JMOC 5C0JB 1DVFB 3EDKA 4YHKH 1JGDB 3E6FB 4GW1B 3EOTL 4GSUA 4IBTA 4QCIA 1OSYA 1ZCRA 3HAEA 2R2BB 5CSBA 1LD9B 3V4LA 2XKNB 5TE7H 3RDJA 1JJUA 4BFRA 4G9FE 4GY4A 4PCTA 2XVLA 4HT1H 3UL4A 2AV7B 1RUKH 2YKKA 1WK0A 2ED8A 2WCSA 4X7EC 1V54B 4N0RA 1OCOB 4UTAL 4RDBA 3AWFA 4R8WH 5E6SB 4HK3J 5ANHA 4N2EA 4RESB 2J71A 32C2B 2J20A 4OB5H 1IILE 5CEZH 4KQ0A 2B4CC 1S9WB 4M7ZB 5D7JA 3CN0A 4P2AA 3BZ4B 4PRNA 4EDWL 2R2CA 4Z7OF 3P54A 4K07A 3MFFB 4YGVB 1HI6B 3APCA 1TO4A 3IMTA 1LMIA 3BGAA 1U41A 2FO4A 5TTRA 2NYKA 4L3CB 5E00B 2NSXA 1U8QA 4LMQI 3D25B 3GMMB 3VYOA 4OIBA 1NL0L 2Y23A 5I74B 3TV3H 2VO5A 3RL1A 4PGBB 4OGQC 4LSRL 3OXRA 3QO0B 1TLKA 1MF2L 3C5ZA 3CFBB 4O5LH 1DQIA 3MX0B 1GVIA 2QBWA 3BIAX 1OQOA 1T5KA 2VAAA 5IQ7L 5FGBC 3ROOA 4AZ8A 3L95A 5LNGA 1BAGA 4PS4L 4A6YB 1U92B 2R29L 3QZWB 1X44A 3GHEH 3HIZA 3O3EB 1CLZH 2MMXA 3R4RA 2CDFA 1EZUA 2VCOA 1QBMH 3H9YA 4M1DL 2GTQA 1I4FB 1TEFA 1UHVA 5C0RH 1HJBC 4JDTL 5HHQA 1WPCA 2OMYA 3QP3A 3VXPA 1WWCA 1JHTA 1QNZH 3CPLA 5BMFL 4PHXA 2K9FB 3SY0A 4H25B 4Y4FA 1F6AA 3BP4B 3ETBF 3S2CA 4ZFOL 1CGTA 4DUXA 1IGJA 3A6CH 1ETA1 1TYEB 4LEEA 5E6UB 4YBHA 3ES6B 1J9SA 1TZHA 2IG2H 4B9KC 5IFJB 4N2FA 2R15A 3CJJA 1MH5B 4J8QA 4OZHB 1GYVA 3L9RB 5FWQA 1EO7A 4JFHE 2DBLH 2DW5A 3BVTA 2FEDC 3P73A 4JGJA 4NO0A 2Z4QA 1MLBB 2GVYA 4QF1A 4RQQA 3QG6B 2XV2A 3VWKB 5JORB 4JPSA 1UACL 1WC7A 3QJVB 4FXGB 3WGUB 3M1OA 5AB2A 3NSJA 1FFRA 4PJEE 5ESQB 2W60A 1KCRL 1PNCA 1FSKB 3QG7H 4IRJD 4OFDA 4N2HA 3VXUD 3QNZA 1I8KA 3RX9A 4Z76A 5KVEE 3GBNH 4ODUB 3DURA 3FCGA 2BIQA 3RJOA 4EVNA 1VRSA 3IPEA 2AJZA 4HPOH 3FAXA 2ENQA 3PCYA 3O6FD 5FA4A 5BW7C 1RZJH 3DOHA 5IHZA 1RQ5A 5GS0D 2CH8A 2F7RA 4OZFB 4EOWH 3SE3A 3TZVA 5L2KE 4EI5A 1UZ8B 2YBRA 4GUQA 3RWEA 4LBAA 4UUJA 2XLLA 3WBDA 2C7UA 1ZLUK 3TCLA 4UV4L 3VQ1C 1VEMA 3QDJE 4EI0A 4PRAA 3UAFA 4IRZA 4LLYB 4GW5A 4HJ1A 4JQVA 4U0RB 5J6HA 5SWQA 4YHLL 1RULL 3BMVA 3JSSA 5CLYA 1BJ8A 2O6FA 4QHNA 3RBSA 3KM2A 4GP5B 2VLMD 4YHZL 4OTXH 1O9VA 1QEWB 4Q4EA 5GGSB 2DDQL 1OE1A 5DQJA 4F33A 1AG0A 4X4XA 5TK2A 4CGTA 3FPYA 2ZG1A 2ICEB 1NMAH 4ODVL 4PJ7A 5DRWB 4Y16B 1S9YA 1BAFH 2DRUA 4L4JA 3ARFB 2FJGB 5C9KA 1LEIB 2A6JA 1AD9A 3IKCB 4MNQA 5LGHH 2A9AA 1SYSB 3CFJA 1JNHA 3O11B 3E3QE 5C0CB 3D1MC 3D4GA 1GZHA 2PWDA 5DVPA 4H40A 4OKVB 3PAVA 1KLFA 1QA9B 1H8OA 4HOMA 1AGFA 2DL2A 5IB2A 4W9CC 1D6EB 1I31A 1PYWA 2IBBA 4NRYA 4BYHA 4F8NA 2MIZA 4JB9L 4XPFL 1WITA 4L3EA 2XBDA 2A73B 1KBBA 2AJYL 1E5YA 5EBWA 4M61A 4IBZA 1N0LB 1VEOA 3MROA 5DFTA 3S4SA 2OI9B 5C09B 1Y1DA 4PJ8D 2H0JA 2XJKA 1RIVL 3WO3B 4DTGL 1OARH 4PJ6A 3WTYA 3QDGA 1F86A 3DOIA 3P3SA 4N8CH 5D4QA 2F58L 4BXSV 5F1IA 2CK2A 2DWEA 4UCFA 4X80L 4UNUA 1I3VA 5MEQA 4ABQA 1E9QB 4E9YA 2AEIT 1JFQL 2YR3A 1ZEAL 2IXQB 5CGMA 5EN2A 4LB8A 2VZVA 5IBUG 3QDJB 3T3ME 2HUEA 4XR8C 1T89A 2VRKA 4WVRA 3GJFA 5KSBE 2Z6FA 3N0AA 4DIXA 2XG4B 4LNVA 3IDUA 3WTXA 3QRLA 3MV8E 3KGUA 3T3PB 3RPKA 4P99A 3L5WB 1SY6A 4OW6A 1R46A 2YEZB 4MS8C 1ONQB 2DKMA 2ZJSH 5F9AC 1F13A 4NEHB 1AOZA 4JRYD 1CFSA 3P11L 2TRYA 1J8HA 3PWVB 4PJXA 1EXUB 5IBLD 1CR9H 1XGRA 1G9NC 3NJGA 1I8UA 3ULSA 5I1DB 4LOUC 1U8PA 3IK2A 2YMXL 1H6FA 3SDCC 1LVEA 2DQIH 3NH7H 4LHJB 2JKRM 4L4VD 5B7FA 1DLHB 3X3GL 1WF5A 4FFZA 5FAAA 4PCSA 4BKTC 5JXED 5MEOA 4GB9A 43C9A 3G7TA 3VXSD 3VVVA 1T04B 4KQ3H 4MJ6B 5DQ9A 1JK9A 3VGBA 4G5ZH 4WFFE 3OLGA 1U8IA 2VDNB 4X9FA 2CZNA 4XP1L 4NI6A 3P30L 4LFHD 4W9FC 4FD0A 1PFOA 4CVZA 2BSCA 1BMZA 1EJ6A 4JPIB 4HXAH 4FQXB 1KPVA 7PCYA 2GITB 1IGFL 4WF7A 3P9WB 3B3BA 4L4TE 1H3PL 2ZPKL 4CVWA 5D72L 2J57A 2GUOA 4KXAA 4PYHA 3VFNB 5CXPA 1HHGB 2QMJA 3A0OA 4DVBB 1BLIA 2FAUA 4NRXA 4AC4A 2EYRA 3IGAB 2DD8L 5E8DL 1JP5A 1UOLA 5IVZA 3U2SA 1E90A 5AB9A 3QJHA 4HJJH 3T3MB 2Y69B 2DWDB 1J1OL 5MHSD 1CPUA 3UAAA 4NFBA 1HT6A 1N70A 4Y4KB 5C08B 4NT6B 3ULAB 2NW3B 2W92A 1U2HA 1P4BH 1WSST 3ZIMA 3CZJA 1A4JA 4X5WB 4BFBD 3VRLF 3O4LA 4XPBL 3AACA 1Q0YH 3L7FB 2JKNA 3NP3A 3VWJC 5D7IF 2VYRE 1W16A 3MACH 1PDKB 4M43H 1RHHA 1SNRA 4NQQA 4DW2L 5BPPA 1F4XL 1DVQA 1UFUA 2IAMA 1MEXL 4QO1A 1OTSC 1MCDA 2YQBA 4FE9A 2R2HA 3VVWA 1JXGA 3WFEL 4AMWA 2QKIB 2C9SA 4PG9A 5T3XD 4H26B 3M1BA 5J89A 3AGVA 3N06B 5KZCD 2HVKB 4FOMA 2AABH 1LEKA 3S36X 1V27A 3OR6A 1PSKH 5DMYA 2GI0A 2IVFC 4O2FA 4R4NC 3S8GB 2NDFA 3T77B 1KJMB 1FLRL 1N5AB 4KKAC 4CU6A 3BSHA 4LMQE 4KI5D 4P46B 2I9TB 1T83A 4AITA 1XSIA 3FTYA 5F7NC 1NBYB 4RDQG 3ZE0B 4PY8J 1RH8A 3T4AA 1NCAH 4PY7A 1H19A 3L3JA 1ML0A 2XTJC 3V4VL 2UYLB 4W4OC 5D7LE 5I1CL 5IIEA 1R5WA 4NO5A 3B6SA