2OI9C

Structure of the 2c/ld/ql9 allogeneic complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
111
structure length
111
Chain Sequence
EAAVTQSPRNKVAVTGEKVTLSCNQTNNHNNMYWYRQDTGHELRLIYYSYGAGSTEKGDIPDGYKASRPSQENFSLTLESATPSQTSVYFCASGGGGTLYFGAGTRLSVLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Major Histocompatibility Complex protein
publication title How a single T cell receptor recognizes both self and foreign MHC.
pubmed doi rcsb
source organism Mus musculus
total genus 31
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2007-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2oi9C00
5C0CB 1KCVH 4ELKB 4Z7WB 3WHXB 2EEDA 1EJOH 2BCKA 3BO8A 2NXZD 2D31A 3RWDA 4FG6D 4DK6A 3QYCA 4G80A 3D2UA 3QDJE 3S88L 5C0RL 3I6LD 2ESVB 4LSSL 1UZ8A 1VFOA 1N7ML 1AGBA 1CE6B 1IJ9A 3DV4A 5HHPB 4MCYB 4MQ7B 3PIQA 3MRJB 1JGLL 3KPOB 2KQNA 1CDCA 1QLEL 4GMTL 1A3LL 2AK1H 4YUEH 4WIQA 1RZKC 4KRLB 4LLQA 3QCVH 3MFFA 4J12A 3GSNL 3QQNA 4JM4L 3BKMH 3O9WC 3IAQA 4YZFF 5E2UH 1NLDL 2PW2B 5E8EB 1C5CL 5FO9A 4K2UL 4M00A 1VFAA 3NCEB 5LCVL 2VDRL 2HTLD 5JZ7D 4NWUL 2VLJD 3MBXH 3O4LD 4YHKL 1ZHKB 1PD6A 4YDLC 3KYMB 1D5XA 2P49B 1JNLH 3KS0H 1QFWH 5CZVL 2EH7H 4Y4KD 1TJHH 3ROLB 4F8QA 4KPHH 3L5XH 4YBLC 1GZQA 4PJCE 1Q0XL 2QV2A 4PS4L 2FEDC 3M17B 3U0WL 3E2HB 3IGAB 1A4KB 3KPTA 4UIKL 1P1ZA 5D96B 4LHUD 2GITA 2VLKE 3S36L 4U31A 3C8HA 1BFSA 1DBAL 3E8UH 3NA4A 4DWHA 4OCYH 5D1XC 1NEUA 5JA9A 1HQ4A 3KLAB 1MVUA 5GZOC 2Y72A 1X44A 2F53B 2CO7B 4GXVL 2E3VA 5DRZA 3MRKB 4NBXB 4OF0A 4GAJH 2JF1A 2OS7A 4Y16A 1OM3H 1XF4B 2QQKL 3QG7L 5F7EH 2I26N 5I1KH 1ZANH 1A9EA 1NL0H 3GBNH 5HHXL 3LDBC 1YY9D 2R0ZL 3QPQC 5CD3A 4FFVD 3VXSD 5CMAA 2QLVB 4YX2H 3AC0A 1P7QA 1KCLA 1EO7A 2H41A 1I3RB 4LOUD 1IGML 4HKZA 4I13B 1JHLL 2Y5TA 3LVEA 5AD0A 4WI7A 4ZUUA 3V5KB 1NMCB 4TQEH 4I48B 5F1SA 3WXWH 4BUGA 1FZOB 1FL6B 4G8FB 2PN5A 5D7KD 1MFEL 1DUZB 1ZSDB 1UWGL 4LRIC 3D9AH 4FQIH 3U82B 1JF5A 3AMKA 3C5ZC 2EC9U 1FYTE 2KQMA 4KUZH 2ENYA 1V7NL 5EH1A 4XNQB 5T33L 1P9MA 3L1OH 4PJFF 1TDQA 4DW2L 5DJ8B 4ZQKB 2R2HA 5JXEA 3OKNA 5ISZE 1NMBL 1M7DA 2AJSH 2IWGA 4P2RD 2R2BB 4XPHL 1MPAH 1RHHB 3ZMRA 4R2GC 1I8MB 2VC2H 3RUGE 4OZ4A 4N90E 1I7TB 5IEHB 4BSWA 4DCQA 1HKLH 5ICYB 4P5MB 1HHKB 3L5JA 1N6UA 3A67H 3D85A 2DD8H 4NO0D 2BMKA 3MRRA 1A7NH 4LCWD 4PLJD 1EJ6A 4RMVA 4JN2A 1YC8A 1BQSA 3EO1B 2OTUA 4OM0L 5CKAA 4BUHA 4JKPH 5MEQB 1H0DA 2IQAA 3PDOB 1FYTB 5DUML 4PJ5B 4P59L 5JNYB 2FJGB 4PJ7A 1UH3A 3H42L 1XR9A 1AFVH 4M61B 2Q8BH 2A0LD 1RSFA 4RMRA 4RZCA 1QEWB 1WBYA 1XF2B 4QXWA 4I3SL 4RFOH 4RGND 1J1OH 4NRXA 3WJJC 3C60C 1K2DB 5ALCH 5EBLA 1NGQL 4WEUD 3FJTA 3BPCB 4V2BA 5IMMA 4HGWA 4P57A 5IB3A 3GZKA 2XXMB 5DFTA 4P9HH 4X6FA 2J5LB 4CDGC 4NO2A 4FQ1H 1X5IA 3SHSA 3HE6B 5D9SA 4PRDB 3VXMB 2ARWA 3QQ9C 4E5XB 5HD8C 3WFCL 5FK9B 1I1AB 3QUMB 3HKFA 4DVBA 1A3QA 3S88H 1WBZB 4UB0L 5C0RH 5CJBA 4BFBD 4OCLC 4KK6C 4LSSH 1JV5A 1N7MH 1FLRL 1R24A 2A6KA 1G7JA 3SGKC 2CDEA 3QB7C 4ENEC 4N68A 1JGLH 1QLEH 4GMTH 4LCYB 3ZDYE 1W72B 4PJDA 5E08L 1A3LH 3TJHC 2X1OA 5F6IB 2R0LH 5CEZE 4F9PA 1NEZG 5F72S 3QAZC 4EDWL 1QYGL 4PJIF 4JM4H 3H9HA 1NLDH 2PO6B 1INDL 1C5CH 4K2UH 2D2OA 3O0RL 5LCVH 2VDRH 1NC4B 2VZ1A 2G9HB 4NWUH 3QRFM 4YHKH 3OKKA 5CZVH 2OJZL 2AV1B 2AP2A 2UYLB 3MOBH 2NY2B 5DJ6A 5DO2D 3RIFK 2MNUA 4NZRL 3ULVL 1QACA 3OAYH 3WCYA 3GKZA 3GSVA 4UINL 2X4UA 2A6JB 1U3ZA 5JDSB 3U0WH 4MDJA 3GEWB 1GHFL 3ULSA 2NW3A 5EUOF 2FX8L 3BYTA 1MI5D 3KPQA 4W6WB 4OIIL 4UIKH 3K8MA 5IB1B 2HG5A 4XVUD 4PRAA 3S36H 4DZ8A 3QQ4A 3F58L 2PTUA 3S35L 4MXQC 1K4DB 5HGAB 1DBAH 5HVGB 5IJKA 4NRYA 1XH3B 4Q9BA 3SE4A 2NXYD 4XPGL 1IGTA 3QHTC 3KYKL 3MXWH 3U0TA 3MA9L 3ZE1E 1REIA 3EGSA 1P2CB 4P4KC 4WU5B 3GRWA 3KG5A 3WS3B 2QQKH 3QDMD 4IIQB 3QDGD 1Z5LA 3FOMB 4EUPB 1RJYB 1NSNL 5I18L 5KSBA 4B5EA 3PWPB 3TJEL 5HHXH 2R0ZH 5CUSL 1ZA6A 4NBZB 5DQJB 3UTQA 2FLRT 1IGMH 3X3GL 3QFJA 4HHAA 3MR9A 1BQHG 1MJ8L 1Y6KR 2JJWA 5T1LD 4PJ7E 3GSOB 4PY8J 4ETQA 1MFEH 1KJ2A 3QUZD 3VXPA 2GK2A 2R2HB 4YFLF 3OKNB 3Q5TA 1NUFA 3BP6B 4HMDA 4MZ2A 1MCOL 1V7NH 4EI5B 3KGRA 3VMPA 5T33H 3RY6C 4Q97A 3CFDA 1YEIL 2ATKA 1NMBH 4YEFA 4DUWA 4KJPC 5AEAA 1ACYL 4Z7UA 5DHYA 1DEEA 2HRPL 4XPHH 2SEBA 5C07E 1N3NA 3QDJD 2C9AA 3I6GA 5CINL 4OLVL 1OD9A 4ZPTB 5ACZA 1TCMA 1H0DB 1S9KC 5GJTH 5JOPE 3VCLA 1YPZF 4NN6B 1VKXB 1OCWL 4RX4A 4OM0H 3MLSL 3U46B 2YSSA 5A2IH 1J0JA 1IGIL 5CEXB 5DUMH 2Z4QA 1IKNC 1AHWC 1JWSA 1IEAB 2B4CC 4P59H 5FUZH 3GMNA 3H42H 1GZPB 1UT9A 3HE7A 1GOFA 4I3SH 1FFRA 1I1CA 2DIJA 5C07B 4J3UA 4PJDE 3G5XA 4I2XB 1LP9F 4P57B 1CQYA 1KLGA 1NGQH 1A1OB 1FN4A 1ZOXA 3F62A 4JFEB 2EIEA 3OXSA 1QLRA 4CVUA 5FKAB 3SKNA 3O6MH 3AAZA 5F9JA 4NZDA 4Z78A 2VKWA 5IQ9B 3LRSB 2GY7B 5BW7A 2VLKD 2X1QA 1SEBA 1OB1B 3BZ4B 2VERN 5J3HD 2GSIB 5DVNA 1MHCA 3UZVB 1R24B 5DD6B 4KDVA 1F4XL 5E24E 3WFCH 2A6KB 4N9OB 4CGTA 3EFFA 4UB0H 4JKLA 3SDDC 1FLRH 2WP3T 1RZKL 2V2TB 5F1IB 4FABL 2EXYC 1U8MA 3MRFB 4KDWA 3DECA 3T0EC 2IALA 1DEDA 3DGCR 1KIPA 3PGDA 4IRJC 1INDH 2NY7H 3O0RH 3FZUC 4L8CB 1GC1L 2GSGB 4C83B 2EYTB 3MRHB 2V2XB 2OJZH 1ZV5A 2JB6A 4WNQA 4NZRH 1U6AL 3CC5A 3SDYL 3ULVH 3WDJA 3O6FC 2X40A 1XGQA 5ISZD 4OGZA 3L7FA 4UINH 3VXTB 5KSAD 3IDYB 5A2FA 4O2CA 1NCAL 1GHFH 3DUHA 5MEPA 3I50L 2FX8H 4IHOB 4N90D 3O4OB 4OIIH 3K46A 1U8PB 2LU3A 1IGTB 5JIIA 5I9QB 2J3SA 3C5JB 4HCRL 3F58H 3S35H 3CSYA 3HS0A 1LEGA 3VA6A 4HIIA 1D5MA 4JQXA 1MY5A 5B3JE 1XMWA 4RQQA 5K9OA 3BPNB 1MJJB 3GMRA 4XPGH 1P84J 5FDWA 1OGTB 3KYKH 3O2VL 1U91A 4AH2A 4Z7UE 4JGMA 4QNPE 4O5LL 1P53A 2IH3B 3D2UD 12E8L 4RAUA 3TPKA 1CDGA 2UY6A 2OM5A 1MHPL 1OQXA 4UU9A 4QRUA 5IGXL 1C8PA 1NSNH 2FSEB 5I18H 3VGBA 3TJEH 1X7QB 5CUSH 4KRMB 3MV9B 3KPMB 4CUCA 4KK5D 3ARRA 4K8RC 1KN2L 5GRJL 4X9BA 2D0GA 3X3GH 2E7MA 1CFSA 1SY6H 5ADOL 3IXTB 4TUJA 1NGWA 1MJ8H 4WHTB 2DYPB 2W9DL 1GVIA 2ICWJ 3QIUB 3EYOB 2AQ1A 1SMOA 4LLWB 3R1GL 3TBTA 1MCOH 4Y2DB 1UXSA 5FIEA 4O2FA 2QQQA 1N3NB 1DBML 1FZMA 1YEIH 2P44B 4S1DC 3RI5K 4Q6IB 3I6GB 3B43A 4U7SA 2Y1VA 3ABZA 3KS0J 2HRPH 2OL3L 1F6FB 1N8ZB 2LTQC 4GRWH 1MFNA 1X5YA 2DL2A 4RMSA 4X6DB 3WDIA 3GGWA 1B6DA 4OLVH 5CINH 3ZHDA 4WW2F 2DL9A 2YSSB 1I8KA 2Z4QB 3DXAA 5HGDA 1R5IB 1MOEA 1J1XL 1OCWH 3MLSH 5ICXB 2G2RB 5JIHA 3S98A 4PYHA 1IGIH 2DWEA 5BMFL 4YDJA 4BFIA 3QG6B 2BVQB 4KJQC 4F57L 4Y16D 1BAFL 4EN3C 1P4LB 1I75A 2IC2A 3QQ3A 1FN4B 4HS6A 4AY0A 1PY4A 3TBSA 2H2SD 5DK0B 3C2AL 5DJZB 3R06B 1H5BA 2P46B 4D94A 1P7QD 3C5SA 3L3DA 4NZTL 2BSRB 3CIQA 1OAKL 4NC0B 3HNTL 5EBMA 5SWZA 3RY4A 1RK1B 1NMAL 1U9KA 5KVEH 3BH9B 4NFCA 1MIML 3X14B 1MHCB 4KI5C 5HYJB 4M7JL 3LPGA 4HC1A 4U1GB 2CLZA 3EO9L 3WIFA 4OGAD 4Y1AA 4I9WE 4PJ9B 5JXED 4IJ3C 2GFBB 4WCYL 3F7YA 4RMTA 5EU3A 5JPMB 2P5WB 2YPKA 4PREA 4S1SL 2CJUL 4NC1C 2A77L 3QXUA 1UB5A 2EICA 3D85D 5CAYB 3V6BR 4FABH 1HINL 5D1QB 4JN1L 1UCBL 4LNRA 5BQ7A 1T1WB 5IVXA 3MOQA 4X8JA 4U3HA 4WW2C 2HN7B 3HPJA 4FQXA 3ARPA 5FM5M 3RGVC 1OHQA 1U58A 3AS1A 3L3GB 4PGCB 2AEIT 4MQXD 3CC5B 4U1HB 2J1KA 4MSWA 3DARA 3QIWB 1UM4L 3SQBA 3UEZA 3OHXA 3DHJA 3HI6L 2H1PL 4IS6A 1MRDL 3MRMB 3SDYH 1SYVB 3VH8B 4BM7A 2I25N 1QPPA 3OXRB 5E5MA 2FO4B 1WVZA 2Z91A 1OT2A 1HXYA 1BEYL 1NCAH 2WMPA 3HS0B 3I50H 1D5MB 5IFJA 5DQ9A 5K9OB 3GMRB 1OW0A 1XGPA 2QQNL 4XNMA 1JRHI 3THML 4DJMA 3DVFA 4HCRH 5FB8B 1DDHB 1G9NL 3HG1B 1PKQA 3RPIB 5JOPD 2ARJA 3FB7B 2D03L 4JFQB 5T3ZL 3ARXA 5GS0D 4M7ZC 4O5LH 2OBGA 2NYYD 5J56B 5BVJB 12E8H 3CFEA 3T1FB 1JZ8A 2VIRA 4G8GA 1XCTA 1MHPH 5IGXH 3DETC 1IGJB 3QDAA 2CPCA 2EDEA 1D6EB 1ZTXH 4QT5B 3DXAE 2PCPB 5B39B 5GRJH 1KN2H 3BEWA 3MJ9L 1FNLA 3KPPB 5E2JA 5ADOH 4U1JA 3ARBA 3QNZA 4M6AA 3WNMA 3TBTB 1SEQL 3BYYA 1KJMA 2W9DH 4HMCA 2XNAB 2P8MA 3F7PC 1I9JL 3GM8A 2P5EA 4LVOB 1A6UL 5J06A 2K3TA 2LU4A 3CH1A 3KXFB 4ORGA 2VLLA 2X4QB 4X80H 1SMAA 4YDVA 1DBMH 2V7HA 3S5LB 4M4PA 3TNNA 4PIRF 2OL3H 4U6XB 4YHPB 4CJ0A 4F7MB 1RZIB 2D7NA 5C0GA 1I8KB 2CMRL 3LPWA 2JB5H 1H15A 2P24B 4R4BA 2OJEB 2PW1A 3B8YA 1JWUB 3AS3A 4X6CF 3EJZD 1R5VB 5ICZB 2Y7QB 3QI9B 5DDHA 5E8PA 1QLFB 4YDJB 2XTLA 1JYNA 1KTLB 2GHWB 2B4CL 4Y1AE 1T7WA 5E9DA 1R3LB 3Q3GB 2QSTA 3N1FC 3RTQC 5TE4H 2H26B 2PXYA 4G9FA 2FJHB 2I07A 1KF9B 3TBSB 1U8KB 3IAPA 2X4NB 4F57H 1BAFH 3JV4A 1MF2H 3VGGA 1S7TA 1EA9C 3ZLQC 4JDTL 2F5AL 2CKBA 1EUTA 2X2YA 3C2AH 1D9KB 2VL4A 1T2JA 4QKXB 5EFIB 5D2LF 1MCKA 3EDDA 5IVXE 4NZTH 3ZKND 4U1SB 5JMRA 1JF1A 3QFJD 1LD9A 3HNTH 4NZUL 1S9VA 5FYKL 3C2SA 3MACL 1NMAH 2CLZB 3SDXB 1NKRA 3QZWB 3DMMC 5BZDB 1MIMH 2JTDA 3A6BL 4F7EB 1WTLA 2X5PA 3K7UA 2GJ6B 3AREB 4KJYB 3JWDL 3OKEB 3Q2CA 4M7JH 1PG7L 4ZO7A 5I8OL 1D5ZA 3MJGX 1FRGL 1XIWC 1BJ1J 2YR3A 2FEEI 2E7LA 4XPTL 3BWUC 1YUHA 1QQDA 3BW9A 4PREB 3N85L 4OFKA 1A6AB 3AROA 4WCYH 1NCNA 3E6FA 1RU9L 3FCTA 4LNRB 4I0PA 4S1SH 4UIMA 2CJUH 5BQ7B 2A77H 5DQDL 5KW9H 4X8JB 3V95A 4NM8L 5DR5L 1YQ2A 1PKQE 5J1AA 1HINH 4JFPB 5DVKA 4P46B 4JN1H 5IT2L 2X09A 3LZFL 1UCBH 2ATPA 3G5VB 4XB7A 4ONGL 3VFPA 4J3TA 3IJHB 5F7LB 4JZOA 3BH8B 4XPFL 3ARDB 1CG9A 5I71C 3TH2T 3AS0A 1H8NA 1NCTA 2CLRA 4L3CA 4YHYB 3OGOE 4G8GE 5KZCB 3CUPA 1UM4H 4JDVA 2B5IB 4YHML 3HE7D 3HI6H 1HXYB 2H1PH 4MB4A 4XP1H 3MV7A 1KCSL 1MRDH 4LSTL 4MCZA 4WTXA 5T3XH 1JMZA 3HNVL 4BFGA 4CMMA 2XTJB 5CZXC 1P7KA 3VU2A 3S4SG 3RWFB 4P2OC 3IDUA 3NAAH 1BEYH 4OZFB 1PKQB 1RIUL 2QQNH 1IFHL 5E2VL 3NIFF 3THMH 4LSDA 1OAYL 2F58H 1A5FL 1FIGL 2P5EE 4NKIL 4TNVF 1E4KC 3WJLA 1G9NH 2NZ9C 2DKUA 3KLSA 3FQWA 2ARJQ 2P45B 4Y4HC 1U92A 2D03H 5T3ZH 1RZJC 5F89B 3HZKA 1INEL 2OSLB 4ZS6C 2HWZL 4URTB 3BEWB 1JE6A 4OF8A 2OQJA 1F4HA 4FQ2H 1CL7I 1N2RB 5E9DE 4YBQC 4KTYA 1BIIA 3LRHA 4GAYB 4Z7WF 5DEFB 1S78D 5IIEA 5IJVA 4U1MB 1PDKA 2WQ8A 1KPVB 3I75B 3SBWA 2DAVA 4WEMB 1A6UH 2QEJA 4CN6A 3GNML 2DJUA 3S34L 4WV1A 2FHBA 3SGDI 3B2UC 2EIZB 3EJYD 3EJJX 1DN2A 2PYEA 4ISVA 1WFUA 2FECI 4I9WD 2C4XA 2IFGA 4M48L 4G5ZL 1UB6B 1UGNA 5IG7B 4Y5VA 1CD1B 3UPRB 2MQ0A 1CZ8L 3F7VB 2ADJB 2CMRH 2LABA 3JTSB 1FCCA 5T1MA 1CGUA 2B0SH 3OB8A 5F7DB 3WLBB 5L0QB 5IMOA 4K3DL 2ICEA 4YGAB 4XTRC 3P73A 1RZ8A 5IW6A 4XP4L 2OTWA 3JWOL 5C0IB 3VFTB 1LQSR 3KLHD 5I6XC 4CN4A 1CVRA 1SJXA 4K23L 5KS9E 4IOIA 4KTDL 1K5NB 3X12A 5I1AB 1MCFA 4BK5A 1UJ3B 2VAAB 2I5YL 5GZNC 5IB5A 4NJ9H 4RAVB 4JDTH 2F5AH 4KMLB 3NPSB 2XY2A 4JANB 4BZ2L 4WU7B 5EU7C 1S9VB 2GUOB 2FJFB 4JLRA 1WZ1L 1U2CA 1AH1A 2R4RL 3QR2A 4IMLA 1QVOB 1NDGA 1YYLL 4NZUH 3O3AA 5FYKH 5FOJA 3MACH 3MRGB 1CGSH 2XY1A 5BJTB 1RJLB 4P5KA 4HK3J 4GRMA 4K94C 3PUCA 1ZHNA 3WO4B 4NJAL 3RWJB 4HUMB 4HX1B 1X5HA 3A6BH 3MRCB 3MRIA 1MCCA 5IWLC 3JWDH 3MA7B 1PG7H 5I8OH 1LMKA 4LPUA 3B9KC 5KS9B 5FAAA 2WK2A 1FRGH 4NYLB 4XPTH 3ZSSA 1WQVT 3KYOA 1T1ZB 3O81A 3QFDB 5E8OB 1G7MB 3N85H 2NR6D 1DVFC 5JPNB 4I8DA 1PGRB 4F58H 1UXWA 2VR9A 3P9LA 1AC0A 5DQDH 5J12C 3VA2C 4ORZC 4U6YB 5DR5H 3P3YA 3SDCB 1DANT 5AZEH 1FGVH 5BS0E 5ALBL 5IT2H 5HDOA 3DXAD 3LZFH 4ZUWA 3STZA 5LJYH 1OSZB 4ONGH 5D5MB 5F8RC 2GTWA 2BNUB 3SPVB 2BVOA 4JAMB 4XPFH 4ONOA 1B2WL 32C2A 5JW4N 1KPUA 5E99H 5LAXB 2D0FA 1ITBB 4FQHB 3KWWB 2J8OA 4U7MA 4X5LA 4YHMH 1PJ9A 2HLFD 1JPGB 4LSTH 1C08B 2ADIA 1CXLA 2WLYA 4RSVA 4NNYA 3EO0B 4LBEB 3PGFH 4Z77A 1RIUH 5BS0B 3TO4C 2FCBA 5HYQA 4XHJC 4K7PX 5SWZD 1IFHH 5E2VH 4GKNB 3JVGC 4JCMA 1OAYH 1A5FH 1FIGH 4NKIH 4X98B 3T09A 3H3BC 1MSPA 1CU4L 4HUVA 4MNQE 4L8DA 4RA0C 2PYEE 3TZVC 1AGDA 4EJ1C 3BUTA 1BBJA 3HUJF 4P5TA 4Y1AD 2ZKHL 3DRQA 2V6HA 4WI3A 3ARYA 1INEH 2OQJB 4HDIA 2HWZH 4UILH 2M1KA 1L0XA 4G6AD 2O93L 1F97A 3P4NB 5IBUG 3MGTB 4D2NA 2R56L 4IRSA 1ZLVK 2H32B 4GMSL 5IOPB 5EC1A 2E9WA 3W11C 5CGYD 2OCFD 3H7BB 4DKFL 4AM0A 4TPRL 5LGHL 4RA3A 4HIXL 4HG4K 2IPUG 3R0MA 4FQXD 4F15B 4MNQB 4Y4FB 5I1LB 2DTML 5KVMC 4ISVB 4RNRA 3S34H 1J88A 3HAEG 3O8XB 4NSKB 4BH8B 2FIKB 3BKYH 3MRDA 3DURB 3QEUB 4HS3B 2Y6SC 1T1YA 4HKXB 5T1MB 4OJFL 4M48H 4QF1A 3EOBA 2FL5A 1WFNA 2WINA 1SYSB 1JZ2A 4PJHA 1WT5A 1YDPB 1CGTA 5GGRB 1CZ8H 5B38G 3HFML 4XNZB 4MB3A 4HW6A 4P2YA 4P2QA 4JFHD 4PJAF 4XI5C 3VI3F 5K9QI 1WIOA 1CS6A 4WDIB 3TFKC 1A7PL 2NW2A 2PUQT 4J1UB 4MB5A 1F42A 1KT2A 2G75A 3JWOH 4XP4H 4YLQT 4JY6A 3X13B 3VXUB 4K23H 3GMQB 4PGBB 2HFEA 3MUGA 3GIVA 1M05B 4JCLA 1MFDL 4RFNC 5L2KA 2XPGB 4G8GD 3FO1A 3LEXB 3VWKA 1MUJA 3VRIB 1KXTB 3WNPA 5E1HB 3GSNA 3O3AB 4XCYB 3RFZC 1I9IL 1WZ1H 4Z7OF 4N1CA 3C6LC 1NBYA 2R4RH 1IE5A 4UBDD 2LQRA 2W07A 3ARBD 3IKKA 3KNBA 4YQXL 1ZT4A 2FZ3A 2EH8H 1T0NB 4M5YL 5C9JB 1Z3GL 4MD4B 5INDA 1EIBA 4QTHB 2X7LB 3C6SA 5HYEA 3EDEA 2P5ED 4NN5B 5DJYB 4WTZG 1Q9OB 4YFDB 3ALXA 5HYSB 3IDIB 1ZLWK 5JW4M 4JM2B 3V7AG 1C7TA 4FQQB 5D70L 5IVZA 1CYGA 5H35A 1EVTC 1NANI 2EKSA 2MSPA 1WJ3A 4ZUWB 3STZB 5DUPL 1JTTA 5IF0B 1F4AA 4CMHB 3LQZB 3MOAL 3WN5A 2XG5A 1DBJH 4WTWA 4QRSB 3TVMA 4XX1G 32C2B 3RL2A 5EU5B 43C9B 4XCNA 2NCMA 4M93C 5E9DD 1QSVA 1UWXK 4J4PA 3QNXB 2Q76A 2HVJB 4DKEH 1OGAB 2PXYD 4QRPA 4G9FD 1VFBB 1YECL 4Y5YB 1Q94A 4S10A 4XAWL 2BY2A 3OV6A 3HAEH 2AVGA 5TE7L 3C09C 4U1LB 5D7JC 5T1KB 3H9SB 1AR1D 4W4NA 1KIQA 1H8OA 2FHCA 1ZLWH 3MBEC 3CK0L 1K6QL 3MQIA 1CK0L 2A2QT 5T5FL 4Z7VA 5CSGA 4KGLA 4LSUL 4HUVB 1T7ZA 3TNMB 3G6JF 1GGIL 3WNKA 2JJSC 3MGOB 2YD1A 1R3IL 4MS8C 1MCHA 7CGTA 4P5TB 2DQUH 1CU4H 1YEDA 2B39A 2HLAA 4ZXBA 1UWXH 4L3EA 2UV3A 3MFGB 1IAII 5SV4A 1HOCA 4XZUA 2CR3A 4H5SB 4WUKL 3T3ME 1J86A 1EV2E 2DMCA 4PJHE 1S7XA 5LGJB 1AI1L 5EC1B 3VFMA 1JN6A 4GSDL 1NEZA 1RD6A 5EOTB 2DIBA 2R56H 4I0PD 3ES6B 4L9LB 4GMSH 4KKCD 3RDTB 1ETZB 2YBRB 1E28A 1KEML 4DKFH 4TPRH 5LGHH 5ACMA 4HIXH 4N1EA 4NQCB 2QADB 2VMFA 5F1NB 2DTMH 2BNQA 4M8QA 3LB6D 3VFWB 3FQNB 4OFPA 4X7FC 5L2KE 3HRPA 1T1YB 2W9EL 4RDQG 1U42A 4QF1B 4LLVA 3K0WA 4AENA 3S3JA 2WINB 5CSBA 2VWEE 3VFOB 5C0DB 3MV7D 3REVA 1CFTB 4N0FA 2GTZA 4OJFH 1FNFA 5GISL 4G43B 1JNNL 1I8LA 4PRNA 4KZDL 1UQSB 4J3WA 1NAMB 2V9TA 2NW2B 5EO9A 5CGMA 4K3HA 3HFMH 1DQML 1B6UA 4W4OC 3QULB 1QKZH 3ARGC 3RZCA 1A7PH 2HFEB 3G5ZB 2H45A 3B3IA 4LSPL 2ITDB 3MUGB 5JOFA 3GIVB 4Y5XB 3QUYA 3S7GA 2H3NA 3SDDD 3WHE0 1A6PA 1OAUL 5I66A 4JFDE 4EIGB 4LLMB 4ZOBA 3T2QA 2IPTH 1MFDH 3ZYJA 4EVNA 2HFFB 3GSNB 4PJ8C 5HSFA 3VGHA 4U3CA 5IHUL 4XNXH 3WDHA 4CADB 1N59B 5IUSA 1NDMA 4G7VL 1I9IH 1FG2A 1ZT4B 3EYVA 3TCLB 1JBJA 2Y5EA 3DBXA 3I6KA 4R4FL 4XXDB 4QWWC 1RUML 1OSPL 1VADA 3ZKXB 1HYSD 1CIUA 2CRZA 1A9BB 1Z3GH 4M3JA 5EUKA 5AUMB 5CEYA 4GG6A 3CXHK 2BOBA 1Q9WA 1SJEA 4JFDB 1RIHH 3V6OA 5CJXC 1J1PL 2XZCL 4XMLL 3G04B 3WO3B 5ID0A 3KPSB 4HKBB 2PYED 2VL5A 3AGVA 5AYUL 3Q5YA 4MAYB 3P9MA 4P48A 1V8HA 2XXCB 4NDMB 2Q20A 2RAMA 5KVDL 3K1DA 1P6FA 5E95B 5A43C 1OTSD 1ZHLB 1T5WA 1ADQL 5DUPH 2ILLA 4QRQA 3LHPL 2QSQA 3MOAH 1R5WB 4ZMAT 5B8CC 3B83A 3WLWD 4L3EE 5I74C 2APBA 4IDLA 4IOFD 4QHNB 3CFCL 2XZQH 2PTTB 4DQOH 3GMPB 2DLGA 5I76A 2IAMC 1D5BA 2WZPD 1GOGA 1YECH 3STLA 4QOKE 1DANU 3OAUL 5TE7H 5D7IB 4MJIB 3QEHB 5B21A 2HRLA 5EU4A 3V5HA 3ZE0F 3UTSA 3T8XA 3CK0H 1K6QH 1I7RB 5EDXA 2EDOA 2JKXA 4L8SA 5JLZA 5T5FH 1JWMB 2XN9E 4LGRB 2EEBA 1EEZB 2FYYB 4JG1L 3DX9B 1AXSA 4LSUH 4WO4C 4ZXBB 2DQFB 1FJ1B 4R7DA 1I8IB 2B1AL 2CDFA 2RFXA 1GGIH 2BHZA 3QIBA 5CFHA 4G6FB 2G5BB 3OJDA 5IFHL 5IKCA 5TH2B 1CTOA 3MRNB 1MCEA 3TC9A 1DQLH 4LHJB 5CP3H 5J89A 3D6GA 4N5UA 2R9HC 2BSED 5FHAL 4QOKB 5FA4A 3SCMC 1X6NA 1CDUA 1NEZB 1U93A 3GSWA 3O11B 4WUKH 4UT6H 3P77B 2HJKA 3PXJA 3HCVA 1YN7B 5DGRA 4GSDH 4FP8H 2Q8AL 1K4CA 1IGYA 3CDGB 1ZT1B 3GM0A 1O5DT 2XN9B 2VDKL 3AU1B 1J7VR 2AJZA 4WVRA 1Q8MA 2GAZA 2VXTL 2WV3A 3O3EB 3RNKB 1FE8H 4M8QB 1KEMH 5I0DA 5D1ZC 1HSAB 4QRTA 4X4YA 2EDXA 4M7LH 4HGKC 1QR1A 5C0BA 4F9LA 4QGYA 5IW1B 2O5XH 2WBJD 3A6CL 4IOSD 3BPOC 1G7QB 2GTZB 2W9EH 3RVXD 1ODAA 2WWKT 3O41B 1QBAA 2MFNA 4LP4A 1AQKL 4Q9QH 1T20B 4PJEF 4TN9A 4ZPVA 4OGYL 1X4ZA 3U6RA 4H0GA 2NY5L 5GISH 4OZHA 3CPLB 1JNNH 2Z8VC 4KZDH 3NFPB 1T7YA 3TIEB 1KJ3L 3T04D 4GUPA 2Z0BA 4P23C 5ANMA 3D87B 3VXNA 4XCEA 1U95A 4QXTA 3ULVE 5I66B 4GFTB 3V6OE 3O3UN 4LSPH 3HNSH 1IAOB 1OAUH 3T77B 1Z9OA 4L4VB 2P48B 2EZ0C 3TN0C 1KLUA 2ZG1A 1UEYA 3PP4L 4HWNA 1A7RH 1BQHB 5JORA 3VRJA 1FFOA 3BP5B 3S6CA 4GW1A 5DI8A 1YEEH 3TESA 5IHUH 5C09A 3HHRB 4IRSD 3BGFB 1HWGB 4G7VH 3FOLB 4PJGE 2F54B 5ESAA 3WEXB 1IAMA 3IJYB 3RWGA 4R4FH 3MNZA 1Y6NR 5H94B 1RUMH 1OSPH 5J6HB 3VGEA 3LSOB 2R1YA 5I2IA 3BDBA 3QA3B 4FHBD 1RI8A 4KQ4L 5ID0B 1FNGB 5DVOA 3P9MB 3H3KA 3CX2A 3QXWA 4YHNA 1J1PH 2XZCH 4XMLH 3MV8B 3FO0L 4Z76B 3UTSE 3QUML 5C08A 1RHFA 4X0KB 2FATL 1A4JA 1S9WB 1XGYL 5AYUH 4HV8B 1H3UA 3VW3L 5F21B 5DGQA 1OAZL 4HCRA 3L3KB 4HSQA 4OLYL 5TGBB 3GJFA 2YUZA 2WANA 2UVEA 2ZSWA 1W72L 4OLXL 4YIQB 3JTTA 3FB8A 4PJGB 3LHPH 4P2QD 2VE6A 4OD2B 5KAQF 1X5KA 3GSRB 4HFUL 2DJ4A 1A21A 4YDKL 1VENA 4S0TD 4PGDB 4YJZL 1FSKB 3EYSL 4GRWE 4MXVE 2Q6WA 3W5NA 3GMMA 4EI6A 2ID5A 4CU8A 4HG4J 3CFCH 4JFXA 5GGSY 1JUFB 1MIEL 1KN4L 1NJ9B 1XF1A 5EU4B 5TFSL 3TYFA 1U8OA 2IPKB 4FNLL 5L2KD 5H2BA 3OAUH 4HXBL 1F90L 4MQSB 3VWKD 3BVNA 1TFHA 4EQ3A 3OGCB 3LEYL 3PV6A 2CDFB 2X1WL 3S37L 3OG6B 2AEQH 5BV7B 4MNGB 2NY4B 3UBXB 5CEZL 4JG1H 4EXPX 5KSVB 1W0VB 2ZUQC 4WWKB 4X9IA 5C0BE 3FN0L 2B1AH 4QHLB 1EZVY 1QSEB 5IFHH 3BJ91 5F9OL 1U93B 4PJXB 2MPAL 4R3SB 5HI4C 2OL3A 5EIIA 2Z31B 5I8EA 5FCUL 2HJKB 3HC4L 3TBYB 3HCVB 1R3JA 5C86A 1B90A 4UOJA 1F6AB 1S9XA 1UH4A 4YDIL 4OZHE 1HH9A 4R0LA 5TDPB 1FL3B 3BPLB 4ODWB 4OBSA 2Q8AH 1S5HB 2C3GA 3VJ6A 3FRPG 4M8VA 2GI7A 2VDKH 2FX9L 3P4OA 3VRLE 2YRLA 2VXTH 4HFWB 3SGJC 5CSZB 3TVMD 1KBGL 2OX5A 2H6PB 3NMEA 4J4PD 4QCIA 4OV6F 4QRPD 1FAIL 1G7PB 1UWEL 4F2MB 2AK4B 4EDXA 5L9DL 5EU6A 3LOWA 4L8BA 5C09E 1RUPL 5DJCA 3HA0A 1U8IB 4ZAKC 2EXWD 3LKQA 2W65B 3B4NA 1B3JA 1QPXA 4OFDA 3LKRA 4OGYH 3IAGC 4U2ZA 2NY5H 4QXTB 5GPRA 1KJ3H 1SJVA 3BMVA 3OKMB 4O02H 2HVKA 2DQEL 4ZOEA 3UDWC 5I1DA 1CFQA 4ODSH 4L3ED 5KSUA 1XZ0A 5IB2A 5C08E 4PJBB 1LHZA 1X3DA 2EDRA 4DZBA 3O9WB 4NQSA 1BLNA 2D4FA 3RJDA 4ETYA 1E4WL 4GBXA 4L3AA 3PP4H 4ZD3L 2JK5A 4EUPG 3WFHA 1KTDB 3MRPA 2BY3A 3DVNB 4KK8C 1FORL 1NFDA 4YDLB 4PB0L 3SE8L 4K3GA 4NO3A 1QFUL 1T6VN 2NTSP 5CILL 4NHUA 1BHGA 4MLIA 4P2CG 2EDHA 4YBLB 3TA3C 4R4ND 3IDMB 3UBXI 3SJVB 3T2NH 2X9YA 4DFIA 3DYMA 2FDBP 3E6HB 4OCSL 1EBAA 1WCBA 2NY0D 3ME0A 2NXZC 4KQ4H 2BNQD 2I9TA 1F2QA 1URLA 3MLUL 5F70A 4FG6C 4JRXA 1TVHA 3FO0H 1KC5H 3IKCA 3QUMH 1OOAA 4PRBB 2FATH 3GJFB 1XGYH 4MA8L 5DJXA 3KLDA 2ZSWB 1N5AA 4L1HA 1AXIB 3VW3H 4YZFE 1OAZH 2NZ9D 5ITFA 4OLYH 3AY4C 1W72H 1IMHC 2E5EA 4FXGB 3RVWD 3LDBB 3Q1SH 1S7UA 4LF3B 5CHNB 5IESL 4NQVB 4JFXB 4YDKH 3RZCD 4ZS6D 1K3IA 2R1WB 3EYSH 4HK0B 2HTLC 5JZ7C 3V4PL 3NIDF 3QUYD 3KHOA 4Z7QF 3OX8A 3TYFB 1JI1A 2I9LA 4F37F 3JUZA 4PB9L 4NO5B 4AEIL 1MIEH 4Y4KC 1KN4H 2GY5A 2MQ3A 5TFSH 1QHPA 3BP7B 3GB7A 3C5ZB 3GSQB 3G5YB 4FNLH 3FQUA 1AGCB 4HXBH 1F90H 1MREL 5F9WC 5TE6L 2EE6A 2VZ3A 3MZGB 2YHGA 3LEYH 3WSQL 2H8PA 4TULL 3S37H 1RJCA 3IVKA 3WFZA 2V2WA 4R2GB 4PJIA 2IFFL 5CEZH 4KDTA 3TO2B 3FN0H 2W0FA 1A8JH 1DUYB 5HI3D 3T0BA 3STBA 2XWJB 1Z9LA 5CWSA 4UAOC 4ZTOL 3ULVD 5EU6E 2MPAH 5MENA 1HSBA 4PTUB 1U3HA 3WXVL 5FCUH 4XC3L 2ED9A 3HC4H 5HYFA 2EDNA 3ZE2E 3DUSA 1YY9C 4FFVC 4XTRD 4EUPH 4OCXL 1IM9B 4YDIH 4AIOA 1I3GH 3HC0B 4LOUC 3TBWB 1JCKA 1Z6JT 3VI4F 2YUWA 4XPBL 1BZ7B 3TBVA 4NKQB 2NY3D 3C60B 4NCDA 5DHVB 4Z5RB 5I1IH 2VNCA 2J8UA 3LKPA 3OKYA 1KBGH 1NBZA 4EIZC 4TVSa 2EYSB 2X70A 2FR4A 1I1FA 1FVDA 3CGTA 3MRQA 1NGYA 1VSCA 3VXRB 1HCFX 3CVHL 3G6DH 3QEGL 3MNVA 1UWEH 3S4SA 4X8XA 3CXHJ 5L9DH 4PV8B 1J10A 1RUPH 3PWJB 5FYLL 1WZLA 2Z8RA 3UTSD 4ERSL 1NCBL 2C26A 3BKJL 2D7QA 2WIMA 2EDFA 4MXWL 5C0EB 4PLJC 4HXAL 2ADGB 4WJ5B 5GSVB 5EWIL 1V7ML 2A38A 3V6FB 1JRHL 4PJFB 1NBVL 4CW1A 4HZLA 1OQOA 2DF3A 3QIBD 4LKCA 3D25B 1E4JA 3ZDXE 2DQEH 4JRXE 1KPRB 1DVFD 2BERA 5A3ID 4UV4L 3GHEL 4GBXB 4QRRA 3KAAA 5D7LE 2DOCA 3BQUA 3QAZB 5DMKA 2A0LC 5FHBH 3WFHB 3T3PE 3BUYB 2X4RB 4XXCA 4RGNC 4NO3B 3R8BB 5FECA 5GS1A 4ZD3H 4BH7B 3CH8A 3QXAA 3EZJB 1U8NB 1FORH 1KEGL 2IH1B 2D7MA 3SE8H 5DRXA 1Q72L 3REWA 1MLCB 5T3ZE 4AYFA 5HY9B 3SE3C 1CWVA 5E6IA 2E27L 2BY0A 1RZGB 4L4TA 4OGXL 4X5XA 1FNHA 2I9TB 5IEKA 2GJZB 3BP4A 2GK0A 5F6HI 4OCSH 1E27A 2O61A 5C0BD 3RY5A 5D7LB 2WBWB 4Y7MA 3MLUH 1SBSH 1ZVSB 3NFSH 5T5NF 4RAHA 1EO5A 1BVKA 4XMKL 1LP9A 5ITFB 3TO4D 8CGTA 4XHJD 4MA8H 2R23A 5ENWB 1ZHBB 5I19L 4PJIE 3MLWL 3MROB 5F7FA 4YFEA 1JP5A 4P4KB 1JNJA 4ZO8A 1JNHA 3LV3A 5KN5B 4OUOA 4GO6B 1YZZA 3I85A 1H8SA 5E00B 1BIHA 3PHOB 1FL5A 2CUIA 1HN1A 3OX8B 1CXHA 3FO9A 5IESH 4IMKC 5IK3A 5CJ5A 5MENE 2DQCL 1RMFL 5A40E 4L29B 4KROD 5EPMB 1ONQA 3V4PH 5C0AA 3SDAA 3PQYA 1CCZA 3VWJA 5C70A 4JFZL 5DO2C 4AEIH 3RVTD 1CFNB 1MH5B 3M07A 2UY7A 2R4SL 1R0AL 1L6ZA 2FH6A 1B4RA 1MREH 5SWSA 5TE6H 2CRMA 4PJIB 1T89C 5C09D 1L0YA 5IMKB 3B9EA 3WSQH 4XVUC 4TULH 3DVGB 3UMTA 4YXLL 4ZDHA 4J3SA 2IFFH 3L3IB 1TZHA 4NN7C 1L9NA 2BY1A 4JHBA 2NXYC 1DQQA 4FZ8L 1FZKA 4Y88A 4MX7B 2CIIA 3BEVB 4HIHB 4LMQE 2VDQL 3GRWH 5EO0A 1FZJB 2D4DA 1I7UA 2FEEL 5EUOB 4PJCF 3VFGH 3WXVH 3CXDH 4P3DA 4XC3H 5FYKE 3VMOA 5C08D 3FB5B 3LMJL 1UEMA 5CJQL 4HJ0D 1AHWB 4OCXH 4LKXB 1HQRB 3MYZA 1BF8A 3LH2L 5C6WH 4QYOA 1AP2A 3S96B 4WY7L 4XPBH 4F80A 5DRWA 3AVEA 3MJ8A 2QQLL 4KMQA 4QRRE 3TYGL 4M1DL 1OLLA 2ZCLL 5IV2A 2N7AA 1AJ7L 2XKNB 1ZT7B 3HI1A 2HFGL 1NBQA 1NGZB 3FKUS 4HUUB 2VXVH 3R8QA 3T0EE 3QEGH 2IGFL 4LPCA 4JPKL 4NGHL 4MWFA 1T0PB 4R8WH 1FNSL 3VH8G 4NQDD 4OF7A 3S35X 1S7VA 1KIRA 1VPOL 5HBBA 5E94A 3LKOB 4EXKA 4ERSH 1NCBH 3IF1B 4CW1B 1XFPA 3BKJH 4L4TE 3RNQA 4E0RB 4MXWH 1TVDA 4HXAH 3NZ8A 5EWIH 1V7MH 5J6GA 1RFDL 4W68A 3OG4B 1UADC 1JRHH 4GRLA 1NBVH 4OM1H 2C3XA 2EDDA 2ADFL 1U8JB 3T4YA 4ODUB 4NQUA 1FH5L 4UV4H 3GHEH 1LP9E 3K4DA 1BFOA 4C56A 3T0EB 3UP1A 4ODXB 1P69B 1G0YR 4IRJB 3SOBL 3SEPA 1YPZB 5GGSA 1QRNB 3FTGA 4UTAH 1KEGH 3G08A 4PRIB 1OY3B 1KXVC 2XV6B 4Z0XA 5CBEB 2BSSB 2IBGA 4KC3B 5B39G 5IEKB 2CDGA 1CL7L 1R3KB 2GK0B 3LD8C 3O6FB 2KDGA 5F7HA 15C8H 2E27H 3BN9D 5C0AE 4OGXH 5J3HC 1MEXL 3O6LL 3PQYE 5TDOA 1NCWL 3D39A 3OKOB 4TTGA 3HAEA 2RB8A 1NUNB 1JPFA 3K3QA 3FQTB 1LDSA 1O0VA 5SWSE 1JTOA 5EU6D 2FECL 4YO0B 4XMKH 4N9GB 2AKRB 3S5LG 5GHWL 2AXFA 4G6KL 4ONHA 5B38A 3TIDB 4QY8B 1FL5B 1TTFA 3SKOA 3IFPB 5I19H 3MLWH 2YA0A 2JCCB 1RJZB 4K3EL 1YMHA 4U05A 4HPOL 2X6MA 2XZZA 4LU5L 4D9RE 5F44A 4Q2ZA 1SHMA 4QHUA 5L7XH 2DQCH 3GK8L 1RMFH 1DL7H 5DSCB 1FDLL 5B22A 3DX6A 5HGHA 2J6EL 1JZ5A 1T6WA 1H3WM 1ZVYA 4KK9D 4JFZH 5E8NB 5D93C 3RHWF 2LU7A 2ZG2A 1IVLA 3VGFA 2R4SH 4G3YL 4G42A 1R0AH 43CAB 4F3FA 5KSAC 4JPIB 4CVZB 3ZDYF 2CRYA 5DFWH 4CAGA 1DCLA 1K9TA 2ERJB 4TSBL 2BHYA 3BWAB 1S7WA 4LEOA 3OR6B 4YFLI 2E6PA 5HHMB 1QFHA 2DWDB 3MCKB 5TQ0H 4YXLH 2MHAB 1RZFL 5HI5D 2IADA 3QZWG 1ZA3B 4GAFB 4WEBL 4WTZA 4K55A 3OL2A 4H8WH 5I15L 5KTEL 1GPOL 2VDQH 4IM8A 1CLZL 1B0RA 1GRWA 4JRXD 4I4WB 1EXUA 1F11B 3CFIC 1TQCC 4D0BA 3OKDA 5FO7B 1GCFA 3RPKA 3WIIL 4FTVA 1M71B 3LMJH 5CJQH 4JO3H 1RURL 3V8OA 3ARGD 2P8PA 3HR5A 4KK5C 2VUYA 3SE9L 4EN3B 4AK1A 4JY4B 3MLYL 5LKNA 1C12B 4HEME 3CSPA 5I75C 3KPLA 3IDGA 2HAZA 5T3ZD 2QQLH 3QH3A 3TYGH 1HZHL 4AEFA 4M1DH 4C56E 4KHTL 1VA9A 3WS6A 1AJ7H 4NFBA 3BHBA 1KTKE 4P9ML 2HFGH 4UQ2B 4QEGA 2IJ0C 2FB4L 2ICCA 1WZKA 4I18A 4V1DB 3RX7A 4WHYG 3TPUB 4LCIL 4LFHD 2BRQA 2IGFH 4N8PA 2NY1D 1EFXB 4JPKH 4NGHH 2XIDA 2E8ZA 3FFDB 2XWBA 5E2WL 2F9BT 1FNSH 3MNWA 4OB5L 3MYJA 1F8TL 4NRZB 2C3VB 3JV0A 3MMEB 4OZFG 4IJ3B 1MWAB 5JXAL 5TQ2L 1RFDH 1OF2A 1I1YA 1HH6B 3BIKA 2ADFH 3CNKA 3QXTA 3L95B 1FNEB 5IBUB 2C7UA 3V0VA 4Y16C 5JW5B 5MEND 3FFCD 2MQCA 5KG9A 4LLUB 1U3HD 4WW2B 3L3HB 2ICWI 1T4KA 5EZJA 5H37H 3RGVB 4CL7A 3B2VL 3PHQA 2H2SC 1PLGL 1WV7T 3NN8A 3S97C 3SOBH 4XP5L 3HZMA 4KH2A 4QTIH 1KNOB 5D2NA 4HUWB 1G6RB 3PWVB 2RR3A 1YJDH 1UVQB 2FD6H 5C0JB 1AD9B 1S7SB 1SVCP 1ACZA 1AIFB 2EECA 1MEXH 3O6LH 3VDBA 1NCWH 1CXKA 1S7QB 4NM4H 2AXGB 1P9MC 3MTRA 4OGAC 3HN3A 5BO1L 4BKLB 5JXEC 3LQAL 1IQDB 2GT9B 3QNYA 3UZEA 3SGDH 2AERT 5FA3B 3HR6A 2QR0B 4PJDF 3V5DB 3D3VB 1DE4B 5EULV 4D0CA 3CDYA 2J7LA 5DD1H 2V7NA 5GHWH 1YMHB 4G6KH 5DVMA 4JZJA 4TVPL 1E4KA 5D2LA 5FEBA 5FYKD 1F00I 2Q3AA 1F4YL 4M7ZB 3UTTE 3DROA 4JO2L 1LEKB 1YEHL 4K3EH 1M7XA 2OTPA 4HPOH 3W0WA 4AIZA 4HIEB 1PZUB 1NGXA 1PY9A 4LARL 2X4OA 3RU8L 5CP3A 5C92A 1PKOA 1W0WA 1A3RL 4H88L 4PG9B 4JFFA 1LEIB 4I77L 4RWYH 4IDJH 3LN4B 4BQBA 3GK8H 3V7AE 4MQXC 4WFFE 2J8HA 4QRRD 2OXHA 3BQUD 1A7OL 1FDLH 4FTVE 2VDMH 2J6EH 1ZE3C 2MCG1 3GMLA 4WHYH 2AEWA 2XOTA 3NTCL 1NLBH 4JE4B 1A1NB 4RFEA 4EKXA 3DV6A 4JFYA 2NY6D 4G3YH 2KZ1B 3QUXA 4XX1E 4RMWA 5I1EH 5D1ZD 3UTTB 3ARZA 3RX8A 4F33A 4H25B 4TSBH 4D9QE 2CXGA 4OZFH 5CCKL 3VFVA 4KMTL 4OZGF 3U79A 4MA1C 1EX0A 1RZFH 5E6ID 3VD7A 4L4TD 5IHZB 5MI0C 1AGEB 4UQ3A 4A2MA 4WEBH 4XWGH 2EE3A 1Q0YL 4BSJA 4F7TA 5I15H 5KSBF 9CGTA 2FBOJ 1GPOH 3L5WB 1K8DA 1CLZH 2NYYC 3VE0B 3DX8A 4JRYB 4ODVL 2JIXA 3HR5B 4XWOD 1EMTH 2ICES 3WIIH 2Q87A 3RTQB 4OCWL 1RURH 1YMMA 4BFEA 5GRUH 2ZOLA 4N5ED 4U1NA 3SE9H 3P4MA 1C1EL 4M43L 3BGMA 4F9PC 3MLYH 4NQXB 5DZOA 5JW4R 1CICA 1CLOL 4Z8FL 5B3JF 5I17A 2WM0A 5DEGB 5K9QG 1ULVA 2AGJL 3GSUA 1FFPA 1WISA 1IC5H 3KDMA 1HZHH 4Z7UF 4OD3H 2XACC 4QNPF 1WWBX 3FAXA 3NIGF 5C0AD 3SDAD 2Y9RT 4P9MH 3PQYD 2R0KL 4HJGA 3VWJD 2VTFA 4OT1L 4ZO9A 3OR7A 3DMMB 4LCIH 4X6CE 2EDLA 5DRNA 5D2NE 3UJJL 4PTTB 1TXKA 4HT1H 5E2WH 5FKPA 5SWSD 3GUTA 3H0TB 1F8TH 1XIWB 5DJAA 4JVPA 4YNYA 5C0CA 4ELMB 5F7KC 3EJZC 4WW1B 1C5DB 5I1HL 5TPWH 1IQWL 3B9KA 4ELKA 4Z7WA 1FP5A 3WHXA 5JXAH 1E4XI 5IJKC 1WIUA 2RIKA 2DI7A 3SE4C 3ULUF 3I02B 3P0YL 3MUY1 1YNKL 5EZJB 1T5XB 1MCIA 4D9RD 3O3DB 1CIDA 4PRHA 1MVFA 4YC2C 1INQB 1CE6A 1J18A 1IAIL 1UENA 4DUVA 5HHPA 4MCYA 4MQ7A 5D2LE 3MRJA 3KPOA 4POZD 4X6CB 1MCJA 4DVRL 5I71B 3B2VH 1AQDA 1WWAX 1ADQA 1PLGH 3PNWB 4LDLB 1X5AA 1LILA 4XP5H 2F74B 2AJUL 2VRAA 3EYUL 3W0WE 4BQCA 3VD4A 3GKWL 3ZKNC 3FONB 2PW2A 4JFFE 5E8EA 5AYQA 2K7QA 4M6NL 2QSVA 2VZTA 4HQQL 4N0YH 1JHTA 4P2OB 1T3FB 1ZHKA 5FGCE 4CNIB 3KYMA 1G1CA 5EBGA 2Q1EA 3H2WA 3O6KH 4O4YL 3TF7C 4XBGB 3ROLA 5IHLB 3GO1L 3SKJL 3FQXB 3OWEA 3PGCB 4Z7NF 2VXQL 3DTXB 3LQAH 3M17A 4ACPA 3IGAA 5D2LB 4U33A 1A4KA 2YA2A 4Q9CA 4M7KL 3DROB 1LNUB 4Y4HB 4TVPH 2LAGB 1F4YH 1W0YT 4GJTB 5C6TL 4JO2H 4P49A 4Y19E 3KLAA 1VCAA 4OFYD 4E41B 2F53A 4K3JL 3MREB 4GRLD 3RU8H 3B5HA 5FGCB 4G9DA 4H88H 5J1SC 4DEPC 1XF4A 5GRZA 4I0KA 2BJML 5EZIL 5E56A 3OJVC 1HKFA 3FL7A 3QJHB 4C56D 1A7OH 1Q1JL 2YZ8A 3HE7C 4OQ1A 1AO7B 1WBXB 1YMME 3RVUD 1CFVL 2L7UA 5IVOA 2HJFB 3NTCH 4F33B 5E7FA 2YPLA 1P4BL 2VSCA 2NQCA 3V5KA 5C0FB 4JJHA 4I48A 1OT1A 2BC4B 1FZOA 1FL6A 4HIJB 4G8FA 1MCWM 2VJXA 3EUUA 2XQBL 4R26L 1DUZA 1ZSDA 4Y19B 5CD5D 3PWNB 4ZSOB 4GAGL 1GGTA 1AD0B 4KGJA 1CGYA 4GKZB 1PG7X 3CMOL 4KMTH 1DSFL 4YAQB 3UYPA 5BW7C 4XRCB 1IL1B 5DJ8A 3D39D 4ZQKA 1QO3B 2G60L 1Q0YH 1ZWIB 2BNRE 2R2BA 5DK2A 1RHHA 4UT7H 1TJGL 1I8MA 5F3HB 4GG8B 3TGXA 3CVIH 1I7TA 5IEHA 4ODVH 5D71H 5ICYA 3BXNB 4P5MA 5I6XB 1HHKA 1WLHA 5C0CE 3BGMB 4R97C 3V0AC 2VQ1B 4OCWH 4Z7WE 4YR6B 5DXWA 3V4UL 3EO1A 3L7EB 4UZGA 3WKNA 1U36A 1NANH 2H32H 3W9DB 1C1EH 5MEQA 1T22A 4HGMA 4M43H 3PDOA 5H8DA 1MAJA 5I1CL 1CLOH 4Z8FH 4PJ5A 5JNYA 2FJGA 3H6JA 1S78C 2AGJH 3UTZB 3NABH 3MLPA 1EEYB 2VISB 4PRHE 3UAJC 3NFNB 3S9DB 1JPSL 2APTA 1A0QL 1XF2A 3ELAT 2BNRB 4PV9B 1LWRA 3RZWA 3EJYC 4OCNC 1S3KL 2YD5A 1K2DA 5CIPB 2VAJA 1EHXA 4NQEB 3GUTB 3KJ6L 4OT1H 4CVXB 5L6YH 3JV6B 3BPCA 2K1MA 3B9KB 3WKMH 1GSMA 2L4OA 4JPWL 2B2XL 4NZJA 4I3GA 3UROR 1YEGL 2D7OA 1NAML 1P4IL 5JO5B 5FOBB 1KFAL 3HE6A 4YWGL 4PRDA 4M9OA 3VXMA 4WI2A 4JQXC 4MDIB 3FAWA 2CD0A 4GLRI 4PRHB 4E5XA 3KLHC 4A6YB 4MGXA 3DYPA 3P0YH 5FK9A 1I1AA 2UWEB 3JWNC 3QUMA 5J12B 3T2OA 2YD9A 1YNKH 2PYFB 4WUUA 1WBZA 1AQDB 2EYRB 1IAIH 3QDHA 4WFFD 3B6SA 3L5HA 5GS2H 4LCYA 1W72A 3FRPA 1MFBL 4FTVD 4YHZL 5CKGA 1HWHB 5F8QC 4AQ1B 2EIDA 2F53E 1M6OB 2BSTB 2AJUH 3EYUH 5DS8B 2VABB 5HVHC 3QSKB 1JHTB 5IM7B 4NKOB 3PE9A 2PO6A 1ZLUK 4KY1L 1HILB 1NC4A 2VQTA 2G9HA 4D9QD 1I3VA 2QKIB 1EAPB 3EDKA 2UYLA 2AV1A 1D6VL 1ES0B 1R3HB 4O4YH 5IB4B 1JHKL 4FFZL 3GO1H 3MLVL 3SKJH 3HZVB 1SQ2N 2MTPA 2YPLE 2VXQH 2A6JA 5JDSA 4X7DC 3BD5A 2NR6C 4OCMC 4M7KH 5EZOL 3TZVB 5IB1A 3C8DA 1JPTH 1U8LB 4UOW1 5IVXF 1K4DA 5HGAA 4N0UB 3MUJA 1JIBA 1CD0A 4G9DB 1XH3A 4JZNB 5C6TH 1BZQK 3B9VA 3BMWA 3ARWA 4K3JH 1ZLUH 3E3QE 1HHIB 2C3HA 2NX5B 1P2CA 4KKBD 4WU5A 2BJMH 5EZIH 3WS3A 4IIQA 4M1CD 1G9MC 3SO3C 4C4KO 1XF5B 3FOMA 4EUPA 1G7HB 1RJYA 5HDQL 2YPLB 5GRWA 3PL6A 3FT2B 3PWPA 3K2MC 2KZWA 5MERB 1XGTB 3RIAF 1Q1JH 2HH0L 2VITB 2HLFC 3ZKQD 5DQJA 4Q7DA 1CFVH 3HMXL 1A14L 1P4BH 4LLYB 1H5BC 1TLKA 1Y18A 1WAAA 2AS5M 2Z93B 1S5IL 2OR7A 4PJ5E 4HAFA 4R26H 1Y6MR 3GSOA 4LAQL 2XQBH 1BGXL 3FO2A 1KACB 3D0VA 4ZFOB 1OLZA 4ZODA 1S9YB 4OLEA 1OPGL 3CMOH 3BP6A 3G9VA 5DK2B 4QLRA 4EI5A 1PEZA 1YJDC 4JFOB 1CXIA 1GYAA 5GS0L 3QP3A 1KSRA 1JGVL 4M6OL 4TNWF 1L6XA 4XHQA 1TJGH 1QBML 2AABL 3PABA 3D0LB 3N50A 2P43B 4F8TA 2XZAL 4ZPTA 3OJ2C 4G6AC 4JGUA 4BZ1L 3JSSA 4PUBL 1AY1L 4X7CC 1T22B 4Y8AA 3VFUB 1MJ7L 3UX9B 3V4UH 4PRPB 1VKXA 3VXME 1J11A 4X99B 4RFNB 5F9AC 5CGYC 3U46A 5CEXA 3W0WD 3HUJB 5I1CH 5I1JL 4K9EC 1IEAA 2WNGA 4FQXC 1YEFL 4WUUE 4JFFD 1GZPA 1BX2B 1JPSH 3C6LB 1A0QH 3KPNB 5FV1L 1EZVX 5C07A 4NKDA 1S3KH 4I2XA 4ODTL 4PYGA 3KJ6H 1A1OA 1H3VA 2D0HA 4JFEA 2YZ1A 1QP1A 1T04B 2YMXL 2FWOA 4OKVB 3QUXD 1GAFL 4TRPL 5FKAA 4APQA 2XWTB 4XBEL 2C3WA 3GSXB 4KRPD 4B41A 5IQ9A 1T21B 1B88A 3LRSA 5GS3A 4JPWH 2B2XH 1OB1A 3BZ4A 1OW0C 1NAMH 1P4IH 2EIBA 1I9RL 1KFAH 2DM4A 3Q48A 4YWGH 2GSIA 2Z8SA 1JYWA 3C8KB 3OAYK 1KIUA 2R8SL 3P4LA 4WUUB 3TEUA 4BELD 4JEGB 1TVBB 4U1IB 3MXVL 2A6IB 4LSVL 3V6ZB 5DD6A 3HRZB 4ZOAA 3B6SB 3RKDD 3LKSB 4U6VL 2JIXD 2VLRE 4M93B 5BRZB 2G5RA 4X83A 3QEQB 3GSNH 2V2TA 5F1IA 4PJAB 1MFBH 4FN0A 4YHZH 3MRFA 1YMMD 2Q7YB 5L2JB 2R2CA 1CT8B 4AT6B 3C09B 5D7JB 1IKFL 4UBDC 5JUEL 1CICD 1VHPA 3ARBC 3CFJB 2YUXA 3LS5L 3MBEB 2P7TB 5GXBB 4L8CA 2O5YL 5DC4B 2BVPA 2GSGA 4DGIL 4C83A 1Q0XH 2EYTA 5F88B 4CJ1A 4R6UA 4PS4H 3MRHA 3PWPE 5DUBB 2V2XA 3MLRL 1J05B 2X42A 1D6VH 4CBPA 4JREC 4FFZH 3MLVH 3VFSB 1L7IL 3VXTA 5K9KB 2VLRB 1WAAE 5DWUL 1VESA 4J8RB 4QXUL 4H26B 4OI9A 4IHOA 5EZOH 2YXFA 1U8PA 4GXVH 1IAKB 2AJXL 3C5JA 3ET9F 2HT2D 5C0CD 1WWWX 1BOGB 2YWYA 2D3VA 1MJJA 2W59A 2ORBL 1ZMYA 3RWHB 1OGTA 4HAGA 3QG7H 4BQ9A 1JVKA 5LG1A 3PL6B 2AXHA 2IH3A 4PP1D 3ULUL 3MODL 2ZSVB 2PXYC 2ESVD 2R69L 5HDQH 1K8IB 1FVCB 2FSEA 5EIQA 1JHLH 1RVFL 4PG2A 1X7QA 1Y18B 5DJ2A 5I30L 4N0CD 1AR1C 2HH0H 3MV9A 4JDZB 3KPMA 4UNVA 3HMXH 1A14H 3D0VB 1UWGH 3EFDL 3FO2B 1BM3L 1T2QL 4HPYL 3CX5K 3IXTA 4WHTA 2DYPA 2A73B 4LAQH 5E03A 4K7FB 3DVIA 1UCTA 1BGXH 3QIUA 4H0IA 5BV7L 3EYOA 4DW2H 1JZ7A 5JDJA 3QO0B 1OPGH 4LLWA 1WICA 4Y2DA 5ACLA 3WV0A 3CVHA 3ZTNL 4XVSL 3CD4A 2Y06L 4I2XE 1JGVH 1ND0B 3PABB 4M6OH 4Q6IA 1QBLL 3CFKA 1PQZA 1Q38A 4JFEE 1N8ZA 1QBMH 3FB6A 4M5ZL 4FXKB 2AABH 4X6DA 4XT1C 2Z92B 5GGQL 3V7MA 3G6JB 4BZ1H 2DBJA 3DRTB 4PUBH 1AY1H 4I0PC 1MJ7H 1TIUA 2A6DB 1R5IA 2F5BL 1VGEL 4KKCC 4ALAL 5ICXA 2G2RA 4PJ8B 2F53D 1FNAA 2H9GB 4X6EB 3PDDA 5FO8B 3NA9L 5I1JH 3QG6A 3WL9B 2BVQA 2W1NA 5GIRB 1JPST 1YEFH 4MD5B 1P4LA 4NKDB 3LB6C 5EC2B 1T1XB 5JHDB 1MHHB 5HHNB 2FWOB 4CU6A 5DK0A 4APQB 5DJZA 3R06A 3SN6N 4ODTH 2Z35A 3HB3D 4ZUVB 4NUGL 5DEZA 3U1SL 2YMXH 2BSRA 2WBKA 1GAFH 5AWNL 2JCCF 4XBEH 3ETBF 2BHUA 5ILTL 1RK1A 4OUUA 1N0XL 3BH9A 2C1OB 3TH3T 4YBHA 3UBXG 3X14A 1CGVA 3BZDA 5HYJA 3QWOB 1I9RH 5IR1B 1J8HB 2R8SH 3WJLC 4PJ9A 1BD2B 1XCQA 3MXVH 1IZKA 1JGEB 2GFBA 2GCYB 5FDYA 5GGRY 3UJIL 5B8CB 4CN1A 5E08H 5JPMA 2P5WA 5I74B 2AV7B 4U6VH 3QHZL 4KHXL 4EDWH 1WGOA 1QYGH 1F2XK 4PJEA 1G0DA 1MFCL 1SJHB 5D1QA 1AKJB 4RMUA 5EG6C 2IAMB 2ZUYA 1T1WA 2V9QA 3I3DA 1YC7A 2BVPB 2HN7A 3INUL 1IKFH 1FYTD 4RIRB 3L3GA 2C4FT 4LAJH 1HHGB 4PJ5D 1HYSC 3LS5H 4PGCA 1OAQL 5K59F 2O5YH 4U1HA 1YEJL 4DGIH 1TZIB 3VXOB 3QIWA 3SBWC 3MLRH 3MV9E 3MRMA 4WO4B 4WV1C 1SYVA 3VH8A 1UKSA 3BSZL 3OXRA 4OTXL 1L7IH 2FO4A 4RBPK 5FGBA 4QXUH 4LPYA 4Y5VC 4KI1A 1OTSC 3UJTL 2QHLA 4NOBA 2ED7A 2AJXH 2H2PD 1ZAGA 4M9PA 3SCMB 1DDHA 5FB8A 1JGUL 1EHAA 2ED8A 1HXMB 3MA9H 4U0RC 3HG1A 3RPIA 1DN0A 3FB7A 4QHMB 3HTLX 3HE6D 3WLWC 2ORBH 5EBWB 3DI2B 3VXMD 1YNTB 3LIZL 4JFQA 2HA1A 4IOFC 5FYLE 5BVJA 5DJ2B 1I1AD 3BISA 3FHQA 3MODH 1F3JB 4X6DE 3T1FA 1HYRC 3LQMA 3FT4A 1AGFB 6CGTA 4KI5F 1IGJA 2R15A 1RVFH 5I30H 1X4YA 2XA8L 4M6ML 1D6EA 1EGJL 1QSFB 4QT5A 3BDYL 3RAJL 4RBPH 2KBGA 2PCPA 5B39A 2AEPL 3KPRE 1T2QH 3KPPA 4HPYH 3VD5A 1QFPA 3BPOB 4DKDC 5FF6B 1WSST 4HLZG 3CVHB 1CXEA 2XNAA 1S8DB 2PO6D 5BV7H 1H3GA 2YEZA 1NC4D 3CFKB 1ACYH 4QXGL 5DLML 3KXFA 1PQZB 3ZTNH 4XVSH 3FB6B 2X4QA 2NY2D 1C16B 2Y06H 1NC2A 5J9PB 4P23B 3S5LA 3IETA 4J23A 3VFRB 4U6XA 4YHPA 4M5ZH 4HWUA 4F7MA 1RZIA 3MRLB 4LSQL 1E0OB 2P24A 2OJEA 5GGQH 1JWUA 3X17A 5HGBB 1IEBB 5CEZD 1R5VA 5ICZA 2Y7QA 3KPRB 3QI9A 5HYJE 1QLFA 4OAWB 3TN0B 1KTLA 1B0GB 1LK3L 2F5BH 1VGEH 5HHVL 1XAUA 3P0GB 1R3LA 3Q3GA 1MHEB 4NBYB 3NA9H 2H26A 5AAWA 2FJHA 2V5TA 4UNTA 1HHJB 1U8KA 2X4NA 1T83A 2WBJC 5F3BB 2P5WE 2Z35B 4P0DA 2X4TB 4PJEE 3PWPD 2X4PB 4MMZC 3RVXC 3CU7A 5CBAB 2OR9L 2FO1A 4PJHF 2WQRA 1D9KA 4W6YB 4XCFL 5EFIA 4OUUB 1CF8L 3U1SH 1PYWB 2IBZX 4U1SA 5AWNH 3U2SB 4WFEE 5ILTH 1EH9A 3U7WL 3SDXA 3OBAA 2YS4A 3GMOB 1BREA 3QZWA 5AZ2L 4LSRL 5BZDA 2L7JA 2EE9A 1XCQB 5D72L 4F7EA 2GJ6A 3AREA 4KJYA 3OKEA 1F4XH 4EI5D 4POYA 1SVZA 1QD0A 3U36B 3WFDL 1J0ZA 4KTEL 4HBQA 4B7LA 4OV5A 2GW5A 1A6AA 1N4XL 1RZKH 3N06B 3UJIH 4PJEB 1N5YL 1A2YB 4Z6AT 1XT5A 2V9RA 4NPYB 1PW3A 4ZFZB 3GJFK 2DJSA 3VXQB 2DM2A 3HG1E 3BZEB 1MFCH 2EC8A 3KYNB 4JFPA 2BXZA 4IRSC 4K07A 4P46A 4P4RB 5E7BA 3MJ7B 4PY7B 3G5VA 3MO1B 3IJHA 5GSRB 4O51B 1GC1H 2CXKA 4LRNL 3BH8A 3S3PA 3ARDA 1TETL 3INUH 2O26U 1F3RB 3WMSA 5DJDB 1ZGLB 3RJQB 1U6AH 1YEJH 1HI6A 2J6EA 3HLAB 2CH8A 5JA8B 5E4EC 3EYFB 3L9RB 4EEEA 5C07D 5F7MC 3BSZH 4OTXH 3RWFA 5J13C 4R7NB 1YYML 4JFED 4OZFA 1YN6A 5F1KC 3GJFH 2YD2A 1DN0B 4APQD 1WWCA 5GQBA 1YY8A 2A74B 4P9HC 3NCFB 1WT5C 3UJTH 3BJLA 3O2VH 4YHOL 3RIFF 3KXFE 4JQVA 3EW3B 5HHOB 5F1OB 3LIZH 3WE6B 5SWQB 5INCB 1BVLB 3FT4B 5F89A 3VGDA 1OTUD 2RBLA 2OSLA 2CR6A 1MCWW 4NT6B 2OMNA 5DURB 4Z7VF 3OKLB 4M6MH 3VWKC 1EGJH 3BDYH 3IB4A 3RAJH 3RWEB 2IF7A 2OYPA 4MD0B 2VWEC 1N2RA 4ELMF 2AEPH 2YEZB 5I16B 4GAYA 5DEFA 3R1GH 3CLEL 3QISA 4ZUSB 4U1MA 3IRPX 4ZAKB 3T08A 5JOEA 2ZZUT 2ZJSL 1LE9A 4P2RA 1U8QB 1KPVA 3FQRA 3I75A 1NC2B 5FYJL 5DLMH 3IETB 4QXGH 5IQ7L 1NCCL 3DLQR 3W2DL 1HNFA 2EIZA 4H1LB 3EAKA 1BZ9B 3IU3A 4XMPL 1UB6A 2LVCA 3LRGA 1V5JA 5IG7A 4U1KB 3PJSB 1CD1A 2WAHA 3UPRA 3F7VA 3DO7B 1WUNT 1UM6L 2ADJA 4LSQH 3JTSA 3SDXE 1J1XH 3WLBA 5F7DA 4Y8DC 5MEOB 1EPFA 4JGJA 3UPCA 4BK4A 4UDTB 5BMFH 2GJ6E 1LK3H 5HHVH 3WN5C 3IFOB 3VFTA 5C0IA 4CU7A 4GXUN 3TVMC 5DHVH 3VFNB 3RWIB 4J4PC 5C1MB 2EC9T 5HPMB 1K5NA 4UT9L 5I1AA 3TA3B 1UJ3A 2VAAA 2NTFB 5FM4A 4RAVA 3FN3A 2VDLL 4JANA 4AG4L 4WU7A 1OAKH 2OR9H 5I8CB 2JJTC 2X41A 3S37X 5GGVL 2GUOA 2GKIA 2N56A 2EXWC 2FJFA 3MV9D 4XCFH 1YEKL 2VLJE 1UG9A 2NXZB 3O4LE 1L4IA 1CF8H 1D7FA 1ITCA 6FABL 5ADPL 1QVOA 3T65A 4X9GA 5EO1B 3MRGA 5BJTA 1RJLA 2DYPD 3U7WH 3EO9H 5FGSA 5AZ2H 3QIUD 4LSRH 4I5BB 3RWJA 4HX1A 5D72H 3MRCA 1TNMA 1VACB 1EVUA 4OV5B 3MA7A 4Y2DD 1EHNA 5KS9A 1I85A 1DQJB 1KJVB 4OD1L 3WFDH 4JJ5B 1CI5A 2XTJE 4NYLA 4RRPG 1T1ZA 3FRUB 3QFDA 5HJ3B 5E8OA 1G7MA 5FYLD 5JPNA 3RP1A 4MMXC 1N5YH 4HWZB 4R96B 3U9PL 2Q86B 2VLJB 3O4LB 1A1MB 4RX4D 5EOQL 4U6YA 3P0VL 1FFNB 3SDCA 1MCNA 4Y4KB 5J11C 1J0KA 4M62L 1JK8B 1OSZA 4R4NC 2R1XB 4XBPB 5D5MA 3ROOB 2BNUA 2W60A 1HI6B 2VLME 3SPVA 3ULVF 4GG6F 4JAMA 4LRNH 1TETH 5F9WB 4ZNEE 1A6ZB 4XVTL 1KB5B 5LAXA 4OLZL 2NY0C 4LHUB 1FPTL 4FQHA 3KWWA 3ILQD 2KPNA 1T89A 2OI9C 5ID1B 4GKOA 1JPGA 1YN6B 1A6TB 4WENB 3CU1A 1YY8B 1LDPL 2DI9A 1C08A 2C4FU 2VN4A 4UAOB 5BCAA 4YPGB 1RZ7L 5F71A 3EO0A 4LBEA 4KU1A 3LS4L 4S1QL 5BS0A 1I8LC 3ARFA 4P2RE 4GKNA 4MA7L 3ARSA 1JMXA 4X98A 4YHOH 1I4FB 3RVWC 3NIDE 5F97E 2XYCA 4YPJA 4Z7QE 4U4BA 3VXSB 5HYJD 4LDOB 5J7CC 2DLTA 3DUUB 3RZCC 5D7SL 1FO0B 4PJ9D 3QUYC 4K8RL 2VYRE 2DM7A 4K7PY 5C8JB 3D69B 1WTGT 2P5WD 4ZUTB 1QFWM 3P4NA 3MGTA 3MJ9H 1JZ6A 5T1LA 2H32A 1QR4A 5IOPA 1SEQH 3QUZA 5IMLB 5D1QD 3D18B 3UAJD 1QA9B 1IARB 3H7BA 1O7VA 1I9JH 1LE9B 2W38A 4P2RB 3FQRB 1VEPA 3G6AB 3CLEH 4KKLD 4MNQA 4Y4FA 5I1LA 4LK4A 4WFED 2ZJSH 4MXVF 1CDBA 5FYJH 5HI3C 4O9HL 1J9CT 2UWEF 4MJ5B 3IU3B 4NO0B 3FMGL 4UTBL 3PDGA 3QIWD 5IQ7H 1NCCH 5J0BA 3W2DH 1IRAY 3O8XA 4NSKA 4BH8A 3ULVC 2FIKA 4HUXB 4NP4L 4YHIB 4GXUM 3MGAA 4S1RL 3V6OC 3DURA 3QEUA 2ZCHL 3DX7B 4HS3A 4HKXA 4XMPH 2FH8A 5ECJE 1SYSA 1YDPA 5GGRA 1UM6H 4LHQB 1C5BL 2B4CH 5M95B 4K71C 4WDIA 4OI7A 4RGNB 5BOZG 3HG1D 4J1UA 4UDUB 4XH2B 3RI5F 4GOSA 2NY3C 5CP7B 3BI9X 5F7EL 2C1PB 1MELA 3GBNL 2DICA 3X13A 2V5MA 3VXUA 3GMQA 4PGBA 5DTFB 5M94B 4TVPE 4YX2L 1M05A 4HH9B 2XPGA 3LEXA 3N9GL 2VDLH 3VRIA 5KANI 1B0WA 4OZHF 3T65B 4LLDB 4XCYA 5GGVH 1ZS8B 1I7ZB 1TPXC 1XGUA 1YEKH 3AB0C 3AM8A 5BXFB 5D5ME 1HK6A 5ADPH 4KKAD 2QJDA 4L8SC 1EO8L 5L8KB 3L1OL 1T0NA 4LPTA 5C9JA 1MWAL 4MD4A 4KZEL 4QTHA 2AJSL 2X7LA 1DZBA 1G7IB 2WW8A 1BQUA 3QIBC 1IGCL 5DJYA 2BOCB 1MI5E 3KXFD 1WFTA 5DD5L 3IXAB 1HDMB 4ZYKB 5A3IC 4OD1H 2DLFL 1Q9OA 1HKLL 1RU9H 5HVWA 4FOMA 4PGJA 1MCLA 3A67L 2DD8L 5HYSA 3IDIA 3U30C 4PR5B 1RUKL 3WUWG 4JM2A 4NM8H 4TOYL 2VR5A 4FQQA 1P84K 5SX4H 3U9PH 2XG4A 3EHBD 1X6LA 5IF0A 4UI2A 3LQZA 2W60B 5EZLB 3P0VH 4YGVB 3QI9D 5J8OA 1M7IB 3QDME 3QUKB 4M62H 4QRSA 5D6CA 5EU5A 5AAMA 43C9A 4OQTL 1G6RL 3DIFB 1T0MB 4RFOL 3O45B 3UTPE 1PZ5B 4OZIB 3QNXA 4PP2B 2HVJA 1T2XA 1MI5B 1OGAA 1ORQB 4XVTH 4OLZH 1KCSH 1VFBA 4O2EB 4Y5YA 5DMYA 1FPTH 3HNVH 4F9LC 5IHBA 3EZ8A 4GW5B 4U1LA 1QG3A 5T1KA 3LCYA 3H9SA 3R4DA 3IDNB 1LO3L 4JB9L 4X7TA 4U3XA 4JPVL 2NXYB 2KL6A 5JR1L 3WD5L 1UC6A 1D9KD 1LDPH 3V4VL 3ARFB 2W92A 4X4XB 1GL4B 3IJSB 4FQ1L 2CIKA 4J7RA 1IM3B 1RZ7H 1UM5L 1VEOA 3TNMA 3LS4H 4S1QH 4YXHL 3QDMB 3QDGB 3Q6GL 3I9GL 1BJ8A 4LCUB 5CLWA 3MGOA 5KOMC 4MA7H 4ZS7L 4MA3A 1E4XL 3U9UB 3QXDB 4HF5L 4YK4C 2GJ6D 3ARED 3C87A 4QGTA 2DQJL 5D7SH 4ZTPL 1IT9L 1RPQA 4KROC 4K8RH 4H5SA 2AJ3B 3EYQC 4G8EB 5T1LB 3RRQA 3U83A 3GDBA 3RVTC 5LGJA 2R0LL 1JGDB 1OTTD 3QUZB 1BECA 5EOTA 2ITCB 4HKJB 4BA8A 3ES6A 4L9LA 2DTSA 1Z0MA 4WWID 4ODBD 3RDTA 1ETZA 1U8HB 4P46D 1CDYA 2YBRA 2UUDK 1LK2B 1WC7B 3ZDZF 3VXUE 4NQCA 4AMKL 3MZTA 3GNMH 3ARDD 3MOBL 1GOHA 3QDJB 5F1NA 1GC1C 4C57C 4CKVX 3VFWA 3FQNA 3OF6A 3T4AB 4ESKA 2B8OT 4J2XA 4O9HH 5KZCD 4J3OC 3FMGH 5GJSL 4UTBH 4G5ZH 4F7CB 5HHQB 2YRPA 2X89A 4NP4H 5TF0A 4S1RH 3VFOA 5C0DA 2ZCHH 1CFTA 4S2SB 1MQKL 3W9EB 2XTJD 5E70A 4K3DH 1XF3B 2BVEA 4G43A 3ZT7A 5DHXB 4HJ0C 1HHHA 2VOTA 1UQSA 1NAMA 1C5BH 4FFWD 3MXWL 5GGUA 5ERWB 3U0PB 3Q6FB 3QULA 3BKCL 2UUDH 3G5ZA 2ZNXA 2ITDA 5IROA 4Y5XA 1S7RB 4KTDH 4C54A 4PJCB 1MCPL 2I5YH 4LLMA 2VLMD 3HPLB 3RL1B 4JVWA 3DWTA 2AW2A 3DI3B 4BZ2H 2N1KA 5BVPL 2HFFA 3LD8B 2NLJB 1XGUB 3M1BB 5KBNC 2VLKB 3IU4L 3ZE2F 3O3BB 3N9GH 1UZ6F 1ED3B 2APFA 2FGZA 1N59A 3X11A 3QWRA 4CADA 5IBLD 1OWRM 1YYLH 1Z9SA 1N6QL 3TCLA 2IPUK 3HZYB 3N1MC 4P3CL 5ELIA 2M2DA 4XXDA 3B5GA 4NJAH 4HK3N 3L3JB 3F12B 2Y25A 1EO8H 1A9BA 4LPWA 1OGAE 3OAZK 1AXTL 1MWAH 1CVSC 4KZEH 1RQ5A 1TQBC 3OQ3B 5AUMA 1IGCH 4JFDA 5GGTL 3H9SE 3G9AB 3OJMB 4P3WA 5DD5H 4MQTB 3G04A 3PWUB 4ZFFB 2P4AB 3KPSA 2DLFH 4HKBA 4BJLA 1NFDF 4MAYA 5F6HJ 1MLBB 1FV1B 4NDMA 1RUKH 5GJTL 3UTOA 2F19L 2QHRL 4TOYH 5D6DA 1ZHLA 5ALBH 4D8PB 5D6CB 4R0LC 3N1QC 3QXVA 2YN5A 4HJJL 1R5WA 1RY7B 4G8IB 1B2WH 5FUZL 5D93B 2N7BA 1JTPA 4X6BB 5ISZB 3OAZH 4OQTH 1G6RH 4QHNA 1BWMA 5KSAB 3BN9C 2BX5A 1UKTA 3ZDXF 3ILPB 2PTTA 3GMPA 2HTKD 4X7TB 3RUGB 3N1PC 2XFXB 4DAGL 3T3PF 1NCUA 2L0DA 3HMXA 5D7IA 1T66D 4MJIA 1LO3H 3QEHA 4JB9H 3O6ML 2CIKB 4JPVH 4U2YA 5JR1H 3WD5H 1I7RA 5KVFL 3V4VH 2BCKB 1JWMA 3BO8B 2D31B 1EEZA 2FYYA 3RWDB 4NQCE 3DX9A 5JQ6L 4MA3B 4G80B 3ZT6A 3D2UB 1LE5A 1UM5H 1MCBA 1RZJL 2BFVL 2DQFA 1FJ1A 3VDAA 1I8IA 4YXHH 3Q6GH 1TQCB 3I9GH 1UZ8B 4R90L 1AGBB 2G5BA 3DV4B 4ZS7H 5TH2A 2ZKHH 3MRNA 1E4XH 3PIQB 1M4KA 4HF5H 2CKNA 2DQJH 4POUB 4ZTPH 1IT9H 3ALWA 4QOKA 3IS0X 2CUMA 3K8LA 4LLQB 5I75B 3O11A 5DT1L 3MFFB 1RUQL 4KK9C 3IDJA 1FVEA 4TVPD 3U4AA 3P77A 4GBXC 4U0QB 1YN7A 2VZUA 5FO9B 1VFAB 3CDGA 1ZT1A 5E6YA 4AQOA 2XN9A 2VDOL 3AU1A 1D5XB 5FFLA 1FQ9C 3O3EA 3SDCD 3RNKA 2NY7L 5F96L 1F45A 1GZQB 1HSAA 4HWBL 5HI5C 2A83A 1QHOA 4AMKH 5I0ZA 2EDTA 4RWHA 2VSDA 5IW1A 3TP4A 1L0QA 1P1ZB 2GITB 1G7QA 5GJSH 3W81A 1HHHB 3O41A 1HQ4B 1MVUB 1MQKH 1T20A 5DRZB 5GGUB 3CPLA 4KQ3L 3NFPA 3TIEA 2YD3A 4Y16B 3MV01 2J8UF 5BS0D 1G9NC 3ARFD 1A9EB 4OZGA 3BKCH 1E6OL 5CD3B 2P8LA 4FQCL 4RGMC 5CMAB 1IAOA 3KPSE 1P7QB 3T77A 4DGYL 4WHCA 4L4VA 1MCPH 4HKZB 3NCJL 2Y5TB 5AD0B 4ZUUB 3UTPD 3X11B 2E9BA 2OXGA 3A0OA 2DQTL 1BQHA 5BVPH 1H3XA 3BP5A 2DLHA 1DLHA 1SY6L 3IU4H 3H7LA 2NY1C 4K94L 5L88L 4YQXH 4ZO6A 3FOLA 1N6QH 4M5YH 3WEXA 2F54A 4P3CH 3IJYA 1M7DB 4B50A 1BJ1H 5H94A 5J6HA 3LSOA 3QA3A 4KDTC 4MNQD 4Y4FD 4OZ4B 1AXTH 5GGVY 4BSWB 4DCQB 1FNGA 2IANA 2CRIA 4DUXA 3D85B 5D7IE 5GGTH 4MJIE 2BMKB 3MRRB 4A6YL 3MV8A 4Z76A 3O8XD 4X0KA 4JN2B 1S9WA 5D70H 3DJ9A 4HV8A 2OTUB 1V3MA 3FN9A 1U3HC 3WNOA 2IQAB 2F19H 3L3KA 4AEHL 2QHRH 5TGBA 2QL1A 1OP5K 2DRUA 4PJ7B 1XR9B 3KR3L 4YIQA 3GBLA 2V17L 4PJGA 3VG9C 2EDWA 1BFTA 4JRWA 4RZCB 4HJJH 4OD2A 1WBYB 3GSRA 5LQBL 4CDHA 4PGDA 4NRXB 5EBLB 4XAWH 4HS8L 2HT3D 2VXUL 3VXUD 4S0SD 3DNKA 1QZ1A 1JUFA 1NJ9A 2DQIL 5IMMB 4HGWB 4DAGH 2BP3A 4GKSA 5GS2D 4AZ8A 4MAUL 5IB3B 2IPKA 4LVNC 5C2UB 1CK0H 4JO1L 4MA1B 4X6FB 2V5YA 2MKWA 2CSPA 4NO2B 4YH6A 5MI0B 3OGCA 1LE5B 5D9SB 5KVFH 5KVEL 1OP5H 4ZOCA 4MNGA 3UBXA 3U7YL 1R3IH 5JQ6H 5KSVA 1W0VA 1RZJH 2BFVH 4WWKA 4DVBB 4G7YL 4QHLA 1QSEA 1TZGL 1JV5B 4R90H 3JWDC 1U3YA 1F4WL 1G7JB 4PJXA 2CDEB 4R3SA 2HJLA 2UZYB 2Z31A 4GLRH 4PJDB 3IDJB 4KUCD 1FVEB 2R0WL 1AI1H 3TBYA 3BQUC 2KKQA 4C55A 4UOW0 1F6AA 5DT1H 3K81A 1RUQH 3H9HB 5TDPA 4XXCC 4JM2D 3SY0A 1FL3A 5GS1C 4ODWA 5T1DL 2NY6C 1S5HA 4QO1A 2ZUSA 4OZGE 1KCUL 2VDOH 4LNVA 4X5WA 3OKKB 2A83B 4TNVK 4HFWA 5DJ6B 5F96H 5CSZA 4GS7C 4HWBH 3GSVB 4L4VE 4ZFOL 5KSBE 2X4UB 5E6IC 1KELL 2H6PA 5SX5K 4MDJB 2V5RA 3VGAC 3ULSB 2NW3B 5HVFB 5C0ND 1OGAD 3KPQB 4WFHE 4MLSA 1G7PA 4F2MA 3W39A 2ZG3A 2A9ML