1W16A

Rat synaptotagmin 4 c2b domain in the absence of calcium
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
138
structure length
125
Chain Sequence
RGELLVSLCYQSTTNTLTVVVLKARHLPSDPYVKVNLYHAKKRISKKKTHVAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGGGHWKEICDFPRRQIAKWHMLCDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SYNAPTOTAGMIN IV
publication title Structural Basis for the Evolutionary Inactivation of Ca2+ Binding to Synaptotagmin 4
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Metal binding protein
total genus 26
structure length 125
sequence length 138
ec nomenclature
pdb deposition date 2004-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 1w16A00
4GB9A 3RPBA 2ENJA 4NS0A 4LDCA 4JPSA 3QARA 4WEEA 4KITB 4AOFA 4EZKA 5EDSA 4PS3A 3HN8A 2FJUB 3F00A 3OAWA 3ZW3A 4IQHA 1DJXA 3L13A 1YRKA 3PFQA 3APDA 1RH8A 2V4LA 1W15A 4J6IA 2DMHA 3CSFA 2WXPA 3M7FB 4DNLA 5CCGE 2WXFA 4BGDA 3L9BA 4L1BA 3JZYA 4PS7A 3HIZA 4Y1SA 3ZVVA 3PREA 4TUUA 5CCJA 2R83A 2QZQA 4NP9A 3R7RA 4ANXA 2YOAA 1TJMA 2K3HA 4QJ3B 1UGKA 2NSQA 2WXRA 1DJWA 3QJZA 4FLHA 4KZ0A 3NSJA 1WFMA 3T8MA 4XX5A 4LT7A 2WXGA 1TJXA 3QR0A 4LCVA 4A55A 3APFA 1DJGA 3F05A 4AJWA 3N5AA 2CJTA 4FJYA 4ICWA 4F1SA 4QAMB 1QASA 4ANUA 4QJ5B 3NZSA 1DSYA 4F91B 1DJYA 3W56A 4HLEA 2ISDA 1UOVA 1GMIA 4FULA 2CJSA 2LHAA 3ML9A 4GNKB 3KWTA 2WXMA 5G2NA 1DQVA 4PS8A 2WXJA 3L54A 4V11A 4HVBA 4FA6A 2FK9A 5KJ7E 3FDWA 2CM5A 4XZ4A 3NZUA 3FBKA 3W57A 3KWUA 2EP6A 2YRBA 3L17A 3IBEA 4QJ4B 4DK5A 2A4ZA 3LJ3A 3MJWA 1K5WA 2RD0A 1DJIA 2WXIA 1BYNA 2NQ3A 4TV3A 1DJZA 3ZIMA 2WXKA 2K8MA 3SD5A 5JHBA 5JHAA 3L08A 2WXHA 1E7UA 3PRZA 2B3RA 2Q3XA 3L4CA 2WXOA 2CHXA 3OHMB 3PS6A 1E8XA 1CJYA 1HE8A 4L2YA 5CCHE 4EZJA 5T8IA 1E7VA 1W16A 2WXLA 4NPKA 4XE0A 4OVUA 4BFRA 4WWOA 1V27A 3GPEA 4L23A 4WWPA 4ANWA 1E90A 1UOWA 2UZPA 3F01A 1WFJA 4WWNA 3L16A 1E8WA 3TJPA 2BWQA 2CHZA 2Z0UA 4NPJA 4G11A 3P2BA 3ENEA 1QATA 3DBSA 1BDYA 4FADA 3R7QA 4EZLA 4FHJA 4L1LA 4FHKA 2JQZA 2Q0ZX 3ML8A 4ICXA 1E8YA 4F93B 3HHMA 2DMGA 2CM6A 3B7YA 3F04A 3RDJA 3DPDA 3TL5A 4F92B 2Y3AA 1RLWA 2CHDA 2ENQA 3PYCA 2CHWA 3QAQA 1DJHA 4IHBA 4TS6A 3CSTA 2QZ5A 3QK0A 3S2AA 2X38A 1A25A 2NCEA 5G55A 3QR1A 2K4AA 3IM1A 2K45A 2A5UA 3APCA 4ANVA 2ZKMX 2WXQA 2ENPA 4FJZA 4Y1TA 5H4YA 1BCIA 2N1TE 5H4ZA 4MJJA 4KZCA 4WAFA 1RSYA 4URKA 2WXNA 2D8KA 3TWYA 4OVVA 1E8ZA 2KI6A
chains in the Genus database with same CATH superfamily
4EO5A 2ENJA 2IVFC 5ISZD 4PRIA 2GTWB 5JPNB 2XRAH 3IDXL 4EZKA 2QT6A 5MEOB 3DO7B 3FO1A 3VG0L 4R4FH 2G3ZA 5SWQB 3CSFA 1JL8A 4LU5L 1OEZW 2N1KA 1WC7A 3C5ZC 4L4VB 4NO5B 2XJKA 3ETBF 4E9WA 4JJOA 1H3VA 1P4BL 2QGCA 4F20A 2K3HA 2ZWLT 1DVFD 3OTTA 3ZT6A 3U4KA 4MZ3A 4PJGA 3WCYA 4POZC 1MZZA 4LLVB 1VFBB 3GZPA 3SPHA 1G7LA 3UG4A 3PGDB 2BFGA 1HCZA 4XO8A 1MFDH 2A6JA 2K6ZA 2RFXB 2XY1A 1HYRC 3JWDL 1KIQA 5TPWH 1G7QA 4D8OA 1I9EA 5EIQA 1I8MA 2WK2A 3IMTA 5B38A 1E6OH 3C2AL 5IBTH 1MI5B 4FFTA 1P2CA 5I17B 4X80L 4F5CA 2UXGA 4MA3A 4R4BA 1PG7H 2AJSL 2XZQH 3O3UN 3ARVA 4LARL 3RDTC 3WFEL 1YN6B 4PRIE 4GRWE 4DQOH 2ZOUA 1FFOA 4RGMC 3WNMA 3DTXA 4RIRB 1AO7B 4DKDC 1ZV9A 3L6FB 1DEDA 2AQQA 3DSNB 4WW1B 3WIAA 5EBWA 4B0MB 1PYWB 4ZUUA 4LK4A 1ZT1B 5TDOA 4FXKC 2K8MA 4PRHE 1CLCA 1GC1H 3FZUD 1I3RA 5IFHL 2MQ0A 2R27A 3L4CA 4HHAB 5D1ZA 3QUYC 4PJGE 2GIYA 4J8QA 3WTUA 4Y5YA 2GJPA 2X6MA 3BZ4A 1LO2H 1HXMB 1BD2D 1WHOA 1F4YH 4BFRA 1OARH 4HCIA 4AENB 4I48A 4GT7A 3BESR 4F7MB 2Z93B 4NB7A 1AGFA 4PRNA 4PY7A 1HE7A 1CL7H 3CDCA 4Y4KA 2Y1AA 3NSCA 4J8RB 2WGXA 4XC3L 1G1CA 4PVMA 1HXYB 4F5CE 4P57B 2DQGH 4AEHH 5C3IA 3LB6C 5DFWH 5J06A 5CZKA 4FABH 3MBEC 2JJSC 3BIKB 1DQJA 1EERB 4PCSA 2W95A 4X6BB 3U4EA 3BT2H 1WAAE 1NPJA 2IH8A 1BW8A 1NFIB 3W39B 1XHHA 1L6PA 2B0SL 5FYLL 2EVFA 3NSFA 1KELL 1M7DA 3IETB 3ABLB 3I02A 1JMZA 3LEVL 4W70A 5C0ND 4NLAA 3RWIA 1BYPA 4URKA 3O2VH 3ARGA 1QFUL 5CO1A 1RMFH 5FKPB 1ZLSL 1LO0L 1BIIB 4D9QD 3BN9D 2ZP0T 4JFTA 3FUKA 3US1A 5H35B 1S78C 4PFEA 1S7TB 3L3HA 1ZSHA 1E6JH 5K39A 4DNLA 2BOLA 1NWPA 3PGFH 5AYUL 3ECBA 2I85A 3JT0A 3QO1B 4HOMA 1EDYA 1Q1JL 4M6NL 4ABVA 2W80C 2OMUB 4HJGA 2B4CH 2R83A 4KFZC 5ICUA 4F9PC 5A6MA 5FDWA 1FNHA 4X98B 1MKFA 2VXSL 4GP4B 2QVMA 4OV6F 4WJ5B 5DD0H 1QRNB 4Y2OB 4HJ0D 5CFAA 5IFAH 4P2QB 4EVNB 4WU7A 4ICWA 3GBML 3HPLA 3DMMB 4BDVA 3U6RB 1RUKL 2NXZB 2QSVA 5I6XB 3B8SA 4F91B 4HLEA 1ET7A 5E99L 4XBPA 4HUUB 4TLSA 4DVBB 3IDYC 4ODTH 4C57C 1LE5B 2QTEA 2WQVA 2Q76A 1FG2B 3MV01 2E7DA 2WCGA 2A73A 2UZYA 2BM3A 1A9VA 3FDWA 4JG0H 1O6TA 4UV7L 3TM6A 1A66A 2QQLH 2X1OA 3DX6B 4PS4H 4ZXBA 1KCLA 3VSQA 1H0DB 1MIEL 4I4WB 1NA8A 4WHTB 1PG7W 2HWZH 5A16A 5ESVB 4KI5E 4APQC 1WFUA 3MRMA 1A47A 1IARB 1WG3A 3IXAB 4JRLA 4LSUL 4PJXB 1IC5L 4DN4H 3I75A 1QR4A 3HRPA 4GW5B 2QELA 3RWEB 4JZOA 3OB0H 1YAIA 4JREB 3ZKMD 3RLSA 4QXUH 4UQ2A 5FR3A 1ECYA 3FQRB 1L3WA 4Y4HC 4JHWL 2DL9A 3SKUD 1BMWA 1MWAA 5CLXA 4U6HB 1E4KC 5JQ6L 5K9OA 4HOZA 1EIBA 1R5WA 5GZND 5TGBA 1SXCA 1UUNA 2EIZB 4OZGF 3IF1A 3OJMB 4MS6A 3DVGA 4HWUA 3CN4A 2JIXA 2WTRB 1OIOA 5FAAA 2JKIS 4P23B 4XAKD 3ZE2B 1DDHB 2HAZA 3CVHB 4E41A 1U95A 2PCFB 3ECUA 5AW4B 3TT3L 1D6EB 4JDZB 1T20A 2XICA 1KIPB 3GHPA 4JFEA 5DURB 2OSYA 1QFWL 1TZGL 2ERJB 3OGOE 4N5UA 4GKLA 2G0LA 2I26N 4D3CL 4AYGA 2A9AA 4V1DB 1CGWA 4N5ED 4XVTL 4KY1L 1OVZA 4HKZB 4NQEB 3SE8H 1LEKA 5EIIA 4M4PA 5DZVA 1EHNA 5E6ZA 4DP0X 4B9KC 2ZWSA 4JNXA 4OQ1A 2IPUK 4PM1A 3GUFA 5KVEL 1OF2A 2X1XR 3LRGA 3BWSA 3EF7A 4JKWA 3C6LD 1BQLL 5IJVA 2HP4A 3LHAA 1J9QA 1S9XB 3NK3A 5KYWA 1EHLL 5EOTA 3QDAA 1A1MA 4M9PA 1ZANH 2WJ5A 3O9WC 4Z6AT 4KXBA 1CFSB 4C55A 2V17L 4YC2C 5HDBE 1WWBX 2QKIB 5F1KC 4OLYL 1ADQA 1FVDA 3AWGA 1AACA 5I76A 1MFEH 3CXHJ 1UCBH 4Y89A 1QWHA 2PW2B 3L3KB 2VW4A 4OCSH 5K1JA 4LCYB 1N3NB 4KQ3L 1JHKH 2GW5A 4LRNH 2B1AH 5T5FL 4ZFOB 4KZDL 4FA7B 1P1ZA 2GC4C 1TYJA 1NDGA 5L2JB 3BGFC 3RPIA 5IM7A 4XBMA 4ZUVB 2EUZA 4NERA 5E24E 3V8CA 1NCTA 4OCXH 1A9BA 4ZO7A 3GKZA 3MLZL 3MRIB 1E5CA 2XBDA 2QLYA 2FR4A 2PTTA 4HKXA 1KSRA 5D7KD 4LVHC 1FZKB 3UTZB 1RIHL 3DJSA 2X9YA 4M5YL 1AHMA 2VDQB 3VXMD 3WXWH 2Z0BA 5HDQL 1RAMA 1CLVA 3UG3A 2CAKA 4C4BA 1JJUA 1U91B 1IBBA 3WELA 4KPHL 1YYLL 4JZJC 3CHXA 1J8HA 2AV1A 4I77H 5CFHA 4OKVB 1FYTA 1NBZB 2VJ8A 3UO1L 2EE0A 3CE1A 5F3FA 3VDCA 1ZJAA 5E8OA 2Z3FA 4FNUA 4NN7B 3GJEB 4QTFA 4B53A 2UY6A 4PGCA 1Q9LA 4G6KL 2DYPA 1U3YA 2BRRL 3BVXA 2WTOA 1DVSA 4OSUH 1VCAA 4PREA 1QUPA 1FZJA 1I9IL 5I8KL 2LU3A 3PWPB 1B4JH 3ZT5A 3K2UH 2RIKA 2AKRB 1CTOA 3K6FA 3SGJC 3VD0A 2WM0A 4J28A 3U0WH 3HE7D 3PYCA 4G7VH 5DJ6A 3R1GL 5KYUB 2FZ3A 1KV3A 3TIDA 4CSTA 3O3BA 3D8MA 3DURB 3VFUA 2XZCH 1GZPA 1S3KH 1S8DB 2IGLA 4S1RL 3QISA 5EUOE 3WLWC 4PLOB 4P06A 4AE1A 2D7TH 1ZMYA 2D73A 1T0NB 1X5ZA 2HCZX 4Y1TA 4F1ZA 1KB5H 1OCCB 3HC0A 3OKYA 4KJYA 4UTCA 1IC4H 4WAFA 4HKBA 4JPIB 1U8LB 2BY0A 3M1BB 4H0HB 4Z7OF 3QUZD 5T3ZH 3NFSH 1J8HE 5C8JA 3VXUD 1FYTE 3HRZC 2XSKA 3KPRD 4KNQA 1EHAA 5BW7C 3MNWB 3C75A 2J1WA 4YWGH 1GW6A 2EE2A 2X3BA 3CU1A 1J1XH 3V0FA 2A9BA 3FUJA 3VWJC 4MMZA 4ZBJA 2CCWA 1KYOK 2ZQKA 3MPCA 5BNXD 4BZ2H 3MKGA 1M6OB 2WLNA 4QT5B 5A2LH 3BYTA 3RJDA 3EBGA 3L4YA 2NOYA 4ELMB 5KBLA 1BXVA 1EXGA 3IFPB 2E9IA 4V2BA 3BSGA 3MFFB 2DKUA 2EE9A 5DD6A 1KZQA 3BH8B 3X2QB 5I8EB 1I8IB 2JELH 2K6WA 1CFQB 4ORGA 1SNRA 1SFHA 4N8CH 4PP1D 3UC2A 3CUPA 3HR5B 4QHMB 2QFRA 2EDWA 4NHUA 1R24A 2EP6A 2FUQA 5DU7A 1UT1A 4M56A 1TVHB 4FLQA 2ICWJ 3OMZA 1PAZA 3NZ8A 3ZR6A 4HU2A 3TN0C 3O8XC 3OPUA 2NRDA 2OYMA 3LNFA 3O6MH 3TBWB 5AB9A 2IWEA 2UWEA 3FCSB 3SDCC 4CVUA 3D2UB 1KGWA 5CMAB 2ADIB 5DYFA 2D0GA 1N8OE 2EABA 3L4UA 1LO3H 3NSYA 4FFYL 5AYQA 4ZD3H 5F3BB 1KCRL 1B4RA 1RIVL 4JMXA 1OE3A 4L9LB 1D9KB 5IF0B 2WV3A 3FFDA 2Q87A 4YDZA 1M71B 5E00B 2PPCA 4UF7C 1Q0YL 4AYMC 2IV8A 4AJ0A 3ZQWA 1B3JA 4FLRA 5DUPH 4NRYB 1FVCB 3Q9QA 3WBDA 1RKRA 3A3YB 4ABUA 5F7MC 1BG1A 1JIBA 1OLLA 2Q1EA 3G5VB 2IMNA 2FQGA 2J7LA 2PTVA 3LEXA 4OZFA 5AVRB 4F92B 3BKYL 1MREL 1I7ZB 5FYKU 1TG8A 4Z7WB 5IVXA 1T1WB 3SCMB 4G8EA 5EU6D 3GMLA 2O5ZH 3GXPA 3GNML 1I1AD 3GI8L 4UTAH 3ESNA 3T2NL 4W9KC 4Z78B 1KXQE 1F90H 4P5TB 4YHNA 2VXUL 4EI5A 4WVRA 5E9DD 3B9KC 4QRQA 3LIUA 5IW3A 4KZCA 3QCVL 3IGKA 3EBAA 3QZNA 4NRZA 3DX9B 1CVSC 4HPOL 2ZUTA 3IDJA 3T65B 2UWEE 2LABA 3NVQA 1YN7A 2VW7A 3E8UH 2V3EA 4FNTA 2JB5L 4AT6A 3U2SA 5J9PB 2C7UA 5EMYA 3IJ7A 2ZOWA 4MX7B 3ZDWA 3GK8H 1F8TH 5HVHC 1W8NA 3DOIA 4Y2DC 5HGHA 2R69A 3BH4A 5I1IL 1JPFB 4TKWA 1IC7L 3RJOA 4H20H 1J10A 4JM0A 4HJSA 3SPVB 2XV6B 5A2BA 1KCBA 4Z7QB 5I5MA 1WWCA 2F7RA 3X11B 4UAOC 3IJYA 4J39A 4N3TA 3N1PC 4U1IB 5IVXE 1C08B 2OCFD 5LLIC 1DQLL 2OMTA 2NXYB 3EH5B 1JWMA 1JWUA 2YAQA 1RJLB 4FULA 2VDPL 4YSDA 3H9SE 2GIMA 1PCXA 2GAZB 4QYOB 4NWUH 1UWFA 3N85H 2J2ZB 2VXVH 1MCHA 1XR8B 2CHNA 4LSTH 1G6RB 4LKCB 1A3QA 4QHNA 3BVNB 4JZNA 1TKWB 4S1QH 4XC1H 2C3XA 3DOHA 3G6JA 3FUEA 4JK0D 4G5AA 3MRNA 2VCOA 5HHOD 2XWBA 2DTML 1ZTXH 2DLEA 4FI7A 1D7DA 2ED9A 1NMCB 2XCMC 2LAGB 4FN0A 5I1GL 5KSUB 2ZX7A 4KGJA 2Y72A 3B9EA 4KHXH 4X7TA 1IAII 5IOKA 1IQDB 2OW6A 4HCRA 3V4PH 4U6VL 5I1CL 3QNZB 2CLZA 4H0GA 1J87A 2F5AL 1KGCE 3A67H 4KNUA 4LEEA 4H2CA 5TQ0H 3TNMA 2Z91B 5GRYA 2JI2A 3KPNB 3GMOB 4U4IA 2X89A 5DJDB 4YO0A 5MI0B 4NAJA 4F2ME 5LQBH 2X6AA 3MLRH 4NLHA 5AW3B 3FFCE 3SKJL 4LKXB 4IOSA 3D06A 4PJ8B 1B3IA 3V6FB 2JQAA 5KSAC 4O02B 5E1QA 2WN3A 4BFOA 5FB8B 3ARBA 4RRPM 3VWKA 4BQ8A 3EYOA 2CM6A 1E4WH 1CDIA 4TVPH 3KPPB 5GGQL 5I18H 5IFJA 4Y5XB 2NTFA 5J13B 1R34A 3DHMA 2A74C 2RBLA 3FONB 1RVFH 4Q2ZB 4QO1B 4EF3A 5ADOL 1G7JA 1DQQA 5CLYA 4YPJA 4FQIL 5AKRA 5CHNB 2MFNA 1EPFA 2QVIA 1JRHL 3W38A 1AQHA 3V6BR 4TNVF 4PRPB 3M1CA 3LH2L 3QIBA 3DV6B 2YXMA 4WTZA 4Y2LA 5F21B 3M8OL 4R7NA 1F3RB 4BK5C 3QG7L 1UG9A 4CC1A 4YHYB 2F54A 3WSQH 2OKMA 3V9EA 2YGPA 3S36L 4PJ9D 2C1PA 3FRPA 1NFDB 3LYRA 3MKKA 4YDVA 2IJ0C 3P4OB 2GY7B 5I1AB 4HV8B 4GG6B 1UM6H 3QR0A 4UQ3B 1BECA 2XKNA 4JQIL 1JPTL 2QQKH 1IIIA 2VXQL 2V8LA 1GGCL 2YA0A 2VDOB 1BLNA 2AJ3B 4AG4L 4NQCD 1FCGA 5CEZD 1QSVA 3QS3A 3VTTA 4RGOL 5CJQL 4PBDA 5B7MA 4CVZB 4GXUN 3FCGA 2O26U 4Y1AB 3MA7A 2HH0H 2FD6L 2QGDA 5D70L 4J2QA 3BKCH 2F9BT 4JPVH 4JY5L 4J2XA 1XGRA 3MGTA 4FNRA 3OAZK 1P7QD 5TFSH 3NIDF 5E1GA 3QFJA 3H3BC 3ZZSA 4NWTL 1OAYL 4FA6A 3KNBB 1CT8A 4PEEA 5B21A 5F72S 4ZI8A 2GCYA 3RTQA 5IB5A 2FX7H 2WD0A 4R90H 3U6XA 1CLYH 4CC0A 4LFHD 3BW9B 4ETYA 2F54E 3VSTA 5I66B 2WQWA 1JF5A 5A3ID 1AQMA 2B1HH 2BNQD 2D3VA 3GLAA 4EDWL 4OLXH 1DVFA 3L3OA 4X4YA 1NGZB 2HJKB 5CJXA 4M02A 5J12B 3BAKA 1E27A 2A9NL 2YGQA 1FHGA 1CLOL 2UXVA 5B8CA 5KVDH 2X41A 5EZIH 1GR7A 1LDPH 3IGUA 1BG9A 3BQUD 3FYIB 4X5WA 3FOLA 1W72A 4AWJC 4A7GF 2Q5BA 2XQBH 3PL6B 3QFJE 4HFWB 2JKTM 1U21A 4TULL 3OAYH 3QUMH 1JZHA 5H37A 4I89A 1KWGA 1SBSH 1E4XH 3MRRB 5BQDA 3A6CL 1FO0L 2VABA 4X5LA 3TS8A 3WO4B 2LW3A 1U8PB 2Y1ZA 4MJ6A 1UOLA 1B0RB 5E6YA 1A14H 5FM5O 1A4KA 1MFNA 2KH2B 2YJQA 3DIFB 1MW2A 1A6TA 1ED3B 3MR9B 4LASH 2Q86B 4O58L 2AEWA 1OT1A 4J3XA 4WCYL 2B5IB 2QVFB 3DXAD 1H8OA 2P48B 4LIQE 1IJNA 3AG4B 1QPPA 2KL6A 4IU2B 1CG9B 1MPAH 1LO4H 2W38A 3QI9B 4MWFA 2QADC 4O5LL 2P8PA 3QWNA 3WGUB 4RAUB 3TV3L 1E5YA 1OHQA 4FTVA 4AOFA 1BQUA 4PGZA 3TEXA 4RMRA 3JZ7A 4GMSL 2ZXWB 4PCYA 1NOFA 1R3KA 5I16B 4IIQC 1DTUA 1YYMH 5EOCJ 1JD7A 3CQFA 3BRDA 1U8QA 3TA4D 3GKWL 2GABA 2FWOA 4FLHA 3P0YL 2HX9A 4JPWL 2P49B 5EBMA 1XEDA 4HMCA 4UNVA 1JVKA 1BOGB 4OZ4B 2OR7A 5EBGA 4JKPL 4Q9CA 4XN1A 4FP8L 4PJDA 4M7ZB 3NCJH 4OLUH 1WAAF 5F7YC 4EI6B 2ROXA 1UH3A 3FUDA 1YA5A 1RUQL 4XO4A 4X9IA 3WDJA 4PAZA 4YEFA 1W8EA 3JXAA 3DX8B 3MX0A 4TQEL 4K23L 1AI1H 1XB8A 1AQDB 3AREB 3CZNA 4ZTEA 5HYSG 4B96A 1M9SA 4Q6KA 3S88H 4I3SH 2H1XA 4G6FD 3GBNL 5CNHA 2FRGP 3TO4C 2XQ0A 3HB3B 1NCHA 4WO4D 3EGXB 3ASWA 2O5YH 2DBJA 2YD8A 3LMJH 4GOSA 1D7CA 2P5EB 4H8VA 2AK4D 1NUNB 3L5XL 3QZMA 4XAWL 3NCYS 2ICWI 2I25N 5JOFB 4AC4A 4FTVE 1VCBC 1EAOA 2CRYA 1O6SB 3MNZB 4TF4A 4XPFH 3ETBJ 2CCVA 3ORJA 1MFVA 2BIQA 2ZAIA 3FL7A 3VFVB 3TO2A 5B22A 2RD0A 4UANA 1VA9A 3NK4A 1IGJB 1VZHA 2VH5L 4PJFF 3CVBA 4WTQA 2ITEA 3EJUA 3F8UB 3TA3C 5C0CD 1BVLB 1SYVA 4PJDE 4LLWA 4YLQT 2ATAA 1JG9A 3EFOA 3QJHA 3NT0A 3MV9D 1DQKA 1FORL 4BELD 5A7BA 4OIIH 1WAEA 2AXWA 3CFUA 3ZE1B 1GTFA 4BQCA 4LCIH 3GO1L 5EZJB 1OP5H 4WUUD 4Q0XH 2IQAB 4JUSA 5E2TL 4N90D 1HSAB 4N8VA 2WZPD 3T1FB 4R7DB 3UFIA 4LF3B 2OXHB 3MLTA 4I5BA 2F2HA 4L1DA 4YX2H 3K2IA 1JVOA 3OF6A 2CPUA 2CDEA 1SVZA 4JRWA 4KI1A 1FA4A 1AXTL 1J7VR 2NY0B 1FC1A 1A65A 1QSFD 4FZEH 3ULUD 1RURL 1UD6A 2VITA 2K6YA 4G7YL 2CU9A 3CXHK 5EO1A 3TWCL 1CFVL 1S9WB 3T0WA 3AABA 3GSNA 5F0LB 4DP9X 4DK6A 2AQ3A 2EILB 1NBVH 1G87A 2KKQA 3BHBA 3H8NA 3CDGA 3ILEA 1GZQA 2HMIC 3L4XA 4M61A 4M6OL 1UXLA 5ELIA 3KDMB 3TJHC 1FV1A 2JJTC 4NCC2 4FFVC 3K6SB 4NT6A 3X3GL 1U8MB 3VD9A 3HIZA 1L7IL 4JY4B 2IPTL 3O45B 2LVEA 4IKLA 1M7IB 3RIAK 3GJFK 1QNIA 1JP5A 1RULH 1YEEH 3CFEB 2GBVA 1YMHA 2WXRA 3QCTL 4XCEA 3NSJA 2A1WH 1INEH 2FJGA 4OLVH 1H5BB 1QI3A 1CK0H 3QORC 5GZNA 1QPXA 3WEBA 3K5RA 1PZ5B 1RK0B 3AJ7A 3KAAA 4R96A 5F9WB 4KRLB 1JZ2A 3BDYH 5E6ID 4G59C 3B7SA 2AK1L 4L3ED 2J6WA 4PRIB 4GRWB 3V9CA 5KUMA 2EVJA 4OGZA 3FO1B 1C5DA 2ZD0A 3CFQA 3IT8D 1NDTA 2M26A 3GSVA 3D5OF 1WC7B 1TTRA 3X1EA 5KBDA 4E9TA 4JQXA 1KFAH 1RZPA 2Z35B 2GI7A 3UPCA 1QYGH 5E2UH 4OV5A 1LVEA 5ILTL 1HSBA 1SF3A 3WDHA 2A6JB 3V0IA 3TURA 4XWGL 5DHDA 1KIQB 5LGHH 1G7QB 4U4BA 4FMKA 1C5BL 1I8MB 2QPEB 5B38B 1LE9A 1RD6A 5EFIA 5C97A 4BJLA 1P2CB 5TF1L 4UT6L 3DO4A 4J3TA 1CDYA 4JO4H 4A67A 4MA3B 5LUMA 4R4BB 2ZX6A 4OJDH 5ITFA 1A4CA 12E8H 35C8L 2F7QA 5K69A 1FFOB 1D6VH 3PWLA 2J5WA 1IVLA 2NY6B 3DTXB 3I2CH 2CBMA 1XMEB 2BDNH 5EBWB 3B9VA 4AV0A 2XKSA 3FSVA 3QYCA 1JD9A 4ZUUB 5TDOB 1QLEL 3T0BA 5AZ2L 3SDYH 1JFQH 1CURA 1I3RB 3AACA 2K7QA 1AKPA 5IT2L 4M03A 4NFBA 4M5ZL 5D1ZB 4PGJA 4Y5YB 3VXMA 3BZ4B 5EC1A 4FNLH 1J5HA 1R19A 1F0LA 1OSPL 1SDAB 3GMPA 4I48B 5IQ7H 1RUPH 2LU5A 1SY6H 1AGFB 4PRNB 4PY7B 4RNRA 4Y4KB 3ZW3A 3WFCL 4XHJC 3T71A 2XWTA 4HXAL 4F7EA 3VMPA 2CJUH 4ZUTA 3VYNA 2ENSA 4YFEA 3SDXF 3Q6GH 1SUHA 5C07D 4TVSa 1NCDH 1KXVA 2NY5H 1OGTA 3U2IA 2NW2A 4RFNB 3T4YA 5TDPA 1DQJB 1TETH 2YQGA 4ZNCD 1XTMA 1G1YA 1I9JL 1X5AA 1X9LA 3MBXL 5TE6H 3U4EB 3NCMA 4D0DA 2EDRA 5DD5H 1FH5H 2GTQA 2JQMA 4YQXL 1GKOA 1JPSL 2VDRL 4XXCA 4NC1E 3FSWA 5AWNH 3HE7A 1M7DB 3I02B 1A6UL 4M1CD 1ZT4B 5EUOF 3F7PC 1WUNT 1IGTA 3ARGB 3TT1H 5LDSA 1DL7H 5D7KE 3FHAA 2PW1A 4MB1A 3VXME 3L3HB 1FFNB 2EKSA 3WXVL 4DPBX 4JB9L 4MCNA 5K39B 3BLBA 5AVWB 3QDGD 1AOHA 3RHWK 3ECBB 3ZSTA 3RAJL 3SZ6A 1M4KA 5DVPA 4M43H 3QUZA 4A04A 4HJGB 3GIVA 4KKBD 1BZQK 3ARQA 4BFGA 1MWAH 5FDWB 3HG1D 2WQAA 3VXUA 4BZYA 4ENZA 3ZIYA 3I74A 3GIZL 3CZEA 3VD4A 3KPRA 3B2PA 1JGUL 3F85A 1HQRA 3VM5A 2FATL 3L4ZA 4WU7B 5BJTB 3HPLB 4BDVB 3ARTA 1WYJA 3ETSA 2Y06H 1J18A 4LCCC 3O6KH 1AR1B 3RWFA 4G3YH 3UTSE 2EDJA 5HI3D 3OMIB 4OF5A 4X7EC 1PZAA 5DK2A 1RUAH 1PIFA 3L9EA 4XBPB 1A4JA 1AHWC 3RZCC 4GUQA 3RVXD 3MTXA 1Y6KR 5F89A 3VGFA 1H3UA 2Q76B 3BSZL 1T83C 1J5IA 4K07A 4DTGL 2VB5A 1DSFH 2A73B 2UZYB 3GEWB 3V5KA 3VI3F 2IFGA 4W93A 1EO8H 4EZLA 4R0LA 2DM4A 3GXFA 3VVWA 2JQZA 2QMJA 3MRJA 3T0DA 1U3ZA 1MRDL 5AAMC 4ZXBB 3EOTH 3DA0A 2R29A 5CWSA 1E5AA 1AY1L 1XD0A 2XUWA 5LGJA 1I1RA 5A16B 4PJBA 1JI1A 3P30L 3BYYA 1J12A 3H7BA 1O9WA 4KK5D 3QEHA 4BH7B 4QHLA 5E5MB 4NQXA 3Q7JA 1L9MA 3VXUE 1L3NA 2A7BA 1CICC 4IW4C 5F7DA 3KPRE 2LT9A 1MVYA 4K7PL 2GUYA 1VEPA 4DFHA 3I75B 1DVTA 4UU9A 2CNYA 1NLDH 5FYJU 4JZOB 4XP9L 2MKWA 3HNTL 5D7JD 3GSQA 3L4TA 3TZVC 4UQ2B 2YPVA 4GAJL 1CL7I 1T89C 1EGJL 1RZKH 3EO1A 2NCMA 4MA8H 4N2CA 5KSVA 3BPCA 4X6EA 1FN4B 1MWAB 4MQSB 4KUZH 4L4TD 3ZTEA 5K9OB 2APTA 1HNFA 4NKMA 4WWKC 5HDBB 1LMIA 1R5WB 3SE4A 5TGBB 4XCYA 1R3IH 3IF1B 3ILPA 3DVGB 2J88H 1UXWA 1KBWA 2EADA 3BIBX 3EHBD 1GCYA 4K3JH 3DUHA 2JIXB 1QZ1A 4HEPA 1IBZA 4JJ5A 2AJXH 4E41B 1U95B 5E4EC 5AEAA 1R4XA 1T20B 3OGCB 2IMMA 4JFEB 4YR6B 3QG6A 4PJBE 3KPTA 1ZWIA 5AOKA 1XBRA 4LLUA 4ZS7L 4LCUA 2PABA 3QUXC 2I5YL 2RH0A 1WFOA 4K8RH 2HPTA 4L8SC 4Y2NA 1W80A 5E9DA 1AKJD 1LEKB 5EIIB 4PV9A 5CN1A 3VX1A 3B9DA 3TH2T 3STBA 2GG1A 2J73A 4GS7C 4Q89A 1OF2B 2VMJA 3PCYA 5IJVB 4PWGA 4BXSV 5KYWB 5EOTB 1A1MB 1B0GA 4Q9BA 5B4MC 4KNTA 1C16A 2C1OA 3LZPA 4RMQA 3UROR 1KNOA 1J1OH 1N7MH 1F18A 3FMGH 4NPYA 3UPRA 1RSFA 1FVDB 1Z9MA 2W07A 2HX7A 3RA7H 3RVVC 5I76B 4GI8A 3K0YA 4F37K 5T5NG 2TAAA 3BH9A 1IFRA 3DRQA 5L0QC 1P1ZB 5F7WC 3W5NA 4LEBA 1IC0A 3L2MA 1NDGB 3HEIB 1YEFH 1TLKA 5AW7B 3V4LA 3RPIB 5IM7B 2PO6C 3CZJA 2IAMD 2DQDL 3P1VA 3TVMC 1A9BB 1WPCA 3L2NA 4FLOA 3VXNA 1BVNP 3KGTA 1RUMH 3WFDL 4P07A 5E9DE 5GGTA 2FR4B 5HI5C 2W1NA 3G6DH 2PTTB 4HKXB 4L8BA 3TEUA 2H6UA 4PJAE 4GG8A 4Z8FL 1SXAA 2WAHA 1Q9KA 1TJGL 2KYIA 5HHOA 2CO1A 3PQYE 4HK3J 3RVUD 4ZG1A 2VN5A 2R59A 2ALAA 4YSOA 3I9IA 2IPUG 3S37X 1J8HB 2AV1B 2DQMA 4FQHA 4M93B 4NYLA 4EUPA 1FQ9C 4DP5X 5L8LB 4RAVA 3L1EA 4PN6A 2QHLA 3D39D 1JZIA 4PG2C 5E8OB 2WMPB 1JK9A 3BJLA 3H53A 1IIKA 2UY6B 3IJ9A 3GWJA 4PGCB 3VDBA 1Q9LB 4BA0A 5EEZA 2DYPB 3ARDD 4KO7A 5AVUB 1ACXA 2A38A 2OULB 1CYGA 1NSNH 4E9RA 2R4RL 1K3IA 1KCUL 1FGVL 1A2YA 4PREB 3ZHFA 4LPWA 1FZJB 5JZ7D 1HCYA 2VL4A 1B6UA 2X2JA 1BPVA 3EYSL 3KJ6H 1S5IL 3V0GA 4AYBA 1YPZA 1E28A 4QAWA 2Z31A 2YS4A 5DJ6B 3IAQA 1RZGA 2Z34A 2FZ3B 3TIDB 4AZ8A 2C9VA 3O3BB 4OCYH 3VFUB 1GZPB 3FHQA 1XH3A 1PD1A 4NM8L 2BNUA 5K9KA 1T7ZA 3IN2A 4NO0A 3VI4F 4DOHE 5DFTA 5DJYA 5I0XA 3HC0B 4GY4A 4KJYB 1NCIA 3S0PA 3EJCA 3A21A 4C4UA 4HKBB 4K9JA 3II1A 1NAKH 1KYUA 2B2XL 1LWHA 4A68A 4UIMA 3UBFA 3DHUA 5JPNC 5K5YA 1MCCA 2BSTA 4ONFL 4R84A 5C8JB 2I9TB 1TO5A 5LG1A 2W5PA 3QQ9C 4IBUA 5C2UB 2OMBA 4BD4A 1LLAA 4DVRL 2DLFL 3QJXA 3ALWA 3PG2A 4MMZB 2DM7A 4OZFH 5E5LA 4QRUA 4PJ9A 1BZ7A 4L0PB 1HX0A 1Z5LA 1N0XH 1WIPA 5AVQB 1T6BX 3VXTA 1T6VN 4HBCL 3RTLA 2ETWA 1K85A 4OZHF 1ERNA 1NANH 3H42H 4GXVH 4OJFL 4XO9A 4HOWA 4BEIA 5DJCA 1BAWA 2LE9A 2FBOJ 4NQCA 4K3HA 3W3BA 3QFDA 4ORGB 1HVXA 3O0RL 4WEMB 5TDNA 3TBBA 5EU3A 3TEYA 3CUPB 4ZO6A 5I8OH 3D18A 5I1JL 3JVFC 4NHUB 2VL5A 1P7QA 1R24B 4DO6A 5HVFB 3CJJA 2ZCLH 3LS4H 3VG0H 1YEDA 2IANE 1URZA 3NZ8B 5KVGL 4AVIA 2IWKA 1MRFL 2UWEB 4AI7A 3AXIA 2GJ6E 5GS0H 1BEXA 2DD8L 3HCVA 3O2DL 1U3JA 2GC7C 4LEXL 2BNQA 2OSXA 3FFDB 2NW3A 3U0TA 1JNNL 1E9OA 1KLFB 3AITA 3BKJL 4FI6A 4PJHF 5FYJD 3C5XA 1PF3A 2VLKB 4NO2A 4PH8A 3HTLX 4IDLA 1NUDA 1MHPL 3C2AH 5CCGE 2IOIA 1BXXA 4CKQA 2L04A 4PJEF 4YLBA 4FOMA 4NQCE 4X80H 3UEQA 4LSPH 3ZO0A 5CEZE 2YRLA 3LEXB 1N67A 4OU3A 3AY4C 1MFMA 4CGUB 3E6HA 3KDPB 5FFOA 3BQUA 5IVXB 1PJWA 4LARH 1U3NA 4G8EB 3GMLB 2WZ0A 1FRGL 3LKPA 2XFGB 2ZP8A 4WI9A 1IKNC 3MRBA 4YHNB 4EI5B 2QQNL 5K33A 4UT9A 1EUTA 3MCYA 1UWEL 1WE5A 4HCRH 4NRZB 6CGTA 2X44D 2BJML 5IJCC 3G5ZA 3IDJB 5KBKA 2H1PL 2YUVA 1YN7B 2X2HA 3ERXA 4AT6B 5E2JA 2ZUYA 5CU9A 4GNKB 3U2SB 1VJSA 2C7UB 3ATAA 3T5WA 1EUUA 1UKTA 2G60L 2R51A 4Y4FD 2ZWYA 1QNZL 3QEQD 2J1XA 5HGHB 4FZ8H 3J7HA 3VFGL 2YEZB 1U8KA 9PCYA 4XC3H 4EI0A 2O5NA 1NIBA 1KPRA 5FGCE 3SN6N 3WEMA 3KWWA 1MFAH 4PUBH 5JOPD 4XI5D 4OKDA 3QXVA 1T7WA 2D7OA 3DMMC 3D9AL 3IJYB 2NXZC 4P49A 5BPPA 5I6XC 1O7VA 5IESL 2J6EL 2OMTB 5INDB 1JWUB 1JWMB 1C8QA 2GBTA 3AVEA 3ESMA 4GMTL 1J0KA 4HP5A 3G9VA 4JHAL 3CFNA 1PMYA 1H9DA 1IO4C 5FYLH 1T03H 4ABWA 3TJPA 4QHNB 4JZNB 3IKKA 5DQ9A 4ZSOA 2DQEL 3G6JB 1MELA 4LSSH 3IU3A 3MCLL 3N42B 3OD3A 2XWBB 2XA8L 3L1GA 2PUQT 1ORQA 2QSQA 1EZLA 1QBML 4GEIA 3VNYA 1SYSA 2ZKHL 1XZ0A 2FHFA 1I85A 4ELDA 4XPAL 4WY7H 4X7TB 2A5UA 2KLSA 2E86A 3D69A 2VDKH 4P59H 2CLZB 2VXSH 3HMXA 3N44B 3TNMB 1UFGA 5JXEC 1MJ8H 2HXAA 3F64A 3NIGF 4FE9A 4ZTPH 1KLUB 2Z64C 3G3LA 3AU1A 1CPUA 3FCBA 4YO0B 4WI8A 4JREC 2V0AA 4WF7A 5C0CA 1ZT7A 3MJ8A 5BS0E 1WH0A 3APDA 5DZNA 3F84A 3W5MA 2IQ9L 1K4DA 2OW7A 2WXFA 4L0YA 3MV9A 5E99H 4N2HA 3RVWC 3QUGA 3ARBB 4FFZL 4U1GB 3EYOB 4DT2A 5IFJB 4YAQA 2NTFB 2DKSA 3UADA 1OHZA 3BAXA 4WUUA 5HHMD 3UMTA 4ZSOE 1IAIL 3EO9L 2YKLH 4P23C 1Z5YD 4UV7H 2CIIA 2WZPA 1G7JB 1DQQB 1T0PB 5EPMA 3RL1A 4LIQH 4GUPA 1J05A 4W9HC 3CDZA 1FSKC 1QASA 3APNA 2ITDA 2VJ0A 3BJ91 5I2IA 4HQQL 5GGRY 2ERJC 1QSFA 3DK2A 2F15A 4OGQC 4U1NA 5HI4C 15C8L 3INUL 2DQJL 3GXDA 4BWUA 3QIBB 4LSUH 1IQWL 3UYPA 3UP6A 1QSED 4DEWA 3UTOA 3VGGA 3OWEA 4TUOA 1RCYA 4R7NB 5DJ8A 2KMWA 3RIFK 1ES0A 5LN4A 2F54B 3MLWL 2VR7A 2XFXA 3CFMA 4KKZA 5C0CE 3WIFA 4FQ2H 2C1PB 3FRPB 1J0ZA 3QCUL 5AL0A 4YDVB 5KUKA 3GSUA 2V3FA 1V3LA 3VRLF 3MV9E 4KXZH 1A8JH 5ENWA 4HLZG 5H37H 3WNLA 4B0MM 2XKNB 2VDKB 4PB9L 1MEXL 2QKIC 1BLNB 1CQKA 4WUUE 4MSWA 2IC2A 5E8NA 2R1YB 3OQ3B 2VSDA 5T8IA 2YZ8A 3E1F1 2JB6A 3MA7B 3AG3B 3ZHLA 4G83A 1FNFA 3TT3H 2F1AA 1DN2A 2YA1A 1XGRB 3MGTB 4JKLA 5CILL 5E6IA 4YXLH 5E6UB 3QFJB 3D30A 4B9GA 1JVLA 1XCWA 5ISZB 4L3EA 3ULUE 2GY5A 1NDMA 2EZ0D 2YD4A 1P7HL 5ICYA 4HJTA 1CT8B 4XNYH 3HPJA 4X8CA 2F1EA 2GCYB 3FT0A 1NCAL 4KY1H 3RTQB 5IB5B 4OFVA 2ZCHH 1PKQA 3SDXA 2NT0A 4F7KA 5G5DA 4TUKL 1RLWA 3T2LA 5IBLC 2V2TA 4RA3A 5CN2A 4HJEA 1W9XA 4JFDD 3CVIL 2CGZA 5BZXA 1YNKH 3FB6A 1DVFB 4AMWA 3DIVA 4BKTC 3RP1A 2RCSL 4X4YB 3VJ6A 5CIPH 3VW3L 1E27B 3VB8A 5HVGB 1WLHA 2ZUXA 4HXBL 4NN7C 5E4AA 5ABDE 4WFFD 3HMWH 3ZQXA 5B8CB 3HUJF 3LKNA 3Q2LA 4GFXA 2EEBA 3BLPX 2FECL 4X5WB 2VIRA 3GINA 4NX0A 3FOLB 1W72B 5F44A 4LL4A 1JF1A 2J1YA 3Q44A 3IDGA 3IRPX 1NCBL 5AZUA 3NEOA 4ZAKD 1CBJA 2DEYX 4QMEA 4WHYG 4G6JL 3EGSA 1ZLWH 1BAFH 1WGVA 2VABB 4JRFA 4KTEH 4KZ0A 4MJ6B 4L0ZA 4PW9A 1A4KB 3OLIA 1A6TB 5FM4A 1PKQE 3MNDA 2BCKA 1DANU 2KDYA 3P11L 4Q74A 1CXIA 1RIHH 3EFFA 2EC9U 1EK3A 5KBNC 4M5YH 3M88A 1UCTA 4MWFB 3OPZL 2P8PB 1ZJBA 4XBGA 3LIZL 1FPTL 2J12B 3DWTA 1YYLH 3NJKA 5AB0A 5J1AB 5E0FA 1JWSA 2IAAC 4A2DA 1R3KB 4KKQA 1FJ1A 2MEJB 4TRPH 2AJVL 2L7EA 4NM4L 4F24A 1CF8L 1MFBH 4OF8A 5LB1A 4G6KH 1U8QB 4NAQA 1BZEA 2FWOB 5EBMB 2X70B 3DKHA 4QR7A 4YGAB 3OAUL 1KB3A 4NAMA 5C07A 5I8KH 4TOYL 4PJDB 1VFMA 4Y8DC 4MNGA 1B9ZA 2OMVA 3QAZB 4WJG3 5GHWH 2ARJA 3MX0B 5FIEA 2COVD 1II4E 1Z0MA 4HSQA 1FIGL 2X4TA 4B5EA 1W16A 5DWUL 5I19H 1S9VA 4ZFGH 3K7UA 2OK0H 3GM8A 3CC5A 3VA2C 3GGWA 1QFPA 2P24A 3IU4H 4XNAA 1UWGL 3T6XA 4XHQA 3DOSA 2DQTL 3EYUL 1IE4A 3KYNA 4AGNA 5DQDL 4IMLA 3QJOA 2FT6A 2BSDA 4ZOCA 3WJJA 3DJTA 3C9NA 2EO9A 4U0RC 1O5DT 2G30A 4O2FB 5DS1A 3IFNH 3SIKA 1UXMA 5D96B 3TO2B 1HZKA 1FL3A 2R4SL 2VN7A 2KQMA 3HG1A 2FTAA 1AGCA 4HF5H 4NKDB 1EO5A 3HC2A 4I3RL 3PP4H 3QWOB 4PI2A 5K93A 5JHDD 2ENPA 5H4YA 4XWOD 5C07E 3S8GB 4M7KH 1SYVB 4LLWB 3I9GL 4KXCA 4MNGE 3RYMA 1C5CH 4N0YL 4L9LC 3AADB 5F0MB 3EFOB 3QJHB 2R15A 2Y3NA 2V8MA 1RZ8A 3JYBA 4EN3D 2XN9E 4G8GD 4MVBD 4DGVL 2R39A 1TFHA 4NXSA 2YN5A 1B2YA 4N8VB 4QWWD 1KTRL 4DGYL 5E1IA 4HJJL 4MD0A 3MLTB 4I5BB 3VNZA 5CAYB 4AW7A 5L8KB 4AQ1A 4Z7NF 1JZ6A 1ZGLA 2WKOA 1CR9L 3BPLB 1VADA 2CDEB 2L8AA 3SCMC 1E4XI 4KDWA 5DMIL 4CRPA 1F42A 3ZUNC 2IPKA 4JPQA 2VITB 3KWXA 2CNZA 3V7AG 2AMGA 5EO1B 4P5TC 2FSDA 5DHVH 2MQCA 1XF4A 1DSYA 5J1TC 1MQKH 3GSNB 4YBLB 3A6BL 5HJGA 3P4LA 3BHBB 3CDGB 4UOW0 1GZQB 5F7BA 3LXAA 2ZF9A 4A2GA 4S0SD 4M61B 3NABL 4XX1E 4FQ1L 2R8SH 5B38G 1FV1B 4GRLD 1KCRH 1IFGA 5F8RC 3HFMH 5D7JA 2IGTA 3R8QA 3QWRD 1GGYA 4UBDD 5JHLA 5GRUH 4OJYA 3QUKA 3ARXA 5IV2A 1YMHB 4DK5A 4XCEB 4L4TA 2FJGB 3QFGA 4JO8A 5HHXH 4MJ5A 5GRVK 1XXFC 4TXVB 4NOFA 4R96B 3UTTD 1I31A 1SZNA 3BKYH 1MREH 5DRZA 3T3ME 2N7BA 4G6AC 4ENEC 1H8LA 1OAUH 4YOKA 4BUGA 2NXYC 1YJDC 1BM3L 2B9BA 2P26A 2IG2L 3GI8H 3GNMH 1BJ1J 4WLCA 2PYED 5F6HJ 1Z66A 3T2NH 4P3CL 4JX0A 4EKJA 2VDNL 2W81C 2UZPA 4YXKH 2VXUH 1AE6H 1C5DB 4WHCA 1ZLVH 5ECJE 2DM3A 5KW9H 1NOAA 1ZCRA 1LK3H 2XG5A 3GSVB 5FWQA 2C9SA 3KLSA 3EJJX 3B6SA 2NY3D 3VFPA 1M53A 4O2CA 1A7NH 1AKJA 2L0DA 4UINL 2Z4TA 1DFBH 5AOJA 3ZDZE 2JB5H 2GSIA 2HJLA 3T6VA 4X6DF 4MJID 5CGTA 1UHVA 1IILE 3T6QC 1NMCC 3FT4A 4OV5B 3SPJA 1HSBB 1OKEA 3K6NA 3V79C 3C6LB 5FXCH 5BRZE 5I1IH 3S4SG 4LQFL 4L4TE 4NQTA 1JV2A 2E4FA 3ZDYE 1LE9B 2FO4A 5EFIB 2AAVA 2X2IA 2YK1L 1MHHB 2MNUA 3IBOA 4IRZA 5MI0C 3WTSA 4Y9CA 3F83A 3HN8A 2IEPA 2HTKD 4HFUH 3UO8B 4PJ8C 3CDYA 3EXJA 1HYSD 4FRWA 5CKGA 1UTDA 1DP0A 5C2BL 1IGIL 3PWLB 1XFPA 4GQ9L 1Z2KA 2Y36L 1G7IA 3R7RA 4B9YA 4QJ3B 4Y5XC 1UGKA 3M45A 5J13C 1IBGL 2EH8H 1VEMA 3B3IA 4PR5B 4PJAF 4KKCD 1MW3A 5LCVA 1S78D 1JTTA 4QAMB 5B3NA 3VXMB 1HNGA 5EC1B 5EBLA 2ZXAA 1OSYA 3ESOA 3GMPB 1U2YA 1URLA 5BZZA 3FTUA 4RNRB 2WKGA 2EYTB 5I1CH 3S36X 5JW5A 2FQFA 2XWTB 4RISH 3SGEH 4F7EB 3MFGB 4HH9A 3H3PH 4ZUTB 3B2DC 2Z65C 3D39A 2OBGA 3TXAA 4E68A 1N64L 1Y1UA 4YHYC 4M6MH 1OGTB 4QTHA 5M94B 2NW2B 3T4YB 1RZJH 3OKEA 4YBQD 3BVUA 5TDPB 2GHWB 5B7FA 2E46A 4TLTA 3WTVA 4R83A 2FEDD 1PX3A 3V0EA 2P80D 1IGFL 1Y18A 3OL2A 4XN7A 3HE7B 4KBPA 1S7VA 4JKMA 5GGQH 4MKTA 1CXLA 4N2FA 1IGTB 1N10A 4IOFD 4K3EL 2BIPA 2WOBA 2EVIA 4P05A 5ADOH 5D6DA 1DBMH 1RL1A 3GPEA 1JZ3A 2EKSB 4N6QA 5D4IA 1SHSA 4AEIH 3OKOA 2YEVB 3TYGH 2VRKA 2YPVH 1KIUA 5IQOA 5T1MB 5SWZD 3QUZB 3IMWA 3TH4T 3GIVB 4BE6A 5LWYL 3WAKA 3HS9A 3PJSA 3VXUB 1G9MH 2YO3A 3N2JA 3D39E 5L0QB 3V7MA 2ZUWA 3WNPA 3KPRB 2C9PA 3QHZL 5DI8A 4XNMA 1HQRB 3QG7H 2WUCH 3FH5A 1BZDA 1KTLA 5T3XD 1OB0A 3RI5F 2WUBL 2F58L 3NSXA 3OM3B 3RWFB 3VFSA 4ZMXA 2UUDH 1KN4L 1IT9H 2L4OA 4R5XA 4W9GC 5DK2B 1OPGH 4NQUA 1A4JB 1JPTH 5D5MF 1TJIL 2VXQH 1GYVA 2YEQA 5F89B 4NXKA 2V5TA 3NRQA 4R4FL 4YHZL 4AG4H 2OCJA 1BQHA 3V5KB 2VLRD 3QXWA 3ZTJG 3HI1A 4R0LB 4KK8D 3MGAA 2MOVA 4JFFD 2J43A 2FD6H 5D70H 2IBZX 3MRJB 1IX2A 1HWWA 1NOLA 2EJ1A 5BOPA 1JYWA 2AXGA 3HI6H 3PL6C 5CWSB 4NRXA 5EIIG 5LGJB 3UAJC 1PLBA 3H7BB 3OR7A 3WO4C 4QHLB 4U1MA 4NQXB 5LBVA 2OZ4A 3V4VA 2MPVA 4XMKH 1GS6X 5TPWL 5EU7E 1E0OB 3RFZA 4U1HA 5F7DB 2HVBA 3GC3A 4OCNC 1YAZA 1E6OL 2B5IC 4RBPK 5IBTL 2QSTA 3AB0B 1JFHA 1NEZG 4UU9B 4F3FA 3QI9C 2CGRH 3GSQB 4ODVH 3UZVA 2E74C 3H3KA 1PG7L 2XZQL 3BIAX 5GSRA 3EO1B 4CU8A 3F12A 4NBZB 5KSVB 2UYLA 3BPCB 4X6EB 3HG2A 5B1JA 4YSQA 4DQOL 1SVCP 2E56A 3GZKA 3QA3A 2WLLA 3LS5H 1NQBA 2A9NH 4NKMB 4NZUH 3MRLA 1CLOH 3SE3A 3GTNA 4IBWA 3ILPB 4TLKA 1E2WA 1UXWB 1E43A 1C8PA 5B1AB 3ZPDA 1NMAH 4JJ5B 2GHZA 5EOQL 1FWXA 2Y23A 4M7ZC 1DJZA 1WV7T 5EN3A 3BFQG 4QHPA 1PIGA 3N3EA 1LO2L 1ZWIB 2IDTA 2WXOA 4LLUB 2KLTA 4LCUB 1OARL 2WLMA 4YBHA 3AREC 4EUPH 5EEWA 1AIFA 4O58H 1VZGA 5E9DB 1HQ4A 4AYSA 1EEUA 3HB3C 1HKFA 2VOTA 4WCYH 4PV9B 1G9NC 1OTTC 3FUFA 2JV6A 2K8QA 2FHBA 1BWWA 2CHZA 3MJ9A 4P46D 2CXKA 1SM3H 4LEOA 2CXGA 2DQGL 2MCPH 4AEHL 4GKOA 4A2LA 4FABL 4NZRL 2DMGA 3BVTA 4TNGA 1EHKB 1B0GB 4Y4FA 4GMSH 5I6PA 1BYOA 3GSWA 2CA3A 1C16B 1DJHA 2C1OB 3QEQA 1E5UI 3QJTB 5FYJE 1KNOB 5DZLA 3UPRB 2DWDA 4GINA 4S10A 2VQ1A 3FB5A 2W07B 2CO3A 4Z7UF 4YZFE 5FA3A 1VKXA 2XX0A 3V6OA 3GKWH 3O2VL 3P0YH 4JPWH 1RMFL 5KS9E 1TQBB 1N9PA 3BH9B 3WNJA 3DRQB 4HWBA 2Z92A 3EFDH 1XD1A 3LPOA 3NPSB 5C0AD 4FP8H 2N0KA 1ZGLP 1GS7A 1WBYA 4FFWC 2QBWA 3ULVC 1E6JL 4W9CC 3PGFL 3MI6A 2MTPA 1OP3H 4JJHA 4N2IA 2ZYIA 3VXNB 4TQEH 5M7QA 3ZGIA 3NAAH 2CD0A 3GBNH 4L8BB 3FTYA 2EXYC 2WSKA 1QR1A 2GTZA 1G94A 4AV4A 4GG8B 4DOHB 5IFAL 3L5XH 4KVNH 1Q9KB 4E42B 2N7SA 5H8DA 3DGGA 2A6IA 5HHOB 2QQQA 1OZTG 2W0FA 4L5FE 4U1KA 2OMZB 2IH1B 1G9HA 2JVUA 4ZW5A 4EUPB 3QEQE 4FQHB 3KPQA 4IKKA 4NYLB 1E3FA 4RAVB 2G9KA 5IZ7A 2VR3A 2E7MA 1HHKB 2YD3A 4ODTL 1JK9B 2EIEA 2WVUA 5D1QD 3VD2A 3Q05A 4OGAC 1S7QA 3ZYIA 3V6OE 1NLBH 4KDTA 5JOPE 2ZF8A 3I85A 5IROD 4J4PD 1A2YB 3C09B 4BFKA 4OGYH 4ONHA 5C0DA 2BP5M 4JG0L 3DX3A 3NIDB 1TCRA 1EO7A 3C8DA 4PS4L 1YYCA 2JI3A 5IMMB 1YPZB 1E28B 5A43C 3NEEA 1SGKA 2Z31B 2VZOA 1CN4A 2H47C 1J5DA 2HWZL 1RZGB 3L8QA 1P7BA 4AZ8B 1AQKH 4GBXD 3ZDXE 5AOZA 4B9JA 4JGUA 2GJRA 4RWYH 1TZAA 2MNJB 3ZHDA 1H5BC 2ZYRA 3D51A 3ZIMA 2V2XA 2BNUB 5K9KB 4NO0B 2LQRA 5F9WC 3FUNA 5DJYB 3LNIA 1FDLH 4QHUA 4DN4L 2F19L 1J88A 1GPOL 4L2YA 4X42A 1GVIA 1YG9A 4UIMB 4E5XA 4ZFOL 3SO3B 5FUCE 2CKNA 2HLEB 4G7YH 1EJFA 4R97C 3N1FC 5DRWA 3N0AA 3HVNA 4GIPD 3IEAA 4N2NA 2HLFC 5AUMA 1ZLUH 1UVQA 4YDMA 3EW3B 3SDCD 1QSEA 4FYQA 1S7RA 3AQYA 5D7IF 9CGTA 1FBIL 1ODUA 4I87A 2FH8A 3UCRA 4NJ9H 5ANME 5AAWA 1KBVA 5A2FA 3UJIH 4QRUB 3X3GH 1ETZA 5CN3A 3HBZA 4PJ9B 2NY7H 1BZ7B 1N19A 3MA9H 1Z5LB 2IPTH 4KDVA 3VXTB 4IOIB 2Y22A 4KX7A 2QEJA 3KLAA 4E9QA 3QCTH 2AQ1A 2O6PA 3NDZE 4UT9H 4A38A 1ET5A 5DJCB 1MJJA 4NQCB 3SE8L 1H6FA 4ZTOL 5KAQF 2ZSWA 3RY5A 1ASOA 1DQIA 3QFDB 4Z7AA 1SRDA 1HIMH 3OKKA 3SHSA 5TDNB 2VE6A 5I71B 1MNUH 4PW4A 5EU3B 5DJXA 1CGTA 1M57B 3D18B 3LN5A 2NPLX 4ERSH 2VL5B 1P7QB 1L0XA 2PXYD 5E5RB 5EA0H 3FCUB 2NY6C 4U0QB 5C0JA 1ZA6B 1YEDB 3ARFD 1F45A 1FAIL 3QC5X 1JPGA 2AXJA 3P2DA 1EEZA 2CKBA 1DVQA 1QSEE 1F1GA 1I3UA 1UCBL 5CR8A 2C9AA 4HIIA 4OCSL 3HCVB 3DVIA 5D1ZC 3OXSA 4QOKD 4EPSA 4PJ5E 4Y5YC 1JHKL 1ZA3A 1SN2A 2BNQB 2NW3B 3U0TB 4Q4EA 5ILTH 4AUYA 3O4LD 4Y2DD 5JNYA 1VEOA 1E9OB 4RDBA 4YDJA 4S2SA 4Y4KC 3VACA 3DI3B 4NO2B 4OCXL 3CZFA 5A2AA 2OJEA 4H8PA 3LH9A 3VGAB 4JVPA 3FU7A 3PWVA 4U2YA 4O4YL 3H54A 2PYFA 2WVSA 4UT6H 5D4QA 2G3XA 4FC3E 4RFNC 3BCFA 2VDLH 3PF2A 3E6HB 4RAHA 5IB2A 3QZBA 3BQUB 3ESPA 1MLCA 4UZSA 3WXWL 4F9LA 3QZOA 35C8H 2C3WA 4HD9A 3LKPB 3K4DA 2XT1B 4DP6X 5G4OA 4ZAKA 1U8IA 4GEJA 1NCJA 5BQ7A 5I74B 3MRBB 2N01B 2Y6TE 4FEIA 3KBPA 2DJMA 1I1FA 4A7TA 2AXFA 4I77L 4HWZA 3ARGC 3G5ZB 1QLEH 4KKRA 3HMXH 3QH3A 4OSUL 4PCTA 2C9RA 5IT2H 4UOQA 2RQEA 1E8WA 4O00A 1FNEA 5HPMB 1JZ5A 1P69B 4FADA 4QKTA 4KI5C 1R1CA 3HLAA 4ISVA 3QW9A 4HIQA 1U8CA 3U0WL 3WFCH 1U8KB 4A6YA 1KPRB 1M1XA 2XZCL 3KWWB 4WFFE 3SY0A 1F6AA 4MMXA 2D7TL 3A4FA 5GS2D 3OZLA 3FQ2A 2M1KA 4DW2H 4E36A 4ZUWA 1IC4L 1FFTB 1EZVY 1CYXA 5KSAD 5HYSA 3DX2A 3NCYP 1AVAA 3VTAA 5BUGA 1KJVA 1JPSH 3LRSA 1NANI 1IL1A 2X12A 5T3ZL 3D48R 3Q2VA 4PJIA 2VZUA 1EEYB 3NFSL 2A9MH 3ZBMA 5ES4B 2NY5C 4G72B 3RB7A 3W9DA 4AMXA 4G6FB 4HC1L 5DQ9B 2VMFA 2VDLB 4ZSOB 4P5SA 3ZVVA 2AAAA 5EUKB 4YWGL 3IU3B 1J1XL 1HILA 2CR3A 3BD4A 4ZXBC 4ZK8A 1ORQB 2JCWA 2C8NA 2XN2A 4PIBA 1OTSC 1SYSB 2J21A 3QULA 2M8XA 1XZ0B 3RAJH 3FO2A 2VZ3A 4MFHA 3UC0H 5F9DC 1UATA 3D69B 3M46A 3X13A 5L4IA 4AX3A 1HHIA 4RESB 3SQOH 1KCSH 3FRPG 3GIZH 5CXPA 1MY5A 3ZJAA 4OCWH 3BEVA 1SOSA 4R9HA 4KVCL 3AU1B 1WCBA 3UIZA 5JHDA 2JELL 1ITCA 5C0CB 3QR2A 1ZT7B 3MJ8B 4N8CL 2OTUA 4XO5A 1K4DB 4DKFH 3MV9B 5IQLA 4EN3A 2HKFH 3EZ8A 4PJIE 5DRXA 1KEGH 4G8GA 3U1SH 3ECWA 3H0TA 2QPUA 4A2MA 2H45A 3BSZH 4YAQB 4PGEA 1DLHA 5SWQA 4DTGH 4WUUB 3U79A 3F5WA 3L3GA 4Y0GA 3VAEA 2NUPA 3KL3A 2HT3D 3IJSA 3O6ML 3OBAA 4YUEH 3ZRCC 2CIIB 3ABKB 4LVNB 5F7UA 5EPMB 3RL1B 5K59E 4GUPB 1J05B 2WSPA 2ITDB 4ZD3L 3BWUF 3VXSD 2Y24A 5I2IB 4DKTA 3P30H 1AC0A 1ZDQA 1QSFB 2KQNA 1BVKA 2NZ9D 4U1NB 1PTZA 1YJDL 1R17A 2ZWKA 4NN5B 2AEOA 2YLKA 5JHMA 3UYPB 4N2KA 5DUPL 2PMZA 5FHAL 3VD5A 4TUOB 3U9PH 5DJ8B 5C1MB 2O5XH 1ES0B 1LD9A 2XFXB 3QXUA 4QGYA 4XP9H 3HNTH 3HI5L 5JHDE 1M05A 4PJCF 3WIFB 2B14A 2R23B 3LQZB 3MO1A 1JGEA 3B7YA 4GRLA 4GAJH 4LLYA 3GSUB 3BAYA 4H13C 4AQZA 1IBYA 2ZIDA 2WSDA 4MB4A 5ENWB 3I6GB 2ADJB 3FN0H 1BAGA 1U8OA 1F90L 4ZW8A 4KV5F 4OCRH 3H9HB 4MSWB 1WFTA 1XBDA 4FJZA 2OJZH 5E8NB 4L4VE 1Z1WA 5IHUH 4BK8A 3KLLA 3NZHH 2JB6B 2BINA 4P2RA 3K80A 2HRGA 3UTTA 2P52A 1JZ8A 5E6IB 1RZKC 3L95B 2CA4A 4K55A 5T1KD 4NEHB 4WI4A 3GK8L 3U36A 1SEQH 4L3EB 3EG9B 4OBRA 1NDMB 4ZS7H 2PYEA 4OLWH 5FA4A 5ICYB 1E2ZA 2X28A 1X3DA 3HPJB 3LZFL 4AIEA 4LSRL 4O02L 3UTPD 4G6MH 3U7AA 2DWEA 3SDXB 1FFRA 4GLRH 1HL5A 4OFKA 5DVMA 5G5DB 5GGUA 1MI5E 1ND0A 1UT2A 1OL0A 2LFGA 2LLNA 4H20L 4KJWC 4YHIA 3WE1A 3ZDZF 4BV1A 2V2TB 4P57A 4GKZA 2GFBA 2QADD 4J3OD 3SEPA 4XXWA 1PW3A 3FB6B 1INDL 4MJIA 1T6WA 5EEUA 1EMTH 4X6BA 4LOUD 4KROD 1UGNA 3VRIA 1OK8A 4NWUL 3KS0H 3WHE1 4MDRA 2VXVL 1AO7E 4ZMYA 3LKNB 1RZQA 3RX5A 4S1QL 1Z3RA 3PP3H 4XC1L 4BQ6A 1A6VL 2VIRB 3L54A 3QJSB 4P2RE 3CFIC 5JIIA 1XF2A 2MOQA 4ZS6D 2QJDA 3QQ3A 3IDGB 1WZKA 1ZTXL 2W65A 1CC3A 2DOCA 2GEQA 5F9JA 3LX9A 3EGSB 4JDTH 1TQSA 3OR6A 3QO1A 5MHSE 3BRFA 3L3JB 3TCLA 2OMNA 4KKPA 3GM0A 4KHXL 4ODWA 2H0JA 4G80A 3TO4D 5JHAA 2BCKB 5JIDA 5GRXG 4ZDHA 3EFFB 2VDOL 2Z1KA 3PS6A 2JTDA 3BAEH 1TJGH 4P2QA 1A3ZA 4EZJA 5I15H 2F7PA 1CFNB 5LQBL 3NACL 3P0VH 4XBGB 2ZPKH 4OVUA 4X9GA 5T1DL 4YL9A 1OTUD 4IGBA 4UM9D 3T0EA 2EDFA 2FB4H 1JWSB 5IR1A 1SQ2N 1FJ1B 4HUUA 3KPSD 3REVB 1TCMA 3DO3A 1LE5A 1E4WL 4RDQF 4I9WE 3TL5A 1KCUH 1FGVH 4MMZC 4CSZA 5C7XH 3U4BL 1BZOA 1IEBA 5C07B 1RVFL 5DWPA 5AB1A 3BXNA 4POYA 4FD0A 4E9YA 2H8PA 1XSJA 4KXZI 4MNGB 4NZJA 3EYSH 2VUOA 3TTYA 2OMVB 3DX6A 5TK2A 4N2DA 4N8VG 3D87B 2X6BA 2WWMC 2ARJB 4I4WA 5IW1A 5F93C 4OF7A 3LKQA 8FABA 1OD7A 2HJFA 2P80A 1C7SA 2X4TB 4BCXA 3U0PA 2XWCA 3AGVA 1S9VB 4HG4J 2XVKA 4HMDA 3CC5B 3AWFA 4JPSA 2XACC 3GGWB 2AGJH 4LRIA 2H2SC 2HVJA 2P24B 3S3CB 5DTFB 1KBGH 1BMZA 4P2QE 1QFWI 3KYNB 1CU4H 3LCYA 2WXPA 1R3JA 3WNNA 2CG9X 4IMLB 4ZFZA 3LAFA 4PBXA 3C9NB 3NCWA 5ACMA 2Y9RT 1HOCA 4ONFH 3T0EE 3CZKA 2HRLA 3MVSA 5JHLH 1UM6L 5ECGA 2XY2A 1DJWA 1FL3B 3DVNA 5SWZA 2IH3A 1I1CA 1UM4H 3HG1B 2HMID 1AGCB 2DLFH 3BFOA 5FUZH 1G7MA 1RHHA 3BUTA 4UILL 2Y7SA 5L2KD 3VU2A 4Z95H 2BIIA 3CVHA 2HH0L 3BKCL 4JPVL 4EQ2A 1A64A 5TFSL 1RZ8B 2SEBA 1S7SB 4R26H 3KYKH 4S0TD 5SX4H 5BRPA 2AV7A 4HBCH 2QV4A 3UAFA 3X17A 2OPCA 1IFHH 3QORD 4P5MA 4UQCA 3TBSA 1Z9LA 2FX7L 4PJXE 4R90L 2ZKYA 2LAAA 4MD0B 5F7LB 3LNEA 4XBEL 4AQ1B 2VLRA 1ZGLB 3C5JB 2QSCL 2AJYH 4X83A 1VADB 3T3MB 1KGIA 3EXLA 4WK2B 2PETA 2B1HL 4AK1A 4BBWA 4OLXL 2IPKB 1U30A 3WLBA 1SJHA 5T33L 3NIFF 1S9XA 3GDBA 3DUUA 4EI5C 3J27A 1ZSDA 5SWZE 1XF4B 3V0HA 1CFSA 2ZCKL 1M1SA 2NY1D 5CCHE 2N56A 5IY5B 2V9RA 3ATBA 1MRFH 3AQZA 3O4OB 5KVDL 2JCCA 1HEHC 2VLME 4NHCH 4MCMA 1SJXA 4IRZH 3WD5H 4AITA 1QUNA 2J1KA 3GXMA 2YMOA 2PPDA 5T3XE 2CZNA 5D7JB 1FZMA 5T1JA 1X5HA 4HISA 5IW6A 4PPTA 4X6FA 1GW0A 4YDNA 3QUKB 2YBRA 3GDCA 3PUCA 4XP6H 3IKCA 1E4XL 3NBNA 2BVOA 1JBJA 4RFOH 4L4TB 1UXSB 3MUJA 1WK0A 4N68A 1A14L 3ZDYB 3Q2CA 3R06A 4MJ5B 1N18A 4LASL 1OOWA 2F6AA 3GHBL 4IMKA 5GS0C 4AYID 1SFDA 2BIMA 2K4AA 3EHBB 1YDPB 2EDOA 2VLRE 3KVPA 1K8IA 5DRZB 3B5TA 3OLDA 1MPAL 1LO4L 3ZUCA 1FRGH 3MLYH 5E7FA 4FLSA 3RPKA 1JZFA 4J27A 4M8UA 3A4EA 2FJUB 1NBZA 4E9VA 2OL3A 2BJMH 4Y9FA 5ANHA 5MEQA 1YYML 3T65A 4G82A 3AAZA 4JHBA 2H1PH 1VFOA 3B6SB 3L3IA 5E1HB 3VFPB 2JCCE 1RJZA 2FIKA 1AKJB 4O2CB 4ZQTA 1VLXA 3FTGA 3MYZA 2GSIB 2HJLB 3FTSA 4P46A 2QZQA 2D7QA 2VMCA 3FT4B 1B0WA 1EZUA 2X4RA 4OLUL 3NCJL 4JFPB 2CO7A 5E95B 1B9KA 1OO2A 4XHJD 3UBXI 1JV2B 1F4AA 1NWOA 2FO4B 4GW1A 4QNPF 1AI1L 4AXWA 3S88L 4I3SL 2E9BA 5KS9F 1GGUA 3LMJL 2O5YL 4KKAD 3D9AH 5DJ0A 1TQUA 3K74B 3ABGA 4K9EC 4NZDA 1LK2A 2BIOA 2YLHA 5C0AA 4ZMZA 3SDDD 1KEML 4RMUA 4XPFL 5DUBA 2FX9L 2IAMB 2Q8BH 3ARBC 3VWKC 1P0SE 2WLIA 1G7IB 4U1GC 4BE5A 5L6YL 4B7IA 4ZFFA 1QEXA 4B5ZA 4D94A 1VHPA 1CQYA 4D9LL 3B3IB 4WSJA 4Y8AA 3MNWA 1WTLA 2F1BA 1SPDA 3MCLH 4LLQA 4CBZA 3B43A 1JZJA 2D9CA 2MH4A 1L7TH 3PWPE 5EBLB 5LBSA 5LG6A 5I5RA 1WIOA 1B2WL 2VISA 4OAWA 4PJ7A 5IGXH 5JW5B 3QIBC 1F4XL 4LCIL 4BFNA 4XMUA 4HH9B 3D39B 4KJQC 3QWQB 4Q0XL 3EBIA 1TZOA 3N43B 5D1QA 5KEZA 3ULSA 3ARDB 4QTHB 5IROA 1EWHA 3OKEB 4J4PA 4MQXD 2E9JA 4LPYA 3MLVL 4JO1L 5EZPA 4CN6A 5GGSA 4YX2L 3FF7A 2EUWA 5C0AE 1MY7A 5DUJA 3ZY7A 2BS8A 3P2TA 2IQ9H 5A7EA 4FZEL 1Y18B 4X50A 4OB5L 1QEWA 5EB9A 5HSFA 4NKIH 5HYJD 1LYQA 5AKSA 4GBXA 2OXGA 2MQ3A 1ID2A 3JV4A 4QD2E 3S8WA 1A6ZA 1BWMA 3U1PA 3EO9H 2I60L 3JVGA 4OGXH 5E2WH 3CV5A 1N68A 5DSCA 4GB9A 4JO5A 2OMWA 3BO8A 5EULV 5GGVL 3E80A 2X2UA 2BWIA 4NIYE 3OKOB 4PMEA 4FNPA 5AB2A 5ID0A 4TNWF 5GRJH 3SQBA 1D9KA 1KIUB 4F15C 5IF0A 2WLKA 4U2ZA 4PJ7E 5IQNA 3PJSB 4XVUD 3RTQC 3ZL2A 1KENH 1YEEL 1GIGL 1IQWH 1QP1A 4JDEB 2A1WL 1FVCA 1SMOA 4NRYA 1INEL 2QDWA 2P47B 5DI8B 3ZTDC 3PHAA 1KY7A 1NAMA 3MNMA 4URTB 4XNMB 1CK0L 1KTLB 3MLWH 4FKHA 3EJQA 3CH8A 3OC8A 2PLTA 1KTBA 1DVFC 4GIAA 3BDYL 3IYLW 1I7ZA 3AGWA 3QCUH 4J3SA 3VFSB 3GXNA 2BC4A 3WIHA 2XBZA 2X0VA 4OLZH 5CJXC 5CD3A 2PTUA 1K5NA 1LP9F 2K78A 2LVCA 4XNUH 2CO6A 2CJSA 3UAAA 2FX8L 5B8CC 3G04A 4FMVA 1BQHB 1TQWA 2D4FA 1HINH 5ALBH 2VTFA 3HI1B 5LHDA 2I7OA 5G4MA 1CD9B 1KOAA 3W57A 3FBKA 2AXGB 1JGVH 4NRXB 3IJ8A 1MCRA 4QRRD 1UFUA 1MNNA 5E4OA 4CL7A 3VSVA 1QYGL 5E2UL 3QUXD 3OR7B 4L5FH 5F1SA 3PAYA 4U1MB 4FQXD 3V4VB 2PXYA 1OAKH 5LGHL 3RFZB 3ARFA 3B3BA 4U1HB 4DPRA 1CD8A 1J0YA 4HLJA 4EIUA 1W2KT 3ETTA 4F3FB 5CD5D 1EVTC 1RZFL 2O6EA 1T2QL 1EGJA 2YGNA 3FZUC 2PCYA 4HWBH 1PLGL 3UZVB 5BOZG 2EXSA 2EDBA 4OJAA 5GSRB 3F12B 12E8L 2RCSH 2UYLB 4QRAA 1N4XH 4YL4A 1RJLA 2X2YA 3O4LA 5I0DA 1REIA 2BS71 3QA3B 1D6VL 1PCSA 1ZD6A 2GAZA 2OJ1A 2WLLB 3VW3H 2XV0A 2ZX5A 5JW3L 3BPOB 3TBVB 2AZUA 1E8YA 1G6RA 1X5GA 3FAWA 3U9WA 5IUCA 1SJMA 5IUSA 5J6SA 3RU8H 5C0IA 4W6YB 3E6FA 1WJ3A 1S2EA 2FAUA 2AFNA 1JFQL 4GUOA 4E9SA 4KMTH 2PO6D 2ODIA 1U58A 1NGQH 1D5RA 3QAZC 2EIBA 3BAIA 4ANVA 4CDHA 4FNLL 1BZ9A 4TL5A 4P04A 5KYNA 5D2NA 1JYXA 5IQ7L 3D25A 3H4FA 1RUPL 1SY6L 4UB0H 1AIFB 5C0NC 1GRWA 1CLZL 1HQ4B 1G7HA 5DFVD 1ZS2A 3NIGB 3QPKA 1TMCB 2CJUL 1BJ8A 5LAPA 3PAUA 4LEOB 3BN9C 3NOIA 4NUJA 2NY5L 1JRHI 3TTSA 4N3UA 4UM8A 5KVFE 3IS0X 1TETL 2C4XA 3LIZH 4AL8C 3CZLA 4Y4FB 5TE6L 5CINH 3GSWB 3DUSA 3O4LE 1FH5L 3QEQB 5D96C 4S1SL 2WYZA 3OMAB 3K46A 4LT7A 1XL6A 2WBKA 1E40A 2DWDB 2VQ1B 3FB5B 4ZMOA 3JUYA 4LOVA 5FA3B 3KPPA 5L88H 1J1PH 3LNDA 3TT1L 1UC6A 3I6SA 2Z92B 2ZUQB 5EWIH 3VMOA 3D85D 5FWRA 4W4OA 3G7TA 1WBYB 3M17A 4PCKA 4OI7A 2BOCA 4JRXD 1NGYA 4QGTA 4R8WH 5D2NE 1IGCH 5G2NA 2WJ7A 5FFLA 3B2MA 4M43L 3ZDXB 4Y19D 1MWOA 1PVHA 4PRPA 4RGND 5DWUH 5I23A 4MS8D 3ROOA 1MWAL 2E7HA 3CHSA 3BP4A 3GYRA 4A63A 1QR1B 2GTZB 4IBSA 3LSOA 1A6AA 3BPLC 5DQDH 3DGGB 2A6IB 2AP2A 5F0JB 2W0FB 1FP5A 2B59A 4U1KB 5I6KA 2Y06L 4PD4J 3SZKC 3O6KL 4A7VA 4G3YL 4JGJA 4AQAA 2P43B 4LVEA 3KEHA 4BM7A 3KPQB 5I1AA 4HV8A 1NIEA 1RUAL 1QO3A 4R7LA 4YBLC 1TPXB 4QRPD 5HJDA 3ZE0E 1LILA 1TSHA 1PZCA 1S7QB 4NPKA 4BZ1A 1AGBA 4K5OA 4KC3B 2H4EA 4WWPA 1DSFL 1CFMA 3ILQD 3WKMH 5CZVH 4ONHB 5C0DB 2DLIA 2CWRA 3P2BA 3I9GH 1BDYA 1SUJA 1TCRB 3ZKMC 4KWUA 4JGNA 4KOCA 4ZMPA 4Y9EA 5I5JA 2ESVD 2E9GA 3WMSA 4GAGH 4PRPE 4EEEA 2ID5A 4HT1H 3IJHA 3CHQA 4MZ2A 3TEZA 5GZNC 2EO7A 3P3RA 2V2XB 5DHYA 5K59F 5HHMB 4IKIA 3SYPA 4QHUB 3O41A 4I1RA 5CP3H 4P5KA 5I1LA 4GIOA 2NUTA 3LH8A 3D50A 2Q6WA 4R2GD 4E5XB 3B2XA 2XIBA 2O1AA 3VXSA 1I8LA 4LFHG 4IBTA 1RZKL 1L9TA 5DRWB 1BF5A 3LV3B 3WUWG 4WNJA 4Q6IA 2EUVA 1UVQB 2LLLA 4U7MA 1R3IL 3UPAA 1QSEB 2J88L 4KH2A 1ZHNA 2APVA 3D12B 3MDJA 4JQXC 3VXPB 4K3JL 1WSST 4UDTA 1EJOH 1ETZB 4LCVA 3T3PE 3BE1H 1K3ZA 2XTJD 2P42B 2J8UA 2F53D 1VF5C 1KMGA 4H25A 3MOBH 3CWGA 3MLXL 1B0RA 4K8RL 3ZYOA 5FLVA 4XZUA 4CMHB 1JOIA 4HAFA 1MJJB 3FBQA 2ZSWB 2YSTA 5C0EA 1E4JA 1MCBA 2HN7A 3OKKB 2VE6B 3S48A 32C2A 5DJXB 2EAEA 3LDBB 4AKQA 3COOA 2JF1A 4GSRA 4TQHA 4PRBA 1KB9J 3OKMA 2JWYA 3SJVD 5T1KA 2VDNH 4NC1C 4S11A 3X1FA 5C0JB 5E03A 4UMGA 4OI8A 3D3VD 3L4VA 3MUZ1 5AKTA 3AY2A 1JPGB 1EEZB 1N7ML 2CKBB 3OG6B 5DMYA 3FMGL 3IVKA 4UINH 2FH6A 4HJ1A 2WW8A 4HIIB 2DJUA 4AEFA 3OXSB 3WY1A 4XP4L 3FAXA 3S2CA 1KCVH 1ZA3B 2CHXA 4J12A 3MOQA 1Z9OA 5CSBA 2QMKA 4MXWH 4N1EA 3LXUX 3ZHKA 4HG4K 4ZMQA 2L7JA 4YDJB 2F18A 4MXVF 4S2SB 4LQFH 2A6KA 4KTDL 3KYMA 2OJEB 4WFHD 1FVEA 1RUML 1U4EA 2EUXA 3BZDA 2X5PA 3EDDA 3PWVB 4BKSC 2XWJA 4BWTA 3G6DL 2DRUA 2PYFB 1KXVC 3DMMD 4B97A 1B4LA 2H26A 1V7NL 5JIQA 3GSOA 5IB2B 1MLCB 4Q58C 4KO5A 1KC5H 5DA4A 3F7LA 3QAQA 3PGCA 1SN0A 1OM9A 1WICA 3CMOL 4GW4A 4LGSB 4JFHD 4XXCC 4ZAKB 1U8IB 3QR1A 5BQ7B 1CD0A 3CHPA 4PLJD 3HE7C 4CAGA 1I1FB 2AXFB 3I9AA 3UCQA 3L1OH 5CP7A 3SBPA 3WOVA 2C3VA 4HWZB 2X1PA 5C0BD 3UTPE 2EVHA 2EVGA 4JM2D 3QH3B 4S1DD 2GQHA 2KI6A 1OOAA 1FNEB 5D2LA 1MHCA 1M3JA 2DLGA 3KJ6L 3IPFA 3HLAB 4ISVB 2ZCZA 3QUZC 4WGVB 5IHHA 1U8CB 1Y07A 4UM9A 5FO7A 3UIYA 2Y2WA 4N4YB 5JXED 1NBQA 1GYUA 3FN9A 5C7ZA 3S34L 3X3FH 4OCYL 4ZO9A 1CGXA 4A6YB 1M1XB 3C60D 5J4MA 3AS2A 2IQAA 1OP4A 3SY0B 2HTLD 1F6AB 5F7KC 4R7DA 5E08H 3MBWA 2VKWA 4RH4A 2P5EE 3AMKA 3FB7A 2YRPA 4ZUWB 4XMTA 2VDPB 4PYHA 4KRPD 1INQA 1KTDA 5EG6C 5HYSB 1NAKL 1KJVB 3RVWD 4CVXA 2YD1A 3LRSB 1IGFH 1IL1B 2W9DL 1S7XA 4PJIB 5GSVA 3NJLA 2C26A 1MCDA 4AM0A 3IAPA 3W9DB 4XTRD 4H7VA 1RZJC 4R0LC 4W9DC 1OCWH 4YE0A 2G5UA 3T08A 2DWXA 3T77A 5D2LE 1KY6A 3A23A 4PP1C 1PS3A 2ZOKA 3QULB 4FHBD 2E5EA 2VWEE 3NSDA 3ULVE 1QRKA 1L0YA 4V1DD 4JY4A 5HI4D 3FU6A 3P69A 5LWYH 2DIEA 1M7IA 3ZE1E 4NQED 3RVTD 3X13B 4IYKA 1RK7A 1HHIB 5AW2B 5IEKB 1PG7X 2ICEA 2Y6SD 1OZUA 1QBBA 1YQVL 3BEVB 3QHZH 3AB0C 3QJFA 1UENA 1PZ3A 1SLXA 3PJNA 4H8WH 3RGBA 5DCCA 3QRBA 1WCBB 1KCKA 1PNDA 2WUBH 1YY9D 5JTWA 1PZ5A 5JHDB 4KQ4H 3NP4A 4NKOA 5L2KA 1OQOA 2OTUB 1L6ZA 2E8ZA 2PF6A 5I8OL 5F9OL 4LBAA 1XV8A 1J9TA 1G9MC 4EN3B 5DRXB 1TJIH 1V05A 4G8GB 2ZCLL 4LBEA 1YEKL 3SE4C 3LS4L 3H0TB 1QW9A 4YHZH 4PGEB 1DLHB 2WVVA 3PDDA 4U1SB 4PJXF 3F5WB 1MJ7H 3L3GB 2X1QA 3FYEB 2NUPB 3HAEA 3GSRA 3IJSB 1A7RH 3TEWA 2R56H 4PG9A 5IWLA 1H15A 2NCEA 4WWID 4WW2A 3WKNA 3RI5K 1X6LA 3QZWG 5GS0L 1ZXQA 3U4AA 4TSCH 3S3DB 4OZIA 2Z35A 1ONQA 1CE1H 3N6YA 1BVKB 4BKLA 3NA9H 2DWSA 2W91A 1SJEA 2J56A 2XTLA 4IRSA 1COBA 1EV2E 1WDAA 2JLLA 3BAWA 1U33A 5JPMA 4WDIA 1XXDC 2A2QT 5BRQA 4ZW3A 1LD9B 3FT1A 2H6PA 1JDAA 3ZE2F 4OFYD 4IIZA 4LSPL 3BD5A 1M05B 4HS8H 2CIKA 5L2KE 3FU8A 4IRJD 5GRWA 3MO1B 1JGEB 3QDMD 4GRLB 4LLYB 5CCJA 4PIRF 3S35X 1TJMA 4LLDA 1OP3K 3FUHA 3CLFH 4YDIH 2DBLL 1UWXK 3D05A 3VGBA 1DBKL 1U8OB 5E8PA 3APMA 4HUWA 1OY3B 4NDMA 3EYQD 3CIQA 1ZAGA 1J0JA 4HCRL 3WG7B 4BHUI 3OC5A 4MNHB 4P2AA 1TQBC 1YNTA 4L3FA 1I4FA 5I24A 1DJYA 5EOQH 4P2RB 3NPSC 2ZXCA 1OP9A 3V7AE 1U9KA 3UTTB 1KIRA 1UADC 4OZIE 3N1QC 2M2DA 3U36B 5BUPA 4K9EL 4ZYKA 2PYEB 1MAKA 5FA4B 2DEXX 3GMQA 3VD1A 2EC9T 3TJEH 1I7RA 4FZ8L 2DWEB 4I2XA 2EIKB 2GITA 2MRYA 5GIRA 2G9HA 3LPFA 3WN5C 5GGUB 1ND0B 3LZQA 1QBAA 1MFAL 4PUBL 4YHIB 1AFVH 2NY3B 4GKZB 2DIAA 2GFBB 2VUKA 3P4NB 1K9TA 5HGAA 3WHXA 4AGLA 4UAHA 1Q9WA 2HRPL 3S4SA 4HAGA 5KBMA 4NZRH 4DFIA 2Y25A 2JE8A 4MJIB 4YSSA 4JLRA 1W0YT 5IP4A 3QRFM 4K0OA 2LV4A 3HNSH 4RMBA 1D5ZA 4IJ3B 2LOEA 3GJFA 3VRIB 2CUIA 3CSYA 1O7SA 1EXHA 2ATPA 3DC0A 5DZAA 4BFJA 1T03L 1V7MH 3RWDA 1NCCH 1ZT4A 4KNSA 4L23A 2VRAA 3M1OA 3DRTA 3C09C 2CDFA 3LRKA 1XF2B 1IEHA 4LSSL 3CPLA 5TQ2H 2K70A 1FO0B 3SYAA 3QQ3B 1VERA 3D6GA 1FFNA 3WTTA 2W65B 2Z31C 3EH1A 4UNIA 3RG1C 5F9JB 2DEWX 3SDDA 2XYCA 3OR6B 5A2JH 3TCLB 4ODWB 4WY7L 4G80B 1N6VA 2X38A 3LD8B 3II2A 5GJSL 2JKLA 2VDKL 4BWWA 4P59L 2ARWA 4ZDHB 1MJ8L 2QHRH 1LEGA 4P4KD 4ZTPL 5T1LD 1UZGA 4HGWA 5JDJA 5BJTA 4XNBA 4B9ZA 3CVHH 3L5WA 3SO3C 1HH6A 3L45A 3F7RA 4IGBB 4LGPB