4M7JH

Crystal structure of s25-26 in complex with kdo(2.8)kdo(2.4)kdo trisaccharide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords S25-26 Fab (IgG1k) heavy chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7jH01
1JGUL 3RNKA 4W70A 1T7XA 1JWUB 5FGRA 3RDTD 5GSVA 1GHFL 3UYPA 3P11L 3D39E 4LAQL 1K8DA 3UAJD 3WHXB 1YNLL 4R4BB 2ZSVA 2HT4C 5DUMH 4ZNCD 3JSSA 4FQQA 3WNPA 3UTOA 2CUIA 1N3NB 3RRQA 3SGJA 4NQTA 2HH0L 3WO3B 1G7JA 1XF1A 1NAKH 3CH8A 3LPGA 4GKNB 3V6FA 3BWUC 1U93A 3TIDB 4P4KB 2WIMA 1PG7W 4HWBA 3ILQD 4UTBL 1KIQB 4JAMB 1C5CL 1ERNA 4R4FH 5IW1B 5T1KB 4JM2B 5GZOC 4QT5A 1AXSB 4HIXL 4PP1D 4Z6AT 3GJEA 4NCC1 3A6BH 4GAGL 3UZVB 1HXYA 2DLFH 4OLXH 4YPJA 1EDQA 1YEEH 1AP2B 4XP9L 5CEZL 3DXAD 3FOLB 5FO7A 4G9DA 3LV3A 4H8WH 4LSRL 5I71C 2BNUB 1HZHH 1KULA 3W9DB 2DQTH 1GGIL 2EO9A 3O6LH 3S9DB 3P4NA 3RWCA 5DZOA 2VLKD 3TT3H 2DWDA 4WEBL 4WU5B 3ARDC 1Z0MA 4L3CB 2B5IB 4JO4L 5IHBA 4DVBA 3QUZA 3MPCA 2H26A 2GJZA 2NQCA 4NFBA 4YDVB 35C8H 4QCIA 1RK0B 1EO8L 4P3CH 1UWXK 1SVCP 1NDGB 4Z95H 2BNRE 3RTQB 1MCOH 3GUTA 3SN6N 1JNHA 1GOGA 3PXJA 5LGHH 3ULSB 3DRTB 4NC1C 5EU3A 3V6OC 1M7DB 1W72H 4QHNB 5EOTA 4XBPA 1RZFH 2MTPA 3JXAA 1D5BA 1DQDH 1KIPB 1PKQE 3V6ZA 2HJKA 3K0WA 1RHHA 4PLKD 1VEPA 3UC0L 4F57L 1OSZB 4P3DB 3WNKA 2HP4A 2CD0A 3BIKA 3HS0B 5MHSE 1U58B 3PWLA 1OAZL 2DLIA 4RZCA 1Q0YH 1ZA3A 1N6UA 3DHMA 3VMPA 2IAMC 1EUUA 3IDYB 4L5FL 4WI4A 3HR5A 2DMKA 3B9KB 2VXUL 1RUKL 4HWBL 1S7SB 1QFUH 1IZKA 3CMOL 15C8L 4QRPD 4CKVX 4N9OB 2I60H 2CLRA 5KSAA 2J12B 4U7SA 5D1ZA 3HAEH 2DQGH 3PL6D 2O26U 4KI5F 3KPMB 2CLZB 4TSCL 2HVKA 3BO8B 3KWWB 1CIUA 4CMMB 2J6EL 3K3QA 3SJVD 2IEPA 2P7TB 2GIYA 2VLJB 1F6LL 5DJ6A 5IR1A 4GSDH 4P2YA 1IGYB 2B0SH 5HHPB 4L8SB 4QXWA 5A2LH 1XZ0B 1RIVH 3PF2A 2X10A 4OCNC 1UB5B 4OV5B 1IFHL 5DZNA 1G9NC 1OTUD 3BUYA 4HUWA 5H37H 1EAJA 4MAYA 3SQOL 3TN0C 3MLRL 4KPHH 4NFDA 5K9JL 3WKML 1RV6X 5GSRA 1Q9WA 1U6AL 4CN6A 4FQIL 3BI9X 1UWEL 2PN5A 3U7WL 3MMEA 4K8RD 1QPXA 4R96B 3G5XB 1MHEB 2ORBL 4YHLL 3F8UB 4P5TC 3VXUD 1LDPH 1P7HL 4JVPA 2UY7A 4YUEL 5TQ0H 4MX7B 3BZDA 4TNWK 3UBXA 4LSDA 5H94A 1T0NB 3GM0A 4WHYG 5DUPH 2XN9B 4MJ5B 5EZOH 5E7FA 3MXWH 3JVGA 4WNQB 3V5KA 5CD3A 4LCYA 3BN9C 3NACL 4O2CA 4I77H 4LGRB 3CU7A 1IKNA 2FJGB 3PIQB 3SDAB 4PRHB 5ILTH 3IKCB 4BA8A 3BD3A 2QKIA 4DN4L 5I1GL 2FB4H 2J2ZA 1GGCL 1CICA 4G6ML 5L7XH 4HG4K 4M43L 3TZVC 1IGCH 1LO5A 3SKJL 1U3JA 4WTXA 3EOTH 2PO6C 3RVVC 1MH5A 5DMKB 4JFDB 4GRWE 2DI9A 4FS0A 4KK6D 1KXTB 1WAAF 3UJIL 3U4BL 3DARA 5IK3A 1XEDA 4Y5VC 4RMWA 1AR1C 5DVLA 1CFQA 2EDHA 1UXWB 1U8PB 1ZA6A 4KDVA 5DFVD 1FNFA 4A6YA 5SX4I 2OTWA 5IFJA 4UT9L 1P1ZA 5IB2B 3DO3A 1JHLL 5JW5B 5DGQA 4GBXD 3R4DA 3CLFH 4XMKL 5I1HH 1WBYB 3QCVH 3QUYD 3VXRE 5DRWB 1FYTB 4NRXA 1MF2L 4U6TA 5JA8B 3S37X 1FP5A 4ZUWB 5E94A 1KLUA 5JXED 2I07B 2OTPA 1C1EL 5CIPB 4QRSB 1QVOA 2YK1H 4EDWH 3NCYP 2R0WH 1RUQH 2C26A 5B8CA 4JR9H 2H6PB 2EC8A 5ALBL 4D0BB 4ZPVB 2AK4A 4YK4B 3SY0A 3UEZA 1BGXL 2JJTA 3B6SA 4MQXC 2H8PB 5E4EB 5HHVH 1ZE3C 1VPOL 3NA4A 4JANA 4QRRD 5DRNB 2R56H 4S10A 5JQHC 1HHJA 1IAKB 1IKFL 2H32B 3LN9A 1W0WB 4MZ2A 1EEYB 2JJUA 5IHZA 3ARED 4PJ7E 3RL1A 2ADFH 4HXAH 1Q9LB 1JTPA 3CSBA 3O11A 3MO1A 3UYRL 2DJ4A 2BOBB 3LKPA 3T2OA 1OARL 2GQHA 3UPAA 3S88H 1R3HA 3MV8A 3UTPD 3N85H 1VHPA 3DV4B 1FV1B 1B9ZA 2W0PA 5KSBE 3F58L 2Q8AH 4XBEL 1ZAGA 1U8OB 1FVDB 2UZIL 5CEYB 3RVWD 4Z7NE 5F7UA 3WXVH 2JELH 2LV4A 4LKCA 2W38A 2UZYB 4DK6A 4JRYD 4X6DA 1NMAH 2MMXA 5EG6C 4P2OB 2V2XB 2Y5TA 1ZHKB 5JHDE 2VH5H 2I9TA 5MENA 1UWXH 2ITDB 1X4ZA 3IFLL 2HLAB 1E27B 3ROLB 4O4YH 3TFKC 5EU6E 3X13A 1JGDB 1Q9OA 3O0RL 1EGJH 5DLMH 1TENA 2YMXH 2CJUH 3H8NA 3I3BA 2AEQH 4ZFFB 4WWKD 1S9YB 4WJ5A 2UWEA 4PJEA 1BFVH 2F8VA 1NFDA 3QPQC 2DKUA 4J12A 2BVQA 5IEHA 1A14L 4LIQH 3C6LC 4KC3B 4RMQA 3MRBA 4LBEB 3HPLA 1RZ8A 4MNGB 2V17L 1I4FB 4EI5C 1D6EB 1SYVB 2DICA 3QIUC 1K5NA 4YDKH 3TNNA 1MHPL 5FM4A 4DAGL 1WEJL 4XHJD 4XXCC 3VGAC 4NNXB 2RHEA 2FEDC 3F7YB 5D7JC 3IXTA 5LGJA 1S78D 1DLHA 4K7PY 2MJWA 3FN9A 2Z8RA 1YEIH 4DZBB 3FFCE 4PRPE 5GQBA 3OJDB 4XC3L 4F7TB 4K23H 1AFVH 1JWSB 2AEWA 4K3EH 5FA3A 3G5ZA 1Z2KA 4XB8A 5HYEA 1IC1A 1OL0A 3B3IA 3LKRA 3CFBA 1ZGLA 2AXHA 5T1MA 3PQYB 4MXWH 3PHOA 4LAJH 3IFOB 3BGMA 4KKLC 3RWHA 4RQQA 5D7KE 3GSXB 3K8KA 4QXGH 2IG2H 3S5LA 3W0WD 4PB9L 3MYZA 2AQ2A 4GKOA 4EBQL 1A4KB 3IDXL 4X7DC 3ULVL 1H5BC 2DQJL 3CAFA 3S36H 3O41B 3PL6B 2JF1A 4ERSH 1WFOA 2FRGP 3STBA 3SDCB 4PJ5B 5INCB 1YNTA 3EYVB 4LLDA 1NC4A 4J3UA 2GCYA 3EFFA 4Y4HD 5HHOD 3S3JA 1ZK9A 3QDJA 4ESKA 3ZL4H 5I2IA 4JPKL 2ZUYA 3HNVL 5DSCB 4NM4L 1RZKC 3C9NB 2K7QA 4TUJB 4PJFB 5F3HA 5MP6H 1QBBA 3TO4D 3L5WB 1G9NH 2FO4B 2G5BB 4F3FB 2W9DL 2J8UB 4KKCC 3WS6C 1OAQH 3X14B 2I5YH 1B0GA 3S7GA 3L3GB 2Y7QB 1NGWB 4G9FB 4HS8H 5LGKA 4NZRH 1CGXA 3AB0C 1S7RA 5I1JH 4J6RL 3CX2A 3O6ML 1LVEA 4LNVA 1YYMH 3CSYA 3FO1A 2GITB 4KTDH 1I1RA 2HRPL 4HK3J 4L1HA 3S3SA 3L7FA 4ZUVA 3IF1A 1FCGA 3MJ7A 4GLRH 4LCUB 1O7SA 4OSUL 4YR6A 3EGSA 2D03H 4K9EC 2KPNA 4RIRB 3R06A 3FT3A 3GHEL 2CDFA 3MGTA 3HE7B 3LEYH 4HFWB 5C7XL 3RUGA 4JHWH 5IG7B 1JGLH 4X8XA 2HFTA 4HFUH 4UAOC 3TNMA 4OKVA 5C0DB 4YHNB 2IFFL 1JRHH 4L8CB 1IM3A 4X8JB 1P4BH 3KVQA 3MC0A 2IC2A 3ZKNC 3H0TA 5C6WH 1AD0B 1ZHNB 4LHQB 1WISA 2D3VA 1N2RB 5F93C 2Y9RT 5FGSA 1MFAH 2XWJB 5KN5A 1F6AB 4LVNB 5I1CH 3L5IA 5IB5B 3Q1SL 2X4QA 1A7QL 1MY7A 2Q87A 3OTTA 5KZCD 2L4OA 5CMAA 1NAMB 4NQUA 1LO4L 4O02L 3CPLB 2N7BA 5GGUA 5AWNH 4X9BA 2PXYC 4FQHA 1OGAD 3PUCA 1R5VB 1KENL 1EJOH 3WJLA 1YECL 4K55A 4OIAA 5DF0A 4ALAL 1WCBA 2BNQE 2NY1D 4ZTPL 3MGOB 1AGFA 5SX5K 5DVKA 4HF5H 3T0BA 1MQKL 1RUPH 1DVFB 4EZMA 4KAQL 1SYSB 7CGTA 4M02A 3ARVA 4XZUB 1RJCA 1YPZB 3K4DA 1U8KA 2VXVH 1QSFD 5KS9F 1MJ7H 4GBXB 4ONFL 2B39A 2P5WD 3HC3H 3MBXL 2OMBA 4IIQB 3WFCH 4MSWB 2O61A 2F15A 1LE5B 1BJ1J 2APTA 1FZKB 3QBTB 4U1IA 1ZVSB 1XF4A 2WM0A 2PTTA 1D5IL 4U1GB 1U36A 4PJIA 1JPTH 1SJHB 4MJIA 5MEQA 1NBZA 3OX8B 2FH6A 3A67H 4PJ7F 1HWHB 5IHUH 1LEGB 1TJGL 3O2DH 4MB5A 5JORB 3VE0B 2O5YH 3U9PL 5HYSG 2PYEE 2QL1A 1WZ1L 4OTXL 2OR7A 3QCUL 2ZP0T 4E9LA 3G6DL 3ARGD 2X70B 1JWUA 1JL8A 1MIMH 1JNJA 3SO5A 5KSBF 3OGCA 3GJFK 3WHXA 4QXUL 1MEXL 4OD1L 4R4BA 4Z7NF 4B53A 1N3NA 1UM5L 4UOW1 3SCMD 4X5LA 2YD1A 1MJJB 2BVEA 3DYPA 3V95A 3RX8A 4GKNA 4P46C 3MV7D 4HXBH 5I73B 4Z0XB 2E9IA 1ZHLB 3TIDA 2EDBA 1HHGB 1TIUA 4P4KA 3HG1D 5DRXB 5CEZE 2RB8A 1KIQA 4F58H 4JAMA 4OLYL 4NQDE 1KB5A 5IW1A 4JM2A 4YHOH 3QIWC 3UTQB 1AXSA 1GVIA 4BJLA 3ZE1E 4OZIE 2X9WA 4EXKA 1PD6A 1QBMH 3PWPE 3QIBB 1AP2A 5GRWA 3O9WC 1FORH 3KYNA 3FOLA 3WFDL 5A16B 2DQCL 1IBGL 2BNUA 1N0LA 5A2IH 3W9DA 4PJ8C 1HH6B 1MRCH 3BGAA 1P84K 1B0RB 3AM8C 5EORL 4WU5A 3ZE0E 5KVDH 4L3CA 1XGYH 1ACZA 3VWKD 5EC2B 4RFNB 1M6OB 4YHZL 4LPCA 5D71L 4WFEE 4L3AA 5C0EB 4YDVA 4FQ2H 1RK0A 3NA9H 1KLGB 3QNZB 5LBSL 4XGZB 5EWIH 1OLZA 5JR1L 5KSVB 1NDGA 3RTQA 3VFGL 4YXKL 5FYKL 1MFCH 3ULSA 5JPMB 3DRTA 1HK6A 1M7DA 4DKFL 4QHNA 1RIHL 1Q9KB 5DUBB 1KIPA 2X1PA 4GXUM 3MJ8B 5FUZL 1WITA 2XZQL 3O3EB 1OSZA 3SKUD 4P3DA 3U82B 2MHAB 3QG7H 3HS0A 4HJJL 3LB6C 1U58A 5I0ZA 2GT9B 2F53B 4WHYH 5C9JB 1UVQB 2DQUL 4FQCL 2QQNL 1CTOA 3B83A 3B9KA 4WUKH 1S7SA 3NZHH 5DA0B 2VTFA 5IF0B 3VG9C 1HYSC 1AJ7H 3W0WB 1KB5L 2WBKA 4X6EB 1BFOB 1QZ1A 2ESVB 1MFBH 2HTKC 3KPMA 2CLZA 2JIXD 2WLYA 3FN3A 3BO8A 3KWWA 3QXUA 4CMMA 1D5MB 3VRJB 5IVOA 4A2LA 4FQLL 1CGSH 3RZCD 2VB5A 3U0WL 1XF3B 4Z7UB 2VLJA 5HYIA 1WIPA 3WIFA 1IGYA 5D7SH 5HHPA 4L8SA 1XZ0A 1IC7L 4YDLC 4EOWH 1UB5A 3V0VB 4OV5A 3T3PF 4GG8B 5CD5D 4LU5H 3QUMB 1A6WH 4E0RB 3D85B 2M1KA 2IBZX 4XB7A 2ZPKH 5KVFL 5E1HB 5D7IB 3D9AH 2L7JA 5E5MB 4M4RA 4R96A 3G5XA 3VWJB 1MHEA 2NW3A 4M48H 1MCBA 4J3SA 1AC6A 1DN2A 4YXLL 3BPOB 4K9EH 4LASL 3DNKA 3VFSB 3W82A 2QSCL 2XZCH 4JKPH 5J12C 4YBLC 1CS6A 1NLBL 4MX7A 1UCTA 4R3SB 1RVFL 5AYUH 3E8UL 3PGCB 4P23B 5ACZB 4OF5A 3RWGB 5I1KL 1T0NA 4HUNB 2XN9A 3F7VB 4MJ5A 1LEIB 4CMHC 2VQ1B 5SV4A 4I3GA 4WNQA 5SX5H 4PJAB 5IFHH 4NZDA 3SDAA 3PIQA 4DTGH 2FJGA 3UTTD 1GOFA 3BAEL 4PRHA 5MI0B 5BW7A 4JY5H 5HYJE 1GIGL 3IKCA 3HE6D 3ZKMC 5K9QI 3U7YL 5DQ9B 1MRDH 4ZTOL 4JG0H 3FQNB 3DO7B 4D9RE 3DUUB 3K4AA 4GG6F 4JJHA 3ZDZE 5DMKA 3U48A 4JFDA 3IDNB 4OQTH 1OGAB 3ZO0A 4YHIB 1CIDA 2A6DB 5IMKB 4HKXB 3VD3A 2HWZH 4B50A 1G7MB 1PG7L 1UXWA 3FZUC 1H3GA 4KRPC 2E3VA 1NBVH 1MPAL 3VGHA 4YEEA 3NABH 5IB2A 5BV7B 5JW5A 4XPHL 1AC0A 4PPTA 3GSQB 1WBYA 1QFWH 1JPST 2A6JB 3GJFH 2AJYH 3BW9B 5DRWA 1FYTA 4HIJB 4BFBD 2AQ3A 4M1CC 4ZUWA 4JRXB 2E7CA 4FHBD 1NBYB 2I07A 4KUZH 1HH9B 5CIPA 2AQ1A 4QRSA 1R24B 1N5AB 4YPGB 1FNHA 1ZKAA 5FEBA 4IBLT 3QEQD 1C5BH 4X7FC 1DBBH 2H6PA 4AEFA 4OLVH 4BQCA 2MCPL 3O2VL 4FQJH 4ZPVA 4D0BA 1ODAA 3P0GB 3V4UH 5DMGD 5IMLB 1FN4B 2H8PA 3MLSL 1K2DB 5F9JB 4H1LA 4XXDA 1EIBA 1QOKA 4YLQT 5DRNA 3FTGB 4QY8B 3S36X 2JB5L 4RGOH 1DBAH 4FQPA 1IAKA 3MRRB 2H32A 3RVUD 3LS4H 1NGPH 1EEYA 5E6ZA 1BQHB 4WTZA 4GAFB 1Q9LA 4DW2H 3ZE1F 4OZIF 1TCMA 4XVTL 5LQBH 3NFPB 2BOBA 1BD2B 1T2QH 1FFRA 2NXZB 1INEH 4JREC 3HMWH 2GJ6D 5E4IA 1UT9A 3DV4A 2OZ4A 1FV1A 4XP6H 3EO1B 3BX7C 1U8OA 1FVDA 5CEYA 1V3LA 2N56A 1FAIL 4IJ3B 1M7XA 5JDJA 3THMH 3ET9F 4P2OA 2V2XA 4QTHB 4M1DH 3ZE0F 4C56B 1ZHKA 1KC5H 1ZANL 1ORSB 2ITDA 4X4MA 2HLAA 4PJBB 4XMPL 5F7EL 1E27A 3ROLA 4OGAD 1JGDA 3VXTB 1CD0A 3W39B 2VR9A 1DQJB 4ZFFA 1DANT 2C3HA 3U79A 5C0AD 1S9YA 3GBMH 1F02I 2GKIA 4MB3A 4B41A 2R2HB 5IKCB 4LBEA 1T7VA 2AK4E 4MNGA 1I4FA 5I17B 1D6EA 1SYVA 1VGEL 4NCDA 2EH8L 4KZEL 3QQ9D 3TH3T 4NNXA 4LNRB 1WSST 2M26A 4FP8H 3F7YA 4UZGA 5EOQL 2CO7B 2ZG1A 1A1MB 2XIDA 3QHFH 4QHLB 2R9HD 3QXWA 4DZBA 4F2MB 1OW0C 3OJDA 4QF1B 3QEGL 1YMMD 3MV8E 4F7TA 1JWSA 2ZUSA 1SBSL 1CT8B 1TNNA 3AY4A 4ODVH 1FG9C 2QHLA 5KVGH 4CAGA 3PQYA 1AHWB 4PGZA 3IFOA 1VCAA 2J1KA 3ULVE 4X6DE 5BS0B 4U0RB 2G60H 1WCQA 3GSXA 4UT7L 4YHYB 1D7FA 4NQED 5MENE 2P47B 4YBQD 1A6UH 4M9OA 5D93B 1A4KA 4KDTC 4Y88A 4DVRL 3O41A 2OS7A 4UT6H 1JYNA 2OL3H 2UWEE 1E6OL 2JIXB 4PJEE 3UTSD 3SDCA 4PJ5A 1NFDE 4AEIH 5INCA 2DTML 5ETUB 2VDNL 4L4VA 3EYVA 3D1MC 1NEZG 4HH9B 2BVYA 3BP7B 5DSCA 3OV6A 5HHNB 3QDMD 4TUJA 4PJFA 1A3LL 1X5AA 5A40E 3L5WA 4PS4H 4ZFOB 3TC9A 2FO4A 2G5BA 4F3FA 3ARFB 5D70L 1KFAH 2J8UA 2OYPA 3X14A 1FGVH 4CNIB 5IJVB 5DURD 4RA3A 3L3GA 2Y7QA 1BVZA 5JNYB 1NGWA 3GMRB 4G9FA 2XRAH 4JZJC 4YHPB 4XHQA 5E6IB 1LO2H 3EYUL 3HNSL 3ARZA 2LQRA 5LXGL 4HAGA 2GITA 1AIFB 3FQWB 4TUKL 2X4OB 4Z7WB 1LO3H 4LCUA 1YEHH 5B4MC 1CWVA 4OGZA 3C8KB 4RIRA 2DAVA 1DFBL 1EBAA 1IJ9A 3FFDB 3HE7A 4HFWA 4ZMAT 4NUGL 1PDKA 5I76B 5IG7A 3KR3L 3U2SB 5IESL 4XT1C 5DVMA 4YHNA 1S7QB 1J05B 4NBXB 4KJWD 4H25B 5C0DA 5C0ND 2IQ9H 4L8CA 4X8JA 3HI6H 4NO2B 1UYWH 4WO4C 3TJEL 1AD0A 1ZHNA 2MKLC 3O8XC 4X7EC 2KZWA 2FX8L 2HKFH 4X80H 5TH2B 1FGNL 1N2RA 4X5XB 3MLYL 5FDWB 5IVNA 2XWJA 3TPUB 4BH7B 1F6AA 5IB5A 3Q6FB 3U1SL 1JZ8A 4PRNB 5LJYH 1U8HB 1NAMA 3S8WA 5D5MB 3QDJE 4LLWB 3WXWL 4OJFL 4U49A 3KPLB 3IDIB 1QQDB 4QOKD 3PGDB 2C3VB 4ETYA 4OGYH 4JFPB 1R5VA 2MPAH 4HWUA 5T3ZE 1J0YA 3WIIH 5E2TL 2IALB 3C09B 2EIZB 4G6JH 3MGOA 1MAML 1TJIL 2VLRD 1DVFA 1SYSA 1KCRH 3BDYL 4ACPA 2HT3C 2Z4QB 4XZUA 4BZ2H 4EN3D 1YPZA 4UDTB 2UVFA 4FTVB 3LH2L 4GBXA 4KJPC 5B3JF 4IIQA 3U30B 4WVRA 4KU1A 4MSWA 4PTUA 2CMRL 4NWTH 1LE5A 1CU4L 1FZKA 5HDOA 1ZVSA 2M2DA 4ONGL 3RUGE 4ZDHB 3DGGB 1I7ZA 4LLQB 1DSFH 3PABA 1SJHA 3TH2T 3OX8A 1LEGA 5JORA 3VE0A 3BOVA 4KHXL 5F9WB 3V0WL 1NMCC 3O6KL 5F21B 2X70A 4QRTB 4EUPB 2KZ1B 4HGWB 1T1ZB 5J1TC 3BZ4B 1MLBB 2YRPA 5JOPE 4KJQD 1IC5H 4H0GA 1MJJA 4LP4A 1B2WH 3Q2CA 4OGXL 1J8KA 3BEWB 4Y2DD 2DB8A 4JGUA 4NN5C 4Z0XA 3CXDL 1BM3H 1NAML 1ZHLA 4JDTH 5JA9A 4MVBC 1HHGA 1A0QH 2QADC 4K3GA 4IRJD 4ODTL 2XKSA 4G6AC 4HPOH 3MRCB 1U3HD 3UTQA 2VJXA 4FG6C 4XAKE 4FABH 5HVHB 2HJFB 2EC9T 1N7ML 2EEBA 4WRLA 1KF9B 3GSVB 5EO0B 3LKNB 5E03A 3QIBA 2HKHL 3CFKB 2BMKB 5A16A 3B2UD 3JUZA 1A6TB 5FYKU 4PJIE 1HH6A 4MJIE 1D9KD 1N26A 4LCCB 5IQ9B 1WLHA 1B0RA 3EFDL 4M7LH 3QDGB 5AZEL 1NDMB 3ZYOA 5EC2A 1M6OA 1MCLA 2FBOJ 1FQ9C 4RGND 4R0LB 2KUTA 5IJKA 5MEPB 5AZ2L 4IMLB 5C0EA 4HULB 5FYLD 3CFCH 1KLGA 3DJ9A 3QNZA 3K8LA 4XGZA 1KSRA 5DO2D 2DD8L 5KSVA 1SEBB 1U3ZA 3KPRB 2XA8H 3R1GL 1KJ2B 3ULVF 4KTEL 3NMEA 2F19L 2YKLH 1OWRM 1AI1H 3HI5L 2P48B 4NUJB 5JPMA 3PGFH 2WNGA 5DD0L 2NXYC 4URTB 2HRLA 1Q9KA 4N5EC 4Y16C 3V8OA 5DUBA 3MJ8A 3JV5A 2M8XA 1P7QD 1T83C 4YGVB 1X7QB 3O3EA 2AI0H 3CVIH 1RI8A 2R2EB 2MHAA 3HFML 3GSNB 1LQSR 4JN1L 3WDHA 2Q1EA 4PJEF 3HA0A 2GT9A 1NFDF 2F53A 3WS3B 2HT4D 1J12A 1UVQA 4KK8D 5IF0A 4TVPD 1A1OB 3V4PL 2UY6A 1V3JA 4LRIA 1T1WB 3W0WA 4X6EA 1BFOA 2AEPL 1UA6L 3O4OC 4NO0B 1L7TH 2ESVA 3QCTH 4PG9B 1U8JB 3RX7A 3FONB 5DMIL 1MJUL 1D5MA 3NCYS 3VRJA 2Z93B 4QTIH 1IGFH 2AJXL 4M4PA 4PJDB 5DJXB 1XF3A 5EOCH 4Z7UA 3WSQH 2DYPB 3S35H 4DOHB 4ZG1A 4ZO7A 3RHWK 3VFVB 4Y1AD 5K9OB 1EMTL 1DJSA 1I8LA 1EHAA 4XNMB 5FXCH 4C54A 2C3XA 1T1YB 4GG8A 3DSNA 3QUMA 1IVLA 4E0RA 5GJTL 2P5ED 3D85A 3MACL 3NFSL 3ZKXB 2NW2B 4GMSH 5ADPH 1JTTA 5D7IA 3QEUB 3BSZH 3FHAA 5E5MA 3TBVB 3VWJA 2NY4D 3RIAK 3ARDD 1CZ8H 3WO4B 4XPTL 3WFZA 3T0EC 1ETZB 5CILH 3EO9H 4ZFZB 3VFNB 1BREA 1EH9A 3VFSA 4JKMA 2QEJA 1N0XL 4NZUH 1KEML 4R3SA 3PGCA 4P23A 5ACZA 3RWGA 4O5LL 2FNBA 1W2KT 1ZSDB 4S1RH 1NCBH 1LEIA 4MJ6A 4Q9RH 5DWUL 5FHBH 2VQ1A 3JWOL 43C9B 4PJAA 2CRIA 4H5SB 1CD9B 4MYWB 1W72B 3DX9B 4E42B 1LHZA 3KYKH 5GRJH 3MYJA 5B38G 1X5HA 1Z5LB 3H3PL 5DQ9A 4AJ0A 4BZ1L 2LE9A 2F5AH 2YD4A 3FQNA 4P9HL 1S9XB 2VLJE 3DO7A 5D6DC 3I9GL 3DUUA 1OP3K 1HKFA 4Y4FB 5ALCL 2VUOA 2OBGA 3IDNA 1OGAA 5A2FA 3PP3K 3ZT6A 4YHIA 4NN6B 1CE1H 2A6DA 2OR9H 2J5LC 1BBDL 5IMKA 3X3GL 5SWZB 3WFHB 4HKXA 4FZ8L 3F6IA 3HUJB 2ZCKH 1G7MA 1XGPB 1MY5A 2CRZA 5C0BD 3RUGF 2A38A 5FCUH 2JE8A 3VFOB 2B1AL 3RL2B 4XNUH 1T22B 3PV7A 4S1QH 1FNSL 3OKNB 2NY2C 3QUML 5HGGS 5DMJB 3GSQA 3W9EB 5BO1H 4EN3B 4PLNC 4GRMB 2A6JA 3IU3A 4TOYL 3BW9A 4GFTB 4HIJA 4GQPH 4JZNB 1Y18B 4F8TA 4JRXA 4D9LL 2AJSL 1NBYA 4LEOB 2YSSB 3WFEH 4MXQD 1HH9A 3ARPA 4G6FD 4GXVL 1R24A 1N5AA 4LHUG 4YPGA 3TN0D 1QSZA 1JGVH 2ZCLL 4QLRA 5IBTH 5I74B 4HIEB 4LMQE 1NCCH 2XN9E 2W0FB 4P2QB 4JQVA 4IRSD 1HEZB 1U8LB 3LZFH 3QG6A 3RWDB 4BK4A 5IMLA 1FN4A 5F9JA 1K2DA 1BQUA 4PRHE 5ITBL 3RDTC 1J1PL 4AH2B 2ZOKB 5F1IB 3FTGA 3IJHB 4QY8A 3NCEB 3SO3B 4OZFG 1MCIA 3C5JB 1EXUB 1U0QA 1SVZA 1BQHA 4G8FB 1N6VA 2R29H 4LRNL 2HT2C 1WFNA 3ZTJH 3F7PC 1V7MH 2YA2A 1BD2A 4CJ0A 1L0YA 1T5XB 2L0DA 3MV9B 2X4RB 4I3RL 1T7YA 4UTAH 1JVKA 4F9LA 1RU9H 3VXMD 1L9MA 3EO1A 1E4KC 4PJIF 5D2NE 2H9GB 3BKCL 3TZVD 4NKQB 4K3HA 4QTHA 5CLWA 1J86A 4C56A 1FYTE 1K6QL 1ORSA 4I4WB 3QXDB 4PJBA 5C70A 1CFTB 1FC2D 3RU8H 3VXTA 5BV7L 2J4WH 5FYJE 2HN7A 3W39A 4IOSD 4WCYL 1DQJA 3MLXL 4IOFD 4G7YH 1N6QH 1I9RH 3BKML 1I1AB 3H3KA 2PR4L 4M6NL 5T3XE 4OCLC 1UM6H 5D7LB 2R2HA 5IKCA 1JPGA 4LSPH 1ACYL 5I17A 1L7IL 1TJHL 4O9HH 2A0LD 4HS6A 4P59L 3LY6A 3JUYA 3CZFB 5D2LF 5LWYH 3QYCA 3SE8H 1ZMYA 4LNRA 3RIFF 1Y6NR 2E7MA 4Y5YA 4TULH 3V4VH 1ULVA 1HYRC 4K71C 1UJ3B 1A1MA 4GJTB 4QHLA 3H3BC 1VEOA 4F2MA 1H3WM 1KGCD 4QF1A 4PV8B 3L95B 1S9WB 4MQXD 1DUYB 5CJQL 1QSEB 1SEQL 1CT8A 5EO9B 1YEGL 2FX9L 4M7JL 3CCHB 3WLWD 2VITA 1AY1L 1P4LB 5GGVH 3L3HB 4JZOB 2WWMD 5BS0A 2FX7H 4WFFD 5F7FA 5J11C 4BZYA 2CKBH 5L8JB 4X4ME 3K74B 4E41D 2XQYK 5GHWH 4K7FB 4UIMB 4XC1H 4U6VL 2ZWLT 4PV9B 4MXVE 4Y19B 4LCIH 5E9DB 2ED8A 2JIXA 2BP3A 3I6LD 2Q8BH 5ETUA 4RWYH 1S7TB 1E4XI 1DBKL 5CSZB 1F4XL 2VWEC 4MNGE 2FHBA 4HH9A 1CQKA 2DI7A 5CCKL 1CDGA 2KBGA 3BP7A 1H0DB 3TJHD 4S0TD 5HHNA 4YQXH 4ZFOA 3TFKD 4Y1AB 4XPAH 3ARFA 5ICYB 1OLLA 4AG4L 4CNIA 1OTUC 2PF6A 5IJVA 5I71B 3NIFE 5JNYA 3GMRA 1PAMA 3X12B 2VXTL 1CL7L 4LPYA 4YHPA 5E6IA 3RJQB 2J8HA 3J8F7 1KN2H 4BFEA 1R0AH 4RDQG 3ZDXF 5ID1B 3M8OH 4NYLA 1AIFA 3FQWA 4WY7L 4K94C 2X4OA 4Z7WA 3ARDB 1HQ4B 3QIUD 3MTRA 4IDJH 3BKJL 4KUCD 2GFBB 1OP3H 3C8KA 4ETQB 2H1PH 3PQYE 4X83A 2YZ1A 4NWUL 3FFDA 5I76A 5D1XD 5TFSH 3U2SA 2R4SL 4XAWH 4OBRA 3PP3H 1S7QA 1J05A 2FEDD 3WJJA 1HKLH 4H25A 4ZAKC 4U6HB 1FO0H 4MLSA 4I9WD 4V1DB 2AXGB 1A3QA 4NO2A 1DBJL 4MAUH 4HT1H 2OP4H 2R0ZL 5LCVL 4YHKH 2VE6B 3GIVB 1FNAA 2D7QA 3BIBX 4MHHG 5TH2A 4X5XA 2X4PB 4O58H 1A02N 4PJ5E 3T8XB 5FDWA 2E6QA 3TPUA 4BH7A 1F2XK 2AJVH 2WWKT 4GUPA 4L4VE 1UCBH 5F72S 3D3VD 3Q6FA 3TT1H 1NUNB 4PYHA 5GS0D 1RULL 3P30L 4PRNA 1U8HA 4R26H 5D5MA 4LLWA 2CDEB 1RURH 4MB4A 3KPLA 2IAMB 1QQDA 3IDIA 3PGDA 1NCNA 2C3VA 2IH1B 4JFPA 4X7SH 4U1HB 4BQ8A 1KCKA 4KK6C 2XWTA 2J8UE 4PB0H 4RFOL 4MA7L 2IALA 2EIZA 3H7BB 4G9FE 1I8IB 4LSTL 1INQB 3LSOB 1G9MH 5C0BB 4ZFOL 1BF8A 5L2KB 2GSIB 4XVUD 3BN3B 2Z4QA 4MDIB 3RWJB 4UDTA 5E99H 4FTVA 3QUYC 2DMBA 2FEEI 5CIPH 1RZ7L 2NX5B 4Q6YA 5JXEC 4M8QB 1RIUL 4NGHH 1QRND 3TCXA 3WUWB 4ZDHA 1OD7A 1ZT4B 5FV2A 3HNTH 3DGGA 4MA8H 5EU7C 4G6FB 4LLQA 4XWGH 2PNDA 5EA0H 4OLZH 5DD5H 2IFGA 2D7PA 5EBWB 1LK3L 4OCSL 5JPNB 2DBLL 5C0FB 1BF2A 4QRTA 4EUPA 3STZB 4P5TB 4HGWA 1T1ZA 4S1SL 5E8OA 3BZ4A 1GL4B 1MLBA 1K4DB 1NJ9B 1NGQL 4P5KB 1UKTA 3MLVL 5TF1L 1F3DH 5IMMB 5I75C 5KJRL 1NL0L 5L2JB 3AREC 2D0FA 1H8OA 3SBWA 1IMHC 3GBNL 2VABB 3K2MC 3LPFA 4K3JL 5CINL 8CGTA 2VC2L 5J9PB 1EK3A 2AJUL 4W4NA 3BEWA 3S35X 5KS9B 3WNMA 5CP3A 5J8OA 3KPOB 3FRPA 3F62A 1MCPH 3GSRB 3KPSD 3T0DA 1R5WB 4WI5A 2DTSA 3RVWC 3V0AC 2BHUA 3MRCA 2DDQL 1LE9B 5DR5H 3K7UA 5IQ7L 2GHWB 2FD6H 1YPZE 2LAGB 1DLFL 3GSVA 5EO0A 3LKNA 3QWRD 2PO6B 3CFKA 3QEHB 4DGIH 1HNFA 3NTCL 4YE4L 1MRFL 1A6TA 4TTGA 1XAUA 2VXSH 3CDGB 4Y5VB 2ZOLB 4WWKC 5C07B 4LCCA 3NIDE 3QWOB 4XCNB 4U3CA 5EZIH 3QDGA 5T33L 2VLME 4XNQB 3FHQA 1NDMA 2BSTB 3GFUA 3H6JA 2AXJA 4DGVH 1J87A 1TQCC 4L4TD 4R0LA 5MEPA 4HAFA 4IMLA 2LVEA 4KK9C 1BOYA 4XHJC 2QQKH 4GW5B 1SEBA 3KPRA 1KJ2A 2FGWH 3ARYA 4NUJA 3VRLE 3HZKB 2XQBL 4H26B 3ULUL 1S78C 5HGDA 4JY6B 3RZWA 1JGUH 2P46B 4OZ4B 4AEHL 4YGVA 3C87A 1X7QA 3EDFA 1K3ZA 3SGKC 3GO1H 1LWRA 1I9JL 2R2EA 2R39A 4LFHD 4MXVF 5HHMD 3TYGL 3GSNA 5F44A 3JVGC 3LD8C 3WS3A 3E1F1 4HK0B 1I7UB 2A77L 4KVCH 5GISL 5DJ2B 2AGJL 1A1OA 1FH5L 2A1WL 5IB3B 1DBML 4MQTB 1T1WA 3BXNA 2GK0B 5BJTB 4RSVA 1T66D 4NO0A 4ZNEA 2BK8A 5JXAH 5D1QC 4PG9A 1J0HA 1C5CH 1U8JA 3FONA 5K33A 1CLZL 3NIFF 1F11A 5C0CD 5K59E 2Z93A 3WHE1 4MGXA 4PJDA 5DJXA 4GAGH 3C2AH 1C08B 3LS5L 4Y4HC 4XP9H 2DYPA 1I8MB 1AQKL 3O4LB 3VFVA 5DD1H 5EBMB 3CFJB 3O9WD 3TO4C 5K9OA 4HMEA 4XNMA 3KDMB 4YFEA 4M5ZL 1T1YA 2V2TB 1CLOH 1A2YB 4OFYA 1GGIH 1V3MA 3OPZL 2R8SL 3L3KB 4PJ8D 4NO5B 2NW2A 3SDDC 2DI8A 3ARBD 4WEBH 3QEUA 5KBNC 3MREB 4K8RH 3IS0X 4PGCB 4K94H 3TBVA 1TPXC 1Q8MA 3C6LB 1PEWA 1QHPA 4HPYH 4LEXH 1WV7T 1ETZA 4PLJC 4EI5B 4ZFZA 3VFNA 1QFHA 1NLDL 4HCRH 5FUOL 4D2NA 2F53E 1ZLVK 3A6CH 3SE4A 2I24N 5DK3A 1KBGH 2R2BB 1G0XA 2F8OA 4NOFA 4QRQB 5HDLA 3VGAB 2QLVB 4A2MA 1E6JL 4IEFB 3ULUD 1ZSDA 5D7JB 3KXFD 2WK2A 4PJFF 2DQDL 43C9A 4H5SA 4M1GH 3DVIA 1W72A 3DX9A 2ESVE 4E42A 3B5TA 2J8UF 3GK8H 1GYAA 3MUY1 4NHCH 1OAZH 1Z5LA 5L6YH 3VXNB 5I66B 4FMKA 3HPJB 2XACC 1S9XA 2R1WB 4Z7UE 4NQCB 1NAKL 3VXPB 4Y4FA 2CQVA 3DIFB 4WI8A 3P0YH 4TTDD 2PUQT 3DRQB 5CUSL 4PG2A 1MI5B 5AAMA 5SWZA 3WFHA 3CFEB 2V5TA 2XV6B 3FT4B 3HUJA 2NY1C 1H5BB 3HAEA 3O45B 1XGPA 1HILB 4NKIH 4P57B 3VFOA 4K7PH 4YDJB 5D7IE 3A6BL 3W11D 3RL2A 1T22A 2DLFL 4OLXL 2YN5A 3FB5B 3KS0J 4JQXC 4BFIB 4PRBB 3OKNA 1B90A 2VL4A 3Q5YA 4OLWH 1T89C 3BT2H 3W9EA 3I2CH 2NY3D 4GRMA 3L7EB 4N8PA 1N4XL 2D2OA 5FHAL 3ZZ1A 5FOJA 1MCNA 3LN4B 4JZNA 1MREH 1Y18A 1HZHL 1VKXB 4MQ7B 2X6MA 2DQTL 3SQOH 3O6LL 3MLRH 5K9JH 3QQ4B 2YSSA 3O2WH 4LEOA 1U6AH 4AEEA 3TT3L 1GCFA 1UWEH 1QA9B 3GSUB 4HIEA 4QEGA 2OMNA 3G9AB 2DQIH 1C7TA 2W0FA 3AB0B 4BELD 4W4OC 4PBVC 3VXSD 4P2QA 3LMJL 4PJAE 3LHPL 1HEZA 1U8LA 4GG6B 3RWDA 1V05A 35C8L 2EDLA 4PJ9C 5CWSB 4YUEH 5GIRB 3ARGC 4AH2A 3EYSH 3GRWH 2ZOKA 5F1IA 4Z95L 3IJHA 1MCOL 3GBLA 4KH2A 3C5JA 1EXUA 5LGHL 1W72L 5BRZD 2ZUVA 1RZFL 1YPZF 4G8FA 1UQSB 3HC4H 1DQDL 1Z3GH 3SCMC 1GGYA 1EEUA 1NGYB 4PJCB 5J3HD 4UAOB 3LRHA 3ZYJA 1I7TB 4U6YB 2X41A 5M95B 1T5XA 3MV9A 4AYFA 2X4RA 2O5XL 3EBAA 4DN4H 4BKLB 3N9GH 1Q0YL 1S3KH 3IVKB 1GGCH 3QJHB 4M43H 1G7IB 3FT2B 1JE6A 1QFUL 2C4XA 2H9GA 3DX6B 4WWID 3NIDF 1FNGB 2EE2A 1FFPB 5CKGA 5C3LD 3WHE0 3B8SA 2DQGL 4EQ3A 3RPKA 2A2QT 3QXDA 2WP3O 1GH7A 2PXYB 2VIRB 4S1DD 1CFTA 1T4KB 4JRXE 3Q6GH 5DDHA 3WKNA 2EIBA 3AU1A 5BZWB 3VU2A 3FN0H 3MA9L 3HZMB 1CF8L 1I1AA 3T3ME 2WLZA 1U41A 2B0SL 4HKZB 5D7LA 1JZ6A 4ZXBD 3RY6A 4ZUTA 3VWKC 1D5ZB 1A64A 3BWAB 3KJ4C 1CQYA 1FBIH 4L4TB 4KPHL 3GJFB 3CZFA 1DQQB 4LSVH 2CLVB 2WBJD 4HHAB 3T09A 3VA2C 4BSWB 4JO1H 4QWWD 4WFGD 5F1SA 4IS6B 1A5FH 1YNKL 2P8MB 1F42A 2NTSP 3PWVA 1UJ3A 5ALBH 4KI5D 3RAJL 1BD2E 4PGJA 4HLZG 4OB5H 3X17A 3MGAA 3L95A 1S9WA 1DUYA 1QSEA 4UV7H 4OCWL 3C60B 4X7TB 4GRLC 3CCHA 5JO5B 4L9LC 5K59F 1P4LA 3L3HA 4JZOA 3P9WB 5DHYB 3EHBD 1HXMB 3G04B 5EZOL 3IGAB 3MXWL 3NZ8B 1AGEB 5F6IC 3VGBA 4C56E 3C5SB 1JF1B 3QP3A 3UJTH 1BAFH 4I77L 3OF6D 1Y6KR 5ILTL 4K7FA 4UIMA 1FZJB 4HWEH 3BVNB 3T4AB 1CCZA 1CDYA 1FLTX 3RGHA 2FB4L 1FPTH 4PV9A 4Y19A 3F58H 4P46B 5EBGA 3C8HA 4XBEH 2X40A 5L7XL 2UZIH 1A7RL 5E9DA 3OJVC 3VI3E 5ELIA 4HS3B 2ITCB 3H9SB 3RZCC 1S7TA 1QBAA 4HH8A 5CSZA 1VFMA 3QIWB 1H0DA 1QACA 5JMOC 3I75B 1I75A 1ZLVH 3MLWL 4ZPTB 5KANG 2YD5A 5HGBB 4Y1AA 2VDQH 5ICYA 3VH8G 1AO7A 1A4JB 3MUGB 2BY0A 3UJJH 4TNVF 3QPXL 1FDLH 1EGJA 3N1GC 1A14H 4GMTH 4PJ8B 5I1HL 3HMXH 1CFNB 3V2AR 5ID1A 3QCVL 4E5XB 5IW6B 1NMBL 3U83A 1MHPH 3ARDA 3NCJL 3OQ3B 3HRZB 1HQ4A 1WEJH 1NSNL 1VDGA 2YK1L 4EDWL 3QRGL 3MUHL 2GFBA 2QJDA 4ETQA 2NZIA 2R0WL 1RUQL 3RWFB 5E2VH 5CJBA 5BS0E 5C2BL 1P6FA 4GAJL 4JR9L 4Z7UF 1MVFA 3GMPB 1HINH 1DL7H 3LRSB 4V1DA 2AXGA 5HHVL 4XC3H 3V6OA 1KCLA 3JWNC 1F58H 2R56L 2VE6A 3GIVA 3CUPB 2DBJA 3M45A 1FFNB 1AGCB 5HI4C 3HE6C 2X4PA 4YC2C 3HZVB 1F4AA 4O2FB 3CVHH 5FGBC 3T8XA 4ZFGH 1B88A 1TZGH 2ADFL 1IC4L 4G8GB 3PV6B 1GAFH 5IM7B 4NCC2 2X89D 4UBDD 4FNLL 2ICEB 4KI1A 2CDEA 4PB9H 2NR6D 1KIRB 4ODUB 2IAMA 4H20L 4EBQH 3D39D 1UXSB 3IDXH 2IH1A 2NCMA 2Z31B 4JM2C 2CRYA 3VG9B 1AXTL 2Q8AL 1GPOH 1Z0NA 4AQ1B 1NC2B 3WXVL 2JELL 3H7BA 3SDXB 2APVA 1I8IA 1INQA 1IGML 4MMXC 1NMAL 3LSOA 5DJYB 1FG2B 2W9EH 5C0BA 5L2KA 2GSIA 2VH5L 3RWJA 3S98A 1M1SA 1JP5A 4Z7WE 4PJAF 4O4YL 1RZGB 2DL9A 1SQ2N 4Z7OE 1EGJL 1U95B 3JTTB 3B9EA 5DLML 2W9DH 3TF7C 5IB4B 2AEQL 4YDLB 4UB0H 4F7MB 2NX5A 1BFVL 2IPKB 3WUWA 4J6RH 1ZT4A 3V52H 4LIQL 3P4MB 3IETB 4JEGB 3HKFA 4H1LG 5EBWA 3MOBH 1WZLA 5F70A 5JPNA 4L4JA 4APQC 1EVUA 2UUDK 1PYWB 3ALXA 5DMGC 5C0FA 3C08H 3QUXD 1HIMH 3STZA 5FIEA 4P5TA 1I7RB 3SPVB 4WEUD 5C7XH 1WZKA 1G6RH 2V5MA 5MEOB 1K4DA 1NJ9A 4JB9H 5I30H 4P5KA 3OZ9L 1KT2B 5IMMA 3ARXA 2IFFH 4MNHB 5L2JA 5D5ME 5BZDB 5J12B 4YBLB 4U0QB 2QR0B 3K2UH 2VABA 4I3SL 4FFYH 4K23L 5J9PA 1AFVL 5IT2L 3DWTA 1OHQA 4K3EL 4WO4D 5KS9A 4CMHB 2BNRD 3KPOA 4KQ4H 1OPGL 2YA1A 4LF3B 4MXWL 4CN1A 3GSRA 5F7NC 4OKDA 3DV6B 3KPTA 4NM8L 1R5WA 1FE8L 5IMOB 3VFWB 1LE9A 4QXGL 2IG2L 3T3MF 2YR3A 2PCPB 1D6VH 4KK5D 4O02H 4N0RA 1BEYH 3O6FD 4FTVE 4O2EB 4I18C 2F58H 2BJMH 1T5WB 1B6DA 5E95B 4Z77B 2PO6A 1CFSB 2R0LH 4KZDH 2JJWA 3QEHA 4ERSL 4OGAC 4QHMB 2P8LB 4Y5VA 2ZOLA 2FATL 5F88B 5C07A 4HX1B 4OCYH 5IB1B 3QWOA 2BRRH 3ZL4L 4XCNA 1BVLB 4KRPB 1EFQA 2C4FT 5MP6L 5I16B 2YEZB 1G9NL 4XNQA 2BSTA 4Q58C 2W1NA 2H2SD 1OAQL 4FXKB 4GW4B 1REIA 3BDXA 3ZKSD 3P40A 4HS8L 4NZRL 3FO0H 5FA4B 5I1JL 4YJZL 3QQ9C 5KOMC 1RZJL 4CN4A 4UILL 3WNNA 3HZKA 1ORQB 5JW4Q 4AZ8A 4H26A 4F9PA 3S97C 2WINB 1IM9D 4JY6A 4OTXH 4PJBF 3G6DH 4OZ4A 3O2DA 1MCSA 5F96H 2Y4SA 2VNCA 3TM6A 1S5IH 3SKMB 2BVOB 2CUHA 3LEYL 4JHWL 1JGLL 4OD1H 4ODBD 3ECBB 4HFUL 3NH7H 2O5ZH 4Z76B 4WI9A 1JRHL 1UM5H 1UEMA 4HK0A 1I7UA 5BW7C 1WC7B 1O0VA 4NSKB 2HFEB 5DJ2A 1KJ3H 2QBWA 4YBQC 5IB3A 3EJYD 4EKXA 5BJTA 1WF5A 4JFXB 4XVSL 2NY5C 3FAWA 2QTEA 4MVBD 4PFEA 1CFBA 3U0PB 4JREB 1TVHB 5E2JA 3E6HB 4G6AD 2Y06L 1T21B 3VMNA 5AWNL 1S7VB 4BUHA 3TGXA 4FG6D 3QDGE 3H9HB 3ROOB 1P69B 2Z92B 5GS1C 1EJOL 2C3GA 2MFNA 2BVPB 3WFDH 3O4LA 1QLFB 5EBMA 5JQ6H 3CFJA 1SM3H 2W59A 1IBGH 2IANE 3KDMA 5D2NC 2V2TA 4NQVB 4HF5L 1NANI 4DZ8B 5E2WH 4OM1H 2ID5A 2VOTA 2LTQC 4F33B 3KPRE 4N1HB 3L3KA 4NO5A 5EORH 4J8RB 2HJLB 1A6VL 5I8KH 2VXVL 3MREA 4X0KB 4PGCA 1J0IA 4G5ZH 3HC3L 3WFCL 4NZJA 4HBCH 1TMCB 5HI3C 3C6LA 1UZ8B 5T1DH 2ED7A 2ZJSH 4CGTA 1RMFL 5INDB 5C9KA 1L9NA 4EI5A 5IW3A 4Z7VB 1T6VN 3J7HA 4FQXC 4F7CB 1X6NA 4JDVA 5KAQF 3OAUH 3VFGH 4Q9CA 3A67L 1A6PA 4F37K 5IHUL 2R2BA 5FYKH 3VXRD 1U92A 1IEAB 4QRQA 4XXCA 2O5YL 1UH4A 2YUXA 2A9MH 2NZ9D 2NXYD 5D7JA 4Y16D 1MIML 3S37H 3TBWB 4ZNEE 4BFGA 3VW3H 1ZLSH 3NVQA 5C6TH 3D2UB 4YHMH 1KPUA 4NP4H 3MRPB 3ZSSA 2WQ8A 1UADC 3VXNA 4PJDE 5I66A 2DQUH 3U6RB 4FQCH 2D4DA 2QQNH 3HPJA 2R1WA 4DN3H 1ZXQA 3UDWC 4NQCA 1BFTA 3VXPA 4DOHE 2FBJH 3DIFA 4Z7WF 1JWMB 4ZOCA 4XPFH 2FJFB 4Z7OF 4LKXA 1BPVA 2CKNA 3DRQA 2PETA 1MI5A 4F58L 3CFEA 2X7LB 1ZTXH 3FT4A 4NJAL 1B4JL 1H5BA 3BQUC 3O45A 2XFXB 5IFAH 1HILA 4FQLH 1IEBB 4P57A 3LEXB 3U0WH 1OCWL 4YDJA 5HTSA 2X1WL 5JW4R 1CFVH 2UUDH 5ADOH 3FB5A 1QBML 4BFIA 4NPYB 4PRBA 1FORL 3L7EA 1FLRL 1BQSA 1Q72H 2BVUA 2BSRB 4DQOH 5EFIB 1VKXA 3G6AB 4MQ7A 2G2RB 1MRCL 5I8OH 3QQ4A 3MRHB 4Z8FH 5KVFH 3JV0A 4RNRB 4HV8B 3WS6A 5JHDD 1QA9A 5J1AB 3GSUA 4X4XB 1FL3B 1MVUB 1XGYL 1XR8B 1B0WA 4JZJB 5EU6D 3SKNA 2DIBA 3V79C 1TCRB 1PY9A 2X2YA 4XCCH 4YXLH 4GG6A 4EUPH 3WBDA 3WIHL 4MA3A 1RZIB 4FQ2L 4HGKC 4U1KA 5CWSA 2AEIT 3NA9L 3D25B 4BK5A 2WV3A 3L3IB 1EX0A 3KJ6H 4BSJA 3QNYB 1NLBH 4F8QA 2X09A 3U7AA 4KJQC 1BOGB 3NPSB 3TBSB 4MD0B 1UQSA 4HLZH 1YEJH 1MHHB 3QNXB 1NGYA 4PJCA 1BZ9A 1KTLB 3W81A 1I7TA 5JW4N 4NRZB 4U6YA 4Y2DC 3NFNB 3DOSA 3BAEH 1MHCB 3BP6B 4R7DB 5SWZE 1GIGH 4WO4B 3HUJE 3O8XB 1CXFA 2BNRB 4BKLA 1MFEH 3U36B 3IVKA 5FAAA 3QJHA 4IRJC 4LLUB 1G7IA 3FT2A 5E00B 3NZHL 3DX6A 3FFCD 4PRPD 1FNGA 2B4CL 2QQLL 4D0CB 1AJ7L 1FFPA 3TVMC 2KL6A 1PLGL 2VQUA 3SDCC 4P9MH 1OD9A 1HQRB 3EYOB 2PXYA 2VIRA 1T4KA 2DLTA 2R1XB 3DX8B 1JNLH 5D7KD 4OQTA 1S7XB 1CGSL 5BZWA 1GXEA 2BX5A 2YD7A 4ORZC 3HZMA 1XFPA 1D9KC 3MZGB 4MCYB 1WGOA 3IFPB 2VLLB 5D7SL 3VFMB 3F7QA 4HKZA 4CDHA 5SWQB 5CSBA 4P2QE 4EOWL 5FGCB 2J88L 5GGVY 1D5ZA 5T1LB 4HQQH 3BWAA 3KYAA 4MQSB 3V7MA 1A6WL 1VA9A 2D7TH 2EXWD 1ZWIB 2SEBB 1WAAE 3GJFA 2ZPKL 3SKOB 1DQQA 1X5XA 3MR9B 2CLVA 4HHAA 1QLRB 4BSWA 5DO2C 3LQAL 3I3DA 4IS6A 4YAQB 1KV3A 2P8MA 1G7HB 2V5SA 3HC0B 1OTSC 5ACLA 1JHKL 1YC7A 3MV9E 5TF0A 4K9EL 1IM9B 4YIQB 1MWAL 4PIRF 4I0PD 5ISZB 3MCLH 1EJ6A 5IBUG 3ZHKA 2XZCL 1NMCB 4JKPL 1DP0A 2HFFB 2EDJA 3C60A 4X7TA 5JO5A 3FB7B 5B21A 1QP1A 5DHYA 1HXMA 2EYRB 3G04A 3IGAA 3NZ8A 1AGEA 4MD4B 3LVEA 4KK8C 3VI4E 2HT2D 3C5SA 1JF1A 1I9IH 2VDRL 4DTGL 4JY5L 1FZJA 3DTXB 4MDJB 5DI8B 3BVNA 1MRDL 3T4AA 5H35B 2NY5H 4P46A 2E5EA 3BRGC 1CXHA 1AGDB 4NN5B 4P2RD 1WT5A 4CJ1A 2XOTA 2EKJA 1FAIH 4HS3A 4KKNA 5D2LB 2ITCA 2QADB 3H9SA 4NBYB 5D7LE 3OWEA 5FK9B 4O51B 2YPLB 2DN7A 2I27N 4OQTL 1ZANH 3QIWA 5J4MA 4XMPH 3IYLW 5F7EH 5KSUB 2XY2A 3I75A 1DVFC 1IAIM 3MRMA 4ZPTA 5SWSD 5HGBA 2E9JA 3MUGA 4B7LA 4U1SB 1NBVL 3NABL 5I15H 1TETH 5J57B 3OAZK 1UH3A 1AE6H 4PJ8A 4L8DB 4KJYB 1QFWL 1IAMA 2AJYL 4U05A 4E5XA 1T0MA 2NY4C 1I3RB 2BNQD 3CC5B 3AM8A 5HHXL 5IW6A 1VGEH 4OUUB 1J1OH 3HRZA 1QSEE 1U2CA 4KUZL 2MNUA 2OCFD 3VFRB 4PJDF 1C5BL 3RWFA 1DBBL 4Q9QL 5EOQH 3WYRA 1UWGH 5GGSB 5CZVH 4FQJL 2BDNH 3GMPA 3V4UL 4N8VG 4U31A 3LRSA 4RX4D 3REWB 1IILE 5D8JL 2NXYB 5EIQA 4HUVB 2FR4B 4Y16B 2NNAB 2W9LA 1F6FB 4RGOL 1DBAL 4RMSA 4Y19E 3CUPA 3X3FH 4F37F 3QRFM 1FFNA 1AGCA 4UMGA 5E9DE 1NGPL 4O2FA 3EW3B 3JWDC 2BFVH 1X5GA 1RFDL 2PYED 4G8GA 3PV6A 4TSAH 1Y6MR 3QXTA 5IM7A 1GC1C 2XG5A 4LVHC 5LQBL 1T2QL 4ODUA 1KIRA 1OAKL 2HLFD 1AKJD 5ERWB 2Z31A 3JV4B 4Y1AE 1A6AB 2CKBB 3QI9C 4U1MA 1AO7E 4XP6L 2BVTA 2HA1A 4MA1B 1ES0B 1NC2A 3O4OB 2VDMH 3SDXA 2VDNH 5DJYA 1H3XA 1ZLWK 3FOMB 1FG2A 5HPMB 3B5HA 2OL3A 2R1YB 4M1DL 1JYWA 4XMLH 1KC5L 1NUFA 3E2HC 2F54E 4HEME 5HYQB 4N0YH 3ALWA 1C16B 4LIQE 4U1NB 5BVPH 1J18A 1RZGA 2OM5A 5CEZD 3PWUB 2XTJC 3FKUS 1U95A 3JTTA 4NQDD 5IB4A 1DANU 3D6GA 3T65B 2NYYC 4F7MA 1L6ZA 5DHXB 2NPLX 3GBML 2EYSB 3HCVB 4MXQC 2IPKA 12E8L 3HNSH 1X5JA 3P4MA 3PWPD 3IETA 2DJUA 1M4KA 4HSQA 1F3JB 4NC1E 4V1DE 4OV6F 3V6OE 4IRSC 4DFIA 2XWBB 1PYWA 4PUBH 3H42H 2A73B 3HUJF 1BQHG 1QNZH 5CZXD 2P43B 3DMMD 2XICA 4KROC 3T0EB 8FABB 1I7RA 3SPVA 4LHUD 4FP8L 5MEOA 2BY1A 2BXYA 4XPBH 2GTWA 2WZPD 1KT2A 3VDBA 4MNHA 2E9BA 5BZDA 4LGPB 3QHFL 2AV1B 2R69H 4U3XA 4ZAKD 2QR0A 4LDEB 4WFED 1CK0H 3JWOC 4L3ED 3ES6B 3K1DA 3WN5C 4BH8B 1FO0B 3CK0H 4J23A 4ODVL 1CBVL 4LF3A 5KVGL 3IDGB 5FV1L 3DV6A 4P9HC 5IMOA 2PYFB 3VXQB 5L2KE 4LCWA 3VFWA 2AABL 2PCPA 4QGYA 3WXWH 1A6UL 1F4HA 4O2EA 4BQ9A 1T5WA 3G08B 4AENB 5J6GA 4Z77A 3T77B 1YC8A 4UT6L 3WD5H 1CFSA 2I25N 2OL3L 1QLEH 3SEPA 2NX5E 1FZMA 1PQZB 2UYLA 4AIZB 2ICWI 4QHMA 4AEIL 2P8LA 2J5LB 2YPVL 3MZTA 4IOFC 4M62H 4WUUB 4AK1A 1DQMH 5F88A 4DEPC 4HX1A 4D9QE 5IB1A 4X6CB 1DDHB 1XF2B 1BVLA 1B6UA 1H3TA 4NKOB 4PS4L 5I16A 2YEZA 4P5MB 2VDPL 2NY2B 4NNYB 4G3YH 4MD5B 2A0LC 4FXKA 4GW4A 4ONGH 1F90H 4KMQA 5FYLH 2R4RL 4R6UA 5FA4A 1LO2L 3QUZD 1J1XH 2FYYB 1ORQA 3VI4F 1LO3L 3O6KH 4N0CC 1YEHL 5KS9E 5TE7L 4Q9BA 3SKMA 4MNQB 2BVOA 1S9VB 5I8CB 1KEGH 2NLJB 4JFFB 3PDDA 3RDTB 3ECBA 5BMFL 1K3IA 4Z76A 3WLWC 2WWMC 3HI6L 4UNUA 1TZIB 1KYOK 1ONQB 1WC7A 3C8DA 1OAXH 4R8WL 1UYWL 4TVPH 1U8QB 1MCDA 1PVHA 2HFEA 2K9UA 4NKDB 4NSKA 5IWLC 3L3JB 2HKFL 4JPIB 4X80L 3RKDC 1HSAB 1Z9SA 2XZAH 3OAZH 4OCXH 1CLYL 4JFXA 5IHLB 2BC4B 2IPUG 5F7HA 2YHGA 4OIIH 1CXKA 3U0PA 1TVHA 1PSKH 1VFBB 4W81A 3E6HA 2YRLA 5C07E 4P2RB 4HG4J 5KSAD 5D1ZD 2YOCA 3GMMB 1HCVA 4FXLA 5FM5M 1T21A 2CDGB 1S7VA 4M6OH 2AK1L 3TPKA 2CR6A 3H9HA 4OGYL 3ROOA 2FWOB 4YZFE 2Z92A 3BDBA 4HWZB 5HYJD 2MPAL 1IEHA 2HKHH 2BVPA 3MODL 3TJHC 1QLFA 3WIIL 1TQBC 1X6LA 4Z7QE 1HHHB 4G6JL 4A6YL 3WUZA 1Y0LB 2X9XA 3JTSB 1QSVA 4NQVA 4NNPL 1NCTA 5SWSB 4DZ8A 1RUMH 3DXAB 4D9RD 1KCRL 4F33A 4WW2C 2EECA 3P0VH 5J1SC 3EFDH 4RA0C 4J8RA 2HJLA 2LFGA 3BZFB 4EI6B 4X0KA 5AZEH 4OZHB 1F13A 2VLKB 4MAYD 5CJ5A 4NWTL 1UZ8A 5IROA 2BNQB 5DHVH 5INDA 5E5RB 3PWNB 4F7EB 3KHQA 4Z7VA 5DC4B 3UBXI 4F7CA 4KK9D 4UV4H 4LFHG 1M71B 1DSFL 5JZ7C 4KTEH 2F19H 4DFHA 3DROB 2EE9A 5D1XC 4G80B 1IEAA 3VD7A 2H2PC 2BXZA 4C4KO 4ELMB 1A7BA 5E08H 5L0QC 2RJMA 4K71B 4NRYB 3OR7B 3TBWA 3OJ2C 1Q0XL 1ZLWH 2V5RA 2EICA 3HFMH 4KMLB 4QNPE 3D2UA 1OW0A 3EDDA 3MRPA 3TEUA 1RUAL 3JWDH 1WWCA 4MHHI 1PG7X 2X9YA 4X6BB 4D0DB 3U6RA 1QFPA 2D7MA 2EXYD 2V7HB 4LQFH 1GC1H 4PTTB 1B2WL 4AL8L 5GS0C 2PYEB 5HVGB 3O4LE 1JWMA 5FM8A 5GGQH 5J11B 3ARTA 1BM3L 3GI9H 2FJFA 1CICD 4WI3A 4QRPB 1JMZA 1A0QL 1AKJB 2P24B 1PW3A 2X7LA 1LO0H 5DMIH 4HPOL 4KDTA 5D1QD 4WHTB 1MJUH 5B38B 2XFXA 2FECL 1H9VA 1IEBA 3BKYL 4YNYB 4FABL 3LEXA 2EC9U 4IRZH 3RVXD 4PGBB 4K07A 2YXMA 4XVUC 4ZUSB 3SJVB 4NPYA 2Y25A 1NEUA 2VDKH 4ODSL 1VERA 4PRID 4KWUA 2X4TB 2BSRA 5EFIA 2YWYA 3G6AA 2EDEA 2VZUA 4NQDB 2G2RA 5IGXH 1QG3A 2GSGB 5GGTH 3MRHA 4NJ9H 4OT1H 4RNRA 4HV8A 4M7LL 3SDDD 5J1AA 4X4XA 1FL3A 1MVUA 1XR8A 4JZJA 4FZEH 3V7AG 5CJXC 1TCRA 3TWCH 3I6GB 3ISWA 4LSUH 1SMAA 5DQDH 4LDOB 1RZIA 1RD6A 4L9DA 4Y5YC 3CFCL 3LRGA 4PLJD 3D25A 3T3PE 1AH1A 3L3IA 1N0XH 2XA8L 3H9YA 2WUCL 3VXUB 3QNYA 3UTZB 2V2WB 1KEMH 2YKLL 3GHBL 1AI1L 2AK4D 4LHUB 1BOGA 4NQCE 4RBPK 4WDIB 4MD0A 4OF3A 3FRPG 2C3WA 5DWUH 1MHHA 3QNXA 3MRDB 4YWGH 1KTLA 4ZAKB 4NRZA 3KYMB 2AI0L 3PWJB 3CVIL 4EEEA 3GKWL 2CIIB 1MI5E 3NFNA 4L3EB 1MHCA 3BP6A 2LAAA 4R7DA 5CJOH 3KLHD 3EDEA 4WO4A 5DEGB 3O8XA 2BNRA 4TNWF 3V8CA 4P9HH 2ADJB 4LK4A 3LKOB 3VRIB 2YC1B 3P73B 4OZFB 5DEFB 1JF5A 4LLUA 5E00A 3I9GH 2DQHL 2D4FA 3GMNB 4D0CA 2GEEA 5F6HI 4JFEE 1HQRA 3EYOA 3QCTL 3X3GH 1WTGT 1LILA 5BVJB 3ULVD 3DX8A 2R1XA 1EZVX 3WCYA 3A0OA 4QTIL 1S7XA 2MOVA 2B1AH 3RGVC 4RMTA 5MEND 1F8TH 3NN8B 3WSQL 3GB7B 4M93C 3MFFB 4MCYA 1IQWH 1FNSH 3IFPA 2VLLA 4KMTH 3VFMA 1GZQB 5SWQA 5T3ZL 2B7DT 4GG6E 1CTNA 4JCMA 5T1LA 1QFWM 5E6IC 4OZGB 5DRZB 4D9LH 3EOYG 3H9ZA 2SEBA 1F4WH 1ZWIA 3QUYB 2ICWB 3SKOA 4L29B 4N68A 2FHCA 3MR9A 4GMSL 5FUCC 1QLRA 3GSWB 3BSZL 1KCSL 4YAQA 3RNQB 2IPUK 3DETD 4XPGH 3IFNH 1G7HA 3NBNA 1CZ8L 4PJCE 3MLZH 3HC0A 3TA3A 3T08A 5C09E 5CILL 3EO9L 3OAYK 3K81A 4YIQA 4JFQB 5ISZA 4PJ9D 2DMCA 4NZUL 2ATPB 4OI8A 2HFFA 5EUOB 2Z91B 2YRZA 5DZLA 2HMIC 4QRRB 5EU5B 2OQJB 4AMKL 3V6ZB 2EYRA 4LRNH 1NCBL 4S1RL 4WW1B 3KYOB 5FHBL 4MD4A 5I75B 3KLSA 5CGMA 1JFQH 3AREB 3NAAH 4YZFF 4LSQL 3SDYL 3I50L 4I3RH 3KYKL 4OFIA 4Z7QF 3DTXA 5GRJL 4MDJA 5DI8A 1T66C 1H15B 2NY7H 4UINH 2F5AL 3MNZB 4ZYKB 1AGDA 1J0JA 3UYOD 1IGJB 1VSCA 4QRUB 2VAJA 1JN6B 5D2LA 5T1KA 3E3QC 5FK9A 4O51A 3MV11 3QFJD 1EA9C 2YPLA 4XCEB 4MWFB 2IPTH 3CH1B 4YFLI 4Y4KC 1CE1L 4JRYB 5KSUA 3MUZ1 3G5VB 1C12B 5HYJB 3ZSTA 1FRGL 5TPWH 2ZCKL 3V6BR 1NC4D 5FCUL 3Q5TA 4ODHL 2ARJB 2X4UB 3QDJD 1X3DA 4U1SA 1E4XH 4TRPH 4XNUL 2PR4H 3AC0A 4S1QL 4KY1H 4M6NH 2XTLA 5BO1L 3ARBC 4KJYA 1E28B 4L8DA 1SY6H 2OX5A 4LPUA 4WWKB 4ZSOB 5T3ZD 1Q38A 5DJ0B 1T03H 3RX5A 5D72H 1I3RA 1SBBA 1I3UA 1L7IH 3CC5A 1TJHH 5TQ2H 1W8OA 4P59H 4OUUA 3WFEL 3E0GA 3KPPB 4WV1C 4QNPF 1TQCB 1JGVL 4JQIH 3MLTB 5IBTL 4TSBL 2NY0D 5EBLB 3VFRA 4ZQKB 2DOCA 3RWEB 1WICA 5GGSA 2F8XC 1U9KA 3OGOE 3LQZB 3LZFL 3ULUC 4FFWC 4ISVB 1R3LB 3REWA 1HN1A 3WEXB 5I1IH 5DJ8B 2OI9C 1WVZA 5HPOA 4HUVA 2FR4A 4Y16A 2NNAA 1SEQH 1BJ8A 1T83A 2FX9H 3EDKA 3MJ9H 1AY1H 1P53A 4GRLD 3H9SE 2ERJC 5GS0H 1A21A 1V7ML 3LD8B 4HUXB 1UZ6E 2NY6C 1YY9C 4N0FB 1G7QB 2DJSA 2X1XR 4TYUA 4W6YB 3HAEG 4TTDC 4J4PC 4UTAL 3EYFB 5ERWA 1BP3B 3JV4A 1E4JA 1A6AA 2CKBA 2G9HB 3LKSB 1RU9L 1H3PL 2BY2A 4R4ND 1ES0A 5F1OB 1DQLL 5HJ3B 2DQEH 5JDSB 1A1NB 1N5YH 5D1QB 4GKZB 1UEYA 2B1HH 3FOMA 5HPMA 3W11C 1F4XH 2P7TA 2LU7A 4FFZL 3QUKB 4X9FA 5CCKH 5E8NB 4Z78B 5HYQA 1C16A 1RZKH 2NY3C 4U1NA 1FHGA 2WBWB 3RU8L 3PWUA 2MQCA 4Y4HB 5HHOB 2J4WL 2XI9A 4LPXA 4PRIB 2V9RA 4RBPH 4AG4H 3BJ91 4G7YL 5H37G 3T65A 3TO4B 1CYGA 4XAKD 3HCVA 2EYSA 1BZ7B 3K46A 1FIGH 1P84J 3Q48A 1UM6L 4KRNA 4Y5XB 1F3JA 3SDDB 4O9HL 2QHRL 3ETBF 1MUJB 2XWBA 1TPXB 1YQVL 1LP9B 3FQUB 4MJID 5LWYL 2A73A 1CXLA 1UACL 1V7NL 4PGDB 3T0EA 5DC9B 8FABA 1JHTB 1LEKB 2R4SH 4BM7A 4TULL 5JW3H 4G8GE 5A2KH 3V4VL 5CBAB 3QO0B 5FYKD 1UJTA 2AV1A 1SJEB 1O5DT 4HC1H 5J3HC 3RY4A 3ES6A 5LCVH 1IL1B 2A9NL 2JJSC 1FO0A 1TNMA 4FMFA 5IVXB 1WBZB 1KCVH 3D0LB 3IDGA 3SDXE 4UQ3B 5GGVL 4JCLA 5HI4D 3TH4T 1J11A 2FX7L 3QO1B 1XMWA 2PYFA 3VXQA 2CKBL 2DQFB 3CVHB 1XIWC 3G5YB 5E1AB 3UPCA 4P4KD 3FQRB 1QBLH 5GHWL 3U4AA 4M5YH 5KZCB 4LPTA 3G08A 4AENA 3T77A 5F71A 3IU4H 2YPKB 1YJDL 2ICCA 3B8YA 4RFOH 1XR9B 4JM2D 4MA7H 3LEVH 4S1DC 3VJ6B 5C0RH 3REVB 1KXVC 5HDQH 1PQZA 1QUNA 5FKAB 4CADB 4AIZA 2Q8BL 4WUUA 1MNUL 1U8PA 2NY1B 3OAYH 1K85A 3BPNC 4X6CA 1DDHA 1XF2A 5DQJB 4PJCF 5FB8B 4NKOA 3R0MA 4M61B 4ZXBC 4JVWA 4M6ML 4P5MA 2VKWA 4XPAL 3TO2B 4NNYA 1R3KB 1QSFB 2W65B 4MD5A 5C0JB 4R90H 2AW2A 2Q86B 2P5WB 5GPRA 4JPWL 2WBJC 2VDOH 3IT8D 1OAUH 1KN2L 4QWWC 1R0AL 2FYYA 3EO0B 3VFTB 1JJUA 5I18H 4P4RB 4Q2ZB 4KI5C 4IDJL 3RTQD 5B3JE 3OG4B 4APQD 3CFIC 2H1PL 2VZ1A 4MNQA 1S9VA 4S1SH 1URLA 3C6SB 5I8CA 2NLJA 1JZ3A 4JFFA 5F7MC 1R3IH 4PJ9B 5DXWA 1PKOA 5TFSL 4XAWL 3ARGB 4J3WA 3RDTA 2OXHA 5GRVK 4LCWE 4W68A 5KJRH 1HKLL 3VA6A 1DLHB 3HTLX 3MLUH 3DSFH 3EHBC 1W0WA 3EYQD 1TZIA 3IRPX 2ZUWA 3GBNH 1ONQA 1G6RB 2VSCA 4K3JH 4NDMB 1U8QA 4NKDA 1JNNH 3DI2B 4UNTA 4MAUL 3L3JA 4HT1L 4CW1B 1IGIL 2OP4L 3SCMB 4YHKL 4QKXB 1W8NA 4JPVH 2HFGL 4JPIA 5F7KC 3ZMRA 1HSAA 4M3KB 3F5WB 1A3RH 3MBEC 3B9KD 2AJVL 1SJXA 4RQQB 5DS8B 3MV7B 5CHNB 4BUGA 2HTLC 5E7BA 1VFBA 2DDQH 4P2RA 3GEWB 3NGBB 4R26L 5IQ7H 3GMMA 1P6AB 3HG1B 1RURL 2LVCA 4NN6C 4U7KA 1E4KA 2CDGA 2W0KA 4RRPG 2D7OA 3I6KB 6FABH 2IQAB 1J8HD 3OKEB 1YMHB 4X7SL 4ZODA 2FWOA 4HWZA 3QFJB 4PB0L 2D0GA 1E4WH 1T7ZA 2I26N 3GSOB 1HHHA 2EDTA 1T6WA 1Y0LA 3JTSA 2VLJD 5SWSA 5KANI 1A9BB 3DXAA 1G9ML 3C2SA 1BWWA 3TIEB 1MLCB 5E99L 4CBPA 3EUUA 1CGUA 3BZFA 1YQ2A 4EI6A 4JFZH 4KVNH 2A83B 4JFHE 4OZHA 4XNYH 2VLKA 4PREB 5FYJL 5I74C 1MAJA 5GRYA 3MQIA 1I85C 3VWKB 3PWNA 4F7EA 3KJ4B 3SE9L 2ADIB 3O3AB 5T3XL 3F12B 1M71A 3MNVB 5EA0L 4LMQI 4ZO8A 3DROA 4OLZL 5DD5L 4OCMC 4G80A 2EIEA 2XQBH 2BOCB 1UZ6F 4ELMA 3ULUH 5FFLA 2RCSH 4GQ9H 2L7UA 4DUXA 1RAMA 4NRYA 3OR7A 3DBXB 3TYGH 3QA3B 4JN2B 1P9MC 1QYGH 3B2VH 4G42B 3KNBB 2XN9D 1ZGLM 5L88H 4WFHD 4X6BA 3EOBB 5DD6B 5IVZB 5A1AA 2V7HA 2J7LA 1X5ZA 5GISH 4GRLB 4PTTA 3SDAD 1UM4H 4L9LB 4PRHD 4UBDC 2V6HA 1DBMH 2OZ4L 2NR6C 5F6IB 1RJZB 4XTRD 1MCPL 5HVFB 4QRPA 3OXSB 4IOIB 1AKJA 4PJXB 2P24A 1FSKC 3PL6A 4WHTA 5CMAB 1QKZH 5DR5L 5B38A 4N8CH 3ZHDA 4YNYA 4XP5H 2FD6L 4KQ3H 1BFSA 3OKOB 1KNOB 1MCWM 4PGBA 2DLEA 4JKKA 4ZUSA 3QHZH 3SJVA 3VDAA 3RZCB 1DEEB 1X5KA 4DGIL 1JGEB 1UC6A 1YEKH 1TLKA 3WUWG 1I1AC 4Z5RB 3C9NA 1WWWX 2X4TA 4Z7VE 3OKMB 1OB1B 2VXSL 1ZV5A 3OPZH 2GSGA 2OTUB 1CGTA 2CK0H 2F5BL 3KLDA 5HY9B 1FYTD 5EZIL 4DGVL 5K9KB 5DK0B 1N64H 4GS7C 1VADB 3ZDYE 1FL5B 4LHJB 5HI3D 1XGTB 3I6GA 1EHLH 4YXHH 5ID0B 4KGJA 2OLDA 2QQKL 3QUXC 2IH3B 3SDXF 4FQXD 4FOMA 5DFWH 3VXUA 3QR2A 3UTZA 2V2WA 4ENEC 2FGWL 4LHUA 1WK0A 4ZS7L 1JTOA 4HCRA 2CXKA 3VG0H 2BERA 4WDIA 3MRDA 2DQDH 3X11B 4ZAKA 3KYMA 3PWJA 3GO1L 2K3TA 2VDLH 2CIIA 1KTKE 3OGCB 1IT9L 5FDYA 4L3EA 5DEGA 2XNAB 2K7PA 1MCRA 4NBZB 5DGRA 2ADJA 3VRIA 3LKOA 3UTTB 2YC1A 3P73A 4OZFA 4KVCL 3HE6B 4YC2B 5DEFA 5AG9A 3NCMA 4KK5C 3GMNA 32C2B 3O6FC 4PGEB 5ESQB 3WLBB 3CPLA 1G1CA 5CUSH 4IMKC 1OGTB 5JXAL 1YYLL 4J7RA 1EHXA 5BVJA 1KB5B 3S4SG 1UFUA 4P2OD 3BQUD 1F97A 3C2AL 3NN8A 3GGWB 3GB7A 3GI8H 1OOAA 3MFFA 2J6EA 3KYNB 1GZQA 5DD1L 3SOBH 4OFVA 1N4XH 5FHAH 3T1WA 5GS2D 3FCTB 1CLOL 1F00I 4Q6IC 4G8EB 4OZGA 2H2SC 1XCQB 5DRZA 5D9SB 3QUYA 2ICWA 3IS1X 3MCKB 4L29A 1KUMA 3GSWA 3LDBC 5JXEA 3RNQA 4K8RL 5A43C 4K94L 1KOAA 3LMJH 5AD0B 3LHPH 5I19H 5C92A 4HPYL 4LEXL 4JGJA 5T5FH 4C55A 3QEQB 4HIIB 4ZD3L 4HCRL 1HDMB 5E8EB 4JFQA 5EOCJ 4Z18A 1ZVHA 4OLUH 4HBQA 3A6CL 2ATPA 3VGEA 5EUOA 4APQB 1KBGL 2Z91A 3HI1B 4PD4K 5JIPA 1S7WB 5C0GB 4W6WB 4PY7B 2W60B 4QRRA 3GRWA 5EU5A 2OQJA 2DRUA 4WW1A 3KYOA 3IJYB 2Q76B 2MQ3A 2VQTA 4M1GL 3AREA 4BQBA 2APXA 3RJDA 3GK8L 4AQOA 5HXMA 1T7WA 2O5XH 3PQYD 3EJYC 4KKAD 4NHCL 5I6XC 1H15A 2MWCA 5KTEH 5L6YL 5GRXG 4LLMB 2WIIB 1MQ8A 3MNZA 4ZYKA 4PJGB 3LAFA 1IGJA 5J89A 2GJ6B 5DRXA 4QRUA 1JN6A 1EZVY 4CVWA 1JPFB 2BCKB 5B39G 5CKAA 5FGCE 3P0YL 4XCEA 4MWFA 3CH1A 3TVMD 1J8HB 4JRYA 3UXFA 3SDCD 4PJ5D 3G5VA 1C12A 4I18B 5HYJA 1EPFA 1JUFB 4L4VD 4OM0H 3MX0A 4NKIL 2ZUQC 4K7PL 2ARJA 2X4UA 5TE6L 4POYA 3MA9H 2KKQA 2AKRB 1CF8H 3WIFB 5DJCB 4OLWL 3BT2L 2P4AB 3MXVH 3I2CL 1E28A 4WWKA 1GGBL 4ZSOA 5C0AB 4P0DA 4DGYH 2OK0H 2ICES 5DJ0A 2G5RA 3CLEL 3BE1H 1MREL 5ISZE 4G9FD 3O2WL 5E0QA 3KPPA 1MCQA 4DKEL 2Z8SA 4G6KL 3MLTA 3VH8B 3I85A 5DJAB 4I13B 1YNKH 5EBLA 1RZJC 2LU4A 4WGVB 2DQIL 4KGLA 4ZQKA 2NW3B 3RWEA 3RAJH 3LQZA 2BSSB 2D9CA 3QISA 4ISVA 1OTSD 4HUUB 2NZ9C 5DA4A 1R3LA 3LIZH 3WEXA 3U4EB 3HE7D 4F15C 3EYSL 3GRWL 5DJ8A 2OJZH 2AAVA 2DWEB 3ARRA 3HB3C 1TTUA 3RA7L 3FB8B 3MRQB 4OCWH 4PD4J 2WUBL 4FFVC 2DM2A 4N0UB 4NQSB 3OHXB 1YMMB 3SGKA 5I0DA 5D2LE 3HC4L 1Z3GL 5JW4M 4OCRL 5C9JA 2YPLE 4XVJH 5I1EL 4HUXA 3W2DH 4BYHA 5IIEB 4N0FA 1G7QA 2E9WA 4LSSL 4X5WB 1NCAH 4XRCB 2ZKHH 4OIBA 1GRWA 2D9QB 3L9RB 3EYFA 4NQEB 3N9GL 3LKSA 2G9HA 1S3KL 4Z7VF 4BQ6A 2YD8A 25C8H 5EULV 1A7RH 3K4ZA 5HJ3A 1P4IH 2DM7A 4HJGB 5C08D 3V9FA 5JDSA 1A1NA 3CX5K 1XF5B 5D1QA 4GKZA 2XY1A 4D8PB 3UTSB 3QUKA 5E8NA 3B43A 1ZT7B 4Z78A 3MLWH 5HGHB 3ZDYF 5JIIA 1KCUH 3Q6GL 3GKZA 4Y4HA 1DVFD 5HHOA 5GS1B 3AFLA 4JLRB 2XA3A 4RMVA 3KLAB 3V0VA 4PRIA 3QDMB 3TO4A 3FN0L 5D2NB 3QPXH 2EDKA 1BZ7A 1X44A 2LTQB 2CH8A 5DURB 4Y5XA 4RISH 3SDDA 1NMBH 3P3YA 4XP1H 4XNXL 3NCJH 1FBIL 3HMXA 1CR9H 4HGMA 1NSNH 4J2XA 1MUJA 4MJ4A 4LSVL 5GRUL 3FQUA 1LP9A 3QRGH 4XNZC 5EUKB 1BIIB 4JO1L 3CJJA 3T2QA 4F9PC 4PGDA 1A5FL 1TTFA 1JHTA 1LEKA 2OR8A 5DT1H 5C2BH 4FQXB 4GAJH 2VLMD 3RVTD 4TPRL 5CBAA 2MSPA 3QO0A 3MRLB 3NOIA 1J5OH 4CVUA 5A3ID 1SJEA 4OB5L 3ZDXE 4XI5D 1JPSH 1TVDA 4K3DH 4H1LB 4XXDB 3F7VA 4XCFH 5CS7A 1OTTD 2P44B 1IL1A 4UV7L 4EIGB 5IVXA 3MUJA 1WBZA 4XP4H 3D0LA 4HDIB 2EO1A 2E27L 2IGFH 2VN4A 4UQ3A 1IC4H 3QO1A 5BCAA 3H7LA 4FNLH 3TV3H 1YEFH 2DQFA 3CVHA 1BAFL 3G5YA 2J3SA 3UJTL 5EN2B 1T04B 5E1AA 2R2CA 4H20H 5JOFB 3FQRA 5I1DB 1VACB 4HWEL 4YO0B 3NCBB 1LGVA 1FPTL 1YUHB 2YPKA 1AXTH 4QOKB 3BRFA 1XR9A 3VJ6A 3REVA 3QI9D 3BMWA 1LD9B 5FKAA 3CX5J 4CADA 4UOJA 3D5OF 5KVEH 1DQTA 1IGMH 4M8VA 3BYYA 1A6ZB 1SMOA 3QIBD 3TYFB 1IAIH 2WP3T 3BQUB 4OFDA 4ONOA 4PYGA 2VLRB 4N90E 4JO3H 3UZQA 5DQJA 3FMGL 5FB8A 2IBZY 3PHQB 4M61A 2R0KH 4JQXA 2VDQL 4LOUD 3TO2A 2E8ZA 3VFUB 5F7WC 1T89A 2XTJD 5I9QC 1R3KA 1QSFA 2W65A 5C0JA 2EXWC 2Q86A 3T0EE 3UJJL 2P5WA 1FDLL 2NYYD 4OI9A 2VERN 3VCLB 4GMTL 3VD9A 3HMXL 4JM4H 3B5GA 2DLGA 3EO0A 3VFTA 4PJHB 4P4RA 3DPBA 4Q2ZA 3CSGA 4M00A 3SE3C 2VN7A 3L1OH 2B2XH 3PP4H 4W4OA 3MJ6A 2APBA 4I0PC 5TGBB 3EZ8A 1L6XA 3C6SA 3G6JB 1INDL 4PJ9A 5E2VL 4KROD 3ARGA 3OZ9H 1DEDA 1P2CB 1FNLA 5L9DH 3MRRA 3UCRA 1FNEB 1HINL 1DL7L 1G6RA 4I3SH 4NDMA 2PKDA 5IT2H 4CW1A 3SCMA 1F58L 1PJ9A 4JFDE 3K1KC 2F53D 3NFPA 4HMCA 1OPGH 3QHTC 3BEVB 2ZCHH 3F5WA 3O3DB 3CVHL 5C86A 4ZFGL 4Y2DB 4LARH 4NM8H 5DS8A 3MV7A 1FE8H 1TZGL 5CHNA 4POZD 4WUUE 1GAFL 4Y7MA 3HG1A 4X6CE 3MRFB 4R2GC 5FYJU 2N4IA 2B4CC 2ESVD 4IRJB 1C5DB 3I6KA 1U3YA 1VENA 2IQAA 4Y89A 1ADQH 3OKEA 1YMHA 1RK1B 1U3HB 1BQLL 4NZTH 3QFJA 1S7UB 3D0VB 3IXAB 2GTZB 3TVMB 1GPOL 2EZ0D 3GSOA 4H88L 5I1AB 1A9BA 4L4VB 3B9AA 3NIGE 5TE4H 2HG5B 2W9EL 2FATH 4GT7A 1MIEL 5E70A 5FKPB 3T4YB 4GRWH 1MLCA 3MROB 4LVEA 4HJ0C 3TIEA 1D9KB 2A83A 1BLNB 4PREA 3U46B 5F7DB 3D85D 1IQDB 4HW6A 1NANH 3K8MA 3S34L 4UB0L 4MNQE 5JUEH 3VWKA 4JFFE 4KKBC 2BZDA 1MFDH 4RGNB