3MUGB

Crystal structure of human fab pg16, a broadly reactive and potent hiv-1 neutralizing antibody
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
239
structure length
238
Chain Sequence
EEQLVESGGGVVQPGGSLRLSCLASGFTFHKYGMHWVRQAPGKGLEWVALISDDGMRKYHSDSMWGRVTISRDNSKNTLYLQFSSLKVEDTAMFFCAREAGGPIWHDDVKYDFNDGYYNYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antibody PG16 Light Chain
publication title Structure and function of broadly reactive antibody PG16 reveal an H3 subdomain that mediates potent neutralization of HIV-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 238
sequence length 239
chains with identical sequence D, F, H, J, L
ec nomenclature
pdb deposition date 2010-05-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mugB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3mugB01
5DF0A 1V5JA 1ZANH 4YHPB 4NQXA 1NBQA 2BRRL 3ZYIA 3VD9A 1T20B 1QR4A 1WVZA 2VLLA 3QI9B 3N1QC 1YUHB 3OJ2C 3SBWC 1PG7H 2J5LC 4JG0L 1MJ7L 2PNDA 1ZAGA 4PJFA 5T5FH 4LEXL 3RWHA 4L8DA 5F1KC 4ZUSA 2XKUA 1F3JA 2WLZA 3ZL4H 2AVGA 3RKDC 3MLPA 4NQCD 3UTZA 3U2SA 1IZKA 4EVNA 1G9NL 2F5AH 3BP6B 1OARH 4OZHE 3P30H 1V3MA 4RFOH 2P42B 4MQXD 1NGXA 5GRVK 1LDPH 3WXWH 1TLKA 3ROLA 3LQMA 3MLWL 4HBQA 5DRZA 3H9YA 4GS7B 4MMZC 3WIIL 1E6OH 2W0FB 3HZVA 4FXKB 1U8NB 4YO0A 4JG1L 5J0BA 1GRWA 4F8QA 1KB5B 5DJYB 2C1PB 1FSKC 3DVFA 1JGEB 1OAUL 3SKNA 3DRTB 4P9MH 1Z0NA 3FTGB 4TSAL 4AM0A 5GS0H 5BCAA 1FDLH 1MPAL 4QYOB 1EK3A 1JUFA 4HPOH 2VDRL 5EOTB 1IBGL 4OM1H 4PRHA 3NH7L 2WUCH 4OQTH 4OGXH 4QRQA 1HQRB 3BD3A 3GMNA 1MHCB 1EHNA 2ARJA 5D1ZC 3QG7L 2VLJD 3BX7C 3VDAA 1MRFH 4H20H 4JFHD 3MV7D 4X7FC 2X41A 4Z8FL 5I1EH 3VCLA 4F33B 3ULVL 1ZLWK 1XGUA 4P9HH 2XTJB 1W72B 2BVYA 3BH9A 4JO2H 3WHE0 1NEZA 1XGTA 4PJFF 3F12A 2WBJA 3NIFE 4XMPH 2DQTL 3LZFL 2GYSA 3BGFB 4TPRL 5BW7A 5JQ6H 4JDTH 3C5SA 1IAIL 3NAAH 3GB7A 3RQ3A 1G7MA 3IFOA 4H1LH 3EYVA 4AH2B 3CDGB 2F8VA 4LU5L 4MJIB 1W8OA 5IG7A 4HEME 3O4OC 4C59B 5MEQA 4JN2A 4LCYA 4P23B 2BMKB 3B2VL 1GZPA 3IDGB 3JV4B 4G5ZL 3Q0HA 4PV9B 4HDIB 5I1DA 3NCJH 4X4XA 3DVIA 1XF5A 4L4TE 1U58B 3DO3A 4JFXB 4MXVF 1EPFA 5DMKB 3PWPA 3I3BA 4OCRH 1ORSB 1EUTA 3HG1E 4BJLA 2DS4A 1KCUH 2VZUA 4JPWH 5D72H 1G0DA 2CH8A 2AK4E 2XRAH 4KROD 4AEEA 2R4SH 2QHLA 2DQDH 5J13C 5J6HA 4IRSB 2PW2B 1A4JB 3AB0B 4JFQB 4JVUA 3SO5A 1CF8L 4N0YL 5EO9B 4FQLL 2GT9A 5J1TC 3BIKA 3T0AA 5EPMA 2FSEA 5DHYA 1JPTL 4TUKL 3U4EB 4BZYA 4JY4A 2YPLD 3JWOH 4OCMC 3U83A 2C5DC 4KKLD 5GZND 1OTUC 4HT1L 5E4EB 1IAKB 5CUSL 2E7BA 3BISA 3O2DH 5L88L 3R06A 2WUBH 1MWAB 3P0VL 2HT4C 3OG4B 2D3VA 4WWID 1PLGL 2O26U 3C8KA 4B53A 4JG0H 3TIDA 1BQHA 3BPCB 4BKLA 3G04A 3QXDB 3WO4B 3UJIH 3MRFB 1YZZA 3FO0L 1BVKB 1EDQA 3RHWK 1G9NH 3QB7C 3FOLA 2K7PA 1U95B 1OGAA 5IQ7L 1J86A 1D5BA 1QSVA 2ZUUA 5EU6B 1YNTA 2D7PA 4M5YL 3MLWH 1I7RA 1K9TA 2YUVA 3WIIH 5GS1B 3ULUC 5ECJE 5JUEL 5D7LB 5FKPA 1IAII 3MBEA 4R9HA 4BYHA 5J6GA 1KULA 4JG1H 3ARDA 2OR7A 15C8L 4XCYA 5F7UA 2AXFA 1F4YL 2NLJB 4HLJA 2NY2C 1KPRA 3WFBL 1RZJL 3T65B 4P5MB 3AGVA 1OAUH 4YBLB 3FN9A 4FA8A 1C7SA 2CJUL 32C2A 3EFDL 1MPAH 1LO0L 4EI5A 3EJJX 2C3XA 3EOBA 1HWHB 1IBGH 5CZXD 1BF8A 4ORZC 4KI1A 3SY0A 3CDFA 2BK8A 5JW3L 5B8CA 2MNUA 1OQOA 4Y4KB 3O6FD 1BGXL 3QCUL 2YZ8A 3QG7H 3RWIB 5DVKA 3LN4A 4BSVA 4ZSOA 5KSBE 4U1JA 1NMBH 3LSOB 3BWAB 1RZ8A 3ULVH 3I50L 3DI3B 3DTXB 4LPXA 2X1QA 4JKKA 1NQBA 5IROA 5BVPH 2R1XA 4NN7C 3U9UA 1NMCB 2DQTH 3BI9X 3LZFH 3WFCH 4AZ8A 4LSSL 2DM4A 4WCYL 2EO1A 1IC4L 4UV7L 1A3RL 4MD0A 1IAIH 1ITBB 1RVFH 5JA8B 4LPVA 1OW0A 2MHAB 2Q1EA 5CMAA 4MD5A 4ZQKB 2XQYG 2UY6A 5JPMA 5ID1A 4ODVL 4LU5H 3MO1B 5I1LB 4R0LC 4MXQC 4Q6IA 5D7JA 4JJ5A 1IGFL 1CGUA 4Z77B 1DN0B 4G5ZH 3PG2A 2LVEA 1DP0A 1CBVL 1K3ZA 1MCQA 1GXEA 3L7FB 2P24A 4XX1E 4JPKL 4K8RD 1F2XK 4I3SL 1DR9A 1N5AA 4LBEA 5CEXA 4PPTA 4QLRA 4Y16A 5DRXA 4FABL 2OL3L 2P5EA 5CJBA 2EDDA 4EJ1C 4HD9A 3E0GA 4MCZB 4URTB 1NFIB 3MRMB 2GCYB 1JNNL 2HWZH 1KLGA 1KIPA 4PLJC 4PJAE 2EDNA 3B9DA 4O2FA 4O5LL 1OB1A 4R2GC 3G5YB 4KK6D 1CF8H 4N0YH 3NZ8A 4FQLH 5E9DD 4X5WB 1RMFL 2WBKA 4G9DB 1B4JH 3LB6C 3SDDB 4AEHL 5C0JB 3GSVB 4FFZL 3RTQA 1JPTH 3NPZB 4TUKH 3ROOB 5A1AA 1PSKL 4HT1H 4FRWA 3TVMA 4HHAB 3P0VH 3X17A 1PLGH 1UCBL 1KLFA 1QSED 4ZAKA 1LNUB 1XGPB 4KGJA 1YC7A 3H42L 3RU8H 5IV2B 3DX8A 5J06A 5EO0B 5I74C 5E5MA 1FCCA 5E00B 3A6OA 5DURB 5GRYA 3RDTB 3PXHA 4L8BB 4KVCH 4G6FD 1UVQB 3FO0H 4XB8A 3WBDA 5J11B 4MCYB 1RUKL 4L9LA 4XCFL 4D3CH 3LHPH 4TUOB 5ACLA 4YH6A 1G7JB 4M6NL 5I1IL 1JGDA 3QWOA 3MREB 3ES6B 1UZ8A 5TDNB 3P0YL 1IILE 1YPZB 4I18C 5IQ7H 1U8KA 4HUMB 1ZS8A 1TENA 4JO3L 5BVJB 1FZMB 2WQ8A 4M5YH 3QWRA 3VFWA 2FIRT 5DFVC 5JUEH 1JZ3A 1U8MA 1NGQL 4AMKH 5J9PB 4DQOH 4ERSL 3FB7B 3VFOA 4YPGA 3VXME 4U1HA 4CL7A 1SVZA 4JRXB 1AC6A 4NUJA 5LCVH 5T1MA 3H9SB 3WSQL 1JHTB 3KPRA 1I1AD 3TH4T 5ICYB 3WFBH 2OI9C 3NFNA 4JQXA 1KIRB 1CD0A 3QEGL 3IJSB 3PXJA 4FQPA 3TV3L 5GJTL 4IDJH 2CKNA 5FM5O 3EFDH 4P59L 1GPOL 3VXNB 3CFCH 3MRHA 3WLWD 1V7ML 4HUVB 3DNKA 2WWMC 5GIRA 1KB9J 2W07A 3VD4A 1DCLA 3MMEA 4YZFE 5I17B 4FQXC 3DI2B 3I6LE 3OB0K 3H9HA 5JW3H 1E28A 5HVFB 7CGTA 1T89C 3IVKB 4FMFA 4JKWA 1H3UA 4MNHB 4KTEH 3DVGB 1WZ1L 3G5XB 1NMAL 2EDXA 3I50H 3C5JA 4U4BA 2O5ZL 3Q1SL 4WV1C 5AYQA 1QSFA 3W11C 2A74B 3TCLA 3QDAA 4RMVA 3V6OC 3QNYA 4OCNC 3Q5OA 2R0WL 3OKYA 4WCYH 2V2TA 1CXKA 1GZQA 1IC4H 1A3RH 4UV7H 1FGVL 4WDIB 4C58B 4ONGH 3L95B 4GG6B 2V9RA 1AHWC 3RVVC 4LQ1A 4ODVH 1QLRB 1SYSB 4HKZA 2X4PB 3NN8B 3WNOA 1A1OB 1IGFH 1QA9A 2VQUA 5F7LB 1T21B 4LAQH 1CBVH 4CKVX 3QJFA 2FJHB 1CZ8H 3W81A 4JPKH 4DVRL 4CADB 3OSKA 3TT1H 3NZHH 3VRIA 4I3SH 3GSUA 4JFED 1JCKA 3UTTD 4FABH 1NCTA 3W0WA 3QXAB 5C2UB 3U36B 3NFSH 4DCQA 4U1MA 2WW8A 3O4LD 4Y5VC 1KG0A 3LN5B 2B2XH 2W59A 4PBWD 5D1QD 5I9QC 1F42A 5DK0B 2RFXA 3HMWH 4D8PB 5C0CE 1ED3B 2DJ4A 3CMGA 4O5LH 2D03H 3KPPB 3G6AA 3VA2C 5GGRB 3I85A 1RMFH 5ADPL 5C0GB 4FFZH 4QHMB 4U1IA 3U48A 1A9EA 4XNZB 3O8XB 1J05B 1LHZA 2FJFB 4FN0A 2DYPB 3DUHA 3ZKXB 1E6JL 3TZVD 3BDYL 4RZCB 1UCBH 3DMMD 4PR5B 4CJ1A 4LKCB 4KJPC 4D0BB 5BRZB 1KJ2L 5E7BA 4X6FB 1M71B 4IRJA 5TDOA 2GUOA 4LHUA 1K8DA 3HI1B 4NZRH 5D7SL 1NLBL 1RUKH 5JDJA 4XCFH 4KWUA 4N8VG 4OQ1A 3U0WL 1K2DB 5FYJL 1C5DB 4IRZL 1JTPA 4XP6H 2FX9L 4U05A 1JWUA 1S3KL 1QBBA 5C0EA 1Y6KR 4F3FB 4LCWD 5EUOB 5GGUB 2E27H 5CHNA 1YEIL 4CVZB 1NGQH 5ICXB 4MJ5A 3T1WA 2F53D 4NSKB 5L7XL 3Q6FA 5HHOE 4J23A 3WSQH 3DO7A 1CFQB 2BDNH 2DWDB 1JYWA 1Q9LA 3D0LA 3IXTA 4NO0D 3QUMA 5B38G 4OLYH 5GJTH 1GPOH 3RPIA 1ZE3C 4WUKL 5DEGB 4OZIE 3V9FA 3MLVL 3ZE2F 1BD2B 4FOMA 5MI0B 1HSAA 1RFDL 1WZLA 4NFBA 5IM7B 3S35L 5JOPE 3AM8C 5TPWH 1L6ZA 3CZFA 1DQJB 1LK2B 2UUDH 5DYOB 1J8KA 1IAOA 3L3GB 5EZOL 1JTTA 4LCCA 1PZ5B 4NO3A 4CNIA 2D4FA 1S78D 4AENB 5BV7L 2O5ZH 4HWZB 3Q1SH 3UEZA 1ZEAH 3I3DA 1X5XA 2HG5B 1JWMB 5GRWA 4M9PA 5LGJA 2BSTA 1KELH 2E6PA 2DWEA 3FB5B 1C7TA 1CIUA 4LDOB 3QEQE 4PJIA 2GITA 3WJJC 3TO4A 1PKQA 4GS7C 1DE4A 1H3WM 3MFFB 4Y4FB 2X5PA 3OQ3B 2R0ZL 3KDMA 4C56E 1HHHA 3ZSTA 1KJVB 5E6IB 1F4WL 1TNNA 3EYSL 1VERA 4IMLA 5BJTA 3SKMA 4EN3D 2BNRE 1FYTE 2GY7B 5F9OL 4L4VA 3WKNA 3HS0B 1DUYA 4DVRH 2A1WL 3BE1H 1U8PB 2IPTL 4IIQB 4XZUB 1RZIB 3CDCA 5IVZB 1M7IA 3KR3L 2YRPA 3RX8A 4Z0XA 2JCCF 1QR1B 43CAB 5FOBB 5I8CB 2B7DT 2EC9T 3O9WA 2DLFL 1LE5B 2QKIA 2NY6B 4QRRE 2E5EA 4TTGA 1BEYH 3IRZA 3DETD 4XPGL 3PDDA 4HS3B 2BERA 3REWB 5ADPH 2O93L 1FL3A 4NJ9H 3Q3GA 2HLFC 3X13A 4KJWD 2XTJC 4U1NA 4KZDL 8FABA 1G7HB 2BOBB 4OGAC 3HI6L 2FR4A 1E6JH 2J1KA 2QHRL 4PRHD 5SWQA 1RIHL 2VR4A 5FB8B 4RFNB 3P4NB 3ARSA 5L2JA 3QPQC 2JTDA 5LAXB 2BNQB 3KS0H 2R2BB 3C60A 4FQHA 1B0GB 2WNGA 4PLOB 1B2WL 1RJYA 2HMID 1NLBH 4M7JL 4YFLI 1AH1A 4ZUTB 4PY8I 4P23C 2OJEB 5JA9A 2CGRL 5FYJH 5C9KA 1A6WL 4IRZH 5HI3C 2WIMA 3X14B 2FX9H 1UWXK 4I0PC 5ILTH 1S3KH 4Y1AB 1T0MB 2C4FT 3OKOA 1WFOA 5ISZB 4XTRC 3VXPA 2R39A 2H2PC 4G80A 4UDTA 2WP3O 1QACA 5D6CA 1WC7A 1UKTA 5F8QC 5CAYB 1SEBA 1TETL 1XR8B 1A6ZA 1F5WA 4OZGF 4K71B 2X4QA 3AB0C 4LLVB 1U3HA 2NXZC 1VFOA 2Q8BL 5EZLB 2ZJSL 4J3VA 1ZHBA 5EC2A 4WUKH 4KK8C 5JW4N 4PGEB 2FDBP 4XCEB 2DM7A 1N4XL 1BFSA 3EAKA 5T3ZD 3PWPD 1RFDH 3S35H 4MB5A 1QRNB 2V5SA 2NY1D 3PWJB 2PYEE 3F7YB 4N9GB 5DJXA 2F19L 2P48B 3WO4C 5EZOH 1TVBA 4LPWA 3ZMRA 4D9QE 5DSCB 2Z31A 2Y36H 3ULVF 1E4KA 4HJGA 4LLQA 1WFNA 3TLRA 3I2CL 5KANI 1BZ7A 5SWSE 4UU9A 1DQQA 1IKNA 1UXWA 4WI5A 1U2HA 2P5WB 1MFDL 4POUB 3S9DB 1OD9A 4UNVA 3QDJB 5T3XE 2XWTA 1XCTB 3V7AG 2ADIA 2LU7A 5GS1C 2EKJA 4E0RA 4NKIL 1U8OA 3QH3B 1P84J 3VXQA 1KN4L 4H26B 4EBQH 4PJHA 2VZSA 1HSBB 4M8VA 1WAAE 3F5WB 4NQDB 1CGYA 4X7TA 1F4WH 3EYSH 1J1PL 1F02I 2BVPB 2DRUA 4QHUB 4X7SL 3ARFC 4YBLC 4QF1A 4ZNCD 5A3IC 3GO1L 3T77B 1T03L 2VUYA 2IPTH 1OGAD 2FL5A 1INQA 3MROB 1Q94B 1URLA 3SCMA 1IFHL 2AEWA 1ZA3A 5I2IA 3IU3A 5B3JF 3ALXA 3MBED 1S9XA 1S9VB 4N90D 3TH2T 4MVBD 5EC1B 3ARDD 5INDB 1C1EL 1EEQA 2IBZY 3V6BR 3V6OE 3RUGE 2IADB 4PLNC 5B4MD 3P11L 1NGWA 3GIVA 4EIZC 4JQVA 1UA6L 5KG9A 2ZUVA 3EDJA 1IQWH 1Z3GL 1OGTB 5DZNA 1D9KA 5HGDB 4E5XA 4EI5D 1P1ZB 4ENED 2QHRH 1EERB 4WGVB 4PJ9C 5H35A 5C2BL 3UTSE 1RIHH 3ARWA 2IQAB 2ZKHL 4J1UA 4LLMA 1MCSA 3DROB 4M1GH 4PLKC 2FLRT 2NY3D 3C5ZC 4ZFOL 4DGIL 4ZTOH 3L1OL 4X99A 3WNLA 1E4XL 2OZ4H 1TNMA 2AJZA 2PO6C 2X1PA 3HC0B 3ARZA 1MJ8H 1YN6B 4HKBB 3MV8B 4M02A 3KPMA 3RNQB 5IB3A 4X6CA 4UIKL 5EIVA 4OF7A 1LE9A 4O9HL 4PJHF 1SM3L 3SDXB 2H1PL 1IM3B 4KZEL 2VMFA 4BUHA 2AV1A 3P3YA 3BZFA 3C87A 3CLFL 1S7SA 3BPLB 4LARL 4MSWB 5EBWA 3IJHA 1JNLH 2UV3A 5FYKU 4OIIL 1PEWA 3BD5A 4XCCL 1WIOA 3FQTB 2OL3A 4V2BA 4RIRA 2NW2B 5D7JD 4JFYA 4X6DA 3GKZA 1BF2A 2ZJSH 5C9JA 3SDDC 3BESR 3JUYA 1HCFX 3CSGA 1HE7A 5HD8D 4LF3A 3BZEA 3OKDB 4WUUE 3E6HA 1N4XH 4P2OA 3WUWB 4DVBB 1AD0B 4P2QA 1AO7E 4HUUA 1UXSA 2YUWA 4Y16D 2J8UB 1IZJA 2P5ED 5HPMB 4ZXBB 3QHZH 3JVGA 3NMEA 4TSBH 3RDTC 3EYOB 1EAPA 1MIMH 5L8KB 4HUWB 3VU2A 1CDBA 3RAJL 4P5TA 4EUPB 5FA3B 2CLVA 3I2CH 5J11C 3VFNA 2A77H 4JFDA 3HUJB 1LP9A 1UB5A 1CQKA 3ETBF 3VWJA 4CW1A 4TOYH 1KB9K 4MYWB 3MRQB 2RCSH 4NJAH 2C7UB 2NZ9D 1V05A 1OAKL 1K8IB 3S3JA 1WBZB 1MVFA 4MQ7A 3TVMD 4PJ5A 5HYJA 2VXQH 2DQFA 1UJ3B 1OL0A 4RFEA 1ZLUK 1OVZA 5K33A 2Z35B 1A21A 2B1AL 2YD8A 5FYLL 2DLGA 2ZUTA 3C6LB 4D94A 3C8DA 1CGWA 4RQQA 4NHUB 2AP2A 3Q2CA 1Q0YL 1J1PH 5ANMB 1JGUL 4MS8C 1E4XI 3DRQA 4X7SH 3GJFB 1GHFL 5E8NA 2EIZB 4F7MB 1EFQA 1JK8B 1J0KA 2X4OA 1SJXA 1T03H 3VI3F 1SBSL 2EDJA 1WCBA 1Q38A 4OV5B 3CSYB 3DUUB 3EDDA 2C26A 1TJIH 2H6PB 3PP3H 1R24A 5CGYC 1JL8A 4J12A 1QO3A 3QWRD 5EB9A 1CE6A 1FNEB 2BVOA 4X6DF 2CUIA 2Q6WA 4AG4L 4U3CA 1VFUA 4F7PA 4WNQA 1C1EH 3LMJH 2Y6SC 2B20A 3G9AB 5HYSA 2V2XB 5JW5A 3IDIA 4XHQA 3KPRD 3P11H 2GJ6B 1UA6H 3MRLB 2EYSA 4OUUA 2IBZX 3KNBA 2ZUWA 4MAUL 3DV6B 3PWLB 2MKLC 1CE1L 5DD5H 3V6FA 4XXCA 3VJ6A 2VC2L 3GIZL 1NFKA 5C2BH 4XPBL 5HYEA 2VWEC 1T1WB 2XACC 1LP9F 3BHBB 4PJXA 3L5IA 4H1LB 1I4FA 3L1OH 1YY9D 2ZOLA 1E4XH 1RHFA 1N0XL 4NKMA 3H7BB 1TZGL 3DX7B 1CR9L 1YDPA 3HC4L 2DIAA 5FO8A 2B8OT 4ELMB 5JXEC 2NR6C 2C3VA 3MV7B 1MUJB 3FFCA 1QSFD 1GC1C 4UIKH 1S7XB 3H7LA 2ED8A 2R1YA 3VG0H 4O9HH 3ARBC 1MELA 1SM3H 2H1PH 5CCKL 2WQRA 3DVNB 3IFPA 2GTWB 4G42A 4UIMB 2BVQA 4XRCB 1FORL 2JCCB 4DZ8A 1FNSL 4ETYA 1G9ML 4OIIH 3D0VA 5DZOA 5L2KA 4R96B 1ND0B 4YX2L 2XQYK 5F9AC 4YHMH 2XTJE 4J4PC 5J1AA 4LVNB 3VGDA 4PJEB 3T0EB 1JYNA 3MRPA 2UZIL 2R29L 3BKYL 2V7HA 3OGCA 3EOTH 5ESQB 4XNZC 5E2TL 5ACZB 1MI5D 3NCEB 3O8XC 4ODBD 1KCLA 2X40A 5DO2D 3TPUB 1ES0B 1F4HA 3FO2A 5JIPA 3I6GA 1G6VK 1Q0XL 4PV8B 5ALBH 1FAKT 4FG6C 4NP4L 4MJIE 1IJ9A 2PETA 2PCPA 1X9QA 1ZT7B 1WUNT 3JBG7 5CP7B 4U33A 2X09A 4U1GB 2EDFA 2ATPB 4WJ5B 3RAJH 1T1XB 3BGMB 4RAVA 2AJYL 1MCPL 1KJ2A 1HDMA 5C09B 4AEIL 1QHPA 1CD1A 4PJXF 4AEFA 5HVHC 1OAKH 2IBGA 2X9WA 5FCUL 1AXSA 4IOIA 5CJQH 1T5XB 2HVJA 4GRMB 5JPNA 1YEEL 3RRQA 2CXKA 1N59B 5DGRA 5E03A 2DKSA 2DI7A 5MENE 2FO4B 4R4FL 1N0LA 3PABB 3C6SA 5EWIH 3WXVH 2A6JB 1Q0YH 3KPQA 3VW3H 4OZGB 1JGUH 3QIWB 4LHUD 5FV2A 3QIBB 3S88L 4OV6F 1GHFH 3HZMA 2FHCA 1CVSC 3MLYL 3WFHB 4FTVB 1EHAA 2KKQA 1DLFL 1Q9OA 1UC6A 2A38A 1NEZG 4QTHA 5TDPB 3VXSA 5AUMA 3RNKB 5MI0C 2Y07L 4AG4H 4Z7UA 2EIDA 2OTUB 1F3DJ 1VPOL 2E6JA 1IARB 3L3KA 3OL2A 4PG2A 3BXNA 3G5VA 1NUNB 3E3QC 4WHYG 4U0RC 3RVWC 4XI5C 5FGCB 4HMCA 4F7TA 1PJ9A 5KSVA 2E7MA 3D18A 5IESH 4KKAD 2Q3ZA 5EU6E 3STLA 2BJML 4JR9H 4MAUH 1F11B 4FFWC 5CZVH 1CE1H 5D7LE 2E7LC 2VC2H 5CLTA 4OAWB 4FS0A 4XPBH 4F9LA 3RL1B 2GFBB 2BSSA 1QD0A 4MHHI 5E2UL 3HMXL 4Z7WA 4ZTPH 4XNXH 4F58H 5C0IB 1WWAX 5AZEL 5FYKL 3HAEH 1CDJA 1N0XH 5ERWA 1U8JA 2G60L 3P73A 4EEEA 3RWEB 5DJAB 4N8CL 1TZGH 2QADD 5DVOA 1JZ8A 3HC4H 3ZHLA 1I7ZA 3D85A 2ICWB 5HHPB 4JY6B 3WCYA 5IBLD 4CN1A 4U6VL 1PEZA 4HZAA 4JM4L 4U1KA 4GFTB 1H8NA 3QO1A 4HXAL 3P4OA 2X4NB 4GKNB 3C9NA 2K1MA 4WY7L 2P47B 4TRPL 1K6QH 1FNSH 5IVXF 3OAYH 1ORQA 1FAIH 5DI8A 2F8OA 1G9MH 5IFJA 4HF5L 4NO2A 2RR3A 4PJCA 3TBWA 2ITCA 1WWCA 1NCCH 1QPPA 4M4PA 4YX2H 1BQHG 3TBSA 3OPZL 3PWNB 2NY6C 2UZIH 5IWLC 4EIGB 4YHLH 4XMKL 2X44D 4HGMA 4G8FB 4WW1A 4L4VD 4Z7UF 1DFBL 2R2HB 4RNRA 5TQ2L 5E2TH 2A6KB 3V4PL 1A7OL 35C8L 2UYLA 4G3YH 4H5SB 4XP4L 3HE7A 4AIXA 1Q0XH 1ZT1B 4NP4H 3NCFB 4RFNC 1T4KB 2Z8VC 4HZLA 2DLEA 4UOW0 4O51B 2NCMA 2AJSL 4Y4HA 3O9WD 3LIZL 3L3OB 4M4RA 2D0GA 2ZSWB 4YFLF 2NY5C 1MCWW 4QKXB 5IMMB 4NRYA 1HHIA 3D69A 1BJ1J 3QAZC 1UWGH 1U3JA 4AEIH 1S7UA 3LAFA 1FHGA 4OCXL 1OAYL 4QHNA 5FCUH 5E9DB 3VFUB 4LIQH 3KLHC 3QFJB 2P8MA 4LSTL 5I8EA 5B39B 5DMIL 4O4YL 2PF6A 5CBEA 5HDQL 1U92A 1FP5A 1N7MH 5HHNB 2DD8H 4R4FH 3MR9A 2B4CC 5DDHA 4YHKL 3C60D 3D2UA 4P5KB 1KIQB 1I9EA 3S88H 3OXRB 1N64L 3PWVB 3FT3B 4OZHA 4K71C 1BFOB 3K80A 4NC0B 3SKUD 4I0KA 1DLFH 4NC1E 5DJDB 4PJCF 2NMSA 4Y89A 3HNTL 1HNGA 3QUKB 4H88L 2ZG3A 1DBML 4HWNA 3LKPA 3P4MA 1A1MB 4R90H 3O3EB 1VPOH 3KLAB 3IJYA 3SGJA 3OX8A 3QCTH 4LNVA 1G6RL 5I1AB 5EU3B 4ZUWA 3JTSA 3UPRA 1UACL 1VADB 1YPZE 1B6UA 4IOFD 1DTUA 3FN0L 5TF1L 1CFSA 2BJMH 3GMLA 1YNKL 2X1OA 2V7NA 1D3CA 1KYOJ 1I1AB 2A73A 3UBXB 3TBVA 5DC4B 5KJRL 4JRXE 1HHJB 5E2UH 3HMXH 2IEPA 3H9SE 2WANA 1I3RA 5LG1A 3K8MA 5IBTH 5AZEH 4U49A 3LQAC 5CGMA 2FZ3B 2G60H 2FHFA 3DV4B 5J3HD 4N8CH 5IB2A 1R3LA 1FG2B 3ZTJH 2Z31D 4KKNA 4HULB 4U6VH 5FO9B 1DBJL 2NY0D 1L9NA 4AL8L 4UB0L 4HXAH 5E2VH 2MCG1 1LO5B 5FV1L 4EDXB 3PHQA 4M9OA 2OR8A 4MA3A 4WY7H 4MDIA 1GGUA 2GJJA 5I6XB 4OZHF 2NW3B 2J7LA 1GGBL 1MCCA 1CLOH 3HI5H 3MLSH 2AGJH 4ONOA 3S97C 2Z9TA 1DBAL 2IGFH 4L4TA 1P7QB 3I9GL 3LPWA 1BECA 1H3VA 2AKRB 3HR5A 3AMKA 3VXTA 2VWEE 2YC1A 5TQ2H 2O61B 3HG1A 1TTUA 3IDNA 1EIBA 2QEJA 1TITA 3V6ZA 1LDSA 1S9KC 2V9TA 3DECA 4GG6E 4TNVK 1FVDB 2AK4A 5DS8A 5EBLA 3FQWA 3GHEL 4OCYH 3HPLB 1AGBA 3SCMD 5E2WL 3G5ZA 4XBPB 2AJSH 4JFEB 1KXTB 2YD7A 5F3HB 1OAXL 4ZNEE 3QUYA 1H5BB 4NBZB 5AYUH 5E56A 5JQHC 4MNQA 3QZWB 3BYTA 2VKWA 1T04A 1U91A 4ZFOA 1KV3A 5JO5A 1OAYH 1SYVA 1BJMA 3GM8A 1D9KD 1HKLL 4L3CB 3QA3A 4O4YH 4UV4L 3N0PB 1JZ6A 3OJDA 3ULUH 1JRHL 3T2NH 3BPLC 3NIFF 3PGCA 1AQKL 3CFDB 1GIGL 1KTLA 5BS0B 1CK0L 5GS2H 1RPQA 4NRXA 1HK6A 3MRKA 3WUWG 5EU4B 2G5BB 3QDHA 4N5EC 1T1YA 4L1HA 3RPKA 4ODXA 1NGZB 1PZUB 1A0QH 3VWKC 3SKOA 4H88H 5BRZE 5HHQA 4HKXB 4XWOC 2QR0B 1Y6MR 3QIUC 5TE7L 3LRGA 3B8YA 4AY0A 5EUKA 1W8NA 1WF5A 4ZXBC 1G6RH 4BH7B 4RMTA 1ACYL 4M1DL 4DKEL 1Q9WA 4XPFH 1UACH 4Y2OA 4DWHA 2FX8L 4X9HA 2EXWC 5TF1H 4DAGL 5HGHB 4M1CD 3DPBA 5EUOE 3S4SB 4MQTB 5F72S 5GISL 1WBYA 1CVRA 2HH0H 4JY5H 3WFZA 4CVXB 5FM8A 4P2OD 1AD9B 4F7CB 3V79C 4DZBB 4P2QD 1UJ3C 2X70A 5H94B 5KSBA 1P7KB 2QQKH 4X6BB 5DRWA 2FJGB 2D7TL 3C6LC 3CUPA 4JFZL 2QQNH 3BIAX 3PL6B 2XWJB 4LSRH 3PDOB 3VA6A 3O11B 1OTTD 4EI6B 5HGAB 4D0CB 1BD2E 2QSTA 5SX4I 1DBJH 4JFDD 3VWJD 5D96B 2DQIL 5C0DB 1H3TA 3CDYA 3KJ6L 3PIQB 1EJOH 3DHJA 2HJFA 4QY8A 5DQDL 5HYJD 4PJ5D 2VN7A 3BW9B 3E3QE 3FQUB 4CRPA 2IAMB 1JRHI 1GGBH 4G7YL 4QRUB 2V2WB 1RZFL 3L9RA 4KDWA 3AY4C 1M7XA 1VACB 2YBRA 1PFCA 3GSQB 3CK0H 4P0DA 1IEBB 1MCJA 3S35X 2CO6B 3WHXA 5ACMA 3OR6B 5AG9A 1HXMB 2XWBB 5C0RL 3ZKMD 4CN6A 4P4KA 5F7DA 4EN3B 2JIXA 4L3EB 5F1IA 5DUBA 5C0BB 5A2IH 1NSNH 3O41B 3GHEH 4AJ0A 5E2WH 4LK4A 4XC3H 4PJAA 2E9BA 3AXLA 2R4RL 1JV5A 3Q5TA 5DRNA 5DJ0B 2H3NB 2YUXA 1PKOA 1KJMB 1M05A 1J18A 1UT9A 5DRZB 3I75B 2NPLX 1IGML 4YDIL 4DKAA 4PY7B 3ARYA 4YQXH 1TDQA 5KSBF 4Z7QE 3HAEA 5M95B 4PRBB 4GRLA 1HKLH 1KCRH 1OP9A 4UQ3B 2YEZB 1GOHA 3MNWB 3SKNB 25C8H 4E9LA 1J88A 2EDHA 3RY6C 5IVXB 2VSCA 1JRHH 4XNMA 4D0DB 2G9HB 3L5HA 1BBJA 1AQKH 2VDKL 2DTSA 2KBGA 2R1WB 3VMNA 5FKAA 1RV6X 1GIGH 2HJLA 1FZJA 3WIFB 1CK0H 5T3XH 2R0LL 4OLUL 2I25N 5EG6C 1CFNB 4K3HA 1JPGB 3LDBC 4FNLL 5DT1L 1FFPA 3T0EC 4K3JL 2M2DA 3BQUA 4FQQB 1CLYH 3NCBB 4M6ML 4X0KB 1WQVT 2ERJB 2DQEL 3FFCD 5CSGA 1FLRH 2BNQE 3VXMA 1O7SA 1AP2B 5EBMA 2AQ3A 5CFHA 5FUOL 3IU4L 5TE7H 3NIGE 4DUXA 5IMLB 1OAZL 5FGBC 2FBJL 1QEWA 3MC0A 4OF3A 2OJZL 3RP1A 1ACYH 2AAVA 4UMGA 4MAYA 4M1DH 4DKEH 4PJDB 4U1GC 5L2KD 5JHLL 3SBWA 1I1RA 2P43B 3C5SB 3IFNH 5E8PA 4DAGH 5ENWA 1IC1A 4X98A 4Y1AE 5JNYB 4PJAF 2F54B 3W9DB 4R4BB 4WW2F 1FJ1A 5D1XB 5ISZE 1ADQL 4WU7A 4GW5B 4JN2B 2EYRA 3GKWH 3G6DH 1HIML 1T2XA 4OUOA 4HGWB 1FFOA 1I9JL 4XXDB 2OMBA 1SJEA 3MPCA 4W6YB 4XAKE 4BFBD 4TULL 2HN7A 4ZUUB 3PWPB 1D6VL 3RZWA 5DJZB 2PYFB 4ZYKA 1AGDA 3VG9C 2VE6A 1KB5L 4Y5YB 3QIWC 3QIBC 4NZTL 3D5OF 2VDOL 1NBZB 3QR2A 3DWTA 1JPFB 2DQIH 3GSXA 3NCYS 1G7LB 5FXCH 3BP7B 4IHOA 5T1DL 1QRNE 1T83C 5DQDH 2GT9B 3SN6N 4C55A 3FB8B 4OLVL 4YHOH 4DK3A 1I8IA 1FFNA 3TCXA 4CMMB 4G7YH 5FYJD 4ISVB 4J3TA 4OKVA 4OLEA 4NNXA 1LEIA 2MTPA 1ZA6B 4LNRA 1INEH 1FVEB 1OF2A 5TFSL 4JDZB 2P5WE 2V5MA 4LMQI 3TIDB 3AU1B 2ARJQ 1KLUA 3QDJE 2I5YL 4BKLB 3DYMA 1R3HA 1MSPA 1W72L 4XB7A 1XIWB 5JR1L 5H2BB 1FL6A 4N0RA 3OKNB 2X2YA 2O5YH 3VXSD 2BCKA 5KTEL 1XF2A 3CVHB 4NQDE 5C0CA 1PVHA 3RWDA 3OAZK 4P46B 4R8WH 3WV0A 4PTUA 2CIIA 4YZFF 1DEEB 1NCWL 5EOCH 1V8HA 2H8PA 4DOHB 2E8ZA 3GBNL 5DQ9A 3QT2A 3HMXA 4BQ8A 5J6GB 1IGMH 5KOVC 4YDIH 5DJCA 3O6FC 5GJSL 2P7TA 4OF6A 2Y06L 4CBPA 1EHLH 4U6XA 5CSZB 1MLCA 1D7FA 3AS2A 4UTAL 1FZOB 3IF1B 1F6FB 4L8SB 1CG9A 2KQMA 3ZE1E 4HC1H 4YEEA 4OFIA 5MEPA 2VDKH 3QQ9D 5KSAA 4X6EA 4D2NA 3OKKB 2VXTL 2R0LH 2YD1A 4OLUH 2NY4D 3BN9D 3CNKA 1YEDA 4FNLH 5DT1H 2VJXA 4HPYL 3FRPA 4XPHL 1ZVSA 4I77L 5IW3A 1QQDB 3D85D 3U4AA 1EEUA 1NBYA 2ZOKB 2MJWA 2M1KA 3GGWA 3PHOA 2DQEH 3QUZA 4JKLA 4AIZA 3D1MC 2BC4B 3B9KB 1LVEA 1JZ4A 1MRDL 1DVFD 4DEPB 4EOWL 3WYRA 2D31A 1MWAL 4WHTB 3KG5A 3IU4H 4GW4B 1A6VL 3O2WH 4JREB 1I85C 2CDEA 3TNNB 1MEXL 3GSWB 2FBJH 2PXYA 3TN0D 5ICZA 4KJYB 4PJGB 2OJZH 3HZYB 3BZDA 3MV8E 5CGTA 2VITB 5JHLH 3LEYH 2VISB 4QGTA 4OZIA 3O2VL 3CGTA 3KPLA 1MHHB 3SDXE 1J0ZA 3EO1B 1EEZA 2EYTA 5EFIA 3FHQA 2YA2A 4MX7A 3S3SA 2EZ0D 2R2CA 1ADQH 2GK2A 4WEBH 4KK6C 1I3GL 1EZVY 3EYFA 5SX5H 2VKXA 3UJJL 2XTLA 1WISA 3CFBB 3FO9B 1I9JH 2Y5TA 1BLNA 1EXUB 4KHTL 5MHSE 4NKDA 4Y4HD 1D6VH 3PJSA 3UAJC 4Y16B 1KB5H 3NIDE 4ZOAA 5HDBE 4FFVD 1WCQA 1V7NL 1KYOK 4LCUA 3MRIA 4KY1L 3BEWB 1F45A 1XCQB 1PY9A 2IFFH 1QBML 5T1DH 3LS4L 2J8UE 4ORGA 1IEAA 1KPVA 3BT2L 2BP3A 2L0DA 4OF0A 3SEPA 3FT4A 5MERB 4YDKL 4NKOA 4OLVH 4JZJC 1P5VA 1XR9B 1TZHB 3E2HB 3FQXA 4HCRH 2BNRA 1FYTA 1MFNA 3RL2A 3D2UD 3HUJE 3IAQA 5DK2B 3ZKQD 5E7FA 3UBXG 1QLEL 4LSDA 5TFSH 5DLML 3RVXD 3VXRA 1T5WB 5C07B 2I5YH 1BZ9B 5JXAL 1G6RA 2XY2A 4R3SA 5DUPL 1W72H 3S34L 1I1AC 5JR1H 1D5XA 5HDLA 1AIFB 3NCCB 5CILL 1MFCL 3KLDA 4X4YB 5CIPB 4OZIF 3SQBA 3ARGB 5ANME 3MLXL 5H37H 5I66A 2C1OB 2FATH 3B6SA 3CLEL 4QRSB 3OKMB 4JPIB 2HTLD 2VXUL 2AEPL 4WFFE 2GAZB 5GGQL 1QPXA 2IWGA 3GBNH 1K4DB 2BY3A 2VB5A 4JCLA 4BSJA 4W4NA 1VHPA 3F58L 3ZE2E 5GJSH 4GSDH 1QLFB 4NRZB 4JFOB 1P4LB 4GBXB 1AQDB 4NUJB 4UTAH 2FD6L 4RWHA 1ONQA 3BRDA 1VCAA 5KN5A 1SQ2N 2WINB 4JO1H 3ULUF 3FT2B 1RUAH 2DAVA 2JJTC 3BSZL 5I8KL 3TBYA 4ZMAT 3LN9A 5ABDE 3FO1A 1NDGA 3EJZC 4M5ZL 2VXTH 2D7MA 2GJ6E 2UY7A 5GIRB 5AZ2L 4BSWB 1IM9B 1EVTC 3GSNB 3LY6A 4OZFH 4X8JA 1VFMA 4YGVA 4I4WA 4HPYH 4BFIB 5IJKC 1MVUA 4HFUL 5CJ8A 3N06B 4OCWH 1GGCL 1YYLL 1ZV5A 5D70L 1T7YA 4TQEH 1A2YB 2BNUB 3S6CA 1MRDH 2DQGH 4EOWH 1DLHA 1X7QB 3O45A 1MWAH 1FPTL 2WZPD 1A6AA 2ITDA 3EDFA 2FO1A 2A9MH 2XPGA 1MQKL 2AEQH 5C0FB 5GQBA 4X9FA 1A3LH 3K2MC 3S98A 3G9VA 1BREA 4UT6H 4ELME 2VDPH 3QDMB 3MV7E 4R7DB 2H32A 1JN6A 1H5BC 2YD2A 4UTBL 4N9OB 5T1KB 3BP5B 4L4TD 5MEOA 1A5FL 2AI0L 4PUBL 4UUJA 1IGJA 4KQ3L 5CBAA 2DKMA 1OLLA 2Q8AL 2JCCE 3HG1D 2H26A 1WBXB 1I3GH 3U6RA 1KT2B 5GSRA 3UJJH 1OP3H 2PYEA 3VH8B 2AK4D 3LKSB 4H25A 1MI5B 3I84A 4I18A 2XI9A 4PJEE 3T0EE 1XEDA 4HLZH 5IFHL 3TZVC 4KHXL 1F3RB 4LLYA 2ZNXA 2VAAB 5EDXA 1IAMA 5SWSA 3OXSB 3QUYD 4O2EB 4LPUA 3AS1A 4MJ4A 3TIEB 1QP1A 1V7NH 3B5GA 3DURA 4MNQD 5HYSG 4U1LA 1D6EA 4S2SA 1QBMH 3LS4H 5IKCA 1EFXB 3DYOA 3QULA 1MH5A 5DJ6B 3FONA 3JWDC 4KGLA 4YNYB 5JDSA 4B7LA 1T22B 3N1FC 3QFDB 5A2JH 4NQEA 1KEGL 5DJ8B 3D39B 5AWNH 3BDXA 4K7FA 2ICES 4S1DC 1XGQA 1U36A 4XMLL 4UAOC 4FXGB 5C09E 2BX5A 2H41A 4FQXA 1KFAL 2AQ2A 2RGSA 4W81A 4ZS7L 2DQUL 1FC1A 3N9GL 5JXAH 3RKPA 5DUPH 4WW2B 4XH2A 3S34H 3FB6A 4O58L 5CEYA 1RZKC 4HIEB 4PIRF 4XPTL 4WTZA 5CILH 1MFCH 4WV1A 1RUQL 3B9VA 3MLXH 4QRTB 3RVTD 4B50A 4RGMB 3DIFA 4X7EC 2H45A 3MCKA 4ODHL 4AQOA 3CLEH 3RUGA 2FLBT 3TYFB 3QYCA 2VXUH 2AEPH 3GNMH 2JLLA 2OX5A 1VDGA 4FTVE 5TH2A 4U6HB 4F2MB 3F58H 2BVUA 3PL6C 3NOIA 3K4AA 3QISA 1SMOA 3LKNB 3MQIA 1CWVA 1MHEB 3R0MA 1AHWA 2CLRA 3UTSA 1TJHL 5D96C 3BO8B 4NFCA 3SDCB 2X4UB 2OMNA 4RAHA 2FGWL 3D0LB 1QBLL 1S78C 1PYWB 3IXTB 4YAQB 2I9TB 5BZDA 1JIBA 2X42A 3BSZH 5E8DL 3V4VL 5FGCE 1OP5H 5IJVA 5LQBL 4NDMB 4K94C 4QXTB 3D9AH 5F3BB 4JB9L 1IL1B 3B8SA 5JLZB 1RI8A 5FA4B 2AK1L 1G7PA 4HFUH 3EHBD 3U0PA 4JGMA 1WAAF 2J2ZA 5FYLD 1GGCH 1U3YA 5F1NB 1DUZA 5DA0B 2PTTA 4XP5L 3WL9A 4M6OL 3T8XB 3OZ9L 2YUZA 1R0AH 4R6UA 3B4NA 2CK0L 3V5DA 4EN3C 3KYOB 4B7IA 3T0XA 3BAEL 2OTWB 3RY4A 4G6JL 5LVEA 4DKDC 3QG6A 3ZDZE 1CT8A 5IF0A 1ZTXL 3R8QA 4RMWA 1FH5L 2X4SB 4YDVA 1TQBC 1FE8H 2ZCKH 1I8LA 2X4TA 1T0NB 3HPJA 1PKQB 1A5FH 4PUBH 1WT5C 3CCHA 3BVNA 4KQ3H 5CEZH 1BAFL 3BUTA 1J5OL 2Z4QA 3STZB 5KVDL 1AO7A 4JO4L 2Q8AH 3RUGF 5EU7C 4ZPVA 5I30L 1F90H 3DETC 4P4KD 3SKMB 4F37F 4L4VB 2DF3A 1CQYA 1FC2D 4IS6B 4KJWC 3P9WB 4OD2B 3MNVB 4ODWB 5ETUB 1F6AA 4NFDA 1M7IB 1WZMA 4N8VA 1CGSL 3FRUB 2FIKB 2C3HA 1XF1A 2X1XR 4GLRI 4UT9H 3BP4B 1LO4H 3RWJA 3LKQA 3KPOA 3L5WB 3HE6B 5BZWB 1MAKA 5HY9A 5J56B 3U7WL 2QKIB 3RJDA 2ERJC 4GRLD 1MREH 3SJVA 2AW2A 4NO5A 4XNUL 4DKFL 4WO4A 1NC4A 3SDAB 1ZWIB 5IHLB 1GGIL 4U2ZA 1KEGH 1AGCB 4PRPB 5D1ZB 4YHPA 1NUFA 1T20A 4PB0L 4XVUD 2WP3T 3S8WA 5B38A 3GI9H 3QI9A 1KFAH 1YEFL 1MJUL 1YUHA 5FM4A 4ZS7H 3LQZB 5E9DE 4K9EL 1ZOXA 3QFJE 3BKML 3BQUD 3IETA 4Y0GA 3O3BB 2GI7A 3O0RL 2Z8WC 1H15B 2DQCH 1H3XA 4J3WA 3N1PC 3VXMD 2BOCB 4GKZB 5IHZB 4M93B 3GUTB 3BP6A 2PN5A 2HKFH 4ODHH 1JWSB 1ADQA 3D3VD 1WITA 4KUZH 4MAYD 5EU5B 3O4OB 4GLRH 5I16B 4PJ8B 3WJJA 2NY1C 3SE8L 2W0FA 3LS5H 4JVWA 4QGYA 4FXKA 1U8NA 1LWRA 1BJ1H 4U1SB 1TJHH 1GC1H 1SEBB 1QFOA 2FGWH 1KB5A 1QBLH 2DMCA 4GUPB 5DJYA 1FYHB 2C1PA 1EA9C 3KHQA 4NQSB 3ZSSA 5CWSB 4D9RE 5I1GL 1JGEA 1I9RL 3DRTA 4LSVL 3FTGA 5KANG 5TGBB 5CJOL 2AJVH 5J13B 4JHAL 4QYOA 1UM4H 3LD8C 5EOTA 4C4KT 2A9NL 1NCAL 3KXFA 4UQ2B 5LGKA 4XHJD 2AK1H 5AAWA 3GMRA 5GGTL 1HQRA 3QNXB 5HHOB 5GGVH 2CMRL 3UP1A 1UENA 2AV7B 3U4BL 6CGTA 4BK4A 4O02H 5EN2B 4K2UH 4JM2B 4XP5H 5E6YA 2Z31B 2CK0H 1J0HA 3F7RA 1LK3H 2WAHA 4F33A 1B0RB 1JF1B 1ZTXH 1W72A 4PJBB 4S1SL 2O5XL 5IK3B 1FH5H 2X9YA 4P46C 1TFHA 1QG3A 1I8MB 1NC2B 1QUNA 2YWZA 2NY5L 3PV6B 4WFGD 4MLIA 1NPUA 3VXQB 4I5BB 1ZLSH 3MBEC 1J8HB 1S7WB 1BAFH 1E0OB 4MVBC 3MRCA 3T4AA 1T1ZB 2XFXB 3ARDC 1KXVC 1TIUA 5KVDH 4JO4H 2IALB 1EH9A 5F88B 1MFAL 3CDGA 1IKFL 3M17B 4MJIA 5B4MC 2AJUL 3X11B 2BMKA 2GK0B 3JV4A 3IDGA 3QWQB 4KI5D 4PV9A 4HDIA 5DMYA 2B4CL 4ZFZB 1U58A 1KGCD 4JFXA 4EI5C 1G1CA 2FL5B 4ENEC 4KAQH 3QEQB 4YHZH 2LAGB 1WK0A 2YPVL 5DMKA 1CGSH 4QEGA 1ORSA 4LSUH 2YA1A 4NCC2 2NY3C 2OSLB 1OHQA 3HFML 2MKWA 1T7VA 2E9IA 5FYKD 1QFHA 4IRSA 2IQ9L 2PW2A 3TA3D 1J1OL 3B9KC 3W9EB 1A4JA 4JFQA 3LKOB 5D2LA 4XNUH 4KV5F 3BJLA 5EO9A 2DBLH 4JFEE 4DEPC 1B4RA 3KS0J 4S0SD 3STBA 1GGIH 1OSPL 2ATKB 3U4EA 4Z76B 5EA0L 5IROC 1CXHA 5KSAD 3B2UD 1IAKA 2VDML 1NDMB 2P8LB 4MB3A 3X12B 1MWAA 2HFGL 2D7QA 3MV01 1C8PA 2R15A 4NN7B 3BPCA 3O0RH 3QXDA 3QUZD 5JHDD 3MOAL 2Y7QA 1CDHA 3MRFA 4JGJA 4Q6IC 1WIUA 5D7JC 1BIIA 1BVKA 5BS0E 1J1XL 5IB3B 3AREB 4JANB 1U95A 2APTA 4FP8H 2BSED 2PXYD 1OTUD 2AJXH 3KPSD 1L0YA 4GW1B 4KDTA 3BZFB 3BYYA 2HT4D 4Y16C 1MFEH 5GS1A 2FX7L 2KL6A 5D7LA 3GSOB 2L4OA 4Q0XL 5E6ZA 1HQ4B 2R56L 2BY1A 1GGYA 5JOPD 2NLJA 4ZFGH 3E6FB 4EXKA 5I1GH 3T2OA 1FO0B 3T65A 1I9RH 3VMOA 1RJZB 1X5YA 1RULH 2NZ9C 3E2HC 4LSQL 2ZP0T 3BZ4B 5JORB 4JHAH 1INDL 5SWZB 4PP2B 3TVMC 1A7RH 3R1GH 4PY8J 2A9NH 2HRPL 1F58H 5GGTH 3V5HB 2F58L 3UROR 3U4BH 4ELKB 4Y19A 4Y4KA 4BQBA 2V5YA 3NCYP 4S1RL 5F7WC 3RWIA 1Z5LB 3S5LB 3MRJB 3LSOA 2B1HL 2NY2D 3BWAA 3V0WH 4RRPG 1MHPL 4JKMA 3DTXA 4H8WC 2XIDA 4QTIL 4S1SH 5BQ7B 2O5XH 3D87B 1JHLH 2Z92A 3L7EB 2CKBH 1FYTD 2NY5H 2NYYC 4PJ7B 3VXRD 2MHAA 3QHTC 3ECBB 2LTQC 4ZQKA 4GBXC 4F9PA 1Y6NR 4RAUB 1G1YA 2VSDA 3MO1A 5I1LA 5DR5L 5K9OB 5IUSA 4JQXC 1DL7L 1OCWL 1UWEH 3TESA 3CH1B 4Z77A 2XN9B 1ZGLB 2AXJA 5M7QA 4M03A 3WS3A 2B4CH 4I2XB 3L7FA 4Y2DB 4RGND 2APXA 1TZIB 2WLYA 4XP1L 4JGUA 1R3JB 4OTXL 4Q6YA 4ONFH 2ESVD 4TN9A 1BP3B 3MRDB 1YJDC 2G5RA 4L8CB 3HRZB 4L3EE 4GXVH 4MCZA 5CZKA 5C0BE 1NFIA 3HFMH 3MCG1 2GCYA 5I75B 1XF4B 1YY9C 1J1OH 3G5YA 5F70A 5E99H 1N6UA 5E0QA 3WNPA 3WS6A 4X5WA 1XGRB 1PG7L 4NBXB 2Y9RT 4G9DA 3SDDA 1OSPH 5C0JA 7FABH 3GSVA 1CU4L 3ARRA 3ROOA 5T5FL 4HIJB 1T7ZA 3DSNA 1NANH 3PNWB 4X8XA 2YD4A 4HHAA 3PQYB 4FFYH 5EU7E 5EO1B 1S7VB 1KPUB 1IT9L 3KGRA 1LNUA 1XGPA 4DW2H 2F5AL 5HYFA 5EO0A 3MRBB 5E00A 1YQ2A 5FECB 1FL5B 2VABB 3F65A 4L8BA 5IVXE 4PLJD 3BPOB 1JJUA 1UVQA 2YXFA 3MJ9H 4R2GD 1LDPL 5CINH 2DM3A 5I76B 3WXWL 2ZPKL 3EJYD 3DLQR 1J1XH 3N1MC 3LB6D 4TUOA 1G7JA 2R1YB 2IPKB 1YPZA 3S36H 1HNFA 3IFPB 3LQAH 5BVJA 4TUJB 5DO2C 1FZMA 3GHBH 4LHJB 5IB1B 3HTLX 3U7YL 5L8LB 2XXCB 3GFUA 5J9PA 3FB7A 4Q0XH 2RAMA 4XX1G 5GS0L 2R56H 3KPNA 1J0JA 3H9SA 4HPOL 1JHTA 5KZCD 1E4WH 5ICYA 3MJ7B 4OQTL 2A6DB 4WIQA 1N5YL 1KIRA 3IJSA 4F57L 1T2JA 1ERNA 2PYED 5I9QB 4PJDE 1WEJL 2HFTA 3VXNA 1OWRM 4IM8A 1INDH 4HUVA 1MRFL 5JMRA 3RZCA 4H20L 1S7RB 5D93B 4J2XA 2F54E 4KRPD 1Q1JL 2JB6B 4KKCD 5SWSD 5I17A 5I1EL 2F58H 3IKCB 1YN7B 1VFBB 3IVKA 4GXUN 4JO2L 4MXWL 5L6YH 4S1RH 3GI8L 4MNHA 1S8DB 1XF3B 4XMPL 3DVGA 3HAEG 3G5XA 4I48B 4NNYB 3ZYZA 2RBLA 1BHGA 1JTOA 3PWPE 5JQ6L 1HEZB 1MHPH 4WUUB 3VE0B 4NQED 1Q72H 3MCLL 4RGMC 3MACL 5BOPA 1JYXA 2GW5A 5DHVH 2HT3D 1NAMH 3V8CA 4FQXD 2JE8A 2D9CA 2LABA 5CSBA 1BOYA 4WDIA 4HK0B 3NCJL 3FJTA 3FL7A 4KKBC 4M7LT 4RBPH 5EH1A 4XPAL 1NKOA 4NHCH 1YPZF 2VO5A 3QEHA 1QLRA 1RZGB 1SYSA 3SE4A 4GAFB 2X4PA 3NN8A 1DL7H 1A1OA 4Q74A 4M43H 5HYQB 1T21A 4ZNEA 1KCUL 4XGZB 2FJHA 2GSGB 2XRAL 4CADA 1U9KA 2R4SL 4PTTA 1NKRA 1UCTA 4OTXH 1MY7A 3QXAA 1P69B 3P0GB 4XVJL 5DJ2A 3U36A 4WU5B 4MHHG 3LN5A 4WEMB 3D48R 3VRLE 4ESKA 3JWOL 4X5LA 3SGDH 3UTSD 3RVVD 4D8PA 1ED3A 4J4PA 1RK1B 3KPPA 2QADC 3O2DL 5GGRA 2WUBL 3MZGB 4WWKB 2EE6A 5IBLC 1CS6A 4WFHD 5C0GA 3HB3D 1CU4H 4DOHE 4QHMA 3UZEA 2W1NA 3OGOE 3VMPA 3O8XA 1J05A 2FJFA 4MA8L 2DYPA 3UJIL 1QOKA 1WWWX 5F21B 1V3LA 4RZCA 2LAAA 4OCLC 1IT9H 5TE6H 4EUPH 4PR5A 2QQLL 5JOEA 4LKCA 4D0BA 12E8H 5HGBB 4LDLB 5F1OB 5BRZA 5E94B 4N0UB 3AVEA 4X6FA 1M71A 8CGTA 3ILQD 4HJ0D 5AD0B 2VLKB 3HI1A 2VQ1B 2ZPKH 2ZCLL 3WFEH 3T08A 4APQB 2XXMB 4YBQC 4HMDA 5KVEL 1K2DA 1C5DA 4WENB 1EMTH 3KYAA 4GG6F 3W2DL 1DVFB 3P77B 3F7PC 4W4OA 4F3FA 5EUOA 3U7YH 5CP3H 5GGUA 1JI1A 3RBSA 4CVZA 3GJFH 3TN0B 4KK5D 4P48A 5ICXA 3HE6C 4NSKA 3O6KL 3QSKB 1AO7D 2K9UA 1CFQA 2DWDA 2Z91B 3W39A 4PJGE 1N5YH 2YZ1A 3Q48A 4F57H 3JV6B 1LEKB 3SDAC 1J0YA 3GZKA 3L3DB 1XAUA 3OHXB 4YC2B 1ETZB 1WEJH 3QHFL 3OF6A 5DEGA 5A2KH 5D2NA 1BD2A 4XT1C 1Q1JH 2F5BL 1NMBL 1JNHB 4JLRB 5IM7A 4RWYL 1FRGH 1HILB 2X4RB 1MCDA 2R69L 4LVOC 1AY1L 3C2AH 4MXWH 4HKJB 5FK9B 5I18H 3GI8H 5BVPL 5I73C 1DQJA 1LK2A 3OKLB 1I1YA 2A6IB 5DYOA 3L3GA 3EZJB 1UYWH 4HWBL 1PZ5A 3WFCL 3SJVD 2DJUA 3ARXA 4AENA 5TQ0H 2UUDK 4HWZA 4WO4D 1NC4D 1S7UB 1GSMA 2F74B 4FZ8H 4M93C 4U2YA 5C0AB 1I1CA 1RVFL 3WEXB 3MCLH 2HG5A 4OLZH 1HYSC 1U41A 3MACH 5D7IB 1HXYB 4FQ1L 3J7HA 5E24E 3ZYOA 2YD6A 3FB5A 2EDBA 1CDCA 3QI9D 4PS4L 3EIFA 4PJ8C 3MR9B 3TT3L 1KUMA 4PG9A 3ZT6A 3MFFA 4Y4FA 3FRPG 4I0PB 4XPAH 3WUZA 4GAGL 3GMQB 4N8PA 3RGVA 5I0DA 3TFKD 2VDNH 2VH5H 4GKOA 1KJVA 1X5GA 3CXDH 5E6IA 3PWUB 3VFGL 5EUOF 4EQ3A 1YMHB 5JOFA 3HS0A 3RX5A 1VESA 2EDEA 2HWZL 4OZFB 4IIQA 4XZUA 5C07E 1RZIA 5IVZA 1KN2L 4N1EA 5MENB 4XVJH 2NXZB 1B4JL 1QR1A 2I26N 2XZQH 43CAA 2CPCA 5FOBA 1G7IB 5I8CA 1NFDB 3FQRB 2YA0A 3VFPB 1LE5A 5J3HC 4JM2C 4TNWF 3THMH 2Z31C 3K74B 5GGTA 5IWLA 3DUSB 4HS3A 2NY0C 4P57B 4WI6A 5C3TA 1IKNC 2YK1H 3RU8L 4ZOCA 1G7HA 2BOBA 4MA8H 4G9FB 4KVCL 5IR1B 2DLIA 2PW1B 5IEKB 3KXFD 5E8OB 3P4NA 4NZUH 4HW6A 2QQLH 1L6XA 4D3CL 3LHPL 4OI7A 5LAXA 3TJEH 2BNQA 2R2BA 3LRSA 1B0GA 2CK2A 1VGEH 3G6JB 4P3DA 5IB2B 5J1SC 3QRGH 2ZCLH 2CXGA 3KYMB 3QXUA 1NEUA 4BM7A 4XBEL 5T1LB 2OJEA 4X9IA 1AC0A 3GMPA 4AMKL 5KVEH 4DQOL 4LCIL 2HLFD 3X14A 2HTKD 4PGCB 2PTVA 3W2DH 1AR2A 3PHQB 2Y1VA 1T66C 2B0SL 1RZJC 4Y1AA 1T0MA 5LCVL 5KVMC 3V7MA 3FOMB 3SCMC 5GRUH 3ARFB 5FYJU 5ISZA 3QPQD 4IDJL 4J7RA 3UXFA 3CFCL 3O6KH 4P3WA 1QSFE 3UZVB 3KWWB 5HSFA 5GGRY 4C57C 1XR8A 1FZKB 1S5HA 2J4WL 1RQ5A 1VKXB 3SGKC 3C08H 2R2EB 4MJID 5GGVY 4KJQC 4LLVA 1BQLH 2WM0A 4Z7QF 4JQVC 4PRIB 1OAQL 5EZLA 3QHFH 3QDME 5HI3D 4PGEA 1RURL 4XCNB 5LBSH 2RJMA 5I8OH 3WN5B 1YY8B 4XCEA 4KTEL 2F5BH 3L3HB 4Y8DC 4M48L 5DZLA 4RWYH 3M8OL 3ARTA 1A7NH 1QRNA 3EO0A 3MRRA 5F9JB 2R69H 3GRWL 2CUHA 1AY1H 3PWJA 5I1CL 2H2PD 4Y5XB 1XH3B 4GQPH 3F7YA 4N9GA 3SE3C 4KRMB 4OFYA 4PJ9B 4HWBH 4JAMB 1MI5E 4IRSD 5F96L 5DSCA 4ZUVB 1DANU 4HS8H 4U3HA 4G6AD 4ONGL 3AREC 3C5ZB 1Y0LB 4FQ1H 1NCDH 2KPNA 1MCFA 2ADGB 2P5WA 4UDUB 4X83A 1EO7A 4PBVC 1F13A 2PO6B 3NIGF 5MP6L 1OWWA 1XCTA 4PS4H 1I7TB 3TT3H 4LAQL 3QH3A 4LLUB 3O81A 4GAGH 4H26A 1CZ8L 1HSBA 4KH2A 3F5WA 4NQDA 4AT6B 5HI4C 4KPHL 3TT1L 3NZHL 5CKAA 3EGSB 2BVPA 3D39E 3MRKB 4QHUA 3TC9A 3VFGH 4NKQB 3ARUA 3KAAA 4HGKC 1U2CA 3NFSL 1T1YB 2CLZB 2B2XL 3T77A 4QT5B 2CRZA 4MA1C 5HJ3B 1FN4A 3HMWL 4V2CB 4ODUB 3RBGA 1KN2H 3MROA 1GAFL 2D03L 1Q94A 3K4ZA 5FCSH 1P7HL 1YC8A 4FQJL 1DBBH 3MV9A 5D7LD 3CFJB 1A64A 1S9VA 5EC1A 3HRPA 2W9DH 5INDA 2R0KL 2N4IA 1T80A 2HKHH 1ZHKB 4YIQB 1OTTC 2IADA 2GHWB 2GSIB 3IDMB 4ONHB 1AXTH 2ZUQC 4TSCL 4QNPE 1T6WA 3V5KB 5A3ID 2VLRA 1OGTA 3MRNB 4LP4A 5HGDA 3AAZB 1P1ZA 3CFKB 4NZRL 2I60H 4R26H 1OLZA 2IQAA 5C70A 1WGOA 3DROA 3WHE1 1MF2L 4Y19D 1S9YB 4Y4KD 3MOBH 4XP6L 3IGAB 2HT2D 4OCSH 1H3GA 1UKSA 3I3EA 2FEEL 5E8EB 3UBXI 4LEOB 3UZQA 3HC0A 2CRYA 2E27L 4RISH 4XBEH 1YN6A 5D9SB 4HKBA 3T09A 3MV8A 1LD9B 4LCIH 1C12B 3RNQA 4S11A 1A8JH 2OYPA 5IBUB 3ZKMC 4C83B 3NBNA 1HH6B 4Z78B 2B0SH 4Y2DC 3SDXA 3P9LB 1IM3A 1FCGA 2BDNL 4YE4L 1V3KA 5FDWB 5DD1H 4UBDC 1GCFA 4QOKB 3VXUB 4MSWA 4HFWB 4OLYL 4U6YB 5FIEA 1ZHLB 2YBRB 5I75C 5A2LH 2J4WH 4S1QH 3FQTA 3JWDL 4QRPB 3KVQA 1P4BL 2OBGA 2W9EL 4RA3A 2NW2A 5EZIL 4WTZG 3VFTB 1OAQH 5TPWL 3MJ8B 4DUWA 4LP5A 4P2RB 4PJIE 5INCA 1PKQE 4P4KB 1X4XA 1RURH 3MA7B 3BOVA 5DQJB 3ZE1F 1W0WB 2DI8A 3OKDA 5F1IB 3H2WA 1CICB 2VLMD 3WUWA 4DVBA 5FGRA 1AD0A 3KYKL 4M48H 2RQ8A 4Q9CA 3REVB 3M8OH 4LIQE 3QXVA 2J8UA 3GRWH 1ZEAL 1PAMA 5HPMA 3K2UH 1VEMA 4HAFA 5I1CH 4ZXBA 4ZS6C 3WE6A 4L4VE 2JELH 2OM5A 5GZOD 3BPOC 1KELL 4HUWA 4XBGB 2AXHA 5F96H 3ILPB 4EUPA 5EIIB 4PFEA 4MDJB 3M1BA 5FA3A 2FEDC 1EO8L 3HUJA 3SDDD 4UILH 5F71A 1UJTA 4NPYB 4F8TA 3MRQA 4GAJL 2AJ3B 4W68A 1CCZA 3IDXL 1PG7W 1K8IA 1WBZA 2VL5B 5MP6H 2Y4SA 2AERT 1KNOB 1UJ3A 5GS3A 3MYJA 1CIDA 1AR1D 4PRNB 5FKAB 3UTQB 2YSSB 4DN4H 4Z95L 5E08H 5KVGH 4G8GB 3C6LA 5DD6B 3ARBB 5HHMB 2KZWA 3BE1L 4NHUA 5DURD 3DXAA 4KPHH 4PREB 5ANMA 3SDXF 4PRPE 2FEEI 4N1HB 3OAUL 5D71H 3GJFA 3VFVB 1CGXA 4F7MA 2EIZA 1JK8A 4CU7A 4A6YH 1DSFL 1TJGL 4JZOB 4JDVB 5D7KD 4OV5A 3CSYA 3DUUA 1GAFH 2H6PA 4I3GA 4OQTA 1F00I 5D93C 5C8JB 1BEYL 1EO5A 4FQJH 1FNEA 2VOTA 4NJ9L 3D3VB 3PP3K 3LKRB 2VR5A 3NIDF 5HDBF 2P8PB 5GHWH 1AGFB 2R0KH 4PGBB 2VERN 3H9SD 2V2XA 5E8PB 1VEPA 2GJ6A 2L7UA 3QPXL 3MRLA 2J8UF 4TSCH 1R3KA 4JFFD 3MUGA 3DV6A 3PWLA 3K4DA 4N68A 3F7VB 4F15B 5IMOB 3BEVB 3RZCD 3SQOH 1R5IB 5CGYD 3DX6A 3JSSA 3WFDH 1T1WA 4Y88A 3NABL 4ZO6A 2RIKA 3HUJF 3BHBA 1MF2H 1UH3A 4H1LA 5HVHB 3IAGC 4OJFH 1YQVL 5ILTL 4KUCF 2Y6SD 3BWUC 3RWGB 3H7BA 3ZDYE 3DX7A 4ZO7A 1RAMA 1RIUH 4ZPTB 4ELMA 2APVA 1MUJA 1S7XA 2HVKB 2WMPA 1AKJB 1A6TB 3DVNA 4QHKI 2GTWA 4YE4H 4E42A 4UIMA 3RY6A 4OM0L 1CFVL 4XRCA 4LLWB 5C92A 2JCCA 4KQ4H 2ICEB 3IDJA 4WHDA 4OFKA 4PG2C 4KMLB 4RX4A 2OXHA 1H0DB 4R96A 1MNUH 1ND0A 3JWDH 5D5MF 4PJBE 4UNTA 1P4BH 2W9EH 3VRJB 4PJEA 3T0EA 5EZIH 5K59E 4WWKC 5E95B 4ZODA 2FGZA 3WNMA 4NQTA 2WIIB 3GBLA 2VZ1A 5ACZA 5DEZA 4N0FB 4U0RB 3O2DA 1FL6B 3RY5A 1J8HE 2CO7B 3O3AB 1OY3B 4OZ4B 5BXFB 1B6DA 3ISWA 5BV7C 1I3VA 3UPCA 3DHMA 1XF2B 3TPUA 3KYKH 1ES0A 2HAZA 2HLAB 1S9WA 2Y36L 4JRYB 4PV8A 4RCAA 4HX1B 3TO2B 4UZGA 3RA7L 4POZD 5FGBA 2FECL 1ZT7A 3F8UB 3ULUE 1PQZB 2NY4C 3BN9C 5CP7A 4B41A 5J7CC 1RZKH 2ATPA 4WJ5A 1S7TB 4J4PD 1T1XA 2W91A 2BRQA 3QJHB 1EO8H 4APQC 5BMFL 1MLCB 5C09A 4R4ND 3TA3B 4GAJH 3IDXH 4OBSA 4EBQL 4NM4L 4TTDC 1IE5A 1DVFC 3O8XD 1T5XA 2DYPD 4GRMA 1RSFA 5A16B 1N59A 2VIRB 2ILLA 4JE4B 4Z95H 3TN0C 2FO4A 4LPYA 1WJ3A 4ELMF 1KTDB 5ID0B 5BRZD 2E9JA 2IANB 2IH1B 3DGGB 3O6LL 2W0KA 2A6JA 4OZGA 3QIWA 3QIBA 1CLCA 1OSZB 3OAUH 3GK8L 5C08B 4O2CB 1A6UH 4Q2ZB 1N8ZB 3WFHA 1MCLA 4FTVA 1DSFH 1TJGH 2EZ0C 4YC2C 5JHDB 2DQJH 2CR3A 4K94H 1BVLB 3BKCL 4Q7DA 3JTTB 4K23L 2FCBA 3LEVH 1DN2A 1U8LB 5TDPA 3U46B 3RNKA 4PJEF 1A22B 5J12B 1F8TH 3KPSB 5H37G 1MCNA 1IQWL 4FFVC 3HZKB 3QPXH 5E1HB 4GMTL 1EEZB 2J88L 3MRGB 1J12A 3CVHL 4M1GL 3UO1L 3B3IB 1CI5A 2HFFB 3NFPB 3OF6D 1F11A 2YRLA 1MJJB 1ODAA 2CKBB 4HWBA 3BD4A 4ETQB 4ZTOL 5ADOL 4OAWA 4FZEH 2OZ4L 1BD2D 5GRXG 3RL1A 4KMQA 2GFBA 2Y5TB 3DGCR 3QAZB 1P6AB 3NABH 1RUPL 1MJ8L 1EEYB 2DBJA 2FECI 5C0IA 3RI5F 1ZHNB 1LEGB 1YQVH 4PB9L 4GO6B 1A14L 2WBJD 3TNMA 3RWEA 5DJAA 3U9PL 3RVXC 3LVEA 1MRCH 5KS9B 5SWZE 3BH8B 4U3XA 4U7MA 2ICWA 5HHPA 3SKJL 4JY6A 1JNLL 3FQNB 2CR6A 3BN3B 5CD5D 3EFFB 1K4CB 1R5VB 3FT4B 3ALPA 4NKOB 2QSCL 2X4NA 4OM0H 1CFVH 1JZ5A 1D5ZB 2HTLC 4MLSA 4Y4FD 3OAYK 3RGVD 4NWUH 3BRGC 1EJ6A 5E6ID 2ICCA 3PWNA 4HWEL 4BH8B 5HYJE 2HJKB 1UQSB 4G8FA 4DUVA 2R2HA 3QHZL 5EOCJ 4E41B 2A6KA 3VFRB 4H5SA 2ZG2A 4TSBL 4PJ7E 1MIML 3PGDB 4PRDB 4XWGH 2R9HD 3NTCL 1ZT1A 1I85A 4OD3L 3RA7H 2A77L 4RGNB 3JV0A 1T4KA 4O51A 4WHYH 4TOYL 5I1JL 4NJAL 2DICA 2RCSL 2W65B 2XN9E 5C6PB 5ALCL 4HLZG 3L3OA 3P9MB 2ZSWA 2ESVB 4I2XE 5IMMA 4NGHL 2VXQL 5BMFH 1A02N 5IVNA 3S37L 4HJJH 5KOMC 4C4KO 1ONQB 1Y18B 4GRWH 4NM4H 5E9DA 3VFUA 5C71A 3QFJA 5B39A 1AGEB 3ZDZF 1X44A 2JK5A 4Q9RL 4Z7NE 2NNAB 1U6AL 3CFIC 1Q9KB 2BNQD 3O6LH 1CFTB 4P5KA 4X8JB 2ED7A 1KIQA 4HH9B 3T2QA 4LKXB 1TJIL 3RWFB 3VDCA 3PWVA 3GK8H 3FT3A 5DC0A 1BFOA 4LLDB 1VGKA 3PQYE 4BFGA 1ZK9A 2IBBA 3MGOB 4HUKB 2VDQL 3S7GA 3BKCH 5DJDA 1C16B 4K23H 1RJLB 4LRNH 3QUKA 3LMJL 3WN5C 2M26A 4Y1AD 3IT8D 3K8LA 4JPVL 4LL9A 3T3ME 4Q58C 5F89B 1A1MA 5IT2L 5H8DA 3O3EA 1PG7X 5ISZD 3R4DA 4HIIB 3OJVC 4YXKL 3KLAA 4WRLA 4Y5XC 1WFTA 5I1AA 5DTFB 1J87A 5EU3A 3QUYC 3MLRL 3FFCE 5D8JH 5DD5L 4EQ2A 1VFAB 2XZCL 3F6LA 4MNGB 5DMGD 1VADA 5EOQH 4P4RB 3GRWA 4GMTH 2J88H 4RMRA 3CVHH 3UO1H 5FAAA 4H8WL 3W82A 5DHVB 3H0TB 1NAMB 3UBXA 3ORJA 5ADOH 3EW3B 4X7DC 2OQJB 4IOSD 4MD4B 2KH2B 4QCIB 4H25B 1RUPH 1DQMH 1QRND 1R6VA 2Z93B 2NXYB 4KRPB 3S96B 3FAWA 4PB9H 3VG0L 1A14H 4OFYD 3WJLA 1BFTA 2FZ3A 2YMXH 3DV4A 5ESAB 5AAMA 3U9PH 1FG2A 3EKCA 4LDEB 3SKJH 3UPAA 5FO9A 2IH3B 1AFVH 3FONB 3O3DB 5I15L 1LO5A 2QSCH 3D25B 5E1AA 4EDXA 2P5WD 3GSNL 4YHML 1YEKL 5JW4M 2JJTA 3KYNB 2NW3A 3HNSL 4N1CA 3EOTL 5DD3L 5HVGB 1N3NA 3U82B 1DDHB 3VWKB 2A2QT 5GGSB 2Y72A 1R3IL 4MGXA 4NQDD 1BX2B 4YDJB 2DL9A 5IJKA 1P7QA 4HWEH 1U8IB 3QIUB 1JGLH 5ALBL 5IOPA 4HUXA 2AKRA 3QDGB 4XH2B 4NOFA 4CU8A 1K3IA 3QUXA 1G84A 3UTPE 5HYIA 4HAGA 5GSVB 2A0LD 1OM3H 4HWUA 2ARWA 1FVDA 5T5NF 1YMMB 3NTCH 3HPLA 4OD3H 4XBPA 1ITCA 3FZUC 3MV9D 5I1JH 3RTQD 5ALCH 5F3HA 3FMGL 5F7KC 1X5AA 1H5BA 5CJQL 1L9MA 5KSUB 4NGHH 3EHBC 3QZWA 4M3KB 5IB5A 4ZAKD 3S37H 1GYAA 2EC8A 2VLRD 5EWIL 3WXVL 1EVUA 4YBHA 2F8XC 3VW3L 3DBXB 4L3CA 3U0TB 4GKSB 4Z7VB 8FABB 4Q9RH 1I1FB 3V0VB 4NYLA 1U6AH 3KJ4B 4G8IA 3CFDA 5BS0A 2AXGB 2LQRA 4NQCB 1FIGL 5D5MB 4KMTL 4IMKA 3E8UH 3RIAF 4WI9A 3CFEA 4UI2A 5EU4A 4WFEE 2G5BA 3MV8D 4XC1L 3GMMB 2VDQH 2PTTB 4Z7WE 3WL9B 1NGZA 2BFVL 3SPVB 4L5FH 4P4KC 4FQIH 5TF0A 2JF1A 3CSBA 4N0UE 4JPVH 4HKXA 4EDWH 5IMKB 3B83A 1CICC 1IGTB 1NJ9B 1ZLVH 2QR0A 2ADJB 5IESL 5IT2H 1NGPH 2VLKE 3IXAB 5A2FA 2YN3A 4YXKH 4JR9L 2VXSH 4GMSL 4BH7A 3MLRH 5CZVL 3MLTB 2COQA 2XZCH 1MAMH 3L6FB 1OTSD 3NA4A 5CIPH 4H8WH 2CIKB 4ZTPL 5FHBL 4XNXL 3S4SA 1A1NB 4JJHA 1MFBL 4NIKB 4F58L 1I7UB 4W6WB 1HHKB 4CVXA 3INUL 2EDOA 4F7CA 4DZBA 3ZLQC 5H94A 3NVQA 2VLJB 4KV5E 1P7KA 3P4LA 4LOUD 4X6BA 3JUZA 4ZXBD 1F97A 2FJGA 1RK0B 4MWFB 3PL6A 2XWJA 4V1DA 3PDOA 3LPFA 3O11A 2EXWD 1H3PH 2DDQL 4OGZA 4EI6A 1K6QL 5HGAA 4D0CA 3BQUC 1FAIL 4QXUL 4HEPG 1JPST 2YN5A 3PIQA 3SJVB 5I15H 4YXLH 4YHIB 1NCCL 3LDBB 4ZDHB 2OXGA 1NC4B 3GSNH 1YEKH 1O0VA 3BW9A 3MUZ1 3FQUA 3VGFA 5LGHH 2IAMA 1YJDH 3PE9A 3HNSH 4QRUA 4YHLL 2V2WA 3T2PA 5DD3H 4FQCL 4XVSL 3C6LD 4MAYC 4I9WE 1VACA 3OR7B 5C0AE 5B38B 4G3YL 4GG8B 2X9XA 1R3IH 5KVFH 3DXAD 4CU6A 4X7CC 5D7IE 2SEBB 3GSQA 1CDYA 4JZNB 1FV1B 3W0WD 1IEBA 1JVKA 1QFWM 3IETB 4WFFD 3OR6A 4L29B 5D4QA 5GS0D 1HXMA 2FRGP 2XWBA 4EN3A 4F15C 2UWEB 4L3EA 1NGYB 5C0BA 2GJZB 3VFMB 1TCRB 5FHAH 1CN4A 3O41A 2UVFA 3K81A 4KROB 1UWGL 4LSPL 5JZ7D 1XGYH 3ZT7A 1QFPA 1QKZH 1U8QB 5DJ0A 2H3NA 3FMGH 5DEFB 4LIQL 1KJMA 4XHJC 3IB4A 3I75A 1WT5A 1N7ML 2GJ6D 2YPLB 4JFPB 1CL7L 4PY7A 1DQLL 2DD8L 1A9BB 2YHGA 4PRBA 1P2CB 1IGIL 2EDLA 4IRJD 4MJ6B 3VG9B 4UQ3A 5C6WH 2YEZA 1NFDE 3MNWA 4WI7A 4O00A 5IVXA 3C8HA 4D0DA 4HV8B 5HTSA 3ARVA 4CDGC 2G9HA 1EHXA 2R1WA 1MAJA 3T4YA 1M6OB 3BUYB 3WIFA 1E27B 1FIGH 3KLSA 3KXFB 4KMTH 4HIHB 1CFNA 3A6CH 1JPGA 5TE4L 3GMRB 4G9FE 1KCVH 4R90L 4FQQA 4BQ9A 4XC1H 2W60B 2YR3A 4X0KA 5ITFA 4XNQB 3NGBC 2BFVH 3QCTL 2VZ3A 1PX3A 1ZSDB 5HVWA 1AP2A 1QVOB 4KI5C 2H2SC 3G6JE 3QNZB 2F15A 2B5IB 5IMLA 4GMSH 5IW1B 3CVIL 3M45A 4RX4D 2APBA 4PJDA 4I0CC 3T0ED 2N7AA 5SV3A 1U8HB 3MRCB 3T4AB 2FYYB 5JNYA 5IFAH 3K7UA 5FHBH 2F54A 4ODTL 1MFBH 3W9DA 2NX5A 4R4BA 5IBTL 5D1XA 3TA3C 1D5IL 3TBTB 4GW5A 5FO7A 3INUH 2YPKB 4IEFB 4HGWA 3CJJA 3O6FB 5D6DC 5CD3B 3VXOB 4XXDA 1P5UA 2G75B 3OKEB 5KSAC 4F37K 3B2UC 1KEMH 1Z2KA 4ZUUA 4PRIE 3CPLB 3RVUC 1NL0H 5E2VL 5FUCC 5DJZA 2PYFA 4Y5YA 3QUMH 1LO2H 2DDQH 5DXWA 1XZ0B 2DOCA 2VAJA 3UYRL 1NBZA 1JPFA 1CL7I 3TO4D 1CLOL 4QXUH 1R5WA 3HI5L 3MLSL 3QUZC 1G7LA 5LJYH 5C09D 2AGJL 3BP7A 5D2LB 3FFDB 1C08B 1UB6B 3HA0A 2E6QA 1UH4A 2D4DA 2IGFL 4NUGH 3FB8A 2V5RA 4LPTA 1ZT4B 4CMMA 4MNQE 1HH9B 2BRRH 4ISVA 4I8DA 5J12C 2PXYC 4TVPE 4FQCH 4XVSH 1HOCA 4AK1A 1HI6B 4NQVA 2G2RB 1ZA6A 3LV3B 2CDGB 3QIWD 3T0BA 3QIBD 1FVEA 4GAYB 1MJ7H 5IGXL 4OCYL 4JDZA 1AJ7L 4LEXH 3AU1A 4FTVD 2BHYA 2EECA 3LPGA 1SY6L 5F8RC 2Y7QB 5DC9B 1XIWA 1BIIB 2QSVA 1OOAA 5H2BA 4DK6A 3OKNA 4PJDF 5AYUL 3RX7A 4NT6A 3CVHA 2UVEA 3GMOB 3F7QA 5FEBA 4LSPH 4P46A 4K3EL 3CIQA 2BXZA 1DEEA 2XKNB 2OZ4A 2IMNA 1FG9C 1RUML 1TPXB 1S7QB 3ULVD 4F7EB 3ULUL 1CL7H 1DQLH 3T2NL 2I07B 3HCVB 4K3DL 1RU9L 3EYQC 1X6LA 4M61B 5CSZA 4GRWF 1FZOA 5IW6B 3IF1A 1IGIH 5F44A 4L8SA 1QSEB 3O6ML 4I3RL 4WI4A 4TSAH 2WSKA 4J8RB 1VEOA 4YUEL 5IIEB 2GTZB 2VDRH 4N0CD 4G6FB 4RMSA 3OKKA 4PBXA 2A83B 3NH7H 1A0QL 5TE4H 1U93B 1CXFA 1HHGB 3MOQA 4M62L 4JZJB 1P84K 2Y5EA 1XFPA 4Y19B 4QWWD 5K9JL 4ZD3L 1QQDA 2NTFB 3WLBB 4NM8L 3RWCB 2ZOKA 5HI5D 4J3SA 4PGDB 2H9GB 3CC5B 3T1FB 5CS7A 2BC4A 2EICA 2KDGA 5CEZE 3B9KA 4Z8FH 1CGVA 3GEWB 2BSRB 3EOAB 4HSQA 4UINL 4XPFL 3G08B 4WHTA 5DVLA 4WI3A 1II4E 2R23B 1U3HD 4GW4A 3PV7A 2VNCA 1DBKL 2Z92B 2W0PA 3TNNA 4RGNC 3GSWA 4DGVL 5FYLE 1H9VA 4KJYA 4PJGA 3CVIH 3HZYA 2Q86B 2HH0L 4FXLA 4JY5L 2VITA 4YHYC 4TPRH 1TQCB 2VISA 5L0QC 3VRLF 1MHHA 5EZJB 1FVCB 3EO1A 4ODTH 2XY1A 2QQKL 4QOKE 3IAPA 1MLBA 3PGFL 3VXUE 1D5IH 4LGPB 1K5NB 3B2VH 2QQNL 3I02B 3V4UL 4LSRL 3CFBA 2OR9L 3FO9A 1OT2A 3WS3B 2XNAB 1IQDB 5SX5K 2JJWA 1EXUA 4QRPE 4OKDA 1EJOL 4N5UA 4P2RE 1BZQK 5M94B 4R7NA 1QHOA 2X7LB 4PP1D 1TTGA 1FO0L 4I1NB 3UYRH 4A6YB 1W0VB 3ULSA 3BEWA 3MFGB 1XCQA 3WKML 3EJYC 3U30B 5MERA 3QFJD 2R8SL 3CK0L 1XR9A 1TZHA 1FNGB 5L88H 5CUSH 1RHHB 2Q76B 5ESVB 1JF5A 3UAJD 2FBOJ 3F6IA 5DK2A 1NSNL 5IGXH 4Z0BL 1AJ7H 5GRVL 3UCRA 4XC3L 1T5WA 5C07A 1BZ9A 2Q7YA 1NBVL 1SY6H 4PJGF 3UTTB 1BBDL 3QQ3B 5FUZL 2HA1A 1AIFA 4G8GE 1BM3L 5F7YC 3O4LB 5HHME 5D1QB 4X4YA 5CIPA 2DI9A 3ARGA 2C1OA 3MLUL 3T0VA 4K3EH 4YQXL 4QRSA 1A4KB 3OKMA 4JPIA 1EBAA 2NXYC 4D9RD 4KRPC 2GAZA 1BFVL 1KCRL 4KKCC 3UC0L 1K4DA 1RUMH 3L3JB 4RRPA 5LWYL 25C8L 4M3JA 2FWOB 3LEXA 3I6KB 1QLFA 4NRZA 15C8H 4JFOA 4K3DH 1RU9H 1P4LA 3KPNB 4GBXA 1AQDA 1F4YH 1UEYA 3TZVB 4BK5A 4G8EB 5T3XL 2APFA 3DMMB 1RZJH 3D3VE 1UM5L 4L4JA 3HLAB 3O6MH 1IGYB 4TVSa 4I3RH 2WINA 4JFFB 1DZBA 2CJUH 3FT2A 4M8QB 4YUEH 5IQ9B 5FF6B 1LO0H 1CLYL 3TYGL 2HT3C 1WFUA 3RZCB 3QO0B 4BSWA 1IM9A 3GSNA 3TJHC 2QTEA 1YNLL 1FLRL 2CD0A 3LCYA 5BO1L 2OCFD 4M62H 4H0IA 4BFIA 5K9JH 4ZD3H 1BGXH 1QSZA 3QCUH 4EUPG 4NM8H 3ZKNC 43C9B 4LCWB 1A3QA 4UAOB 3MODL 1A2YA 2BNUA 3MA9L 4OF8A 4UINH 1BWWA 4OIAA 1X7QA 2X89A 4ZO9A 1RJCA 2CRMA 2DTML 3IFNL 4QHLB 2F53B 1DBKH 5DHXB 4DGVH 5C0FA 3EJZD 3VFSB 3WNKA 4LSSH 4NO0B 1BOGB 1JHKL 3QDMA 4R7DA 3GKWL 2XOTA 1D5MB 4OI8A 3G6DL 5T1KA 3BP5A 1P7QD 1G7QB 4UOW1 4HS6B 1M7DB 1PGRB 1TVHB 2EKSB 2BY0A 3QEHB 3PGFH 3R8BB 3QUXD 1WBXA 2B39A 1KT2A 2YXMA 3V4UH 3ZE0E 2OR9H 3HB3C 4P5TD 3FCTB 4WFGE 3VH8A 3QQ4B 5IB4B 3LKSA 1MI5A 4KFZC 3AS0A 1OP3K 3KJ4C 4G43B 4PTTB 2VAAA 2OL3H 3OXSA 5DJ2B 4O2EA 3TIEA 3AUVA 3ZDXE 1FO0H 4YHOL 4YHNB