1HE7A

Human nerve growth factor receptor trka
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
SHMPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR
publication title Identification and Structure of the Nerve Growth Factor Binding Site on Trka.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2000-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1he7A00
4YWGL 2IGFH 1A5FL 4KDTA 1QSEE 1UJ3A 3MRNA 5MEPB 3QUMA 5DRXB 5C09A 4ZAKD 3ZL4L 1CE6A 1VENA 2FB4L 1OGTB 1QP1A 4GOSA 5AYUL 2ZSVA 5ID0B 3BGFC 3V8OA 3LS4L 4Z7VF 4NN7B 3MOQA 3TIEB 2V2TB 3ET9F 1KT2A 3MX0A 3DETD 2OR9H 5D7LA 1QVOB 2FIKA 1YEDB 3D39D 1CR9H 1CU4H 2DL9A 4H25B 4PJCF 2HT4D 4RGMC 1KCVH 3DI2B 4AYFA 4X99A 5I75B 4ONGH 4XNMB 3TJHC 2H8PA 4LU5H 1NSNL 5GZND 3U4BH 3OXSB 4MA7H 4FG6D 4PJBA 4HJGA 1NGWB 3VXUE 4BK5A 3BE1L 4HUWA 2AI0H 2FECL 4IEFB 2KPNA 3TA3C 1WLHA 2A1WH 3MLTA 1B0RB 3WXVH 4QHNB 3UDWC 1A1NA 3K4DA 4OCYH 4CRPA 2IAND 3IXTB 1SEQH 3ILPA 1MPAH 4HWBL 1VDGA 2WP3O 2XKUA 3WKML 4P59L 4DAGL 1YMMA 4L9LA 2LU3A 4ZUTB 1TZGH 4K71B 3U4EB 1C5DB 3W9DB 4WI9A 1KC5L 4KTEL 1CDGA 2B5IB 5GISH 1NCDL 1IGML 3GMLB 2MCPH 3VD4A 1LEGB 1KTLB 4WI3A 5FECA 1DQJA 4N9GB 5TF1L 5C0DA 2VR5A 4QRRE 1BZ7A 3RA7L 1S9YA 5IK3B 5T33L 4P48A 5DC0A 5DRZA 2E9BA 3QXVA 3WNMA 3HB3D 4QHLA 4JHWH 3E1F1 3KPTA 3QG6A 5E8PB 5HXMA 2G9HA 1NDGA 5F3HB 1QPPA 2WUBL 2F5BH 2NYYD 3PXJA 5INDA 1A6UL 1KELL 5D7JA 4CVXB 5F9WB 4OZFB 1JZ5A 3QUXA 3O6ML 5TQ0L 2NW2B 3RDTA 3I50L 1TJGL 5DVLA 1NFDB 5ENWA 4ZQKA 3SDDD 2UY7A 3GSQA 3TO2A 1VFBA 3MA9L 3U30B 5J89A 1H3XA 4PYHA 1QRNA 2CDEA 3P73A 1AO7E 1U3HA 3KPRD 3IJYB 3HTLX 3EDJA 3BDXA 4GBXD 4NRXA 4HWZB 3SE3A 1N64L 4EUPB 1MREH 1H5BA 3DYMA 4KPHL 4NCC2 1T66C 5EU6A 5DHYA 3HG1E 3PWNA 2J4WL 3AB0B 3PF2A 3WIIH 5HSFA 4LLQB 3FRUA 3FB5B 4I9WE 4XCEA 3ULVH 1NC4A 1EFQA 3QIUB 3DXAA 1M7IA 1JPST 5EOCL 2B2XL 2I9LA 1I1RA 5SX4H 1NLDL 2CD0A 3GMQA 3KPPB 2BHZA 1G1YA 1ACYH 1CDYA 4IMKC 5T1MA 2JJVA 2DQDL 1F4AA 4Z7VB 5HVGB 2NY0B 4YDKH 2JJWA 4KK6D 2EDBA 2MWCA 5I1KH 1N3NB 1S5IH 3QCUH 5FK9A 1FFNB 1MCOL 3BUTA 2EE3A 5LQBL 1I3UA 5C7XH 4PJCB 4A6YH 4M3KB 1SM3L 5IESL 4X6DE 2HJLA 1TDQA 1FC1A 3S5LG 3O3DB 1S5HA 1XIWB 3CZFB 3TA3A 1HCVA 5IJVB 3UDWA 3FB7B 2XICA 1F4WH 5D2NA 4N5ED 2WQ8A 3MLWH 5D1XB 2NPLX 2W07A 2XZAH 2YD1A 4G9FB 3ESUF 1HHKA 4X7CC 5D7IA 2LTQB 1S7TA 1FVCA 2UWEE 3A67L 2VH5H 4JQIH 4K3GA 4ZNEE 2A6KA 5EC1A 1EPFA 4OUUA 4XCCH 5EC2B 4APQC 1ZXQA 1MRFL 3MBED 3OXRB 3KHOA 3ELAT 5D7SH 3U0PA 4TUOA 3EYVA 3P4NA 1G7PA 4YWGH 5C0BD 1MUJA 5E2WH 4M6NL 1DSFL 4MXQD 1AC0A 1A2YA 4TOYL 5D5ME 1WBZB 3ZL4H 2FB4H 3DBXB 4G6ML 4M7LL 5AYUH 3RVXC 4U1HA 5IWLA 3Q0HA 1A8JH 5EBWB 5I76B 4X0KA 1I7UB 4NJAL 2FATL 2R2CA 1ZLUH 1X5JA 1JI2A 5DD0L 5EU3B 4A6YA 2P24A 1NCWH 4DEPB 5ICYB 3V5KA 1UWGH 5T1LD 1OSZB 4X4ZA 5CLWA 2WAHA 1JGDB 4FQHB 4PGJA 4QRPB 2W38A 1RMFL 1CD1B 3LZFL 1WIUA 1T2XA 1NSNH 4HWUA 1W0VB 4JPIA 1C7SA 2CR6A 4N9OB 3U7AA 4BFIA 1IC4H 4YHYB 2VYRE 2P1YA 3BE1H 4Q0XL 4XBGB 4NQXB 3VU2A 5FGSA 1TQBB 2CK0L 4PJHA 4KRMB 1IKNC 3VFGH 1KIPB 1XCTA 2NY6D 4HWBH 4JFFE 5DURB 3U1SL 4JHAH 4L8SB 4YPGA 2IADB 2W0LA 4IDJL 4P59H 2BFVL 2Q8BL 4DAGH 3MA7A 2XWJB 4OM0H 4AEEA 1ZK9A 4XNQB 4OAWB 1KC5H 5KSBE 3S9DB 2XIDA 1NCDH 3GGWB 2OSLA 1S9WB 3BEVB 5H35B 5LCVL 4JM4L 4LLDB 5IB3B 2FCBA 3RWEB 5IEKA 4UMGA 2NY3B 1GXEA 4NNYA 4RFNB 3VFTA 4W6YB 1JI1A 3BKJL 5T33H 1MVFA 5KOMC 2X6MA 3PUCA 2VAJA 4M61B 2ZWLT 3HA0A 3CX2A 1A1MA 3A6OA 3QHFH 5F1OB 3VFPB 5JHLH 2DM3A 4D0BA 4TTGA 4HFWB 3VFRA 2GTWA 2WUBH 2HJFB 5E4IA 1A6UH 5EIVA 1KELH 2FZ3B 1UB5A 4QOKA 1DE4A 1QHPA 2D7PA 1G9NH 1S8DA 3V0VB 1V7NH 4P2OB 2WIIB 5IMOB 4M7ZC 3W0WB 1X5ZA 3NACL 1TJGH 5EZLA 1PX3A 4XCYB 5GGUB 4UTBL 2YEZA 4HWBA 1LD9B 3T0VA 1N59B 2WBJC 1AY1L 4MJIB 3GSOB 5T3ZL 3BRGC 2ESVD 2BVEA 2YOCA 3PHQA 5B39G 3VGHA 1KJ3L 2XTLA 3L5XL 1U2HA 5J9PA 4P2QA 3VDAA 5F1KC 1MHHA 1N64H 2R23B 4BFGA 4PLJC 1IAOB 4OCMC 3S6CA 4KPHH 4LVHC 4JFEB 2F54B 4OGYH 2NY1D 2XA3A 2J4WH 4QNPE 3CJJA 2F19L 1SQ2N 4H1LH 3LKOB 5ITBL 1BQHA 4R4NC 5FKAB 4CW1A 4JDVA 2ATKA 3IDIA 4I3RL 2LAGB 3RTQD 4UIMB 2XFXA 3LKRB 2B2XH 4PJXA 3OWEA 1J11A 4OUOA 4RMWA 1UEYA 3MRMB 4MQXD 5AWNH 3MLSH 3MODH 4JZJA 2DQDH 3L3IB 5IW6B 4P5MB 5D7KE 5C08E 4KRPC 4ZFFB 3K4ZA 2J7LA 1EUUA 2X4TA 4IRSA 4Z0XB 1P4LA 4BQ6A 4DK3A 4GW4A 2UUDK 1Q9LB 1MCOH 1T7VA 2E3VA 4TVPL 3BN9D 1Y6KR 2RCSL 3BT2L 3QYCA 2OX5A 5C09D 5LKNA 3D1MC 1SM3H 2VOTA 4LCCB 3LKQA 1JGEA 3QEQA 2H2SD 2D9QB 3QFJB 2H32H 2BXZA 1IKNA 5EN2B 3LN9A 3ZE2F 3G5VA 1QO3B 2HWZL 3IU4H 1S78D 5D7LD 1BF2A 3Q2CA 5ILTL 3SDCD 4HIEB 5F7FA 2LE9A 5CSZA 4H1LA 1MRFH 3BX7C 3PDGA 4YPJA 4KQ3L 4PJAA 2VL5A 1CL7L 3DIFB 1CL7I 1X7QB 1DSFH 3EDFA 2DLEA 4P3DB 2ICES 5I1IL 4XNZB 4TOYH 5HPOA 2Q7YA 3NH7H 1H0DB 2X4UB 1RZ8A 5F9DC 4LSPH 4G6MH 1YA5A 5K9KA 5JR1L 2YRZA 5JW4N 5TDOA 1DLFL 4NN7C 3NOIA 4U6YB 4WI7A 1ERNA 2FATH 5KANI 3TNNA 3U36B 1SJVA 4LIQE 1GOHA 2EH8L 5DD0H 3QP3A 3LKNA 5EDXA 1QR4A 4U2YA 5IV2A 1CGXA 2UZIL 2JJUA 2H32A 4JRYA 1KIQB 5I75C 2C3VB 4JZOB 2H41A 2XG5A 4Y0GA 3MRRB 1RMFH 2KZWA 3HUJE 2JIXB 2QV2A 2VXSL 1Z5LA 4HKXA 4UUJB 4F37K 4PREA 2PTTA 3WS6C 1WEJH 4KZDL 1TENA 1HZHL 2VLJA 2WBJA 3ZTNH 3OKOA 1UT9A 4OIBA 1H15A 3GO1L 4PJDF 3VFWA 4Q0XH 4RGND 3ME0A 2CK0H 2E7BA 2NX5B 35C8L 3RVUC 1ZLUK 4JHBA 4YDIL 1DBBL 3H3BC 4FXGB 5JHDE 1LEIB 4XB7A 5E8DH 2G2RB 3CZJA 4MS8D 5JIIA 3K0WA 1BIHA 3L3KB 3WSQL 2XKNA 3MLUL 3U1SH 4L4VB 5A2JH 1GGYA 5C07B 3QDJA 4YNYA 2BFVH 5DD5H 2ED7A 4K71C 3EYUH 4HKBA 3WNPA 2DWEB 5D7JD 4XX1G 1BOGB 2B5IC 3RX8A 3W9EA 1KPUA 4MJ5B 2IC2A 2EEBA 1R5VA 5JXEC 4K9EL 5KVDL 4DZ8B 3SY0A 5LCVH 4KDVA 3LSOB 1V3LA 3GSVA 5BZWA 4JM4H 1UXWB 1QRND 3ZZ1A 3UYOD 3ZDXE 3KXFB 5I8KL 5GJSL 3MNVB 4HH9B 4MQ7B 1U3HD 1AKJA 4NPYA 3O3BB 3VXOA 1QFWL 1QFWI 1EVTC 4I2XE 5JZ7D 3BIAX 1WWWX 1HWHB 3QAZB 3UJTL 5IB1B 1MRDH 5F8QC 5F3BA 4ODWA 4LSRL 1QD0A 4I5BB 3ROLA 5F9WC 2VLRE 4QHKJ 5C0CA 4MLSA 2WSKA 1NC4D 3VXSA 3DXAD 4AEFA 4Q2ZB 4UTBH 3U30C 5I19L 3FO1B 4BA8A 1G0XA 1T5WB 1KJ2H 5T3ZH 2VUOA 4R4FL 1T4KA 3BH8A 4LEXL 2V7HB 3L5XH 1HH6B 1CICD 5IHZA 1JNNL 4UIKH 4OGAC 2BK8A 5T5FL 4NO3B 5K33A 3SQOL 3KYOB 3DVFA 2KL6A 1ZT7B 1I1FB 4J8RB 4LCWB 3TJHD 5GHWH 3W5NA 4V2CB 3AB0C 5MEPA 1NGQL 5DRXA 4CBPA 3T0BA 5GJTL 5ID0A 5ITBH 3JWNC 3QIUC 5D2LA 1QFHA 2J8UB 3V79C 1BEYL 5C0EB 3QULB 3LRSB 1XGUB 5IW3A 3FFDB 4I3RH 1EXUA 3TIEA 3ECBA 2C4FT 2V2TA 3FQNB 4L29B 4CMHB 4HLZH 1YNKL 1MJUL 1QVOA 4ZOEA 3ZHLA 1RAMA 1D5ZB 1YEDA 2R1WA 2YPLB 1Z2KA 5K9JH 4WO4B 2D03L 3ULVD 2JTDA 1BFOB 2AK4B 2VLLB 4O5LH 3GK8L 1VKXB 1Z6JT 4XNMA 5SV3A 3QNZA 4FTVA 4TVPH 1IC1A 4LRNL 3BT2H 3OXSA 1KJ2A 1A6AB 3WS6A 3DMMD 1NGWA 3SCMB 1OM3L 1CGTA 1CLYL 4PJEE 3GBML 1XIWC 3AMKA 4JZNB 1QSFB 2Q20A 2MQ0A 3T2QA 4OD1L 3ZDZE 4I4WB 1ACZA 4UINL 3IXTA 5D1XC 4PJDB 1CTOA 4LCIL 2LTQC 4XP4L 2IALB 3V5HB 4ZUTA 4ZFGL 2OL3B 5JW4M 4Z7OE 2FIRT 3W9DA 3X14B 3FRPA 4K9EC 1LO0H 4GSDH 4CUCA 3GMLA 3FKUS 2HH0L 4KQ3H 5E6YA 5DK2A 3RZWA 5I17B 1J12A 1GGTA 4OSUH 5AYQA 5JXEA 4EUPH 3DV6B 5E2UL 2Y9RT 2IANE 1AR1C 3VI3E 4N9GA 2B1HL 5I1IH 4L4TB 1DTUA 4EVNA 2NY7L 2FNBA 4GRMB 3VFMB 5IK3A 1I9IH 2IF7A 2OJZL 1R5IB 5JR1H 1E27A 4DOHE 5EPMA 1DLFH 1N5YH 1S7XB 5E8PA 4X7SL 3HLAA 2V2WB 1IAIL 5F3HA 1IAII 4DEPC 2VZSA 4LSQL 5E8EB 2V7NB 4W68A 4CVXA 4P0DA 2UZIH 5IBUB 1JPSL 1PQZB 2NW2A 5KSAB 1RK0B 1NFDA 4U7SA 1EVUA 3C09B 5E95B 4PGCA 4UT9L 4YHYC 4D3CL 3LH2L 4KZDH 1UC6A 2EO9A 2FH6A 2ZG3A 4LHUB 3O45B 1TQBC 3GO1H 4M43L 2XOTA 35C8H 3IJYA 3BZEB 3WS3B 5F88B 4YDIH 4OM1L 1P9MC 4WEBL 4HWZA 4JG0H 4Y5VB 4EUPA 4L8SC 5B4MC 2RIKA 1RSFA 2VMFA 1IGYB 4MA1B 3EJYC 4QOKD 1MNUH 1UZ6F 2CDGB 4HPYL 3DURA 3O8XB 3FB5A 3KPRE 4K9EH 3WO4B 3QIUA 5KVDH 1MCBA 5I18H 4LP5A 4KXZI 4MAUL 5JQ6L 2J5LB 2NY3C 1FHGA 5D1QA 4HG4J 5ICZB 3CCHB 4RFNC 2Y36H 3KPPA 3UZEA 5ESVB 5GJSH 5I8KH 4ZXBB 4Z7VA 1UH3A 4PRBB 3PGFH 1KUMA 4P2QD 3RVVC 3X11B 1QFWH 5DVOA 1N3NA 4I3SL 1FFNA 4R0LC 4ZG1A 2WMPA 4M5YL 4OT1L 1II4E 3SJVB 3UJTH 3VWJA 4ZODA 5HDQH 2BVPA 4U0RB 2IBGA 1OD9A 1K8DA 5IBLC 4Q9RL 3O3DA 4P2OC 3QXUA 2IBZX 3QUZB 4KGJA 2X89A 1XIWA 3CZFA 4XHQA 4HUUA 5IJVA 2OCFD 1ZLVH 5C6PB 4I48A 4Z0BL 3ZDYF 3BD4A 5D1XA 4G9FA 4R4FH 4X5WB 3M1BA 4LEXH 3GJFB 5FM8A 4YX2H 5EC2A 3OXRA 5HYEA 2XZQL 4IRSD 1YNTB 3MRBB 5DJXB 1K8IA 3TYGL 1NGQH 1U2CA 4P9MH 3C6LA 2GUOB 4JJHA 3OKKB 1WBZA 5ADPH 1FL3B 4KK5D 4GKZB 5B38G 2IPUK 3DBXA 1WC7B 2ZG2A 2DI8A 3OG6B 5FGRA 4ONHB 1BEYH 5EBWA 4RISH 5I76A 1I7UA 4QRSB 4JHZA 3ARDB 4L9DA 1CYGA 3QEGL 1NUFA 1FQ9C 3ZTJH 2A6IB 4FQ1H 4FXKA 5EU3A 1F58H 5C0BE 5HD8D 1MJUH 5IHBA 4FQLL 4ODXB 3B9DA 5ICYA 2EIZB 5DYOB 2D03H 1XF5B 5FM4A 1AFVL 4QRPA 3ZHDA 3G6AA 1CD1A 4TULL 4ZD3L 1CF8L 1W0VA 4AL8L 4Q9CA 4LRNH 1ZHLB 4GAYA 4LCCC 1QA9B 3VXME 3T09A 1OM3H 4XBGA 4NQXA 1CLYH 3Q3GA 4ODUB 4OD1H 3BD5A 3MRGB 1KIPA 1R6VA 3EYSL 1Y6NR 5C0ND 4WDIB 3QHZL 4PFEA 4L8SA 5C6WH 2IADA 2ERJC 4XP4H 1LE5A 4P46B 3B6SB 3GSNH 4PP2A 4F7MB 2XWJA 1FPTL 4OZIE 1B9ZA 1CGUA 2ATPA 4XNQA 4OAWA 1VA9A 4JRYD 4AIXA 4N1HB 3GGWA 4PD4J 3NMEA 2HH0H 2IAMB 5F93C 5LG1A 1F02I 5HGGS 3V4PL 5HHOD 1S9WA 3BEVA 1EAJA 1RU9L 4HAFA 5H35A 3GIZL 4FFYL 4XNZC 4LLDA 3QDMB 5D70L 4BZ2L 3WE6B 2VLJD 5B3NA 2WK2A 4UDUB 3GJEB 1L7IH 2CSPA 4L3EB 3N85L 2MJWA 1A7NL 4NUGL 4CVWA 2IQAB 2OJZH 1BZQK 4M61A 2I26N 4KKCC 2C3XA 3EO0B 4X7SH 3QDJD 3KVQA 3RY4A 4NKIL 3VFPA 1IAIH 3BKCH 4FZ8H 4HFWA 5D8JL 4LSQH 1B4JL 2HJFA 4K3JL 4K2UL 3RWDB 1OAQH 2FZ3A 3NZ8B 3V0VA 5IB2A 4P2OA 5IMOA 3TC9A 2HVJB 1XFPA 4XCYA 4XVSH 5GGUA 2W0FA 3V4VL 2A0LC 1RIHL 3QHTC 1LD9A 4UT9H 4NQDB 3BXNB 2DQHL 3LH2H 4ZUWB 3GSOA 1RPQA 3GSNA 1AKJD 5E5UB 4WFED 2V5SA 1ZOXA 4HUXB 4M43H 1QEWB 3HC3L 4KRPD 3RP1A 4OM1H 4W70A 4WEBH 3RNKA 2R23A 5DD1L 4PJ9B 3CXDL 1IAOA 2F54A 4Q97A 3ZMRA 4RNRB 1YN7B 4KJQD 3D3VB 5C0CD 2OL3L 4JFPB 1FLRL 3T1FB 2NR6D 2ESVE 1CFQA 1WZKA 3LKOA 4HPYH 3H6JA 4LL9A 3NPZB 3VXSD 3ULUE 5FKAA 1MH5B 5HVFB 3KNBB 1AXSA 3O6KL 4KXZH 4UIMA 3P0GB 2OP4H 3LKRA 4LFHG 4MAUH 2X1PA 5DC4B 5JQ6H 1P7HL 3DUSB 1DFBL 1T03L 3BMWA 1XT5A 1J10A 1T7ZA 2BSRB 3MRMA 4K55A 3TV3L 5IW6A 4P5MA 1F4HA 4ZFFA 4DQOH 1CXFA 4Z0XA 1XGQB 2DQUL 4ZS7L 4I3SH 4LSSL 4JY4B 1Q9LA 1YY8A 1PFCA 5EFIB 2VXQH 3QAZC 4M5YH 4TNVF 4P2CG 1CFNB 2CMRH 4LCCA 3S36H 5KVEL 2ED8A 4PJ7E 1WTGT 3PQYD 3QFJA 4M62L 3OKLA 3JWDH 5FHBL 5EN2A 1T0NB 1C5BL 5J0BA 2E9WA 5F7DB 3OG4B 1QO3A 3D2UB 4Z0BH 5A2LH 1SEBB 4X5LA 2BSSB 1QBMH 4Z95L 4YZFF 2JJSC 1LVEA 2XNAA 3O0RH 3BZFB 5E1HB 2H3NB 5C09E 4HIEA 1G7MA 2DLHA 1D5BB 4U6TA 2FGWL 2VQUA 1EEUA 1WZ1L 3DIFA 4WTXA 1GOFA 1MAJA 1H9VA 4FTVD 1X7QA 2GYSA 2HMID 4P3DA 4YDLB 5F7EL 1A0QL 2WINB 2VZ1A 4JN1L 5D7LE 1TTFA 2VB5A 4UI2A 3CFJB 3S4SB 4ZO7A 4TUJB 2B1AH 4Y1AD 1HHHB 1O7VA 5GGVL 3QEGH 4U6YA 4X6DF 6CGTA 4CMHC 1Q94B 3DECA 2XRAL 3MLXL 3V6OA 5J1SC 4FQLH 1R24B 1JK8A 1FYTB 4M00A 5DQDH 1J1OL 5I1LB 1KIQA 4NO0D 2C3VA 4JZOA 1XR9A 3MRRA 5KSUB 3ZSSA 3MRPB 4KK8C 4TULH 2JIXA 4PLKD 4AL8H 5F1SA 3GHBH 3TCLB 1JTTA 5IVXE 3SCMC 2OR7A 4OI8A 1KN4L 4LPYA 2R8SH 3PWVA 2NX5A 1GC1L 4EXKA 4JM2F 4FXGA 4K8RD 3EYSH 3QRFM 1A6PA 2G2RA 4EDXA 3DHMA 5D5MF 3L3KA 4P9HH 2F8VA 4XWGL 4I77L 4TVPD 4L4VA 4QF1B 2MQCA 4MD5A 1I9JH 4LPTA 3BPCB 2DWEA 3FB6B 4XP1H 4X6FA 1BOGA 2EDWA 4QRRB 2FEEI 4BJLA 4MHHG 4RGNE 2APFA 2H45A 2ZUVA 3DNKA 1FL6B 4HV8B 3V4PH 4E42B 4PP1D 1CVSC 1CXKA 1RU9H 3OAYH 3ZKNC 3LSOA 2F53E 1D6VH 3NCBB 4FFYH 1UXWA 5D70H 4BZ2H 9CGTA 3KXFA 1LWRA 4PJ8D 4ZFZB 3MNVA 4HH9A 2A77L 2HFEB 4MQ7A 2OZ4L 3RBGA 1KEGL 4K3DH 3O3BA 4OCSH 4KJWD 1Q9WA 1IM3B 3CSPA 1CT8B 4HG4K 4HIXH 2WZPD 2VERN 2ZUXA 2FH8A 2XQBH 3ZKSD 4PRPB 2CKNA 3KPQA 1A9BB 1B4JH 1QRNE 4I5BA 3MFGB 5CHNB 3BKYH 3ZYZA 5IMLB 2EKJA 2OQJB 2P5WE 1AO7B 5KSAC 2VXUL 3C09C 4OF8A 1V3JA 4M03A 3QH3B 4IIQB 5E6IB 3FO1A 1RIHH 2Z8RA 3G5ZB 4PGEB 5D1QD 2XY1A 2ZKHL 1T5WA 1IGJB 1KTKE 2X44D 5KSBF 3QCVH 25C8H 1R3IH 2BHYA 2JJSA 2NY0D 3CMOL 2V7HA 3BIBX 2WLZA 1HH6A 2JELH 3FHAA 5FF6B 1KENH 2CKBL 4NO3A 3HC3H 4TPRH 4F33B 4Y5VC 1XMWA 5DD1H 2XZCL 3CXDH 1ZT7A 1I1FA 4GQPH 1IARB 4J8RA 4LCWA 3EYFB 3VWJD 4YIQA 3EJZD 3HI1B 4YHKL 5FUZL 4CNIB 1X3DA 3P30L 5DUML 1A6WH 1G7HB 1NMAH 1WAAE 3EYQC 3MRDB 2OL3H 1KCUL 3O8XC 4HXBH 1JHKL 4LOUD 3E6HA 4X7FC 1XIWD 3LPGA 3WO4C 2J8UA 4JY6B 3QULA 3LRSA 1XGUA 2K7QA 3FFDA 2J5LC 5MEQB 3DX6B 3RRQA 5D1XD 3F5WB 5KS9E 4H0IA 2YMXL 1DFBH 3FQNA 4L29A 2I9TA 4ZXBC 3RHWF 1P4IH 4U7KA 5ABDE 1D5ZA 4XPHL 1EEYB 3TV3H 3D69B 2YPLA 3VG9C 4X6DB 4WO4A 4ELME 1BFOA 2DQUH 2Q3ZA 5D96B 3VD5A 2HTKD 1VKXA 5K59E 1GJIA 5DMYA 1NAMB 5D2NE 4U0RC 1AR1D 5IVOA 3C6LD 1YQVL 2J12B 5D7IE 3SCMA 3TH2T 2H2PC 1FC2D 2EDYA 4Z7WE 2DS4A 2W91A 3QUZC 4HWEH 4JZNA 1QSFA 4M62H 3ZHKA 5CP3H 5GGRY 4XPFH 1LK2A 4RA0C 3D85A 5E5RB 3OL2A 1C5BH 4I4WA 5HTSA 4LRIA 3ULVE 4X7TB 2OMNA 3WYRA 1ORSB 4DN4L 1ZLWH 4QNPF 3HCVB 5EOTB 2YPVL 4Z95H 2YXFA 5GSVB 4LMQI 2IALA 1DL7H 4JM2B 1U93A 4ONOA 2OL3A 5D5MB 4F9PA 3X14A 1NMBL 4Z6AT 2FGWH 1JRHL 4QRPD 1JRHI 1WV7T 3DV6A 1YN6B 3CFCL 4L4TA 2DM4A 5F7EH 4GS7B 4P5TB 4PD4K 1MVUB 1NUGA 1SJEB 5ETUB 2UZYB 4GRMA 4IOSD 3HZKB 5CWSB 1TCMA 1MLCB 4LK4A 3T4AB 2PO6B 1R5IA 3ARDC 4YHNB 4K7FB 3C2SA 5DURD 1S7XA 5C0GB 1B4RA 1OARL 2V2WA 2WW8A 2XRAH 1NKRA 5E8EA 5HYSG 2V7NA 1GYAA 3EJYD 1MFNA 8FABA 5HI4C 1J1OH 3GKWH 1PQZA 4U1NA 5CP3A 1D9KB 4JGJA 5KSAA 2ENSA 2DJUA 1EO8L 1ZGLP 5FYLD 4JN2B 3WFCL 1X44A 2MCG1 3LIZH 1HYSD 1FNAA 4LHUA 2ADGB 3O45A 4X98B 5F6IB 5LXGL 4YHIB 1OGAE 3B5TA 3WS3A 4BH8A 4LVOC 1ES0B 2DWDB 3RVVD 5BXFB 4M3JA 1BMGA 5KSBB 4DKFL 3EFFA 4Y5VA 3JUZA 4XWGH 4P46C 3WIHL 4DUVA 3J8F7 1IGYA 3FCTB 3WEXB 1RIUL 2ICEB 1W0YT 3PHOB 3GJFH 4UOJA 2WUCL 5DS8B 1WTLA 2A9ML 2CDGA 2IAMC 3D0VB 1FLTX 2VLKB 5K9QG 1X5HA 3F7VB 1EO7A 3KLHD 1VCAA 4K7PX 1YQ2A 3MUY1 1J0IA 4OCLC 5ICZA 5JW4R 4HX1B 3CCHA 5ESVA 3K74B 4ZXBA 3O2VL 4PRBA 3BDBA 4QOKE 3HUJF 4LCYA 2G60L 4OZHE 1CWVA 2F54D 2GJZA 2O5XH 3SJVA 4HK0A 5E4EB 4KQ4H 1J0HA 4YHML 3IFOB 4N8VB 3OAYK 4F7EB 1MELA 3MXVH 1L7TL 4JCLA 4P2QE 1ORQB 4J7RA 5CINH 4MNGE 1A7BA 2ZKHH 3F7RA 4X5WA 1L0QA 2AAVA 5I71B 1DANT 3B2UC 3CMOH 5FUCE 3JSSA 3GJFA 3NCJL 3ZO0A 4M7JL 4JKWA 2E5EA 3GIVB 1YNTA 4NC1C 4M9PA 3MRBA 2BNUB 4PJ9C 3HN3A 5GS2H 1N8ZA 2X4NB 1IBGH 4KROB 1IL1B 4OLXL 4URTB 5E7BA 3HZMA 3JWOL 3F58L 4YHKH 5FUZH 1TFHA 2OJEA 3P30H 2GUOA 3OKKA 2GSIA 3GI9L 3B2VL 4GKZA 1KCUH 3V0AC 4RBPH 1WC7A 1SBBA 2BERA 3CFKB 3NFNB 3BKMH 5ICXA 3L7EB 2DJSA 1OB1A 1SY6L 4ONHA 4FOMA 3WKNA 1FE8H 2EH7L 1UM5H 4QRSA 3ARDA 4YGVB 4ZUUB 2A6IA 3A6CH 2YMXH 4M8VA 3PG2A 3BP4A 5F96L 1CS6A 4ODXA 5D6DA 5DYOA 4OLYH 3V9FA 3CVHB 2DYPD 1XF5A 4ISVB 3I2CH 3X3GL 3VGDA 5I1JL 1T20B 2IH3B 1MY7A 3VJ6B 2DKMA 1ZHLA 1YQVH 1QA9A 2D7TH 2R0ZL 1AH1A 3IDGB 2AXGB 5DMGC 4ODUA 1S9XB 1LDSA 3RWJB 3MRGA 3FMGL 2GJ6D 1UEMA 4WDIA 1TVBB 3KYAA 4JE4B 4DN4H 4ZTOL 1BJ1J 1GOGA 1A14L 4P46A 3B6SA 2QADB 4F7MA 4BQCA 4B7IA 2ARJB 1X5AA 4XPAL 4UNVA 1I8KA 4WJ5B 1NMBH 3GSXB 4AIOA 3MGAA 2IAMA 1JRHH 5IFHL 3IS0X 4FFZH 4YDLC 2X9YA 3QDMA 4S2SB 4NP4L 4U33A 2CRYA 3WE6A 3GJEA 4L3EA 5IB5B 1MCWW 2NX5D 1D5MA 1ZLWK 5C86A 3RL2B 1D5IL 4MJ4A 4WW2A 3SE9H 4NN6B 3DROB 4JRYE 1D5XB 5IVNA 4L4VD 5GGQH 5HHOE 1AQKH 3ROOB 4Z78B 4PJEF 3OAUL 3HUJB 1DN2A 1K3IA 4PGDB 1MQKL 3RWDA 2VLJE 5DUBB 1P4BL 4D0CB 3NZ8A 3MV11 2V5MA 1T21B 5IIEB 1OTTD 1KG0B 3PWPB 1UZ8B 4YXKL 2BJML 3FAWA 1NAML 2AJSL 3MV9A 4NQDA 3BXNA 2ZUSA 4Z7OF 4QXTB 4ZUWA 4WU7B 1S9VB 3BJ91 3QDJE 4HUXA 1QEWA 1IZJA 2NXYB 1F3JA 3BSZH 1NUDA 4ZO6A 3VI3F 3MO1B 1XGPB 4G6JH 3FOMB 4PJ9A 3JWOC 3UYRL 2IH1A 1UM4L 1NCCH 4LARL 4UOW1 2C7UA 1PVHA 1U8OA 4RNRA 1YN7A 1RIUH 3D3VA 1NEZB 4JFPA 3T1FA 4KAQL 3VXQA 4WFEE 2CPCA 1AXTL 3KNBA 5FUOL 3RGHA 2NQCA 4U6VL 4YC2B 4ZUVB 4TUKL 1EV2E 3JTSB 4I2XB 2CQVA 1BD2A 1Q38A 4G8EB 2VDKL 5DFTA 2Y7QB 4XVUC 2BSRA 2XXMB 3SDAB 4CVZB 3ZYIA 1L4IA 1NBZB 1FG2B 5C0CE 1WIOA 4GG8B 4OTXL 1OAZL 1XGQA 3QG7L 1X5KA 4JY4A 2VSDA 3PWLB 1DQLL 3VXSE 5EFIA 3GJFK 4MJ2A 1BJ1H 4NWTL 3GZKA 1CFNA 4HULB 2IFFL 2CK2A 5DI8B 3HMWH 3H9ZA 2YD8A 3SE4A 1J9CT 2B4CL 4XH2B 5EZJB 1CLZL 1T0NA 4IIQC 1XGTB 5E6IC 3V4UH 3EAKA 4G42B 4OQ1A 5F7DA 3D2UA 1OAXH 5E2VL 4OD3L 2BSSA 2Z4QB 3J7HA 4P4KA 4KKNA 5BJTA 1H8SA 1LDPL 4RAVA 2YPLD 4OZGE 1D5BA 4WO4D 3L3HB 2DQFA 3I84A 2MSPA 1BBJA 3PQYE 1W72B 1U95B 5D2LE 2OK0L 4RAUB 5E00B 5I16B 4KK8D 4Y8AA 1A3QA 4NCC1 2DMBA 4G7YL 3MRFB 1H3WM 2WINA 3GI9H 1FAIL 1HHJB 1SJHB 4U7MA 3D85D 3CFJA 1SY6H 5HHPB 1XF3B 4G6KL 4MLIA 4TUJA 4OF7A 1XGRA 3CFBB 1HHHA 4HF5L 5A1AA 2E27L 1A3LL 4ZO8A 2M8XA 1MIEL 1ZSDA 4FTVE 4H1LG 4M8QB 1E28B 2YR3A 5F96H 1R24A 1FYTA 4S1SL 4G8IB 4F7PB 5I1LA 3SKUD 2VDOL 4PJEB 1QNZH 4M02A 5KSUA 3MRPA 5GGVY 4Y1AE 4RBPK 3ZKND 3QI9D 2DIJA 5I30L 4JPWL 4PB9L 2R0ZH 1J8HD 4XPGL 4JFDB 4OV6F 5K9OB 2Y5TB 1WBYB 5KZCD 2CGRL 1P6FA 5TH2B 4ZTOH 4JM2C 2ZOKA 4QF1A 1A14H 3BW9B 1P5VA 2IANB 2GKIA 4QXWA 2DQIL 1LO3H 3BPCA 2F9BT 3FB6A 4M5ZH 4ODHH 5SWQA 4XPAH 2PW2B 4QRRA 2OBGA 2O93L 2BVYA 2ITDB 1L0YA 1SY6A 4HV8A 4N0YH 4E42A 5IFHH 1T2QL 3SO3B 4KTYA 43C9B 1CGVA 2RJMA 3CU7A 1F4YH 1L6ZA 2EECA 2I07B 4GS7C 1JPGB 4P5TC 4DZBB 3INUH 4NQCB 5KAQG 4JANB 4ZFZA 4BUHA 2HFEA 2PO6C 1X5GA 1IM3A 4FQ2L 1MI5D 1CT8A 4MX7B 4MGXA 2D0FA 3R4DA 1MCEA 2R2HB 2V9TA 3VFVB 1TZHB 5E70A 4PRPA 2C4XA 2ARJQ 2GFBB 4PJFF 4OF0A 3MR9B 3KJ6L 1A9BA 2I25N 1MQKH 2NY2D 1DLHA 3H3KA 5IMLA 3VRJB 3E2HB 1D9KC 2B4CC 2OQJA 1AO7A 5CKAA 4BKLA 3QH3A 4IIQA 4U6HB 4YXKH 4PV9A 3IYLW 2IWGA 4X9FA 4OZIF 3G5ZA 2AJSH 4R6UA 4JAMB 2ZG1A 3OTTA 5F6IC 1GAFH 2N4IA 4ZXBD 1OL0A 3SDDB 5FF6A 3CNKA 4Y2OA 5CAYB 4F33A 3OKEB 1EHAA 1FVDA 4XWOD 4Q6YA 3KPRB 5ALCL 3UYRH 1AGCB 1UM4H 3EYFA 3HAEB 4GBXB 4D8PB 3HI1A 4XXDB 4C83B 4CNIA 3MLRH 5DT1L 1G7HA 1I7RB 3MRDA 5E94A 4KAQH 5DDHB 3T2OA 4JY6A 1OAYH 1AXTH 2CO7B 2IBZY 5MEQA 3DX6A 4U6VH 3SBWC 3F5WA 4TUKH 3UTSB 1IMHC 1E6JL 2VKXA 3WLWC 2OM5A 4LIQL 2VDKH 3DTXA 4XBEL 2C26A 2XTJD 5DGQA 1QLEH 1EEYA 3D69A 4U2ZA 4X6DA 1K4DB 1KNOA 2OS7A 4N0FB 5JMRA 1DQLH 3SGKC 2QQNL 1M05B 5E4EC 3TESA 4ALAL 2YWYA 4HBCL 4NBZB 4NWTH 1BM3L 3WHXA 2IFFH 2VE6B 3B83A 3K8KA 3AM8A 4ZNEA 2CIIB 1HQRB 1X5FA 2B4CH 2LABA 1CLZH 5AUMB 3ARDD 4AMKL 4X7TA 2GT9B 1ORSA 4QHMB 3HCVA 1KN2L 3LN4A 3QWRA 5EOTA 1OTUC 3QFDA 4OD3H 4KV5E 5GSVA 5I71C 4JM2A 4B5EA 1LDPH 3ULUF 4U1MB 1AXIB 1FJ1B 5D5MA 5I15L 1A4KB 1YNLL 2VZTA 4KROC 2OK0H 5SWZA 2CRMA 4L8BB 1NH6A 3MBEB 1YN6A 1IEBA 3ARQA 3ARRA 3L5HA 3UC0L 2GY7B 4U3XA 1A21A 1BVLA 4P5TA 4X6EB 3REWB 2GSGB 1SJEA 4R9HA 5ETUA 5C0JA 5C0BB 2C1PA 5SWSB 5CWSA 3AS3A 1WQVT 3REVA 1MLCA 1T89A 3T4AA 5JLZB 1YEFL 2FGZA 5C0AD 2PO6A 1L6XA 3SGJC 4G6KH 3AREC 4WWID 4HF5H 4YHNA 2A9NL 4TN9A 3RWCA 1LK3L 3C60D 5C0GA 5DFWH 2P44B 5HI3D 4V1DE 1MIEH 3KAAA 3SOBH 1UCBL 4ZDHB 2X05A 5IEHB 1A7PH 3VXMB 2OMBA 2FJFB 4G3YH 5HI5D 1D9KA 2IAMD 2VDOH 4LGSB 4PJFB 1FP5A 5FIEA 4JN2A 1V7MH 1YECH 3QWOB 1IM9D 5I30H 1FCGA 2EC8A 4PB9H 5E2JA 5HYQB 2FO1A 4XPGH 4L3ED 1U42A 2ADGA 4X98A 4CN1A 4YHIA 2ZNXA 1K6QL 4OZIB 1UACL 1HHIB 1AD9B 5BXFA 3JV0A 5KSBA 5F6HI 1ZTXL 2CGRH 4KKBC 4IMLB 2QADC 5FYLE 4OZFG 2NY6B 3FCTA 4YE4L 4X6CE 3WEXA 5F7NC 2DQIH 2DQEL 1J0KA 1I7ZB 3PHOA 4XPTL 5DS8A 4QYOB 5E9DD 3TBYA 2VLKA 5IM7B 3F7VA 4BFEA 1W72L 1T2QH 3C08L 4XP5L 5DZOA 5IMMB 3LPWA 2HLFC 1JGLL 1IT9L 2EICA 3MV9D 3W11C 1O5DT 2BVTA 4Y2DA 2IPKB 3KPLB 1JPTH 3S37X 1T83C 1MFDH 5JA8B 4EQ3A 1YEKL 5KJRH 4NN6C 3FTGB 5DWUL 2L7JA 3WHE1 5IVXF 3QXWA 3UPAA 2MPAL 2Y6SC 4RX4A 4AZ8A 2UZXB 1EIBA 3B9EA 3CK0H 1YYLL 3I9GH 5CSGA 3IFOA 1N7ML 4S0SD 4AQOA 4LLVB 2X9XA 3CVHH 5KANG 5C2BL 3EFDH 4RWYH 5F8RC 5JDJA 1GSMA 5CD5D 3MV01 1KLFA 2GJJA 1ORQA 2YZ1A 5H37G 4KJPC 3UBXB 1BD2D 3QQ4B 3WD5H 3G5YA 3H9SE 4L3CB 3ES6B 3VXRB 2DRUA 4GRWE 2QJDA 1QSVA 2FSEB 3GIVA 4R8WL 2BNUA 4HS8L 1Q9OB 4BZYA 2X4NA 2P8MB 5ALCH 1IL1A 5BZDB 4P57B 3KG5A 2WBWB 1B0WA 3A0OA 5J3HC 4OFIA 5DT1H 3GNML 4CMMB 1EZVY 3P9MB 1AC6A 3BJLA 4KKLC 1OVZA 2NY1B 1ROWA 3NFNA 3I3BA 3L7EA 2KBGA 4HK3J 5F6HJ 5TFSH 2C9AA 4YC2C 4YGVA 4J23A 3D2UD 4ZUUA 4QTHB 3PV7A 2ADFL 3TN0D 4P4KD 3MPCA 5E5MB 4LIQH 4PRHA 4XBEH 1REIA 5ACMA 5DD3L 3RTQB 4YXHH 1NDMB 1AHWB 3CVHA 2GY5A 4ISVA 4JFYB 1T20A 4Q58C 2IH3A 4WI4A 1NCAL 5FYJU 2QQNH 3VJ6A 4HFUL 1Q72L 4ALAH 4NN5B 1ZANL 4YBHA 3IDGA 1HHGB 2AXGA 3QUMB 4P2RD 5C09B 1S9XA 2B0SL 4NT6B 3RWJA 3VMPA 1FCCA 3N06B 3AS2A 1RZGB 1WAAF 1KN2H 3S5LB 1RULH 5ID1B 1FYTD 3QO1B 4NWUL 4RWHA 1KT2B 4WJ5A 5I15H 5KN5B 2IPTL 5D7LB 5KS9F 3PJSA 3SDCB 1IAMA 1OLLA 2GJ6E 1J1XH 4MAYD 4S2SA 3NIDF 5ACZB 3AVEA 1Q0YL 5DK0A 1EK3A 4QGTA 4ELMF 1VERA 5FM5O 5IB5A 3V6OE 2C3HA 2XZZA 5K59F 3RL2A 2VN4A 3DROA 4LSVH 1D5XA 3U0WL 1IGFL 4BSVB 1LK3H 2VLMD 2NZ9D 3O11A 5D7IF 5CIPB 4HPOL 4Z7WF 2FBJL 1GZPB 4FFVD 2VDPL 3ROOA 4Z78A 1ZHNB 5D6CA 2JB5H 1UCBH 3NIGE 1N4XL 4XXCC 3LHPL 4PGDA 5CSBA 5DUBA 5IVXB 4D0CA 3ULVF 4UQ2B 1GGBL 4L9LB 5IIEA 4HUKB 4UV4L 4HT1L 3PWPA 2HT3D 2HT4C 4JO2L 1UZ8A 2HAZA 1KLGB 4XCFH 3PHSA 4OZ4A 1ZS8B 4QXTA 3D25A 4ZOCA 4WU7A 3Q5YA 3QNYB 1DZBA 5GZNC 4HQQL 5FECB 1CDJA 4FG6C 3L5WB 4HHAB 1K6QH 5DGRA 1UACH 4GQ9L 2FHBA 2YD2A 4R96A 4ZFOB 5TDNB 3TBVB 1XGPA 4RGNB 3BYTA 4CDHA 1ZTXH 3FOMA 1SBSL 4O51A 4PRPD 2FJHB 2RB8A 5MEND 3BOVA 5HPMA 2F53B 3CH8A 1Q1JL 2DLIA 4WHTB 3QG6B 4Z7UF 2DQEH 3RHWK 1ETZB 1NEZA 5CUSL 32C2B 2D3VA 4DGYH 1W72H 4XP5H 1BZ9B 1CBVL 1JGLH 1A3RL 1IT9H 2KH2B 4ZUVA 4I2XA 4YHLH 1B88A 3AMLA 4KHTH 2AGJL 4G8EA 2Y7QA 4OCXL 4NRZB 4ZQKB 4IRZL 5E03A 4XGZB 3SDAA 4CVZA 1NBZA 1QRNB 1LMKA 5CEZD 4GG8A 1KXQE 1MAML 1JHTA 1H3VA 5DWUH 3EOAB 1U3HB 5GSRB 2P5WB 2NXZD 3PWLA 4FQQB 4LSUL 2FDBP 3HB3C 3H3PL 3TYFB 4KI5E 1KGCE 1YYLH 4BSWA 1H5BB 1N7MH 3E2HC 4TTDD 1JFQH 2NYYC 5C2BH 4XH2A 3OB8A 3DOSA 4MB5A 1XGTA 4MMZC 3JTTA 3FOLA 4G42A 4G6AC 3MV8D 1AJ7L 1MCWM 4WW1B 4JREB 3JV4B 4JPKL 4DW2L 2Z4QA 1CZ8H 3L5JA 3ARVA 5JIHA 3SDDC 4MQTB 1OF2B 3UTTB 5D72L 5GRWA 3L3HA 5GZOC 1A7QL 4R8WH 1LO2L 1FNHA 1KBGL 2HRPL 1W72A 1U95A 3I6LD 2J8UE 3NN8B 1VGKB 2X1WL 4RAUA 5E00A 5I16A 4GBXC 4ETYA 1CICB 5B39B 4OLWL 4JRXE 1OWRM 2YD3A 3MMEA 4CVUA 2VDNH 5KS9B 4F8QA 5J12B 4OZHF 3V7MA 1HHJA 5ACLA 5ADOL 4ZPTA 5BV7H 5HHPA 1XF3A 4KVNL 1MJJB 2ARWA 4BH7B 4FP8L 1EFXB 4ELMB 1S5HB 3K2MC 3QWRD 3BPNC 2IQ9L 2ADFH 4JM2D 3BPOB 4M8QA 2OR8A 5GS1B 5D2NB 1E28A 1U0QA 5DD3H 3K2UL 4JO3L 5D7IB 1GRWA 4F7PA 1FVCB 4Z7WB 4I8DA 3NFPB 4PJEA 5SWZD 3EOTL 4KK6C 4OUUB 4HIHB 1NCAH 1OCWL 4MA3B 4HFUH 3BUYB 3U0PB 4PLOB 3UJIL 4AG4L 3EYVB 1ZANH 5JTWA 3H9YA 4JFDA 1MUJB 5K9OA 3BWUC 2Y5TA 1MOEA 1A2YB 1H8NA 4EN3B 3K80A 5HHVH 3DMMB 3UPCA 2DICA 1IKFL 1F8TL 4U1HB 5TH2A 3MRQA 3UBXI 5T3XD 4MA8L 3BZ4B 1FNFA 3BW9A 5E1AB 3MJGX 4PS4L 2LVCA 1J8HE 2PW2A 4UV7H 3OR7B 4A6YB 1BAFH 2IPTH 1U6AL 1TJIL 4H8WL 2ITDA 1UA6L 3W5MA 4WFGD 4ZUSB 5DMIH 43C9A 3MBEC 4Z7UB 4Y4KA 3ULUL 5D1ZB 2I07A 1EX0A 1JPGA 4DZBA 2XWTB 4NQCA 2X7LB 4JANA 2CRIA 5IJKA 1T1YB 3ARPA 1SJXA 1Z9OA 1BFVL 1EGJL 4O2CB 3KDMB 5HYJD 2DQTH 4JGUA 3U0WH 2AV1B 2R2HA 3TNMB 1TZHA 4HPOH 1CXIA 1XCTB 2GFBA 2VDPH 3IDMA 2KUTA 1VHPA 1NL0L 3V0WL 1Z3GL 3LHPH 3MXWL 3S37L 4YPGB 2I60H 2R9HD 4OLUH 3VRJA 4BK4A 1J0YA 2VLKD 3K81A 4LNVA 1OGAB 1PZ5A 3QSKB 4HT1H 5L88L 1MI5E 2KKQA 3KPSB 3LEVL 4JO2H 4U6HA 1HKLL 1Z9MA 3TT1H 5C0RH 4O58L 1XR8B 4DVBB 3MUJA 4Y2DD 1C7TA 2P7TB 5F21B 2OSLB 1EAPA 2EDFA 3U6RB 2VDQL 4JAMA 3NZHL 2CH8A 5EBGA 4K7PY 5KTEL 1G7IB 3WLWD 4JVPA 2AJXL 4HQQH 1ITCA 1WFOA 1FZMB 3QUML 3RU8L 4OFPA 4QLRA 4F15B 3FQTB 3OKEA 1JWUB 4JRWA 3VXTB 1LILA 1WVZA 4C56B 4UZGA 2VISB 4J4PA 3UAJC 1AGCA 1OLZA 2NY6C 5EZIH 4D8PA 4XXDA 4C83A 1QOKA 1I7RA 3HZVB 3Q5TA 4D0BB 3VFRB 3IVKB 2GTWB 2A73A 2WP3T 3ARUA 3IDYB 1FZJB 5DUPL 1UB5B 1WJ3A 4X8XA 1CBVH 1A3RH 1B2WL 4OZHB 3UTSA 1MHPL 5EZLB 3KLSA 4OCXH 3NGBB 3TFKC 4G43B 3L95B 3R06B 1IRAY 1MAMH 3PHQB 2VO5A 1AGBB 2HRLA 2C4FU 4LSUH 3ARXA 4DJMA 1M05A 4P2QB 3P9LB 4KWUA 1A6VH 3H3PH 3SDYH 5DEGB 4MNGB 1F4XH 5KW9L 2VE6A 2NW3A 2IGFL 2Z9TA 2P5EA 2XTJE 1YUHB 2CIIA 1HQRA 2VRAA 2YRPA 4ZS6D 3T8XB 5AUMA 3EHBD 1R0AL 2GT9A 4JKKA 3FO9B 3UP1A 5J1TC 2I24N 2EDDA 3W2DL 4JPKH 3QEHB 4M1DH 2RR3A 4DW2H 3AS0A 2JCCF 5LAXB 4LSTH 4PRHD 4F7CB 2ATKB 4POYA 3UXFA 2XFXB 1I8IB 1FJ1A 5D72H 3PP3H 4H8WC 3NBNA 1A4KA 1A7QH 3K1DA 4ZFOL 4EIZC 3EO9H 4JZJB 1CR9L 1RHHA 1CU4L 3KR3H 3ULUC 5JDSA 1KCVL 4N0CC 4XHJD 3MBEA 2EDXA 4IRSB 4ODBD 3S97C 4XVJL 5EUOE 3ZT6A 1L0XA 1DQDL 1JZ3A 3REWA 1QBBA 4X6EA 3R1GL 3PIQB 1WT5C 4LU5L 2NY1C 5SWSA 2MTPA 3U4BL 1MAKA 1YY9C 5L0QB 1ZLSL 4U3HA 5JLZA 5ADOH 4KVNH 5CGYC 1P7QD 3F7QA 5FDYA 4FP8H 2A1WL 4KKBD 4GXUN 2IQ9H 4LKXB 4LQFL 1HSAB 1T1XB 2Q7NA 2QADD 3LAFA 3RTQC 4G8GB 5IEHA 2BDNL 3QA3A 1DBAH 1AHWC 3VXMA 3K2UH 4UTAL 2FJFA 3NCMA 5JNYB 5L2KB 5FGCE 2W59A 1TZGL 4PJFA 5C0AE 3EOTH 5L9DL 5CSZB 3N1MC 1OCWH 2DQJL 4NN5C 4WENB 1VFAB 3RPIA 3UJIH 3QWOA 4AG4H 1F13A 3MUZ1 4OZGF 1IGCH 2APTA 5HYQA 1E4JA 1U91B 3RUGA 3BN9C 5DMJB 5D2LF 4B50A 4HUNB 2Q7YB 3BFOA 4OZIA 1AD9A 1RZIB 3GHEL 3TPUB 2EDTA 2H2SC 2GK2A 1IKFH 5K9KB 5F70A 4IMLA 4MA8H 5DJDA 4JHWL 5IBUG 1ZVYA 2AXJA 3PDOB 4W81A 3BRDA 4U1IB 1FN4B 4PS4H 2VDRH 1I7ZA 3PNWB 4NDMB 3LKNB 5TQ2H 3SDCC 2F5BL 1OWWA 1U6AH 1TJIH 1W2KT 4H8WH 5IM7A 1UA6H 3CSGA 2VQ1A 3PWPD 5IMMA 4JRYB 3ULUH 4LHUG 7CGTA 1MCRA 1YEHH 2IPKA 2CO6B 4WCYH 4RMQA 3KPLA 3TJEH 5HHOB 2J2ZA 4MZ2A 4MSWB 1JZ7A 1F97A 3RY5A 4AQ1B 1EGJH 2NXYD 2VLJB 4X6BB 2UVFA 3FTGA 5E9DE 1H15B 1I9RH 1KXVC 3OZ9H 3E6FB 3TBSB 1OD7A 4LPCA 1EJOL 4YDJA 3S35L 4RMRA 1F2XK 2GHWB 3MV9E 4XT1C 5FA3B 4O02L 3S37H 5DFVC 4LLVA 5D93B 3U9UB 4L9LC 4N0UA 1BVKA 1KB5B 3X3FL 1JL8A 4I18B 3WFZA 5L88H 4PJGE 3LEVH 1QBLL 5AD0B 1HKLH 3W9EB 4O58H 2RHEA 2ZJSH 4L1HA 4HC1L 3UBXA 3ULVL 2VDQH 3SY0B 3H2WA 3NZHH 1MCQA 4FQIH 5KTEH 3QQ4A 2AJXH 2YBRA 1FYHB 3GSVB 3SDAD 4XTRD 4L3CA 3ES6A 3VXRA 3VD9A 2R4RL 2FSEA 2YC1A 4RGNC 1ACYL 1Q9OA 2JCCB 4YFLF 1ADQH 3WFEL 1RFDL 1BJ8A 1JZ4A 2VZ3A 4MS8C 2ZPKH 5BZDA 1JCKA 4MNQD 5TE6L 3CSYB 2Y5EA 4P99A 4CMMA 1DN0B 5C7XL 5B8CB 1BD2E 3P9MA 3UZVB 2YD5A 1WT5A 1EGJA 4MYWB 4A6YL 3L3DA 1L9NA 5DUPH 3DSNA 5EBLB 3EDDA 5IHUL 4AEIL 4D0DB 5DQ9B 3LEYH 5DSCB 1RV6X 3ARZA 3AGVA 1TTGA 1J05B 5E5MA 3MLWL 2EIEA 2XZAL 1NDMA 1AHWA 1U92B 1JWSB 2YZ8A 5CEXB 1U3HC 1T4KB 4JQIL 4KI1A 4JFYA 5CGTA 4QRTA 4XCCL 5CIPH 1Y0LB 5D7SL 3SE3C 3U82B 4U6XA 5JZ7C 1H5BC 5KW9H 5E2WL 5HY9A 2EDRA 1HHGA 1I9EA 3DGCR 5DRNB 4NT6A 3BESR 4OZGB 3EYOB 3CDFA 1R0AH 4BM7A 1RZGA 4JREC 1ADQA 3P4OA 2N7BA 3PQYB 3WHE0 5D2LB 3W2DH 3S5LA 4Y88A 3CSBA 4XZUB 5ID1A 4MVBD 4WHDA 1EXUB 3QO1A 5IKCB 4X4MA 3ECBB 1FNEB 5KN5A 4DUWA 5B22A 1NCWL 4GXUM 3SDCA 2R1WB 4P2RE 5GGSB 2VWEE 3P11L 1CICC 1NC2A 1UWGL 3MCKB 1A7RL 3HNTH 4XVJH 2R1YA 4YEFA 5ACZA 2XI9A 3MLVL 1DQDH 1MFCH 4JFDD 3R1GH 4JJ5B 3AU1B 2FBOJ 3B3IB 3QNZB 4FTVB 4P3CL 2K7PA 2EKSB 1IC4L 1FYTE 5IGXL 1KJ2B 1ZLSH 4J1UB 1PD6A 4NQSA 1L9MA 3VFGL 4BSVA 3KWWA 5CIPA 4GW5A 3BPOC 1IEHA 4LQFH 5B38B 1GZPA 5GS1C 5D2NC 4JDZB 4NFDA 4CADB 1ZHNA 4AY0A 4F80A 1TVHA 4Y1AB 3UO1H 4I3GA 2GW5A 2BDNH 4JHAL 1E4WL 5I0DA 5IVXA 4O2EB 4UQ2A 4UTAH 4OM0L 1HOCB 5JW5A 4Y5XB 4KV5F 4FHBD 3N1QC 4F58L 5L9DH 4Y4KD 2DQJH 3ULVC 1KLGA 4O00A 1JNLL 5JO5B 4NO0B 5DK2B 1DEEB 2VLME 4NQCD 2Q3AA 3UJJH 1ZS8A 4U1KB 1BLNA 2IG2L 3QNYA 3KYMA 3QXDA 4EN3C 4GMTL 3L5WA 4HHAA 4EVNB 4PGZA 3DMMC 4AH2B 5IBTL 5LGJA 3GHEH 4U3CA 5DHVH 4ZFOA 2YUWA 5TDNA 2V6HA 3TBVA 5IWLC 3NFSL 2BXYA 2FJHA 1KSRA 1ZE3C 2YUVA 1E27B 4FZEH 5EPMB 1FORH 3ISWA 2F53A 4J3VA 5E8NB 4WHTA 1UWEL 1ETZA 1HE7A 3HLAB 3QHFL 1KTRL 32C2A 5JHLL 1NJ9B 3B5GA 4I0PB 3BH9B 2ZP0T 4C55A 3UTPE 5DEZA 1BZ9A 4TSCH 5D1ZC 1G9NL 3RAJL 4PLNC 1CI5A 1V7NL 4JO1L 4EDWL 4G6AD 3GMOB 1JPFB 1HH9A 5BQ7B 4PRPE 4XB8A 5MENE 4NRZA 5JA9A 4PGCB 4NRYB 4XGZA 2SEBA 2YPKB 3C9NB 2QHRH 5GZOD 2COQA 3STZB 4PJ8B 1BQUA 3UTOA 3EOAA 5GSRA 2P5WA 5K93A 1TTUA 4FQQA 4JVWA 4J4PD 1EJOH 2X40A 3S35H 4JPVL 1AGDB 3TYFA 1UCTA 2X4SA 4MWFB 3HE6A 4O02H 4OGYL 1XF2B 1NKOA 4ETQB 3X3FH 1I8MB 3V8CA 5DHVA 5E08L 5CEZE 1QBLH 2W9LA 4YK4B 3DURB 4X6CF 4YZFE 3IAGC 3UTSD 4WW1A 1F6AB 3V6ZB 3BWAA 3V52L 3VFUA 3JV4A 4HC1H 1RK1A 1DVFD 2AQ3A 5KSVB 2HKHL 2WANA 4XCNB 1OF2A 3UTTA 5D1QB 1MCIA 4DVRL 3H0TB 1WAAA 4F15C 2R4RH 5AWNL 3MLSL 2ITCA 3MODL 3NN8A 1VGKA 5EA0L 2PYFA 3WFEH 5B39A 1RFDH 1CICA 1MCCA 3MV8E 5TE6H 1X4XA 5KS9A 1DQQB 3ILQD 1QLFB 3ZYOA 2P5ED 1IVLA 2VR4A 3VWJB 1BQLL 1SVCP 4RRPG 2BVPB 2BCKB 5I1CH 5LWYH 1K8DB 1BWMA 1MJJA 4BH7A 5IHUH 1J87A 5HGHA 1E6OL 1EFXA 4PJ5B 4AEIH 2X42A 4ELMA 1Z0NA 3I6LE 5I8CB 4HUUB 2DLGA 2LAAA 3NGBC 1ZAGA 5GS1A 4I48B 3PGDA 4KK9D 3IU4L 2OTPA 1R3LB 2EC9U 1RURH 4R7NB 4JVUA 4Z7WA 1P53A 1N5AB 3M1BB 3NFPA 1FIEA 4HIHA 3FAXA 4MA3A 2XPGB 3BUYA 1DEDA 1E0OB 4HC1A 1EHLH 1K8IB 1INQB 4GRWF 4JCMA 4W4NA 5AG9A 3S4SG 3LDBB 1OSPL 2MFNA 4FQCH 5SWSD 5FEBA 5DJAB 1LE9A 5FUCC 4EN3A 3C6LB 1KB5L 3I85A 3NH7L 3SQBA 3TLRA 4YO0B 1A6ZA 3DMMA 4LSPL 2HTLD 4U05A 4C57C 5SWZE 4NNXB 2P43B 5HHXH 2CDFA 3BZ4A 3PP4L 5E1AA 3QDGE 4KKAC 4ELKB 3NTCH 3VXMD 4FXKB 3OR7A 4JZJC 1G6VK 1G9NC 4ZUSA 3IDJB 3P11H 3HS0A 4Z7UA 4IRSC 2VDLL 2Z92B 1A7RH 1JJUA 4S11A 5D1ZA 2V17H 1PY9A 3HC0B 2XWTA 3MLVH 1RZKC 3MJ7A 2X7LA 3G6AB 3MUGB 2EYRB 4PY7B 4V1DB 5T3XE 4P3CH 5L0QC 2D4DA 1T1YA 3ARFA 2FEDD 3TT3H 1WEJL 4GAYB 5IGXH 4O2CA 3KDMA 3ZTNL 5EO9A 2FX8H 4ENED 4KK5C 1VGEL 3SHSA 1LEKB 3IDNB 2AV1A 3Q3GB 3QQ3A 4WV1B 4WFGE 3TNMA 1BX2B 5EORL 2AJZB 3UAJD 4OFVA 3P40A 1X6LA 5E8DL 3T2NH 4F3FA 1CXHA 1E4WH 1LE5B 5HD8C 5DD5L 4PP2B 4QTIL 1JUFB 1OGAA 3EYUL 2ATPB 5HYJE 1GL4B 3KPSA 4F58H 3WJLC 4JO4H 2RFXA 1XR8A 4DVBA 1F6LL 1JNLH 2P7TA 2GITB 3U6RA 3C8DA 3CFIC 1G7IA 4M4RA 2IG2H 3JVGC 1PGRB 3DYOA 3T65B 4GMTH 1FZMA 3TFKD 5DJCB 1X5IA 5C92A 4X6CB 4X4YB 5IBTH 3P4MB 3FQTA 2VLKE 1JWUA 3VXTA 3QT2A 4C56A 3NFSH 2VISA 3L3OB 2ZCHL 5C0NC 1X5XA 1KPRB 3NIFE 1PBYA 4LLYB 1UWEH 4RZCB 3MLYL 3HZVA 3Q48A 1DJSA 1MRDL 1JWMB 1GGUA 4E5XB 3IVKA 1HINH 4B53A 5BVJB 1FZJA 4S0TD 1E4XL 1E4XI 5BCAA 3NIGF 3RAJH 4JO1H 4EDWH 5GS0H 5IB2B 4OZHA 4NQVB 5HYIA 5I6XC 1MHCA 3U9PH 2W0FB 3VFOA 2AEQL 3STLA 4JB9H 1RZKH 1GGCH 1WUNT 2H1PH 3Q1SH 3FN9A 4G43A 3L95A 3R06A 3VXRD 1KJ2L 3GSNB 4RFOH 1S7WB 3HC4H 1I1AB 3T3ME 1AGBA 2AERT 2B39A 1JYWA 4GMSL 3ULUD 4UIKL 4HMCA 3ARBD 3P9LA 4N0CD 4JPVH 3MREB 1QLRB 1TVDA 5DEGA 3RNKB 3LV3B 2BSED 4MNGA 5D93C 1FSKB 4L1DA 5GHWL 3BAEL 1YY9D 1YUHA 1QFWM 4KTDL 5F44A 3H9SB 5E08H 3T8XA 5CGYD 4GRWB 1CFQB 2APXA 4M93B 3FO9A 3V52H 2DQCL 3L5IA 3QEHA 1TCRA 1FNGB 2HKHH 5LAXA 1AXSB 4F7CA 3S96B 1I8IA 3ZE0F 1ZT1B 3QISA 4DVRH 3S36X 3HI6L 4OBRA 1U36A 5JOPD 1KCRL 2R0KL 5A2KH 3MJ9H 4GAGH 3IJSB 5EA0H 5IROC 3MRJB 5K9JL 4C54A 4O5LL 3LKSB 4CDGC 4D94A 4K8RL 1YY8B 5B8CC 3H9HB 3PIQA 1YEEH 4PRID 1NLBH 3T04D 4PRHE 1U8HA 3O3AA 4YFLI 3OMZA 4IOIB 2DB8A 1BQLH 3DUUA 2XXCB 1AR2A 4KJQC 1YYML 1G7LB 1DUZB 2NR6C 4KI5F 4W6XB 2D4FA 4F2MA 1E6OH 2Z31A 3OKLB 2EEDA 4LKXA 1HSAA 1T1XA 4NM4L 3FFCA 1FH5H 4G8GA 5IMKB 5DJYA 2G5RA 5EWIL 1UVQB 1TITA 4WTWA 3G5XB 2XNAB 5JNYA 5L2KA 4EJ1C 3WL9B 2F58L 1NC2D 1G7MB 1OW0C 2LU4A 1LO0L 4GSDL 1VFAA 3WJLA 2DYPB 4OSUL 4U1LB 4LF3B 1U91A 1OSPH 1EA9C 1MFBL 3JVGA 3M17B 2J8UF 3QJHB 2O5ZH 5MHSD 4NNPL 1R3HB 1KB5H 5HHMD 1RZIA 5GXBB 1XF4A 2BSTB 3MJ9A 3TPUA 3ZT5A 5CP7A 4QT5B 1I9IL 4QHKI 1TNNA 3WLBB 3RFZC 3WFHB 5I8OH 1EBAA 2ZSWB 3P2TA 4X9IA 1MQ8A 2GJ6B 3PP4H 3PDOA 1N5YL 4NKOB 3NA4A 4U1IA 1X6NA 1FN4A 3UROR 1FVEB 3PNWA 4NDMA 5DFVD 1IAKA 5GRZA 4FMFA 4M6AA 2W1NA 3OAZH 1JK8B 2L0DA 5KVFH 2VDLH 3KGRA 3RX5A 1XR9B 1YC8A 2J8HA 4DKAA 3ABZA 5HHOA 3MLZH 2HMIC 3MTRA 1RZFH 3DSFH 3MV7B 4MSWA 5EZOH 4UAOB 3GMPB 5I73B 4X6BA 1VGEH 3PWVB 5FYJE 3E6FA 3TBSA 3VDBA 3PWPE 3L3JB 2Z91B 5EORH 4EEEA 3RWHB 1CDBA 5SX5H 2F53D 4JG0L 4EDXB 5FA3A 3KJ4B 2B7DT 5FYKU 4CU6A 4P49A 3U9UA 4ORGA 1CK0L 1KB5A 4PJIA 4Y5XC 3UTQB 4QTIH 4MD5B 3SDXE 1NGYB 1MNUL 4I18A 4WHYH 3RWIB 5LJYH 4X6FB 4Q9QH 3OR6B 5AD0A 4LGPB 1AGEA 4LPVA 4U0QB 1XEDA 2EDHA 1IAIM 1KYOJ 1EBPA 5I18L 4PLKC 1T3FB 2EIDA 2HYMA 2Y36L 4LAJH 2P5WD 2JCCA 3EDKA 4TSBL 3PGFL 1Q9WB 3QIWD 4QHUB 4K8RC 4N8VG 2ZCHH 5IROA 1DANU 4L4JA 3CSYA 5H94B 3GRWH 2KQMA 3HE6D 1DN0A 5B8CA 3D48R 3DPBA 1FNLA 3MLYH 4WWKB 3KPQB 3OF6D 5HDQL 3P77B 2QLVB 2R15A 1MHEA 1E4XH 3TIDB 5EBLA 1UADC 4D0DA 5DQ9A 1FIGH 5DSCA 4X9BA 4PP1C 3UCRA 1J05A 2AEQH 4MNQE 5D9SB 1E4KC 3UTTD 3EZ8A 3V7AG 4PJ8C 5L6YL 1DDHA 1JWSA 1U92A 5CEXA 1VFMA 2UYLB 4KJWC 4YX2L 4CAGA 4LKCB 2BMKB 4GMSH 4RGOH 4L5FH 1Y0LA 1IQDB 1OW0A 3I3EA 5JOEA 1J0ZA 1UB6B 3IKCB 4Y16D 1F90H 4YIQB 2O26U 3BAEH 3KS0J 5EUKB 4P9ML 5DRNA 3OGOE 2OI9B 4KTDH 5ADPL 4OZGA 3EYOA 4YK4C 1EFXD 2AK1L 1I75A 3RQ3A 3E6HB 3LS5L 3PQYA 5TPWL 1ITBB 5ANME 2VZVA 2DQCH 4RISL 3HKFA 2IBBA 3GRWA 4XZUA 1SMOA 4P2YA 1JTPA 5D1QC 4JRXB 5FYLL 4FQ1L 5IKCA 4WTZG 2I9TB 1F58L 4HUMB 3HI6H 1FNEA 3FO2B 1KCRH 2NY0C 2R0KH 1T7WA 4YEEA 5GGSA 4OLVH 4H5SB 1TIUA 3MCKA 1HNFA 4K8RH 4MB4A 1RJYB 4OI7A 1EEQA 3AU1A 3B3IA 4JJ5A 2FX7L 3VWJC 4S1DD 3EJZC 3CX5J 4EN3D 2EKSA 2PR4L 1YYMH 2BNQD 4J1UA 4XC1H 3IJHB 4LOUC 1KULA 5CJXC 3C8HA 1LK2B 2BNRA 3D85B 5B38A 5F89B 4JDZA 3D9AL 4NM4H 4CADA 4Y1AA 4MHHI 3V6BR 3O2WL 4JFDE 5EWIH 4O2EA 1U93B 3GSNL 1HOCA 2CXKA 4G7VH 3TVMA 2DI7A 4Y5XA 2F58H 1M4KA 4KJYB 3N50A 1CFBA 5D1ZD 2HTKC 2APVA 3ORJA 4NO0A 5JO5A 1DEEA 1GGIL 3GUTB 3GSUB 4U1KA 3LDBC 4O9HH 3ARFD 1MFBH 4GFTB 3C6LC 4NNPH 3QI9B 3BDYH 3OPZL 4AH2A 1P6AB 1L7IL 1J8HB 5EUOF 3TZVB 4BUGA 5FCSH 1RZ7H 3HHRB 3GI8L 1A64A 5HBBA 5KZCB 5E8NA 3SPVB 1CE1L 4NQCE 4NUJB 1ED3B 1DBJL 1YPZA 4U31A 2RQ8A 3BKCL 3K46A 4FZ8L 3V5DA 1CFVL 1NJ9A 5DJ0B 5C8JA 4I0PA 1OGAD 3BH9A 3AAZB 1OAQL 3KPSD 1N0LA 8FABB 4YFEA 2HFGL 4U1NB 3GMOA 5GS3A 3BQUB 1JPFA 5BQ7A 1DBKL 5HGAB 2YHGA 3JV5A 4XVSL 3BHBB 3L7FA 4EOWL 5F71A 4NRYA 2R1XA 2YPKA 1BECA 1A9EB 1E4KA 1XCQB 3C9NA 4JQVC 4GO6B 4HAGA 3STZA 3C2AH 4PJ8A 4WV1C 3SKJH 3UTZB 1PSKH 4C56D 5TF0A 3PXHA 3LOWA 5C3TA 1C5CL 1Q8MA 3TH4T 3VGEA 4BH8B 2NTFA 5A2FA 1MI5B 1NEZG 1AGDA 1V5JA 4NSKB 2FO4B 3EFFB 1FO0B 4MWFA 3OAZK 5C70A 4HKJB 1OP5H 3NCEB 1QPXA 2HA1A 1XF2A 4ETQA 1CK0H 4N5UA 1KLUB 4UNTA 5JORB 2EDQA 1I8MA 1PG7L 5DLML 2NY2B 5SV4A 2NY4D 3M8OL 1M71B 1F6AA 3V6ZA 1B90A 5I8EB 1MCLA 5KSVA 1PEZA 2F8XC 4WW2F 2C1OB 2OP4L 4POUB 4XCNA 3U7WL 1HYSC 1NUNB 3H0TA 1M7DB 2RAMA 5SX5K 4TSBH 4NGHL 2E9JA 1KF9B 2J3SA 3JXAA 1I8LC 4DQOL 2HKFL 4LCYB 2YN3A 2P8PB 3WUWB 3UTSE 4TRPH 5JIKA 1P84J 2VXQL 1DQQA 2K9UA 4XP9H 1QLFA 2AXFB 5DJ6B 4HS6A 2GJZB 3PV6B 4HK0B 3NA9H 3ZLQC 1W8OA 2WLYA 2CMRL 2E6JA 2BCKA 3S36L 4LNRB 4Y4FB 3NVQA 3PL6B 2YA0A 4PJ5A 3STBA 2AJVH 2DLFL 3NABL 3RIFF 3JWDL 5I8CA 3KLHC 2WIMA 4E41A 5CJXA 3G9VA 3O9WB 5KAQF 3VH8G 2GI7A 1R3LA 2ICWB 4KKAD 4PJGF 1QBML 4R7NA 4BZ1L 2P5EE 5L6YH 1I1AC 1LP9E 3O0RL 4G9DB 4WVRA 1N5AA 3W39A 2BHUA 5ELIA 1UXSB 1MJ8L 2X4PB 3P0YH 4YUEL 2XTJB 4R90H 5GS0D 2XPGA 4UBDD 5FO8B 1N8ZB 2VABA 3OHXB 1FSKC 5CMAA 5KG9A 1JYNA 2YD9A 5IT2H 1INQA 2C5DC 4GW1B 4RMUA 3HZMB 3T77B 5DJZB 5DJAA 5DJ2B 2OJEB 3F7PC 1AE6H 5I74B 1W0WA 3D0LA 3C5JB 4YO0A 4NYLB 3DRTB 2GSIB 4M93C 2AK1H 2GK0B 2Z31D 1UG9A 3RVWD 1SYSA 3LS5H 5TPWH 4NNXA 5ICXB 4HKZB 1OB1B 2B1AL 3FFCD 3HNVL 1DQMH 1T80A 4F8TA 1J1PH 4G8GD 5EUOB 5FYLH 4ELKA 3BP4B 5L2KD 5SWSE 4ONFH 2QQKH 4XMKL 4MNHB 4HUVB 3IDJA 2CLZB 2KQNA 3PGCB 5DQDL 1U3ZA 5EU7E 1F11B 2Z92A 3WXWH 2KZ1B 5T1DH 1DR9A 3HC0A 2AQ1A 4OFDA 3MUGA 2EYRA 4PY7A 1ZEAL 4V1DA 5C2UB 2FX7H 4JDTL 2PTVA 2J1KA 3GHBL 2PR4H 5FDWB 2G5BA 4JQVA 3DRQB 2R8SL 1LEKA 3IDNA 4PJFE 5EOQH 5FGCB 1INDL 4WV1A 4BQBA 3MOAH 1BX2A 3T0EE 1EO5A 3GB7B 5C0AB 2AJZA 1FGVL 3D9AH 1BOYA 1HXYA 4H88L 4P9HL 4PRNA 4NJ9H 3C60B 5K9QI 1VADB 3O2WH 3RUGE 1G7JA 4G80B 5CJ5A 4M1GH 3IFLL 4XI5D 1WCQA 1ZGLB 1JUFA 2LU7A 1I9JL 4NM8L 4XP1L 5IR1B 5IFAL 3TWCL 1I8KB 3DVGB 1MCDA 3BGMB 2Y07L 2GITA 1GGIH 5BS0E 3T65A 1D6VL 2Z93A 1R3JB 2CUIA 5DJCA 2Z0BA 3C8KB 4O4YH 4X6CA 1NPUA 1IM9B 3OPZH 1RVFL 4X4YA 4U49A 3P4MA 2OLDA 1KYOK 4K3DL 1D5MB 3R8QA 1IGIL 4GRWH 4OCSL 4O2FB 4F57H 4WW2B 5HGBA 3GI8H 3L3OA 1CCZA 4HIXL 1I8LA 1KPRA 5EULV 1T0PB 12E8L 5EIQA 2XQBL 1CE1H 3EO1B 5AZ2H 4LLYA 4RZCA 1DBJH 1G1CA 2H26A 1DUYB 1J0JA 3V6OC 3O4LB 3C5ZD 1CFVH 4ERSL 2MNUA 1JWMA 4E5XA 4Q6IB 5BVJA 4LDOB 3CLFL 5MERB 3BKYL 5CKGA 1P2CB 4LLUB 4OB5H 1ULVA 3JWDC 5E9DB 2HFGH 2XYCA 2JKXA 4NQVA 1GH7A 1OAKL 1DBKH 2QSVA 5M95B 1F3RB 4EOWH 3A6BH 3RPKA 5EO1B 1G84A 1MFAL 3MV9B 4UAOC 5I73C 2YKLL 3QCVL 25C8L 1R3IL 1PW3A 1S7WA 4N0UE 3HAEG 1I1AA 1T6WA 4R4BA 4OJFL 5F9JB 2JELL 1C5CH 1KENL 1F3JB 1KIRB 4PJGB 4TPRL 3MREA 1QLRA 3QBTB 4FXLA 3KJ4C 3LV3A 5L7XH 1N6QH 1U8NB 1ZA3A 2PN5A 1AQDB 2IH1B 3SE8L 2PYED 3GEWB 3QZWG 2R56L 2C7UB 1A6WL 1U8OB 1NMAL 3H9SA 3RY6C 2W65B 3VXRE 1PG7H 5DLMH 3VWKA 2VN7A 4HXBL 4MDJB 4OF5A 2QQQA 2GCYB 3VXQB 3M8OH 1OTTC 1JV5A 4M6OL 3T1WA 3MROB 3SKMB 1FNGA 2QEJA 3GMRB 5M94B 1FZKB 1NCBL 3QPXH 3U7WH 3S96A 1ZT1A 5GRUL 3RKDD 1R3KB 1BD2B 1P4IL 2CJUL 2A6JB 3IJSA 3FZUC 2W0PA 4NGHH 3MRJA 1AP2A 1IZKA 1HCFX 2PXYB 2HKFH 3LKSA 5FYKD 5F1NB 3H9HA 3HFML 2ZCKH 4WWKC 3WNOA 3G08B 1EZVX 1SVZA 5ISZD 4IOIA 3ESVF 4RCAA 1G7LA 5TGBB 1DUZA 3QJFB 1JF1A 4AENA 4HWEL 5JOPE 3GKZA 1U8IA 4S1QL 3CX5K 2DLFH 3NABH 4NZRH 4XPFL 4P9HC 4GXVL 4KI5C 2RBLA 1ZGLM 1WISA 2A38A 4WUUB 1U8QB 5IMKA 1MEXH 1PY4A 1CG9B 1UVQA 4NKQB 4QY8B 3BIKB 3G5XA 4PRIE 4BZ1H 3TN0B 1DL7L 1HEZB 4P4KB 3WL9A 5BJTB 3DO7B 1MJ8H 1RUKL 4RAVB 4YUEH 4UNUA 2DQFB 1K85A 2DYPA 1S7UA 5HDBE 1BBJB 5JMOC 4U1LA 1FO0L 4LF3A 4ZYKB 3X12B 3U0TA 1CIDA 3M17A 2B20A 2OI9C 3QJHA 4TSAH 3BI9X 4X4ME 1R3HA 4N1CA 3VMOA 3UZQA 2JLLA 5DO2C 1ZLVK 2BSTA 3H7BB 3T4YB 1LHZA 1ZHBB 2Y06H 4QT5A 3WLBA 3K4AA 3CH1B 3WFHA 2BNRD 4P2RB 4R26H 2ZSWA 4RMSA 3GSRB 3HNVH 1XGRB 3HZYB 1KTDB 3SKNB 2GJ6A 5GIRB 4NKOA 2CXGA 1FVEA 1ZSDB 5HVHB 4W4OA 3TVMD 1WWAX 4XMKH 5MHSE 5HHME 1MIML 4WO4C 2J8OA 3GKWL 2M1KA 2ICCA 1ZEAH 3F6LA 2VNCA 4JDTH 3KPNA 3MV7A 3O4OB 4MAYB 5IG7B 3LIZL 4HIJB 1RD6A 3GMPA 4HMDA 5I0ZA 3RZCB 2FECI 1INDH 5GGTL 2YD4A 1QQDB 3L3JA 2Z91A 4ODTL 5T1KA 4LRIC 3RWHA 5GRJH 1FGVH 4UT6H 4X4XB 4H88H 5MP6H 3K1KC 1VFUA 5JUEH 4NOBA 2AJ3B 2NNAB 4FFWD 2ICWI 2ZOKB 4I0PD 3IFLH 3UTQA 2ZCLH 4F9PC 1NGYA 4NM8H 3RWIA 5IFAH 5SWQB 3LQAH 3RY6A 3TWCH 1QTYT 1H3TA 5FB8B 2FEEL 3OR6A 3O2DL 4ZTPH 1FV1B 5TDPA 5HYSA 2Y07H 1UKTA 2DBLL 2EE2A 2ORBL 4PUBL 1I4FB 1T3FA 3QI9C 4QWWC 3VXNB 1RIVH 1IQWL 1RVFH 4LPUA 3OBAA 1IFHH 4PIRF 5A3ID 3TZVC 1IGIH 3DI3B 4EI5B 4QHUA 4N8CL 4ZOBA 3U83A 5BRZD 3ARGD 1FBIL 1IC5L 5H94A 5IVZB 12E8H 2O5XL 4WWKA 2F5AH 2R0WL 4KQ4L 5MENB 2HFFB 4ERSH 3LB6D 3OKNB 1BFTA 3UBXG 4AIZA 1B0GB 3IGAB 3CLFH 3P77A 1HDMA 3TIDA 1DLHB 1P84K 1BGXL 3BQUC 2YRLA 3FB8B 4BKLB 1OAKH 3MXVL 2W9EL 3FQXB 1CIUA 5JPMB 5CINL 4PV9B 5D9SA 3P0VH 2EXWD 4ZMAT 1MFAH 3CVIH 5T5NF 5CS7A 2YKLH 2E7HA 4IJ3B 2RGSA 2UYLA 2ZOLB 1Z9SA 3TPKA 4OJFH 4LKCA 4UB0L 2BMKA 3TO4A 1IQDA 3OGCB 1FVDB 1UB6A 2FJGB 2NXZB 3IKCA 1IBGL 5BO1L 1D6EB 3SE8H 2O61B 4MA1C 5EUKA 2R56H 1NGZB 2UUDH 3UTTE 1MFEL 1KOAA 3WUZA 2NY2C 3GMMA 5E94B 3NIFF 4PJ5D 3BKML 4M6OH 1WCBB 4E41D 1FE8L 1UM5L 1NCBH 3A6CL 3MV8B 4JRXA 2ICWJ 3MCLH 4K07A 2W0KA 5GRUH 3IFPB 3FO2A 4LFHD 2LV4A 3DTXB 2CJUH 4UQ3B 3CLEH 4OLYL 4H5SA 3NIDE 4HJJL 3OX8B 1JNHA 2X5PA 2VXTH 3I2CL 3BN3B 1KNOB 4XWOC 3CD4A 1RJYA 3OV6A 3HFMH 4G8FB 3T3MF 3FHQA 3GMNB 5D71H 5IB4B 1ODAA 3WHXB 4AT6B 1HN1A 2D7TL 4Y4FC 3U2SA 4P3WA 3T0DA 3PL6C 3IJHA 2JF1A 5JOFB 1CGSL 4R2GB 4S1QH 3B9AA 3O9WC 5F89A 4NKDB 4GXVH 4R7DB 1ND0B 4YQXL 4LASH 3LN4B 3SKOB 3QFDB 4GKNA 4MMXC 1UQSB 2XTJC 2O5YH 4ZSOA 1RUKH 1V8HA 4KRLB 2BNQE 4KJYA 4M4PA 3GUTA 3VGAB 1FO0H 3GSUA 5SWZB 4V1DD 4FFZL 1PZUB 1A5FH 2WNGA 1IEBB 5I74C 3QI9A 3QDGB 2X70B 3ARTA 1BVLB 2XN9B 5ITFB 4K94L 1Z0MA 1J8HA 4J3SA 5C0JB 2C1PB 3TZVA 3CDGB 5DD6B 3LS4H 3REVB 3LD8B 3SE9L 4Z7UE 2V9QA 3SPVA 1MCKA 3RWCB 3IU3B 4F7TB 3TBTA 4NUJA 1ED3A 5GGQL 4B41A 2HJKB 1AQKL 1CVRA 1YEIL 2H6PB 3SO5A 4FMKA 5DJ0A 1BQSA 5D6DC 3AAZA 3VMNA 1MIMH 2DN7A 3QPQD 1KJMB 2JE8A 3VA2C 5E99L 5TE7L 3TBWB 3BQUA 1UH2A 3O3UN 4Z9KB 2Z8VC 5HGAA 3BHBA 5EOCJ 3CPLB 2VIRB 4OLZL 1FFOA 1A9EA 1XCQA 5LGKA 5CLTA 4YFDB 5C1MB 3FT3B 3UTZA 1J5OL 5GGTH 3KPSE 3BSZL 3NCYP 4ODTH 5HYJB 1MI5A 1T7YA 3RVTD 4NSKA 2FO4A 3VGFA 1FO0A 3C60C 4G6JL 4U1JB 4LDEB 5HI3C 4HKJA 3WKMH 1NCCL 3Q6GL 4FQXB 1KLUA 4RAHA 5JORA 1FRGL 3LRHA 5HJ3A 2OTWB 1NGPL 4NKMA 4KTEH 5HI5C 3O2DH 1CFTB 1M71A 1IGMH 3TBYB 5I8EA 4C56E 3HPLB 1CDIA 2X9WA 3VE0B 1H8OA 1T22A 5EU4B 2DBLH 2ORBH 4PUBH 2C1OA 5TF1H 3L3GB 4Y2DB 2GTZB 3OKMA 1IQWH 4OGXL 1M7DA 3B8YA 3RA7H 3PWJB 3VW3L 1I1AD 3H8NA 4IMKA 2BY0A 4WW2C 2XA8L 5GGRB 3V2AR 3THML 4N8CH 2P8PA 3EBAA 1FBIH 2E6QA 2VL4A 3WUWA 3QRGL 1IC5H 4XX1E 5CD3B 4R0LB 2AXFA 5DJ6A 2PETA 5J4MA 4BSJA 1RUML 3PV6A 2R0WH 1LNUB 4Q6IC 1U8LA 5BW7C 4WFFE 3H9SD 4Y5YB 1MCSA 3VWKD 3HMWL 4LNRA 4Y4FA 4HGMA 1BGXH 3O6MH 3PL6A 2R39A 4X8JB 5TQ0H 5GGTA 3T0AA 3I50H 1O0VA 2W9EH 3V4UL 3O9WA 3GBLA 3QQ9D 3VXPB 3MA9H 3SDXF 1OAXL 2ICWA 4IRJD 4G9DA 3TP4A 5I1GL 1U58B 3SN6N 1UXSA 2X4PA 3G5YB 4NQTA 4GG6E 5BOPA 2WV3A 3O2DA 4UB0H 3N9GL 4LLWB 2FX9L 4APQA 2DBJA 4LP4A 4XAKD 4EI6B 5FO8A 2Y4SA 3OHXA 3DGGA 4E0RB 3IS1X 4GW1A 3QO0A 5BO1H 5EIIB 3T77A 5DJZA 5DJ2A 1N26A 4K94C 1MFEH 1FNSL 3ARSA 3C5JA 4NZUL 4NYLA 1AD0B 3DRTA 2DM7A 1PKOA 3GBNL 4JFQB 4KY1L 3O3EB 4Y19E 2GK0A 4UT7L 3V7AE 1BF8A 3BP7B 4HKZA 1V3KA 5CD5C 1IJ9A 1S7RA 4EKXA 2JK5B 1Q0XL 1C1EL 1U41A 5EOCH 5EUOA 2P8LB 1NLDH 2AEIT 3F12B 5A16B 3WIFB 4PRHB 4MNHA 4HUVA 4MJ6B 2CLZA 3PGCA 2PXYC 4HJJH 1F11A 3DX7B 1NQBA 1QNZL 5LQBH 1T1WB 2ZNWA 3FFCE 4G8GE 2X4OB 5FDWA 5IESH 1R5WA 3JUYA 3VI4F 3DRQA 2YUXA 1GZQB 3OJ2C 5L2KE 3SE4C 1CGSH 1JTOA 3GB7A 5C0AA 4MXVE 1JZ2A 1P7QB 4XNYL 2P46B 4K3HA 4YQXH 3C60A 1TJHL 1VADA 3TN0C 5E0QA 1I1YB 4P4KC 4G80A 2ERJB 3A67H 3IRZA 1J86A 5EG6C 1ZGLA 2PNDA 2HT2D 1LO3L 4M5ZL 5IR1A 5MI0B 4ODHL 4F9LC 3DVGA 4OLEA 3EGSB 3BGMA 3HPJB 5CEZL 3PJSB 4N0YL 1CD8A 4H0GA