4JM2D

Crystal structure of pgt 135 fab in complex with gp120 core protein from hiv-1 strain jr-fl bound to cd4 and 17b fab
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
229
structure length
220
Chain Sequence
EVQLVESGAEVKKPGSSVKVSCKASGDTFIRYSFTWVRQAPGQGLEWMGRIITILDVAHYAPHLQGRVTITADKSTSTVYLELRNLRSDDTAVYFCAGVYEGEADEGEYDNNGFLKHWGQGTLVTVSSASTKGPSVFPLAPSSLGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PGT 135 Heavy chain
publication title Supersite of immune vulnerability on the glycosylated face of HIV-1 envelope glycoprotein gp120.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/viral protein
total genus 38
structure length 220
sequence length 229
ec nomenclature
pdb deposition date 2013-03-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jm2D02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4jm2D01
1BZ7A 3TBYA 2G60H 3KYMB 5CINL 2E8ZA 3MLSL 4YWGH 4B0MM 2ATPA 1A7QL 5LCVH 3ARWA 4GBXB 4ZNEE 5IJVA 2A6DA 4DGVH 3RGVA 3HUJB 4FXKA 4NFBA 4O5LH 4WW2A 2VXSL 1QHOA 2VERN 3FT2A 5DA0B 1FV1A 3DMMC 3AAZB 4G7VL 4KKLD 2D31B 2ZCHL 3EFFA 4X4YA 1K9TA 4MNHA 1IC7L 4NDMB 1EEZA 1BVZA 1H5BC 4Y4FB 4ZTPL 1Y6KR 3MLXL 3BUTA 3NFSL 3VMPA 1HWHB 5D1XD 4ZFGH 2ADIA 4WFFD 4TSCL 4HDIB 5TDNB 3EDFA 3HS0B 2E7HA 4FQLL 2CDEA 3WIIL 43C9B 1CIUA 1D5IL 3LDBB 1JF1A 5IF0B 2C1PA 3D48R 1WVZA 5IVZB 4M4PA 4MJ5A 4R6UA 12E8H 4Y1AA 3NZ8B 1QRNA 3H3BC 5B8CB 3JWOH 4AK1A 2WBJB 1QSFE 2VLRA 5DD0H 1BEYH 4PJEB 2IC2A 3HTLX 4YX2H 5GJSH 5GS1C 1RJLA 2BSTA 3VFWB 5J13B 1CVRA 1MCLA 4WWKA 3GSNH 2WUCH 4EXPX 1A4KA 4KI5C 3C08L 5DC4B 2XT1B 1P5UA 5K9JH 1AFVL 4QF1A 1T0PB 2VDQH 4WWKC 5DEGA 4YBLB 3MV9E 1G7LB 5EOQL 1PY4A 4NO3B 5I15L 3DYOA 1QLEL 2F58L 1XR8A 1JGUH 3RKDC 3EYSH 2HJKA 1LD9A 4NQTA 3NGBC 5EIVA 5KZCB 1SJHB 3DI2B 3O6LL 4I2XB 2BVPA 3W81A 3V6ZB 4YEEA 3I3BA 4P46B 4G42A 4IRSB 3TA3C 1G9NC 4L8BB 4AEIL 5FM5M 3QDJA 3OAUL 1UB6A 3VXQB 2ICWB 4F58L 5TE6L 4UQ3B 4HG4K 3B8YA 5L2JA 4LEXL 2P5WE 3HE6C 1CGTA 3IDJA 2XFXA 2MSPA 3GGWA 1UWEL 5DD6A 1N59B 1PLGH 5JHDD 4ISVB 3RA7H 1E6OH 1S9VB 3L3JB 5E7BA 1MH5A 2YZ1A 1C16B 4QY8A 4FQHB 5LGKA 1I8KA 2JJSC 2JK5B 5DA4A 2DQFA 5EPMA 6CGTA 2ZCKH 3RZCC 1X7QB 4GRWE 4YNYB 3V5DA 1FL3B 5D1XB 4X9FA 3SKOA 3O11A 3PIQA 3I9GH 5T1MB 4YZFE 1DN0A 2CIIB 2NY7L 2X9WA 1AR2A 3X13B 1MREL 2I5YH 2PO6D 1NLDL 2EYSB 4GJTB 5HY9B 4Z0XB 3GMMB 4OKVB 1X6LA 2HKFL 3BIAX 2VO5A 1AD9A 5C0DA 3VFRA 3DLQR 2Z31D 3BZDA 5GGSA 2QKIB 4JO3L 1VESA 1ZHBB 1IQDA 4AEHH 5F21B 3L95A 5IR1A 3QNYB 2IBZX 4WCYH 3K4ZA 2KZWA 1QSFA 3C60D 5EO1A 4JN2A 5GGVH 4RGOL 2APWA 2ZWLT 3LV3A 2H1PL 4X6DE 3CK0L 3D6GA 4TUJB 4PJBA 4RGND 4R90H 1AKJD 2UZIL 1TQBB 4I4WB 3ARDD 3W9DA 1N6QL 3PL6D 4IMLB 4V2BA 3L3HB 5B3JF 2RFXA 3LRSA 3PGDA 2R8SL 5CKAA 5EU6D 3HC0B 5I9QC 4GMSH 3VA6A 5AWNL 2WWKO 2J6EL 3O8XA 1MHPH 4OAWA 5EZIL 3FL7A 1TLKA 1HINL 1EZVX 2VXVL 3QG6B 1CBVH 5ELIA 3OKKA 2PW1A 3UX9B 4MMZC 4ODBD 5IB2B 5C0CE 1IM3A 2BY0A 4WU7A 4HQQH 2RQ8A 3OBAA 4DKFH 4YPJA 3I6LE 4FQXA 1NGPL 4IOFD 4DW2H 3ILPB 5JXED 4G9FE 5CJQL 5JHDB 2GUOB 4JKKA 3QCUH 4FQXC 4PJDA 3WLBA 4G7YL 2B7DT 4K7FB 5HHVH 4LSTH 4YDLB 3N0PB 4B7LA 5J9PA 1Q72H 5MEQA 4HWZA 1NDGA 1RZIB 2AGJH 1N5YL 4HEME 4HKBB 4QKXB 5HHQA 2VLKE 2PW2B 2ZJSH 1YEJH 1PKQE 4PLNC 1RQ5A 3PQYE 1MCQA 2FR4A 2PO6B 2FJFA 4HWNA 5DQ9A 5HI4D 3L9RB 3VH8G 2W59A 5BZWA 4XCFL 2AVGA 1CICA 1AP2B 3NTCH 2OI9C 4M61B 2DLGA 4EN3C 1YEEL 2EEBA 2BRQA 2Z31B 4IMKA 4OZ4A 3BWAB 4ZPTB 3IXAA 4E42A 4AT6B 3NCMA 4X5XB 1CGSL 4CMHC 1FVEA 3PHQA 1VKXB 4M6MH 4F7TB 2H32H 4HWBL 1T1YA 2XKSA 2GJ6E 4X6FB 4QRSA 3WIFA 4PS4L 3D0LB 2DJ4A 4XMPL 5JW4M 5T3XH 4K7PH 2GTWA 1DDHB 2J3SA 2P5EA 2WNGA 4CVXB 5DDHB 5HYQA 4HUUA 5KSAC 4RGNB 3MJ8A 5ICZA 1AKJB 3U6RB 3ARDB 5CJOL 5EUOE 3PL6B 4IOSD 4PR5A 1IZJA 2DIBA 4X6DA 3KHOA 2FX7H 2AK1L 2GQHA 1NMBH 1QACA 1WTLA 1QR1B 3BPLB 4OV5B 5ICYA 5IBTH 1N7ML 5JOPD 3UEZA 1U8NA 4W68A 3OV6A 5BVPH 2GSGB 3GHEH 3CH1A 4AZ8A 3O6FD 1OAXL 2VIRB 3DUUA 3BVNB 1KPVB 3MRGA 1DLHA 2IJ0C 5C0CA 1GGIH 9CGTA 2XY1A 4OFVA 4NKOB 2A0LD 4HPOL 3OSKA 2G5BB 3E3QE 3WFHB 2OQJA 3U0PB 1ZSDA 5D72L 2AJXL 1U8HA 3OAZK 1UXWB 3SDXA 4W70A 1JK8B 4QHUA 4G9FA 3JV4B 3TYGH 4WTXA 1V5JA 4RWYH 4V2CB 3VWJA 2C4FU 3CMGA 5DJ8A 1ORSB 3D18B 4LQFL 4M1DH 2V5TA 3CFBA 3L5HA 5ISZD 4PJ9A 4JPWH 4X7TA 2CR6A 5CIPH 1R3KB 1IBGH 4NC2B 4DTGH 2VLKA 4PJXE 5ITBH 1FNGA 5D1QA 4NQXA 1PKQA 3U30B 3IETB 4ELME 3RWEA 4NN5C 1MJUL 2BC4B 4L3EE 5EU7E 3PQYA 2CO6B 3CVIL 4FABH 3WJJC 1CXHA 2H2SC 1T22B 4PGDB 3H9SD 4L4VE 5BZDB 2Q1EA 3GHBL 2P4AB 4AG4L 1CLOL 3F7YB 5D5MB 3GMPB 4NN6C 5DYOB 2DL2A 5KSVA 2VL5B 3BPOB 3L6FB 2BVUA 5I2IA 4NKDB 2NY4D 4Z7OF 4JDVB 1B88A 2QTEA 2GJ6A 2UYLA 5CHNB 3BHBB 1UQSA 3TLRA 3BH8A 1MJ7H 1DFBL 2CUIA 5HHPA 1O5DT 1OY3B 4MA8H 4G9DB 2W65B 4M7LL 4I3RH 1BGXH 1LO3H 5D96B 5EUOA 4XNQB 4JDZB 4YHLH 5K9KA 1XEDA 4GQ9L 4G5ZL 5GRVK 1IGTB 3KPOB 2DLFL 4I5BB 4ZUUB 1WSST 2Q8AL 5JA8B 3G9VA 1BJ1J 3O6FB 1S7QB 2DBLH 5JDSB 5FA3A 2P1YA 3LZFH 3QI9D 2GHWB 1A4JB 1JWMB 1JUFA 1RK1B 4TNWK 4H1LA 2Y7QA 4BH8A 1EERB 1RZKL 4R97C 5HGGS 2OM5A 3L7FB 2GY5A 1UWGH 3QFJE 1OP3H 2DQGH 5I1LA 3QCTL 4OF5A 3FB5B 2EDJA 2A2QT 4JQVA 2OLDA 1ZWIB 2MHAB 2VLME 3BEWA 3HZVB 4GW5B 4WO4C 2D9QB 1RHFA 2IPKB 4XCNB 1N26A 5C0AD 5DJAA 4CNIA 2XZQH 2CGRH 3E3QC 3DRQA 3MJ9A 2X1WL 2GT9A 1U8QB 5DFVC 2DD8L 3M07A 4Y19E 2NZ9C 1U8LB 3P30L 2NY3D 4JRXE 2HLFD 5I73C 2HTLC 4WRLA 2YPVL 4PY8J 1E4WH 4TNWF 3QG7L 2YMXH 4U1KA 5GQBA 1DVFD 5IW3A 3VW3H 4KC3B 4NNXA 4X98A 4N0UA 4OZHE 4ELMA 4L3EA 3WNMA 5HYIA 1E4XL 1MWAB 4HUXA 4HCRA 4U6XA 4PJ7B 3U36A 3W0WE 3CPLA 4OD2B 5EU7C 1RZFH 4YDVB 5BV7B 3MLZH 3MPCA 2X4NA 5E6YA 1T20A 3AU1A 1A1NB 3UO1H 4M02A 4WUKH 3MLTB 3FQWB 1YYML 4XNYL 5HHOD 2MQ3A 2YHGA 4ZPVB 2HP4A 4YXKH 1A7BA 5DUPL 3OPZL 3VH8A 3BRDA 4WJ5A 1BQLL 2AEQL 1UVQA 1TMCB 2LQRA 4XBGA 3MRCA 4K9EC 3N9GL 4JY4B 1WWBX 1U58A 4HWEH 2Y23A 1OLLA 4PJFF 1RUQL 1Q9LB 3AREC 3DSFH 4Q6IA 1FG9C 3DO7B 4Z7UB 3ARBD 1DQTA 1OW0A 5KVDH 4H20H 5DK0A 3QI9B 4D9RE 3I50L 1A7NL 2F19L 3FKUS 5HDBF 3EO9L 4L3CB 1PG7W 3P2TA 2DJUA 2CJUH 4UMGA 1KF9B 3HPLB 1FDLH 1N0LA 4PG2A 4LOUD 4X99A 1RVFH 1OWWA 1V3MA 4R26H 2D3VA 2O5XL 3FONA 5F7LB 1LNUB 5IMOB 4PG2C 1RD6A 5IKCA 5C0AB 3BKMH 3VRIB 3QUYC 3TPKA 4RFOL 1U3HD 1MCNA 1X6NA 3O0RL 4UILL 3QXDA 1IAII 5IW6B 4UINH 4NP4H 1B4RA 3SPVA 1WJ3A 2NY3B 1HKFA 3U2SB 3M8OL 4GAGH 2FD6L 1FYTE 2VDKH 3MBED 3CVHA 2X10A 4JRXA 1T5WB 3DX9A 1IFHH 4O2EB 5IVXE 1DVFB 3M1BA 3MRDB 3FAWA 5C0FB 1FPTH 4L8DB 5C09D 4XB7A 2OBGA 2CMRH 4OZHA 2NY1C 2XKNB 3RPIA 3WFCH 1MIEL 3ZDXF 1IAIH 3GMOA 1CLYL 4PJFB 4MHHG 3SGJC 3FTGA 4EI5A 5B38B 3W0WA 2DWEA 5I18L 4OFYA 5CSGA 2AK4D 4F3FA 3FQNB 3HAEB 2HH0H 4HT1L 2DJSA 4C4KT 2NY0C 1UJ3C 4R4NC 3LKOB 2A83B 3TN0A 2CKBB 3P9LA 2AXFB 1I7RB 3NA9L 1T7VA 2CUHA 4HZLB 5F3HB 1CDBA 5BJTA 4ZFZA 3IAPA 4JKPL 5J1AA 2W07A 1FFQA 8FABB 1DTUA 4PTTA 5ID1A 3F65A 3VFVA 5D7LD 1MUJA 3LKNA 2PXYA 3ARBB 3MCKA 1FRGH 3RBGA 4UDUA 1ZT7B 1F6AB 3T65B 5L2KA 5K59F 4G8EA 1F2QA 1ZAGA 1QSVA 1E4KC 1W0WB 4N0YH 3IF1A 4NKMA 4XNZC 5E94A 4UOW1 3VXSD 1MF2H 5GJTH 4NBZB 5FF6B 1U91B 3UTZB 1I9EA 4PREB 5LVEA 4GMTH 3VXMA 4YEFA 2AJYL 2BOBB 5GRZA 2IF7A 1WWAX 1ZOXA 3RUGB 1T04A 1U3HB 4I48A 1XCQA 4TTDC 4JFYA 3QEHB 2H26A 3IFLL 4KJQC 5EBLB 3BO8A 5DS8B 5KJRL 2V9TA 2KH2B 5GHWL 1UEMA 3HKFA 1H3PL 3SKMA 4BM7A 3MBEB 5E6IB 2J5LC 5CAYB 3K1KC 2QL1A 4YR6B 4XXCC 5FAAA 3WN5A 5IVXA 5C09B 3DX7A 1QBMH 5I1KL 5I0DA 4JKMA 1S7XA 3MJ9L 5GGSY 1F6LL 5LBSH 1T4KB 2HFGH 5GRUH 2MPAH 2DI8A 2QSCL 2JB5H 4Z7QF 3NIDE 1ZGLM 1Q1JL 4LKXB 3L3KA 1AO7A 1I1FB 4D94A 3QIWB 1JBJA 5DQDH 1JPST 2GEEA 3IB4A 1A21A 2AK4B 3JVGC 1WISA 5IB1B 3G5XB 2YRLA 4OM1H 5DMKB 3SBWA 2J1KA 3LSOA 4GFTB 4Y5VB 3T1WA 2H6PB 4WVRA 3QAZB 5ALCH 4HGMA 3LMJH 3L3DA 3SQOH 4HCRL 3KLAB 4NOFA 5HPMB 2Q7NA 2P8PB 1U8OA 4PJ8C 3WUWG 1GZPA 3CFEA 4XNXH 1LE5A 3RWHB 1B0RA 4MZ3A 3SO3B 1KJ2A 2DMKA 1LEGB 2XA8L 1JHLL 3OQ3B 5CEZE 5ILTL 4QOKA 5AYUH 1Z3GH 3S4SB 1UH2A 1MLBA 1F11B 1BFVL 3BN3B 2V2TA 5ID0B 4N5EC 5D6CB 1D9KA 1MCSA 2MCPL 3MROB 1ZVSB 3TJHD 5CGTA 5DSCA 3LQZA 3O2WH 5JR1L 1FFNB 1YN7A 2O93L 1B0WA 1T0NB 4XWOC 5E08L 4NKIH 5C0RH 5KVMC 3STLB 4GG8A 4R4FH 4I3GA 2CDGA 3FO2B 1SMAA 3VFGL 3C09C 3KJ6L 5D7JD 4AQ1B 5KN5B 3TIEA 5IWLA 4WW1A 5I1CH 3V52H 1VADA 4ODXA 5IESL 2LU4A 4N0CC 5DURD 4RFEB 3P73A 2Q6WB 3GSWB 2EDYA 3LVEA 3T4YA 3SE8L 4PJAF 3RWFB 2HJFB 3TNNB 3V8OA 4HBCH 4ZFOB 4LSVH 1YEFH 1QNZH 3KHQA 4DGYH 1V7ML 3F7VA 1FNHA 1HDMB 5H8DA 2BNQE 4HIXH 3VRLF 3RVWD 2I9TB 5T1LA 4RRPG 3S35X 4BK5A 5HHXH 4UNTA 1JHKH 4O2FA 2GY7B 2HT4D 3C5JA 1YMHA 2YD1A 1OT2A 3MACH 1DQML 4JZJA 3CVHL 1HN1A 5DD1L 1BQHG 2NYYC 4LGSB 1H0DB 1TTGA 1U3ZA 3MRIB 4OJFL 1RHHB 3VA2C 3TO4C 3OKOA 4KQ3H 4NOBA 2QHRL 3OAZH 1GH7A 1E28A 1R5VB 3S9DB 1MHHB 5EUKB 3BGMB 4S1QH 4NUGL 4GKNB 4MJ2A 1JTOA 3B83A 3H8NA 2V2WA 3DGGB 3EDEA 4HIHB 3HNTL 3D69B 1JZ4A 5EWIL 4APQC 3U4EB 2FIRT 1I3UA 1TITA 2DF3A 2N56A 3Q5YA 4XT1C 3QQ3A 1JZ8A 4LNRA 5KG9A 2ZUXA 2ERJB 4E41D 5I19L 4K3JL 2R0ZH 3BZFA 4HD9A 3MLVL 4FTVE 4FXGB 1FZOA 1KNOA 2HN7A 1XGTA 3DUSB 1KLGB 5DJYA 4JN1H 3ZTJG 2HJLB 2CK0L 2FBOJ 4M6NL 5D7JB 4PUBL 1BOGB 3ULVE 4JY5L 5C07D 5JQ6L 5DURB 1PZUB 5A2JH 5ITFB 1XGPB 4ZS6D 1EFXA 1JPFA 2BERA 1EX0A 4Z76A 4MD4B 4K23H 3H9HB 1INEH 1RIVL 1OTUC 5D71H 4N0RA 5A16B 1XGUA 1KSRA 1KIPB 3CXHJ 3RIFF 4O51B 3B3IA 1FCGA 1TJIL 5TGBB 3LPWA 1T66D 4M5YL 1NCWL 1FQ9C 5E2WL 3EOAA 4RNRB 4CU7A 3QXUA 1I8IB 1XAUA 1NDMB 4DGIL 3I2CH 1SM3H 3LN4A 1J0KA 4LHQB 4WHYG 3TBWA 1QSEE 1RSFA 3VXUD 3SY0B 4KK9C 2FSEA 4TSBH 3MMEA 3DMMD 5CSZA 4M93C 5I17B 4J12A 3OR6B 3JV5A 4P4RB 5C0BA 1NGQH 4MWFB 1IQWH 2ADFH 4Y4HC 3TBTA 3LH2H 1XF2A 3CX5K 4XVJL 2AV7B 2HT3C 4Q9QL 1IEHA 2YPLE 3GSOB 1HXYA 3U1SH 1I1YB 3FT4B 4GKSB 1NCUA 1L0YA 5CILL 3W5MA 1KIRB 3GSVA 4ODVH 2YXFA 3VDBA 3KYNA 4PPTA 4U6HB 4G8GE 5DJ0A 4BSVA 1YN6A 2JIXB 3KYKL 4GS7C 5E9DD 3PJSA 4WW2F 1RI8A 4E41B 1TJHL 4CW1B 5TPWL 4OCXL 3GJEB 3EJYC 5C0GB 2EE2A 4WNQA 1GAFH 2QQLH 4QRQB 1MFCH 5MENB 4NWTH 1DCLA 5SWSE 2VLRD 2X4PB 4FTVA 3HPJB 4G6JL 3WUWA 1P7KA 1ES0B 1YNKH 1KJ2L 1ZV5A 2IQ9L 2NNAB 4LCWE 2X4UA 4KKAC 4KI5D 3TZVA 3KNBB 4QHNA 3NACL 1RULH 3NH7L 2V2XB 3FN0H 2BDNH 4RA3A 3JBG7 4WWKD 1HI6B 1IC4L 5C07B 4E9LA 3NA4A 2E7LC 4ONOA 5E8PA 4JG1L 2B4CL 3PHOA 3MRFA 3RKDD 4X6BB 3PV6A 5I75B 4EDWH 3Q1SH 4P9ML 3VCLB 3VGBA 3WFEL 1N0XL 4OLVH 4NRYA 3TA3D 1MAMH 2E27H 4LKCA 1IM9A 4FQIH 1XF3A 1N4XH 4EOWL 2X4OB 1MEXL 4CADA 1J5OL 3JUYA 3HE6D 2UZYB 4PRHA 1CD1A 2WK2A 1BD2E 1BZ7B 3GMQA 3KR3L 3Q5OA 2GITA 3TBYB 4NQCE 4BKLA 1BF8A 3W9EA 4HIEA 4HC1A 3KPMA 2W0FA 4LCIL 3D3VD 1F90H 3DMMB 3AM8A 3O81A 2A6DB 3RGVB 1FIGL 1QSEA 1U8MA 2FH8A 4GXVL 5EOCL 1H5BB 2ED7A 1YYLL 5LXGL 1MRCL 3FT2B 4JO2L 3RZCD 1RZJC 3AM8C 1R5WB 1ZHLA 4K71B 3HN3A 1CE6B 3FO0H 3EFFB 4MNHB 1EEZB 5JW4N 2BSRA 5E2UH 2YPLA 2D0GA 5BRZE 1WCBA 1MY5A 1XIWC 2R4SH 3KAAA 2ADIB 4HMEA 4W4OA 3RY4A 3MGOB 2W9LA 2AABL 2Q20A 5HYFA 5JLZB 3C5ZC 3EHBC 4P5TA 1JF1B 1HE7A 5FO9B 4C4KO 1NC2A 3B9VA 4S1DC 5E9DB 1MJJA 1A6AA 4PY7A 4K94C 5IFAL 4MJ5B 1DL7L 3FQRA 3BT2L 1S8DA 3U7YH 5GS1B 4JRYE 1HHKA 4MJIE 2VLRB 4J23A 4P9HC 1AE6H 4IRZL 4XVUC 5SWSA 1QSFD 1VPOL 3P9MA 5GGQH 4RMUA 4WWKB 4LCWA 3BZEA 4LMQI 1R3JB 1A4KB 3MRJB 3QNXA 1VHPA 4OLYL 3QDGE 5GS0H 1TFHA 3KPNA 4ZYKB 4NHUA 4N8CL 4OIBA 1HH6A 2X89D 2Y5EA 3QHFL 4QF1B 1P9MC 4KUCD 5HGAA 1TCRA 2VDRL 5L88H 2B2XL 2O26U 4MSWB 4M43H 1FZMB 3U7AA 1S9YA 1XR8B 4QEGA 2F54A 2A6KB 2NY5H 3S88H 3MV9D 2HJKB 2ZPKL 1LD9B 4NJ9H 1MAKA 2HMIC 1H15A 4A6YA 1HZHL 2BVPB 1T7ZA 3LIZH 1JWUA 3JTSB 3HE6B 3QDJB 2YWYA 4U49A 5D4QA 1L7IL 2YA1A 4X4XB 1B2WH 5D7SH 2P8MA 1K8IA 3EDDA 1KB9K 5TE4H 5L2JB 2X9YA 2C3HA 3EYVB 4FQXD 3DIFB 3MFFB 1BD2A 4KUCF 4PJBF 4X5WA 3IDJB 4TVPH 2XFXB 4NQCA 5DVLA 3GGWB 5DD6B 4U1GC 2DLHA 2P5WD 4E5XA 1G9MC 3FMGH 2GK0B 2V5YA 3STZA 4ZDHA 1PQZA 3RZCB 2ITCB 3DV6A 1MH5B 1FVDA 1AIFA 4QY8B 1I8KB 4LLDA 5JIKA 3I3EA 3HC3H 2ZSWA 2DQFB 5EPMB 4JG0L 5T3ZH 4JDTL 1I75A 1VGEL 4JPVL 1DBJL 4UT6L 2YEZA 5GRJH 3SKOB 3O11B 3PIQB 1OPGL 5ABDE 1FAKT 3UBXB 2IWGA 3MLSH 1DN0B 1D6VL 4EN3D 5J7CC 3QUXA 4DCQA 1YC7A 1I9RL 1WFOA 4PJDF 1FO0A 4WV1A 4YPGA 1AD9B 3ALWA 3SKNB 1UC6A 1H3VA 5GGSB 5I1AB 3CJJA 4G7VH 4XPAL 5HGHB 4CAGA 3F7PC 5HHME 3L95B 4GUPA 2EKSA 5IR1B 1JI2A 3NFSH 5AG8A 2VMFA 4MJIA 1QSFB 4EKXA 5EA0L 5HVWA 3PG2A 5KSAD 5EO1B 4JN2B 3HE7C 2BY3A 3WIIH 3DVFA 3LV3B 4YZFF 1YEIL 3ETBF 5I9QB 5DT1H 4QRTA 1Y0LA 3OKDA 3QH3A 4Q6YA 3QDGA 1UFUA 2DMBA 2RR3A 1CXFA 3LRSB 3PGDB 3SE9H 3MV9B 4NQSB 3ULUL 1OLZA 5IIEA 1Z5LA 1SEQL 4JM2A 3ZE1F 2Q76B 2BNRE 3JUZA 1EGJH 3P0GB 2DOCA 3MO1B 1X5JA 5CZXC 3MA7A 3BOVA 4BSJA 3I6KA 2PW1B 2FEEL 1S7RB 4M3KB 1IM3B 4WI7A 4WU7B 3ULVL 3ALXA 4FQXB 1S5IL 4YFLF 1TNNA 3DO3A 3C08H 1YNLL 1YEHL 4X6DF 3B9AA 1BFOA 2P5WB 3VI4E 3I6LD 4H8WL 3WS3A 4ERSH 1QLEH 1BPVA 2OX5A 4M8VA 1WT5A 3QDHA 4G9FD 1GXEA 4Q2ZA 4HS3A 5J9PB 3O6LH 5H94A 1RZ7L 3LS5L 1ZHKB 4MQXC 3U82B 1EVTC 2YD8A 4AEIH 3OAUH 4EQ3A 2MTPA 4OM0L 3TPUB 4Z6AT 5HHQB 4OD3L 4LCUA 3ARZA 4GRWB 4HC1L 2EYTB 4NZRH 4DEPC 2OI9B 3K8LA 4LEXH 5DQ9B 2R1WB 2H2SD 2Z35B 4MAUH 1CICB 2OJZL 5CCKL 3PQYD 3QEGL 3SDXF 4CMHB 5IHBA 3I02B 3VD9A 2QSVA 3FN9A 1KCLA 4OZ4B 4XVSL 3OKEA 4ODHL 4E42B 4W6YB 4J3TA 2V9QA 2LVEA 4MAYC 5FDYA 1FVEB 3PHQB 1KEGL 1QKZL 3VDAA 1KJ3L 2X05A 5KSAB 4WFHE 4K94L 4LP5A 3TJEL 2W92A 5H2BA 1DUYA 2GTWB 3C2AH 3SOBL 2P5EB 4NGHL 1NAMA 3DVNA 3MJ8B 1NLDH 1WZMA 3EDJA 5ICZB 1A6UH 1MOEA 3VE0B 4CVZA 4PR5B 3GSQB 2HKFH 4X6DB 4YGVA 3VXRE 4OLUH 1X5ZA 5KVFL 5J6HA 3HI1B 1D5XA 2DKUA 2I9LA 5ICYB 3C6SA 3FO9A 4UV7L 4BZ2L 4JO3H 1MLCA 1U8NB 5ESVB 4XC3L 1UKQA 5K9OA 2ZOLA 3CFCL 3CH1B 4JGUA 3OB0K 4ENEC 1YQVH 3MRGB 1AI1L 4XI5C 2A74A 1T7XA 1DLHB 5DHVH 5C0CB 1Y18A 5EO9A 4UBDC 3VFOB 3ARPA 3D2UD 3Q3GA 4RFNC 4Z78A 4WO4D 2OQJB 5J57B 1ZSDB 4KJYA 3V4VL 1U8HB 5H35A 5EUOF 5DR5H 2BFVL 4QHUB 4G9FB 4CVUA 4U1HA 3P4NA 4A6YL 5DFVD 1MIMH 3VWJB 2NZ9D 4R2GC 2X4SB 3O2VH 2HTLD 5DMYA 2NW2A 1ED3A 3CFBB 5C6TH 3WBDA 4NN5B 3RWGA 2DQUL 2ZNXA 3E6FB 4X6CA 4X7TB 4U1MA 2VLKB 5T1KA 1FBIL 2HKHL 1FNGB 1JZ3A 4NQXB 1NGPH 1I4FA 25C8L 5EDXA 4KZEH 1KCVL 1PKQB 2JTDA 3A6CH 3RWEB 3PQYB 1CD0A 3RWJB 4XMKL 5EBWA 5CJQH 2EDQA 4NN6B 5DD3L 3MRQA 5F7WC 1A5FL 1LEIA 4NRXA 2J4WL 2IH3A 4MDJA 2A6JA 3U0WH 1C1EL 4ZXBA 5C0JA 4AENB 4CBPA 3BEVB 3KWWB 3T77B 5KSVB 3QIUC 4L4VD 1T6WA 1CR9L 3TH3T 5EC2A 1N5YH 4CRPA 4UQ2A 2GJ6B 5E2TL 3LHPH 4XCEA 2XTJC 3BH8B 3G6AB 3RY6C 5HHPB 5E5MA 4XCFH 1FO0L 3SN6N 4ELMF 2YC1B 5EUOB 5CBEB 1KN4L 1NLBL 2AXGB 1OAUL 4UV4L 3WKNA 5K9KB 1EVUA 3P40A 4P59L 2FJHA 3D87B 3VXRA 2A9ML 3D0VB 2BVTA 3Q0HA 4XGZB 1CGSH 4H88H 1DBKL 1TVHA 1C08A 2OCFD 2NTSP 4R97B 2XNAA 4PRNB 3DXAE 2EC9U 4Y88A 4NO0A 4PS4H 2B5IC 4HXAH 4PRBA 4XMPH 4U3HA 5FUZL 4BH8B 5T5NG 1MHEA 3D2UB 1S9XB 1J0HA 5DLML 4P2OA 1P4IL 1I85A 3WS6A 2AK1H 3QUYD 3BP5B 3QFJD 3BEWB 4Y5YA 4OF8A 1N7MH 3X3FH 1WK0A 1D7FA 5F44A 3ZKSD 1F58H 5LGHL 1BVLB 1G7HB 3JWOC 4CNIB 1TVBA 2VLMD 4R8WH 5I73B 2VZSA 2DM2A 1QZ1A 2ED9A 3QDAA 4X7FC 3GSNA 4Y5YC 5AUMB 1VDGA 2VXQH 3HRPA 3Q2CA 1OAXH 3CLEL 3GZKA 5I1EH 5FDWA 1WBYA 4LLAA 1RJCA 5SX4I 1HQRA 2BX5A 2R2EB 4Y19D 3CFDB 3RZWA 4J1UA 2W0KA 4YE4L 4JRXD 4U1KB 4PJXB 4WFGE 1YY8B 3TYFB 4OBRA 2AJXH 2NY1D 5LQBH 4X98B 4CU6A 1MCDA 4ELMB 5E00B 3MLPA 3NAAH 4L3EB 4PV8B 4XP4H 4HUXB 3B4NA 4U6XB 1BAFL 3U36B 4AL8L 3V2AR 3LCYA 3Q6GL 3AU1B 4K8RL 2NY0D 2NY2C 5SX4H 3VU2A 3BAEL 1W2KT 1X44A 1KXVC 1OF2A 5IFHH 3VH8B 2BOCB 1MJUH 4BELD 2XA3A 3CVIH 1UVQB 4XBGB 5JZ7C 1P53A 4OZHF 3IDXL 1AY1L 4AG4H 5L0QB 1CLOH 3FFDA 4UZGA 1RUAL 3ULSA 1YEKL 4KPHL 4Y16A 4BUGA 4NRZB 2SEBA 5DK0B 2NLJA 3KLHC 3BGAA 1T1ZA 1NAML 1KJVA 3DXAA 1IZKA 1IAMA 1QPPA 4J6RH 4D9RD 1DFBH 1E4JA 1M6OB 4MJ6A 5CZKA 2H2PC 4G6KL 5BCAA 2I60L 2LAGB 2O5YL 4X99B 1KEML 4M7LH 5DWUH 4JFDE 3QUYB 3FONB 2W9DL 1J7VR 3QFJB 4TTDD 5EC1A 3KGRA 5MHSE 1H3TA 1JV5A 4GQ9H 4KJQD 1DANU 1JGDB 1JI1A 3D5OF 2IANE 3F5WA 3MBXL 2X9XA 3QXDB 3RP1A 2ADJB 2Q8AH 4U1IA 5C9KA 3IFNL 1ITCA 1WBXA 4KK5C 5D8JH 2P46B 2KDGA 2FZ3A 3DX6A 4WHDA 5DFWH 1VFBA 4Y19B 2YOCA 4WHTA 5DK3A 5HGDA 5FGBA 5I1DA 4H5SA 1RZKH 3VMNA 1RUKL 3CVHB 2JELH 4JRXB 4WFED 1R0AL 3DX9B 1T1XA 3M1BB 2NY1B 5E5RB 4MXQC 3SGDI 1FYTD 3U46B 5HGBA 5FV2A 4OZHB 1ODAA 4EUPA 2Z93A 2D9CA 4YBQC 1UXSA 1X4YA 1Q0XL 3FTGB 3HMXH 2NY0B 2DD8H 4KK6C 3W0WB 5I74C 2R1YA 3SJVA 5GPRA 1L9NA 3SQBA 4QTIL 1I7TA 4Y4KC 3IS0X 3V0AC 3SGDH 3OXSB 2FWOB 3GI8H 5HHNB 1J11A 1XZ0A 4PJ8D 5IVXF 1T89C 3QUKB 4PTTB 2DKMA 4ODSL 2I07B 5HTSA 1H3XA 4LEOA 5C3TA 4ORGA 1OGTA 1U8KB 4OTXL 3VFVB 1XCTA 4IRJC 1A0QL 1MUJB 3ZKMC 3G5ZB 3LKNB 1OTTC 4XNZB 3MCKB 2Y4SA 4XPHL 4UDUB 4WY7H 3N1PC 1PX4A 3IDIA 3NN8A 1YYMH 4XNYH 4N5ED 4DKDC 4Z77A 1DQJB 4XP1L 2HYMA 4PIRF 3IF1B 5E94B 2AKRA 1QQDA 4O5LL 4KH2A 4MXVE 4RA0C 5DUPH 4YFLI 3QXWA 3D85A 4XWOD 4J7RA 3HI6L 2ZG1A 5C0EA 5J56B 1BQLH 5J1SC 3QBTB 5ETUA 3L7EB 1P2CA 4JFDA 3UTPE 2H32A 4JRWA 4ZFGL 3BD3A 2P24B 1CGUA 1T04B 5EOTA 1XCQB 3VFUB 4JFYB 4N0CD 4HKJA 2H26B 1YEDB 2IANA 2J5LB 1Q8MA 3Q48A 5DJ2B 3RJQB 1TQCC 3LN5B 3J7HA 4DVBA 3I50H 1JGVH 2F19H 1REIA 3SKMB 3DBXA 3X11B 1NAKH 12E8L 3ZSTA 4B41A 5BS0A 1ONQA 4UDTA 1FYTB 3VGGA 4OT1L 4D2NA 3MLWH 1BEYL 3QHZH 5IVXB 2PTTB 3BH9A 1RIUL 3DX7B 4WUUD 1ETZA 1HSBA 1UADC 4YX2L 1E0OB 4U1SB 2MFNA 1S7XB 1XF1A 3GSNL 2WUCL 4JO1H 4U6VL 4M48H 3O0RH 2QBWA 5D1ZA 4G43B 2NYYD 3EO1B 3L3KB 1GIGL 4O4YH 5K9JL 2VDQL 3CC5A 3O3DB 2XWTA 1PZ5B 2FD6H 4UTBL 3WE6A 5IEKA 2J8UE 3EYSL 3QXAB 2YK1L 5C8JA 4PJ8B 1MFEH 1EBPA 1KT2A 1F4WL 4TQEH 5A2KH 2PTVA 4P99A 1KXQE 4OI7A 4MQ7A 1A7OH 3VI3E 5FYLL 3C8DA 5E4EC 1GZPB 3CFEB 3FQUA 4J3UA 1CDCA 1ZVHA 1LE5B 4APQD 3GB7B 2CLRA 4I9WE 5CGYC 5CIPA 5I18H 4NZDA 1AHWA 1MLBB 3RA7L 1E6OL 3CFJA 1L6ZA 5CEZD 1IGIH 4YFEA 1T7WA 3SDDA 2C4XA 4JKPH 3F58H 4Y0GA 3C09B 5B4MC 1YN7B 3OHXB 3RTQA 2B39A 4KFZC 3T3PE 3I9GL 2CDGB 3EJJX 2I5YL 4WW1B 3K80A 1VADB 3O2DH 4ODXB 1ERNA 5DZLA 4AQOA 3B43A 3MRKA 3K2MC 2QHLA 3P73B 5FEBA 3LKPA 1HH9A 4GBXC 4KY1L 1EFXD 4XX1G 4XCCH 3T4YB 3T0EA 1LEKB 3UTTA 4RX4A 1ZXQA 3FQXB 2KZ1B 5EZOH 4PRIE 3F7VB 2OYPA 2EE6A 5D9SA 4KK9D 5T1LB 3IFLH 4O2FB 1PD6A 2BNQD 1OTSC 4MVBD 4OKDA 2N7BA 4I77H 1KELH 5KJRH 4H1LH 4JZJB 1H3PH 2XXCB 3BXNA 1A1MA 4K2UL 1GC1H 1K5NA 2NX5E 4GMSL 4H26A 3DVGA 3C8KA 3OKOB 1MHPL 4EQ2A 3HZMA 3BX7C 2J8UA 4M7LT 2EIBA 1DE4B 3JZ7A 2GJZA 4OSUH 3BYTA 4NNPL 5B8CC 3MRHB 3MJ9H 2WBJC 4APQB 4KMQA 4XRCA 4DKFL 4ELKA 3CDGB 3HCVA 5F97E 4DW2L 5IMLA 4QHMB 1H9VA 5IQ9A 3TVMA 2FLRT 2X09A 3MUGB 2Y5TA 5J3HD 3QCUL 3EJYD 5A1AA 2IMMA 5HHVL 4PJCA 3F6LA 4LSTL 4LNRB 4MX7A 2VDLL 4YBLC 2YKLH 1Q72L 3BZFB 3GSRA 5C08E 1A6WH 1FZOB 1KNOB 2AGJL 2EDKA 4HCRH 4KKAD 2HN7B 5GS2H 5DRWB 3D39E 1XGTB 5DJYB 1Q0YL 1GGCH 1YEGH 2YPKA 5F9JA 2ZJSL 4FTVD 1YEJL 2B1AH 4F37F 2V6HA 4BZYA 1I1CA 5JO5A 4P46C 2XIDA 1CF8L 1BJMA 2AJVL 1Q9KA 1JHLH 2YA2A 5AAMA 5ILTH 4WEMB 2CLVB 3ULVD 3DGCR 1EFXB 1JPFB 4KKBC 4Z76B 3FFCA 5FM8A 3MXVL 1JZ2A 1BJ8A 3ULUF 1T1WB 1XGUB 4URTB 3VG9B 4OFDA 1TNMA 3BP6A 4TNVK 4HFUL 2COQA 3L5XL 4BQBA 3B3IB 1LO2L 4K7PL 2PCPA 2H8PB 3GBLA 2Z9TA 2WQRA 3QR2A 3CX5J 1AGFB 4FNLL 2RBLA 4M93B 5ACMA 3TBWB 5ERWA 5B3JE 3ULVF 1U41A 5IESH 4M4RA 5DVKA 2FSEB 3MMEB 4XX1E 4C56E 1BBJA 4QRRA 5DRZA 1NMBL 5IBTL 1QSED 3L3OA 2O5ZL 3SE8H 5C86A 3H0TB 4ONFL 3TBTB 1XF2B 5BVPL 3BKCL 2NX5A 4PLJC 3GHEL 3MR9A 3LRHA 1XIWD 2ATKA 2YD9A 2HFEA 2V5MA 3O4LA 5JMRA 2QADB 3OKNA 3VDCA 1XH3A 2YPLD 3JWDH 4UOJA 4PRPA 4TNVF 1U8IA 1IEBA 4S1DD 3ARGA 3WIHA 3OF6A 3U4AA 2YN3A 1P4LB 1A3RH 3GSVB 1TJGH 3RWCA 3KYNB 5FHBH 5AYQA 4L8CA 2GAZA 5DJ0B 1U3JA 4L8SA 1YN6B 3TYGL 1EO7A 3PJSB 1UCTA 2DQIL 2YUVA 3QB7C 4G8GD 4WNQB 1OAQL 3CX2A 2CR3A 4RISL 4XVUD 4HH9A 1U42A 4FTVB 4WHCA 5C08A 4JPWL 3WUWB 1P7KB 4NUGH 3TZVB 2B1HL 2X4UB 2CXGA 1IBGL 4DTGL 5ITBL 4QHNB 5SWSD 3V4UL 1ORQB 3MRRA 2J88H 3S96A 4F9LA 2XQYK 5EWIH 2W38A 1U95A 1OAYL 1F8TL 4FABL 3PHOB 3UYRL 5JW3L 2XWJA 4M6AA 2APFA 4K3JH 3R0MA 3WNLA 3MLVH 4LKCB 4U3CA 1XF3B 4NQED 3GKWL 4U6YA 4CADB 5EZJB 2W60B 4PUBH 2VYRE 4XAWL 43CAA 4FFYL 1CD1B 1EPFA 3GMQB 4G8IB 4BKLB 2R2HA 3W9EB 2VOTA 4HIEB 3KPMB 2W0FB 4N8PA 5DZOA 2LU3A 4I3RL 1LO3L 1N6VA 4NQCD 4OFIA 1K3ZA 4FP8L 5C7XH 1QSEB 1U8MB 4JFHE 2DS4A 4C56A 1BZ9A 4X5LA 4BSWA 2R0WL 4S2SA 5KS9A 1XIWB 2GCYA 4EXKA 3L5WA 1A47A 3LZFL 2ZSVA 2BSRB 2YPLB 3MRNB 4M5YH 1FVCB 4JFFA 4K7PX 1VCAA 4WEBL 4YQXH 3FRPA 5BRZD 2DQGL 3IJHA 4P5TB 1BQHB 1N2RA 2PYEE 4UAOC 1ZVYA 3FZUC 1MJJB 3NCJL 3ZT6A 4PY7B 4M1CC 2LABA 2RB8A 3FQRB 4G8GB 3QDME 4P49A 2XPGA 2XZQL 3NFNB 2CGRL 3BPLC 4QTHA 4W6XB 5IHZA 3B2VH 3HE7D 2VAAB 1AXTH 1NGYB 2BJMH 4JRYD 5TH2A 1IKFL 1JMZA 2EXWD 4MJID 1FGVL 5SWSB 1A2YB 1E4WL 4LCWB 1ZLSL 3BZEB 3ESVF 3TCLA 5KANI 3QNXB 4CMMA 3VW3L 3WNNA 5J11B 3KPNB 4NHUB 3WO3B 2BHUA 4HKZB 1TCRB 2WV3A 2C5DC 3QDGD 5JXEC 2A1WL 3TBSA 3MV8E 4MD0A 1KB9J 1S9YB 3OB8A 4JVPA 2VQ1B 3HI5L 2ARJB 3A0OA 4HIIB 5KAQF 5F9AC 3QWOA 4FQPA 4JM2D 3MLZL 4KRPC 2MNUA 4Z7OE 1WIPA 2FATL 1H15B 3QZWG 3SKJH 3KPPA 4JFQB 1JWUB 1UACL 1KJ2H 2IQ9H 4LPVA 2W0PA 3MRMA 4YXKL 3U9PH 4JQXA 3NACH 2P8MB 1K8IB 4FHBD 2B8OT 1ZT4B 1B0GA 1I7ZA 1HOCA 1MQ8A 4TPRL 1BD2B 4JG1H 3MUHL 4NQCB 5LAXA 3T1FA 3S34L 3U30C 4ZDHB 5CP7A 3WKML 4JM2F 4N1EA 3DSFL 3DV6B 2W1NA 4V1DD 3VWKA 4MQXD 5KVDL 4LLDB 4I13B 4OCWH 1KG0B 4Q0XH 4IS6B 1CZ8H 5F9DC 3VWKC 2YEZB 5L7XH 3KXFE 4LCCA 3RDTA 1FDLL 2XZCL 3KR3H 4P5MB 2KBGA 4Z7WA 1DSFH 4LCIH 4R26L 4AIOA 4LCCC 2AJ3A 5F6HI 3ALPA 1JZ5A 4GXVH 4MAYD 5EOCH 5IHUH 3NBNA 1FO0B 2PYEA 3BKML 3DV4A 1M7DA 1MRCH 4JO2H 4N90E 5MEPA 4GAYA 3LQAC 4KGLA 3QDMA 3SE4C 4NP4L 5BXFA 2EDBA 4JRYB 5DFTA 5E99L 1A8JH 4MJIB 1P69B 3WIHL 5HHMD 4OQTA 5C92A 2AABH 1PEZA 1IFHL 4U2YA 3MOAL 5L6YH 1M05B 3ECBA 1BZQK 1Y0LB 2JJTA 3QH3B 4NQDA 3WEXA 2A0LC 3QDGB 2CMRL 4P2YA 5IFAH 3G04A 3DUHA 1AQKH 3WFCL 1R24A 5C9JB 5IIEB 4JM2B 4FFZL 1VB9A 4Z95H 3MV8A 2L4OA 4GRLA 2VISB 3N1GC 1I8MA 5J06A 4ENED 4D9QE 1CLZH 3MA7B 4IRZH 4LU5H 4ACPA 2BNRD 5MEOB 3I6KB 1VPOH 4UBDD 5J8OA 1NCAL 4ZO7A 2X4QA 5HYEA 4Z7NF 5M95B 3PXHA 3B9KA 3P4OA 3WXVL 4OLYH 4Y5XA 2F53A 3TV3L 4OD1H 4EI6A 3IJYA 1OVZA 4N8CH 2E7MA 2HWZH 3QHFH 4S11A 3G5YA 3GMNB 2VDRH 2B2XH 3WS3B 4JHWL 4R2GD 2GIYA 4HUVA 2AAVA 1MRFH 3QEQD 4HS3B 5DK2A 5SWZA 1YMME 5EU5B 4J3XA 2HVKA 1HZHH 4I0PA 5H94B 5HDBE 1ZMYA 2R69L 4LVNC 4QYOA 3BD5A 3PWNA 4N0YL 1L7IH 5BV7C 3TC9A 4DKAA 1UB5A 4LCUB 4ZOEA 1PYWA 1MF2L 2X1OA 4I0PC 4F2MB 3D25A 5GGTA 3T8XA 3KXFA 2R9HC 3CSBA 3KPRE 3VXTB 4DQOH 1B4JH 4GMTL 3MNVA 5D2NA 2E3VA 4HFWA 1T21A 5J4MA 2VNCA 4KMLB 4MAYB 3TBVA 2WANA 2IAMA 3IDNB 4RQQB 4WI6A 3NFPA 3OKEB 4MYWB 4LRIA 5CKGA 3MREA 5ENWA 1DN2A 3C6LA 4BZ1L 4GT7A 3ZKNC 4M7KH 2HRPH 4JDTH 1AJ7H 1VGEH 5TJWK 2XTJD 3KG5A 4UT6H 3B5TA 5HHMB 4WDIA 4X6CF 4CJ0A 4N9GB 5H2BB 2IFFL 2NCMA 4GG6E 4F9PC 3QCVL 1DBBH 4RMSA 4HGWA 2XTLA 1NAMB 4WFHD 5IEHA 3SE3C 3AY4A 1RZGA 4CVZB 3RJDA 1QBML 2VWEE 5SV4A 4YGVB 4JPIA 2DI7A 1KJMA 5FYJL 5J6HB 1AC6A 3FB8A 3QQ4A 2I9LB 4WTWA 3C6SB 2HFGL 1UG9A 3OXRA 2MPAL 2JB5L 4N0FB 3VXRD 4AM0A 5C0IA 4XPAH 1EHLL 4OB5H 2CD0A 3IVKA 3FRUB 4PD4K 2ZOLB 4PBVC 2BNRB 1T5XA 2BVQA 2ID5A 3MJ6A 1CI5A 5EA0H 4RFNB 4OM1L 5TDOB 2F8VA 1NL0H 4I8DA 3IFPA 2FEEI 2NY3C 1UGNA 5E0QA 4NZJA 3OG4B 5ALBH 5ALCL 5EO9B 3HMWL 1YEIH 3LMJL 4Z78B 3Q3GB 3LOWA 4B5EA 4PGCA 4KJYB 3LKSB 4P2OD 3GEWB 2BSSA 5H35B 2E8YA 1DVFC 4R2GB 1U3YA 4XNXL 4M62H 3ULUH 1KENL 4U1HB 3JV6B 2X70A 5FM4A 4D9LL 5K59E 1H3UA 2JJWA 4MNQE 4NQVA 3V5KA 1FG2B 1JNHA 1BREA 3GUTA 2NW2B 3GMRA 1ED3B 4D3CH 5SWQA 1QYGH 4LLVA 3MXWH 5J12C 3RWGB 1HKLH 4DUXA 3V7MA 1G7IA 4U6TA 4U1MB 1DR9A 1S5IH 5CLTA 5DD5H 1HILA 2BNUB 5IK3A 4QT5A 4YK4C 3UZEA 3BQUC 3K4DA 1YEHH 3EYQC 5E2VL 5EBWB 3MRQB 4NKIL 4IOIB 1U8JA 4R4FL 1NC4D 4NRXB 4MDJB 4KK8D 3VRJB 4LMQE 4L29A 4PJ5A 2NY2D 1WC7A 4M5ZH 5I1CL 3UTSE 3HR6A 1RZ7H 1S7UA 4YBHA 4TVPE 5EC2B 1AGEB 1SQ2N 4OM0H 1C7TA 2AXHA 4OD3H 3LS4H 1I3VA 3BYYA 4RMVA 4F8TA 4HC1H 4W81A 5JPNB 1F6FB 1LMKA 1OT1A 4GG6A 4LSVL 4MA3A 1UM5H 4QXUL 1QNZL 2OJZH 1DQDL 4LOUC 4RMTA 5CCKH 2Z8WC 5T3ZE 4S1RH 2XWBA 2IQAA 4XVSH 3QIBC 4F7EA 4Z7QE 5FO8A 4HIXL 1BP3B 5I66B 2FJHB 3VXRB 2EIEA 3ABZA 3KLHD 3TO2A 1JHKL 1TVHB 1KEGH 2AJSL 4R4BA 4OQTL 1U3HC 4ZO6A 2VWEC 3BKYH 3RVXC 1MCIA 1QRKA 2VLJE 5DEZA 1HHJA 3CXDH 4PRBB 5CS7A 4GH7B 2XI9A 3DXAD 4K3DH 3SOBH 5IV2A 1MHEB 4KQ3L 4LSRH 3ARQA 2F9BT 1FFOA 4MD5A 3MBEC 4P2OB 5LJYH 5E6IC 1VGKA 3S5LA 5IMMA 1OAZH 1F4HA 4GRMA 4JZOA 4Y5YB 4ZS7L 3VD7A 4PYGA 5F71A 4BZ2H 4KK5D 4LBEA 4XC3H 3MTRA 5GSVB 5JNYB 3FB7A 1IGJA 1OD7A 3CFCH 2X1XR 3GSNB 1QTYT 4HXBH 3FO1B 3LEXA 3LKQA 3QIWC 4F7CA 1E27A 4MXQD 3SDAA 3MV7E 4JHZA 2E9IA 2JCCF 4FQJL 4J1UB 5TFSH 2R0ZL 2VZTA 2XZAL 3OAYH 5CP3A 1J0YA 5F89B 5KSBA 1NANI 4JN1L 1NC4B 4YBQD 1IRAY 1UZ6F 4WFGD 4A6YH 3IXTA 2NY2B 4KK6D 2IPUK 2NY5C 1AGCA 4OUUA 4Y4KD 2VDNH 4CKVX 1RK0A 2DB8A 3SO3C 5DMJB 5GGTL 1L7TH 2DQUH 4PJAE 1OF2B 4NSKB 2G2RA 3UC0L 5CBAB 1JF6A 1Q9WA 3MRLA 2MQCA 1NANH 5CEYA 5D71L 1T0MA 4XMKH 5DD3H 1A5FH 2CH8A 4IRJD 5E8NB 2E7CA 3VRLE 1OTTD 2QQQA 1NGZA 2ZG3A 5HJ3A 2HVJB 3FFDB 2AJUH 2LVCA 3ULSB 1XR9B 1C5BH 1CR9H 1HSAB 2SEBB 3PNWA 5GS3A 4TSBL 3D9AH 1BFSA 4NN7C 1FCCA 4XC1H 1T1ZB 2AI0H 3DXAB 3LH2L 4MJ6B 1MCFA 2DYPA 4YDJA 4C57C 4LNVA 2DQHH 2YA0A 1OSZA 4UV4H 1JV5B 3BMWA 3U1SL 3FAXA 5IM7B 2A9MH 4JFDD 2ZUUA 3F5WB 4BFBD 1DBKH 4S0TD 5MHSD 1G9NH 2EKJA 2VN4A 4U1IB 5TE7H 3OTTA 2IAND 3T3ME 3EOBA 1WBXB 5T3XD 1U92B 1EXUA 2FZ3B 3NIFF 3IDYB 3NABH 4KAQL 2PYFA 5FUZH 4WHTB 5HGDB 5FKPA 3AS2A 4H5SB 4J4PA 4LCYA 3CCHB 1F3RB 1H3GA 3MV7A 2JKXA 1JHTA 1INQA 3MRPB 3RWDA 4HF5L 4A2LA 5HGBB 1CLCA 2JJUA 1YNKL 1EGJA 1RAMA 4CN6A 1YJDH 5IG7A 5F1IB 5I74B 3BI9X 2X7LA 1RULL 3S7GA 2Z93B 5LGHH 3VMOA 1YDPA 2BDNL 3PGCA 5GRXG 1UXSB 1CFSB 5FO7B 4EVNA 2FIKA 4Y4KB 3BW9A 3DX8A 4YDKL 4M9OA 3MNWA 2XN9A 3MLYL 1MCEA 3CLEH 4P3CL 3L3GA 3LEYH 4XPFH 4EDWL 4ONHA 5T5NF 1F3JB 1I7TB 3QO0A 1CFQB 1BIIB 1MAML 2E27L 2AEWA 1U0QA 1DLFL 4FQIL 1MQKL 1N4XL 2IBBA 4ZODA 4HHAA 4L1HA 4ORGB 1OGTB 4P23A 5CGYD 1XCTB 2ZP0T 1KIUA 1KPRA 4PJHA 5GIRA 4Z5RA 3IFOB 2APXA 1QVOA 1TENA 3Q6GH 4K8RH 3IDIB 3NN8B 4XBEL 4I18C 32C2B 1LO0H 3F7QA 3V4PL 3BAEH 3UMTA 4E0RA 1EO8H 1EEYA 2AKRB 1QQDB 4YO0A 2J8HA 3I85A 4GOSA 2FGZA 5B4MD 3F8UB 3D85B 4XXDA 1O0VA 5C0EB 3SDDD 1B90A 4FG6C 5ETUB 1JGEA 2YBRA 1S7TA 3ROOB 4JFDB 2H32B 1TQCB 1AY1H 1I1AA 1CL7L 1N8ZA 2L7JA 2R4SL 1QFPA 3CLFH 5EOCJ 3H7LA 4JO4H 4OLWH 1RUAH 5EOTB 5I71B 4NYLA 1YEKH 4KPHH 4WI3A 3UTPD 2YSSB 4HKJB 2IANB 4ZUSA 2NMSA 1NBYA 2FX8H 2HG5A 4DVBB 5A40E 1UZ8A 2DQJL 3PGFH 4B7IA 1BX2A 1A6TA 3WFZA 1Q9OB 4G6KH 1LWRA 4MXVF 2I60H 4UDTB 1KEMH 3REWB 4MJ4A 4QGTA 3FQTA 4XZUB 5F6HJ 2W9DH 3HZKA 1HSBB 4RAHA 4YHYC 1AE6L 5GGQL 1OTSD 2Y36L 4XP6H 4LVOC 5C0NC 3MV11 1F4YH 5GS0L 5IMKB 3IFNH 2QQNL 1G1YA 2YN5A 1RZ8B 3NZHL 4NIKB 5E7FA 4Y1AE 3Q6FA 1NGXA 1QRNE 5L88L 1KB5A 4YHZL 4M43L 1B3JA 2FJGA 4OBSA 5DMIL 1RUKH 3WE6B 5IEKB 1I3GH 2LFGA 1FGNL 4NNYA 1SEBB 5C8JB 4RWHA 4NJ9L 1OL0A 1QFWM 1KT2B 4PBWD 5CZVL 3P77B 4TN9A 1B2WL 3P9WB 5D7SL 1GGBL 3FQUB 5ANMA 5BO1L 2C7UB 4LPCA 2VZOA 3RFZC 5TE4L 3IYLW 1Q0XH 2BY2A 3ZE0F 1Z6JT 2CLRB 4TVPL 3HRZB 5CIPB 5CUSH 4KZDL 1S7WB 2ITDA 1KFAH 1AGDA 4G3YH 4KTEL 1T83C 1LDSA 3BPCB 4Y2DC 1G6VK 3L3IA 1G7JB 4I9WD 2WM0A 4QTIH 4ZSOE 4QRPA 3CFJB 5M7QA 3SDDB 5I75C 2J8UF 3C8HA 1NUNB 5T3ZL 3CZFA 4UUJB 4P46D 3RTQB 5GRJL 3RVTC 1A0QH 1B6UA 4OFKA 4XPHH 1VFOA 3AVEA 3O9WA 1T66C 4JANA 1IAOB 5DVMA 3OJDA 4KKBD 4XP1H 3GMLA 5FYKL 1TETH 4PJCF 1SYSA 3NOIA 6FABH 3RGVC 3HI6H 1AGBB 1A1OA 3BJ91 4WW2C 5D7KE 4KDTA 4R3SA 4K71C 5D9SB 1P1ZA 5FOJA 4PRID 3T3PF 4OV6F 2P8LA 4Q9CA 3WFDL 4WI4A 5I8OH 4LPUA 2VLLA 5DT1L 1JTTA 1YY9D 1IGFH 3WL9B 4IJ3C 3W5NA 1FC2D 3BXNB 4HIJB 1PSKL 1SYVB 5I16B 3SE9L 2VXUH 2H9GA 1N6UA 4PLJD 3WLWD 1K5NB 3M17A 3DVGB 3C8KB 4OT1H 1EGJL 2J8UB 3ZL4H 4JHBA 1BLNA 1RIUH 2NX5D 2GJZB 1R3IH 4MCZA 4D8PB 4LHUG 2NXYB 4BJLA 4NZUH 3I84A 3W82A 2UVFA 3UJIH 4XRCB 4U6VH 4PJBE 4ELKB 4WTZG 1L9MA 3HCVB 1GIGH 1JPGA 3ARXA 4WU5A 5IQ9B 5AD0B 4NBXB 5I0ZA 4ERSL 3QFDB 4LSSH 4UTBH 3U4BH 4C58B 4KU1A 4HBQA 2WLZA 2YK1H 4ZSOA 1X5FA 1F4WH 4L1DA 2E5EA 3R1GH 1QFUL 3GSRB 3QWRD 4CVWA 2ZG2A 5FYLH 2M1KA 3QXTA 2YPKB 5F9JB 1OCWL 3AAZA 5C08D 3V0VA 4NZRL 2D31A 3RVVC 3D39D 3H3PH 4NDMA 3S6CA 4Y4FA 3WJLA 4P57B 1ZK9A 1Q9KB 2AQ3A 4PJDE 3U83A 4MAUL 2DWDA 4R0LA 3TT1L 3HS0A 3WJLC 4BH7A 5A2FA 2RCSL 5IF0A 1KC5L 1QSZA 1PKOA 5EORL 1T7YA 3NZ8A 5D6DA 4PRIB 1TZHB 1NKOA 1ZA6A 3C2AL 2NW3B 3LRGA 1NCCL 5BW7A 3GBNL 1I8LA 5C6PB 1A6UL 3RNQB 3WXWH 1FP5A 4OLUL 2D7NA 5C6WH 1BBJB 5DRZB 3GK8L 3ZE1E 5TQ0L 2YS4A 4KY1H 3SDCA 5FOBA 5DQJA 1SBBA 3LEVL 4C56D 3T0XA 2NX5B 1G9EA 1W0VB 1FYHB 3SDCC 1PX3A 2OTWB 2CDFB 3O4LB 4CUCA 2P5EE 2R0KL 2JLLA 1YQVL 3OKNB 3FB6B 1QO3A 4HS8H 3UDWA 3NCFB 4H1LG 1SJHA 5IB5A 2VUOA 1IEBB 3V6ZA 1J0IA 3CDYA 3FZUD 1KB5L 5B39G 1ULVA 3QJFA 3VXQA 2ICWA 4M1CD 3RWCB 5DR5L 4OLEA 2GAZB 4L8SB 3PWLA 4K2UH 1TPXC 3G08B 4QXGH 1MIML 1RZKC 3MNZA 1T2QH 5DJ6A 5KS9F 1BQSA 3O2VL 4TUKL 4Z9KB 4ISVA 4K9EH 4EUPH 3CD4A 5CWSB 5C6TL 4NNPH 1K6QH 1S9VA 3L3JA 3HMXA 3O8XC 4YHOH 5C08B 4FQHA 3D39B 1N5AB 1IAKB 3MRRB 4ZG1A 4KZEL 3SDXE 1D5BB 1IT9H 2DLEA 1L4IA 1FL3A 1NFDE 3A6CL 4YNYA 3S96B 1U95B 3R8QA 5T1MA 4OZGE 4D0DA 2XWJB 1CT8B 4U1NA 2CIIA 3EIFA 2D7PA 4LDOB 4KRPD 3U0WL 2IALB 2VDLH 5KW9H 2EYSA 5HY9A 1T03H 1CK0L 4YUEL 4GW1B 5I1HH 1S78C 3BESR 4GSDL 1Q0YH 1XF4A 2QKIA 1DZBA 1S7VB 3LHPL 43CAB 1FE8L 3AB0C 1SBSH 1HHIB 1DQQB 4LAQL 1CF8H 2AJVH 3QNYA 5E95B 3DWTA 1CD8A 4YHKH 4C56B 1CICC 3C9NA 1J05A 3MXVH 4TUJA 3ZO0A 5EU6E 4H88L 4BSWB 4QXTB 3PWJA 4I4WA 4IBLT 3CU1A 4HKXA 1WFTA 4IMKC 3KYOA 4JFHD 3VWKD 3L3HA 4H0GA 1K85A 2PNDA 2BVOA 1A6VL 4HXAL 3THMH 2VC2H 4HFUH 3L5XH 1Y6MR 1LO2H 1Z0NA 2V7NB 4JKLA 2EH8L 4KQ4H 3GO1H 1OM3H 4UAOB 4FNLH 1NFIB 3QG6A 3IJHB 3K46A 5DI8A 2WAHA 3X3FL 1ZGLA 2O5ZH 3ILPA 4PV9A 1F58L 1XGRB 2PYED 1ZS8A 3GSXA 4ONFH 3VXNB 3BKCH 5DJXA 1MCKA 4R8WL 5JHDA 1KCSL 1RY7B 4HV8A 4PJGE 5HPOA 3FHQA 2IPTH 4JQIH 4J3SA 2VXQL 3QDMD 5IHZB 4K7FA 4LHUA 4HK3N 5I1EL 5TH2B 3BSZL 3VFPA 2MOVA 2GTZA 4WTZA 4C83A 1RZIA 4Z7WF 4ETQB 4POZC 3TCLB 4HKBA 4CMMB 5LQBL 4DAGH 1NFDA 3NAAL 2X2YA 4X0KA 4KRPB 1Z9MA 1ACYH 4XP4L 3H2WA 2PO6A 4IIQA 3TBSB 4OZGA 2DQIH 4MD0B 3L9RA 3VJ6B 4PP1C 2DN7A 2FYYA 1OAQH 2HLAB 2YUWA 1AP2A 3QWOB 4RISH 4M61A 3TH4T 3MV8D 3KPPB 2AQ1A 3BWAA 2HT2D 4GRLD 3VWJC 4AT6A 3REVA 4X5XA 2B1HH 5FUOH 3BGFB 5F7MC 1VKXA 3V4UH 5IFHL 4OCSL 4N0UE 1I7ZB 3C60A 4PJ9C 4F8QA 1OAYH 4X8JB 1F8TH 1VEPA 4UTAL 5ADPH 1WAAA 3UYRH 5JW3H 5D1QC 5LAXB 1DDHA 3T1FB 1YZZA 2QSTA 1NBVH 3QP3A 5DDHA 5FHAH 3U6RA 3ARDA 3VWKB 2FRGP 3KDMB 1EMTL 1S5HA 5EU6A 4LDEB 3OJMB 5F70A 3GKWH 1UWXK 4JJ5B 4I0PD 1EHXA 3O2DA 4J6RL 2QV2A 2R9HD 2J8OA 4XAWH 3QUMH 4FFYH 3MV01 4LCCB 4ONGH 3DRTB 5I30L 2VIRA 5A2LH 5DWUL 3KXFD 1VFMA 1KPVA 4GQPH 2AJ3B 5GGRB 4FP8H 5SX5K 3RIAK 3BUYB 4FZEH 3EW3B 3ZKND 2PYEB 2IAMD 2G5BA 3DV4B 4PGEA 1BMGA 2R0WH 4J8RB 4KUZH 2Y07L 5MEPB 1UXWA 1PFCA 3QDMB 4HJGB 3SGKA 4A2MA 3JV4A 5D8JL 1F00I 5BXFB 1QLRB 4HJJL 4PJGA 3MZGB 5ISZE 2JELL 4OCLC 4WEBH 3CUPB 5B39A 3ZTNL 2QR0A 3UPRB 3K7UA 1RMFL 3ECBB 1NMAH 4U05A 4ETYA 3WEXB 1R3KA 4HMDA 3BMVA 3NCJH 3BFOA 4CN4A 3G04B 5JOFB 1R24B 2BC4A 4NT6B 3H9SE 3MV8B 4JQVC 3HMXL 4K07A 1TVDA 4GRLB 1I8MB 2YD3A 2Y72A 4PGDA 4FMFA 1G7MB 2H45A 1IKFH 2D7OA 2J2ZA 3F7YA 5D5MA 1FGVH 5DYOA 2X4QB 5JORA 4D0CB 4D9QD 3WCYA 4LLMB 4F33B 1ZLSH 3GI8L 2OTUB 3U9UB 3P4OB 2GFBA 1KTLB 4UIMA 5T5FH 5GRYA 2XICA 4Y5XB 3PHSA 1NCDL 2PTUA 4EI6B 4ZAKA 5GGUB 5E8DH 3G5YB 1FIEA 2A1WH 3JWNC 4PB0L 4LVNB 5C71A 2YRZA 4HUVB 4OCYL 5L8LB 3HI5H 5DVNA 4JFEE 2UZXB 4PTUB 4WIQA 3T4AB 2FATH 4WY7L 4XNQA 4JDZA 2HVKB 4I0PB 5KANG 1NFKA 2CK2A 4P0DA 1UACH 2MJWA 1YMMD 3KPOA 1PYWB 1OSPL 3BQUD 3EYQD 3IDMB 2N7AA 4NUJA 3D25B 3O6FA 3KXFB 4TPRH 4Z8FL 1A4JA 1RK1A 4XBPA 3S34H 3TBVB 3QPQC 3HZYB 4MA1B 2IAMB 3KPRD 3NFPB 3WKMH 5L2KE 1MAJA 3V5HB 3FB5A 2OR9L 1EHNA 1X5AA 3HZVA 5L0QC 1LO5B 1PBYA 1NUFA 2E6JA 1JGVL 4Q6IC 4XCNA 1W8OA 1KACB 3V6FB 1NAKL 3LQMA 1OW0C 4WDIB 3MODH 5E24E 2XZCH 3QRGL 2CIKB 1U8QA 3VXME 5BMFL 3ZKXC 5ISZA 1U8LA 4HGWB 4OZIE 3MLWL 1JMXA 3F7RA 3QIBD 1RZGB 5E1HB 3QHZL 3VGHA 5HYJE 3P0YH 1WICA 1H8OA 4JPIB 4OCRL 3SHSA 5I1GH 3FB8B 4X8XA 4JO1L 1SHMA 4M48L 4ZMAT 3OXRB 5IW1B 4AM0B 1TZIA 3RVXD 3GSUA 4GAFB 3H9SA 4O4YL 3KPLA 2LTQB 4PGBA 1MWAA 5DMGC 5K9QI 1GOFA 5E99H 1T5XB 1XF5B 4PJ7A 3WIHH 3DHJA 4OD2A 4IHOB 3PABA 5HHOE 3ZT5A 5E6ID 3IFPB 3MOAH 4GG6F 1MFEL 3MLTA 4TQEL 4NCC1 4DFIA 4P2QE 4PGCB 1A7OL 3SCMA 4UT7L 5CJBA 2NR6C 1WQVT 1WLHA 4NO2B 1MJ8H 2APVA 1AO7E 3VFNB 4FFZH 3SCMC 2ENSA 5J12B 5JPMB 4NQVB 4JM4L 3V5KB 3QZWB 4JFEA 3V0WH 1JNHB 3QIWD 4R7NA 2AJZA 1X5LA 3GUTB 4MLSA 1YMMB 5ACZB 1NGWA 4MNQD 5SWQB 4YK4B 3BQUB 4LLVB 5INDA 1NCAH 4EI5C 4Z7UA 5GS0D 1IGIL 1QEWA 3MQIA 3WXVH 3H7BB 3QI9A 3RWIA 3TV3H 2C1OB 5IK3B 4QT5B 5I6XC 3F58L 1S9WB 4L3CA 3ZHLA 3TN0C 3U0TB 1EHAA 4C55A 3KPRB 4XP9L 3CSPA 1U8JB 2EYRA 4JHWH 1JZ7A 4RIRB 4O58L 1EDQA 4L29B 3V8CA 4IDJL 2ZUYA 4QOKE 3O2DL 2R69H 5IMOA 4J3VA 5FCSH 1S7UB 2PXYC 5C0AA 3VRIA 4Q97A 5IGXL 3UTSD 5HBBA 2FHCA 1OWRM 1JGLL 5IW6A 4XCCL 4TVPD 4FMKA 1CFTA 4PP2B 3QIBB 4LAJH 4GG6B 4P2RE 1A6ZB 5I8CA 4MA3B 3U2SA 5EZOL 4O00A 5KSBF 4OZIA 2CPCA 3G6DL 3LB6C 4PRDB 5DTFA 5LWYH 5HYJA 3U48A 1T5WA 4DZBA 4F7EB 5FO8B 2EXYC 5C0FA 4GW4A 3AXLA 4BZ1H 1Q94B 4L8DA 3UXFA 4I77L 1KELL 4JZNA 4R4BB 3ISWA 3C87A 4UNUA 4FOMA 1UM6H 3UJTH 4DK3A 4PYHA 1GC1L 2IFFH 2OL3H 3BDYL 2Q8BH 2R15A 3QCVH 2X1QA 2EEAA 5HHOA 1ZT1A 2VLJD 5TDPA 1HEZB 4MD5B 4RMWA 4PJIA 3P3YA 4YXLH 1VGKB 4XAKE 3T04D 3EOTL 4OSUL 3TH2T 5IMMB 4GXUM 5EO0A 3LKOA 2A83A 4P2QA 5FYJH 4LQ1A 2AXFA 4GRMB 1I7RA 4JZOB 4HZLA 4N1HB 5F3HA 3WN5C 1J8KA 3DURA 2K1MA 1EHLH 4XVTH 5D7LE 5GZOC 8FABA 2ARWA 4LBEB 4AEEA 3NCCB 1AXSB 1JFQH 1KGCE 2CRZA 3WMSA 3LY6A 4MNQB 5EU4B 2D7QA 5CGMA 3ARBA 2VQUA 3LKQB 1ZT7A 1F6AA 4F7CB 3B8SA 2YKLL 3VXSE 1N3NA 3HMWH 2C3XA 2YD2A 1HCFX 2E9WA 1A6WL 3KLSA 3SBWC 3MV7D 1GGCL 2UVEA 1YEGL 3ZLQC 2FDBP 1KENH 5FF6A 2B1AL 3IXTB 2A77H 4OLZH 4MB5A 4D9LH 1AGCB 1T2JA 2DQDL 1MNUL 3X3GH 1U93A 3CSYB 4N8VG 3UTSB 1EAJA 1RK0B 3RUGA 3QNZA 4OIIH 3QEHA 5EBLA 1KPUA 5DS8A 1WF5A 1N64L 3MRLB 1WEJL 4X9IA 5E2VH 2WW8A 2B4CC 2EICA 3O4OC 3MRBB 1D9KC 3GRWH 4P2RA 1HHHA 4YR6A 1W72H 2OR8A 5HJ3B 3E2HC 4NPYA 4NN7B 2ZOKB 5C09A 2DTMH 3ZYIA 4RSVA 2I26N 4P9HH 4TUOB 3QPXL 5I1IL 1JZ6A 4M7ZC 2VQTA 4YJZL 4DOHB 4YHIB 1T4KA 5IWLC 4RMQA 5F8QC 4NJAH 2IFGA 3MCG1 1ZKAA 1EAPA 2VLJB 1MCPH 2Z8RA 4FG6D 2DYPB 5IB1A 4X7CC 4QXUH 3L5IA 1DQDH 5ADOH 4RAVB 2CUMA 4KROB 5EIIA 4Y5VA 1GZQA 2H6PA 4LSUH 3O41A 3JWDL 4YIQA 1K4DA 2X1PA 4PJHF 3DYMA 3KLAA 2AJSH 4KRNA 3IGAA 1PG7H 1A3RL 4OQTH 1TJGL 1LO4H 5D7LA 5E1AB 2E6QA 5FHBL 5C0BE 1EXUB 3RWHA 5JHLL 3SO5A 1YNTA 4JY6A 1DBAL 4NHCH 5FKPB 1LEGA 1CXKA 2OSLA 4JZJC 2G75A 2VZVA 4LCYB 1BECA 1OB1B 2Y9RT 3HC4L 3MV7B 3VXSA 1G9MH 1Z9LA 4X7SH 1F11A 1INQB 3OZ9H 3RWDB 5C0ND 5D6CA 3UTQB 1QG3A 3MROA 2W9EL 4ZS7H 5IG7B 1SMOA 2X7LB 4R7DA 2J88L 4JVUA 1FFNA 3PGCB 1P7QD 5DRXB 2Q86A 2FIKB 1V3JA 1YECH 3OJVC 4MXWL 4EVNB 5KOMC 3EDKA 2WIMA 3L3GB 3T3MF 5DJDB 2JIXD 1I3RA 1J1XL 4YC2B 3ULUE 3CGTA 4PJAB 4FQJH 3QO0B 3TWCL 1FLRL 4JAMA 2XZAH 4F7PB 5E6ZA 1OOAA 3A67H 3BIKA 3DSNA 3C5SB 5MEND 4HHAB 2Q6WA 3GSWA 1BFTA 1EA9C 3RWFA 4P23B 4I18B 5F1NA 1KPRB 4ZFOA 4HPYL 4PJHB 4JREB 4Y2DD 1HXMB 1UWXH 1X5HA 2FB4L 4Y7MA 2VITA 5GGTH 5C7XL 4YO0B 3UC0H 4IDLA 4L4TE 4EBQH 5F3BB 5CJ8A 5SX5H 1KTRL 3RVTD 1NEUA 4PRHE 2M26A 3GDBA 3H9YA 2YBRB 4KHXH 4ZOAA 1S7TB 1J0JA 1N8ZB 3MC0A 3RHWK 1R5VA 5IB4A 3VG9C 3GBMH 4YQXL 4NYLB 1NKRA 4JPKH 5ESQB 2HG5B 3EJZC 1ZANH 5ESAA 1UZ8B 1AD0A 2BVYA 4MVBC 3RGVD 1J9CT 3DGGA 4NM4H 1X4ZA 1BX2B 4HIHA 1QFWI 1LDPH 3D69A 5DJCA 4YHYB 5C1MB 4G80B 5KAQG 4XNUH 3HNSH 4UB0H 4LVOB 2NTFA 3B2VL 5I1JL 3HZKB 1AXTL 1UKSA 2BJML 4ZFFB 1LILA 1A9EA 5BOPA 3ELAT 1P7QB 4FXGA 5K93A 3G5VA 3DUSA 2QADC 3WD5L 2VR4A 3AS0A 5DHVB 3G6JE 4U1JB 5D7JA 1QFWH 3Q6FB 1NGXB 5CD5C 1LK3L 4KAQH 4LVHC 3KPSE 3RL1B 1IEAB 1AH1A 2Z91A 2FJGB 4FZ8H 5J3HC 4AIZB 3WNPA 4Y1AD 1QRND 2VDOH 5ITFA 4P5KB 1XGPA 3SKJL 2ICEA 3PWUB 4HF5H 5IROA 2ARJQ 3H9HA 3U9PL 5EFIB 4RAUB 3ULUC 4Y2DB 4OI9A 1HYSC 5IROC 3U7WL 1KIPA 3GJFK 1G6RH 3TZVC 3WFBL 4YDKH 1JNNH 3LD8C 4N8VA 3MLYH 4P3CH 2GYSA 1WWWX 5CEXA 2ITDB 4LLUA 2F54E 4RNRA 2AW2A 3VXUE 1MVUB 3ULVC 2EIDA 1G84A 2DMCA 4YDIH 1XT5A 1DLFH 4L4TA 3PP4H 1MQKH 2VKXA 4OCWL 1CQYA 2G9HB 4Q0XL 3RVVD 4H8WC 2E6PA 4X9HA 5I8KL 1CZ8L 4P4RA 3NMEA 4MWFA 3QDJD 1J1PH 4F57L 5L7XL 3TP4A 4LPXA 1CL7I 1CDIA 2ATPB 4PBXA 3VFSA 1DSFL 3GSOA 4JANB 3NVQA 5D2LA 3OJDB 4OGXL 4XBEH 5IJVB 1A3LL 3V4PH 1GPOH 4G6FD 3WNKA 4FXKB 5IHUL 4PY8I 4WW2B 3MSPA 1IGCH 4LHJB 1FV1B 3N1MC 3A6BH 1X5KA 4X4YB 4U1LA 3RVUC 3TIDA 4J2XA 3QT2A 4E41A 4R3SB 1CL7H 5C0GA 1P1ZB 5D7KD 2R4RL 4IJ3B 2IH1A 4QRQA 2CDEB 4KI5E 2P8LB 5L6YL 2X4PA 1C5DA 3QRFM 1GYAA 4W4OC 2C1PB 4XH2A 1ES0A 1MFBL 4HK3J 4HLJA 2DQJH 1SVCP 3KNBA 4QO1A 3G6JA 1AQKL 4Y1AB 1HI6A 5C07A 5IQ7L 1QRNB 4P5TC 3KPSA 3SDCD 4Z95L 2ICES 4X6BA 5J6GA 4X7DC 3TGXA 2P42B 3ARFA 1BLNB 1GCFA 2OK0H 1CLZL 4MCZB 4LU5L 1E6JH 1RJLB 2BSTB 4OIAA 3QQ9C 5J0BA 2Y36H 3VFTA 3ARFC 4RCAA 2X4OA 5I76A 2ZNWA 2R2BA 4OD1L 3UAJC 3E8UL 1JPGB 2QQNH 2HWZL 3NZHH 5F6IB 5DEGB 5LG1A 3D3VE 3LKRA 5IFJA 4YHZH 4ZO9A 4OGZA 5J11C 5DMIH 3N06B 5CP3H 4HG4J 1MRFL 5DRNA 1FGNH 3T2NH 3MJGX 3VXUA 4DVRL 1CWVA 2QQKH 4ZSOB 5AZ2L 3DMMA 4X83A 2R0LL 3TT3H 3O8XD 2EZ0C 5KVEH 1X3DA 1H5BA 4G42B 2Y06L 4U2ZA 5CZVH 3OKMA 4P3DA 4ZFOL 1UB6B 3ZE2E 1GGBH 1R5WA 3V0VB 5BO1H 1CE6A 2OP4L 5F9OH 4YXHL 4DQOL 1B4JL 1FL6A 4G6FB 4Z0BL 4KZDH 2VZ1A 4HWBA 4KTEH 3MGOA 2DWDB 4R0LB 5JLZA 3UPAA 3O6MH 4BH7B 2EDDA 4LIQL 1S78D 1CU4H 5FO9A 4XPBL 5E9DA 5JIPA 4M7KL 2HRPL 1AJ7L 35C8L 3V5DB 3FJTA 4RDQG 3JSSA 2YZ8A 5GS1A 2FX9L 4ODTL 2XXMB 3CMOH 1ZA6B 4JKWA 4XHJC 1DBBL 3RL2A 3HG1E 4HLZH 1GOHA 1CICD 3DARA 4LSQH 5FYKH 1R3JA 5C0DB 3MRJA 3VFRB 4KGJA 4OF0A 3SDCB 3QUXC 4ZYKA 5DQJB 5FOBB 4OF7A 1A14H 4OB5L 2VUYA 2E9JA 1IQDB 4M00A 1M4KA 1WZ1H 4WV1C 4MSWA 1FZMA 4MZ2A 2A6KA 4Z7NE 1VA9A 3TA3A 3CNKA 1OQXA 3QO1A 1FNAA 1NL0L 1PDKA 3B9EA 1QO3B 2XACC 2VJXA 5IB5B 5ALBL 3WFDH 2EXWC 4ZTOL 3AS3A 2P5ED 4OI8A 3WSQH 1TPXB 3JTSA 3BKJH 1F45A 4PJBB 3HE6A 5B3NA 4W4NA 3W9DB 3QJFB 2RHEA 4X4XA 2FECL 1PSKH 3BN9D 2RFXB 3EZJB 2M8XA 3PWLB 4M62L 4ODWA 3EYVA 3D3VA 5INCA 3DIFA 3MFFA 5HI5D 3MNZB 3HNVH 3O8XB 5DJ6B 4IM8A 1KUMA 4K3EL 4OAWB 1BM3H 2ADGA 2JJSA 2GK0A 4ZNEA 1MI5E 4HJ0C 4JM2C 3RZCA 4D3CL 3OKKB 3BDXA 5DO2C 1QYGL 2ITCA 4POZD 5IB3A 3MXWL 3RQ3A 4LHUD 2MKLC 1ROWA 1NCBH 1HKLL 1YJDC 5DD5L 5F7EL 5C0CD 4PFEA 3BISA 2QEJA 1M7IA 1RPQA 1U36A 4I3SL 4HUMB 3QHTC 2X44D 4PP1D 1DBMH 3UBXA 4PJDB 4XHQA 3WLBB 4D0DB 4U1NB 3O6KL 2YUXA 4RBPK 1FSKB 1UA6H 2DRUA 5IJKA 5EIQA 3VWJD 4BFIA 4M5ZL 5KVGH 5MEQB 1Z2KA 2CLZA 4HWZB 1QFUH 1NDGB 3AB0B 4X6CE 1WT5C 3SKNA 5IJKC 1OCWH 3LS4L 5I1AA 1XF4B 3PWVA 1PGRB 4PJ9D 3ME0A 4DJMA 4JEGB 5HGHA 2FR4B 2VLKD 4Q74A 2FJFB 5MP6L 5D1QD 5EG6C 2Y6SC 5BZWB 1UYWH 1UM5L 4ODUA 4K8RC 5JQHC 1MFAL 3HG1A 1M1SA 1NFDF 3TT1H 4S1RL 1FORL 2KKQA 3IXAB 4OZGF 4BFGA 5DUBA 5GXBB 2E9BA 2VN7A 2X89A 2RCSH 3C9NB 4JFXA 1J05B 4JHAH 1KC5H 3PWJB 1MCBA 4HKXB 1ND0A 1T1YB 3KYOB 4MS8C 5EORH 4QRSB 3H9ZA 3WIFB 1IC5L 3BKYL 3MV9A 4NQSA 2BVOB 3CXDL 3ZHDA 1A7RL 1BVKA 2GJ6D 2Q76A 4K3DL 5JXAL 1NCCH 4LSRL 5HYQB 4HUUB 4XNMA 3GBNH 3MO1A 3OKLA 3ZT7A 3WHXA 1HNFA 1WAAF 1S7RA 1P4BH 4ZUWA 1OAZL 4FQCH 1VFAA 2A73A 3GK8H 5DI8B 5TQ0H 3R8BB 1ACZA 1ZGLB 1PW3A 1RIHH 4MDIA 3LEVH 4PV9B 4Q9RL 1CG9A 1ZS8B 3GSXB 3V95A 2P5WA 3O3EA 5DJXB 2H41A 4HV8B 1LHZA 1PY9A 3BDBA 4HXBL 3DUUB 4LHUB 2R0KH 4S1SL 3N85L 1MI5A 4YGAB 3VFPB 2GTZB 4C83B 1ZHKA 3EYUL 4QWWD 5TFSL 1VSCA 1KB5H 1FC1A 3TPUA 2VR5A 3ES6A 4HW6A 1DQLL 3SDXB 4NFDA 1NFDB 2EYTA 4X0KB 5GZND 4RGMC 4EN3A 4IIQB 3S3SA 2EDTA 2R1WA 4OZGB 4YHMH 4EUPG 2Z35A 2B20A 3KVQA 2FYYB 5DJ8B 2IPUG 4TUKH 3I02A 1LK2A 1V3KA 3QUZA 2VDNL 4PJGF 5JDJA 4PJ9B 1L7TL 3REVB 1F5WA 2CXKA 1Z0MA 5HVFB 1JTPA 4X80H 1V7NL 3QUZC 5D1QB 1G0YR 5IT2L 1GGUA 3C60B 1CTNA 4AJ0A 5KSAA 3NPSC 1J10A 3ZZ1A 4ZAKD 1OARL 4KTDH 4L3ED 5FYLE 4M7JH 4OLXL 4D0BA 2OZ4H 2WP3T 4FQ1H 1CN4A 5GS2D 1H8SA 2AJUL 3ILQC 3VE0A 2V9RA 3GSQA 4LFHG 1CK0H 2JE8A 4NCDA 1C5BL 3AROA 4YUEH 1S5HB 5EU6B 5I2IB 3HI1A 3D9AL 4GSDH 4ZXBC 4XC1L 1NEZG 2AI0L 5D5MF 2UYLB 1UQSB 5ESVA 3PWPE 4XP5H 4O02L 1FE8H 5EBMA 2W91A 1CGXA 4LAQH 3L1OL 3F6IA 3QPQD 2VXTH 1K2DA 2P43B 1C8PA 2IBZY 1RU9L 2VABA 2DQHL 3MUJA 2D03H 3HHRB 1M71A 3VFOA 1LQSR 4PGEB 1JF5A 2OS7A 5FB8A 5DXWA 1G9NL 5TE7L 1I7UA 2KUTA 5FA3B 3NCYS 4HAGA 1A6VH 4PJGB 3NABL 1JL8A 5JMOC 1JUFB 2JCCE 2EH8H 4H1LB 3BZ4A 2X4SA 2Y7QB 5C2BH 3T2OA 4QRUA 5EBGA 2RGSA 1FNFA 1EZVY 4GXUN 5B39B 1EO5A 2QR0B 5I1LB 1UM4L 1UZ6E 3SGEI 3E6FA 3WJJA 4P2OC 1YJDL 1I85C 1K3IA 5DJAB 5DMGD 4FFWC 3WS6C 3RWJA 3DRQB 1KCSH 3OMZA 2L0DA 2GT9B 3LEYL 4XPFL 4KI1A 3BSZH 4AENA 5FA4A 3BEVA 3KWWA 3T77A 3GJFH 4ZD3L 4ZNCD 5JORB 4DN3L 3SGEH 2MMXA 2GFBB 4UIMB 5IVOA 2NR6D 2L7UA 4NNXB 4N0UB 4ZAKB 1J1OL 3G6AA 2D0HA 3SCMD 5D70H 3RX8A 4MQSB 1KBGH 3CPLB 4KK8C 3SJVE 2YC1A 1MRDH 2EE9A 4K55A 2X4NB 1K8DA 5CBEA 1T20B 4JR9H 4EI5D 2AXGA 3W0WD 1LO0L 4JFED 1UKTA 4OFYD 1EO8L 3K8KA 3D0VA 4PJ7F 3QWQB 3RU8L 4XGZA 4OCSH 4NUJB 8CGTA 1XGYL 1JPSH 3TN0D 3PWPA 4PRNA 4LSPH 1AQDA 4GKZA 4WJ5B 4O9HH 4UTAH 3CFKA 5JW5A 4TTGA 3RNKA 3MRCB 4XBPB 4YH6A 1INDH 3D2UA 1S9XA 3DROA 1U58B 4WO4A 4G8FA 3CLFL 3ZDYF 4JO4L 1S7SA 4OLWL 4Q6IB 2PXYD 1EMTH 1CIDA 3NIFE 3BP4A 4KVCL 3BP5A 2FX8L 5L2KD 3ZKXB 5F9WC 2O61A 4MLIA 3PGFL 4KRLB 4Y16C 4Z7UF 1BVLA 1G7HA 2R2CA 2YWZA 3QYCA 5FIEA 1ZGLP 2JCCA 3LB6D 5AUMA 3QJHA 5ISZB 5I30H 2ICWI 2FO4A 4L9DA 1G0XA 3VXMD 2EXYD 2R2EA 2ZCLH 3CFDA 4NCC2 2D4DA 4YAQA 2ED8A 2XQBL 5IKCB 5HYJD 3P0VH 4XP6L 1WTGT 4PJXA 1YY8A 3CZJA 3TYFA 2Y07H 1F4YL 1TZIB 5E00A 5B22A 3GSUB 3H9SB 2FGWL 4PV8A 3SPVB 3KPLB 3VGAC 4PGBB 4HJJH 1OHQA 4JFOA 4HMCA 5BS0E 4L4VA 1CDYA 3PABB 1I3GL 1CTOA 2NY4B 4PGZA 3IDYC 4KKNA 3ZTNH