5KTEH

Crystal structure of deinococcus radiodurans mnth, an nramp-family transition metal transporter
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
213
structure length
211
Chain Sequence
QVQLTESGPGLVAPSQSLSITCTVSGFSLTSYGVHWVRQPPGKGLEWLVVIWSDGSTTYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTAMYYCAREPPYGYWGQGTTLTVSSAKTTPPSVYPLAPGCTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Divalent metal cation transporter MntH
publication title Crystal Structure and Conformational Change Mechanism of a Bacterial Nramp-Family Divalent Metal Transporter.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Transport protein/immune system
total genus 24
structure length 211
sequence length 213
ec nomenclature
pdb deposition date 2016-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5kteH02
1AQDB 2PYEA 5EZLA 2X1WL 3PWPB 4NZRL 3V4PL 1HHIB 1IGYB 4JCMA 2AXGA 2R1XB 3ET9F 3TJEL 2BVEA 4HUXB 5KVGL 3MRMB 1JK8A 4QRSB 4KROC 2DM2A 4HGWA 5HDQL 3RY5A 1SVZA 5L2KA 4AEEA 5BQ7B 2A77L 1A1OB 1I3UA 1ZHNA 2H8PB 2NY5L 2VKXA 4JFEA 3BW9A 1KSRA 2I07B 4F8QA 1HKFA 2XN9D 4OF3A 2ZUYA 3H7BB 3WFBL 5E2UH 5HYFA 3U9PH 1U3HB 2ZSWB 5ILTL 4HWBA 1CS6A 5CWSA 5KG9A 4OCSH 5GGRY 1UWXH 2XXMB 3V0VA 3SDCC 1PGRB 1LO3H 1T89A 4GRMA 4LGRB 3LRHA 3O45B 3VFGL 3ARDD 1RVFL 2HFFA 3WJJA 3SE3A 1MCQA 4XCEA 2ICWB 3L7FA 1BP3B 3MLZH 4MAUH 4HK0B 5DJZA 3WL9A 5KSBB 1PX3A 4L9DA 1BM3L 3H42L 4KKLD 4I18A 5JDSA 5TE6L 4ZG1A 3L3OB 2ED9A 2ERJC 4P3CH 2D0FA 3ZT7A 1FGVH 1QSEE 3QJFB 5C0EB 1AC0A 2C1OB 2J8UF 2OR9L 2Z9TA 3VXMA 3FFCB 3FO2A 4H26B 2CIIA 1E4WH 4FXKB 4RGMB 1KJ3H 4DN3H 1IKFH 1IL1A 3OSKA 3VMNA 3G6JF 4TUKH 4LAQH 4ZO6A 5IQ7H 1A02N 8FABB 1V5JA 1AHWC 2F8XC 3TBSB 2Z91A 1KGCD 5EIIB 3RUGA 3I6LE 3B9DA 1WCBA 5T1MA 3GBMH 3DRQA 1S7WB 1GAFH 2BVQB 4U6VH 3JVGA 3RWHA 1V7NL 1E27B 3GMRA 3HCVB 4D0CA 3FOLB 3X17A 2DQCL 4HJ0C 1TJIL 1F45A 1IM3A 3Q2CA 1Q1JL 3BXNB 2HT2D 3GSRA 5D1XA 4L8SB 4NQCB 3EOTL 3ZKMC 3LRSA 4KFZC 1GC1C 4WI3A 3IU3A 1CDCA 4N8CL 4DGVH 4MXQD 3VD4A 1NC4A 3NACH 1ADQA 1CICC 4YBQC 2H6PA 3T4YB 4ZXBA 2F5AL 3HZYB 4NKMB 1NGWB 3NH7H 3RZCD 2A9MH 5FYLE 3L95B 4U1JB 1EX0A 4DUWA 4MNGE 3WS6A 4FG6D 5HVHB 4NNYA 4YX2L 4WI6A 4PJDB 4WCYL 3RDTD 1WJ3A 3L9RB 3L5IA 2EYRA 1D5IL 3K80A 1G6RL 3FQWA 4GMSL 1QHOA 4KAQL 3DYOA 4NN5B 4AM0B 4O2EB 5D2NC 3QQNA 4RIRA 5A3IC 3STBA 1QYGL 3LOWA 4EIZC 4JO2L 4DVRH 4NFBA 4MVBD 5CHNA 1PBYA 5AZEH 5MEOB 1WWAX 5J1SC 1FYHB 3MLWL 1O7VA 3ZYJA 3SGJC 1CR9L 3EO1B 3JV4A 2BSSB 5I8OH 4Y19D 4QOKE 2HFGH 3QIUA 3D0LB 5ESAA 3LEVH 4GKNB 3VXSB 3C08H 3EFFB 4R8WL 2VXUL 3NCJL 5J1AB 5SV4A 4JFDB 2HFTA 4M7ZB 3JWOL 5IBTH 4KK9C 3VFRA 5IVXA 1YEIL 1FQ9C 1FE8H 3Q3GA 1CFSA 4X6BA 3PQYD 3ZL4H 3WO4B 4F7CA 1PG7W 3D69A 1GGCL 1NJ9B 3LSOA 2R2CA 3GMOA 5C0IB 4X5LA 4G3YL 4JPKH 3EDJA 3ELAT 1NBZB 5E0QA 3MRJA 4JEGB 1BLNA 5DJ2A 2AQ2A 1AGEB 3P0YH 4JN1H 4IHOA 1UH2A 1KCSH 3W11C 1NUDA 4HIXL 3PP4H 4NJ9H 1UB5B 1ZLWK 7FABL 1CD1B 1YMHB 4UAOB 1AO7E 2R0LH 3V6FB 4MLIA 4P9HL 3VMOA 5IG7A 4UTAL 3RWFA 4TVPD 1AP2B 3WLWD 3UTTB 4L4TD 3WN5B 1FFRA 1D5XB 3MCLH 4HWUA 3TIEB 1AR2A 1UH3A 5TE7L 4MA3B 5D1QA 3BYTA 2V5TA 4PJAE 4GBXC 1QUNA 2IPKB 43CAA 1DQMH 3OAYK 3U36A 4AENB 2GITA 5EBLB 2DQDL 2E9WA 3DUHA 4TQEH 2B0SH 3C5ZA 4I3RH 2GAZB 3HPLB 3H9SD 4HJGB 3HFML 2O93L 5IFJB 4IIQC 3BIKB 2JE8A 3V5DA 2CK2A 1HCFX 5E5UB 3RKDC 4X4XB 1GC1H 3GKWH 3S88L 1A3LL 4OF0A 1DDHB 4NKOA 3HZVB 2D9QB 4HUUB 2DIBA 5EOCJ 4PG9B 3KPPA 4NO2B 2PTVA 3IYLW 3BH9B 1LO0H 3DROA 4Z7NE 1I9EA 2VNCA 3RPKA 4Z0BL 4CVZB 2F53D 1G9NL 4PG2A 3BJ91 3PWLA 5DRNA 1T22A 4JKWA 4IOFD 1AQKL 1U9KA 4LNVA 5JHDD 2LFGA 3C09B 4BELD 3VA6A 1MWAA 3EYVA 3C6LC 4LP4A 3RDTB 4WHTB 2CGRL 3UTPD 4X6CE 4MQXC 5CLWA 4RQQA 5C0FA 1GPOH 3GJEB 3JXAA 4UQ3A 4MD5B 3C5JA 2D7QA 5C0CA 4JM2A 4X9FA 1BFOB 1T5XB 4A6YA 5TF1H 3DHMA 2X9XA 2A2QT 1V3JA 4I13B 1FVCA 3MV9A 5F7EH 2HVJB 2Q86A 3ARYA 1YQVH 2AABL 3SPVA 3CX2A 3TWCL 4K8RD 2DJUA 2E9JA 3EDDA 4DCQA 1M05A 1EAPB 2YMXL 2YZ1A 4X99B 1Q72H 1UZ6E 1PZ5B 4PRDA 4HJJH 2M2DA 1CXEA 5GRJL 1KLUA 5DJAB 2NX5E 1RJZB 1CFVL 4V1DE 4WDIA 1XR9A 4PY7B 4EBQH 4L1DA 3THMH 1SQ2N 5C07A 3RWJB 4PJ9A 2E7LA 3KNBA 4XPTH 3L3KA 4LLWA 1CFQA 4PRID 5SWSA 2BHZA 4YDIH 5EUKB 3DARA 4NQEE 3VXRE 4J3XA 2IWGA 5DFWH 5EIVA 3LH2L 4ZUVB 5FYJH 3RPIA 1T03L 2YRZA 5GS3A 4OZFG 4H5SA 5T3XL 4P46C 4OGXH 3BYYA 1EUUA 3S35H 4HC1A 1KYOK 1TQBC 4L4TB 1WF5A 4YUEH 4FNLH 5I1CL 3P77A 4NUJA 1Y0LB 4BKLA 3PE9A 3LIZL 4RX4A 1XR8A 1AR1D 2HJFA 3U0TB 3FQTA 4MJ5B 4LASH 4LPUA 4PJIE 4YIQB 1OAYH 4PGJA 1FYTE 3I75B 3PGCA 5TGBB 5IBLD 2XQYG 1UA6L 4JO4L 4WTXA 3KYKH 3FN3A 4EN3B 2DLFH 4TSAL 4NHUB 1GVIA 1T1WA 1U3HC 5LGJA 1E28B 2IALB 1NAMH 5FGCE 1EUTA 4HUKB 4Z78B 1JPGA 2ESVE 2P5WE 2B4CC 3VFOB 4HUVA 2NW3B 4NZJA 3U82B 4RAVA 2A6KA 2BSRB 2WBJB 4AMKL 1BWMA 4LVEA 3TBVA 1R3JB 3UCRA 3T4AB 4H1LH 4KMTL 4JHWH 1Z6JT 2VL5B 4X7DC 1NFDA 3RAJL 15C8L 5BO1H 4Z77B 1UVQA 4AEIL 4OB5L 1XGPB 5T1KB 2FWOB 1BBJB 4D94A 3JTTB 4NWTH 2OTPA 1CXFA 3IRZA 2J8UA 3L1OH 4PJBB 4FRWA 1F90L 4PGCB 1A6WH 4RGMC 1MFAL 5K9OA 3BZEB 4Z7UF 4XAWH 2XKNA 5D70L 2DMCA 4H25A 1F97A 2YK1H 1WUNT 2XTLA 5FA4A 5E2WH 2CO6B 2EIZB 3MJ8A 2H2PD 5DA0B 3STZB 3KDMA 1E6JH 3M17A 4URTB 1IGFL 2ATKB 4L9LB 3TPUA 4KJPD 1KEGL 3D3VA 1W0VB 2CRZA 5DD6B 3DVGB 2D7TH 4GKOA 4QXUH 4J1UB 3QHZH 1ZSDA 3GO1L 4RFNC 1Q0XL 3TT1L 4M4PA 1ES0B 5C0NC 1DP0A 4L8SC 3K4DA 1C5CH 1Z2KA 5BV7L 4YHKH 3F7YA 3IXAB 5LAXA 2X1QA 5ADPL 4KJWC 2R69H 5KVFL 3GNML 3MV7B 3VWJC 2XIDA 2EH8H 2L0DA 4JKLA 3MJ9A 4G6JH 1D9KB 4WFGE 3F7QA 1EERB 4L8DB 3OAZK 1N5YH 2YUWA 5HVHC 3DSFH 4JRYB 3GSUA 1MRFH 4C4KT 4LVOB 3HZKA 3ALWA 4ODXB 2R1YA 5CS7A 3D18B 4ZPVA 4ISVB 4UB0H 4HQQH 1DN0A 4LGSB 3U30C 4C83B 4F9LA 2G2RA 1P9MC 1OAUH 2PXYA 4JO3L 4O2CB 5C09A 1ZVYA 5DQJB 5DTFB 1FNAA 2BVOB 3OZ9L 2Y23A 2LVEA 3ZHLA 2CJUL 4MGXA 4C56E 1FL3B 3MO1A 2VDNL 5FK9A 4MX7A 4LRNL 3FZUC 1C1EL 3FN0L 4OM0L 3BQUD 4K7FA 5IMMA 5CJXA 1X3DA 4H88L 5AEAA 1P7HL 2DQTL 3OKDB 5F9DC 4M7ZC 3L3IB 4JG0L 1I3RA 4YPGA 5C2BL 1NC2D 1NCDH 2B4CH 4OFYD 4WEBH 1PQZA 3WO4C 2FR4A 4P3DB 2Q76A 2VQUA 1S7SA 1DLHB 2E27H 2YKLH 5CMAB 3T1FA 4HFUL 3ZKND 3D0VA 3QEQD 2VZUA 1JWSA 3Q5OA 1NGYB 4FFYH 4R4BB 1JGEA 1EEUA 1J1XL 5E9DA 2P8MA 5EORH 3TESA 3EJZC 1LE5B 4L3EE 4NRZB 2V5YA 2EDBA 3CXDL 1JYXA 2XNAB 4M7JH 3OXRA 4F80A 1DUZB 3WN5C 2Y9RT 3MRQA 4KDTA 1L6XA 5CEZD 2Y1VA 1MHHA 1FG2A 1TCRB 3MRDA 5B3NA 4L4VB 4UIMB 4BQ8A 4ZUWB 1Q94B 4X6EB 2HTKD 2Q20A 3FB7B 1IEBA 3MLSL 1HINH 1MREH 3O2WL 5IP4A 4ODSH 5HI3C 1NEZG 4RNRB 1MJJB 2A0LC 3H9YA 4LARH 2GYSA 3QH3B 4ODUB 1KPRB 4HT1H 3ZTJH 3GEWB 2HTLC 5H94B 5BZDB 4JFYB 4KTDL 4DUXA 5I1GL 2C1PA 5FYJU 1HI6B 3QIWC 1GGUA 3MFFA 4K23H 4OBSA 2AJYH 4XCFL 3VFMA 4JZJB 1DE4B 4MS8D 4U1HA 1JUFB 4XWGL 5IF0B 1U0QA 1JV5B 3KPNB 4LCWA 2VH5L 5CBAB 2FH8A 1ORSA 4XNYL 3K8MA 4MNQD 32C2A 5TPWL 3IXTB 5DRXB 1IGTA 5GSRA 5DQ9B 4KY1H 2Z31D 5I16A 3CFEA 4OUUA 1OTUC 3BPOC 4YZFE 1OP3K 3CUPB 4O9HL 3RDTC 4M6ML 1JWUB 3EYFB 3DUSA 4JANA 2Q8AH 5ADOH 2AXFA 5IGXL 2KH2B 1D6VH 4RDQF 4L29B 3HNTL 4MNHA 4MDJB 5H8DA 4FFVC 5MEQA 2R0KH 3L3GB 4OLYL 4MQ7A 2RIKA 3KPSA 4RDQG 2HLFD 3QUXA 4MB4A 1JMXA 2VE6B 1H3UA 2DKMA 1IRAY 1X6NA 5I30L 4D9LL 3P4NA 3SKOB 5TDPB 3GDBA 2AI0H 4K2UH 3BQUB 3TVMD 1KELL 5BVJA 1U2HA 2ATPB 5CAYB 3PWJB 3PHSA 2M26A 4P2QB 4FS0A 5AG8A 1JZ3A 3E2HB 5ITBH 5MENB 4I4WB 4Y5XB 5KSBE 1YNTB 1LEIB 5IMKB 5J9PA 3G5ZB 3QULA 3NCFB 1MQ8A 1A7QH 4FQXC 5LGHL 3REWA 4APQA 4I8DA 2XZCH 4EUPB 4M1GH 2GSIA 3TBTA 4X83A 3QEQB 3MRPB 4AYFA 3UTSA 4I5BB 4FTVE 1JP5A 4PRHE 3GMMB 4JQVC 2BXZA 3EOBB 1FGNH 4OZFA 2WUBH 1LEGA 4Z76A 4JZOB 3PV7A 2VDKH 1Q0YH 2PO6B 3LQZB 3AREC 3LB6D 2BJML 1A7OL 4XH2B 2WWKT 4HWEH 1S9WA 4OLEA 1A3QA 5JORA 1CGSH 3KJ6H 1HSAA 3QFJB 3TZVC 1HXMB 4FQQB 1D6EB 5FKAA 4HKZA 2Z93B 1K5NB 2R23B 3BP7B 3BZFA 3KWWB 1MCEA 4HWBL 4JDZB 1UB6B 4U1KB 1F6AB 4M93B 4J12A 3T0EE 2AK4A 4KHXL 4L8BB 4XNQB 4WO4B 2BDNH 2BNQA 2NXYB 4KXZH 1J1PH 2NY0B 2GJZB 4NNXA 3DUUA 4L8CB 1KB9K 3REVA 2UZIL 4W4OA 4Q97A 4R90L 3T3MF 1SJHB 1ACYL 2HLAA 3EYOA 4EN3C 1T5WA 4M1CD 3QPQC 5DK0B 1UKQA 2LU4A 4G42B 4UTBH 1UG9A 4XCYA 2E8YA 3EOAA 1N6QH 2XKUA 1XIWD 3UTOA 1AXTH 4TUOA 5DLMH 1TZIB 3GMQB 3BN3B 4NRXA 4ZD3H 3V5KA 2WBJC 3V6ZA 1LDSA 4UMGA 1G7IA 3GKZA 3MUGA 3TLRA 4XNZC 1KFAL 2FX7H 3QZWG 2OTWA 1J05B 2Z31B 3DWTA 4QF1B 5CJOL 5JPNA 3RWIA 2R2EA 4H1LG 1KIUA 1UWGH 5E94A 1N26A 3AROA 3SDAA 1AGCA 2QSQA 3QEHA 4D8PA 2XN9E 1CFBA 3QQ4B 4JGJA 3PV6A 5TDNA 3S97C 4HZLA 2IAND 1ZV5A 4ZAKD 2AGJL 4Z7UA 3EGSA 1FORH 3OKYA 3X3FH 1JHLH 3FOMA 3MACH 4PJ5D 3U2SA 4R3SB 4R0LB 1FZKB 4CADA 2E9IA 3NABL 4HK3J 5JXEA 5D6DC 4Y4HD 5HHNA 1LP9E 4IOSD 4L9LC 3HB3C 1OCWH 3QO1B 4K94H 3V0AC 1MCFA 1ADQL 3P9WB 3IAGC 1Z9MA 1SMAA 3OKEB 5DDHB 4N0FB 1OSZA 2VKWA 1EXUB 1OGTB 3S3SA 3Q6GL 3ETBF 4ZSOB 3HI5L 1H5BA 4MDIB 4WWKD 1DBML 1G9ML 2N4IA 1UQSB 4MA8L 1AXIB 1YEEH 4HLZH 3KHOA 4M6OH 4YEEA 1A6AB 2GW5A 1N8ZB 4NZUL 5GGUA 2E7MA 4U1IB 1D9KC 5IWLC 2C7UB 4FQ2L 4PUBL 5J4MA 4I2XE 5LXGL 3EO9L 2YD8A 5ICYA 1X7QB 5C0AD 1XFPA 3EYUL 3HG1D 2FNBA 3ULVC 4WTZG 2IGFH 4LVOC 5I8KL 3VGFA 4MJIB 1TIUA 1F4AA 4Z95H 1K8IA 3OAUL 4JY4A 4LCIH 5KOMC 1A4KA 4X5XA 4LKCA 5LG1A 2VLKD 1MIEL 2MMXA 1I9IL 2DM4A 1LE9A 1PX4A 4F3FA 5DVKA 2MCG1 5E2VH 5DI8B 4AEFA 3IDNB 2DIJA 1ORQA 1YJDL 2FD6L 1JNHB 2JJWA 4ZFOA 2HRPL 3D2UB 2BCKA 1MELA 1YN7B 3DMMD 3RL2A 1X9QA 2DQHL 4U6YA 4X98A 1A2YB 2FJFA 1G1CA 2J2ZA 2VC2H 2DTSA 5EU6A 3VCLB 2YBRB 1AGFA 1UM5L 2ARJB 2IH1A 5ESQB 4XWOD 1CDJA 3SDYL 3W9EA 2Y07H 3INUH 3SDCA 4WUUA 4BQBA 3CFBB 1K4DA 4U7MA 5DEGA 2I5YL 3M8OL 5EIQA 3PGFL 4FABH 4JZNA 4M7KL 1XGTA 2WINA 4Y5YB 5C2UB 1JPSH 1ERNA 3HE7B 5FOJA 3LQAL 1UXWA 1RIUL 5KSBF 4LLVA 4KUCF 3V6OE 4M9PA 5B4MC 4F8TA 2AXHA 4DQOH 1I1FA 3F5WA 2NY6D 5DUML 1FL5A 1UYWH 2RAMA 3JV0A 4NO5A 4QNPF 5F71A 3LS4H 5FF6A 1JFQH 2X05A 4M43H 3B2UD 4Y19E 3CFCL 3WMSA 1E4XI 3Q5TA 4TTGA 5GGSA 3BO8A 2NW2B 3IDMB 4ODHH 1RUMH 1YY8A 2COQA 5C8JB 2OK0H 5T3ZH 2AEQL 1INQA 5HYJE 1AY1H 3PQYE 1PYWB 1Y18B 5D7SH 2IANB 1NEZA 5GJSH 4ZAKB 5HHOA 2GY7B 4PRPA 1ZLWH 2VZOA 3B2VH 3F6IA 1UM4H 1B90A 3WE6B 2KBGA 2Z92B 2YPVL 2Q3ZA 4ODWA 3JWNC 1XGQB 2BHUA 1O0VA 4Y4HB 4I77L 4RGOL 4KJPC 1MJ7H 3BDXA 3S96B 1YMMD 3HE6A 2ZOLA 4B7IA 2V9TA 3ZTJG 1NCUA 4NDMB 3NIFE 3RL1B 2QKIB 3QI9A 3T0VA 1X5FA 4NM8L 4WNQA 1MWAL 3QCTH 3GIVB 3QCVH 1LEKB 2VDML 4XPBL 1ED3A 4TVPE 3WIHH 4JZJC 1CICA 2QSVA 2HH0H 1PEWA 2GT9B 4QRQB 4XP6H 1CN4A 3PABB 3VE0A 3O3AA 3S34H 4P3WA 5C08D 3HS0B 4PJDF 3ALXA 3ULVH 4D9QD 3H3KA 1W0WA 1KCVH 4A6YL 1T83A 2A74B 1KXVC 4TULL 4P4KB 3HA0A 1KT2B 5D2NA 3IF1A 1U8IB 1IC4L 5GISH 3H9SE 1F4HA 4L1HA 2BNRA 3OXSB 5CD5D 2V5MA 1IGIL 1YDPA 1N5AA 1MCSA 4PJHE 3KXFB 1KULA 2J7LA 5DRZB 5T1DH 3O2DH 3FB5B 2VLKB 3G6DL 1S5HB 5L2JA 3SGJA 4OLUL 5C3LD 5HJ3A 3FT2B 4G8GD 4PB0L 4BH8A 2VO5A 4TPRH 1FL6B 3UJIL 4PD4K 5E6ZA 4NO0B 4PJEA 5IESL 4R6UA 5GZND 2W07A 1NL0H 5I19H 4XNXH 2DQEH 1K3ZA 3MV01 5FV2A 4BA8A 2F53E 3BAEH 1NAKH 4JR9L 1A6UH 2EKSA 3E2HC 4GRWE 1G0XA 4N9OB 5E2TH 2NZ9C 5JHDE 2DMKA 1FHGA 2XZQL 2CDFB 3G5YA 2JJUA 3X3GL 1SEQH 4XVJH 3MV8D 4HS3B 3GRWH 1H8OA 3UTPE 1R6VA 5ESVB 5GGVH 1EO5A 1LK2B 2GJ6D 1CD0A 5EO9A 1RZFL 4HC1L 5HHPB 3V0WH 2X09A 3O0RL 4OIIL 5TDOB 4JQXC 4GUPA 5SV3A 1GGTA 1T2QH 4IBLT 4ODTL 1U8MA 3I85A 2ADFL 4PTUA 4D3CL 5HD8D 1MI5B 2PO6C 1G7QA 3JWDC 4M1DH 1MCPL 3WD5H 5K59E 3G9AB 5DC9B 4QHNA 1RMFL 1TVHA 3O6LL 4DGYH 3FHAA 4GBXA 1Y6KR 3B8SA 4WEMB 2CLVA 4WW1B 1A7RH 2Y7QB 2OL3B 5HGBB 3LEXA 4I9WD 3E3QC 3VJ6B 1AGBB 5BXFB 5JHLL 1L7IH 2DI9A 3OKMB 5DXWA 4YXLL 4Y4KB 1D5ZB 4W4NA 4OGYH 4X4YB 5GZOD 4IIQA 3X14B 1RJYB 5J1TC 4NBXB 4M93C 1J8HD 3SE9H 3OGOE 1JNJA 3KJ4B 5D96B 5AZ2L 1X5GA 2FYYB 4WO4C 5E99H 5C3TA 4NQVA 2NXYC 3IFLL 2NY0C 1MCWM 3B9KB 3VFPB 4Z5RA 3OR7A 2VXQL 4PRIE 3D48R 5IB3B 4HPYL 4QHUB 2HT4C 3K46A 1JPST 2QR0A 4JFZH 4EVNB 2YWYA 3O8XC 5KSAD 2YXFA 1YEJL 5DA4A 1KTDB 5HGGS 2RGSA 4CAGA 3KYNB 4G80A 1NAMA 4YDLB 1S7QA 1GZQA 2BP3A 2EDXA 5T1LB 4U49A 1XF4B 5C70A 1ZT4A 2FEEL 3BMWA 2BRRH 1F4YH 4BZYA 1KG0A 4GG6E 3QDGB 2YSSB 2RFXA 4TOYL 3QZWA 5C9JB 3B6SB 3O4OB 5C08B 2JCCE 3K74B 1JF6A 3C6LA 4JO1H 4H1LA 4ORZC 5F7MC 1HQ4A 3PJSB 3O11A 3LVEA 4XMKH 3BMVA 1DEEA 5CJQH 1CF8L 3FO9B 1F11B 1Q9LB 1XF3A 5GS0L 4XPHH 3MLTA 4LVHB 1IAKA 3QG7L 5JQ6H 1NCWH 1S9YB 1UGNA 4PRBA 3GSQA 5JW4Q 4GRLD 1CGWA 4PRNA 4K9EC 2CKBB 5F88A 1A9EB 5B8CB 3RWDB 3ZT5A 5F3HB 4G8GB 4XXDA 2HLFC 4R0LC 1MLBB 4P5KB 1AFVL 4PLKD 3ARXA 3S3PA 1S7XB 5FUZL 3U79A 4S10A 3Q6FA 1IM9D 4YWGH 3TH2T 3RX5A 2AV1B 5M7QA 3S8WA 5C0BA 5BRZB 3IFPB 4G6MH 2WWMC 5FO7B 4EUPH 4NZTL 5E00B 3VI4E 2X44D 4EI5D 3MJ9L 2VDRH 4F33B 3O3BA 2W60B 2Y6SC 5JA9A 3A6OA 4OQTA 1MFNA 5E8EB 2A83A 4ZO8A 3VXUB 4BSVB 3BWAB 2E5EA 1GOFA 3DIFB 2GJ6B 4J3WA 4FQJH 3RY4A 3CU1A 1MCWW 5MP6H 1ZLUH 4QKXB 1U8HA 3JWDH 3Q1SL 2P8LA 4P46A 4WTZA 4LQFH 4HLZG 3CC5A 3OGCB 3WNPA 2DDQL 3V4UL 9CGTA 5ID0B 4JFFD 5D6CB 1XH3B 1AQDA 3PWPA 5ALCH 1HHIA 1IGYA 2OZ4A 2ZUSA 1KIPB 2QQNL 2R1XA 4LFHD 4FQ1L 4HUXA 2QQQA 3K2UH 4QRSA 2OCFD 4QLRA 3MBXH 5F1IB 1FPTL 1MQKL 2C3HA 2ZCLL 3A6CH 5BQ7A 1A1OA 2H8PA 3DBXB 1MAJA 4XVSH 3OAZH 2I07A 5FO9B 1NBVH 2UWEB 5EC2B 5JXAL 3D39E 4YHML 1A6ZB 4OD1H 2X4RB 4LSQH 1GYAA 1EK3A 5EWIH 5FGSA 5TE4L 1U3HA 4YHZL 3I6KA 5JW4N 3KHQA 4PRAB 3W39B 1P1ZA 5D71H 3BKYL 3ZTNH 1NGZB 2NY2D 5IB5A 1VFUA 2R15A 3GIZH 4O58L 3SKUD 5KSAB 3MLRH 1KUMA 2R56H 3CVIL 4TN9A 4G8IB 1JNNL 2AKRB 3R1GH 3O45A 5DMIL 3PP3K 1RPQA 4Y5YC 3HE7C 4HK0A 3O6ML 3CFDB 1MFDH 4UINL 2OP4H 4IDJH 4F9PC 3L3OA 4QYOB 4YBHA 1SJXA 2VMFA 4MCZB 2QTEA 1NANH 2DMBA 3OJMB 1EPFA 4NC1C 4GQ9H 5F6IC 1WFTA 3QJFA 5C0EA 2C1OA 1PKQE 5L9DH 5CGMA 1ITBB 4PJBF 3FFCA 5C7XH 3U48A 1X5KA 2XI9A 4FXKA 3ARBD 4KQ3L 2WUCH 1UCBH 2R0WH 2Y72A 1C8PA 3S3JA 1J0KA 4KVCL 8FABA 1NCAH 1SBSL 1MRDH 2EDFA 1YUHB 5EIIA 2IAMB 5DT1L 3JUZA 4NCDA 4GRLB 5GRVK 1S7WA 5K59F 3QDJD 2BVQA 1TENA 5DWUL 1A7PL 1E27A 3VXTB 3HCVA 5GJTH 3QEQE 1WZMA 3TA3B 3FOLA 1IQDB 1JVKA 1IM9B 4GS7B 3BXNA 1WBXB 1BJ1H 3P30H 4L8SA 4MZ2A 3CMGA 1KBGL 3H0TB 4NQCA 5TFSL 3RJQB 3ARFD 3RVVD 5JQHC 2VJXA 2C4XA 5TQ0H 3WKMH 3I50L 1IJ9A 2ICEB 3RNKB 1WSST 2F5BH 3T4YA 3HZYA 4NKMA 1NGWA 1TZGL 5CEZE 3WEXB 3L95A 4U1JA 2ZUWA 2KUTA 4PJDA 3ULVF 4H0HB 2LTQB 3L9RA 1W2KT 3UJJH 2HN7B 4MWFB 3LV3B 2VIRB 1QLEL 4P4KC 2MCPL 3WIIH 4GH7B 4O2EA 4AM0A 3O6KL 4JFFB 5IB1B 1P9MA 5CD3A 4Z0XB 3U6RB 1QRKA 4QRRB 5ICZB 4C55A 1P7KB 2VR4A 4YXHH 5SWZB 5CBEB 4O02L 1LK3H 5CIPB 2IPTL 2SEBB 2BSSA 1JNLH 4M8VA 2OXGA 3GSNL 4GKNA 3VXSA 3EFFA 3RKPA 5J1AA 2NY4D 4JFDA 4WY7H 4YDVB 3IDGB 4KK6D 1JIBA 3ILPB 4PJXB 1DVFB 2NY3B 5LJYH 4MNQE 3C2SA 1NJ9A 1C5BL 2E3VA 4F7PB 5C0IA 2XWJB 1DBBL 5FB8B 5FXCH 5IT2L 5DJ6B 4NWUH 5ENWA 1DQTA 1NBZA 3OPZH 5BW7C 3N85L 4WFFD 4U6TA 1T20B 1AGEA 4IRSC 3B8YA 1H3VA 2I60L 4OT1L 4OLVH 4OCXL 4AG4L 2IBGA 4NUGH 3NBNA 1QRND 2OR8A 1FBIH 4XBGA 3T2OA 4Y7MA 1CD1A 1YMHA 1BBDL 4YHPB 3U0WH 4V2BA 4XP5L 5FOBB 2VRAA 3V6FA 4XX1G 2A9NL 5IKCB 5KW9H 5GIRB 1AP2A 4NNPL 3UTTA 1JN6B 1CGYA 2DWEB 2ICCA 3SKMB 3WN5A 5EA0H 1D5XA 2ICES 4PP1D 4AEHL 3TIEA 4AH2B 3MOBL 3ARRA 4MA3A 3ZZ1A 5EUOB 4KK8D 1EGJL 2IPKA 3D85D 3HMWH 4JREB 5EBLA 3FQRB 5E2UL 4Q74A 4MYWB 2YPLA 4Y4KC 2XOTA 5D2NE 3HPLA 4HJGA 4M3JA 6FABH 5IFJA 3BIKA 3FTGB 4TTDD 4OCSL 3KJ4C 3D9AH 4X4XA 1J8KA 2D7MA 4E41B 3B9KC 3QIWA 1DDHA 2YD1A 4OZHB 4OGAD 1BWWA 1LO2H 1J0IA 2DQGH 3HZVA 4HUUA 3IFOA 2VTFA 4FQCL 5EFIB 5FM5O 1KNOB 3ZDXE 4NO2A 1J87A 1PSKH 5CSZB 1ZS8A 5B38B 3BH9A 3MLZL 4MAUL 1V05A 3LZFL 1NLBH 4CVZA 2D3VA 4PGEB 4HDIB 1FGVL 5EC1B 1G1YA 1K9TA 4RMSA 4IMLB 3V4VH 4IRJB 3O4OC 1E4WL 2YS4A 4DN3L 1KJ3L 1IKFL 3B5HA 3RDTA 4WHTA 4LAQL 2IQAB 1ZEAH 1WWWX 5E2JA 4HSQA 3GJEA 3GBML 4MD5A 2JB5H 1B0GB 4GFTB 2YD9A 5DC4B 1BFOA 2MPAH 3BEVB 5HYSB 4LVHC 1INDH 5EBGA 3GI9H 1T5XA 1QEWB 1U6AH 3SO5A 1JPTH 2XTJB 4ERSL 3QHFH 1RI8A 2OS7A 4LPTA 4I0PB 2HVJA 3DYPA 5E7BA 5B8CC 2FGWL 5EBWB 2B1HH 2UY7A 4P5TD 1RIVH 4X99A 2Y4SA 3RWGB 1PZ5A 2NY4B 5C6TH 2FX9H 3QQ9D 3ULUC 1RJZA 5CZXD 3NACL 3QIBB 5L8KB 1MIML 4PY7A 1BD2B 5D7LD 2L7JA 1NUFA 3L6FB 3RWJA 2J88L 4JJ5B 5DJCB 4LPCA 2WIMA 5EUKA 4JQVA 3B4NA 3DLQR 1DFBH 4ZUVA 1N0XL 2VLRD 3ILQC 3ZE0E 3VGHA 2XA8H 3C60D 3AREA 1T0MB 4HXBH 3KPRB 5HYEA 3WSQH 5DHVB 3MRBB 4PJ5E 1KPUB 4XVTH 1KEML 3LN9A 2X4NB 2OL3H 3NFNB 4JN2A 4L4TA 3TZVA 1KTRL 4CVXB 4K71C 4ZFOL 3QHTC 5JTWA 2HFGL 4NC0B 3LEVL 3FMGH 5IHUL 3P11H 5H37H 4ZS6D 3RTQD 1QLRA 3LKSB 3U0TA 1QR1B 2CLRB 4MJ5A 5I1JH 5HHQB 4EZMA 1FE8L 1V3MA 4ZS7L 4YIQA 4BFIA 4Q9QH 4XTRD 3I75A 3HUJE 1S78C 1IGMH 4OCWL 4XPFH 1H3TA 5TGBA 2A1WH 2EDKA 3EAKA 4PJ7E 4EI6B 4EN3A 1EFQA 4NHUA 3W9DA 4JN1L 4QGYA 1E28A 2IALA 1MVUA 4Z78A 3ME0A 4NJ9L 3O4LB 2V6HA 3LKNB 5C0AE 3HG1E 3VFOA 2NW3A 1RQ5A 4YGVA 5CP7B 2BSRA 2WBJA 1MFCL 1U8JB 5F89B 2H2SD 1R3JA 3RWCB 3T4AA 3TO4B 1H3PH 5CUSL 5KOVC 3NIDE 3MCLL 2I9TB 1XCQB 1IAOB 3W81A 4PJ8B 1DL7H 4Z77A 3K4AA 3OKKB 1XGPA 5T1KA 2FWOA 3S37X 1BBJA 1DQML 2A73B 4OI7A 3AFLA 4WJ5B 3AVEA 2FB4L 4PJBA 3L5WB 4PGCA 4TQEL 2B0SL 2CKBH 3K2MC 1YPZB 4GOSA 2XFXB 4OCMC 1GIGH 3BZEA 1JZ7A 4WHYH 4Y8DC 4Q9RH 2G9HB 2HMID 4G8EB 2IAMC 2EIZA 1F2XK 3A0OA 1GC1L 3STZA 4JGMA 5D6DA 3BSZH 2HJKB 3LEYH 4LBEB 2ATKA 4L9LA 4WFHD 5JOFB 2PYFB 3QPXH 2IFFL 4GAJH 1W0VA 1R0AL 5DD6A 2V5SA 3DVGA 3TA3C 1LO0L 4XCNB 4UV7H 5FM5M 2XICA 4J1UA 3GSWB 1ES0A 5A2LH 1K2DB 4JPWL 3X12B 1UFUA 4OCRL 4FHBD 4Y16D 5D7LB 1YEFL 4C54A 4YAQB 5HTSA 5I8CB 5HI5D 3O3EA 4LCYB 3WIHA 2GSGB 1KIQB 1G7HB 1BZ9B 3MV7A 4X7TB 1QD0A 4XB8A 4OM1H 1D9KA 3QNYB 5IWLA 3TBYB 4U6XB 3T77B 4P59H 2Y5TB 4LSDA 4U1NB 5E4EC 1RFDH 4L8DA 4DFIA 3VWKD 2VDLH 3GFUA 1UENA 2R0ZL 1Z9SA 4JRYA 2VLRB 3JV6B 2LTQC 3QDMB 2N7BA 2XQBH 4XP4H 1FRGL 3PXJA 1IAIM 4ODXA 1KJ2B 5E5RB 5KN5B 3D18A 5FCSH 4ISVA 4BZ1L 1JZ5A 1NSNH 2F9BT 4C83A 4K7PH 1YQVL 4PLJD 4O2CA 1CDBA 4JJHA 1FAIL 5DQJA 5DTFA 4JVUA 2BVOA 2I26N 4HEPG 2CMRL 3O2DA 1U8LB 4W81A 1Q72L 1YMME 4O4YH 1FL3A 4YXKH 4HJJL 3K1DA 1I8IB 4KRNA 3KYOB 2Z8WC 1IMHC 5GXBB 5LWYH 1JRHL 4UV4H 1G7PB 5B3JE 4ENEC 3THML 2P24B 3OKDA 1CBVH 4ZQKB 3L3IA 2FSEB 4XPTL 2QSCH 3UBXB 4J3TA 2ZUUA 5C08E 1DVFC 2NY3C 1FDLH 4P3DA 3G04B 4FQHB 4YDIL 4D9QE 2X1XR 1DLHA 3SDXB 1CQKA 1J0YA 5FHBH 1HHJB 5CMAA 1OTSD 3FN9A 4IMKC 4PS4H 3STLA 2X2YA 2VN7A 1F6LL 2V7NA 3DGGA 4N0UB 1DBJH 1BQHB 3GRWA 2VYRE 1H3GA 4R4BA 4EKXA 2V9RA 4P49A 3GJFK 4MJ2A 2BY3A 2P5EE 3S35L 2DQJL 1LE5A 1NPUA 4FNLL 2ZOKB 4NRZA 2WK2A 4N1EA 2X41A 1B4JH 1HH6B 4G8GE 5FM8A 2QQKH 5AYUH 2XNAA 1PFCA 3VFVB 5D7JD 4ONHB 4JY5H 1DUZA 1RULL 1OWRM 2VN4A 4QY8B 2MQ0A 3GSVB 4RFOH 1TCRA 2DLHA 5DHXB 1OAYL 3F65A 4L4VA 4UIMA 4OFDA 4P2RB 3BPNC 4JRXB 4X6EA 1B6DA 5TJWK 3MRGB 3SCMD 4JREC 5ERWA 5J3HC 4X5WB 3SO3B 1L9MA 4PJCE 1MFBH 1MJJA 1QFWH 3MV8E 3QH3A 4KVNL 3TV3H 4LSSL 2X4TB 1QKZH 2VQ1B 3WFHB 2AJVH 1RUPH 1BVLB 3I02B 5H94A 5BZDA 4JFYA 4NQTA 1HI6A 4G7VL 4HWZB 4Z7OE 1C08B 4XVUD 1MHPL 3HUJF 1IFHH 4JZJA 4OAWB 4CVUA 3PDGA 1JUFA 5D72L 5IF0A 1A6VH 1JV5A 4JHWL 2BNUB 3VW3L 4G9FE 3KPNA 3BD5A 5CBAA 1DJSA 3QXTA 1KJMB 3IXTA 1P4BH 5BO1L 2VR5A 5DRXA 4C4KO 2NLJB 4AIZB 3WNMA 5DQ9A 4FQIH 4JG1H 1C16B 1XT5A 3KLHC 4I9WE 4QTIH 3L1OL 4IRJC 3IDIB 1A6WL 3CUPA 2P44B 1JWUA 2M8XA 5D8JL 3EYFA 4KI5D 2YK1L 2JKXA 5JW3L 3RWEB 3SE3C 1J8HE 4HKXA 5D1ZB 4L29A 4OKDA 1EO8H 2F54E 4MDJA 1I9RH 2GI7A 3L3GA 5CIPH 3I9GL 4CN6A 5T5FH 4NO3B 3KYMB 2XTJC 3HRPA 2VE6A 4I0PC 1MY7A 4GO6B 4LSPL 1H9VA 3SKOA 3QHZL 1ZT1B 1MJUL 2ICWJ 3MA9H 4Z7WE 4OQTL 4RRPG 2OJZH 1GGIL 3QO0B 3PWJA 1C5CL 4P2QA 4XP9L 5MENA 4I4WA 4Y5XA 2NY4C 5I6XB 1LEIA 4NKIH 5IMKA 4C58B 3DETC 3VFNB 3E0GA 2R69L 4U3CA 4OFYA 1RUAH 5I2IB 3QIBC 3JVGC 1HQRB 3QXAB 4HMDA 2IBBA 2YPLE 1ACZA 2EH8L 3G08A 1T66C 1GCFA 4G6JL 7CGTA 4HD9A 3MRPA 3T0WA 3F7VB 1IZJA 4I5BA 1T7YA 4JQXA 3VDCA 2OZ4L 25C8L 3EOBA 1JTOA 4UB0L 1A6TB 4HQQL 2O5YL 4JZOA 5I73B 2PO6A 2V2WB 3LQZA 2FX8L 1OAUL 4JDTH 5DMJB 1M7IB 4XH2A 3BOVA 4KKCD 1SHMA 5ABDE 4ZXBC 5HBBA 3O9WD 1JYNA 5D7JB 3QFJA 3ARGB 4DAGH 4M7LH 3WS6C 1NCBL 1HYSC 4FQQA 1D6EA 2YUZA 3S36H 3QUZD 2Z93A 1K5NA 2R23A 3BP7A 3KWWA 4JDZA 1UB6A 1F6AA 2R2BB 3O6FB 4JKPH 1K8DB 4XNQA 4P2OD 3U4BH 4WO4A 1KOAA 1CLZL 2B4CL 2GJZA 4GQPH 4L8CA 2YKLL 4TNWK 1NGQL 1G84A 1TJGH 2VAAB 5HHVH 3SN6N 1FFQA 1SJHA 5CP3H 4F58H 3O8XA 1P7QB 5GGTH 3BI9X 1A22B 5DK0A 5KVMC 5DSCB 2AK1L 4M8QB 2EC9T 4G42A 3B9VA 4WV1B 5EORL 3MBED 4U2YA 4YBLB 4JFFE 3EDKA 1TZIA 3GMQA 1IEHA 1CL7I 4ZUTA 4NCC2 4EJ1C 12E8H 4QWWD 3TO4C 4MXVE 3RA7H 5K9KB 3CFKB 1J05A 2YD6A 4QF1A 4F7MB 4MA1C 5LBSH 3ZT6A 5HY9B 4PJ8C 2AJUH 4XNMB 3MRLB 3QXVA 4NQDB 1HINL 5T3XD 4NPYB 1YY9C 1MREL 4KGJA 3QQ4A 2EE3A 5INDB 4LARL 1ZTXH 3BPLB 5E5MB 3FAXA 4LU5H 1BFVL 3MREB 4R3SA 4R0LA 1FZKA 2P8PB 4RBPK 4HCRH 5KVEH 2X4UB 1WK0A 1GL4B 2EXWD 4WHYG 3GJFB 1TNNA 4X9BA 5DD5H 3W0WD 2MWCA 1OF2B 2AJYL 5DD3H 1S7UB 1PLGH 3QO1A 1C5DA 3VFTB 3OKEA 3HNSL 1RIHH 5DDHA 1DCLA 1EZVY 2GQHA 3SJVD 4N0FA 1UKTA 4QHLB 4R96A 1EXUA 1OGTA 2C3VB 3BP6B 4LEXH 4O5LH 3OKNB 4XBEL 1YEHH 4ZSOA 4MDIA 4GW1B 1KPVB 3C5SB 5JUEL 1UQSA 5GGSY 2EE9A 4Q6YA 3E8UH 4Z7QE 4YFDB 1A6AA 3UC0H 3CJJA 1N8ZA 1IC7L 4DW2H 3BRGC 5DK2A 3TCLB 3VFWB 4Q6IC 4U1IA 1Y6NR 5DHVH 4ODVL 3VRIB 1D6VL 2C7UA 1MH5A 1YNLL 2FATL 3V7AE 2CR6A 4KQ4H 5DJXB 1X7QA 5DGQA 4U6HB 3QDJE 5F9WB 4MJIA 3SKJL 1RU9H 4U4BA 3SDDD 1KB5A 1XGUB 4I48B 5DFVD 3WNLA 4NJAH 1DUYB 5IR1B 5L7XL 4ONOA 2AI0L 2X5PA 4K2UL 3TFKD 4PPTA 3PGDB 2D0HA 5GQBA 2BFVL 4DGIH 3IDNA 4OV5B 3DGCR 4U1GB 4H20H 4JFOB 3V5HB 3UZQA 1JNHA 5DC0A 2UWEF 1XGYH 2BSTB 2E6PA 3SE8H 5IVNA 3D2UA 1YN7A 2XZCL 1A2YA 1RJCA 2XPGA 4X6DE 2D0GA 3VCLA 2ARJA 5ESQA 4OLXL 4G43B 4LP5A 3TN0D 4Y1AD 3CGTA 3CFBA 3PL6D 2CO7B 1KJVA 1Q9OB 4LLDB 1MVFA 2EH7H 4M61B 2VDKL 3MBEB 4Y5YA 3HE7A 4NN7B 1EFXB 1TVBB 5ISZD 1H8NA 2CXKA 2EO1A 1IGCH 4F9PA 3GMLB 1B4RA 4PJGE 1QPPA 1WV7T 4F57L 3NN8B 1CGSL 1P6AB 2RCSH 1R3KB 3KJ6L 5DJ8B 5BZWB 5IB4B 5CGTA 5GGQH 4M7LT 2ZP0T 3L5XH 1QBLH 3N1MC 5EZIH 2RB8A 1N2RA 5ITFB 5HDOA 1CGUA 4X0KB 4YK4B 3DXAD 2NW2A 2YA2A 3IDMA 1RURH 5HI4D 5FO8B 5C8JA 3VGEA 5LQBH 3CCHB 1J1PL 1MCLA 2BVPA 4W6WB 1Y18A 4D0BB 2IANA 3BFOA 4XNUH 3WE6A 1NLDH 2Z92A 3BDYH 4WFFE 4E0RB 3SO3C 4RFEB 1VEPA 4MNGB 4UTBL 1GGYA 5IV2B 1U93B 4U0RC 1RZIB 1N6QL 4RZCB 1QRNE 2B20A 3S96A 3WXWH 1AXTL 1KXQE 4J23A 3WLBB 2Q87A 2MHAB 4NDMA 3RL1A 1KTLB 2QKIA 2EDLA 4ZD3L 1SMOA 2X4QB 1T6VN 3GIVA 4I3SH 1LEKA 5JZ7D 2HT3D 5FHAL 2EICA 4QRQA 2GT9A 3RGVD 3HPJA 3A6BH 5I74B 2MFNA 4JB9H 2ZCKH 1CDUA 3PABA 5IQ9A 5A43C 5FCUL 3S5LB 1MFEH 4GW5B 3I3DA 3V52H 2J1KA 3MJGX 3HS0A 1AKJD 3OB0K 3UX9B 4QOKB 2A74A 1KJ2H 4MJ4A 1EHLL 1OHQA 1W72A 3NIGE 4AT6B 4P4KA 4TYUA 2WW8A 3EJYD 1KT2A 2GFBB 1AJ7L 5I1DB 1PKOA 3AM8C 2P7TB 5I71B 1CIDA 4Z9KB 3OXSA 1FORL 4ZUUB 3MACL 3KXFA 1QBMH 5DRZA 3SDDB 4DZ8B 4BZ2H 3FB5A 5D1ZC 2VLKA 5ID1B 5INCB 4KZDH 1IT9H 3FT2A 1LDPH 1OCWL 4OZGE 4N9GB 4OZIB 4NQED 2BOBB 2XT1B 2XWTB 4NO0A 4RRPA 1B0RB 3OG6B 4OFVA 2W9EL 2D03L 3ZO0A 3CZJA 4ZYKB 4PJXF 1AO7B 1TDQA 1F58H 1ZE3C 1BF2A 4OD3H 2HRLA 5MEPB 4G6KH 3NAAH 5I6XC 2CDFA 4ONGH 2D31B 5EDXA 5BW7A 4Z7VE 2JIXD 1JHTB 3C9NB 4IRSA 2XRAH 4X4ZA 4HS3A 2RQ8A 1V8HA 3TN0B 4E42B 5KAQF 3DO7B 1JF1B 5ESVA 4PJAB 2EXYD 1LK2A 3PL6B 1ZHLB 3HI6L 3RP1A 2E6JA 5HHPA 1KENH 1T3FB 2KKQA 5BV7B 1J7VR 5KAQG 5ISZB 1BQLH 2JF1A 3HKFA 4LCIL 3VXPB 1ZGLA 4FOMA 1MJ8H 2EKJA 4FQLH 4GT7A 4WHCA 1MI5A 4X4MA 1LO4H 4MSWB 1YEKH 5I73C 5ANME 3AMLA 1N3NB 5E6IB 2DYPD 2P1YA 4MAYD 4RMVA 2MJWA 3WS3B 3W2DH 5E2VL 3HAEH 3P9MB 3F58L 5HGBA 4WW1A 3S4SG 2Y7QA 1OB1B 2OL3A 3VRLE 3B5TA 4NZRH 3V4PH 1VGKB 3ARGC 1RJLB 1AGBA 3GHEH 4R4FL 3VJ6A 5BXFA 2NPLX 3WNNA 3TJEH 3OKMA 3J8F7 1Q9KB 1FVEB 3MXVH 1ZWIA 3N1PC 4Y4KA 1D5ZA 3HHRB 4RA0C 2FEDD 5EZJA 5HDQH 5MI0B 4X4YA 4JHAL 3X14A 1NMBL 1RJYA 3AXLB 4HAGA 3TO2B 3O6FC 5AG9A 2A77H 5TH2B 3D5OF 4JFXB 2NY5H 2FYYA 2QLVB 1ROWA 3SBWC 3B9KA 4FQPA 5J57B 4KC3B 3LPFA 3VFPA 4OZHF 5IB3A 5DMGD 4QHUA 2OSLB 4YHIB 1OGAE 3GGWB 4X6CB 4EVNA 3ES6B 3MMEA 5CINH 1JPSL 2VLRE 1KTDA 1KF9B 3VH8B 3KYNA 5D2LE 3QUMB 4FZ8L 5T1LA 5B38G 1UYWL 1XF4A 1CT8B 4WV1C 1NEUA 3VXQA 3LS4L 3FT4B 4YBLC 2KL6A 1JFQL 4X6DF 4P23B 3QDGA 2HVKB 4R26H 2DN7A 2YSSA 4ZPTB 2D4DA 5C9JA 1CGXA 5I76B 3TT3H 3FO0L 1TPXC 5DMKB 2PYED 1MCOL 1BM3H 1P53A 3H42H 4ODHL 1RUML 3PJSA 1HH9B 2OK0L 5T3ZL 1RK1B 2CK0H 3CX5K 4LSVH 3W5NA 3FO9A 3RIFK 1F11A 1AY1L 5D7KD 1Q9LA 2K7QA 1HK6A 2H26B 2OR9H 5GJSL 5L2KD 2NX5B 3GMNB 5BS0A 4V1DB 5FYKH 2YD2A 1S9YA 4NM4H 5IK3A 2VDPH 3B9EA 3OL2A 2B1AH 5HYSG 4JFED 4LQ1A 3HMXH 4QRPE 2CKBA 5HDBF 1A3RL 5B8CA 3ZHKA 3RWDA 2LAGB 2VWEC 4BH7B 2FJHB 1JRHI 3RNQB 5F3HA 1I1YB 1S8DB 1QFPA 3RVXD 3CZFB 1MJ7L 2W65A 5ELIA 2NXZD 3IKKA 1MLBA 4P5KA 1FAKT 4NQEB 4WFGD 1S7XA 4LIQE 2Q3AA 3IDYB 3PF2A 2AV1A 4AY0A 5IROC 4QO1A 3IFPA 5BRZA 3WIHL 4FFZH 2VUOA 5FO7A 3DV4B 2HH0L 4XP6L 5JO5A 4DKAA 1HSBB 5E00A 5C0JA 1CU4H 3S34L 1S9XB 3S9DB 4D0DB 1IARB 3UPRB 3JV5A 3SGEH 1NBYB 2W59A 3ULVL 5E8EA 3VXUA 4J8RA 4BSVA 3IGAB 3BWAA 3DIFA 4N8CH 4PY8J 3EYQC 4V2CB 2R8SL 4GXVL 2GUOB 4C56D 3DV6B 2GJ6A 1T1XB 5GISL 5F9JB 4PJIB 3VXMD 2APFA 1FYTB 1U58B 1B6UA 4YX2H 4WCYH 3OGCA 4LVNB 2C9AA 5ID0A 1D5IH 2ZWLT 1NMAH 3NMEA 4MB3A 1XH3A 2DYPB 4MAYB 4KAQH 4WFHE 4TPRL 5A2FA 5FGCB 1KIPA 3JTSA 1VCAA 1NL0L 1LWRA 1KYOJ 4JO2H 2ESVB 2P5WB 2DQEL 5F1IA 2C4FT 1P4IH 2JELL 4S1SH 1NAKL 5KS9E 3MQIA 1CR9H 1UACL 5FO9A 4U1GC 5D1XD 4A2MA 1OT2A 2UWEA 4IRZH 5EC2A 1WAAE 1SEQL 1OTTC 4R8WH 1A6ZA 3NCJH 1AD0B 2X4RA 1OWWA 5DZNA 1YEIH 4DVBB 1NC4D 1NGZA 1GGCH 4J4PC 1CG9B 3FONA 3FT3B 3R8QA 1BPVA 4G8IA 5F9OL 4G3YH 2AKRA 4KK5D 4MMZC 1KACB 1T04B 4HG4K 2KQMA 3V6BR 3MBEC 4NN7C 4M1DL 3WD5L 1OAQL 3CFDA 5HGDB 4Y4FB 3MOAL 4QYOA 1INEL 4DGYL 4MCZA 3DX7B 5F9AC 4M6NL 4EDWH 4TNVF 4P9HH 1L7IL 4OLZH 5F7FA 1ZANL 2YA1A 1YPZF 1P4LB 2EEDA 1F42A 4YK4C 3SE9L 3FB8B 2P45B 3QIUD 4ZFZB 1YUHA 1FO0B 4HIEB 5E99L 2IAMA 1SJVA 1CLCA 4JFEB 2PCPA 3WO3B 3GJFH 4N5UA 1NGPL 4X80H 1O7SA 2W0KA 4YFLF 2DQDH 3SE4C 1F02I 4JFZL 3VXTA 1XF5B 3TA3A 1CXHA 6CGTA 4M62H 1IQDA 1YZZA 1BZ7A 1WBXA 1TTUA 2JK5B 1A3LH 3H9HA 2BRRL 3H0TA 2OI9B 5C0GB 2R4RL 1JGVL 5DEFB 4WI8A 2ICEA 3RNKA 1MCCA 4RGND 4G6FD 4Z0BH 5I74C 3WEXA 1G9NH 1MCRA 5D9SB 4C56B 1BVZA 4QTHB 1WEJL 5JQ6L 4MWFA 5D1QD 1KN4L 3LV3A 5D2LF 2MQ3A 2VIRA 2XG5A 2CGRH 3UZEA 5FDYA 2BXYA 5IB1A 5I71C 1CXKA 4Z0XA 4QRRA 5ICZA 1WCBB 1CLOH 1P7KA 1RHFA 5SWZA 3T0XA 2CDEB 4N90D 5CBEA 3RWHB 4NC1E 4YWGL 3V8OA 5CIPA 4PR5B 1PG7X 2QADD 2SEBA 2ZUQB 3TYGH 1QO3B 2DRUA 3SDAC 4YR6A 5FUOL 1YYLL 1T0PB 2AABH 2XG4A 5EOQH 4ZOCA 1MNUL 5D1XB 3U1SL 4YDVA 2YMXH 3IDGA 3ILPA 4PJXA 1DVFA 4L3EB 1FLRL 3MCG1 3SDXF 2OR7A 3UBXG 4F7PA 5GRJH 4IMKA 5FB8A 1CFVH 1U36A 2H9GB 3H3PH 4BM7A 1FCCA 2ZUVA 5MP6L 1T20A 3JWDL 3EO0A 4BQCA 2D9CA 2ILLA 3DRTB 4MD0B 4DK3A 1TXKA 4LQFL 4KI5E 1BQHG 3IJHB 3T0ED 1ZK9A 3FQWB 3PNWB 4UQ2B 5DS8B 5FOBA 5ALCL 3MLYH 4JM2D 5C0CD 5IKCA 5GIRA 3UYPA 3TEUA 2DWEA 1KLGB 1PD6A 4YDKL 5E6IC 3SQBA 5DYOB 3O41B 3MV9D 3S4SA 1JYVA 4AH2A 4HULB 3EHBC 1FH5L 1OT1A 4P48A 5EUOA 4OBRA 1OD9A 2BX5A 1ZAGA 5CILH 5I1CH 1NBVL 5I1EH 1BJ1J 2GCYB 5ESAB 5L6YH 5FYLH 4WHDA 2VLMD 4LSQL 1ZT7B 4O51B 5EWIL 4PB9L 5MI0C 3K3QA 4OI8A 3FTGA 3MOQA 2F58H 3CD4A 3VMPA 3CFIC 3LSOB 2J5LC 3MLRL 1RZ7L 2R56L 1MUJB 4E41A 4MA7H 4PJ9D 1UA6H 1Z3GL 4HUWB 4OZHA 4R2GB 3R1GL 3MCKB 2H1PH 3VGBA 3ESVF 4NOBA 4B0MM 4TSAH 1KNOA 1KCLA 4OV6F 4CU7A 4OD2B 5CP3A 3HC0B 4JGUA 5SWSD 5CSZA 5GGTA 5B38A 2J6EA 2K7PA 1KN2H 1BZQK 4KJQC 1MFDL 1MHCA 5L8JB 3QUYD 3VFSB 5IHZB 1WAAF 2WAHA 2AJ3B 5AWNL 4PGEA 1A1NA 4HDIA 5FFLA 1J1OL 4RCAA 5EC1A 4IMLA 4P23C 4P4RB 2A6DB 3BT2L 4IRJA 4K9EL 1G6VK 1DANT 1H0DB 4KMTH 2X4OB 1HHKB 2WUCL 2R0WL 5C71A 2IQAA 1MRDL 1VPOL 1T1YB 15C8H 2FIKB 1OM3H 4RX4D 4AEIH 2QV2A 4OB5H 4PJFE 4KTEH 2IEPA 4QXGL 3U7AA 1B0GA 43CAB 4RAUB 3U36B 3BEVA 5HYSA 1VENA 1QEWA 2VLLB 3VRJA 1F90H 5GJTL 4I0PA 4HKBB 1Z5LB 2AVGA 1ZHBB 3MX0A 3OF6A 1FV1B 4M5ZL 5D70H 5EBWA 5F97E 3QSKB 3D25B 4FTVB 4HMEA 2K3TA 1GHFL 1IC5H 5DRWB 4PRHB 1HWGB 4HCRA 2DD8H 3RWGA 5F21B 1B2WL 2IFGA 4N8VB 3IDYC 1EJOL 1VHPA 4P9MH 4YE4H 5H35A 3TJHD 3DROB 3CH8A 3QIBA 1ZLVK 5F7KC 1FCGA 2F5BL 1BD2A 4HBCL 4XHJD 3OBAA 3L6FA 3GO1H 4JJ5A 1T1ZA 4S0SD 2HKHH 3PWLB 5E7FA 3TT1H 1ND0A 2VLJA 5BV7H 4GLRH 4U3HA 4LLUB 1HHHB 1I1AB 3UJJL 4RBPH 5T3XE 4NCC1 5J11C 4F37F 4DZBB 5ADPH 1KB5L 3HE6C 1MWAB 3QP3A 4UDUB 4HX1A 3ZDZF 3MFGB 4Y2DC 3MNVB 1DANU 3WIIL 1UZ8B 2EZ0C 4N0YL 1V3LA 3QI9C 4KRPB 3T0EB 1T0MA 1I3GH 3KPRA 4CN1A 4HPOL 2AJSL 3MRBA 1BIIB 4YXHL 4MZ3A 1KPUA 4ZOEA 4BK4A 5K9JH 4LVNC 1LK3L 2X4NA 4Y2OA 2N1KA 3NFNA 5BOZG 1A7BA 4CVXA 1JNLL 4MAYC 3W0WE 1FVCB 2APWA 5GS0D 1T83C 1WTLA 3T2QA 3P4MB 3O3DB 3D3VD 3LKSA 4DKFL 4WY7L 4U7SA 3SJVE 1QR1A 2CLRA 4U31A 5HHQA 3BN9D 1JHKL 4LHUG 5DJDB 2CJUH 5AUMA 4KKBD 2CR3A 2PN5A 1C1EH 3W5MA 1WVZA 4WU5B 5BS0E 3HC3H 3IAQA 3OPZL 4EI6A 3BGFB 1FNSH 4LOUC 2IH3B 2DQTH 1KB9J 3L3KB 3ARZA 3QUMH 4UBDC 5I17A 2IG2H 2DM3A 1FBIL 3O4LA 1RK0B 4K3JL 4ETQB 1NDGB 1QSFA 4KHTL 2XN9B 3LAFA 3LKNA 1H3XA 5HYJD 3QUYB 5CP7A 4JDVB 4I3GA 3RWCA 3TO4A 2I9TA 3HLAA 1XCQA 2XY1A 1J1XH 1HDMB 4Y4FC 4PJ8A 4OZIE 1PY4A 2PXYD 1LP9B 5C09D 3HN3A 3OKKA 35C8L 2A73A 4ZTPL 3ARDB 3CXDH 3HMWL 3PDOA 1BMGA 4WJ5A 2JB6B 2F19H 2YUVA 3L5WA 5JW5B 1L6ZA 4P2YA 2HJFB 1YPZA 2XFXA 3FQTB 4YHOL 1U8KB 1HKLL 1YEDB 1S5IL 2HWZH 4F7TB 2G9HA 2CH8A 1U42A 4G8EA 4FFWD 4OKVB 3MLSH 2JJSC 4ZNEA 4Y1AE 2HJKA 1LO2L 5JOFA 4LBEA 4XI5D 5F8QC 3GSOB 2LQRA 1CVRA 5ISZE 1BJMA 4XCNA 4MLSA 4I2XB 1G7JA 2OMBA 2WLZA 3ZMRA 3GSWA 4RAVB 3DURB 1K2DA 2A6KB 3V4VL 3X12A 2OI9C 5D7LA 2A6IA 5E56A 1W72L 5E9DD 3H9ZA 4YAQA 1YN6B 4NKDA 5I8CA 4LCYA 2GSGA 1S3KH 5D7IE 3HI1B 1NFDB 1KIQA 1G7HA 1BZ9A 2IBZY 3DXAE 4X7TA 2MOVA 4XPAH 5D5ME 4Q6IA 3QNYA 1IGJB 3TBYA 5IMLB 4U6XA 3T77A 2Y5TA 4U1NA 4OCYL 5MHSD 4Q9BA 4RISL 3JV6A 2PTTB 2NY7L 2VISB 3CAFA 4W6XB 1INDL 3QDMA 3GI9L 3QHFL 3EFDH 5KN5A 5D93B 4HXAH 5DVNA 4F7EA 3RZCB 2EE2A 3RVWD 1T7VA 1RZ8B 5IGXH 2BOCB 3MJ8B 2B1HL 3T0BA 4YO0B 3RVTD 5JPMB 1CXIA 1RIVL 1U8LA 3UMTA 4EOWH 4S1RH 3ZHDA 2FX9L 3D3VB 4LCUB 1I8IA 3OB0H 3KYOA 4MHHG 5FUCE 1F3JB 4NZDA 1E4XL 1G7PA 1J0HA 3MRNB 4X7CC 2W38A 3MROB 4NQSB 1WIUA 2P24A 2EDDA 4ZQKA 1KELH 3UBXA 4UILH 4BYHA 4LCWD 2X89A 3EYSH 4FQHA 2YPKB 4Y19B 3SDXA 4UOW0 1QACA 1HHJA 3BEWB 3ABZA 5LGHH 5I15L 1R5IA 4N0UA 1BQHA 3BPCB 1F4XH 1NFKA 5HYJB 3PQYB 1R3IH 5IFAL 3GSUB 4NHCL 3P4OA 1FVDB 5I75B 3WBDA 2K1MA 2ZJSH 5HVFB 2ZOKA 2UVEA 5EOCL 3N1FC 1HH6A 1DQDH 3RVUD 3FMGL 1MCJA 3D6GA 3VFVA 3I3BA 3P11L 4ONHA 4ELME 3KPSD 1A7OH 1UWXK 3QUXD 4QY8A 3GSVA 1CTNA 1FO0H 3QFDB 1QA9B 4KWUA 3MO1B 1IGML 4P2RA 4JRXA 4XPFL 1A0QL 2XA3A 3TYFA 2A1WL 3MRGA 2VXVH 4PFEA 4NP4H 4S1QH 5JW4M 1BOGB 4ZO9A 4X5WA 4KU1A 1BECA 4HWBH 2ENYA 3WYRA 1A47A 1X44A 2AP2A 5CJ5A 2GTWB 2X4TA 3VGGA 1UJ3B 4APQD 2VQ1A 2WP3T 3WFHA 4K3DL 2IJ0C 2Q76B 1BVLA 3I02A 4E9LA 1OQXA 2I9LB 2W0FB 3PHOB 4HWZA 1FSKB 4R2GC 1ACYH 1C08A 3UTSD 2R9HC 1U91B 3H9SB 5CGYD 1J5OL 4OAWA 1QFUH 4PJHB 3WNOA 2G75B 2BNUA 1JGEB 5A2KH 3NA9H 1MHEA 5J6HB 2NQCA 1DL7L 1ULVA 1KJMA 2NMSA 4G9DB 2NLJA 4AIZA 5F1NB 1GGBH 5FGRA 3S5LG 1C16A 3P40A 4TNWF 2VXTH 5ALBL 4CNIB 2CKBL 4POZD 4KPHL 3IDIA 5DO2C 1I75A 3AM8A 1UKSA 2W9DH 1XGRB 2X6MA 2F53B 3NCCB 3PIQB 4Q9RL 3AY4C 3U83A 2PR4L 1T4KB 4GRWB 5D1ZA 1HWHB 5JHDB 4RWYH 4YGAB 4DTGL 4DFHA 3ARQA 2AK4D 3FRUB 3LEYL 2BNQD 3MSPA 3ULUL 1NFIB 4GAJL 4DKEL 3SGDH 4OZIF 3WFDH 3HMXA 5AYQA 2AGJH 4IM8A 4XGZB 3WIFB 1TETH 3OQ3B 1ZT1A 4N0CC 5GRWA 3MR9B 3G6JA 4HMCA 2Z35A 3NABH 2X10A 3QO0A 1FJ1B 1S7TB 4KMLB 4PD4J 1OQOA 1MCNA 3PHQB 2NZIA 4OFKA 3VFNA 1ADQH 4E5XB 1WFUA 1HQRA 3QXAA 3ARWA 2PYEE 4JPVL 4UNVA 1LD9A 32C2B 4PJAF 4PV8B 4P59L 1RFDL 3UEZA 4LCCB 2R39A 1MCIA 5D7KE 1YQ2A 5JNYB 4L5FH 1AI1L 1I1AC 4PY8I 4XC3L 3HI5H 2XQBL 5L2KE 3MLVL 4XP4L 5CFHA 1N0LA 1FNEB 5ICXB 4XCCL 3WHXA 1II4E 1A6TA 2D4FA 1NSNL 4PBWD 4JFEE 4K7PL 2D2OA 2V2WA 4KRPC 3DUSB 4C57C 3D39D 4TSBH 4FQ2H 4PUBH 4N5EC 1MCKA 4JAMB 1T80A 5LXGH 1LQSR 4PRIB 4R4ND 5D7IF 1B9ZA 4LGPB 5I8KH 4YXKL 4MQ7B 1WZKA 3ARGA 3QUXB 5I1AB 4B41A 1U2CA 3VD9A 5E1AB 1RY7B 4Z7NF 3V95A 5LWYL 1MIEH 1DBKH 3P4NB 5JXED 4LHUA 4XAKD 3VU2A 1CDGA 2HKFH 3LKOB 2R2BA 2W0LA 5DR5H 3MRIB 3O6FA 4JPIB 4NN5C 2QSCL 1K8DA 4FA8A 4GG6B 4PGBB 4G5ZH 3SBWA 1FDLL 3CVHB 3DVNA 5FHBL 2VAAA 1AE6L 2JCCB 4PS4L 2HRPH 1T2JA 2FJGB 2CLZB 3GSNB 3IS1X 4X6CF 5IW6B 5I1HH 1TQCB 4APQB 4XMPH 2FDBP 3NTCL 3KPLA 4TVSa 1P7QA 1DBJL 5LCVH 1QPXA 2NTSP 5DSCA 2NR6D 3KS0H 3VXME 1UM5H 4M8QA 2VOTA 5J0BA 3SDYH 5F7UA 4WV1A 2R2HB 3G6AB 2DQFB 1MEXH 3VH8G 4TSCL 3SKNB 3RUGE 4M00A 1L4IA 3PGFH 4UI2A 4M7KH 2QQKL 1J12A 5AYUL 5IW1A 3CMOH 1RIUH 3QEGL 1E6OL 3H3BC 5K9KA 3CFKA 3MRKB 4F7MA 5DUMH 1UZ6F 4B53A 4KROD 2DQIH 3GK8H 4XNMA 3MRLA 1JYWA 2AW2A 1J0ZA 4NQDA 4PBVC 4JQIH 4NPYA 1RHHB 3ARDC 4YHNB 3CFCH 4UAOC 4LMQI 2OTUA 3BZFB 5INDA 1QFWL 4KKLC 1HXYB 4NBZB 5E5MA 4BFBD 4X8JA 5C86A 2AEQH 2H3NB 3KGRA 3MREA 1I8MB 1TZHB 3DUUB 1KCUL 2P8PA 5SX5H 1RUPL 2O5ZH 3MODL 5EU6D 2ITCA 1NCCH 3GJFA 1JI2A 3VGAB 4UOJA 1CXLA 4HIIB 5DZLA 1OF2A 5IROA 1S7UA 3VFTA 3SDCD 3F12B 4WUUD 1OPGL 2QSTA 1A6VL 4I77H 1N4XH 3VD5A 1RV6X 3HC4H 2C3VA 3BP6A 3IRPX 3OKNA 2QHRH 3R4DA 4FQIL 3E6FB 3P0VL 4I0CC 3MRFB 5IB2B 1MWAH 3MUGB 1KPVA 3C5SA 4ZUSB 3CXHJ 5DMYA 4PJIF 2NCMA 1JTTA 2HT2C 3VFWA 3TCLA 3BKCL 5E94B 3VRIA 5DJXA 4A6YH 1NMCB 1QSFE 4U6HA 5IVXE 3KG5A 5SX4H 5HPMB 3D39B 1CD8A 1M4KA 4MXQC 1YECL 5D93C 1XGUA 4I48A 1J86A 2C3GA 1IC4H 1BAFH 1DUYA 3P73A 5HHOD 3RZCC 4PRPD 5IR1A 4HGMA 5F72S 1IGIH 3FOMB 1NDMA 1DQQB 3C09C 3LKRB 1KCRH 4FG6C 3MV11 5E8PB 4DKDC 4HJ0D 3SY0B 3PGDA 3G6DH 1LILA 5F93C 5K33A 4HS8H 2BC4B 4TRPH 4OLUH 5HHNB 4OV5A 4EIGB 3VXNA 4PB0H 4JFOA 3V5HA 4NKIL 1MCHA 1BVKB 1I4FB 1I8KB 2BSTA 3ZKMD 3UJIH 5C0RL 3MZTA 1RUAL 2VITB 1QBBA 3V6OC 3WHE1 4MVBC 1DQJA 4HLJA 1OSZB 2AV7A 4G6AD 4RGNE 5F70A 1WBZB 3N50A 2UY6A 1CICD 4YBQD 1QSEA 4TUJA 4J4PA 1EA9C 1PKQB 4G43A 1CE6B 1I7ZB 2KDGA 3QQ3B 1G7MB 2XZQH 5BMFL 1F2QA 3OHXB 4J6RH 1NANI 1EEQA 1Q9OA 3X3GH 4LLDA 2Z8SA 1BGXL 4M61A 2ZG1A 1T21B 3MBEA 1JZ4A 4D2NA 1EFXA 1TVBA 2Q7YB 4K94C 1NC2B 5A3ID 1RZFH 3GMLA 4HC1H 1U95A 3B5GA 1EEZB 1R3KA 2BNRD 1WBYB 4N90E 4OIIH 1PEZA 5I75C 4RMRA 1ZLSH 2XYCA 4DAGL 4M7LL 4JY4B 4U1SB 2ADFH 1M1SA 4LRIC 5I66B 3WUWB 4KROB 5ITFA 3U7YL 1ZHKB 4X0KA 3IETB 4RA3A 1XMWA 5FO8A 4JKPL 2V2TB 1JGUH 3U4BL 1Z0NA 3O6LH 2FBJH 3IDXH 4QCIB 3CCHA 5JIKA 1SYVA 2RHEA 4D0BA 3P9LB 4KK9D 3L3DB 5DGRA 5LVEA 4BJLA 1SYSB 5T33H 3SE4A 3WLWC 4U6YB 1U92B 1FFPB 3N9GL 4HS6B 2J6EL 4E0RA 3VI3E 1R3HB 1RZGB 4RFEA 1AGFB 4MNGA 4DWHA 5IV2A 1U93A 3BKML 5EH1A 1RZIA 4LLMB 1UJ3C 3GI8L 3IFLH 1JF5A 4RZCA 2EDWA 3WLBA 1MF2H 3W11D 2VXQH 4LPXA 2MHAA 3CDCA 4HPYH 1KTLA 3CSYB 5JIIA 2EC8A 1FSKC 4JZNB 12E8L 2ENSA 5C0CE 3UYRH 1YEJH 2X4QA 3UYOD 5IFHL 4LLVB 3AS1A 4CKVX 3F5WB 1Z9LA 5HHMD 3S5LA 4GW5A 1KC5H 2ADJB 3MV9E 3BESR 4NO5B 5LBSL 5A1AA 4HH9A 2GTZB 3K4ZA 1VKXB 1EZVX 4FZEL 2CSPA 4NC2B 3BZ4B 4QOKA 4BFGA 5EB9A 2DJSA 4GBXD 2GFBA 4GMTL 5I1DA 2VLME 1ZTXL 2P7TA 3QNZB 1AHWB 4XC1L 3RUGF 3WDJA 4MNQB 4ZUUA 1A1MB 1CF8H 1FNGB 4GG8B 3SDDA 4DZ8A 4RWHA 4IOFC 5GS0H 4HCRL 1C12B 1NEZB 3ZE1E 2ZNXA 5C07E 5ID1A 5INCA 3RKDD 1PG7L 2R4SH 4YFEA 1ONQB 4N9GA 3WUZA 3OB8A 5SWSE 2BOBA 3T2NL 1FZOB 1CWVA 1B0RA 4EDXB 4OGZA 4ZYKA 2ZOLB 1GJIA 1AFVH 3K8LA 1AO7A 4AQ1B 3UJTL 5FUZH 3QNXB 1YEHL 4JM4H 3RIFF 4BQ9A 2D31A 2HFEB 3E8UL 4XZUB 3WNKA 2XKSA 1JHTA 3C9NA 4K8RC 1FFOB 3UC0L 2J4WL 3VE0B 5B39B 5DURD 4E42A 3TVMB 3DO7A 1JF1A 4PJAA 1G7LB 3C6LD 5EU4B 1ZHLA 4ACPA 2DTML 1W0WB 4KQ4L 4MQXD 1T3FA 5IBUB 3I6GB 4LCCC 1IKNC 4BK5A 4XP1H 2DLTA 2WIIA 1VB9A 2DLIA 1GXEA 1RU9L 1DQLH 5D2NB 1M7DB 3VXPA 2YN3A 4NJAL 4NT6B 5E4IA 1MRCH 5IMOB 5E6IA 1N3NA 4ONFL 1ZLVH 1RUQH 1QR4A 3WS3A 2DDQH 1LHZA 4HF5L 2ADIB 3V4UH 3P9MA 4DGIL 2V17L 5HJ3B 5J6GB 5K9QG 2VDQL 4BH8B 4TVPH 1VGKA 3I2CL 4UUJB 5I0ZA 1X5YA 5DD0L 2EYTB 5GS1B 4FQ1H 1IE5A 1Q9KA 1FVEA 5DFTA 4ALAL 1MQKH 5C0BD 2ZCLH 2N56A 3AXLA 3TO2A 5TH2A 3TBWB 1I85C 4JFXA 4X6FB 4HIJB 4DK6A 2CDGB 2DKSA 4CMHB 4YZFF 1NFDE 4KKAD 5EBMB 2OSLA 4YHIA 5JXAH 3GGWA 4X6CA 1TQCC 4PIRF 4EXKA 1AR1C 4RMTA 2J8UE 3VH8A 3ZE2E 4HV8B 4S1DD 4CUCA 3QUMA 4O58H 5L88H 2RCSL 1CT8A 3CVIH 5GGQL 3G5VA 1JNNH 5IBLC 4P46D 2PW2B 4P23A 2GEEA 2EDYA 5FDWB 2HVKA 4LKXB 4ZPTA 5DMIH 3L5XL 2G60H 2AJZB 3MLUH 1Z9OA 5HHMB 1P2CB 5EZIL 4K7PY 2YR3A 5DMKA 3ARVA 2BZDA 5FECB 1OOAA 5EPMB 3O6MH 4XPGH 3PWPD 3D3VE 1DBAL 1XIWB 1JTPA 1RK1A 4GRWH 4MXWL 3QCUH 4ZFGH 2CLVB 4POZC 1OSPL 3A67H 3TF7C 3EUUA 3MRCB 2H26A 4P5MA 1HOCB 2NX5A 3S35X 3GMNA 3QRGH 4HKJB 4V1DA 5AAMA 4XNUL 4JKMA 5HGHB 2F74B 1HIMH 4KQ3H 4CJ1A 3VFUB 1TJHL 1FIGH 1P84K 4BH7A 3BH8B 2FJHA 1QSVA 1I1YA 1WFOA 2FECI 1S8DA 5DT1H 1AD9B 3ECBB 3CZFA 4J3UA 1NBQA 4J3OC 2PUQT 3IDJB 2VZ3A 2W1NA 4NQEA 3VXRA 2DLGA 1T7XA 5A16B 1LVEA 3VGAC 1L7TL 5DWUH 1A7PH 1WWBX 4R97B 4I3SL 3TPKA 1Q8MA 1EMTL 4K8RH 5DJ0A 3DV4A 2ZG2A 5HYIA 4N8VG 1HSBA 4PJ5B 2ZCKL 3V52L 1S9XA 2H2PC 1HZHH 3NPSB 1NKRA 3UPRA 5TFSH 3VI3F 5HHXL 1NH6A 2X40A 4LDEB 5E8OB 1A5FL 5C09E 2CRIA 1CK0L 3I50H 1XZ0B 3MUHL 3VG0H 3LS5H 2GUOA 3DV6A 4Y2DA 2YEZB 3B9AA 1T1XA 3LDBB 3BKJL 1H3WM 4UNUA 5F9JA 1TZGH 1WFNA 4PJIA 2L4OA 2ZKHH 4S0TD 4AZ8A 1FYTA 3FFCD 3HUJB 3OAYH 3ZDYE 1WGOA 2DBLL 3AAZB 1RUKL 5DK3A 4BZ2L 4PJ7B 4DOHE 2OQJB 2DL9A 3L3JB 4WWKB 3KLAB 4GW4A 1IT9L 4M6AA 5GHWH 1LDPL 4MAYA 1CYGA 3O6KH 1PY9A 5F88B 3AU1B 3OJ2C 3FCTB 4HWNA 4U3XA 5EU7E 2ESVA 2P5WA 3EJJX 4XXDB 5ETUB 1HNGA 5E1HB 5C0AB 3HG1B 1CDHA 1S7RB 2F8VA 4O02H 1F58L 1IAIH 4OTXL 3CVHH 2P5ED 5C0ND 3GSNH 5E9DE 4NQCD 5DQDH 4JY6B 3ZE1F 1AD0A 4N1CA 1OW0A 4FMKA 4KJWD 5TQ2L 4DVBA 4I0KA 2EDQA 3FQUB 3VWJD 1KENL 5MHSE 4LPWA 1C5BH 1CG9A 3FT3A 4S11A 2MNUA 1A4JB 1DBBH 3BQUC 1BQLL 3CPLB 2DAVA 3U9UA 3DMMB 3UTQB 1MY5A 3N85H 2XY2A 1T04A 1VACB 1MJ8L 4O2FB 1U8HB 4FQLL 1QQDB 3IVKB 4Y5XC 1QZ1A 1YEKL 2I60H 4OCXH 4AG4H 4ZDHB 4OFPA 4Y4FA 2DM7A 1PDKA 3OR6B 4UU9B 1BBDH 1U8QB 1LP9F 3DX7A 1AXSB 1T2XA 3DX6B 4XP5H 3TNNA 3ZKNC 3GHEL 2A9NH 4YQXL 5T5NF 2IMNA 4NNPH 5GPRA 3MXVL 3FZUD 1P4LA 3MRHB 4G7YL 4AEHH 5T5NG 4JFHD 2NY6B 4WW2B 5KVDH 3MOBH 3FB8A 3C8KB 5GRUH 4G9FD 4HIEA 1FO0A 4ZFZA 3VXSD 1EGJH 4LCWE 2JJSA 4JFDD 4XBPB 3GHBL 1FNFA 2BY1A 4S2SB 1FN4B 1YC7A 1M6OB 1EJ6A 4EQ3A 5CINL 1CD9B 1I8LA 1XF5A 3I6KB 5KJRH 5JIPA 1P1ZB 3NFPB 1IILE 4Y0GA 5IB5B 1WC7B 2HTKC 3VXOB 4N1HB 2JK5A 4B5EA 1EBAA 2E7BA 4R26L 5FKPB 4OJFH 4FQCH 2F54D 3EJZD 4ZTOL 1B88A 1E4KC 5C0GA 3TT3L 5DEFA 1OVZA 3D1MC 3LKPA 4PGDB 1WWCA 3F8UB 1NFDF 3LZFH 4MQTB 2EO9A 3KPSE 2BSED 3K0WA 5F6HJ 1YMMB 2CK0L 2UYLB 3UTTD 4LSVL 2NTFB 5D9SA 4C56A 4LDLB 4QTHA 3V7MA 4AQOA 4DN4L 4YNYB 4QXTB 3ZE2F 5FYKL 2P46B 2P43B 4NM4L 2DI7A 2VDPL 3ISWA 3IU4L 2WV3A 4MS8C 2B1AL 3HMXL 5CCKH 1I7UB 4P57B 1FFNB 4NBYB 4K55A 4LLQB 5HI3D 2MQCA 1JPFB 2YPLD 4BSJA 2A0LD 3LHPH 2IQ9H 1OP5K 2CDEA 2Z31C 3SOBH 3FQNB 4ERSH 4PR5A 2HTLD 1QO3A 4ODBD 5AAWA 3UTSE 4FFZL 3QIWD 1QG3A 4IOIB 2FGWH 5A2JH 1CU4L 2APBA 1JCKA 4RFNB 2P5EB 3MUJA 3VD3A 1I9JL 4L3EA 2Q1EA 5IVZB 1MLCA 3CNKA 1B0WA 2VQTA 4G6AC 3N1QC 2H9GA 1MIMH 3CSPA 5GRYA 3VWJB 4YHLH 3KR3L 4X7SH 1OTUD 3B3IB 1D3CA 4B7LA 2ARWA 2J88H 3DRTA 4MD0A 1FP5A 3TVMC 1CDIA 1HHGB 2DOCA 5IOPB 2IADB 4X9IA 3IJHA 1NMAL 1T7ZA 2CRMA 2AK4E 3PNWA 4UQ2A 5DS8A 2Q6WB 3AS3A 4PJCB 1N0XH 2BNQE 3U30B 3MV8B 4FFVD 1QTYT 5I1KL 1OAXH 5CD3B 3IJYA 1KLGA 4NKQB 5DYOA 1P4IL 3O41A 3SQOH 1QFWI 4BUHA 1KEMH 3NIFF 4S1SL 3QR2A 4AIXA 2EDHA 4N8PA 2DJ4A 3ZDYF 2EIEA 4IRZL 4OLWH 4Y88A 1QVOB 2GCYA 2HAZA 3QWRA 4G9FB 3HR5B 5IHUH 4A2LA 5GS1C 5CEZH 1V7MH 5F7HA 1ZT7A 3LB6C 4O51A 5DVLA 4ZS7H 4FQXD 5MERB 3MRMA 5KANG 4OCWH 1MUJA 4CMHC 2FHCA 1A9BB 3L3HB 4HUWA 5ENWB 3MCKA 1R24B 4OD2A 2DQUH 3HC0A 4PJHF 1FG9C 1J8HB 2BVTA 2DBJA 5CSBA 1YYMH 3H7BA 3WJLC 3VFSA 2F54B 4XBGB 5IHZA 2DI8A 2ZSWA 2AJ3A 3ARED 4Z7UE 3H8NA 4EDWL 4P4RA 1ODAA 4OLZL 1MFCH 2A6DA 5HSFA 3LN5B 2I25N 4M1CC 1VSCA 1H0DA 3TZVD 1CZ8H 3KPMB 2X4OA 3GSXB 1SEBB 1HHKA 2AAVA 5CUSH 4QGTA 1UWEL 4XAKE 4Z7WB 2FO4B 3AY4A 1XF1A 2ICWA 1XIWC 1IQWH 1T1YA 2FIKA 4GAGH 4GRWF 1ZGLP 5KSBA 5IJKC 4QXWA 4RAUA 1X5IA 4X80L 3KPTA 2VLLA 2FB4H 4LPYA 3MPCA 2YPLB 2ARJQ 4HKBA 4K3HA 1Z5LA 1ZHBA 1FV1A 4M62L 3QJHB 1EEYB 3DJ9A 2BRQA 1RZJC 4H26A 4EN3D 3D25A 2I27N 3QPQD 4FTVA 3F7RA 4WWID 1TCMA 4PRHA 5DRWA 3QIWB 5JR1H 1MCDA 1VFBB 3TBSA 1BFSA 3IFOB 3MXWH 4N8VA 2IFFH 2FL5B 1ZS8B 2LAAA 3LPWA 4R97C 1R0AH 4ZAKC 3JBG7 2WBJD 4OI9A 1U41A 3K81A 5FM4A 4QEGA 2CRYA 4CMMB 3HR6A 1GZPB 1HYRC 3NPSC 4JPWH 4OCRH 4ZFFB 4LLUA 1HHHA 3IFNH 3BPOB 1I1AA 4Y4HC 1YEFH 4HAFA 4DZBA 3BGMB 2ZNWA 4UDUA 5T1KD 3MNVA 4EI5B 1UZ8A 5KBNC 3LDBC 1FZJB 3T0EA 2J8HA 1CLOL 4JLRB 1BIIA 2R0ZH 3U46B 3LPGA 3JUYA 2D7NA 5EU6E 1FRGH 4HHAB 4WWKC 5T3ZD 1CL7L 2F15A 1QFHA 3TYGL 4BZ1H 3UPCA 1WZ1L 2PKDA 4WUUE 2XZAL 1RZKC 3P4MA 3HB3D 1OARH 3O3DA 1FAIH 5EOQL 3QUKB 5J7CC 5C9KA 2CMRH 5DJDA 1D7FA 4GG6F 3UZVB 1OAZL 3DTXB 3C2AH 5MEOA 2WANA 2JCCF 1GH7A 2AJXH 4WU5A 1URLA 1JRHH 4FQXB 1MAMH 3H3PL 3HNVH 2IH3A 1LNUB 3EO1A 2K9UA 1I7TB 5BJTB 1BX2B 1T0NB 4KKAC 3D0LA 1OP3H 5E8NB 5F44A 1RK0A 3MV7D 4ETQA 1NDGA 2APVA 1EVTC 2XN9A 1D9KD 3FKUS 3QYCA 4UOW1 3OJDB 1YNKH 5HXMA 4FP8L 3QUYA 5JMOC 3DMMC 3MLYL 4JRYD 4S1DC 1CE1L 4JDVA 3ULVD 3AREB 5HHOE 4PRPE 4UNTA 2NY2B 4XWOC 1HDMA 3K1KC 5F8RC 3HZMB 4JN2B 2DQJH 4CL7A 3TZVB 1LP9A 5CILL 1P5VA 5I1EL 3ARDA 4PYHA 1FZMB 5GGRB 1UB5A 3TIDB 4KUZL 4QHMB 3IS0X 3VI4F 5L6YL 5FYLL 2JB6A 5JW5A 5E8DL 5CKGA 2AERT 1RULH 1QLRB 1U8KA 1RZJH 1N64H 1YEDA 4WW2C 2NY6C 4BFIB 5C6PB 4F7TA 2F58L 3LQMA 4FXLA 3WFCH 4OKVA 4MA7L 1F3DH 3QG6B 3GZKA 3NVQA 3B2UC 2H1PL 3ARBB 4LLYB 3GSOA 3W9DB 4HGKC 3EW3B 1I3VA 4AENA 4KVNH 4LSSH 1KN2L 2Q7NA 1MVUB 2AEWA 1K6QH 4I2XA 3U9PL 2XWBB 4GKSB 2GAZA 3AB0B 1WZLA 3QDJB 2BNRE 4F15B 5B4MD 4YGVB 3CSBA 3DURA 4G7VH 5D96C 4LEOB 3WXVH 2HA1A 2Z8RA 1MHPH 4YDJB 4XNZB 3NCBB 1LO3L 1YN6A 5D72H 3VW3H 3HI1A 2CXGA 1VEMA 4PG9A 2HP4A 3NCYS 2DIAA 1IGJA 5IMLA 1OM3L 2D7OA 4HW6A 4KTEL 4PJEE 2FBOJ 3ARFB 2PTTA 2VISA 4YDLC 4L4VD