5KTEH

Crystal structure of deinococcus radiodurans mnth, an nramp-family transition metal transporter
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
213
structure length
211
Chain Sequence
QVQLTESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLVVIWSDGSTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAREPPYGYWGQGTTLTVSSAKTTPPSVYPLAPGCTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein/immune system
molecule keywords Divalent metal cation transporter MntH
publication title Crystal Structure and Conformational Change Mechanism of a Bacterial Nramp-Family Divalent Metal Transporter.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 24
structure length 211
sequence length 213
ec nomenclature
pdb deposition date 2016-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kteH02
1DEDA 2VSCA 4ZTOH 4IBLT 5EPMB 3LEXA 4N0UA 2VWEE 5LXGH 1YMMD 5SV4A 5GRXG 4OI7A 2EDDA 3OZ9L 2E7LC 3V6FA 3GSQB 1RFDL 1YN7B 2VSDA 3QUYB 3UYPA 5EN2B 1OHQA 2OR8A 1AGBA 1FFQA 2GJ6B 4NC1E 3GMMA 3MBEB 3U6RA 3GSWB 1PQZB 7CGTA 1HHJA 2X4PB 2UYLB 5K9OB 4X7CC 2PW2A 3U9PL 4MDJA 4UU9A 2FSEA 3QNYA 2YD4A 5DHYB 3GSXA 4YXKH 1GGYA 2O61B 2CLZA 3DUHA 4I9WE 1FJ1A 5DHVH 5IFJA 3B5TA 2PYED 1TTUA 5GS1C 4F9LC 3RBGA 1UJ3A 3VXTB 2BSRA 4D9QD 5LGHH 3EOBA 2UWEF 3EYUH 3G5XB 5DYOA 2RCSL 5IUSA 3LKRB 3QCUH 2ZUYA 1H3WM 1S9YA 1Q9KB 4Z77B 4XNMB 4BZYA 2HJLA 4Y16A 2ZSVA 1EEZA 1IJ9A 1E4XI 5CS7A 4GMSL 5GGVH 1JI1A 2CO6B 1HNGA 2A77H 5FO9A 4P59L 2X7LB 2KQMA 1O7VA 1FL3B 1EMTH 4HMEA 3AAZA 3HHRB 3CSBA 4OI8A 4UQ2B 1GVIA 2CKBB 4M7JH 3AC0A 4JZNB 3CUPB 1RMFL 3P4MA 4LAQL 2VXQL 4IS6B 5CSZB 1DBKL 3C08H 4X4ME 5DC9B 4JDVA 3O9WC 2VWEC 3LD8C 3EYOA 1KOAA 4TUJB 3NFPB 3W5MA 1NLBH 2HH0L 3LDBC 2DM2A 3PDOA 4NM4L 1ERNA 3KAAA 1HEZA 3EJYC 5HJ3B 5EBLA 3SDDB 1KJ2B 2VAJA 3T0ED 4DVRH 1U0QA 4HF5H 3HC0B 2HVJB 1QVOB 1P53A 4AL8H 3ZDXF 3GJFH 5DRNA 4Z0XB 1FYTE 2C9AA 3V5HB 5IQ9A 1OAXH 3GKWH 1ACYL 5F71A 5HVGB 2J8OA 1QPPA 1V7ML 2CLRA 3O3DA 1D5MB 4QGTA 1N8ZB 2VZOA 4I48B 1WAAE 5JOPE 2YUVA 3WFEL 1JRHH 3UTZA 3LV3B 5I15H 4MA8L 3A0OA 5TFSH 3WXWH 4MX7A 3UJIH 1MRCL 3B4NA 4PJHB 1QQDA 4Z95H 4PFEA 3HAEB 5T1LD 5INDA 1D5BA 1KLGA 4HIXH 2AK4A 5F89A 4YHOH 1WFUA 4PB9H 1U93B 4WO4C 3S35X 2Y06H 4JY4A 1YA5A 5FKAB 3FB6A 4O2FA 4K8RC 1T5WA 5E2WL 3BKJL 2FJFB 1XF2A 2VZUA 3QDGA 1YEGH 3HPLA 4EOWL 1IGYA 3MRKB 4FN0A 1A6VH 4XB8A 4XNYL 1X44A 4PBXA 3FZUD 1G7PB 3O6KH 3TFKC 5K59F 4RAVA 3LEYL 2QV2A 3NCYP 3FFDB 3LN4A 2HN7B 5T5FL 5I76A 4KGJA 1GPOH 3DROA 3CZFB 3V0VB 4HQQL 3OX8B 3PP4L 1LDSA 3R8BB 5F7DA 2EZ0C 4M8QB 3TT3L 1D9KC 4H0GA 1TTFA 4NPYB 2WUCH 4HWBL 4PJ9A 5JUEH 3VMOA 1D5XB 3RZCC 2HTLC 5IESH 3RNQB 2VLJD 3B9KD 5SWZE 3MRLB 1UADC 4CBPA 3QUYC 2CRZA 4ZNEA 1CXKA 4OCXH 3MNVB 5INCB 4R4BA 4N9GB 1MHCA 1YECH 2ZCLL 3DUSB 4RRPA 3DX6A 2Z8RA 1LDPL 1BMGA 5CILH 1VACB 5KVFH 1A4KA 5HYFA 4KQ3L 3MLYH 4WV1A 2BNRD 1FL5B 2JCCB 4FZ8L 4BUHA 1G6RA 3BRGC 4Y1AB 4FXGB 4X9BA 2NYYD 2CXKA 3ILQD 3L3DB 1UH4A 3MLVL 5CIPH 4HWUA 3HNTL 4KTEL 2H6PB 4M1CC 2NTSP 1BFTA 1N2RB 4JGMA 2WNGA 5F88A 4XC3L 4GXVL 4POZD 4RMTA 4FQXD 4KK5D 5DK0A 5BQ7B 3BGMB 1EO7A 3VXPB 2EDWA 4MXWH 2VZ1A 1TENA 2CJUH 5C2BL 2VISA 3M8OL 5HI3D 4PJ5E 4QYOA 4OLWL 1Y6MR 1P7QB 1GIGH 1EVTC 1EXUA 3HN3A 4FFZL 4YIQA 5E8OB 2NTFB 5BV7B 3D39D 4RA3A 5D9SA 3MSPA 3QG7L 5ITBH 2NLJB 2X9YA 1MCSA 4QTHB 5EO1A 4WHYH 2VTFA 4XNQA 3SO3C 3VFNA 3X3FL 1BX2A 1OY3B 4CU6A 3FO9B 3TESA 1R5IA 4HLJA 1RULL 4WEUD 5I1JL 5MP6L 1JZ2A 5HHNB 4KI5E 4NWTH 1QD0A 1AD0A 1ZLWK 5TDNA 1FFNA 1GGCH 2B4CC 2VLME 4KTYA 3OAZK 4TVPD 4PTTB 3EOYG 3DX8A 5E9DA 3KYMA 4K3JH 3QIUA 3VWJB 1U8NA 5E70A 1MFNA 1XR8B 2X1PA 2DTML 4RQQB 4XH2A 2A0LC 4NGHL 2BHUA 5GZOC 1QR4A 3I3DA 4NN5C 5C3LD 5EA0L 5DUMH 2OSLB 2WWMC 2WIMA 5DFWH 1U8PA 3SCMA 3CLFL 4P9HC 1WTGT 3KYKH 3FQNB 5IHUH 2FD6H 1HDMB 3WE6B 2FH8A 4LLYB 1AJ7L 2VXSH 1YY9C 4E9LA 4EDWH 3X11B 1KCRL 1QTYT 3DETC 3QG6A 5I1KL 2X4SB 5HDBF 3SGKC 4P9ML 1FC1A 4HKZA 3U30B 3N1MC 3R06B 1Z3GH 3VFPA 4M5ZH 2AJUL 3G08A 3HAEG 5I73C 3IGAB 1FLTX 1JWMB 2FX7H 1BZQK 3DVIA 2AJZA 3FQUA 4NQSA 1C7SA 5CJQH 4HGMA 1RU9H 1NH6A 2OL3L 4KDTC 4UT6H 4U6XA 3MBXL 4HUVB 3ARBA 4G7VL 3L3GA 4HKBA 1NL0H 4J12A 3MR9B 2CDFA 4LLUB 5C0JB 3QDAA 3HC3H 4OCWL 4P2YA 4XHJC 2DMCA 4QXTB 1JHTB 5IEKA 1JVKA 5CP3A 5D7LA 3KNBB 5ANMB 4KI5C 1SJEB 3MRRB 5L6YH 4U1LB 1OB1B 2R0LL 3MCLH 4QHLB 4RGNC 4YBQD 2P5WD 4FTVD 3IAQA 1MVUB 1DQMH 3N1GC 4P4KB 4JEGB 4L4VE 4NHUB 1R6VA 3P0VL 3OPZL 4QKXB 2MTPA 4ZO8A 3BP4B 5IW3A 4Q74A 3ZDYE 2IH1A 4WFHE 3SDCB 4OLUL 1L7TH 3FN9A 4M7KL 1RIUL 4GO6B 1JF1A 2CLVA 4DKFL 5C09D 5DTFA 4WFGD 3DURB 4KKCC 2KUTA 3FAWA 2F5AH 3MRGB 3ARDD 4JY6A 3VCLB 1T6VN 3ZDZF 2BXYA 5T1MA 1VFOA 1ZS8B 5IMKA 2BVPA 4LSUL 1FIGH 5FM5O 4RFOH 1TVBA 2J8UF 2IFFL 1G0YR 2X70B 4PJFE 3AY4C 4LIQH 3ARSA 3S37H 2ITCB 1W72L 3RX7A 1UQSA 1EGJL 4WU5B 1G9MH 3NN8A 2VL4A 2RR3A 3TBVB 1FO0L 1S5IL 3BP5A 3TYFA 1A4JA 4HX1B 5FO7A 1TJGL 4YDJA 3WN5C 2Y6SD 3KYAA 1PFCA 1RJLB 2EYTA 4D0CB 2AW2A 4KTDH 1A0QH 2JELH 2XG4A 3MOAH 3IFOA 2VAAB 3U48A 1PG7W 4WI7A 4C58B 1BD2D 5IWLC 3PIQA 5EOQL 1LP9F 1NBQA 3DGGA 3IJYB 2C4XA 4IRJC 2NY7L 4XXDB 2ZOLB 2VDPH 4LDEB 1TQCC 7FABH 1FZMA 2GT9A 1HKLL 1ZV5A 3D48R 5IHZB 4F7CA 2RIKA 4G8FA 1OWWA 5ISZB 4LCWB 4HBCH 3WIIL 4BQ8A 1A47A 35C8H 4BYHA 5AYQA 2AXHA 2BVQB 3JUZA 1HINH 5D6CA 4EZMA 1IAOB 3DXAD 4PJIE 5EU4A 3S88L 4ZO7A 1KLUA 5J57B 1YEKH 4U4BA 4CKVX 1DANU 3I02B 4CN1A 5IFHH 3KXFE 2Z8SA 3D3VD 2H2SD 1J86A 2AI0H 4U1SA 4L4TE 4N0YH 2V7HB 5DD1L 1VGKB 3ZKMD 2WINB 1QR1B 1KPUA 5E99L 4K94H 4DK3A 4HS3B 5IBLC 1IGML 2EH8H 2EDHA 3WIHH 1RZKH 1GZPA 1EJOH 4QRTB 5D2NC 4B7IA 2WBJC 4FG6C 2ZP0T 5BJTA 4GRLD 3SDAC 5E8PB 1H15A 4M6NL 5BMFH 1M05B 3RWCA 2AJXL 3DHJA 4M1GL 4MNQB 2A9MH 2CMRL 3GB7B 1QHOA 4ONGH 4ORGB 5C0BA 5TE6L 5I8CB 2VB5A 4Z7QE 3O8XD 4YHNB 1JGVH 4PGBA 4H20L 3SDXA 2FO4A 1ZWIB 1FG2A 4G5ZH 3MLWL 1WGOA 4X5WA 2IPUK 3PHOB 3TF7C 2F74A 4HUXA 4OCRH 1MFBH 3MOQA 2IADB 4CMMB 3PQYB 4NDMB 1AR1C 2LE9A 2QADB 3KPQB 1IM9D 5DFVD 3X17A 4JFDE 2VIRA 1OP9A 4NBYB 1CZ8H 3LB6D 1JFQH 3A6CH 3GI8H 5FA3A 3RI5F 1XZ0A 3WKNA 1I1RA 4Z7WB 3TT1L 5HHMD 3CSYA 3FT2B 1PZUB 5CLTA 2DS4A 1QG3A 3FFCA 4AEHL 2UZIL 4NM8L 3G04A 3RAJL 3IJSA 1GGUA 4WUUD 2VXUH 3C5SA 4FQLH 2PNDA 3R0MA 3BT2L 3CFJA 5GXBB 5I8KH 3VRLF 4OUUA 2BNQE 3RTQA 1Q94B 2AV7B 2BY3A 4ODTH 1MCOH 5BVJA 2PETA 5DRXB 5F3HA 3QIBD 1KNOB 3MV7A 1CL7L 3L7FA 2B2XL 1GGIL 5C0EA 5IKCB 4M61A 3G6DH 4G9FA 4JHAH 1OP5H 4A6YL 1KXQE 2XQYK 1ZA3B 4H26B 3VFSA 1SY6L 4JANB 3DVFA 4NQXA 3W11D 5I0ZA 1GZQB 3QEUA 3EDFA 3VFVA 3UYRH 4KMLB 4AQOA 3K74B 3JV5A 3CSGA 3U4EB 4I4WB 4PJAA 5T1KA 3OR7A 1AP2A 1CF8H 1NFDE 2MJWA 3P11L 4O9HL 3L5IA 2AEPL 2YD8A 2HFFB 1KIQB 4TNWK 4EI5A 5LWYL 3X14B 3P4NB 4IRSC 3L3HB 4HDIA 4UT9L 2DI7A 4Y5VC 4HIEB 3KDMB 1I8KB 2V2XB 4PJ8D 2GSGA 2B5IB 2EC9U 2GEEA 3C2AL 1OF2B 4JDZB 4PJBE 5HYJD 2DQDL 3GSVB 4R7NB 2W9DH 1JUFB 3QUXD 2YA2A 2HJFB 1XIWD 1PSKH 3C9NA 4OT1H 3MXVH 2DWDB 5K9QI 3DMMC 4FFWC 4L3EB 1S7XB 5GGSY 5F6IC 5C7XL 1DUYA 2CIKB 1T5XB 4JM2F 4KKBC 1UB6B 3QEQA 1VFUA 4HPYH 1A9BB 3TBWA 3MOBH 4K2UH 5HHXH 4M93B 1ZLSH 3U0TB 5H37G 4NQDA 1H8NA 4JZJB 1MH5B 4CMHB 1M6OB 4U3HA 4JM4L 4KUCD 4I77H 4Q9BA 4HFUL 5JHDB 1JV5A 5IR1B 2HWZH 4GSDL 3TA3C 3U4BL 4XTRD 4MXQD 3GMOA 1RZFH 1AHWA 1T83A 3LKSA 5TQ2L 1NUFA 1WQVT 1DUZB 1Z9SA 5B4MC 4YHYB 4WCYL 4EN3D 1JZ6A 5IM7A 5I8EB 3QUMH 4NO3B 2EKSA 1VPOL 1BOGB 1RJZB 2CR6A 3WFDL 1AC0A 3VFWB 5ESAB 4U3XA 5HHPA 5FV2A 4PR5A 4JY5H 4P48A 3UTOA 1QRNE 5I1EH 5IHBA 2AJVL 4G8GB 3B8YA 5J11B 4ELMF 2W60B 2Q1EA 1X4YA 3HB3D 4RDQG 1LMKA 3TV3L 1U95B 4GH7B 3M07A 2H1PH 1H3UA 1A14H 1X5YA 4LSQH 5E6YA 2XRAH 4MLIA 4JO4H 5EOCH 3HRZB 3C09C 2PN5A 1H5BA 4PV9A 3G5YB 1I7TA 4WI6A 4R96B 2XZAL 5I6XC 1GRWA 3L6FA 3V6ZA 2X4UB 5L2KB 3V8OA 1H3TA 5IMOB 2AAVA 3OAUH 3EUUA 4PLJC 3DUUB 3GGWB 4JFFA 4QNPE 2H3NB 1HHIB 1I1AA 1FVCA 1KC5H 3HRPA 2WP3O 4GG6F 1A5FH 4WU7B 4Q97A 2AJYL 4XP4H 4ESKA 4RBPH 1MY7A 5MHSE 1EFXD 1G7LA 3GIZH 2VLRE 5DLML 5ENWB 3P0GB 1T4KA 2JJTC 4OFPA 5JQ6H 3GMLB 4KJWC 5IB1A 3VXMB 1CICD 1S3KL 5ETUB 4U6VH 5IFAL 3MRCA 1RUAH 1C16B 2WSKA 1QLRA 1J1PL 5E6ID 4EEEA 2NXYB 4XCNB 2YPLD 2B1HH 5EZIH 4CRPA 5GS3A 1RVFL 4JR9L 5JW5A 1JP5A 1T89C 1IEHA 2K1MA 4MJ6A 3DIFB 1W8NA 4G6AD 5FYKL 3MCKA 3FO0H 1I7RB 3DX9A 3NCJL 5ABDE 4P2OA 1ZHBB 5JO5A 3CFDB 5A2LH 5E2UL 5I1HH 5E8EA 3DV6B 5BVPL 3EFDL 1JE6A 3MRIA 3MUGA 3ES6B 3VFMB 3RL1A 1BVZA 5GJTH 5D96B 4PP1C 3HI6H 4LQ1A 1KJVA 4JB9H 1R3KB 5D2LE 1SJHA 2QQQA 1NAKH 1PYWB 2XZCH 4GXUN 2FHBA 5E94B 3SOBL 3P73B 2FBJL 3VFOB 5DJ2A 1SEQL 4O2EA 1R3LA 2HJKB 2H32H 3H9SE 4Q6IA 3SJVE 5CGTA 6FABH 4ZDHB 3RWHB 3SKMB 1D5IH 5HYQB 1CBVL 1RZIB 5MENB 3QHZL 4MGXA 4M43L 2R56L 5DRZA 3LPFA 1VFAB 4M1DH 3GI9H 5KN5B 4OLEA 3MRQB 2DF3A 5JA9A 2BNRA 4FP8H 3QAZB 4ZFFA 3REVB 2OM5A 4OD2A 5BZWB 1AO7D 1UM5H 2AXFA 3RA7H 1E28A 5IB3B 3K8MA 2A1WH 2VDQL 3P0YH 5FHAL 2ADFH 2EH7H 2ZPKL 3P9WB 5D1ZA 1I7ZB 5CJBA 1DE4A 5EBWA 4JREC 4HBQA 2OL3B 5JIIA 1WIOA 4OTXH 3L5JA 2Q87A 1HHGA 4D9LL 4EBQL 4PRAB 1NC4B 3VD9A 3O6LH 4P2QA 2C4FT 3L5WA 1ONQA 1DP0A 3QWQB 1K8DB 5AZEH 3PGFH 2JB5H 1KBGL 1E27A 1G9NL 3BQUD 5SWZD 1EEQA 2VJXA 5IVXE 5IMLA 3QQ3B 3D39A 3CFCL 4ACPA 2IPKB 2W1NA 3S3PA 2X1QA 4QRRE 4OD1H 3ULUC 5HBBA 4G3YL 1MHPL 4PUBH 1YEHL 5FDYA 4M3KB 1YEIH 5E1AB 1OD9A 1W0WA 3RWEB 3BRDA 5IHLB 2J6EH 1HSAB 5IOPA 1JGUL 3BDXA 5B3JE 1S5HA 1DVFC 2APWA 1GGBH 4R8WL 2DD8L 3QDMB 3BMVA 3EJJX 5HHOE 4YJZL 4U6YB 5DMJB 3Q5TA 1MJ8H 5JORB 1OARH 4PTUB 1AQKL 4L1DA 4YHZL 3IJHB 4GAFB 2H8PB 1LK2B 2ZOKA 1OM3L 4LSSL 1D5ZA 4QRSB 5H35B 3TO4C 3SY0B 3OKKB 3MFGB 4J3OC 3RY6C 2BFVH 1FIEA 2YR3A 2BJMH 5KSUB 4PJ5D 1B0WA 1ACZA 2GCYB 1W72B 4P2CG 5E1HB 5FUCE 1QBLH 1C5BH 2RFXA 5BOPA 1AGFA 1IE5A 1FO0B 3PNWA 4IOFC 5FF6B 3KPPA 2WQ8A 2PYEB 3PWLA 4C56B 4KMTH 2CKBH 2Q8BH 5EU5B 5DS8B 3ROLB 5DD0L 3UCRA 2NX5B 5J3HC 1I3RA 3MV9E 5JW3H 1YDPA 3KWWB 2BK8A 4I0PD 1DQLH 5FAAA 4XPGL 2R9HD 3G6JA 2VH5L 2HKHL 4HV8B 5M94B 1SMOA 3JVGA 4UTBH 3QRGH 5I17A 4J3VA 2OP4L 1A9EB 3ZT5A 1FH5L 5LCVH 3K3QA 1KJ2H 5KG9B 4OQ1A 3T4YA 3UPRA 5K9JL 4UTAL 4KROD 5DDHB 5DMIH 3IETA 1C8PA 4MA7H 4GW1B 1Y18A 5DJ8B 5CZXD 3F6IA 3GBML 3V4PL 3SPVA 2VQ1A 4ZUTA 3DRQA 1YEJL 1OAKL 3QCTH 2M2DA 4HIHB 1T66C 4YHKL 1CFTB 3R8QA 2E6QA 2E7MA 5JXAH 1QP1A 4P9HH 3OXSB 2R0KH 4S1SL 3HAEH 5AAWA 4HXAH 5BRZB 3T0EB 1Q9WB 5I75B 3MRNA 3HPJA 3H0TA 3F8UB 3WFCH 2V9QA 1F3JB 1PKQE 1WEJH 4ENEC 1OAYH 4ZUUB 2W9EL 4LASL 3TO2B 4DJMA 1LE9A 2OXGA 3AREA 2QQLH 1T1WA 2A83B 3W0WE 4PB0L 1MJ7H 4OZIE 1S8DB 4OLZL 5B8CB 2O5XL 3TBSB 4MD0B 1I9IH 1K8IA 5D7KD 1MCQA 2P8MA 2CK0L 2H41A 4OIIL 1MCKA 4DZ8A 4YHLH 3QI9A 2YD6A 4PJGF 5JOFB 4K55A 2EXWD 4R4FH 4JQVA 5KANI 2IEPA 2YD9A 3VXRE 1OW0C 5JNYB 1HH9B 2IJ0C 3KYOA 3UEZA 1YNKL 4UIKH 1DZBA 3I9GL 1TPXB 3NFSL 4PJ7E 4AMKH 4GRMB 1F4XL 3LS4H 4HUUA 2DDQH 1QSEE 4ONOA 4R26H 4X6DB 5F93C 3KPRD 3RY5A 3VFUA 1BZ9A 5KSAD 2R1XA 4L4VD 3DECA 3VI3E 4CJ0A 2D7NA 1IMHC 1INEH 1NPUA 3UBXA 4HH9B 3UXFA 3FQXB 1BD2A 4WFHD 4QRUA 4S2SA 5DWUL 3UBXI 4GKSB 25C8H 2XKNA 5IW6A 3QEHB 1AFVL 1OT2A 4NHCL 3T08A 1KTDB 1Q72H 1TJIH 4OZ4A 4P23A 4QGYA 3VXSA 1A7BA 5EOTB 5D71H 4LSPL 4NNYB 5CJOL 1AXSA 3EYVA 4PRIA 1IKNA 1NCAH 1P4LB 2QLVB 3C8HA 2VLJB 3B9KB 2VABA 4FQJL 1F90L 1TQBC 3QO1B 1UENA 4YE4L 5I19L 5F3BA 4G6MH 3EAKA 4MA1B 4LP5A 2W91A 3O81A 3RX5A 3F5WA 1U3ZA 3FMGH 5CD3B 5F7NC 4PJDB 4PREA 2AABH 2DQHL 5JIKA 3D3VA 2LFGA 4A6YB 2XY2A 3ZL4L 3D2UA 1WCQA 2A74B 4ONFL 3BD4A 4XP1L 2NXZD 3GZKA 3T1WA 4AYFA 4DOHE 1T03H 1EEYB 5BV7H 4QRQA 2HAZA 3MNZA 2IAMD 3HUJE 1CU4L 1G7JA 2NR6D 2EYRB 1TJHH 4NZRL 4GRLA 3VRIA 4FQXB 1ORSB 1J8HA 4YWGH 1QFUL 2MKWA 2JJSC 4MNGA 4AH2A 5GJSL 2M1KA 4LCCC 3P9LB 2GSIB 4HIJB 3WDIA 2E8YA 4YBHA 4KKLD 4WTWA 3TC9A 1KCVH 5KZCD 4Y4KD 4GRWB 5FYLH 3ROOB 4EQ3A 2EIBA 4ETYA 3EGSB 3B8SA 3EYSH 5TE4H 1NC2B 4P57B 3ZTJH 1OQXA 1PGRB 1GAFH 4TOYH 1F2QA 4GKZA 4OZFB 4NP4L 5D93C 5E24E 4V1DE 1KB5L 3CH8A 5JDSA 4CVXA 3GK8L 5AYUL 3OSKA 1E0OB 5FA4B 2D03H 4Z7NE 1EHAA 5J0BA 3SDYL 3W9EB 3QZWB 2FJGA 2EDQA 3OJ2C 4I18C 1HOCB 3CMOH 4OFIA 4WDIB 3QIWC 3CCHB 3TVMC 1H8OA 2FLBT 5FM5M 1BM3H 1E4JA 2OJZL 4WUUA 4KV5F 2MSPA 5E8DL 2DIAA 3LAFA 3QFJA 2DMKA 4D8PA 3T2NH 4Z7VE 1I8LC 1FE8L 3CMGA 2D7PA 2PTTB 3IDYB 4F80A 4OGYH 5B8CC 3HMWL 5CWSB 3GMNA 1SYVB 3T0VA 5DQDH 4M3JA 5IIEB 1TZGL 2R2HB 4OGXL 4RZCB 5IVOA 1OGAD 4BFBD 4WI2A 4N1HB 1IVLA 4OCSL 3RKPA 3IDJA 4Y4HC 4BJLA 1LEIA 4ZAKC 4LVEA 4YFLI 5F44A 4QTIL 3K2MC 4D3CL 1U3HB 3KPLB 1ZHNB 2N1KA 5E56A 4NZUH 4YDVB 5D5ME 5T3XH 1E4WH 1S9XB 2XIDA 1RZ8A 1YNLH 4MZ3A 4BH8A 4JFOA 1FBIL 3UTPE 1MI5B 3TZVA 3BO8B 2VDKH 3VH8A 1MREL 4F2MA 3F7PC 3O41A 2BNQD 3RWDB 3X13B 4R4NC 3GHBL 3TJEH 3MJ9L 1L6XA 2E27H 1MELA 2F54D 1IGIL 5HYJA 2XWBB 5F97E 5CEZE 3QUXA 2YD1A 3RVUD 3S36X 3FOLB 2Z35B 1NCCH 3Q5OA 2P5WB 4K71C 5IF0A 3MGTA 4H1LB 1XGUB 4FMFA 3DRTB 3KPSA 1ND0B 1P7KB 2G75B 4UILL 2UUDK 3N50A 5A16B 1UYWH 4CNIB 3OKEB 3RWJB 4DN4H 3NABH 3BX7C 4KHXL 3S96B 3BEWB 4NNXB 4AIOA 4LSTH 3B5GA 2P8PA 1XGYH 4PGCB 3KLSA 4HKXB 4NQCA 4LAJH 2BVUA 5HYEA 1MRFL 2ZSWA 3PXHA 1ZEAL 3AB0B 1M7XA 4G8EB 5E08L 2I9TB 1BHGA 3BE1H 1ZHLA 4KK9C 5IMMB 4GBXA 2R4RH 4N8VB 4OIAA 1NLDH 2FO1A 3V7AG 5IT2L 4PP2B 5LKNA 3O4LB 5DVOA 5C0GB 4YDLB 4HK0A 5I1GH 2EICA 4ISVB 4YQXL 1G7IB 1S78D 4EI6A 1HYSC 4KXZH 4EN3A 1XCTB 4IIQB 1Q9OB 2QEJA 3IFLL 4L9LA 1N7MH 3JWOH 4M48H 2DTSA 3UJTL 1LO4H 4FQIL 2P48B 5JA8B 4D9RD 3IT8D 3QQ9D 4YBLB 1CGYA 2AEQH 3RP1A 4Z7UF 1NBVL 4LCYB 3WDJA 5H37H 4PJHE 1CE6B 1QRKA 4TSBH 4JKMA 5CGYC 4HKJB 4LQFH 4NO2A 1ROWA 1CG9B 4XWGL 3K1DA 2NW3A 3BKMH 4QHKI 5IG7A 5F6HJ 4OBRA 1E6OH 2NY1D 2J8HA 2OMBA 2CK2A 4IRZL 4RIRB 2OR9H 2PXYA 4LLAA 4GG8A 1BEYL 3C8KA 4L5FH 4G7YL 5DMKB 4C55A 3RJQB 3V4UH 3VD5A 5DUBA 5FOBB 5LGJB 2BVOA 3MGOB 2J88L 1J11A 2OCFD 4LPYA 4NRYA 2XZQL 1KJMA 3E8UL 5C3TA 5KSVA 4DQOH 2IPTH 1NBYB 3JWDH 4TUOB 1KELL 3KLHC 1A2YB 1DQQB 1I85A 3SBWC 4ERSH 5CUSL 5DEFB 5CHNB 3F58L 4JKPH 1QSFD 3DXAB 3IDGB 3ZKNC 3PL6A 4Y5YA 4KY1L 3C5JB 4AEFA 3QZWG 1DBML 4YAQB 1FLRL 3S35L 2V2WB 1IQWL 4KJYA 2NZ9C 1P4BL 4WW2A 3MRDA 4Y4FA 4ZXBD 1QRND 1EFXA 1N5YL 4YDIH 3ULVH 3LQAH 5IBUG 2VLKD 4L8SC 1UWGH 4D94A 1AGBB 1MHEB 1DTUA 1LO3L 5JHLH 1NGXA 2J5LC 5KVGH 3UDWA 3WL9A 3TCLB 3ARGD 1QA9B 1G1YA 4K07A 1X4XA 4JQIL 4D0BA 3MLZL 1RY7B 4GKNB 4JFQB 1MFEL 4LNRA 1NDGA 1GC1C 4NKIH 1XGTB 3LKQA 3OZ9H 5D1QB 1RFDH 5MEQA 4ELKB 1UJ3B 2JCCE 1ZA6B 1UXSA 5LG1A 3WYRA 5HYSB 1DQJA 2HFTA 1AY1L 3GHEL 1CFVL 3O8XB 2Q76A 3ZT7A 3U9PH 3HE6B 4OB5L 3S97C 3TIDA 2X4OA 1FYTA 3SE9L 1I7UA 1CYGA 5TH2A 3QH3A 3FTGA 4LFHD 5AUMB 1MQKL 3LVEA 3RHWK 3RWGA 2JB6A 5ECJE 3QWOA 1WAAA 4RMUA 1IM9B 4F7MB 1TCRB 2ZCHL 5JR1L 4RISL 1U92A 2ESVB 3QA3A 5E03A 4LSRL 3WEXA 1T1YB 2O93L 4GMSH 3RJDA 2J2ZA 3FB7B 1EIBA 2V5SA 4U6TA 4WHTA 2X4QB 4P59H 4HGWB 2VUYA 1YEFL 4P46B 3HI1A 3HE7A 3KPTA 5F1NB 1N5AB 2PW1A 4R97B 5GZND 5IV2B 3MRMB 4P5TC 3PABA 3S34L 4L8CA 2BXZA 2ZZUT 5D4QA 3MRPB 4CJ1A 3FONB 3IXAA 2DBLL 2NY6C 4Q0XL 2MQCA 5KOVC 4HUWA 4J4PC 2QSVA 4H88L 4H1LG 3KHOA 3SHSA 1RMFH 3AB0C 4LAQH 3QIBB 2VXQH 2Z92B 1EO8L 1IM3A 4JQXC 3RGHA 5HPMA 3H8NA 1DBKH 43C9A 3H3KA 4KK8D 4H5SA 4FXLA 4W4NA 1TVHA 2D2OA 5ESQB 4Y19E 5EUOF 4BSVB 5JZ7C 4NM4H 5DD6B 1TTGA 2IH3B 4CVUA 3L95A 3UTZB 3CXHJ 1NEUA 3H42H 4YEEA 5CP7A 1S7QA 4KJQC 2XPGB 4LKXA 2EDJA 2KH2B 3WS3B 1G7HB 3WS6C 2Q7YA 4PRDA 3CX5J 2H9GB 4N0FB 1BQHB 3UTTB 1ACYH 3MACL 2R2BA 4HGKC 1V7MH 5IQ7L 5D7IB 5SWZA 3WFEH 4MS8C 1K4CA 5EZJB 4CVZB 5HY9A 4MA8H 2HRPL 3IF1A 4WI8A 4LPUA 4PJ8B 1MRCH 4NKOA 5CFHA 3S5LA 3TLRA 4LHQB 4X5XA 3M1BA 4OV6F 3C60D 4GQPH 1FHGA 2X4RA 1CGTA 4ZSOB 4LHUA 4FHBD 2OYPA 5E2WH 3BKJH 1CXIA 3ZE1E 4WWKB 1RZGA 2BVEA 1YPZB 3TBTB 4EOWH 2HG5B 2VC2H 2DL2A 1J05A 3QXAA 5HGAA 4XNYH 3D18A 1AIFA 1B0GA 4PPTA 4Y2DC 3T8XA 5ANME 5LBSH 4KFZC 4G42B 4XVTH 3LEYH 4HC1L 2E8ZA 5T5FH 4PJ5A 3QHFL 5A3ID 1IEAB 4O51A 2JTDA 4YHML 4R4BB 4HQQH 2D0FA 3PP4H 5DGQA 3RIAF 2Q86A 1T0MB 2GITB 5HGDA 3BGFB 3TT3H 3DX6B 1OPGH 3J8F7 1YNTB 1F4WL 4HWBH 4TRPL 1AKJB 3IDNA 4UNUA 3DBXA 5ESVA 5HD8C 1J0IA 4YX2L 3HG1D 3ULUF 4MAYA 4UB0L 4RWHA 5J1TC 5F7EL 2C1PA 3BFOA 4P5MA 4DKEL 1UJ3C 1T0NA 3ARFA 1VFBB 4G6FD 4FFYL 3KHQA 3IDIA 4RNRB 2ZCLH 4BFIA 4P0DA 4G6KL 4KH2A 1FFRA 2FEEI 4U0RB 1LDPH 5C0FA 4FQCL 4U1MA 4MJID 3VWKB 43CAA 4RAHA 4Y16C 2B1AL 4KQ3H 1BWMA 2FIKA 4UQ3B 4FZ8H 3V9FA 4QYOB 2Q3ZA 3MLVH 1KJ3L 5FO8B 1JPTL 3QDGE 5HYSG 3HNTH 3EO9L 4JFYB 4KTEH 3EOTL 2I24N 1UEYA 4XC3H 4GXVH 4UUJA 1JNHB 4PGDB 4G43B 5EO1B 5DSCA 2NY2C 1K2DB 5CSBA 5C2BH 2NY4C 3M8OH 1BX2B 4IJ3C 2X1WL 4OLWH 2Y25A 1LILA 4XXCA 5DURD 1MAJA 4C57C 4FFZH 3T09A 1JZ3A 2FH6A 2LAAA 4OZGB 4X9HA 4ODSL 3ARRA 4G8IB 2EDYA 4Y2OA 2OZ4L 3QG7H 1T04B 5IJVA 4LCWE 5ISZE 4ZFOL 4GAGL 1A6ZA 1OTSC 5GGUB 5CGMA 2Z31D 1FFNB 1K5NA 2N56A 2Z91A 3BEVB 4N8CL 2BOCA 3O2WL 5E9DB 1U8NB 1HIML 2B0SH 4KJPC 1CICB 4XMPL 2UVFA 1RULH 5ALCL 3HR5B 2WK2A 2H45A 5AAMA 5I1JH 5MP6H 5E6IB 3DX7B 1U8PB 4HUMB 3QJFA 2P42B 3U9UB 3WFBL 2VITA 2CRMA 2PCPA 4ZQKA 5DHVA 3CZJA 2YPLB 5ALBL 5GSVA 1KB5B 5DJ6B 1F13A 3KPRA 1IC7L 4NGHH 5GSRB 5KSAA 1IT9L 4L4VA 4TN9A 1IL1A 4HWNA 4F57L 3FRUA 3SGDI 5KOMC 1QSZA 3KYNB 1ZHKA 5EA0H 4HKZB 3IAPA 4LEOA 3VFPB 1G0XA 3CX2A 4GQ9H 1LWRA 1XAUA 3CLFH 1EO5A 2DB8A 1BQHG 3FQUB 4NCC1 1ITBB 3ULVE 2ATPA 4JKWA 5MI0B 1AJ7H 2A2QT 4XPBL 2X4TB 2XTJC 3L3GB 4JG1L 5ID0A 4IHOB 3O3EB 5KSBA 4KZDL 4K9EL 2EE3A 4U2YA 4P9MH 5C07B 4BUGA 3HZMA 2C7UB 4PJFA 3NIFE 3VXRD 1F8TH 3BH8B 5DA0B 3PQYE 4JJHA 4PJ9C 2OL3H 2W59A 4UOW1 4O58L 1TZIA 3S7GA 3RL2B 1M7DA 1YN6A 3CPLB 1QSED 5FKPA 4Z7WE 2E3VA 3WIFB 2D3VA 1V05A 5C08D 5J9PB 2IALA 3IB4A 3TPKA 3KGRA 3CFBB 3OKNA 3JTTB 3GJFA 1AO7B 5DK2B 4HLZG 4E42A 2X40A 2R0LH 2R4SL 3NIDF 5DTFB 5SX5K 4K7FB 4YZFF 4LLMA 3LY6A 2C1OA 4JY6B 4WV1C 4U1GB 3GUTA 5ILTL 1MLCB 1MCPL 1QUNA 1E6JL 3P0VH 4ZUSA 4XC1L 4XCYA 4DAGL 3GSOA 3U46B 1JK8B 4OLUH 1G7QA 1UQSB 4PBVC 4M7KH 1RIUH 3VDBA 3SO5A 1UWEH 4DKFH 4Y4KA 3BQUB 4MCYA 2DL9A 3GSNL 3E3QC 3KPOA 4CADA 3T2PA 2X1OA 4XBGA 1A4JB 4PJIA 3KPMB 1PY9A 3JWNC 3S4SB 1U8OB 5TGBB 1AGEA 4BZ1H 3O9WD 3VXNB 4XPTL 5E00B 4LSUH 4HWEH 2QBWA 5HVHB 3KXFA 4AG4L 4PGZA 4JRYD 1NMBL 5E2JA 4L4TA 3VG9B 2A73B 5J13C 3WLBA 2N7AA 1JPGA 1W72H 1FNAA 4QXGH 3PIQB 3VD4A 1EGJH 2ZUQB 5SX4H 3SKOA 1M7IA 1VADA 2YC1A 4NT6B 1FO0H 1S5IH 1XFPA 3RVVC 3MODH 2YZ1A 1MNUL 1TJGH 2YRLA 4YR6A 1FZMB 2BVYA 4L3CA 3ZHLA 4F7CB 5GPRA 2NY0C 2X2YA 1EV2E 4LCUB 2ED8A 3O6FA 1NGQH 4QOKD 5D7LE 4RFNB 1XF3A 1ZTXL 3BPCB 4QF1B 5EOQH 2AK1L 3QQ4A 4O5LL 1QEWA 4P3WA 4XBPA 2NY7H 3VI3F 4GT7A 2F53D 2ARJQ 3EZJB 3K1KC 4L3EE 5DJAA 4XCEA 3QIUC 1R5WB 4BFGA 3D0LB 1HKLH 2B20A 4F3FB 3WV0A 3I3BA 1OGAA 4WO4D 4BH7B 4U1SB 4LOUC 4NRXA 3WIIH 1QO3B 4AQ1B 4MHHG 3BPOB 4PJCA 3SCMC 3L9RB 1NBZB 2ID5A 3LOWA 4QRPD 4I0PB 4MD4A 3LKNB 4JFED 3S9DB 3STBA 5C0CD 5JHDE 4JFDA 4TTDC 3S88H 2LAGB 2VZTA 1U8HA 2AQ2A 4PY7A 5CIPA 3RWCB 5EORL 5DD1H 4KROB 2QQKL 3F12B 4X6CB 3OMZA 1LO5A 3NZHL 4YUEL 1IGMH 5C86A 2XNAB 1XCQA 2BNQA 4UAOB 5B21A 3PDGA 3OG6B 2FO4B 4FRWA 2X09A 3BXNA 4Y89A 1P7HL 5D7JB 3ARBC 4X99B 5GRJL 2AJXH 3BESR 2GJZB 3QUYD 4UMGA 2YWYA 1EPFA 2GJ6D 4M1GH 1NCDL 4AIZA 1S7TA 3TP4A 5FB8A 2CMRH 3MBED 1A3QA 2AV1B 3ZKSD 1P84J 5TE6H 5DEGB 3H7BB 4H20H 4Z8FL 1XZ0B 2F8VA 3U82B 1T1ZA 2GTWA 3MA7A 1WC7B 4JRXB 4ZMAT 2MHAA 3H2WA 3CVHL 1PW3A 3LN5A 5FUZL 3GSUA 5MEOA 3PWPB 3QDJB 5DQ9B 2H2PD 1U2CA 3TT1H 1JZ4A 1MF2H 1AGCB 4K3EL 4TPRL 3PG2A 5K33A 4AEHH 2UZIH 3WSQL 4NM8H 5DZLA 3RAJH 1UM6L 5DQJA 4PJBA 2GHWB 3B9EA 5EBMB 1IGJA 3BT2H 3VRJA 1NCTA 4XP5L 1ZT7A 2FBOJ 3BH9A 3D25A 4MJ4A 2BY0A 2L4OA 1GGIH 4GAYA 1AP2B 5ACZB 4WEBL 5HVHC 5HGBA 2YUZA 4LVHB 4EI5B 4PJDF 4A6YH 5ICYB 2WIIB 1PEWA 1SY6H 3CFKB 2HFGL 3SDDD 3GMPA 4YO0B 4KKNA 3S4SG 3B3IA 4R0LB 1JJUA 4XAWL 5AZ2H 1ZLWH 5FGCB 3VJ6A 3OAZH 4QXUH 4UZGA 1PZ5A 4O9HH 3P11H 2A0LD 3EFFB 4DCQB 3IFNH 4QLRA 5LWYH 2DN7A 5GS0L 4UT9H 1CFSB 1JPFA 5TDOB 2WWMD 1EAPA 3MA9L 3FOMB 4LU5L 4KAQL 4ZXBA 1BQUA 1DUYB 1O0VA 1KN2L 1QRNA 3QPQC 4LKCA 2NXZB 3I6LD 1L6ZA 5JMOC 5DJZB 4XNUL 4GRWH 3C2AH 4G9DA 5IGXL 4LRNL 3HKFA 2QSTA 2DQDH 3DHMA 4NQDB 2IAMB 3DETD 3QYCA 3GMRA 4M6AA 1JGEB 4OZFH 3D85D 4PJEF 1NSNL 1VFMA 5MENE 5EU6B 3FB8A 5C7XH 3ISWA 3OBAA 4K3GA 5DJXB 3OXRB 4ZFZB 3IU3B 3PV7A 3TH4T 1BBDL 3PWUA 2WUBL 2HA1A 5KZCB 2P5EE 2MMXA 4JM4H 4JCLA 5I30L 4HFUH 4U1JB 4C83A 4LLDB 2L7JA 4XHJD 2W0KA 2CDGB 1P69B 4GSDH 1YQVL 4J8RA 3U4BH 3RPKA 1OWRM 2FL5A 3P77A 5TQ2H 4AT6B 4N90D 4PY8I 1OAZL 4RGND 4WEMB 3CC5B 4W6WB 1RHFA 2VMFA 3MZGB 4XPFL 1FC2D 4MYWB 1X4ZA 2YN5A 3MLTA 1FDLL 2D31A 4WFED 2Q3AA 4NN6B 3WLWD 2VLRA 2P24A 3QXDB 4F9PA 3CDGB 4N1CA 1H3VA 1FPTL 1VPOH 4F7EA 4X6BB 4YK4C 3WFDH 2R23B 1RUKL 4X0KB 1H5BB 1LD9A 2OJEA 3PWJB 2AJVH 1S7RA 5HHVL 5JPMB 3RVTC 5IB5A 1A7NL 1MFAL 5TDPA 1C12A 3BI9X 4LVNB 3MV8B 4KKCD 1FN4A 3TV3H 1CD8A 3WNOA 1ZT4B 3I6GB 4Y1AD 1IAMA 3GJEB 2MQ0A 1FNFA 3QDME 5JPNB 4XMLL 4ZUWA 1YMME 3TNMA 4KWUA 3CXHK 1ETZA 1BLNA 4J1UA 3RTQC 1U8IB 2ENSA 3F7QA 3T0BA 2XZAH 4NYLA 3CVIL 5SV3A 1R5VA 4GW5A 5FDWB 3CX5K 3B9VA 1N3NB 2V2TB 4KUZL 1QFHA 5EO9B 3VW3L 8FABB 1KIUA 4JG0L 2V5TA 1DBAL 3FQTB 3MLXL 4AY0A 1UB5B 1K85A 5D2LA 2EE2A 3WIHA 3BP6B 4H25A 5BXFA 2PYEE 1FRGL 4MXVE 3OWEA 4NQEB 4H1LH 4IRJD 5CBEB 3CGTA 5HI5C 2FDBP 2NX5E 4Q58C 1VENA 4XZUA 2GFBB 3SJVA 2O5YH 2Q20A 3F7RA 2PO6B 1AD9A 4EVNA 4KMQA 1VSCA 3QCVH 1I3GL 2E7CA 1HQRB 1S3KH 3TJHC 4EI5C 3VE0B 5IFAH 3C5ZB 3T0XA 3LKOA 1BQLL 1J1PH 3GKZA 1PD6A 5FYLD 2HT3C 3CU7A 3L5HA 2GAZB 4ZOEA 1CGXA 1A02N 1RUML 2BP3A 4JAMB 4ZFOB 2DRUA 3VWJD 1FGNL 3Q3GB 1RVFH 4JR9H 3ESVF 3DV4B 1SJHB 4OZHA 3NCJH 4B7LA 3OGCA 2Q8AH 4N5EC 3Q6FA 4P99A 5LAXA 5E2UH 1ZT1A 3E6HA 5IBLD 5J12B 1CDGA 1MFCL 3NGBC 3BVNA 3JV6B 5BVPH 2JIXB 3F65A 3EFDH 4XGZB 3RU8L 4FG6D 3EIFA 3X12A 4Q2ZB 5IVXA 5BRZE 1UH3A 4Y7MA 3T0EE 1A7OL 3BHBB 1BGXL 4DZBB 1A1MB 4TULL 1P5UA 3EZ8A 4MD5B 4XBEL 4QRRA 2FECL 4E41B 4F7TB 1ZGLB 1A3LL 4U1HA 1MHHA 1F4YL 1HXYB 1X5AA 4PJXF 5GHWL 4HWZB 3RUGF 1OTUD 3BZ4B 1AHWC 1T83C 1SEQH 2VERN 4GW4A 5I1CH 1QLFA 1X5IA 3MO1A 4ZYKB 1MWAL 3AFLA 2FZ3A 4K8RL 5HHOA 3L3IA 5D1ZB 1CBVH 2ITDA 3OKMB 5D6DA 5ICXB 3JSSA 3QHZH 4M43H 2R56H 5J6GA 1KCUL 4MJIA 5EIIA 5KTEL 2CUIA 3GSRB 2PYFB 3HZVA 1AR1D 3O4OC 2NY1B 5IK3A 1CE1L 4WTXA 2XZZA 2W92A 4J3WA 3EYQD 5IMLB 2VDQH 5T3XD 4X6DE 1NANH 5FHAH 2ZPKH 3DYMA 5EU3A 3CJJA 1JWSA 4HIIA 1JWUA 1REIA 2Y5TA 4PRNA 3ZE2E 4X4YB 1BOYA 4D9LH 4EBQH 1BFVH 1H5BC 4N1EA 2AKRB 2IBZY 3D0VA 3DI3B 3MV9A 1X7QA 1QSFB 2YMXL 3BAEL 1G9NH 3H9ZA 4JO1H 3P4OB 4KVNH 1DDHB 3NMEA 1CFQB 4LVNC 1HE7A 5EWIL 4UINL 1U58A 3BP7A 4GFTB 1RURL 1Y6KR 2VO5A 3CFCH 4KHTL 1K3ZA 5F9WB 4UI2A 3GJFK 2AJ3A 3OKOB 4G3YH 1YYLL 2VLKB 1MHPH 2ZOKB 1WVZA 1ZSDB 1YEHH 2VLJE 1I1AC 1QYGH 4FMKA 3U7AA 4X4XA 5FGBA 4PV8B 3IAGC 1G7MA 3WO4C 2DQTL 1V8HA 1JGUH 2VZ3A 5IEHA 2CIIA 3ARGB 3RGVA 5C9JA 1T7ZA 4R8WH 3OKDA 2DD8H 3V7AE 5LQBH 5KW9L 2YKLL 1AQKH 4JFZL 3GSNB 1U91B 4YHZH 4OF3A 1MEXL 3QUKA 3O45A 4OCNC 3RDTA 4O2CB 1DJSA 4LBEA 1OM3H 4DFHA 2VXVL 4LSSH 4IRSD 2J8UB 4CAGA 3AXLB 2VL5B 5SWSB 1EJ6A 4WJ5B 2QL1A 4TNWF 5B39B 3NACL 4DVBA 1DBJL 3VA2C 1CXLA 4BK5A 3I84A 3QUMA 1JF6A 1BIHA 1PKQA 5TF0A 2F5BL 4OLYL 4WRLA 3VFGL 4IOSD 3UTSB 1CDUA 3SEPA 3P40A 2WAHA 5DD0H 2C3VA 4OZIA 4P2OC 2EXYC 1J88A 3DMMD 2J7LA 3VGAC 1NGZB 3BIAX 4GRWE 4XPGH 2EDOA 2D4DA 4KKBD 2VH5H 4ZUTB 3DRQB 3ARPA 2I25N 3G5VB 2ORBL 2OP4H 1FZKA 4FABL 3GRWL 1FH5H 4F33A 4FQ2L 3BN3B 3VXRA 2QHLA 1RZ7L 1OVZA 2V7NB 4HS6B 4RGMB 5FHBL 4UTAH 5K9JH 4Q9QL 3VXUB 1SHMA 3JV4B 4NNPL 4PJ7A 5J12C 1QSEA 3OL2A 3GBMH 2D7TL 3HPJB 3V4PH 3Q2CA 4XPHL 3H0TB 4Q6IC 1S7WB 4UIMA 4ODHL 1OAKH 1OSZB 2X5PA 1NGWB 4TVPE 3E6FB 3NTCL 2YD3A 5JW4M 2QR0B 3ECBA 3TN0A 4S1SH 4MNQD 4GUPB 3MJ8B 1MCNA 4P2RB 1R24A 2NYYC 2R15A 3GIVA 3ILQC 5F9OH 2L7UA 3VGEA 2Y36L 4DZ8B 3ZTNL 2J4WL 3B9DA 4WFFD 1CLOH 2G60L 2FNBA 4ONHB 1UG9A 3QJHB 1N0XL 3EO1A 2W9EH 4LASH 2OQJB 2XXCB 3V95A 1BIIA 1OGTB 3MLUL 3QO0B 4KK5C 4PB0H 3BW9B 3P9MA 3AMLA 5D8JL 4OLZH 5HXMA 2O5XH 3WJJA 1J0JA 2QADD 2M8XA 5TJWK 3QXWA 1FFPB 4HLZH 2CK0H 4OM0L 5DK3A 5I66A 4OIIH 2BC4A 4LLQA 3O0RL 4JRYA 2CO7B 3VXOB 2HFEA 2DQFB 3C60B 3FCTA 1UCBL 4O02L 4YPGB 3D69B 4C54A 1YEEH 1YNKH 3THML 5E2TL 3I9GH 1MI5E 1MJJB 1RJYA 4FOMA 3NFSH 3HUJA 1FVDA 3CVHB 1F4XH 5FOJA 4APQA 1Q0XL 5CEYB 3ZKXB 5D70H 4QEGA 4K7PL 5C9KA 4QCIB 4OFVA 1FL6A 4X6EA 3DVGA 4UOW0 3T1FA 1XGPB 5DO2C 2FATL 3U1SL 1B4JL 5DWUH 3BJLA 4Q9RH 2P5WE 4FTVE 5IW1A 1LNUB 2QJDA 1KPRA 2F53A 4PGJA 1DN0B 1DLHA 4YC2C 2DM7A 2VR9A 5BW7A 1WUNT 4X8JB 4JJ5A 3EKCA 4IDJL 2FYYA 2H32A 2YD7A 2BSTB 5EUKA 4DTGH 2HP4A 4GLRH 4LSPH 2DYPB 4MA3B 1IC1A 3FN3A 5CJOH 4F58L 4NN7C 3UX9B 4V1DA 3H9HA 4EIGB 2YBRB 4LF3B 4FQJH 1F90H 5C09E 2D9QB 4HCRL 2W0FA 4YE4H 5I19H 4UDTA 1T1XB 3BN9C 3LMJH 5C0AB 3T65B 3EJZC 1BQSA 4J3SA 3QFDA 5FM4A 2DM3A 3FT3B 3DTXB 8CGTA 2DQHH 1L0XA 3NIFF 1NCWL 1J8HB 5JLZB 4N5UA 4UV7L 1M1SA 5FGSA 3ZL4H 2OTPA 4KZEL 3KJ4B 1FZOA 4F15C 4XP1H 3JVGC 4G80B 1P1ZB 3ZYJA 1ODAA 1DEEA 3I6KB 5K93A 1KG0A 1RZJC 1CGSL 3ARWA 4Z7VA 1Y0LB 5EPMA 1CU4H 4NZRH 5B39G 1JCKA 4B53A 1P84K 2G5BB 4PRPD 4FNLL 3GSQA 1YN7A 4M7LL 5EN2A 1WFNA 5GJSH 3NFNA 5LGHL 2GJ6A 3QUZB 3ETBF 4NQVB 3MBEA 1SJXA 1PQZA 3QCUL 2X4PA 2UYLA 5ACLA 5K9OA 4OBSA 2OXHA 5DURB 3KLAB 3L7EB 4YBQC 5D1XB 3HZYB 2HKFL 1PJ9A 2DAVA 2J6EA 3LHPL 1I9JH 4GS7C 2O61A 1L0YA 3RRQA 5D5MA 2Z31B 4NP4H 1KB5H 1HH6B 3CH1B 1L9MA 1KFAL 3VU2A 4JM2B 3QFJB 5AYUH 2Y4SA 3BYTA 3G5XA 3C6LB 1SVZA 4NKDA 3LKRA 3SDYH 3DXAE 3AREC 4NQTA 1Q9KA 3CD4A 4Z77A 3CU1A 4ODVL 4XNMA 3MJ6A 5I9QC 1T2QL 3WFHB 4D2NA 5ID1B 2DLEA 4PRBB 3D3VE 4DK6A 3BPLC 2YUXA 2X7LA 2OJZH 4G8GD 4ZPVB 3QI9C 4MB3A 5E8DH 1QBAA 5L9DL 1F4HA 4JQVC 3QNXB 4LHJB 3SKJL 2R1WA 2NY5C 1S7VB 5A2JH 5AD0B 2CKBA 1VESA 5HGHB 5ICZA 2X10A 3NIGE 1FE8H 1W0VB 1WBYB 3CUPA 5T1DH 1KUMA 5EIVA 5EZLA 4IS6A 2ZUVA 3HMWH 4I1NB 5CSZA 4YGVB 3TIEB 2DLIA 5EO0B 2Y6SC 1TZGH 4OGXH 3S98A 4MNGE 4TUJA 5DJ0A 2A6IB 3WCYA 1UACL 4OCSH 2DQIH 4BH8B 3TPUB 5L2KD 4ELMB 4QTIH 5DT1L 3SDDA 1KJ2A 4D3CH 1VKXB 1QHPA 4MNHB 3HC0A 1YY8B 3DLQR 2HVJA 1QVOA 1LQSR 1HQ4B 5GISL 3V5HA 4HIXL 1DBBL 3N9GL 3AU1B 4P23C 1JYXA 2R29L 32C2B 1D5MA 1N8ZA 4I48A 4NO0D 1BVKB 1IKNC 3K2UL 3LV3A 5L2JB 2P49B 4IOFD 4J7RA 1A6VL 5IP4A 3VXMD 4PJHA 1CXFA 5HHME 2E9BA 5GS1B 5C08B 3HAEA 3GHBH 3MJ9H 3P3YA 5GRVK 5EU7C 1IGIH 1Z2KA 4JO2H 4WUUE 4GG6B 1U93A 1BBJB 5FKAA 4HUNB 1IRAY 2WM0A 2NXYD 2FJFA 1Q9LB 1ZHLB 5CEXB 3DVNB 4BSWB 1BFOB 3MRKA 3QRFM 4UILH 1V7NL 5J1AB 4KHXH 2CD0A 1G7PA 5EFIB 1GGTA 4FFVC 1P6AB 4WW1B 4GRLC 2BRRL 1EHNA 4POUB 1MAKA 3RPIA 1MRFH 3FFDA 2HN7A 5F7MC 1M71B 1ZEAH 5B38B 5E08H 4OCXL 1AXTL 5IB2B 3MYJB 1N59B 3OX8A 3H9YA 4P3CH 2APFA 5EULV 3O9WB 1T66D 1YECL 4M8QA 1MAML 5IT2H 3LDBB 4NPYA 5CILL 4OM1L 3UTTE 2R1YA 1D5XA 4YQXH 3RNQA 2NW3B 3D9AL 5IG7B 3F7VB 2LQRA 5D7IE 5GS0C 2F19L 3VMPA 3IFLH 3MRLA 1J5OL 4GG8B 4ZD3H 3UJTH 1B2WL 3RWIA 4FQIH 3MNVA 5INCA 2V17L 2ZCKL 4N9GA 4UBDD 1MUJB 1NBVH 1BJ1J 3U36B 3DUSA 3IXTB 5MEND 5SWQB 3TYGL 2GKIA 4ZSOE 4XWGH 2CJUL 1FL5A 2JCCA 1CGUA 4ZOAA 1T0PB 3BGAA 3BZFA 4Y1AA 4FXGA 2ATKB 3L3DA 3OJDB 4IRZH 1BEYH 1YPZE 1IGTB 2H6PA 1SEBB 3PL6B 3V6OE 2OS7A 1N2RA 4KJYB 2J88H 4WI3A 1RUPL 5ITBL 2XZQH 3E8UH 4WO4B 1MWAB 5BQ7A 3BGMA 3VXPA 2IBZX 1KELH 2JJUA 5CUSH 4QRPB 2XN9D 3F58H 4Z0BL 1P7QA 3SDXF 4JFEB 1JMZA 1CGWA 2GI7A 5C0CB 5BS0D 1KULA 3UJJH 5E8OA 3ALWA 4QHMB 4KY1H 5CD5C 2NTFA 2CKNA 1L0QA 3PGDB 4N0RA 3S35H 1FLRH 1IQWH 1I1FB 1P4BH 2NLJA 1KT2B 3W11C 1N5YH 4QTHA 3S3SA 1U8KB 3HLAA 5EC2A 4I13B 4TQEL 3ZE0F 4UDUB 1MCRA 1WBXB 3W81A 1D9KB 1SBBA 5KS9E 2ZG2A 3QDMD 4Y2DA 3FQRB 5TPWL 1T3FB 3RZCB 3TZVC 1TNMA 5HHNA 1FYTB 1MFEH 1ADQL 3KYKL 1MJUL 3RWGB 1T22A 4Y19A 4PTTA 4JLRA 5KVEL 3VWJA 1XR8A 4RQQA 1AY1H 3VGDA 3VI4E 3QULB 3RNKB 3QUXC 1U92B 3JV0A 3ZHDA 2DKSA 4POYA 4GMTL 4OB5H 1K9TA 2OSLA 2ZUTA 1FNGB 2I5YL 3SE9H 4WHTB 2G9HA 5DD3H 3FQNA 4C56D 3LS5L 1RHHB 4XHQA 1WT5A 3SGDH 5HHQB 1HDMA 3RVXD 2NX5D 3WE6A 1U8JB 4LLYA 4RWYL 1NL0L 2ZCHH 3X11A 4OZGE 1LVEA 2X4SA 4LSRH 4PJAF 3W39B 1IM3B 2DQGH 3R06A 4J3XA 4EKXA 4GBXC 3HNVL 5DGRA 4XTRC 4YDKH 3IGAA 2MPAH 2H26B 4WI4A 4H5SB 4X5LA 1I3VA 1TVHB 1JWMA 5DMGD 3HC4L 4OLVL 3MCLL 3TWCH 4KVCL 2K7QA 4JFXB 4OFYD 2EO9A 1DQML 4HUVA 2DBLH 4Q0XH 4EN3C 4L9LC 3MR9A 3RVWD 4LLUA 2KDGA 5C0JA 1EO8H 1XF5B 3SO3B 1A7PL 1UZ6F 4QXTA 1A1OA 1JHTA 2X89D 4WNQB 3KNBA 5ANMA 1F4AA 1SJEA 3MRRA 4U1LA 5HVWA 2XWJB 2Z93B 2YPLE 1B0RB 3RQ3A 3TVMD 3FHAA 2EDFA 1RK0B 5GGSB 1MVUA 3ZT6A 3IF1B 2IQ9L 3C6SA 5B38G 5BRZD 4NC1C 4P4KA 2X42A 4NHUA 2PXYC 1NKRA 4YNYB 3BP4A 3WXVH 1TNNA 2E9JA 3M1BB 4LVOC 3SDCA 1UKTA 3T77A 2K9UA 3MACH 4PYGA 4QT5B 5IQ7H 4NN5B 3UAJC 1CDYA 3FHQA 3T0AA 3UO1H 1A7RL 3DURA 4WUKL 3VCLA 1RZGB 3MRGA 3O6ML 1I85C 2HRPH 1NDMB 3QXAB 1ZS8A 4DEPC 4LLVB 2EIEA 1A0QL 4Y5XA 5C07E 3PL6C 4Y5YC 4Y4HD 2X70A 4ZAKD 2DJSA 2EIDA 2ITCA 4RBPK 4HHAB 2X6MA 4JPWL 1JIBA 2DI9A 1KPVB 4S1QL 4WW2C 3PWNA 4KPHL 4WU5A 4Y4FC 2R39A 2UV3A 2ZUWA 4QHUB 3D85B 4HX1A 2JJWA 2HVKB 5HGDB 5I73B 4HJGA 1RJLA 3SE8L 3UDWC 4HBCL 4D0CA 4Z5RB 3EBAA 3NOIA 3IDNB 35C8L 4PJGB 2VAAA 4M62L 1AO7E 1RI8A 1I1YB 4HC1H 3STLB 3QHFH 1XGQB 3IJYA 4XXDA 2ZOLA 3EW3B 4PD4K 4YHMH 1T0NB 1EDQA 1MPAL 2LV4A 2ZG1A 1TVDA 5IHZA 1YJDC 5J6HB 4KXZI 5ISZA 4LCWA 1F4WH 1OLLA 4RGNB 4X9IA 4TRPH 1INQB 3ULUL 1RUQL 3T3PE 4YX2H 1UA6L 3MRBB 4LARL 1LE5B 2OR7A 3GMQB 2P7TB 3WIHL 1IAOA 1IZJA 5F7EH 1OP3H 4DKEH 2UUDH 5E4EB 5DUPL 2DQCL 3A6BH 4FFYH 5FUOL 1B9ZA 3I02A 4KK6C 5BMFL 4G6KH 4Z76A 4RFEB 2ADGB 4FQCH 3B6SB 4OIBA 2V7HA 1VGKA 2B1AH 3QNZB 1HHKB 2WINA 4L8DA 1Q8MA 4KK9D 3STZB 1QR1A 3MRJA 4HS3A 4BFEA 5IB4B 1KJ3H 4NC0B 1JPTH 3QBTB 3VFTB 4QRTA 1CDJA 3HE7C 3EO9H 2VQTA 3EOTH 1OAUL 4ZPTB 3MRHB 3OAYK 5E8PA 1FAIL 3O2DL 3RFZC 1CQKA 1HYSD 1M05A 4PGEB 3JXAA 3IU4L 5F70A 4Z7OF 15C8L 1MFBL 2BOCB 2NPLX 5JDJA 3WN5B 1W2KT 2DJ4A 3GB7A 1XR9B 3O11B 1DANT 2BSED 3H3PH 4JCMA 4ORGA 4CW1B 4YHNA 4ODXB 1S7UB 3MROB 4ODSH 1IILE 1Q1JH 4M6OL 1ZWIA 2WLYA 1FQ9C 2OZ4H 1NC2D 3NH7L 4GAGH 4IRJB 3NPZB 1XH3B 3PHOA 4MB4A 1JZ5A 3O2WH 4NBZB 4Z18A 3WHXB 1TQCB 5GSVB 3PQYA 4NDMA 2FGWL 3KPQA 5E2VL 3RKDC 5I2IB 1MIML 2YD5A 2R2EA 4OAWB 3CLEL 1J18A 4ODTL 4XMPH 5GRUH 3WNNA 5ALCH 4Z7WA 3FT2A 2X4NB 3B2VL 3FO1B 2WP3T 2ILLA 3WFBH 3ZKND 2OI9C 4X6CE 3PHSA 4PRHB 5CJ5A 9CGTA 1IC7H 1Q94A 2AV7A 1IT9H 4F57H 3UYRL 4XNZC 5MEPB 1KNOA 5ADPL 3JZ7A 4HMDA 3QDHA 1B6UA 4PJFB 1WIPA 3H3BC 1CF8L 5IKCA 3T2QA 4XPAH 2MCG1 3L3KB 5D2NB 3R4DA 2WBJB 1ZA3A 4H26A 3SDAB 4XPBH 3LH2L 3FRPG 4JG1H 1YN6B 1BP3B 1U3HD 1GZQA 4KZDH 4HEME 1WWBX 3KVQA 4K9EH 2W0LA 3U4EA 4I4WA 1HI6B 2ZUXA 3OKNB 4WY7L 4F8QA 5I1DB 3U0PA 1CDCA 1XGRA 2HFFA 3QXVA 5MERB 1KIQA 3EYFB 3X14A 3P4NA 4CN4A 4UV4L 1PSKL 4LLMB 4EDXB 4OT1L 2V5MA 5D7KE 3UMTA 1MI5D 2JLLA 4HIEA 1A21A 3KDMA 1I8KA 3GBNH 4MAYC 2V2XA 3KS0J 5I1AB 3MYZA 2IG2H 4XCYB 1KXTB 5EC1B 2ICES 2JE8A 4P3DB 3MOBL 3ARFC 1G7QB 2EDTA 3RHWF 1OF2A 4JDZA 1ZLSL 3GSVA 4YPJA 4R7NA 1JUFA 2R4SH 5C0IB 4MZ2A 3KJ6L 3KPOB 5F9JB 1A7QL 2DWDA 5I0DA 3KPRE 4L3EA 2UWEE 5ILTH 1S7XA 1U8MB 4CDGC 1E6JH 4XP6L 2CIKA 3BIKB 1T5XA 1RD6A 2IQAB 5CZXC 4XC1H 4L4TB 1A9BA 5E4EC 3WLBB 1UJTA 3PHQB 2BERA 3U0TA 5DRWB 4AM0B 3LIZL 4JZJA 3K81A 4J4PD 4PS4L 1MH5A 2B8OT 1M6OA 3GSNH 1KEMH 5FCUL 5GGRB 5JHDA 5L7XL 2EC9T 5IR1A 4JY5L 4XPTH 5KSBE 3OKYA 1CDHA 4AG4H 5JZ7D 2CXGA 4XXCC 1HSBB 2AQ1A 3O4LD 5FGCE 1N0LA 2F15A 1DUZA 1XF3B 5FYKD 1J1OL 2YZ8A 3G6JF 1WICA 4XBPB 4NO3A 4J3TA 1V3KA 1BOGA 1RJZA 4JO4L 1VEOA 1QACA 3U7YL 4XCEB 2X1XR 1MNUH 3D6GA 3VFWA 5ESAA 1R3HB 4NRZB 2E7BA 1NKOA 1C5CL 4G8GA 3MUJA 1ZLUH 4MS8D 3ZDXE 4IRSB 5ADOL 1U95A 2A6DB 4Y5VB 1ZTXH 5CSGA 4I0CC 2GTZB 4ORZC 4M03A 4C59B 2AK1H 1DSFL 3W2DL 1MCBA 4IMLB 2EDXA 2P8LB 2O26U 1GJIA 3V5DB 1I9RL 3HRZA 2FEDD 5GIRB 5IVZB 1IEBB 3G5YA 4RMWA 1KN4L 4Z7UB 1TZHB 5KSAC 4R96A 4R6UA 2I9LB 3NAAL 2ZNWA 4OV5B 5L2KA 4HT1L 3DMMB 3IDMB 2CR3A 3DUUA 5F6IB 3GGWA 1XCQB 2LVCA 1J8KA 1HHIA 4H8WH 4BQBA 2XA8L 1YEDB 1F6AB 5LVEA 2DICA 5EORH 1VEPA 1Y6NR 2QQKH 3GFUA 5ENWA 3TA3B 4YUEH 5K59E 3O3BB 3ZTJG 3GMLA 5ETUA 2YA1A 4MJ2A 4RGOH 5HD8D 5DF0A 2BOBB 1C16A 4PG2A 2HYMA 1OTTD 1T6WA 3EOAB 1PX4A 4P5KB 1NFDB 5D1QD 2EEBA 5GRJH 1EHLL 3OKLB 1NFIB 4MJ5B 5L0QC 5I71C 4XCNA 1NCDH 5MEOB 4FXKB 1ES0B 2RAMA 4UOJA 3WUWB 5CJ8A 5E6ZA 5I1LB 3DIFA 1I7RA 4HZLB 4Z8FH 4Y16D 2NR6C 3HE6D 3LRHA 1HHHB 4RMSA 4X80L 1ZHBA 2CGRL 1OGAE 2DLHA 1AQDA 3CFDA 3V4VL 4NKMB 3DV6A 1KENL 4GKOA 3CVHH 5DQJB 1TMCB 5FUZH 2EC8A 2OTWA 3ES6A 4PJCE 3M17B 3C09B 3VFMA 4BK4A 3AS1A 4LGSB 4KKLC 1PY4A 1ZT7B 2ESVD 5I6XB 4Y4KC 5F9DC 1R3KA 2BCKB 3A67H 1PYWA 5E94A 5DJDB 4K3EH 3U7WH 5JW4R 4TPRH 4NQEE 3P73A 3VFOA 5FFLA 3WSQH 1A22B 3I75B 4P46D 4LSVL 2HJKA 2ED9A 4ZDHA 3RWHA 3SKMA 3AS0A 2COQA 5HYQA 4XP5H 1RZIA 5MENA 3REWA 1OTSD 1H3PL 1VFAA 2F54E 5DZOA 5KN5A 3MRQA 1IFHL 3UP1A 1CFNB 4U1NB 4BELD 3PGFL 4WEBH 4KJPD 4OQTA 1PG7X 2EYSB 2P5EA 4R3SA 4MVBC 5E7FA 1IAIL 4AK1A 3O6FC 2NNAA 1I7ZA 1TIUA 1F02I 2DQEL 1CD0A 4LKCB 4XAWH 1JGDB 4PRAA 5HDQL 1NC4A 1JPST 2AK4D 4J3UA 3UTTD 3E1F1 4DUVA 4HJJL 4ODWB 1GGBL 3OF6A 1F45A 5I16B 1U36A 5EUOB 3GMRB 3TM6A 5GS0H 3QQ3A 3QQNA 4LU5H 5FECB 4JPVL 2IPKA 4KAQH 1I4FB 1QKZL 5J1SC 1KN2H 4E41E 3I85A 2AXGB 1OCWL 5E1AA 4XNUH 3DWTA 5F7YC 2GUOB 1MFDH 1HSAA 2XTJD 4D9RE 3QDMA 1JGLH 4C83B 3SE4A 4I8DA 4WWKD 1OSPL 1C5BL 3K4AA 2BSSB 4U6YA 1YMMA 5JORA 5CEZL 1NSNH 4PTUA 4J8RB 1HXMB 1VGEL 4PRPB 3IJHA 3R1GL 1TLKA 5DR5H 1LK2A 3PWVB 5HDBE 1HZHL 3MLTB 1R3IL 4S1DD 5H35A 3SY0A 1I8IB 3OKKA 2VLRB 2AERT 2P24B 3TNNB 5KSUA 1GSMA 1DQLL 3NZ8B 1IQDB 1K4DB 2GCYA 1SVCP 1W72A 2I07B 1NEZB 3ZYZA 2BNUB 3ARYA 1EGJA 5HDLA 2HT2C 5GGTL 1YQVH 5ITFB 2JJVA 1FO0A 4YFLF 1VHPA 2XICA 4I3SL 5FF6A 1NGPL 1S7RB 2PYEA 5SX4I 1OAZH 3MUHL 1AI1L 2Y5EA 1AKJD 5EU5A 3ROLA 1FN4B 2NX5A 2K7PA 2XOTA 1NAMA 5CCKL 1IAKA 1FDLH 5SX5H 1QSFE 3KWWA 4JFPB 4ZOCA 1S7SB 4JREB 1WWCA 4HV8A 1FPTH 1NUDA 3MQIA 4YXLL 1ORQB 4ETQB 2IANB 1RUKH 3WD5L 4J1UB 1A9EA 1T21B 5AWNL 2GW5A 1CVRA 4HG4J 5HHVH 2VLKE 1QNZH 4FQHB 4KQ4L 1GC1L 1A7NH 1MFAH 3VWKD 2ERJC 5KG9A 4G6JH 4OFYA 5DDHA 2XACC 4GW1A 1KTLB 4XMLH 2ARJB 3WUWG 2K3TA 4H25B 1A1NB 4HIHA 3ZDZE 2A6JB 2MCPL 2ICWI 1DVFB 3CVIH 1CFTA 2J8UE 4KKAC 2JK5B 4Z78B 3OXSA 3H9SB 4YHIA 3SJVB 3VW3H 4I2XB 5BRZA 4LIQE 3B2UC 3T0EA 4JG0H 1Q9WA 4K7PY 3QHTC 4RMRA 1HYRC 5DVLA 1ZKAA 4R4FL 4OCYH 3TO4B 3TO2A 1FRGH 4R7DB 2Q6WB 1Z0NA 2A83A 3UTSE 4N68A 4NO0B 3K0WA 4UIKL 1S8DA 2NW2B 1MOEA 3IDXL 4M6ML 3O3AB 5E9DD 3TBSA 3QIUD 1LGVA 4O4YH 5I74C 1LP9E 1I3GH 5T1LA 1TITA 5JOFA 5E5MB 5FYJL 3T3MF 1INEL 2VKWA 2PUQT 2ADJA 1JI2A 5L88H 4X7SL 1BQLH 5JNYA 5A1AA 4ZXBC 1HH9A 1AE6L 1PDKA 4TTDD 4I3RL 2DKUA 3VXUE 3U2SB 4GRMA 5JW4N 1FGNH 3IS0X 4X6DA 1TJIL 1GHFH 1U6AL 1ZVSB 1U3YA 1NJ9B 1S9VA 3J7HA 2QHRH 4HH9A 3HR6A 2A9NH 3AROA 3DO7B 1U8QB 1CDIA 1NGYB 5C71A 1CLZL 2HLFD 2DQUL 3PE9A 3QEHA 4HMCA 2I26N 3FMGL 1JPSL 5IJKA 1A7OH 3BYYA 3O2VL 1BGXH 3ARBD 4ZUVB 4D0DB 4TULH 1KTDA 2XFXB 1OAQL 3K4ZA 4XBEH 4NNYA 5J6GB 2OTUA 1A3LH 1ZLVK 2EIZB 1F4YH 4WWID 5C07D 4CDHA 1P4LA 2VLJA 3B9KA 1G9MC 3HZVB 5GHWH 3MJGX 4H0HB 4XP9L 1MWAH 2IF7A 4XRCB 1CL7I 4K8RH 4WW2F 5A43C 5CD3A 4L29B 2VLLB 4YWGL 4F9PC 2Y7QB 5F1IB 4NFBA 2A74A 1KCUH 5F7UA 3H6JA 5HI4C 1P4IL 1JHKL 1EEYA 4PG9B 1CE1H 3F7YB 3MV9B 1X7QB 3OR6B 2VE6B 4R2GC 4HH8A 2LABA 3RWFB 4Z6AT 2EYRA 4YHPB 1J0YA 3EYSL 1NEZG 4FQXA 1ORSA 2JKXA 1OLZA 5DZNA 4OZHE 3WBDA 2WANA 3PGCB 1T80A 2IC2A 1S9WB 4HFWB 3P9LA 2GSIA 1IZKA 2XXMB 4HIJA 4MQ7A 2XN9B 4KK8C 1QSVA 5BS0B 1FVEB 4OF0A 3KR3L 4QY8B 3BZEB 4TNVK 1LEGA 3BAEH 2PR4L 3IKCB 2EE6A 3ROOA 1WCBB 1RURH 3EGSA 3VFRB 2VYRE 5IROA 1NC2A 4KHTH 4P57A 3VRLE 3HCVB 2QSQA 1WAAF 1YYLH 4K94C 1E4XL 3HG1E 5TE7L 5J56B 1MCDA 3NCBB 4JVWA 1RZKC 1KIPB 1T7XA 5FA4A 1CD1A 2ICEB 4AEIL 1FZJB 4N0CD 1EX0A 3QZWA 3W9EA 3QWRD 1HOCA 4OSUL 1NMAL 4WDIA 5KVMC 5KW9H 1A6PA 2YKLH 3CCHA 2YS4A 4JFZH 1TQBB 1MCHA 3E2HC 4MJIE 1A6AB 5F8RC 1X5GA 1NUNB 3W0WB 3CFEB 1UZ8A 3BIBX 2VXVH 1VCAA 2C3VB 2I27N 4OZIB 1CVSC 4XAKD 1CT8B 1MRDL 2PTTA 1V3JA 3NACH 1DBJH 3INUL 4NZUL 5CWSA 1SYVA 5GGRY 2UY6A 3EDJA 5IIEA 2R2HA 4Q6YA 1JNNL 3BPNC 4RZCA 4F33B 1B6DA 1F00I 1IBGL 2F5BH 4OLYH 2X05A 1YNLL 4LEXL 5FM8A 1N64L 3MRFB 5GRYA 3G5ZB 2QKIB 4AEEA 3LEVL 2DWEB 4DKAA 1U3HA 5A3IC 3KPLA 1ZHNA 4J6RL 1N6QH 4YDVA 4C4KO 3T3PF 5H2BB 3RIFK 2ORBH 4LCCB 4U1KB 1PLGH 4FABH 3GRWH 3JTSB 4FQ2H 2FX8L 4ZOBA 1S9XA 1NCUA 1YUHB 1RZ7H 1NCCL 2D0GA 5FHBH 2B4CH 4JGJA 1MI5A 3TBYB 3ZKQD 1MVFA 1CXEA 2GIYA 3N1FC 4NZDA 5C0BD 1UYWL 2NY3B 3RWDA 5D93B 2D7TH 3OJVC 3NABL 4XPHH 2ICWB 4RAUA 5D7JD 3EO1B 1WLHA 3Q1SL 1N6UA 1VEMA 1BIIB 4NFCA 5D6DC 2XWBA 3N85H 4I18B 4AENB 3FOLA 3NTCH 5C70A 2Z35A 3QIWB 2P5WA 4FTVA 3BE1L 3TVMB 2PTUA 4I5BB 4H1LA 1XGUA 3MJ7B 3ZSSA 3DRTA 2R4RL 3L5XL 1ND0A 1P7KA 2G75A 3HNSL 5A16A 1NLDL 4LRIA 2Y36H 3ZTNH 4CNIA 3DI2B 2J4WH 3OKEA 3RWJA 5CMAB 3AS2A 3MFFB 4HUKB 3S96A 3BEWA 2G60H 4NNXA 5KVDL 3SGEI 2HFEB 4PGCA 4HKXA 5FUCC 1N0XH 2Y9RT 3R0NA 3FFCD 2Z4QB 3PJSB 3MLUH 4JRXD 5JIHA 1GH7A 5C09A 4ELME 3BWAB 4G8EA 1NMCC 5D8JH 2I9TA 3ARDA 5DI8B 3LSOB 5IMMA 4APQB 1V5JA 3RTQD 3PWPD 3QDJD 4OM0H 3MV01 4HS8L 5I1IL 1ZGLM 1A6WL 3O0RH 4PP2A 4Y4HB 2VDRL 3O4LA 5C0GA 3MV7D 4ZAKB 4LQFL 2APTA 1UCBH 4ISVA 4S1RH 1TFHA 3OHXB 4O02H 3IFPB 1MSPA 1XCTA 4G9FD 4IIQA 1Q9OA 5E2TH 1BZ7B 3HMXA 4LL9A 1HCFX 4QHNB 1RK1B 4KI5F 4LCYA 5E4IA 5FGBC 1UWXK 1Q0XH 1FNHA 5C08E 1CE6A 3RGVC 1X6NA 1G6RL 5HI5D 4DQOL 4F7PB 1L7IL 5FEBA 4E5XB 4NCC2 4HKJA 3Q6GL 1CG9A 4ERSL 2FATH 5T1KD 4GG6E 1N4XH 4P4RB 1D3CA 2FR4B 1B4JH 3KLDA 3MNWA 2KZWA 1U42A 4RIRA 3RDTC 3F6LA 1BVLA 2Z8WC 4BQ9A 3TJHD 5DMKA 4EI5D 4ZS7L 5HYIA 1DLFL 5FOBA 5LGJA 3MGOA 4NO5B 3ILPB 5CBAB 3K8LA 1KIRB 5DJCB 4DGIL 4OGAD 3UYOD 3LQAL 1BAFL 1NBYA 1FZOB 2GK0B 4F58H 4K71B 4TUOA 5IBTH 4M7ZC 1A2YA 1DEEB 1DQQA 1X5HA 1PEZA 1KG0B 5DEFA 4HCRH 5CHNA 3T0WA 2CRYA 3DXAA 3IDGA 1VA9A 5C0DB 3C5JA 5EH1A 4N5ED 1JN6B 4NOBA 4XVUC 2V2WA 1P9MA 1QFPA 4YAQA 3S36H 1NCWH 4NKIL 3CSPA 4UV7H 4JRYE 3S8WA 4KZEH 3QEQD 3AM8A 3NFNB 1MHEA 2FWOB 2GJJA 2YRZA 4X7TB 1E4KA 1NANI 2E6PA 1CGSH 4NQDD 3TCLA 1QA9A 4CUCA 4U33A 4JO3L 1KGCD 4NWUL 3CK0L 4GKNA 2EKJA 4JFQA 5EU6D 1XGTA 2SEBB 5D5MB 1KYOJ 5D1QA 4FNLH 4ELKA 3LQZA 3PV6B 4M7LH 4QOKE 1UKSA 2E5EA 5ERWB 1ZA6A 5F8QC 1UM4L 5HYSA 4JHBA 1CTOA 4NKDB 1RV6X 4B5EA 5C8JB 2VDML 1FGVL 3O8XA 2F53E 2HRLA 1F11B 2HKFH 3BD5A 3HE6A 3ZDYF 1KXVC 3TN0C 3WJLA 3LHPH 4XMKL 4JZOA 4PJEB 2NY3C 2W65B 3MC0A 5AUMA 1YMHB 4EUPB 1KFAH 4MWFB 4QRPE 2R1WB 1IM9A 5KSBF 4JFEE 1G6VK 5C0CE 4F7MA 1TCRA 5ICZB 3FO2B 2ESVA 4ODVH 1I8MB 1JZ8A 1T2QH 5EZLB 3UROR 4PJFF 5C6WH 1T1YA 4XCCL 2OK0H 3WJJC 3VG0L 3FB7A 2KBGA 2LTQC 1EH9A 2X4QA 4HGWA 5BZDA 5DJ0B 3SKNA 4P46A 5BO1L 1ZMYA 2DBJA 5F1NA 12E8L 1N5AA 5L9DH 3MV8D 5IV2A 3MRMA 3SKJH 1W0YT 3H42L 4XNXH 3MRPA 3FONA 3WMSA 3ET9F 2IFGA 4JFFD 1Q0YL 4L8SB 1FNSL 1H0DB 4OFDA 3QIBA 2Z92A 3BKCL 4BA8A 1I1AD 5DJYB 2WWKO 2J5LB 4NZTL 4APQC 1FFOA 4GAJL 5ESQA 2JF1A 1UACH 4JKLA 4BSVA 1FV1A 2GJ6E 5DD6A 4OLXL 5A2KH 5L8JB 2IH3A 1X5XA 3KPNB 4K7PX 3WO3B 2FX9L 5DT1H 3FN0L 1CWVA 2XPGA 3V5KB 2XWTB 5GISH 1G7HA 3WS3A 4U49A 3SE3A 4F37K 5BW7C 2H9GA 1DBBH 1BQHA 4N0FA 3UTTA 3N9GH 5JXED 3W9DB 4NUGL 2R29H 4NQED 5GS2D 4PJIF 5CINH 1D6EB 5D7IA 3NPSB 4XWOC 4QHKJ 2AXJA 5EZJA 3K2UH 4CVZA 4FQ1L 5CJXC 2VC2L 4KRPB 5FK9B 2PO6D 4PJ8A 1ZANL 3K4DA 2QQNL 3C5ZD 4P2OD 2YPKB 2EXYD 4ZSOA 5LBSL 4XVTL 3BKYL 1J0HA 3RPIB 1F58L 1XIWA 2DQJL 1ZXQA 1EZVY 4WWKA 2AVGA 4ZS6D 1YPZA 3TBTA 2HG5A 3V6OA 4BZ2L 4E0RB 4K3DL 5DXWA 1OPGL 1V7NH 2WZPD 2R1YB 4P5TB 2HMID 4LLWA 4DGVL 2BRRH 5HTSA 4G42A 2Z8VC 2NY6B 3ARZA 4Z7QF 2FGZA 2YSSB 1IEAA 3QB7C 4U7SA 4LGRB 2JIXD 3RWIB 1LEKB 1AXTH 2FB4H 1VDGA 5KAQF 1T0MA 2GITA 4ZO6A 3MBEC 4L8BB 4IDLA 3ULSB 1MAMH 1RSFA 4MSWB 1YNTA 3LKPB 3HFML 4OM1H 1AKJA 1FORH 4E41D 2FRGP 4PJCF 3SQOH 3PP3K 3BZFB 3D9AH 4HG4K 4NSKB 2F19H 1J5OH 4PLNC 2BHYA 4R90L 1Z9OA 3V0WL 2Q7NA 1B2WH 4MCZB 5KS9A 1B4RA 2V17H 2ZCKH 3U0WL 5FV1L 1QFWL 1VFBA 5D1ZD 3IVKB 2YN3A 1XT5A 3MLSL 4RNRA 2ADIB 4FZEL 2H2PC 3I6LE 3TYGH 3VWKA 1O7SA 3M45A 3V52L 4UQ3A 1R3JB 4P2QD 4PJXB 3RUGB 1KEGL 5FO8A 4GLRI 1U8LA 4JFYA 4Q9CA 4LDLB 1ED3B 2AJSL 1T20B 1RUPH 4MDIB 5HPOA 1KACB 3HZKB 2FJHA 1JNHA 4PGDA 4G43A 4JPIB 4PJGE 3HLAB 5EC2B 1K2DA 3SGJA 4OZFG 3FQWB 2J3SA 4X6FB 4EUPG 4Z0BH 2B0SL 1K3IA 2G5RA 4OZGA 3LEXB 4Y2DB 4N0UB 4G8IA 2GK2A 5DO2D 1NFDF 3SDDC 1T04A 4DW2L 3T0DA 4N90E 4RGNE 3EHBC 3V6FB 5GGUA 4XB7A 1SMAA 1T22B 3UZQA 3BEVA 4Y19B 4WFEE 4JLRB 4ALAH 3EDDA 4MHHI 4TQEH 3GMMB 3U6RB 1HHJB 1IC4L 1T7YA 1CICA 2PW2B 3HR5A 4MDJB 1Z0MA 2FSEB 4OF5A 3QNYB 4UU9B 4Y88A 5TPWH 3GSXB 5E6IA 2CLZB 3BMWA 3DX7A 3DSFL 4GQ9L 4PJBF 1ADQH 2G9HB 5IFJB 1FJ1B 3BN9D 4LP4A 1MJUH 3U9UA 1YC8A 2BSRB 3EJZD 2WBWB 1UVQA 5C92A 4Y1AE 3EOBB 5KVEH 4QXWA 2YPLA 2VXTL 5DYOB 5T5NF 1KB5A 1QLEL 5DJ6A 5SWSD 1S9YB 4S10A 3ARUA 5GSRA 3NPSC 2HJLB 4Y16B 2ZSVB 1EEZB 4GMTH 3KYNA 4OQTL 2I5YH 5F1OB 4KRPC 4K23L 4U1IA 1RIVL 5FO9B 3N1QC 4XVJL 1F8TL 3LS5H 3AAZB 2ICCA 3UTSD 2O5ZL 4X8XA 2XA3A 4YFDB 4RSVA 2RCSH 4RWYH 1A64A 4RA0C 2X4TA 4AIXA 4IHOA 3O3EA 1WZMA 3P4MB 1CS6A 2NY2B 2R69L 5F7KC 5C07A 2C7UA 2NY4B 4IJ3B 4JDVB 1A1OB 3HNVH 3EYOB 5EZOL 4HJ0C 3PDOB 2RJMA 1H8SA 3BH8A 3HC4H 4OLVH 2AP2A 4KVCH 1GXEA 1HEZB 4EJ1C 5EBLB 3VXUD 3CFIC 3C6SB 3WLWC 1DFBL 3RL2A 3CPLA 3RX8A 1HKFA 4PLKD 3WIFA 5J9PA 2R0WL 5DRNB 1A7PH 3CFBA 5IQ9B 5FYLE 1A3RL 3T77B 3JTTA 2CLRB 3ARED 1AO7A 3O3DB 5DK2A 1UWEL 2HH0H 3MX0A 5DVNA 1BJMA 4K7FA 4OKVA 4PRHE 1VERA 2DMBA 2IQ9H 4BZ1L 4P2RD 1MLCA 4MX7B 3NA9L 4HWEL 2CUMA 2E7HA 3QI9D 4LK4A 1QQDB 4N8VG 4Y5XB 2HT4C 5INDB 2V9RA 1D5BB 4WGVB 1KLGB 3B9AA 2AK4B 3U46A 5F89B 1JK8A 5T3ZD 4QXGL 1MCIA 3PWNB 5D2NE 4JY4B 2VDLL 3MJ9A 4QNPF 3FB6B 4O2FB 3SN6N 1T5WB 3BQUA 4KV5E 1A7RH 3TCXA 1XF2B 3OB8A 3QDGB 4WUKH 3HPLB 3KPMA 3MODL 5I18L 3O6MH 3S4SA 1U8OA 5TGBA 1IGYB 2BHZA 2NZIA 4HJGB 3VXNA 5E00A 5AEAA