4M7JH

Crystal structure of s25-26 in complex with kdo(2.8)kdo(2.4)kdo trisaccharide
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
219
structure length
219
Chain Sequence
EVQLKESGPGLVQPSQSLSITCTVSGFSLTTYGVHWVRQSPGKGLEWLGVIWSGGSTDYNAAFISRLSISKDNSKSHVFFKMNSLQANDTAIYYCARMRITTDWFAYWGQGTLVTVSAAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S25-26 Fab (IgG1k) heavy chain
publication title Groove-type Recognition of Chlamydiaceae-specific Lipopolysaccharide Antigen by a Family of Antibodies Possessing an Unusual Variable Heavy Chain N-Linked Glycan.
pubmed doi rcsb
molecule tags Immune system
total genus 38
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-08-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7jH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4m7jH01
1H0DA 3QIWC 1R6VA 3MRRB 3MREB 1D7FA 5FYKE 3BZEB 4GXVH 1KC5H 2VISA 3AAZA 4X6DF 1X5HA 3QWOB 2ORBH 3E2HB 3PNWB 5HDLA 2R1YB 3WO3B 3DRTB 3VXUD 2ADFH 3ECBA 4CMHB 1JWSB 2QSCL 5A2JH 3RVXD 1X4YA 4Z76A 3SKUD 1HSAA 4K9EL 5GPRA 4YNYB 5IFAL 3W39A 4JO1H 3AVEA 4MHHI 3M17A 4S1DC 5F3HA 4ZFOB 5KOVC 4CVXA 4PD4K 2E3VA 4O51B 1T83C 2PO6B 3BZ4B 4O4YH 2OR7A 4D94A 4I9WE 1BBJB 1FYTB 5EOTB 3KJ6H 4Z6AT 4N8PA 3QO0A 4ZOEA 4BA8A 2EIDA 1HIML 2DIBA 3WFDL 4PY8J 2KL6A 4KK6D 2BRQA 4IMKC 1JGUH 1A7OH 1U8PB 3QIWD 4ZD3H 4PJ5E 2O93L 3UJIH 1AQDB 4XPAH 2K7PA 3O3EB 4ONHB 2F8OA 5KTEH 1JGEB 4R4BB 1S3KL 2A74A 5L88H 4TN9A 1RZIB 1AD9A 4LCCB 3ARBB 1V8HA 1RHHB 2XWTB 1DQDH 4J12A 3E6FA 5FHAL 2HJFA 4D9RE 1Z3GL 4KZDH 4WGWB 4XWGL 5KG9A 2ARJA 3IS0X 4ZDHA 1OF2A 5JDJA 4OLXL 1XIWB 4KRNA 3VFNB 4LOUC 4MAUH 3MBXL 1S7XA 4S1DD 5BVJA 3QNZB 5EZLA 5HGAB 3VRLE 2DTMH 4Y4KD 3JTSA 4ZOCA 4X9GA 3BPNC 5I1AA 1NBYA 5EU6E 1WJ3A 3DVIA 4M9PA 3U79A 4G43B 4M1GL 3DARA 3VXQA 3GIZL 1IAKA 5GGSA 3CK0H 1YECL 2Z35B 1GAFL 3HG1E 1T22B 4EUPA 1NGPL 3HR6A 3RIAK 1LO0H 3JV6A 4HZLA 2V2TB 3PHSA 3VXRA 2RCSH 3OB8A 4XVTL 5B8CB 4N8CH 4MJIE 1FHGA 1FIGL 2HFTA 5JZ7C 1PY4A 3PWVB 5JO5B 3U0WH 3RWDB 2V2WA 4NUGL 5HYSG 1VENA 5CJXC 4POUB 2JKXA 2FWOA 4HXBL 4PGBB 4HV8A 5HYSB 5LXGL 1F6AA 4TPRH 2DQIL 1R5WB 4S1QL 2NX5D 4LOUD 1LDSA 4Z7VB 5KN5A 3QYCA 4NUJB 2OP4H 2VRAA 2P5EA 1ODAA 3IGAB 1G7PB 3GNML 1CDIA 3ROLA 5C6TL 3TWCH 5F6HJ 4Z7UE 1U3YA 4E42A 3VXOB 2EDQA 2VQ1A 1FVEA 3BUTA 4XMLH 4LCYA 4JANA 1A0QL 3JWDC 3PXJA 4M6NL 4PJAF 4XP9L 3VFVA 5KAQF 4LPWA 3UAJD 1SVCP 4L3EE 3LD8C 4XCFH 3ZE0F 4OFPA 4Y16D 4ODTH 4WI5A 5DUPH 3MUJA 2VC2H 1CDBA 1GZQB 4FZEH 2DTSA 2AVGA 5FM8A 3FKUS 3TYGH 2Q87A 1IMHC 1ZT7A 2J7LA 2DOCA 4JG1H 4GRLA 3MUGB 1A6ZA 4QXGL 1KLFA 5CIPA 3WKMH 3K4ZA 3BPOC 2BNRD 3PIQB 1BFVH 1KLUA 1IEHA 2EEBA 2G75A 4K94L 3HPLA 4Y19D 4YDLC 3ARRA 3C5JA 5IB2B 5KZCD 2VDOL 5IW6A 1UG9A 1X7QA 1A22B 4OM0L 5DQ9A 3GSWA 3PP4L 3LZFH 2BVYA 1L7TL 3D85A 2YRZA 3CC5B 3VI4F 4NPYA 1TFHA 3RNQA 3GBML 3Q6GL 2XZZA 1PBYA 3BESR 4QKXB 5E6IB 3L5JA 3Q5OA 4C56A 1RZJC 2X42A 5EU6A 5I0DA 5J1AB 1NCUA 1MCJA 3QG6A 5DZNA 4I5BA 2OQJA 2FX8L 3CZFA 1UM5L 3GMOA 3Q3GB 4RX4A 1FFOA 1MF2H 2W9EL 2B0SH 3IFLH 4YH6A 1TJIH 1LO5A 1U91A 4FTVE 4YEFA 5EORL 4RWYH 2JCCF 4HWBL 1G7HB 3MRIB 1FV1A 3I6LD 1LILA 1FVCB 5DMIH 2ITCA 3LRSA 4WY7L 4JY4A 5ANMA 5HYFA 1X4ZA 3B3IB 3C5ZC 4AIOA 5AYUH 2BOBB 2OR9H 2V9TA 2XQYG 4XPHH 1LD9B 2ADJA 1IM9B 1QBLH 1F6LL 3HAEH 4H1LA 3V6FA 1UB5B 5CLWA 2DIJA 4UOW0 5ADPH 3ARFA 3CDYA 4WW2F 1GYAA 2EYTA 5HGDA 3VCLA 1Z9MA 1NFDE 1MHHA 3LQAC 3MRQB 3GM8A 3QDGA 3D3VD 3FHAA 1ND0A 4OKVA 3GHEL 2I9TA 25C8H 1CICD 2HJLA 4Z0XB 5JPNA 5DWUH 2FJFA 3QT2A 5F1IB 1JPGB 2O5ZL 5T3ZH 3TN0B 1MJ8H 2GJ6E 3BYTA 1S7UB 3BP4B 3LDBB 3H9SA 1T7YA 1BQSA 2VLJD 1IC1A 3U0PB 2IAMB 2CKBB 2YPVL 3Q48A 2MMXA 1YY8A 4YHLH 3KXFD 4JCMA 4LSUL 3CLEH 1C5DA 3R1GL 4MNGB 5IW1A 2YOCA 2VLLB 3VDAA 3L3HB 5M94B 2ERJC 4NQTA 1OAUH 2X4NA 3ZT7A 4NQCE 2QQNH 2ATPB 3AY4C 1OARL 1QHOA 1CR9L 5JXEC 3BKJL 3NFNA 5MENB 2BOCA 3GK8H 3U30B 2CO6B 4ZUUB 3FONA 2E27L 3MRPB 4J7RA 3A67L 4M1DH 4MD0A 2EKJA 5DSCB 3O3BA 3CDFA 1IGFH 1YNLH 5IEHB 1T21B 4NJAL 3PQYD 3AS1A 3L3JA 2NTSP 4ZO7A 3BZFB 4NFBA 2OJZH 4OLVL 3SY0B 1X5ZA 3T0DA 1RK0A 5I1LA 4ZYKA 5I1JL 5JIIA 1RZ8B 1ZLUH 4G7VH 1A3LL 3O6FA 1MI5A 1A9EA 4YHKH 4Y5VC 1DBBH 3PDGA 5BRZA 3P73A 4NC1C 1LO2L 1D9KB 3MA7B 3T0WA 3OJ2C 4LVHC 4A6YA 4DEPB 3ULUC 4UT6L 5EBGA 4TSAL 3W0WE 5C0RL 4F2MA 1FL6A 1OAZL 4HKZB 3B5HA 4L3CB 4HIJA 5C0IA 2Q7NA 2R1XB 1DP0A 5KSAC 2AV1B 1JHKL 4HUMB 1KIUA 1YEDB 4PG9A 4K2UL 3TEUA 4IOIB 5IGXL 5JXED 4OGAC 1FLRL 3NCJL 1PVHA 4JN2A 4Q0XL 5J0BA 3L3IB 4X7TB 5HHOD 3KPQA 3MJ7B 1BFSA 1FFRA 5IVZB 1RUMH 4QOKD 4HJGA 1JYVA 5C70A 4HCRH 1S7QA 2M2DA 4HUWA 4RGOL 3WN5C 4KKCD 1BIIB 2HLAA 3IJHB 5D5MB 2K1MA 2VKXA 3GEWB 1G9NL 4I1NB 5IQ9A 3QAZC 2R0WL 4GO6B 4PJ9A 5AZEH 5F7DA 4NO5A 3RWHA 2P7TB 3E1F1 5C86A 3WFEH 1J1PL 1OAKL 5BV7L 1T1XA 4G7YH 5GRWA 5IKCB 5F7NC 4JDZB 1S7TB 1AO7A 1E28A 5JW3H 4RMQA 4G9FA 4OM1H 3BAEH 4PRAB 1FH5H 3C6SB 5FHBH 5KSAD 3WE6A 4FN0A 1D5MB 3AU1A 1NGYB 4JFZL 1B0WA 2AKRB 5MEPB 5IBTL 1JTOA 4OGAD 1HI6A 4LLQB 4NM8L 5DD6A 1FZKA 1PX3A 1JGVL 3KHQA 1QRNA 1NC4A 2AEPH 3EYUL 3Q5TA 1I3GH 4CVWA 1QFWI 4C59B 3E8UL 2BVPB 3VD9A 4U1IA 3KPNB 4MQ7A 3UPRB 2PCPA 3MOQA 4YLQT 1XCQB 5K59E 3SE4C 4D0DA 4PJGE 4ZUWA 1MIMH 3LQZB 1XGYH 3RDTA 3CFCL 4U6HA 1Y18A 2EC8A 1A7NL 3ROOA 3UXFA 3UTQB 2UWEF 4WNQA 3LN5A 4WWKA 3QRGH 5HVGB 1MFDL 1G7MB 5F7KC 2BSTB 3B5TA 3H7BB 4S2SA 4MDJB 2VDPL 3MNZB 5D7IA 2OTPA 3O3AA 1JHLL 4FQ2L 2AK1L 4NJ9H 2HTKC 4UNVA 4DFIA 2XZAH 2NXZC 4PJBA 3OX8B 2FYYA 4QRPA 2IADA 2DRUA 3GUTA 4NZUH 5D1QA 1EV2E 4NHCL 1JI2A 1U0QA 1ROWA 2A83A 3NN8B 1E4KC 3QDJB 1F4AA 3LY6A 2XI9A 2ICWJ 5HPMB 4W68A 2UZIH 1RJYA 3CLFL 4LBEA 1SYVA 2BNQA 5E9DE 2R0LL 1KCVH 4QYOB 3X12B 5E2TH 2EDHA 1QKZL 1IAOA 3O8XC 4ZMAT 1OP3H 1CS6A 3MRCA 1Q1JH 5D71H 2W0PA 5EU5A 2IQAB 5A16B 1HHIA 4YC2C 2Z93A 5I6XC 1WBYA 3NPSC 5IHZB 4FABL 3V4UH 1OGAA 2VXTL 2IF7A 2XZCH 4LQFH 2Q6WA 3ILPA 3OKEB 3BPNB 1IARB 1KPVB 1ZT4B 4PRHE 3CMOL 5HGBB 3QPXL 4ODBD 5HYJA 4QHUB 4G6ML 3MRGB 3WNKA 2J8HA 2DLEA 2QEJA 3O2DA 2VLRB 2HFGL 4HMDA 5E8PB 2HTKD 3NCYP 4LGRB 1AKJA 2NXZD 1CXHA 2EH7H 4KHTL 5FCUH 2O5YH 3T04D 1NC2A 4X4XA 1EEYB 3B9KD 4R7NB 4DGYH 4X9FA 1G7IA 3HB3D 3BQUB 4RCAA 1VGEL 4PGDA 1RJCA 2A73B 4JM2A 5HY9B 3I6GB 4PRPE 1MELA 4KJYA 5CEYA 2V7NB 4XCEA 1FCCA 3RUGA 1ONQB 3EHBC 3U2SA 5E00A 2R2HA 4E0RB 2DI8A 4R4FL 5BMFH 3MV8A 5IIEA 5C0GA 4KV5F 4JZOB 3CFDB 4HKBA 2E7MA 5J89A 3S36X 1YEHH 4GG8B 3KS0H 4MZ3A 1JWMA 1VHPA 4XAKD 4PRIB 4PJDB 2VOTA 4NKIH 1HCFX 2ICCA 3QUYC 4QHMA 3MACL 4KRPC 1QP1A 4L4VB 5JMOC 4MD4A 1GGBL 1PKQB 1XGQB 3HKFA 5IB1A 4LSDA 4QHLA 1WZMA 4JDVA 1AXTH 3LD8B 2VLKA 4MJ5A 2W60A 4K7FB 4P2RE 1FGNH 2EIBA 4RAVA 1OWRM 3MXWH 1KIPA 1Z5LB 5DURB 5I1CH 2YC1B 1V3KA 3LKSB 2HMIC 2WMPA 1CK0H 5HHNA 5DRXB 4KU1A 5DR5H 3C9NA 4TRPH 3T65B 4YDLB 4RMSA 2EYSA 3D3VB 3WKNA 4P9ML 1M05A 1OLZA 1LK3L 5DRWA 2OK0L 4GMTL 3EHBD 3G9AB 2DM3A 3L7EA 1UQSB 3FT3B 4N9OB 3PDOB 2VH5H 1JGDA 1W8NA 3T3MF 2QADC 1U8QB 2CUIA 5A40E 4HULB 4OT1L 4GW5B 3O4LB 3IDMB 2BSSB 1QA9A 5ELIA 2XWJA 1CLZL 1AC6A 1F58L 3QUYD 2KUTA 2NCMA 1QBML 3FB7B 1KGCE 2DQJH 4KRPD 1FZOA 1GL4B 3QEGH 5IHLB 3TVMA 3DSFH 5JDSA 3UROR 4MAYA 2CKBL 2ZCKH 3JWDH 3RZWA 5CFHA 5SX5H 4MJ6A 3BUYB 3PWJB 3TBYA 4WFFD 5BS0E 1EO7A 4QRRA 1MAML 3MRNA 1LP9A 3C5ZB 3SQOH 4CGTA 1PD6A 4F37K 1ZKAA 3T0EE 4J6RL 4JFDA 4DGVH 4JHWL 4L8SA 4NBYB 3WIHH 2VN4A 4PRPA 1GGCH 4TULH 1U95B 3SKNB 1BZ9A 4XBGB 2FGWL 4UINL 5DHVH 1EFXB 3L5XH 4JFEA 1ZLWH 3Q1SH 5IMOA 4YDVA 3OTTA 1GHFL 1JRHI 1KJ2B 4UNTA 1E4WH 1ADQL 2E6JA 2QADD 1M7XA 4JVWA 4ESKA 4I13B 1LE5A 2DMBA 4KVNL 5GRVK 1JF1A 3TPKA 2WIIA 1RAMA 1RZJH 5GXBB 4U6YB 1DL7H 2ERJB 5CP7A 4M5YH 2NY7H 3DHMA 5HYQB 2YSSA 1A6PA 1NUGA 3EGSB 1YEFL 3KPLA 1A6VL 3C09C 5JOPD 1I1FB 1NCWH 2V9QA 5HGHB 1L4IA 4NKMA 4ZUSA 1EZVX 3B2UD 5HHOB 2AXFB 3MLZL 1WT5A 2WV3A 4WU7B 3MX0A 2EIZB 5A2LH 4I18C 4KI5E 2DKMA 4QOKB 1J8KA 1FRGL 3GSNA 4WCYH 1AP2A 3EJYD 1BFTA 1HSBA 5E8EB 3UTSE 1TNNA 4P48A 1SY6A 1EJOH 3CH1A 4LVNC 4HPYL 2J3SA 3PGCA 2MPAL 1MCBA 2M1KA 3ARWA 1MEXL 3QXTA 6FABH 1QSFD 1GC1C 4J3OC 5GS2D 1IAIM 4MJ4A 1NAMA 4IBLT 1VESA 4DCQA 4HWZA 2WBJC 5DQJA 4Y5VB 3O45B 5FO7B 4FRWA 4L8DA 4PJHB 2W38A 2X6MA 1P7KB 3NTCL 4LVHB 3PL6B 1KPUA 4FP8L 4BUGA 5L2KB 3BN9C 3GSRA 1TVBB 5EG6C 1FL5A 2QHLA 1T0PB 4O02H 1G6VK 4XP4L 5KSAB 5JHDD 2YPKB 1DQLL 5MHSE 1X5GA 2YBRB 4RZCB 4XBPA 3K2UL 1D3CA 4LIQL 4ONOA 4XB8A 4W6WB 5BS0A 2EXYD 5HDOA 5EC1A 4OZIA 4I0PC 3JV4B 4FFZL 3QFJE 3HRZB 1AGFA 5D72H 5TJWK 2NY3D 1WBZA 4NQDA 5SWSE 3ALXA 4PLJC 1QR4A 4GAJH 4JY6B 4LKXA 5C08E 1U8JA 4YHIB 5DHXB 3RX7A 3NIGF 5JW5B 4L4TA 1A02N 5B38A 3QAZB 4N1HB 3RVTC 1NKOA 1K2DA 1RIHH 1X6NA 1AXIB 3VJ6A 2WBJD 1T4KA 1MSPA 3HCVB 5GJSH 3OR6B 3IAPA 3IVKA 5HDQL 5KSBF 1B3JA 3JV5A 1PW3A 3P4NB 3VFOA 3BFOA 4TVPL 2DQGH 1AJ7H 2VZTA 3KYAA 2FO4A 5BZWA 5BVPL 3DMMA 3CFEB 4ZO9A 2DQCL 2Y06L 3BN9D 3SDCA 4G8GB 5E2WL 4IRSC 4P2OA 5IVXE 2HKHH 4FQLL 3VFUA 43C9B 3H42L 3WL9B 2BVOA 5GSRA 1GIGL 4YE4H 4DAGH 1T2QH 1I1YB 5A2KH 2F53E 1N64H 3PF2A 5IOPA 1E27A 3DXAB 5LWYH 5BZDB 5KSUA 3MV7B 3RI5F 3BEVA 4JR9L 4X6CE 4UQ2A 1CF8H 1NL0H 4Z7WF 5I8KH 1JGLH 2IBGA 4BUHA 3BSZH 5IFHL 1RY7B 5F3BB 1M7IB 4K3GA 1LE9A 2R0KL 3KPRA 3P9WB 3C60B 1JTTA 2FSEB 4GSDH 4ODUB 4I48A 5ISZE 4DKDC 4ZSOE 1UVQB 5CCKH 1ERNA 1OAYL 2YZ8A 5I0ZA 1A1MA 4GBXA 5JNYA 2PYEB 3QI9D 4FQCH 2VZVA 3VH8A 3ZKMC 5L9DH 3LS5L 3QBTB 4NBXB 3V4VH 3RVTD 1N8ZB 4PRDA 2XKSA 2ICWA 2Y23A 4JPIA 3S3JA 4M8VA 3VMNA 2FX7L 5DJ0B 1UXWB 2NY1D 1CGSL 1CU4L 1SJVA 4P3WA 5EA0H 1N26A 2J12B 2NXZB 3BGMB 2FR4A 5GHWH 1DBKH 5I8EB 2Z8SA 4KAQH 4YJZL 2FL5A 4N1EA 2X44D 3D0LA 4S1RL 4Q6IA 3GI9L 2X1OA 3RZCD 3I75A 3AMKA 4X6BA 2GY5A 2A0LC 1HQ4A 4YDJB 4OLUH 3NACH 1NDGB 2H2SD 2H6PA 3CFIC 3MOBH 4Y1AB 5F89B 1JPSH 2CRZA 3O8XB 1NPUA 2P5WB 3DO7B 1IM3B 3GHBL 4MS8C 5EDXA 3O6LH 3FFCD 4P2QA 4YC2B 1FAIH 5CHNB 3RA7H 5KJRH 1CE1L 3BKCH 4KKAC 1HHGA 1P4LA 1CXEA 4XXDA 1Y6KR 1XF2B 1S9WA 3ZKMD 1DQML 4M6AA 2NR6D 2QSTA 3RGVD 4UMGA 1EAPB 3ULVL 3UYRL 5TE7L 1T1ZB 2J1KA 5ID1A 5C0AE 3S5LB 1IQDA 4UT7L 5I1HL 2RGSA 3O11B 1IAIH 2W9LA 5D9SB 1ED3A 1VFBA 3DSNA 4WV1A 5GS3A 5MP6H 4PJCF 2R2CA 1EGJL 3UBXG 3BMVA 3VXNA 2C3GA 1T03H 3UZVB 3IFPB 5TDNA 4FQXD 4LSSH 2BSRA 1JNNL 3OHXA 1EBAA 3SDXF 3MNVA 5FYKD 5H37G 2GFBB 2GUOA 2BERA 3WNMA 3BOVA 3DVNB 4WWID 3T2OA 3HE6C 3OGCB 3D0VB 3ZE1F 1HWGB 3I6KA 4L29A 3WJJC 4K8RC 4OZHE 3FN9A 4OCNC 3GMRA 5E8OA 3TA3C 1M71B 5DFWH 2ZOKA 4RQQB 5FOBB 4KK5C 1EEZB 4RWHA 2F5BL 4U31A 1CI5A 2PTTA 1CFTB 3QUYB 3MODH 1ETZA 5DI8A 4KRPB 5GS0C 3HZKB 4PJIE 3ZSSA 2XRAH 4I9WD 3MBED 5I16B 1FFPA 1WC7B 3FRUA 3WUWA 4Y4HB 4FFYL 4YAQB 1KTLA 5SWZE 3MRFA 4HUNB 1NBZB 1C12A 4OZ4B 2Y5EA 2IALB 5C7XL 5K9OB 2CGRH 3OXSB 2OZ4L 4YHPB 5KS9B 4PJ5D 1M4KA 3VGHA 2VJXA 3QWRD 3DGGB 3GMPA 2C3XA 5SV3A 5ESAB 2DBLH 4EZMA 4KKBC 3UO1H 4CW1B 4MQXC 4HDIA 4G9DA 4IMLA 2AW2A 4OIIH 4ONFL 2Z91A 2HFEB 4I4WB 3P30H 4K8RD 4D9RD 4KXZI 4PRBA 4IS6B 3V0VA 2VSDA 1RIUH 3LQAL 2L7JA 3MV9E 3QUZA 3TBVB 3T0VA 2MQCA 4WTWA 5D2NA 4L8BA 2IFFL 1INDL 4KJWD 3S4SB 4XCCH 4KROC 1KJ2L 4ACPA 4XNQA 4FQHA 4X9IA 1L0QA 1GGYA 3CFBA 5GQBA 5GS0D 5EO9A 3MA9L 3QCTL 2FB4H 1A14L 4NQEB 2CDGB 1F11A 4PJXA 4X9HA 1TZHA 2JF1A 4O2FB 3RWGB 3OJVC 5CEZL 4HQQL 1IBGH 3V0WL 3IDJB 1IGJB 4ZODA 2J4WL 3HG1D 1I7ZB 1R5VB 3WDJA 1F4XL 4HGMA 3VD7A 4KUCD 2MHAA 1TJHL 2CDEB 3MJ6A 5DJXB 5E94A 4CDGC 4NOFA 4X7EC 5IJVA 2ZSWA 1CWVA 1I75A 1EX0A 4E5XA 4TQEH 3QXWA 1TDQA 4MJID 1KB5H 4U1HB 3TYFB 1PKOA 4KDTA 4KJPD 4YGAB 3HC4L 2EE6A 3WFHB 1WLHA 4KKLC 1OAXH 3VA2C 3H0TA 1TVDA 2E9BA 3OPZL 3BH9B 5DGRA 2BVTA 2ZCLH 4HF5L 4F7MA 4N5EC 4HT1H 2WZPD 3LKRA 3HPJA 1UB6B 3MLUL 3T77B 3FB6B 4KROD 4PJIA 2MKLC 3UJTL 4ODVL 4MXWH 3KWWB 3O9WA 5C71A 4P4KC 5DK2B 3UJJH 4FXGA 4EOWH 2D7OA 1HKFA 1F97A 1AI1L 4NKOB 4PB9L 3ULUL 3PWPE 3EDFA 5C0EB 3C09B 5TGBA 3VW3L 3BKYL 1B6DA 3CSGA 1SEQL 5BOZG 2CDFB 4PGEA 4X5WA 4J4PC 2Y07L 2JELL 4UTAH 1A7QH 1BFOA 5C8JA 1U8KB 2NNAA 3WSQL 1VFAB 1ZA3A 2EDTA 4LVNB 4OLZH 4NHUB 1U8OA 2GT9B 1RUAH 4OCWL 5H35B 5AG9A 3KLHD 3SCMB 4KQ4L 1E4JA 3WLBA 1P1ZA 5IW3A 3L5IA 2P42B 2NYYC 1HK6A 3FO9B 4JFQA 2YEZA 2AEWA 4BZ1L 4LLWA 1VPOH 1RK1B 4HC1A 5GS2H 5BXFB 3K8LA 1S5HA 4BH7B 4WDIA 3EKCA 1S9YB 1S9KC 4GOSA 1J9CT 1WWAX 5HI3C 3EAKA 4HG4K 3NGBB 3UZEA 5D7LB 4XC1L 1XF4B 5DJYA 4JREC 3DX9B 3WEXB 4GMSH 1I85C 4P59H 4U33A 3WJLC 1G6RA 2P46B 4K7PH 3FO0L 1CL7H 3REWB 4TTGA 3CFJA 2IMMA 1CDHA 3P0VL 3WIFB 3EYSL 3RWFA 2P45B 2NY5L 1EZVY 3JV0A 4I0PB 5K9JL 4MVBC 4LMQI 4FTVD 3ARUA 4ZS7H 4J4PD 4D3CL 4LSRL 5D1ZC 1UXSA 1BIHA 3OKKB 2HKFH 4RMRA 1LK2A 5FM4A 4JFPA 3F6IA 2IANB 5T1LD 5JIPA 3CZJA 4HUXA 4HKJB 1F3JB 1J0YA 3SBWA 3U9PH 3LKQA 5FYJH 3FN3A 1J5OH 3QQNA 4HFUL 4F7PA 3PJSB 4NRXB 4ERSL 1RU9L 3DI2B 4G6FB 5EUKB 1GPOH 3VE0A 5JORB 3HR5B 2EC9T 1SYSB 4JRXA 2X4TA 3OF6D 1EEUA 4PV8A 2RAMA 1P5UA 4MNQA 2CRMA 3RIFF 5CUSH 2GJ6D 4IRSB 4QXTA 5HBBA 5I8CA 5IEKB 1TZGL 5DEFB 1DUYA 3L3KA 4KUCF 4EVNB 3U1SH 3KPOA 1J05B 4EN3B 1QSEA 3L6FA 5GGVY 5DEGA 5ICXB 1CCZA 4NNXB 3MLVL 4MVBD 4NQCD 2GSGB 1G7LA 2DLIA 5EC2A 3BZDA 3GSOA 5EUOB 1LDPL 2DWDB 4ALAH 1YPZB 4X7FC 5D1ZD 5HD8C 4AL8L 1FP5A 1I1AA 3G5XA 5C0BE 4F58H 2B2XL 5KOMC 3IFOA 4JZNA 3C8DA 4O9HL 2PXYA 4H88L 5C0CE 4Z78A 5JQHC 1DBAL 2Q3ZA 3QHZH 5DHYA 2G5BB 2GTZB 1ZHLB 3O2VH 2FATL 4ZFFB 8FABB 1H8NA 4Q2ZA 1FG2B 1J1XH 1HHJA 4AEIL 5FEBA 1R3KB 5IFJA 1WZLA 1ZVHA 4U1MB 1FORH 1X5FA 4BYHA 5DJ8B 4YX2L 2PTVA 2P1YA 5I17B 4NOBA 3D69B 1YMMA 3BP7A 3ETBF 1OTUD 4X6DB 4PG2C 4BH8A 2GIYA 1U8IA 2YRLA 4UDUA 3MGOA 4NQVA 5D8JH 1QR1B 4P4RB 3W0WD 3BVNA 1KCUL 4XMKH 1YEJL 5DD1L 3ARDD 1U36A 3TV3H 32C2A 2FZ3B 5FKPB 3BW9B 1ZXQA 4GKZB 4OGXH 1XR9A 3D39E 3DV4A 4XTRD 4HIXH 2A6IB 3FB8A 3LKOB 1Q9WB 5CD3B 1JK8B 5HD8D 5TPWH 4ZPVA 2QHRH 5HHQA 3VRIA 4KTEH 3ABZA 3ESVF 3LRGA 3WS6C 4OCYL 4Z7OE 3SDAC 1V7MH 3KPSB 2VWEC 4TUJB 3GI8L 4JO4H 4YHMH 43CAB 5BQ7A 1JN6A 2EKSA 4NC2B 4LLDB 4O2CA 3P4OA 5TH2B 5TE4H 2Q8BL 3TT3H 4OD1L 1PQZA 1WEJL 2V17H 4NZJA 2AGJH 5CJOL 4GKSB 4F3FB 5DA0B 3FB5A 4BSWB 5GS1B 3PV6A 1U8HA 2Z4QA 1HOCB 2VNCA 5GRYA 1A4JA 3RTQA 3L95B 1S7WA 4MA3A 1HH6B 4LPCA 1XFPA 1JZ6A 3FMGH 4AJ0A 4JQXA 5FYLE 3V5DB 2CQVA 3DYMA 4ZFZA 2OI9C 5EPMB 4Z0BH 5EZJA 1DQJB 4PJ5B 3AXLB 5L8JB 1FC1A 4AIZA 1MVUB 4WUKL 4WENB 2A6DA 4DWHA 3HZMB 3QXUA 5E8DH 2H26B 3HE6B 5FYKH 5LGJB 3VWKC 2XWBB 2A1WH 4W70A 1R3LA 3FJTA 1UJ3C 1SJXA 4P5TC 4YBLB 1GRWA 3FT2A 5LCVH 1HQRA 3TA3B 2CO7B 4MXQC 4AZ8A 5KW9H 2OMNA 1WFNA 1FGVH 1JPTH 1QFUH 3QEQB 4Z7NF 1YYMH 3N9GH 5FECA 2JIXB 2KBGA 1G9EA 5CKAA 1LGVA 3GRWA 4XNXH 3BPLB 3PABA 3THML 2MQ3A 5FDWA 3T1FB 2UZXB 5CEXB 1N6VA 5DVOA 4PP2A 4OF6A 3BD4A 1MCLA 1MNUL 3PXHA 4JO1L 4Z7QE 1CFBA 4ZS6D 2O5XL 1O5DT 1UWEL 1A3RH 5E99H 3GO1H 3RNKA 3MNWB 5DYOB 2Y5TB 4MX7B 3P0YH 4JGUA 3SE8L 1UGNA 1BEYH 2B4CL 1MRCL 3RHWK 3VXMB 4P46A 2APVA 4LPVA 1MWAA 4Y4FA 2LVEA 4YXHH 2WLZA 3WS3B 5E9DD 5IWLC 4P5TD 1JGUL 3U46B 4BSJA 4PUBH 4N5UA 3GJFH 4K8RH 4MXQD 2NMSA 3UJIL 1AD0A 4K3JL 1QFWM 4XPAL 4KPHH 1WCBA 3DURB 4NT6A 3QNYB 1SM3H 4QRSA 5HI4D 1BGXH 1OLLA 3DIFB 3GIVA 4Z5RB 1KB9K 3EW3B 5DJ6B 1ZA6B 5MEQA 2VXUH 1AGEB 1WAAA 5TDOA 4PRHD 1HH9A 3V6OA 3PGDA 4WUUA 5GS0H 1E4XL 3MUZ1 1C5BH 1D5ZA 1QEWB 1A6TA 5I76A 5DGQA 3MLYH 4M5ZH 1BM3L 4Y0GA 3X11A 3BP6A 2F9BT 1PEZA 1U6AH 3BO8B 1KOAA 4R4NC 3G5YB 3MXVL 1S7VB 5TF0A 5SWQA 2NY0D 3EOTL 4APQC 4ZTPL 3MJ8B 5DA4A 4EXPX 3G04B 4URTB 1V7NL 2NZ9D 5E5MB 4H1LH 5F9OL 2YPLA 1FYTE 3L7FB 3QHFL 5IMMA 4UDTB 3NPZB 3ISWA 5F8QC 1BF2A 3GBNH 4UTBH 3EJZC 2ADGA 4CNIB 5HHPB 1AXSB 3RWJB 4MCZB 3CUPA 4N8CL 4DVRL 1RUPH 4RFOL 1K4DA 4U1SA 4P4KB 4NSKA 1I8MA 1T66C 2ZOLA 4IRJC 3K81A 4AMKH 2D4FA 2ZUXA 1NGZA 1T5WB 1SEBA 4TPRL 1XGTA 1BZQK 1CGWA 1N59A 3IU4L 2VUOA 4LRNL 5GISH 1CIUA 1FBIH 1GSMA 3VXSA 1A1OB 2OP4L 4JM2F 5C07A 3IU3A 1I9JH 1PG7H 4P2RD 2IWGA 4YGVB 5K9QI 3ET9F 1GZPA 1F2QA 4OV5A 1AGBB 1KXVC 3JWOC 2FBJH 1S7RA 4LNRA 5LBSH 5C0FB 4LVOC 4AQ1B 5HTSA 4PY8I 4WHYH 2XACC 4APQD 4GQ9L 5DUBB 3SDDA 3MMEB 4JG0L 2Q7YA 3GBLA 4XCFL 2K7QA 5DUPL 1B9ZA 4HEME 3TO4C 2VC2L 4QHNB 3STLB 2IEPA 1IQWH 1INQB 1MFEL 4HS3A 4JZJA 4JQVA 5C09B 4JREB 5ENWB 5I2IA 3HRPA 2O61A 3TF7C 2X70B 2QQKL 1MCKA 4GG6A 3I02A 5IB3B 2YN5A 4HFWB 3S88H 2M8XA 5DK0B 4CU8A 4HAGA 3MRRA 3WKML 3N06B 1BFVL 4OQ1A 4DZBB 2VDLL 4GFTB 4Y2DA 4XZUA 3DV6A 4JAMB 1RZKL 3D18B 4XXCC 4XNZB 3LZFL 1DR9A 1JFQH 2HN7B 5D7JA 5FV2A 1KELL 2YN3A 3DBXB 4BK4A 3EDDA 2V5RA 2OM5A 5E2VH 3A6CH 5D1ZB 4ORZC 4WO4D 2VERN 3IDYB 1DN2A 1MRFH 1NCAL 1JZ4A 1ZLSH 3T0ED 4JRYB 1XCTB 3RWEB 4X5XA 3UDWA 3L3GA 4Z7VE 5DVNA 1MF2L 3CIQA 4OIBA 1DJSA 5BO1H 3IFLL 2PO6A 3OJDB 2YD3A 4AEHL 1RV6X 2JK5A 3V0AC 3WNNA 1X4XA 4CL7A 4HS6A 4MD5B 3U4EB 2DQDH 3TO4D 2A77H 2X1PA 4XPGL 5CBAB 4UV7L 3T2NH 5E7BA 5AYUL 1D5XA 2FJGB 3B9EA 3FAWA 1BAFL 5J9PB 4E41B 3G6DH 3RFZC 3W0WB 4NCDA 3O3EA 4DKEL 1JGEA 4M03A 4I3SL 1ZHKA 4R4BA 1QO3A 1LP9F 1QQDB 2CJUL 1RHHA 1K6QL 3QQ4A 4PJFA 2C9AA 1RUQH 4Y88A 2XTJC 1UENA 3SKMB 1B0GA 1KBGH 3QIUA 1AHWB 1ZEAL 4XRCA 3FHQA 4J2XA 3QXAA 5I30H 3G6JA 2JB6B 2BHUA 3VFNA 4YHLL 4G6AD 1FJ1B 4U1LB 3L5HA 4EQ2A 3QNZA 3UTSD 5FUOL 5CZVH 5M95B 1NUFA 1QG3A 1DANT 5DFVC 1KG0A 3BWAA 4DUVA 2H9GB 4OCRH 4UU9B 5GRZA 4GXUM 4HUVB 5EBMA 2WM0A 3G5VA 4JFHE 1QLEL 5LG1A 4JN1H 4U6VL 4NRYB 3STBA 4HKXA 3H3PL 3X13B 2Z35A 1CDCA 1B4JH 3BEWA 4RFEA 2XICA 4WJ5B 4WHTB 3HE7A 2OLDA 4XPFH 1T22A 5F9WC 3WDHA 3EO0B 4PB0L 5CINL 2V2TA 1ZWIB 3NAAL 3WFBH 5B8CA 3TP4A 1BJ8A 2CPCA 4DW2H 3RWDA 4ZQKB 1Q94A 5T3XL 1ZK9A 3MRKB 3SE9L 1FZJB 3ZZ1A 1IL1A 2ZSVA 1F02I 3U0TA 3WDIA 3QFJD 4EIZC 1Q9OA 1VACA 4QRTB 1CT8B 5I1GH 1DFBH 3RVVD 1CGYA 5DRNA 2UWEB 3B2VL 4NUJA 3SDAB 2NW3A 5C9JA 5SWSD 1H3PH 1FZMB 1I8IA 5IK3B 5C08D 1J8HD 3VXOA 1P7QD 2QTEA 3IFNL 4EEEA 3HNTH 5ESVB 3UC0H 5J1SC 4MNGE 4WW1B 3LQMA 5EO0B 4FNLL 1Z2KA 3M45A 2YXFA 3RX8A 4JQIL 4PJ7B 4XP6H 1G7QA 1NCDL 1F2XK 1T5XB 1GZQA 4G6JL 5MENE 3QIBC 4OZIF 3HAEA 2W0LA 1OCWL 2OI9B 2V7HA 1DANU 5I1DA 3CCHB 1RJZA 3QJHB 4D0CB 1UJTA 1UEYA 3TZVA 1KJVA 2IPKB 2F53D 3KPMB 4P3DB 3G08B 5GIRB 4HIEB 4G7YL 3VWKB 5T1DL 2OJEB 4YPGA 1UJ3B 1LO4L 1BX2A 2CIKB 3BYYA 3MFFB 3W9EB 4P5TB 1RVFL 4R2GD 2KKQA 4G80A 5IG7B 4M00A 5ISZD 1HZHH 1BD2B 1BJMA 4LQ1A 5FHBL 1XGRB 2R15A 2I27N 3QUMH 1MCSA 1NSNH 5SV4A 4LLYB 1MCOH 3MLRL 5DJAB 3TFKC 4PR5B 2YD5A 2XN9A 1A6WH 1OPGH 4UIMB 3LMJL 1G7HA 2XNAB 5ILTH 3ZMRA 4PLOB 3CXDL 2N4IA 3WFZA 5B39G 3B3IA 1Q72H 4KI5F 1NLDH 4BFGA 2CXGA 1LD9A 3E0GA 4LRIA 1XGYL 5B39B 4M7LH 3LS4H 4PJ8B 3FOMB 3ALWA 2D7PA 1A3QA 3C87A 2DDQL 1KIRA 3IJYB 4PS4L 5D5ME 4YWGH 2DIAA 3QRGL 2VL5B 5GGUB 3QJFB 1FO0B 1BVZA 3F62A 2ESVD 2VITB 4NZRH 4ELME 2R1WA 4GAYB 4ZXBD 3S34H 4XH2B 1JPGA 3TN0A 1KLGB 5INDA 2HG5B 1FPTL 3C6LC 5JA8B 3L3DB 2XKNA 2YD2A 5ADOH 4LP5A 4BELD 4LIQE 2F54B 4QTIH 3DETC 4LSVH 2DM2A 3SO3B 1SJEA 1JTPA 1JCKA 5KVDL 5GRJH 3UCRA 2JTDA 4DKAA 4R26H 3A6BL 35C8L 5GGTL 1ZAGA 1KCSH 1MFAH 5E2TL 3QUKB 4D9LH 5C0AD 3QG7L 4ZUUA 1M7DA 3GKWH 4HCRA 4H5SA 5M7QA 1HHKB 3V4UL 4NQSA 1XGPB 2XZCL 4BFIA 1C1EH 2X4UA 4KK9D 4BQBA 2D31A 3O81A 4MMZC 1UWGH 2H8PB 1N7ML 3ZT6A 1RZ8A 4APQB 2F8XC 1ORSB 1GGIL 4PGCB 3KYMA 5LGHL 3OAUH 1CG9B 1QLFA 1FAKT 4POYA 3VFSB 2Z31C 3BI9X 4KMTL 2XQBL 1Q0XH 4ORGB 4R0LC 3SGKA 1DVFA 4JO2H 3W11C 1IGYA 3ARGC 1G9MH 5E2UH 1Y0LB 3L9RA 4YXLH 2H1PH 4KWUA 3FFDB 2P8LB 1N5YH 5IVXF 2BFVL 4KY1L 3NCCB 4GW4B 1SJHA 3DRQA 2BXYA 2P48B 3VXPA 3OB0K 4V1DB 1CD1B 4M61A 4IRJB 1JE6A 3GSUB 4X6CF 3QDJE 3L3IA 5BMFL 3MJ7A 3AS0A 3VXUA 3CAFA 2BCKA 1KNOB 4NQXB 1QFWL 3I3BA 4OCSH 1OGTB 2RBLA 1YEHL 1JWUA 2YD7A 5SWZD 3RGHA 4CJ0A 3FCTB 1G0YR 3CVHB 4XP5H 3V9FA 4JPKL 1A1NA 1YDPB 4NKIL 3F8UB 1RURH 3KYOA 4LVOB 1LEKB 4IJ3C 4OBRA 1Q9KA 3AREB 3FZUC 4UILL 1FVDB 5DTFA 3BH8A 2Z31D 5L7XH 4TSBH 2Q20A 1FGNL 3ZDYF 4J1UA 4J23A 1LEGA 3ARGD 5EWIH 2ICWI 4PYGA 3PP3K 4LHUB 1FL3A 1IKFL 2A38A 3IKCB 3QIWA 2VLRE 4PRAA 3MV9D 4XC3H 2AJZB 2EZ0C 1F8TL 2AKRA 4WEBL 1I7TA 2X1WL 3EOAB 2R9HD 4YHNB 2BRRL 4EDXA 5BJTB 4QNPE 2CR6A 1TCRA 2JCCA 2V5TA 3UTTB 5IMLB 3WXWL 5FA4A 5D1XC 3KHOA 4XGZA 1EHLH 3EYFB 3MLWH 2WP3T 2WUBL 2B1HH 3KPNA 3GZKA 3UPRA 3QP3A 3MRLA 4M7KH 1W72L 3D6GA 5ECJE 3QEHA 3UTSB 3CVHH 3ULVE 3LQZA 4WFEE 1WK0A 2K3TA 1PZUB 4RAHA 5E24E 4Y4KA 3P11L 4WW2A 1XT5A 5FF6B 4R7DB 4CN6A 3DSFL 2I60L 4M8QB 3P77B 4YDIL 3SJVB 4PRIE 4PJDE 5MERB 4M43H 1BQLL 1G7MA 3H7BA 3BDYL 2A9NL 4OCXH 4L4VE 4IMKA 3F58H 3UTZB 1PKQE 3F7VA 4HJJH 1XF1A 4LCWB 2UYLA 1NAKH 1GGCL 4TULL 1PGRB 3OX8A 2IQ9L 2I5YL 3CX5J 5D2LB 4JFYB 1I8KB 1RZFL 3BRDA 2EZ0D 3GSXB 4Q9BA 5KVFL 3WD5H 4X8XA 2DLFH 1S78C 3L5XL 1CIDA 4JLRA 4Y5YA 5HHXL 1EH9A 4OAWA 4DTGL 5HPMA 3RU8L 5J13C 4EJ1C 4OI9A 2XTJB 3PWPD 4M7JL 4MJ2A 1DSFL 5D1XD 2W1NA 4OQTH 5I15H 1F4YH 1I3RB 3D3VE 5CSZA 3TIDA 4EI5D 4BKLB 2IQAA 5I1KL 2NX5A 5EO1A 1T7ZA 1CXKA 1D6EA 4F8QA 5JA9A 1DQTA 3S3SA 1DL7L 4F33A 1UM6H 2IG2H 5D70H 2GKIA 3N1FC 2ICEA 3MR9A 3O4LE 1X6LA 1J8HB 3CU7A 5E1AA 1P7QB 2PW2A 5J8OA 3QH3B 2BJML 5HGBA 5EIQA 3L1OH 5HDBE 1J87A 2C7UA 3VU2A 4ZAKD 1XGUB 5ICZA 4PJIF 5GJTH 4I2XA 3F65A 2ED7A 1XH3B 1DQQA 4Y16A 3V6ZB 3AS2A 1CBVL 5E8PA 1INEH 3SOBL 3FO2B 1CFVH 3UZQA 1X5JA 1XF3B 1MUJB 1PFCA 3AUVA 1EEYA 6FABL 3SE3A 3VD4A 3ARFC 4OB5L 4PY7A 5IHUL 4DVBA 4CJ1A 2BNRA 1U93B 1IGIH 4NDMB 1CFSA 4Y19A 3K1DA 4J3UA 3V5HA 2GCYA 1HHHB 4JFFE 2V5SA 1WBXB 3MYJA 3ZE2F 2AAVA 3NZHH 4IHOB 4ZPTB 2VLME 3T08A 5GRUL 4Y5XA 3G5ZB 1FNEB 3DX8A 4HIHB 1P84K 1NCTA 3C8KA 4PJDA 1MJUH 5ESQA 3VWJB 1L7IL 1A2YA 1HYSC 4U1NB 3KG5A 4IDJL 4GW1B 3MGTB 5CEZE 5CBEB 1T1WB 3KPPB 1LHZA 4RGMC 5TQ2L 1I7RA 3O3UN 1QNZH 4L4JA 4HH8A 1P6FA 4N0CC 4P2YA 4MLIA 2LU4A 4B0MM 4DQOH 5ICYB 3CXHK 3WIHA 3QIBB 2VXSL 5F70A 4ETQB 5DHVA 4QOKE 5GGRB 1FYHB 3AS3A 4JPWL 2YA0A 4WTZG 5CSBA 4FQIH 3B43A 4K94C 1T0MB 1RUKL 2R56H 3T65A 4K23L 4YQXL 3D3VA 4X98A 5GZOC 3ZKNC 4BQCA 1UQSA 1AFVL 2DQGL 3FT3A 1JRHL 2ESVB 3PDOA 1CICA 2WWMC 4X4YB 3PWNB 1G1YA 1BQUA 2DKUA 2HKHL 3QDAA 2H45A 3IDMA 5C0BD 2VLJA 5FYJU 4PJHE 4PREB 4YE4L 4NC1E 1FO0L 1T2QL 2NY4D 4DAGL 1RIVL 3KXFA 3T0BA 4PLNC 5C0CD 1LNUB 1BF8A 4YIQA 4PTUB 2VZOA 3O2WH 4ELKB 3ULUE 4H26A 5L2KE 1NKRA 3FB7A 1C08B 3KR3L 4IEFB 1NL0L 1UZ8B 1RJLA 1JGLL 1FQ9C 4NFCA 2FNBA 5I1EL 5JUEL 4H0IA 3S36H 3N1PC 3K4AA 4N0CD 2F8VA 5C0AB 3TJHD 3BRFA 2B20A 3OKLB 1T04B 5IM7B 5CCKL 5C9KA 4KUZL 5IB4A 1U3ZA 2DQEL 3WIIH 3SGEI 1LWRA 5FK9B 4YR6A 5L9DL 1WFTA 4LLMA 2F19L 1QPXA 3PQYA 5B4MC 2H41A 3ARTA 2XA8H 1U8MA 1U58B 4LLAA 4YO0B 3TGXA 4PJ9C 1JF6A 3O41B 4JFXB 3I2CH 2D9QB 5GZOD 1MHPH 1W0VA 4LLVB 3D25B 3D39D 4PBWD 3IDIB 1BWWA 1T2XA 2P47B 3LPWA 2FJHA 1R24B 2BDNH 4OCMC 1NANI 4ONGH 2EDOA 5EZOH 5GHWL 3C6LB 1H0DB 1OD9A 2ZUWA 5EU7C 1QFHA 3WLWD 4JDTH 3RWCA 5SX4I 3S3PA 2AEIT 4G8GE 2AQ3A 2VISB 1I9EA 1T6VN 3V8OA 4X6EA 5HYQA 4OLUL 5JXEA 1I1FA 3ECBB 1GGUA 1IJ9A 1JPSL 4RNRA 3NA9H 5E4EC 5HHOA 3DXAE 1TQCC 4Z76B 4WU7A 3MV7E 1IC5H 1HSAB 4QOKA 1FAIL 3MOAL 1MPAL 4MB4A 1WVZA 5EOCL 3M17B 5F3HB 3STZA 1UM4L 2F74A 4OZFG 3VG9C 5DVMA 5J6HA 4CVXB 3K74B 5E7FA 1K3ZA 3RDTC 3NIDE 3CVIH 1AQKH 4OZFB 2AJUH 2ZKHH 2PYEE 4ZTOH 1H3GA 4Y5VA 1JNHA 3IDGA 2C3HA 3LIZL 1TETH 1AO7D 4OF3A 3JWOL 4NIKB 5MP6L 2YK1H 1TVBA 2VSCA 5D1QC 5F44A 2A74B 4RISH 1D6VL 5KSAA 3MUHL 4UB0H 1AD9B 3LEXA 5AUMA 5E56A 3DECA 4QY8A 3LHPH 5KVGH 5CLTA 3C5SA 3E6FB 5F1OB 2HJFB 3JV4A 4OBSA 5FUZH 5KG9B 2ARJB 4GAGH 2CIIA 3NCYS 2E7HA 1OF2B 3R8BB 4YZFE 5FCSH 3P40A 1EAJA 2QQQA 5BVJB 2Z92A 3WN5A 4P23C 2XFXA 5EZLB 3WUZA 5BW7A 2F58H 4XNMA 4Y1AE 3IXTA 1MCPH 2GSIA 4K71C 5E1HB 1CYGA 1G9NC 2P5WE 5CSGA 3JTSB 3SGEH 2Y4SA 5I1AB 1P9MA 4YHIA 4KZEL 5FYKU 4LSPH 4P3CH 2DN7A 4OZFH 4RMUA 3ZTNH 3F7PC 3HCVA 3HI6H 4F7CA 4XAKE 1VFOA 3QUXC 3OR6A 4G3YL 1IAKB 1AGDA 5BV7C 3TCLA 1T0NB 5GGSB 3GKZA 4EUPG 2P24A 4EQ3A 1CD0A 1ACYH 4Q74A 3L5WB 2E9IA 1SQ2N 4EUPB 1F00I 3JV6B 5E8NA 1REIA 4I0KA 4KFZC 1MQKH 1OAQH 5AZ2H 3V52H 4G5ZL 4XP1L 4ZNCD 5A3ID 3VXRB 2C1OA 2AV7A 2C3WA 4L1HA 2DBLL 1TXKA 2V9RA 4MSWB 3UO1L 1I1YA 4TUKL 2V2WB 2PR4H 3EBAA 2YWYA 3HI5L 4UBDD 2Y25A 2CLVB 3EYQC 5CAYB 3P30L 4HV8B 1KN2L 1F6AB 3RX5A 5D1XB 4TSCL 4XPBL 2J88H 3QDMD 5CJBA 1EO5A 1CZ8H 5F1NA 4R96A 5KN5B 3ARBC 3U7AA 2P5EB 4P23D 5IR1A 1UVQA 1KJMA 2DQHL 2PYFA 3DGCR 2VXQL 4OTXL 4P57A 3SE4A 3FO1A 1GOGA 4Z7OF 1TQBB 2J8OA 4QWWC 1KENH 1N0XL 2APFA 5GGVH 3BGFB 4E42B 4BZ2L 1RULH 2VQ1B 1CLOH 1W2KT 1FVEB 4NNPL 3SDYL 4AQOA 1R3HA 4JANB 4S10A 1XIWC 3OWEA 4L9LA 2G5RA 4GLRI 3VFVB 3QUXD 2OL3H 4JM4H 2AABH 2YD4A 2YA1A 1G0XA 1Q0YL 1T3FA 1L0YA 5DJ0A 2CMRL 1WAAF 1V5JA 2MCG1 1FYTD 1CFQA 3BGMA 4AIXA 5D6DC 3TH4T 4KKNA 1NDMA 1A6ZB 2GITA 1AH1A 3B9KA 2UUDH 2VABA 1KLUB 2G75B 3HPLB 5KS9E 3D87B 3C5JB 3EYQD 2XG5A 2FIKA 3DUHA 5IW6B 1X7QB 4QRUA 5T1MA 4ODSL 5DQ9B 3GSWB 2IMNA 3D85B 1OM3L 1MCFA 1HDMB 2WAHA 4NPYB 1U41A 4WI7A 2QSCH 3K3QA 3RNQB 5GSVA 3P4LA 5F8RC 3ARBD 3IF1B 5HHMB 5D7SH 3DO7A 4PJEA 4C56B 4HK0A 4K9EH 2D2OA 5IFAH 4TNWK 4QWWD 4FFVC 1JI1A 4I5BB 2OQJB 4OD2A 3CZFB 3GMOB 1FFOB 1XIWD 2Q86A 5AWNL 5C0DA 3HA0A 1LO5B 4MAYC 1N4XL 1UT9A 1FV1B 1YYLH 5CMAA 4TOYL 5DK3A 3MRJA 1I9RH 2DF3A 1YJDL 4UTAL 3O11A 2ITCB 3LRSB 5ANMB 1HIMH 3WFDH 4NQEE 2IBBA 1F90L 2VZSA 1DEEA 2D7TL 5JOPE 4Z7QF 4L8SC 5DS8B 2ADJB 2GY7B 4NO3A 2W65A 4HMEA 1XAUA 1BQHG 1MLCA 1WITA 3IFPA 3ARFB 3LSOA 1WZKA 2EYTB 5HGDB 3VCLB 3UBXA 4JE4B 1MHHB 1WIOA 3QDGB 1VA9A 4D9QE 1ND0B 5KVEL 4OKVB 2I9TB 2HJLB 5JPNB 1OL0A 2FCBA 4MA1C 4DFHA 2E5EA 5FHAH 3OGCA 1Z3GH 4F7TA 4XWGH 1EXUA 5E5RB 3H9SB 4E9LA 4OLXH 1A5FH 2ICES 3TNNA 1MFBH 1G0DA 1M71A 4P59L 3MBXH 1C5DB 4RQQA 5FOBA 4KDWA 2DMKA 4RAUA 5IW1B 5FXCH 4UQ3A 2X4NB 4JHBA 5JHLL 3QUYA 3FAXA 3ZL4L 5C3LD 1I1RA 5EZIL 3VFGL 3U36A 3C08L 3NFNB 4Q58C 4QGYA 2BOCB 4RGMB 5E5UB 2DLGA 2DQFA 3GIZH 5KSBA 1KCRL 1CQKA 4NWTL 1YECH 1VEPA 4MD0B 3P0GB 1GAFH 4L8CA 5JXAL 3O3BB 2RQ8A 2D4DA 4FQ1L 2EDJA 1NGPH 4YHPA 4XMPL 5KS9A 3L3JB 4KGLA 3U9PL 1RK0B 5FYJL 1DDHA 5AAMA 4ZYKB 1KB5A 4XVTH 1CLYL 1FIGH 4CW1A 3CMGA 1HKLL 2F5AL 3W81A 1FE8L 2GAZA 3O6FB 1MI5B 1Q9LB 4XCYB 4NUGH 2IJ0C 1VGKA 1URLA 4Z7WA 2C3VA 5BRZB 3M07A 5I19H 2HFEA 2GTWA 2SEBB 3P73B 4HXBH 2XG4A 4OD3L 4LARL 1C5CL 2YMXL 3K2MC 5LXGH 3KLSA 4A6YB 5B3NA 2DQIH 4S1QH 4UT9H 4F2MB 2Y6SC 1FL6B 2OTWA 4HIJB 3RKDD 5C0IB 5F7FA 5C6TH 3GNMH 3D5OF 4MA7H 4CU7A 5D7LE 2AK4E 1KPRA 4PG9B 4TTDD 3I3EA 1A9BB 3IRPX 3VXTB 4F9LA 1UH2A 2EDFA 5E6ID 1A0QH 3G9VA 4JN2B 4YXKH 4M6NH 5F9AC 3KPQB 3QSKB 4XP9H 4WI9A 1WWBX 4JFHD 1YNTA 1JVKA 1OTTC 1IC4L 1D5BA 4P5KA 1S7QB 1RZ7L 1IGJA 4O5LL 1N6QL 1KEGH 4QO1A 1T80A 2HLAB 4W4OC 3I84A 2CR3A 1CDGA 4HWEL 2DLTA 5IQ9B 4C54A 3PG2A 1E6OH 4QXGH 1J1XL 3G6JF 4PJ9B 1QSFA 2IANE 3OAZK 4NN6C 5F7DB 3T09A 3DHJA 4OZGB 4U1HA 4K94H 1IM9D 4Q7DA 2XKUA 2VDOH 3CNKA 1T1XB 1BVLA 3PP4H 1L7TH 3BHBA 1OTSD 1VSCA 1AO7B 1E28B 3BH9A 1BVKA 3GMLA 3GBMH 4V2CB 3SDCC 3Q6GH 4C4KT 4P2OC 4G9FB 1UB6A 2GJZA 3WE6B 4PD4J 1IEAA 4Q97A 1FSKB 3AU1B 5K9QG 1JNLH 4OGXL 5JHDA 4XHJC 2LQRA 2FX8H 3BDXA 3VMOA 1UM5H 1F3DH 1HI6B 2IAMD 5DD6B 1FZKB 1F3RB 2W9EH 2VIRA 1QRNB 4C58B 1NC4B 4H8WC 2EDWA 2W92A 3DTXA 2CRYA 3EFFA 4HWBH 1MCHA 3HUJE 1OTTD 1TQCB 4S1SL 4KTEL 2P8MA 4U1IB 1G1CA 4I18A 1V7ML 3MV11 2PCPB 1VFMA 3P9LB 5EUOE 4YHML 2FEEI 4LAJH 1UA6L 1JIBA 3MCLL 4ZUWB 1VERA 3VG9B 5MEND 1F4WL 2X5PA 1YPZE 4PJCA 2GT9A 3RDTB 5CILL 4U6HB 1Y18B 2OS7A 5TE4L 3ROOB 2HRLA 5FYLH 4ENED 3O0RL 4WNQB 3SDXA 3VGBA 3LN5B 4WWKB 1DLHA 3SKOA 2WBJA 5CJQL 4IOFC 5FB8A 3EZ8A 4U3HA 3HS0A 3GHEH 5D7IB 3O3AB 2O5ZH 1SHMA 1XF4A 4PJBB 2FYYB 2KQNA 4QRPB 2IADB 1QVOA 4H0GA 1HINL 4OUOA 3GUTB 2YPVH 3EYVB 5D1QB 4LSUH 4KJQC 2FD6L 3R1GH 4X6DE 4Q6IC 4XHJD 1D9KD 1KXQE 1V3LA 3GDBA 2H32H 3WIFA 4J8RA 5FYKL 1RJYB 4LBEB 1OARH 1SYVB 4HBCL 4ODWA 1WICA 5F71A 3BKJH 4XX1G 4UIKH 1ZGLP 1IAOB 3OZ9L 3MRCB 4AG4H 2E27H 5EU5B 3QDMB 1HHIB 3A67H 4N0YL 5KW9L 2Z93B 1WBYB 4LSQL 5C92A 1OD7A 4P23B 1OGAB 1QFUL 2XPGA 4K71B 1L9MA 2Q6WB 1MRDL 4NJAH 2P8PA 3N9GL 4F8TA 2DJSA 5CWSB 3QI9A 4OLVH 3RVWC 5C0JB 3KPSE 1P4IH 3EUUA 2WUCL 5HYJB 3U6RB 2CUMA 1IZKA 2MOVA 4DN3L 2JB5L 3QUXB 4K3EL 1A3LH 4AH2A 3OKOA 5BV7B 1H8SA 3HR5A 4DN4L 1HXYB 3HNSH 1AKJB 1LO2H 3NCMA 1HYRC 2FX9L 4DK3A 5TE6H 2WSKA 4OSUH 4UT6H 4TSAH 4X4XB 12E8H 5IEKA 5DEFA 2HLFC 3W82A 2R2BA 3P0YL 1A7BA 4ZUTB 3VFWA 5FO8A 1G7IB 5T3XE 1JHKH 1MCCA 4U1KB 4FQQA 4K2UH 3RZCA 4KJYB 4NNXA 5CEYB 5IGXH 3JTTA 1AY1L 4XCEB 3RUGB 1RFDL 1FLRH 5IF0B 3NCJH 5E00B 1B0RA 2R2HB 3U2SB 4OFKA 1MJJB 4PUBL 3MV8B 5IIEB 5C0GB 1ZVSA 3S35L 2R69L 4HKBB 4JFOB 2J8UB 3IETA 5E0QA 3FFCA 3ZO0A 4RGOH 2B39A 2OCFD 3BMWA 4FMFA 2N7BA 2FHFA 3RVWD 2GTZA 1G9NH 4QHMB 3GMNA 5C2UB 2FEDC 4BK5A 2R0WH 5I18L 3RGVA 4QCIA 2Q8AL 3SQBA 4MD4B 3QEQE 1A21A 5IB1B 4JDVB 4TVPD 4JCLA 3EDKA 2VLKB 15C8L 1J1PH 2W60B 3DROB 1KIQA 1OAKH 5BV7H 1MREL 4RAVB 2QBWA 2W9DL 4XNYL 1IEBA 2LU3A 4U6XB 3ALPA 3VRJA 4PGZA 2OSLA 1KIPB 2HLFD 4EI6B 1WZ1L 2R4SL 4ODHH 2YHGA 1NCCH 4DOHE 3R06A 4FQXA 5FKPA 2XA3A 3BW9A 1C16A 1P53A 4GKZA 4BJLA 4JFZH 3C9NB 4M6ML 2EYSB 1J0JA 1SBSL 5DRWB 5IBTH 3OBAA 3L7EB 3LKOA 5F7MC 3HC0B 1WQVT 1JGVH 2EDBA 2P4AB 1Q9WA 1JGDB 3EYUH 4AENA 3QDJD 5IV2B 1XF5A 5T5FH 3BQUC 3E8UH 3GBNL 3UYOD 3VXME 1QA9B 1UYWL 3QUZC 4HGWA 4GRMA 5D2NC 5JOEA 5DJDB 5F93C 2XWJB 5F9DC 5EBLA 4LLDA 1FZOB 4WU5A 4P9HC 1J7VR 3ULVC 1A7NH 4OJFH 3TVMB 1MH5A 5JDSB 5DEZA 4MAYB 4MJ6B 2HT3C 4B53A 5KANI 5J11C 2D3VA 3MBEA 3FQNB 1MFDH 5HYIA 4QRRB 3MRNB 2VDPH 1LP9B 2ZZUT 1JHLH 4FQ2H 2AK1H 4L8SB 2JJTA 1BZ9B 1TIUA 5D93C 5EPMA 2VLRD 4U7KA 4PJ5A 4NHCH 2XZQL 3S37L 3QWRA 4JFEB 4LCUA 1NCBL 4H25A 4Z95H 1ORQA 4PV9B 4MA1B 3CLFH 1IQWL 1RZGB 1HWHB 2R0LH 1PYWA 3BQUD 3GJFA 3WJJA 5JZ7D 3LB6C 5ETUB 4U2YA 4XI5C 1LE5B 1MOEA 3GMQB 3S88L 1BZ7B 2OX5A 2HVKA 2L7UA 2WIIB 4FABH 5J12C 2VXTH 3N1GC 3QCUH 4UZGA 4X4ME 4M1CC 3O9WC 1U8LB 4M7ZC 5T33L 3ULVD 4WFED 1KEML 2GJJA 3QISA 2YSSB 4A6YL 1ZSDA 3KPLB 3CMOH 2HT3D 4NKMB 3PGFL 4X80H 4ZUSB 4HX1A 4PRID 4G6MH 4A2LA 3FOLA 2GW5A 4ZFGL 3T8XB 3GSNB 5C1MB 2HFGH 1EUUA 4WI4A 1HSBB 4L4VD 1MRFL 1ZLSL 3HMWH 4NZDA 3CH1B 3LPGA 4LEXL 4KHTH 3HG1A 3MNWA 2YKLL 2BXZA 2VUYA 4NCC1 4MB3A 3K80A 1NAMB 4GKNA 4G42A 4HWZB 4MJIA 5DQJB 5DURD 1VFUA 4L8DB 4LK4A 4R4FH 1W0WA 4XI5D 1G84A 3UP1A 4EIGB 3GSRB 1FL5B 4KMLB 2V5MA 4U1JB 3PWUA 5L6YH 4M1CD 3DIFA 4XBPB 5C09E 5I66A 1CD8A 1UFUA 1NGXA 4Z7UA 4JKPL 3CU1A 5GGQL 2R29L 3O4LD 2AQ2A 5EC1B 1J11A 4OZIB 3MACH 2DL9A 4R8WH 2W0FA 5B3JF 1YEKH 1GGBH 1AGFB 2G9HA 4YHOL 5IROC 5INCA 5TF1L 5I30L 4AM0A 3JSSA 1N0LA 2ZUYA 1WBZB 4WEUD 4L3EA 3ARYA 1F45A 3LAFA 4R90L 3EFDH 1NQBA 4LKXB 2LTQC 3O6KL 1U8JB 4U05A 1MY5A 4L4TB 5B38B 3BO8A 1J18A 1J0ZA 1K2DB 3C5ZD 3QR2A 4M62L 2H2PC 4NN6B 1UACL 3VJ6B 1T4KB 4JRYE 5ID0B 1JNJA 1KTDA 3IVKB 1TTFA 4P9MH 2OK0H 1LK3H 1KXTB 4GMTH 3VFOB 3VGFA 1KTKE 1CE6B 2FO4B 4LCIL 1EFXD 3DMMB 4JFFD 3L7FA 1QFPA 3SDCB 4FFWC 2DL2A 4P2OB 1FNHA 2R39A 2VLMD 5C3TA 4Z77B 5HHPA 1LMKA 2BVOB 5GSRB 1NFKA 5F97E 4NO0A 5CZXC 5IOPB 1CLZH 1E27B 2J6EH 4N1CA 1F58H 3ULSA 5KSUB 3PL6C 4E41E 3BEVB 1ZHBA 2DS4A 3FQUB 3BD3A 1BLNA 4UQ2B 4U0QB 2ATKA 1LEIA 1U3JA 4D8PA 1TJGL 2CKBH 1LE9B 2EH8L 4QNPF 5LAXA 3KPRB 5CEZD 4FTVA 1TPXC 4I48B 4J4PA 4HHAA 1I1AC 4R3SA 3HHRB 2VYRE 1MAMH 3IXAA 2PXYC 1A1MB 1UH4A 1M6OA 4JHWH 2BMKA 5JNYB 3P4MB 5T1LA 3VH8B 2XXMB 2XYCA 4B41A 2FGWH 4UINH 3UC0L 1BECA 3BN3B 4P5MA 2ICWB 2UVEA 2ZNXA 4JPIB 5ACLA 1AGCA 1NFIA 1PJ9A 1NUDA 2WANA 3OSKA 3MMEA 1NFDA 4PJDF 3NABL 1GHFH 2BHYA 4NKDA 4XP6L 4QHNA 3X3GL 4FFWD 1ADQH 3IT8D 2HAZA 4JO3L 3WMSA 4ELMB 1PG7W 2GJ6A 5IB3A 4LASL 2FL5B 1A7RL 2EEAA 3WJLA 4Q6IB 5DLML 3O2DL 3PL6D 2I07A 3I75B 3ULUD 3GSQA 5L2KD 2NY5C 4JAMA 5DUML 5DRZA 3RRQA 1B6UA 2UY6A 4G8EA 3MRDA 3REVA 2AS5M 1HQ4B 1YEFH 4NQCA 4N68A 3GB7B 2H6PB 5DD0L 2MFNA 1N2RA 4HH9B 3MLZH 1MCDA 3INUL 5D1ZA 4NGHL 5EIIA 1FRGH 5B21A 1HHGB 1P4LB 4XXDB 1S9WB 4DZ8A 5AEAA 5C6PB 3HNVH 4HPYH 3C60C 5FUCE 2UWEE 2MPAH 5T1KD 3RVUC 2VWEE 3MRBB 2VN7A 5LJYH 2DQUL 5ID1B 5ILTL 3EIFA 1IQDB 4N9GA 4NWUL 1X5XA 5E03A 1ED3B 4RBPH 1R3IL 1Q72L 5K9KA 2FJGA 3NTCH 2DKSA 2MQ0A 4FP8H 5FKAA 3VXNB 4WI2A 5I1IL 2AP2A 4PJ7E 3W0WA 5TDNB 2BSRB 4XP4H 3ARDA 1OVZA 1DQLH 2IH3A 4YWGL 4G8GD 2APWA 4LIQH 1J88A 2ZJSL 3BXNB 3OXRB 4M48L 2ARWA 5D4QA 2G2RA 3I6KB 1FFNA 4L29B 3DXAD 3OKYA 3GMRB 2C4FT 3MV7D 1IILE 3DVFA 5E8OB 2AEQL 3HZYA 2ZOKB 4JY5L 3ZHLA 3CX5K 5ITBL 2V2XA 3FN0L 3FQRA 4LSVL 3C60D 3Q0HA 1Z9LA 2PTTB 1EHNA 2Q76A 4WI6A 4G6KH 5C2BH 5DI8B 1BD2E 4IM8A 1JYXA 4CVZA 1CDUA 3LCYA 1OW0C 1FFPB 3OV6A 3FRUB 4NRYA 2PYED 3WUWB 1NLBH 3GKWL 3ELAT 3ESUF 4OLEA 3MRFB 3CGTA 3EDJA 4TVPH 1C12B 5A1AA 3D2UD 4X99A 5TDPA 2I26N 5BVPH 2GK2A 2AJVH 2Y06H 5E2WH 1T7WA 2DQTL 4FQLH 4Q9QL 1UWGL 3H42H 5J7CC 3GMPB 4K55A 1WTGT 5J06A 4G9DB 4IMLB 4ZQKA 4KTDL 4LKCA 4JR9H 1N5AA 4P46C 5DMJB 3WCYA 1UKTA 5IFHH 1FZJA 3WFCL 1KV3A 1H3XA 3TBSA 4HK3N 5DVKA 1WF5A 4PRBB 2R0KH 1U92A 1HEZA 4QRTA 5E2UL 3V0VB 5C0NC 4YXLL 4F7EA 3QUMA 3ZYOA 3QUZB 5D2NB 4L8BB 5DD3L 1OAYH 4MDIA 3GMMA 2HRPL 4XNQB 4PJHF 4FQHB 4Y1AD 3O8XD 4TVSa 4PJGA 3WHE1 2P5WD 3LS5H 4LEOA 5EO9B 1OP5K 2IPTH 2YUXA 2F54E 3TIEB 3V6OC 4PJXB 1F11B 1KF9B 3T4AA 1TZHB 5J11B 4POZC 4B50A 3VDBA 2I9LA 5J3HC 2IH1A 1CGSH 4PJ7A 5DDHA 1NCNA 4XP5L 4MCYB 3Q2CA 3V5KB 5EU3A 2MHAB 3CSYA 4M6OL 4OUUB 5D93B 5E94B 1JUFA 4ZNEE 5IJVB 2ZSWB 3GM0A 1Z9SA 4E5XB 4Y4HC 3BJLA 4S1RH 2V5YA 2ZPKL 3DX6A 3GSNL 3OR7A 3MJGX 5L7XL 1SY6L 4CBPA 3H0TB 4RDQG 2EDXA 3MFFA 5EWIL 4F7MB 5E9DA 4P5TA 4QRQA 3LKRB 3HPJB 1NAML 4TNVF 2EO1A 1AE6L 4HLJA 5D7KE 3IKKA 2B7DT 5J12B 1CE1H 2HT4C 1TZIA 3X14A 1MFCL 3MCG1 1DQMH 4XNUL 3O9WB 4JJ5A 4M7ZB 4FXGB 2AJ3A 2RR3A 4WFHE 2VDKL 1MCEA 2VDML 5IB5A 1YN7B 5TGBB 3ULVH 4PRHA 1HN1A 5TE7H 4POZD 4X7DC 5J3HD 3MLSL 4PGEB 3B9DA 3QA3A 4X5WB 4V1DE 4UT7H 5DJ2B 4Z8FL 1S8DA 5I1HH 2B1HL 3IDXL 5C8JB 2NNAB 4WI3A 3W9DA 5HVHC 1U8OB 1EGJH 2VR9A 4Y4HD 3DX7A 3FOMA 1OSPL 1P1ZB 2CLZB 2E7LC 3NIDF 2B4CC 1E6JL 1JNNH 2YEZB 3IDUA 4W81A 4LLWB 3RI5K 5GGUA 1QOKA 1S5HB 4WDIB 2HMID 4NBZB 4MLSA 1H3WM 2QR0A 4JZJC 4JQVC 5DJYB 4JFFB 2A6KA 2HG5A 3EOYG 3RWIA 5TFSL 4NZTL 2HT4D 2DLFL 4L1DA 3RBGA 3SGDI 4Y2DC 5T5NG 2F5BH 5F88A 4QT5A 3RWFB 3OG6B 4UV4H 1OHQA 3OB0H 3LPFA 1EMTH 2GHWB 4LSTL 1JPFB 1YEEH 5I15L 1EJ6A 1UXSB 2J5LC 1ITCA 4FFYH 1JZ3A 1DLFL 1HHKA 1LK2B 3WNLA 4JFPB 4NQED 4P2RA 1W0YT 1BBDL 3ZDXE 2E8YA 3UTTE 1UM6L 4QXWA 5C7XH 2LTQB 4H8WL 2OZ4H 3UDWC 1P69B 4HUXB 3BIAX 3LKQB 1A6AA 4PJEF 1WFUA 4F7PB 3EO1A 4M02A 3ZTJG 4YPJA 1B90A 4APQA 5JMRA 3DWTA 3VE0B 4PGCA 4D9QD 4KQ3H 4ONFH 4JRXB 4AEFA 2X4TB 1WCQA 3BKML 4PV8B 4KRLB 4KH2A 3SCMC 3ZDZF 3SJVE 1BJ1H 4GRWB 3S96B 4QXTB 1QTYT 1QLRA 4XVJL 5I8CB 2Y1VA 1PSKL 1DUYB 3L3KB 4XT1C 3LQAH 4HS8L 1TVHA 3PP3H 3KPOB 2IFFH 3JBG7 1INDH 5J6GA 4GW4A 1QSEB 1KJ2H 5H94B 3MSPA 3L6FB 4LCWE 1IGIL 5DEGB 5DJCA 3NGBC 4O2EB 3BRGC 5D2LE 5AG8A 3QCTH 3GSUA 1Y6MR 1T89A 5EC2B 3GSOB 1A14H 2PTUA 5KSVA 2HVJA 4HWNA 3HFML 2FHCA 2MCPL 3TPUB 1TPXB 3C2AL 1I1AB 3G5XB 3IFOB 5CEZH 4HQQH 4J3WA 4JZNB 4WO4A 3V0WH 2XTJE 4RSVA 2PXYB 1ZVYA 4Z78B 3FCTA 3CVHA 2J4WH 2WW8A 3QEUA 1YDPA 3T0EA 2VAJA 1FN4A 4N0FA 5DHYB 5HJ3B 1TJHH 2NY2B 4Q2ZB 5T1KB 5IFJB 3D9AL 4CKVX 3MRMA 1PAMA 1RPQA 5ITFA 4FOMA 1J8HE 1D5IH 3TLRA 3SCMD 3TO4A 1YMMB 3BP7B 1BPVA 3ZTJH 3OPZH 3HE7C 4I3RH 2HJKA 5DJZA 5F72S 4BH8B 4HF5H 4UNUA 4UDUB 3MGOB 1DCLA 1H3TA 3BVNB 1IAII 5E70A 3TT1L 2AJZA 3MROB 3VD3A 3K0WA 4HXAL 4LFHD 2BY2A 1B2WH 3UJTH 1B88A 1RZKC 1XR9B 5D7LD 2AK4D 2VDQL 3MLPA 1MCWM 2WK2A 3SGDH 3DV4B 3MLTA 1AI1H 4PB9H 3FB8B 5KS9F 3ULUH 2ZUSA 5HVFB 5FGRA 4OQTA 5LKNA 2EDYA 4ZPVB 5E2JA 1SEQH 4LF3A 3VRIB 5HHQB 1R3JA 4OFIA 5ALCL 1K4CA 4EN3C 5ACZA 2A6JB 2Y07H 3ZLQC 3LH2L 1YEGL 4UI2A 3V4PH 1GOHA 4I0PD 1I9IL 5BQ7B 4QF1A 2EKSB 3UTSA 3UEZA 5ALBH 4FQJL 4O2CB 3P4OB 4OCWH 3AC0A 1IGML 4KQ4H 3ZKSD 3P77A 4PLJD 2IAND 5F6IB 4BZ1H 1IGTA 1VB9A 4YHZL 3FB5B 5MERA 4QTHA 3M8OH 2Z4QB 5EOQL 1S7WB 1XMWA 5LQBH 3D2UB 4XC1H 3HZVA 4G6FD 4ZFZB 1ZS8A 3MCKA 2R8SL 1GGTA 4FZ8L 3S35X 5DO2C 4AIZB 3TZVC 3FO0H 1FDLL 2A6DB 4IRSD 3VG0L 1IRAY 3P0VH 3EYSH 4BSVA 4MWFA 3R0MA 4EDWL 1R3LB 1CGTA 2R0ZL 4EN3D 3VFTA 3LKPA 5EZOL 2AJYH 3UBXI 4BFEA 4D3CH 3QFJA 2D03L 2EE3A 4LSRH 3W5NA 1HQRB 1MQ8A 1PZ5A 1LVEA 4F57L 3LN4A 2ESVE 1I4FA 5SWSA 4EXKA 2GK0B 5FECB 3S7GA 5C08A 1J8HA 3N85H 1P7QA 4QXUL 2HH0H 4JVPA 2CK0L 1P4BH 3D1MC 4HFUH 3KNBA 3PABB 3TJEL 4BQ6A 5FDWB 3E6HB 4G8FA 4X0KA 4ERSH 1RU9H 4PP2B 1FNGB 1I8LC 3LKNA 4X9BA 3S5LG 3V6ZA 1ZTXL 2BNUA 1U8NA 4P9HL 3RNKB 3CPLA 4LRIC 5TQ0L 1MUJA 4DGIH 1K8IA 1TZGH 2UY7A 5IVXA 4CMMA 5GS1C 2FH8A 2C1PA 4X6FA 2ZKHL 2F53A 1IFHL 3PDDA 4P46B 2ZG1A 3MLVH 1MWAB 3ZE1E 1TETL 1YN6A 4X6CA 1WIUA 1HHHA 4JB9L 1A7PL 1F5WA 1IAMA 4AL8H 1RMFL 1AD0B 2B2XH 4CRPA 4NT6B 1WCBB 1OSZA 2ZUVA 1FNEA 1H9VA 2A0LD 5ISZA 4QRSB 3ARQA 4ZSOA 4O9HH 4J3TA 4H88H 2YS4A 4JHZA 5EFIA 1DBAH 4UB0L 3DUUA 1NMBL 4YUEL 4KRMB 3VGGA 2R4RL 5F7UA 4H0HB 4MS8D 5MEQB 1FFQA 4YBLC 2FATH 5TDOB 1HH9B 3ES6B 3KPSD 3PGDB 4CN4A 2RFXA 4WUUB 1F42A 3JVGC 4AEIH 5FUZL 4KKAD 3DNKA 4FXKA 3SKJL 4AT6B 1D5ZB 5CBEA 1T1WA 1FCGA 3NFSL 4MXVE 1A6TB 3S37X 4YX2H 5I76B 2E9JA 1IGCL 3CDGB 1ZHNA 3UPCA 3CFKA 3BPLC 3X11B 3N50A 2FH6A 3BP6B 2EDKA 4RA0C 4TNWF 5E08L 2YA2A 1I7UA 3UTPE 4WFGE 1KCUH 3SPVA 1YEJH 5DD1H 2D7NA 4KVCL 4DKFL 2HWZH 3ZTNL 5T3XD 5SWQB 1MIEL 1S9XA 3QRFM 4J3VA 3U4BL 1LO3L 4WTZA 5C6WH 2VXVL 5FGBC 2ESVA 1DVFC 2YPLB 3EJJX 5IMMB 4NYLB 4ZXBA 2KZ1B 1II4E 4X8JB 3V52L 2ADGB 2NTFA 2JLLA 3HE6D 4OCYH 4HC1L 3CUPB 4PREA 3PHQA 1T7XA 1P2CB 2NW2A 2X4OA 1K8DB 1K4DB 4U1SB 5HHVL 3J8F7 4NSKB 3BIKA 5H37H 1U3HC 1I8MB 1C08A 2DYPD 2ZOLB 4YDKL 3TNMB 3BDBA 3HI1A 3S4SG 3TA3D 4LMQE 2Q8BH 3KLAA 4U7SA 4OD1H 3BIBX 1UZ6E 2AQ1A 1WEJH 4KK5D 1UKSA 1CL7I 5CJOH 1SEBB 3QEQD 1ES0B 1N59B 1J0IA 1G6RL 1CZ8L 5C0AA 2JIXD 2OTUA 3VXSB 3OKLA 1IT9L 3IU3B 5C07B 4IRZL 3A0OA 3GJEA 3U4AA 2FIRT 5HVHB 5GGRY 5DT1H 1CXFA 1GZPB 1KENL 3EOBA 3I50L 5FK9A 4OV5B 1RULL 1F3DJ 3OKNB 1S7RB 1YPZF 4LNRB 4O58L 2PW1A 4HAFA 5FGSA 3VI3E 2VDRL 2OL3L 1ZANL 4JM4L 2BSED 5I71C 2Q7YB 3QULA 2BK8A 4RA3A 3DUSA 2XY1A 3V8CA 4KKBD 4JZJB 2AXJA 2ADIB 4MQXD 5I2IB 3X3FL 2O61B 4OZHA 4GG6B 3I02B 3VXMD 2VZ3A 3U9UA 4Y2DB 2FLRT 1U3HD 4XZUB 2Y36L 2X4QA 4NP4L 3DV6B 1JZ5A 3K8MA 3CH8A 4Y8DC 3VXRE 5D7JB 4D0BA 3THMH 4CU6A 1TNMA 7FABL 1FNSL 2Z8WC 1WWWX 5D7SL 2J5LB 4IIQA 3C8HA 1MNUH 3IJSA 2WQRA 4TUOA 2O5XH 4L5FL 1UWEH 2VDNL 3LEYL 5SWZA 5CP3H 4X5XB 4M4PA 1NEZA 5IESL 3L3GB 5LVEA 2YZ1A 2X10A 3KYKL 4Y4KC 2P5EE 3KYNA 5JR1L 2P43B 4WW2C 4OZFA 2QQLH 4K3HA 2JK5B 3SE8H 1YYLL 2HFFA 3QQ3A 2B4CH 1I9RL 4HS6B 4B7IA 1MRCH 4LLUA 1RSFA 2Z31A 2QKIA 4HPOL 2DM7A 2VE6A 5DD5L 4R0LA 4XPTH 1D5XB 3IRZA 1NMCC 3ARGA 1T20A 1NGQL 1A47A 1T1YB 3NH7L 1FNFA 4LFHG 1KYOK 4K3JH 5F7YC 3Q6FA 2G60H 1CFNB 2ZCHL 4KKLD 1ZHKB 2EDDA 3MV9A 1QO3B 1KTRL 1DUZA 4Y5YC 4N5ED 1QBAA 2AK4B 2BC4B 3QQ4B 3B8SA 4PJFB 4XVSL 4C83A 1B0GB 2IGFH 1UKQA 3OAYH 3QIUB 1Z6JT 1E4XH 4XRCB 1X44A 4MHHG 4P4KD 3QXAB 3G6JB 1A5FL 1MCNA 1MFBL 2R2EA 2AJSL 4XNZC 1YEIL 3BPCA 1BM3H 1MFNA 4NM4H 5HHME 1KG0B 3BWAB 5JW4N 2XXCB 3MJ9H 4NN5C 4C56E 5IT2L 2Z9TA 2OL3A 1DZBA 5EBMB 3MXVH 5L2JB 3G5VB 2X89D 4K3DL 5CGMA 3EOTH 3IDYC 4ZTPH 2BZDA 5IMKA 4HKXB 1T0NA 3UAJC 1H15A 1OT1A 1WGOA 3BEWB 1QYGH 2BVQA 4RFEB 1V7NH 4Y16C 2NYYD 3VRLF 4MA8L 2RIKA 3DI3B 3L5WA 3HE7B 3O6ML 5F9OH 2HTLC 2N56A 5ERWA 3QHFH 3V7AE 3HC3L 2X7LA 5D6CA 4Q9RL 1GC1H 4L9DA 4CADA 5ANME 3SE3C 3G6AA 4ISVA 5HI3D 4DVRH 1X5KA 4MSWA 2BX5A 4RFOH 2AXGA 5FO9A 5C09D 1Q94B 3HTLX 4RRPG 2CLVA 3QNXA 4JPVL 5I19L 2XY2A 4ZUVA 4LAQH 2D9CA 1IL1B 2Z0BA 2ZSVB 3PWPA 3U0TB 3O3DB 5GZNC 3QDGE 5D1XA 4X7SL 1Q9OB 1VACB 3NCBB 5I8OL 3IU4H 3U82B 1GCFA 3HUJB 3JZ7A 4LRNH 4UT9L 5DRNB 4Y5XC 4EI5A 2NW3B 4LP4A 5C9JB 1I8IB 4FG6C 4NO2A 4MA7L 1S7SA 4CDHA 2VAAA 3H9SE 4DUWA 1AHWC 1ITBB 3KDMB 4YXKL 3UMTA 5CGYC 5GGSY 1SVZA 3OKDA 4X5LA 4GQ9H 2JJVA 2NLJA 4JRYD 4ZAKA 4JG0H 3HAEG 5J57B 1OP9A 1G7QB 4Z7UF 2HTLD 1UWXH 1KEGL 1MFEH 4LGPB 3HAEB 1WV7T 3GRWL 4HIIA 1NBQA 2X4SA 2V7HB 2QQKH 2QV2A 4G8IA 5I1DB 1E6OL 1RJZB 5EU4A 1NMAL 3F7YA 5F96L 3TZVB 2VDLH 1KJVB 4QEGA 2B1AL 1CGUA 1L9NA 3AB0C 3FRPA 1RZKH 4E41D 1IKNA 3SEPA 1VDGA 1KELH 5GZND 1CICC 4YPGB 5ABDE 1BX2B 1HDMA 4U4BA 1TCMA 2VR5A 2FLBT 1YUHA 1MI5E 4G80B 5KANG 3IF1A 1CTNA 3ARXA 1S9VB 3FQWB 5BRZE 4FG6D 3MZTA 2EC9U 5DC9B 3M1BA 3MO1B 1MWAL 1JNLL 1NCAH 2X40A 4XBEL 5DQDL 1FNLA 1AIFA 4I77L 3AM8A 2YUVA 5JLZA 2XN9B 5CGYD 3RQ3A 1HXMA 3TO2A 2AJXL 3WXVH 5FUCC 4AEHH 2EICA 3VFPA 3LN9A 3FTGA 1NBVL 3F7QA 4LHQB 4XPGH 4UV7H 3N0PB 1ZT1A 4R9HA 5DS8A 4RGNB 1BAFH 1DE4B 3RY6C 2R23B 1HILA 4HMCA 2APBA 2KH2B 3B83A 4PTTA 5FYLL 4OF8A 3U7WH 4DKEH 1KIRB 1KB9J 3FQXA 4I3SH 3NCFB 1BQHA 4QLRA 3F5WA 2CJUH 2VKWA 1Y6NR 3EYOA 1K6QH 3WHXA 2JJSA 2R1WB 2ZWLT 1X5IA 3ZKXC 3PWLB 4PRNA 1VKXA 4OZGE 5INDB 1ZEAH 3T3PE 1ZGLA 3QXDA 2A9ML 2XKNB 4BQ9A 1NFDF 3GGWB 4Z7NE 5C0BA 4HUKB 1AO7E 5FUOH 4ODXA 3RPKA 5C0CA 3QQ9C 5HYEA 1SJEB 4G9FE 5F9JB 3NZ8A 4H20L 1H5BA 5H2BA 3SDAD 2DYPB 5EU7E 4LDOB 3RIAF 3V79C 3I9GH 5MI0B 4R97B 3LV3B 2YR3A 3GSVA 4UIKL 1QLEH 2LFGA 4U6VH 1M7DB 4AG4L 4GXVL 1KC5L 3NFPA 3H3PH 2X1QA 4H5SB 4HJ0C 1QRNE 1XR8A 2ORBL 5IJKC 4NQSB 5JOFA 4BFIB 1JHTA 2X4UB 2ADFL 4KKCC 3RPIA 5CKGA 2D31B 4PB0H 5CINH 4YHYC 1P4IL 3NAAH 1MHEA 1JV5A 3L3OA 4DOHB 3QZWA 4XCYA 1Q9LA 4Y89A 3KYMB 3OAZH 1L6XA 1QLFB 5T3XH 3HNSL 4JGMA 3D39A 3SE9H 2SEBA 5FA3A 4PJ8C 1MLBA 3BP5A 1DVFB 4O4YL 4U3CA 1IVLA 1IGYB 5TE6L 1UEMA 4OSUL 3KJ6L 12E8L 2BY1A 3L9RB 4NNYA 5DC4B 2VMFA 3B2VH 3VWKD 4OF7A 5D7IE 2FGZA 3K8KA 2MTPA 4RMVA 3QQ9D 1SJHB 3DRQB 3VXPB 4PJBE 1U3HB 1A7OL 1YMHA 1A9BA 4QRPE 3VXTA 4M61B 5KAQG 2O26U 3IFNH 4ZD3L 3BISA 2WINA 3FT4A 1R5IA 1BD2D 4M3JA 4PJAB 4HWBA 5KTEL 1S5IH 3IDNA 4FNLH 3VXUB 5L88L 4RIRA 2BCKB 4NFDA 4JQIH 4PYHA 1RQ5A 4HJ0D 3SO3C 1JWUB 4YFDB 1DQDL 2BNQE 1NCDH 2EE9A 4W4NA 4G6JH 1VADB 2YUWA 3T4YA 5BW7C 1A1NB 2FEEL 4KZDL 1K9TA 3H9HA 5IUSA 1OCWH 3QDME 1P9MC 3KYOB 4XX1E 1Q9KB 3RL1A 1OGAE 4MAUL 4YFEA 4F9PC 1KCLA 1G7JB 4NN7B 5EN2A