1HE7A

Human nerve growth factor receptor trka
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
107
structure length
107
Chain Sequence
b'SHMPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTEFLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFMDNPFEFNPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HIGH AFFINITY NERVE GROWTH FACTOR RECEPTOR
publication title Identification and Structure of the Nerve Growth Factor Binding Site on Trka.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 14
structure length 107
sequence length 107
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2000-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1he7A00
4O02L 2ITDA 5K59F 4Y4HD 4WGWB 4RQQA 3DX9A 1F4XH 2EH8L 3OR6B 1MCFA 2GTWB 1MCNA 2G5BA 4YEEA 5HYSG 5IMOB 3TCLA 5E08H 1HK6A 1T1ZB 4ODVL 4X7DC 2OJZH 4MD4B 1NH6A 3GIZL 4QCIB 4ZAKA 1JNHA 4OLUL 2MMXA 4R2GC 4YHNA 3ZKXB 4TUKL 4S1QH 1KG0B 4QOKD 1QQDA 5CSGA 3TO2A 1M1SA 3JWDH 3LQAL 4JHAH 4PJDA 5CUSL 5EU5A 3D39A 5EC2B 2VXSH 1OTSC 3SDDA 1HILB 3CFKA 1FLRH 2ATPA 2WWMC 2DDQL 2VC2H 2G2RB 4GSDL 3DI2B 2V9QA 1J12A 3GSVB 4OGAC 3RGHA 2IH3B 2EEBA 1Z5LB 4Q9QH 4L4TB 1FFNB 3FO9A 4FQ2L 1YY8B 4WW1A 3QXAB 3ARBC 1L7TH 3OJDA 5DRZA 2VISB 2FWOA 2DYPB 4ZFGH 2PETA 3DYMA 3UDWC 4H25B 5I2IA 1I3UA 3VFOA 4PRAA 1QUNA 1KIQA 2D0FA 4Y4FC 1GGYA 3VG9B 4YHLH 1I3GL 1XR8B 3THML 4ODWB 3QFDB 3CCHB 3NAAH 1LD9B 5CS7A 4GS7B 4P2QE 4OZIA 2IANA 4YNYA 3W39B 1BD2B 1JWUB 4L3EE 5C6PB 3M17B 3QIBB 4OCRL 5E24E 1GGUA 1U8HA 3CZFA 2Q7YA 2Z93B 4F7EB 2OXGA 4JRXB 4YC2B 1EVTC 1UENA 1U6AL 4ONFH 1TJHL 4U1IA 3ECBB 1A6UH 2OCFD 1GSMA 1UYWH 1JYWA 5F72S 4HIEB 4UAOC 4MWFB 1GJIA 4GKZA 4FFWC 4Y8DC 3T0EC 3B2VH 2YMXL 3VU2A 2WLZA 2FDBP 2I07B 5JMOC 4JFYB 4JFEB 1F4WL 3JWOH 5DMKB 4YGAB 3UTTE 1FLTX 3HS0A 5SWQB 1MQKL 3D3VE 3MUY1 4KMQA 4O5LH 4Q0XH 1FNSH 2ICWA 1K8IA 1A64A 3ARPA 3O4LB 3ULUH 4CW1A 5LQBL 4S1RH 4X6BB 3IDJA 3C2AH 2GW5A 2HFEB 1D5BB 1CLZL 3GEWB 3MOAH 1A3LH 8CGTA 1YMMA 4WO4D 3S3SA 4N9OB 1Z9LA 1H8OA 3H7BA 1CD9B 2H2PD 3ARFC 3CD4A 4WCYH 4FXKB 1I1AA 4HJ0D 3RP1A 5ESQB 5GS2D 4M7ZB 2Z4QB 5J1AA 1MFEL 3MO1A 4ELMB 3IT8D 4YQXH 4DN3L 3EDKA 3BIAX 3NVQA 5JR1L 4K8RD 2NZIA 4A2LA 1QKZH 3LRSB 1IM3B 4U3HA 4NQDA 2IFFH 1B2WL 4OCWH 1DQQA 5ILTH 2GUOA 3T2PA 2G75A 4DGVH 5AWNL 1F97A 5LXGH 3GIVB 1J5OL 1VDGA 4WFGE 1QSZA 2PR4H 4FMKA 3TO4A 1XFPA 5LGHL 4XBEL 5D7IB 3OZ9L 3UTPE 4R4FL 4BFBD 5CD3A 1CBVH 5BV7C 3PWLA 4WRLA 3MOQA 2VDQH 3GHEL 2J5LC 2B5IB 2DQGL 2JK5B 1IGTB 4PD4J 3HLAA 1DVFB 3FL7A 3SE9L 4NUGH 3WFHA 4GBXB 1T7YA 3MNZB 4RFOH 3QIUA 3P77B 1YPZB 3EBAA 1B88A 2FGZA 2FX8L 5I73B 3O9WB 3UZEA 3D69B 5CZVH 4YXKH 4XVSL 1DQMH 3P9MA 4P99A 2VUOA 3DSNA 4BELD 1IE5A 5DJZA 1FAIH 2VDLL 1PKQA 3CSPA 5C0CE 3BPOC 4LRIC 1EVUA 2R0KH 1S7VB 2HLAA 4KI5F 3BPCB 5E1HB 3Q0HA 4NKMA 4IDLA 4DKEH 1OTUC 3G6AB 4UOW1 4XMPH 5D2LF 1MHPL 1VACA 4K2UL 2VAAA 1QSFD 1KFAL 4R7DB 3MNWA 3T08A 4NWTL 4LCUB 3ARDA 4QTHB 2DF3A 3BWAB 4HSQA 3TZVD 3HHRB 1HHHB 3EOYG 3UZQA 4I0PC 1NCTA 4LHUA 3VXNB 5F44A 3VMPA 4PRPA 5KSBB 1VFBA 1DBML 4FFVD 5IB4A 1JPSH 5GXBB 4NBYB 2F5BH 4YDVA 4ODHL 3QPQD 3C8HA 3DNKA 4A2MA 4MD5B 4NJAH 5DSCA 3DETD 1MH5B 2HN7B 1X4ZA 5E70A 3MBEA 3MR9A 2QQQA 3LSOB 2E5EA 3U9UB 2VLRA 4NZUH 2HJLB 4XCNA 1E6JL 3FTGA 3S36H 3RY6A 1CD8A 2RGSA 5HGHB 1U3HB 1U8IA 4GFTB 2HT4D 1EPFA 2FH6A 2R2CA 4R2GB 4IRJD 3C60C 2CMRL 1AI1L 1FNHA 5GGSB 4KJWD 3UAJC 5C92A 2NY6B 4PG9B 5E6IC 2YRZA 5JNYB 5F89B 3BKYH 1AR1D 1BZ7A 4APQB 5J6HB 3D18B 4CJ0A 4DVRL 4TOYL 3S97C 2HT3D 5JOPE 1UXSB 5IW1B 3HC4H 1EO5A 1N4XL 5AYUH 3HZKB 4Z18A 3CDGB 2FX7L 3PWJA 3ARED 2NQCA 4PJXF 2GJZA 2AS5M 5E0QA 1MFDL 2P5EE 2EDEA 3U46A 2C7UB 1D5MB 4LSRH 1K5NA 1EHLH 4JFXB 1NBYB 4LAQH 1CD1B 3PDOB 1W72H 5TQ2L 3BDBA 3L3GB 5D2NC 3EYVA 5FUCE 1ZGLA 3RWEA 3ZDXE 1ZT7A 4M1DL 1J05A 2CUMA 2VE6B 4Y4FB 5DHYB 3LKPB 1NC2D 1HXYB 5IROA 3VMNA 2QSCH 2I9TA 2YPVL 4MLSA 5B3JE 1NGYB 2H32B 1MI5E 4XAWH 4O00A 4HUUA 5E9DE 3TJEL 3HCVA 1FL3B 2VSCA 3OX8B 1B9ZA 4XAKD 4G6AD 4RGND 1P2CB 4YDKL 3MTRA 3BAEL 1LEKA 2HFGH 2JB6A 2P8PA 1H15B 3HE6A 3U0PB 5IMKA 5GGVH 5FUOL 4J8RB 4NKDA 3LHPH 4OZHA 2HT2C 4LSDA 1E27B 4GKNA 5IG7B 1RZFL 3BDYH 1JWSB 4NKOB 4LGPB 4D0DA 2HRPL 1AKJB 3I2CH 4QHMA 3T0EB 3K4ZA 4H8WH 1RIHH 4B50A 3LPGA 4DVBA 3O3UN 4ZXBB 2PNDA 4Y19B 4L8DA 4PJCA 5AUMB 4EIGB 4JVWA 5T33L 4UIMA 2NNAB 4PJDE 5E00B 2C1PB 3D39E 4LCWB 4LU5L 3HC0A 5E2UH 1D5IH 2VXUH 3WNKA 1EK3A 5A16B 2NY3D 3H9YA 2A6DB 4AENB 4M00A 5DUPH 2E6PA 4M02A 4WI5A 3T3MF 1CDHA 3OV6A 2J8UF 5D9SA 3X13B 2NW3B 3MMEB 2HJFA 5JXEA 2EEDA 4G9FB 3ARFB 2DTMH 4U1SA 1N7MH 3QCTH 3PE9A 3MREA 3PJSA 4JE4B 1BFVL 3HRZA 4U1NB 3X11B 4XCYA 4OD1L 4ELKB 3V4UH 4OM0H 1IAKB 3NFSH 1QO3B 4LCYA 5L2JA 4YBLC 1RJCA 2FLRT 2W07A 2XTJC 2NTFA 4YHML 1N6QL 4LMQI 3CXDL 4DTGH 1DEDA 4J1UA 4GRWB 5EUOA 2AKRA 1XGTB 3U0TA 1QNZH 2GJ6D 5DA0B 3V4VL 1IC7L 2AK4B 2VIRA 5C0RH 1N5YL 1OW0C 1QRKA 4OZIE 2IANE 5D1XD 4MDJB 2Y06L 4MJIA 3ZTJG 1QEWA 1NMBL 3NCMA 2YC1A 1BBDL 3LN4B 3IU3B 3RWJA 4XX1G 1DQJB 4OT1L 4Z7WB 1MHHB 3QWRD 4RMSA 5GS0D 5BV7B 3RTQC 1LK2A 3AC0A 4HIXL 2FO4B 5EN2A 3ZDZE 2ZJSH 3SDXB 5DVMA 4JDZA 4NO3B 3BVNB 4X4XA 4RISH 4OGYL 3T65A 5ALCH 5IGXL 4FQHA 4NIKB 1P9MA 3F7QA 4F80A 1Q9KB 2VDOH 3LKSA 4LLYB 1JV5A 3UTOA 3CSGA 4JFPA 5IFHH 4IHOA 2A77H 1FFQA 2Q6WB 2APWA 3IVKB 4JDVB 1A6WL 3ZE2E 4LKCB 4M1CC 3QFJB 5GHWH 1F4XL 1MCKA 3BPOB 3L3JA 2JB5H 5BZDA 3LRHA 2AJYH 4PJ8B 5E08L 2VLKD 3LKRA 1MCWW 2OJZL 4MS8D 3O8XA 1FZKA 1YMME 1UCTA 3TNMA 1QBLH 1KNOA 2V6HA 4JGUA 3DMMA 4KPHH 3IDYC 5TDNB 2ESVA 3ZTNH 1MFAH 3JWDL 1QFWI 2VR5A 5IBLD 4JHAL 1P84K 1VESA 2UYLB 1GZQA 2VXSL 4I0PB 4ISVA 5HDLA 3AGVA 1FLRL 3KXFB 5CZXC 1ETZB 3HE7D 5I15H 2VC2L 1ZSDB 4QY8B 2BSED 4Q6IB 3SDCC 1E28A 3WMSA 4NQCD 1FVCA 4NQDE 4IBLT 2VUYA 1M05B 1E4KA 4XNQA 1BF2A 2BSRA 2O5XL 1TVDA 4RA3A 4Q9QL 3KVQA 2EZ0D 2XPGB 5K9QG 3U79A 2A0LD 1E4XL 5J1SC 3OBAA 1L7TL 4XXDA 1DE4B 4ZFGL 3ZYIA 1UB5A 2VXVH 1NEZB 1CE1H 4MX7A 5EUKA 5F6HI 2BVEA 1NCBH 5DO2C 3RU8H 1X5FA 3VXPB 3C60B 4HS3A 1IGJB 4KI5C 2DWEA 3OKNA 4UDTA 1AXSB 4BKLB 2X10A 4YHLL 2AEWA 5DGQA 4F2MB 5H37G 5ICZB 1A2YA 3WIHL 1PEWA 1U58A 5DYOA 3VCLB 1MY7A 3FZUC 1FCCA 1R5IB 2R0WH 1G7MA 3KPPB 4OKVA 3C5SA 1JI2A 3SE3A 4XGZB 1O0VA 4PJFF 3CDFA 4GG8A 4QRQB 4JKPH 4PRID 5DJAA 5KVGH 3NFNB 3OKMB 4N90D 5D93B 5H94A 1T7WA 3HB3C 1CS6A 4KROB 2CXGA 2QLVB 1PKQE 4ONFL 4YXLL 1U8NA 2VLME 1MCPH 4JPKH 3PWPB 1DQDH 4PGDB 2VWEE 4M7LH 4X9IA 2VN7A 3WIHA 4FRWA 3B2VL 1YC7A 2CLRA 1N59B 1W0WB 4GUPA 1MCJA 2H32H 3RWCA 3JWOL 2ADGB 4TSBH 3J8F7 4CU8A 5J8OA 1LO0H 3CC5A 2GSGA 2IEPA 5B39A 5DZOA 4O5LL 4Q0XL 2OX5A 1KACB 4QRRB 3ULUL 3L3KA 4PRPE 3RWIA 4S1RL 4JN1H 1U2CA 5DC9B 2K7QA 2AXFA 4OF3A 5IK3A 2DI8A 3WO4C 3U0WH 3MOAL 1A3LL 3FB7B 3HI5H 4O51A 2XY1A 4ZNEA 3DIFA 1FCGA 1CGSH 3NCYP 2UY7A 1PSKH 4CNIB 4YBHA 2MOVA 2VLRE 1UWXK 1S9WB 3QXTA 4WCYL 3BI9X 4GAJH 4HWBH 3VE0A 2VXQH 5JW4N 3PWVA 4HX1A 2YOCA 1BOGA 3QUKA 3MJ6A 5IHZA 4X7TB 2V7HB 1YN6A 4OLWH 4XVUD 4YQXL 1GPOH 3WS6C 4Y5XA 1DUZB 5C08A 4TUJB 3S4SG 2DMCA 1QKZL 4XPGH 4OZFG 3D0VB 4MXQC 5CCKH 5JA8B 5FOJA 3B2UC 5FGBA 4U49A 4OCWL 2BNUB 5D1QC 2P8MA 5ILTL 4L3CA 4XHQA 4DGVL 3P4NA 5LXGL 3VI3F 4LEOB 3BD3A 3MV8B 1CD0A 4W6WB 1A21A 3K81A 4KK9C 1MCQA 5INDA 2PR4L 1X5ZA 3GBML 3WLWC 1SVZA 3DV6B 4JFOB 4NWUH 2BVYA 4MAYC 3UXFA 5EPMB 5C0NC 1RUMH 2B7DT 4R7NB 5F9AC 1CBVL 3OL2A 5MERB 2PW2A 1XCTB 5J13C 3RY4A 4NUGL 3FFCD 3WDHA 4PJ5B 3KLAA 4UOJA 4GRWH 4RFOL 1WIUA 4L8CB 1F6AA 1PW3A 3IF1A 4I13B 4YBLB 3GMNA 3C9NA 3QRFM 3REWA 2X7LB 3LDBB 1P7KB 5EO1A 5A2KH 4YXKL 1R3IH 1XF2A 1M7IB 1DQML 5HHVH 1FBIH 2GITA 3MA7B 4Q97A 1FAIL 3SDYL 3UBXG 5BVPL 4F3FB 2R0KL 4FNLH 4JG1H 3OHXB 5BV7H 2WIMA 5DD3H 4CRPA 1UJ3A 1U92B 4DKEL 4XMPL 3CLFH 4PRBB 1ONQB 4QO1A 3ZKMD 3H9HB 2E27H 2WUCL 3V79C 1CXFA 2QR0B 3RTQB 4EI6A 1G7QA 1T3FB 3FQWA 1U8LB 1OGAB 2FECL 4OZHE 5CJXC 1YYLH 3IDGA 5EFIA 4PRDA 3FQNB 1XF5B 1WWWX 5IVXB 1RZGB 1ZLSH 3FOMB 2B0SL 3V6ZA 1JPSL 4RFEB 1K2DA 2BNRB 2ZNWA 3QDMA 5GIRA 4P57A 5D71H 3EOBA 2P46B 4PJCE 4EIZC 4NJAL 4G5ZL 1OT1A 1S9YB 3IDXH 3VRIA 3LH2H 4HFWA 4ODXB 4NZUL 4GRLC 1J8HB 2YUXA 3BN3B 1YYMH 1FYTB 2X4RB 5D8JH 2XKUA 3S36L 3DV4B 1QLRB 4G80B 4LNRA 2UVFA 1WK0A 1MWAA 2FH8A 3PDDA 2XN9A 4UTBH 1H0DA 1SJHB 5DEFA 1HHKA 3T0AA 3DUUB 5IMOA 3BRFA 3BKYL 4FZEH 2P24B 4PJGA 3H0TB 2A9MH 1YEFH 5JZ7D 4MD4A 3BHBB 1CE6B 1RUQH 1YQ2A 2RHEA 3IJHB 4W70A 2VZSA 4AQOA 5IB3B 3SDCB 3HC4L 3G5ZA 4AM0A 1OVZA 2LU7A 1KG0A 5AYUL 1FFPA 1S5IH 4ZUSB 3C08H 3R0MA 5EUOE 3SDAD 1Y18B 5IHLB 2AJZA 3VXSD 2ZZUT 1FO0B 1WAAA 2WQRA 3ILQD 4LSVH 1L7IL 1LO2H 4W4OA 2EDQA 2ZSWB 4S0SD 3MLZH 1OP5H 4LSRL 3QSKB 4WNQB 3FQXB 4MJIE 2XKNB 2NW2B 3MLXH 4LAQL 1AY1L 1JGDB 4NOFA 3ROOB 2NXZC 3B6SB 5SX5H 1ES0B 5HSFA 5BQ7A 1L0YA 3BP4B 3T09A 1U36A 4ZTPH 1FFNA 4LRNH 1YY8A 3PGCA 3IRZA 3PQYA 2QSCL 1UKSA 5AZ2H 2VISA 5IFJB 3IS1X 4XAWL 5GZNC 1VHPA 2XWTA 1K3ZA 1CFNB 3VXUA 2M26A 3X3GH 4H25A 5EZJA 1CGTA 3UJIH 3X17A 2HFGL 4UOW0 2A83A 1XR9A 3HN3A 3LB6D 2J1KA 1AC6A 1I8IB 3QFDA 4ZPVB 2I27N 3MV9A 4F9PC 3VI4E 4AT6A 3KYOB 4QHLA 4Y5VC 5GGVL 4KUZH 1NJ9B 5MENB 3TF7C 3L5WB 5C3LD 4FQXD 3CPLB 3I2CL 3WHXB 5DUMH 3BT2H 4FMFA 2B4CH 4H8WL 3K8LA 1RIHL 3W9EB 5C71A 3S5LB 2IBZY 1I7UA 1NBZB 4NDMB 3SY0B 3PIQB 4GLRI 2ESVE 2J4WH 5BRZB 1UJTA 4R4NC 4JFDD 3V8CA 5IVOA 4NZJA 4OD3H 1T5WB 4NQVA 1Z0NA 4QWWD 1C7TA 4GW4A 1TZHB 1I1CA 5E2UL 3RX5A 2VXUL 3QRGH 4JFEA 2QADB 3ARXA 3ZHLA 4R0LB 2VDRH 2QSQA 4Y4HC 5FF6A 2WWKO 4HS6B 4N8CH 2IWGA 4MSWA 4ZUTA 1TJGH 2ILLA 4R4BB 2Z0BA 4OGZA 1EAJA 3H2WA 4G8FA 2DTML 5GGRA 4CVZB 1T89C 3GJEA 1QPPA 3IXTA 4PJAF 1D5BA 1C7SA 5C07A 4OM0L 3V4UL 3NFSL 2DKMA 3MUJA 5BS0A 1A4KA 3NOIA 4PJEA 2KBGA 1AGBB 4KZEH 3C5ZA 3PHSA 4DTGL 4PJIB 2IQ9L 4JPIB 3L3OB 4FXKA 4Q2ZA 1QNZL 3DVNA 2FJFA 4P9HH 1KB9K 4TVPD 3P30H 2FHBA 3QUYD 2NXYC 3WKMH 2N4IA 1LO3H 5CBAA 4IEFB 2GQHA 2PYFB 4HGWA 2PTUA 4HUVB 1KIUA 1JRHI 3GIVA 3JV4A 3MRDA 1I7TB 3KPNA 1QSEB 2ZJSL 4EQ3A 1CGXA 4RISL 5ALCL 3D85B 2EYRB 4KZDH 2HAZA 2BNQA 2E7MA 3GSWA 2VDOL 2DL9A 3DWTA 1Q9LA 5D6CB 2OS7A 2A77L 3DYPA 5HGAB 2BVQB 3LPFA 3MUZ1 3O3AA 3I3BA 2JK5A 4Y4KC 1IGTA 2UUDH 1R3JA 4L1HA 1LK3H 3GFUA 3X3FH 5GHWL 4GBXA 3MNZA 2JB5L 3PWUB 1NCCL 2AJYL 2O5YH 4M4RA 2DLIA 3NIFE 3O9WA 4RBPK 4D8PB 1LP9A 1FG9C 2IFGA 1A4JB 1CXEA 4HWEL 3MV7D 4DKFL 4MB3A 4ZNEE 5DHVA 2C4XA 1QBLL 2I9LB 1D3CA 4KPHL 2Q20A 4U0QB 1A9BB 2JCCA 1AFVH 3ZTNL 4EOWH 1MFAL 3RIFK 1MFNA 3G6AA 4DEPC 3IGAA 3L3DB 5I15L 5B8CC 4R7DA 5D96C 1HH6A 4G6KH 5C08E 2VTFA 3V5DA 4P5KB 4NJ9H 3T77B 3HAEB 4XNZC 4AIZB 4FTVD 3BO8A 2J12B 2Y72A 3MUGA 3TVMA 3DRTB 2H9GB 3WEXA 2ZSVB 3VXNA 4GRLB 1TZIB 1KLUB 2X1WL 3GMOA 2BVOA 4WO4C 1F90H 4H1LA 2V2XB 2C3WA 4TPRH 5EZOH 4D94A 3TP4A 1CLYL 1ND0B 3SGDH 4EUPG 4Z77B 4MD5A 5ADPH 1Z0MA 1MH5A 2VXVL 4HV8A 1CE1L 4WHCA 4AG4H 4LCCB 4HJ0C 4PBWD 1NCBL 4PYHA 3RU8L 4ONOA 3MRPA 3ZE1E 5EBLA 4K94C 4O58H 5C0AD 3V5KB 4K8RC 2OTUB 4UV4H 5E5RB 2R0WL 2R29L 1FO0H 3V7MA 3VG0H 3B8YA 5KVGL 2BCKB 3RVVC 5F89A 1BFOB 5IQ9A 1S9KC 3MRGA 3KHOA 4HXAH 5IW1A 1ACYH 1MCPL 3LY6A 1VKXA 1AQDB 4JPKL 1DQDL 4P2RA 1IJ9A 3GMPA 4M7LL 5GJSH 2J8OA 3HZKA 3N85H 4WJ5A 1FH5H 1PAMA 2NXZB 2NCMA 1VEPA 3K3QA 1WTLA 4ZOEA 3DVIA 1DZBA 4TSBL 3C6LB 3IXAB 5T3ZD 1LO0L 4AIOA 3ARBA 2C7UA 4JVPA 2CK0L 2RFXA 1FFRA 3DROB 4R26H 3EKCA 3S96B 2DLHA 2UZXB 1IZJA 3K1KC 1CD1A 4QRPD 4AK1A 4I48B 3UDWA 5HHNB 1S5HA 2DD8H 4F7CA 3QDME 1JJUA 3U0WL 5CJQH 5LWYH 3LKPA 4YH6A 3HI5L 4Z78B 1JGVH 2W59A 2A6IA 1CGSL 4PV8B 1PSKL 4U3XA 1H3GA 4ZFOB 4G8EB 1WZ1L 4U6VL 2ED9A 1GAFL 3VH8A 4GAJL 4HWBL 4BZ1L 4X6EB 3OX8A 3JWNC 3SO5A 4N8VG 3BEVA 2MSPA 5HTSA 3VWKD 2DM3A 4FQCL 1LDSA 4M8QB 5HHME 1T2QH 3AAZA 4OLWL 3QQNA 2XN9E 1GPOL 5KS9A 3HFMH 1G6RA 4G7VH 3TZVC 3U0PA 3X14B 5J57B 2FHFA 1NC4B 4XPGL 1NGZA 3SGEI 5KANI 4KV5E 3SKOB 1S7WB 3JUYA 5C0FB 3BN9D 2XQBH 4NKOA 1D9KD 4PJGE 3T0EA 2FBJH 1ZWIA 3C09C 3DETC 3LPWA 5C0IB 4BFIB 4E41A 5CIPH 3RAJH 4Y4HB 3V6FB 1Q38A 3FAXA 4V1DB 1MVUB 4LLQA 5HHXL 1YC8A 2LU4A 4NNXA 5E00A 3NIGE 1IAOB 4J3OC 1WAAE 4LCWA 3TLRA 4ZOBA 5JDJA 4PTTA 4GW1B 2OZ4A 2R2BB 4QGYA 4KKAD 1ED3A 4HUNB 5DJCA 5EC1B 4NQXB 3MRNA 3MV01 1JBJA 1C5BL 4IRJC 3HZMB 4C83A 3IFPA 3I02B 4QOKB 4OZGF 1MIEH 4X80H 5F7EH 4BSVA 3X13A 2OJEB 5BVJB 2QHLA 3MMEA 2Q3AA 1R3IL 4G9FA 3ARFA 4F8TA 3MGOB 5HHVL 1WVZA 1FBIL 2HT3C 1JMZA 2YD7A 4NC1C 4U1NA 3X11A 3PQYE 1ZT4A 2F53B 1MUJB 5FA4A 1IAKA 5BZWA 4FNLL 5BV7L 4X9GA 3C5JB 2NXYB 5DD3L 3AREC 3S3JA 3VXUE 3CLFL 5DJYA 3SJVA 4WGVB 4OD2B 1XGTA 1G9NC 1EAPB 2E27L 4JRWA 2BY3A 3MV9E 4P46D 4TVSa 4KJQD 4U1MB 5FYJD 3ZHKA 1YYLL 4NCC2 3UTZA 1XF4B 3BX7C 4HIHB 4D3CH 2V5SA 2W60B 4MDJA 1W0VA 5H8DA 3L3IB 1ZLSL 4Z7WA 3D6GA 4W6YB 5J11C 3BP7A 5C0JB 2MQ0A 2I24N 1IC1A 4TNWK 5D71L 1T04B 3SDXA 3PL6C 4Y4KB 2WBJD 4NO3A 1HHJB 3BVNA 4OBRA 3BE1H 1FFOB 4K23H 4CADA 3PV7A 3LH2L 5JO5B 3BH8A 3O45B 4G6AC 4OCXH 1VADA 1YYML 4O2FA 5D8JL 2X2YA 4JFEE 2GKIA 3ZO0A 2DM2A 5C1MB 5SWSB 3QEQA 2BXZA 5EIVA 1GL4B 5JOFA 4LKCA 4HF5L 3QFJA 4BSWB 5DQJA 1YNLH 4UTBL 5CP7B 2H41A 5HVHC 5HHOD 3EYOB 1D7FA 1U95A 4AEHH 3HAEH 2EIZA 2OQJB 1NANH 4FZEL 1KC5H 2A9ML 1BZ9B 2YD4A 5C07E 3JV6B 5BS0E 1RUQL 3AU1A 3F7PC 2IAMD 2Z8WC 3KPQB 4YDIH 5D96B 3S36X 4PJEE 5B8CB 2FGWH 3ZMRA 5JIPA 2BK8A 5TDNA 3WIIL 1S5IL 1H5BA 1QFPA 3C08L 2M8XA 2EYSB 2QBWA 2NY3C 4QHUB 1LO2L 1EFXA 3KXFA 5EWIH 2FZ3A 1KJ2H 3QAZB 5EORH 2R0ZH 3MLZL 4QY8A 1OQOA 3GSXB 5I19H 3LN5A 3MLXL 4MCYB 1R24B 5HI4D 3WFCH 1Q72L 4WFEE 4CAGA 3UPRB 3QT2A 1M05A 1A6TA 4KFZC 3MUHL 4P3WA 3BRDA 4L4VD 3K0WA 1I3RB 1QSVA 5ICXA 4ZTPL 3O3EB 4LRNL 3VRJA 1MHCA 1KT2A 1JF1B 2APXA 1EBPA 5AZ2L 1CTOA 1EX0A 1DE4A 4I18C 3IDMB 3EAKA 3L9RA 2BNQE 1NEZA 4DAGH 3OG4B 5L6YH 3X3GL 3VXPA 3HPJA 3UJIL 1TENA 2Y6SD 4F7MB 3ALPA 5E6IA 4JRYD 4BKLA 4PJ9B 1CI5A 4F2MA 5D1XC 3QULA 4KUZL 4H0HB 3U1SH 3QH3B 3KPPA 3T4AA 3QIWB 4OCYH 4BSJA 1LP9E 1JTPA 5GS0C 4MD0B 1J0HA 1TLKA 4P0DA 3BT2L 5DUML 5DVKA 1MCDA 1CWVA 3PV6B 3OKMA 1AH1A 4RGMC 2BVPB 1FZOB 2FYYB 5GZOD 3ZHDA 1TTUA 1DCLA 2JCCE 5F21B 3RGVD 1MLCB 2J4WL 4C4KO 4RMRA 2YWYA 2G9HB 5HJ3B 3V0VA 4WV1C 4OD3L 4DK3A 2IPUK 2WSKA 5HYSA 1PZ5A 1Q9OB 4HPYH 4JM2D 3SKUD 1CQKA 4RDQF 1TNNA 1NFKA 5D2NA 1U8QB 3UYRL 2EECA 4YE4H 4RDQG 2CGRH 5EBWB 4N8CL 4W6XB 3MLWH 5JHDD 2ICWI 1L9NA 1NAMA 4JJHA 2MCG1 3D1MC 4NFBA 3BP6B 4IRZH 4P3DB 5C9JB 1XF3B 3CSYA 1IBGH 3H9SB 4IRSD 3JVGC 2JIXD 1KIRA 3WNMA 3FB7A 2G60H 2R56L 5IBLC 3TZVB 4GAYA 5CSZA 1GVIA 5MEOA 1FNFA 3JTTB 2F54D 4JY6A 1BX2B 2Z35B 3RQ3A 3NCBB 4JANB 5I1LA 3REVB 3P30L 3AMKA 2YPLD 3C09B 3WKML 1SHMA 1LO3L 4XMLH 2WINA 1F4YH 3IDIB 4U0RC 3QXVA 3NZ8B 1F13A 2EDHA 1QFWH 2UV3A 3GMMB 4XCCH 5HYJB 1P7QB 2UZIH 5DD6B 3GB7B 4LEOA 3MV8A 4JREC 1TETH 1DFBH 4P2RE 5IB2B 4RGOH 2X41A 4HGKC 3W0WD 4KZDL 2Z8RA 4U33A 3FHAA 1WBZB 3WDJA 5MERA 1SJXA 1H9VA 1MCRA 5F9JA 2DOCA 3KAAA 5K9OB 1XCTA 3HUJF 2MPAL 2J88L 5DRWA 3FCTB 4PJ5A 3W9DA 1TDQA 4OLEA 5KN5A 5IF0B 4L8CA 4RFNC 1F4HA 1KPUB 1BF8A 2P7TA 3UC0H 2O5YL 3AREB 1P4LA 3U4EB 1X7QB 2X7LA 2OM5A 2CDEB 2YSSA 2RQ8A 1MELA 1M7IA 2P5WD 1EO8L 2LTQB 4G6MH 2BVUA 1UKTA 5FECB 4EN3D 2APBA 1Q0YH 2C26A 4EOWL 3OHXA 4IM8A 2W91A 5DD5H 3TV3H 3EIFA 3RFZC 2V2WB 1F3JB 3NACH 5KS9E 4G6KL 2R2HB 4MVBD 3VFRA 1U8LA 3PL6B 4N0FB 4LSSH 1BVZA 1HSAA 3G5VA 3DJ9A 4QYOA 3FQNA 1CK0H 1RZGA 3T0EE 3FRUB 4KDTC 5CEZD 2HLFD 4JJ5B 5B38G 3ARVA 1F90L 4RNRA 4E41E 4TPRL 2BNRA 5EZOL 1YEDA 3OAYK 2FATH 5ADPL 1P6AB 3SKJH 3M1BB 5JPNA 1S9YA 2PO6D 4AG4L 3OR7B 4NO2A 4U1HA 3HC3H 3FFDB 4QRUB 3G6JB 5C0EB 3G04B 4LCWE 5HVHB 4ODXA 1J8HA 4BM7A 2W0FA 3KPLB 2CR6A 4XVUC 3F8UB 5F8RC 4BUGA 1LEIA 1QLRA 1KCVH 2YRLA 4POYA 2BHYA 4UV4L 4FABH 5I75B 2ZCHH 3TA3A 1FO0L 3V7AE 3VG0L 2Z31B 1BWWA 4GT7A 4K7FB 4G9FE 4L3ED 3UPAA 5JPMA 3K46A 3H0TA 3TIDA 3L7EA 1ZLUH 3O3DB 5DQDH 2BX5A 1FJ1B 4HXAL 1ACYL 3IJHA 1BP3B 3P0VH 1TVHB 5I74C 4J3UA 3SJVE 5GJSL 3B8SA 4GRMB 3IFNH 4MJ4A 1FH5L 4ODUA 1Y18A 1G7JB 3VFPB 4WU7A 1QTYT 3MPCA 2VMFA 2E3VA 3VWJD 5F3BB 4NUJA 1BJ1H 1UEMA 1CFSB 3T0DA 3UTTD 3G5XB 4QXUH 1I7ZB 4I18B 3G08B 3DUHA 4WIQA 3ROOA 1RUKH 4Z7WE 3B6SA 1ES0A 1J1PH 2ITCB 3VFVA 1I9JH 5CJQL 1I75A 5D2LA 3SDXE 3LEXB 5LWYL 1JGVL 4QXTB 1KB5B 2WP3T 1QRND 2XG5A 3WUWG 2A74B 4DZBB 4NCDA 5DFVD 3EHBD 2P44B 5KSAD 5INCA 4WEUD 4L9DA 3QEQE 1T2QL 3CGTA 2BOCB 4Z7UF 3ARSA 3HFML 3QFJE 3RDTB 4G7VL 1SJVA 2IQAA 3BQUA 4PGBB 3KYOA 3BZFB 1H8SA 1NJ9A 2J7LA 5MENA 3UTSA 5GISH 5HDQL 1BQUA 3L5WA 5GGUB 2XQBL 5ESAA 3CPLA 3OAZH 3WHXA 1IGYA 2FBJL 2R39A 3MCKB 4UQ2B 3W9EA 4NN5C 3FOLB 4P2QB 4P4KA 3RAJL 2HG5B 3U30C 1V3KA 1DLHA 3QWQB 2EDWA 5ETUB 2F74B 2GI7A 5IMMA 4XWOC 3CFJB 5HGDB 3STBA 2AP2A 2VZ3A 3LKQB 1T5WA 5FO7B 3GMLB 3KXFE 1TZHA 4OFIA 5IEHA 3P11L 1JZ6A 1DANU 1OAUL 3H7LA 2LVEA 4QRSA 3F62A 3DX8B 2ZCLH 1CIUA 1WITA 1J0ZA 4K3GA 4UQ3B 3FB8B 2EC8A 4XP9H 1IM9D 1T4KA 4HEPG 4X80L 5F7EL 5E8NA 1AGFA 4R4BA 4Y5YB 1FL6A 2BC4B 2A6JA 3EZ8A 5BO1H 3NTCH 3KPMB 4X4MA 4WEBL 2CDGB 5FAAA 3CDYA 1MVFA 1DP0A 4L8BB 3ROLA 3K4AA 4JO2H 3SDDC 1JGEA 1JTOA 2NY5C 3SDAC 5I71C 1GZPB 3CX5K 5C2BH 3EDFA 4PIRF 2Y4SA 1T7VA 3ILQC 1OSPH 4KJPD 1WIPA 5D1QA 4F57H 4S0TD 3MJ9H 4NT6A 1XZ0B 3BEWA 3R06A 4G8GA 1BQHG 5ANMA 1XGRB 3VFMA 4JREB 3BESR 1LE9A 4D3CL 2XFXA 2Q86B 4NQEA 1YY9C 4MAYA 2ZCKH 3PXHA 4KK5C 1ZANH 4HCRA 1CVSC 1OGTB 4RRPA 2ID5A 1MJJA 5T1MA 5D7JD 2EXYD 1QSEA 4N5ED 3CIQA 4F7TA 1X5LA 2WBWB 2X4NB 3BE1L 3A6BH 4V2BA 5TE6H 3WSQH 4ETQB 5IQ7H 4AEFA 3D85A 5K59E 3CZJA 5FOBB 2OL3H 4PRIB 4Y1AD 3H3BC 1DBBH 4QHKJ 1MHEB 3M8OH 5D2NE 3LB6C 2BVQA 1NDMB 4HDIB 4JKWA 1WISA 1MJ7H 2NY7H 1YNLL 1Z9SA 3E6HA 4HG4K 4FQXC 5L0QC 4ZUUB 4OF8A 1Z2KA 1JIBA 3QDGA 1F8TH 1KC5L 3WN5C 5F96L 4XP4H 2NX5A 3QEHA 5D7LD 4YDIL 1JPFB 2FGWL 4LLMB 2I9LA 4FQQB 1A9BA 3Q6GH 4J4PD 3F7YB 5CJXA 3WFEH 3X12B 4OM1H 1HNFA 2V9RA 3K74B 5T5FH 2GK0A 2W9DH 2HRLA 4X98B 2FJHB 2J8UA 3HG1A 4UZGA 2PCPB 2RAMA 1KB9J 2DI7A 5HDBF 3C8DA 5EOTB 5L8KB 3SCMD 5I75C 5I19L 4P5KA 4LSPH 4OI8A 3WFCL 1LE5A 1RQ5A 5B22A 4GLRH 1HI6A 1LNUA 4KKCD 3VFSB 5CHNB 1V3JA 2H9GA 1Z3GH 1AO7D 3UZVB 1OP3H 1TZIA 3C6SA 3MV8E 3CH1B 1KLUA 1CDUA 1M71B 1ND0A 3QQ9D 7FABH 5IKCB 3RWGA 1YZZA 1NSNH 5ENWB 1EJOH 2MTPA 3EO0A 3IJYB 5L6YL 1DANT 32C2A 5E9DD 4AIXA 5J89A 4OLYH 4R96B 5IHUH 1DBJH 3QWOA 4PB0H 1NEUA 4PJ5E 3V5KA 3EO1B 2BMKB 4YHIB 1P4BH 1RU9L 2KH2B 4OCYL 3SE4C 2XTJE 5I74B 1E4XI 3MODH 4JO3H 3R8QA 4WFFE 2BCKA 5CGYD 4U1GC 1HXMA 1JPTH 1CICD 4NHUA 3QYCA 2MCPH 4CMHB 2WQ8A 4PGJA 4BH8A 1A7RH 2L7UA 1SY6H 3MA9H 4D9RD 1AGEA 1WFUA 5EU4A 1KXQE 1IZKA 2E7BA 4F33B 4HPYL 1ZS8B 5I8EA 1EXUA 3D2UB 1S7UB 5CFHA 4ZFOL 3QIUC 4JFFA 5HDOA 3O2WH 2YEZA 2P8LB 2CGRL 4JGMA 4QLRA 4YAQB 3WS3A 4EI5D 4RZCB 4P23A 5DD0H 1NAKH 1GC1C 4IRZL 3S96A 4DCQA 4C56D 1IBGL 2P5EB 4MNGA 2BNRE 2ICES 1TVBB 4N0YH 5KG9B 3ES6A 4E5XA 2G60L 3MQIA 1GGBH 3TFKD 3L6FB 4F9PA 1KIPB 1VPOH 4Y5VA 4G8EA 5F70A 3EOAB 3BKMH 1J8HE 3P4OB 3NN8B 2WUBH 1F45A 2YUWA 4KWUA 3ZYJA 1U3YA 2CUHA 1CU4H 1PX4A 4M8QA 3FO0H 2BY2A 4GXVH 4XB8A 5I16A 1NFIB 4M1GH 4XMLL 1BJMA 4O2EB 1AIFA 1K8DA 1MAMH 4XCCL 1WWBX 4ZQKA 2VERN 5ITFB 2D31B 2ITDB 2UZIL 3MYJB 4RQQB 4S1DD 3DX9B 1TETL 4KHXL 4Y4HA 1SM3H 1P53A 5GGTH 3KJ6L 3V6FA 3GUTA 4RGOL 4V1DA 2CRIA 3QCVH 4JM2F 3TCLB 4HBCL 2EDBA 2GSIA 3KS0J 4UI2A 4XI5D 1OAZH 2I60L 3F7VA 2AV1A 1OAYH 5DVNA 3TGXA 4GW1A 1JNHB 2X1OA 4PJFA 4M93C 2R2BA 4YHNB 1I3VA 3MRJA 5AYQA 2LE9A 3TO2B 1EEYB 4HS8H 2IBZX 4PJDB 3HZMA 5GS3A 4QOKA 5EU5B 3AB0C 3D39B 3UC0L 3SDDB 3CFKB 5I71B 3O2DH 2ATPB 2HTLD 2MWCA 2OJEA 5BVJA 4KI5E 3VXSB 3V6OC 3UPCA 4CVUA 4G6ML 4NPYA 1UVQB 5D2LE 3MLYH 5IB1A 4P5TD 5HYIA 4TTDD 1CZ8L 1MUJA 1HWGB 2PN5A 1Q0YL 1FHGA 2WIIA 5JTWA 5FM5M 3OKEB 4C58B 3VW3H 3DSFL 5LCVH 3TV3L 1I1AD 1CDCA 5DRZB 5T3XE 4PJBF 5GRYA 5HBBA 5EU6D 2NY2D 1MCSA 1FC1A 3UTSE 5MENE 4LSSL 3GSNB 1O7SA 4NCC1 5I2IB 3TBWB 4L4JA 4TRPH 2F8VA 3VFOB 4PRAB 1KIQB 1SYSA 4LK4A 1CK0L 3KPTA 2X40A 1NLDL 3GJFA 4YX2H 1A14L 2YD9A 4I5BA 4WWKD 2DQCH 1JZ2A 2X4TB 2J3SA 5HVGB 4EDWH 2IANB 4OZIB 3FN0L 4YNYB 2FATL 4NSKA 3SKJL 1KENH 4YJZL 3FT3B 1U8HB 3CZFB 4OZFA 4RMQA 1TCMA 2Q7YB 1VENA 5L0QB 3VGHA 4J3XA 1UEYA 5E56A 5MEPA 1MQ8A 3HE6C 3VWKC 5MHSD 1ZV5A 4KRNA 2PXYD 4XTRD 3TPKA 1KCVL 2CLVA 1ZT1A 2Z91A 4K7PH 4FABL 4HAFA 5F97E 1J1XH 4BSWA 4GKZB 1QBAA 3BN9C 1D9KC 2DMBA 3EYOA 1OB1A 3T4YB 3VRLE 1BM3L 4NNYA 1CGUA 4X4ME 3TWCH 4PBVC 1OTTD 2IH1A 5GJTL 2HH0L 5DQDL 4PP1D 1K8IB 1JTTA 5DS8A 5I18H 3P0VL 5EO0A 4RMUA 2W92A 1T2JA 5D5MB 4WUUD 4K94L 1H3PH 2OLDA 3IFNL 3IDJB 1EGJH 5D7KD 3SGEH 2R23A 3I9GL 3NCJH 3TNNA 5ACZB 1YMMB 4G8GE 4NN6B 5ANME 1PKOA 3CFBA 3ZYZA 4WO4A 3H7BB 4QXUL 3UBXA 3ARDD 2AXHA 4NQEE 4OB5H 2YR3A 1R24A 4M6OH 5DFWH 1RUKL 1DTUA 1R5WA 1J1PL 5J1AB 3MO1B 5F7LB 4OLZH 3P9WB 1I9JL 1QSEE 4AMKH 2DL2A 1JF1A 2AEPH 4KQ3H 2DB8A 4NQDB 4OFYD 4OIAA 2BOBA 1DQQB 2GUOB 3QO1A 4L5FH 2GCYB 4OUUA 4P46C 1VEOA 2D3VA 1TZGL 4U1GB 4KJQC 3ME0A 2WW8A 3TO4B 2W1NA 1A7PH 1XIWC 4HC1L 4LP4A 4NO0D 1UM6H 5CD3B 1NPUA 1PDKA 6CGTA 4M43H 5IR1A 3PWLB 3GZKA 3QDGE 3OKYA 3HLAB 4BQBA 2MNUA 2NX5E 1N5AA 4PJHF 4IDJH 4NRZA 3WFHB 1RZKC 1FZOA 1TQCB 3QIUB 1NBQA 3KYNB 4OZ4A 3EFFA 3QNYB 4X5LA 4IMKC 2GYSA 1GRWA 1KEML 1RZJC 4OFVA 3T3ME 3P9MB 1OD9A 4LAJH 3V52H 2J8UE 3HG1E 5DJZB 2X1XR 5DRXA 4XZUA 4HC1A 4M61A 1ZEAH 5A2LH 3ARQA 5TFSH 2O61A 4P3CH 3L5JA 1UXWA 2HLAB 4PRHD 3NABH 4KXZI 4CVXA 4NKMB 1M6OA 2ZOKB 3LZFH 1VACB 4XP9L 4UBDD 5CBEA 1HYSC 3B83A 2VAAB 3O8XC 4LBEB 1A6ZB 5C9JA 3MNWB 2FJGB 1QSFA 4U7MA 4D0BA 4EEEA 3KWWA 4ZFFA 1SYVA 3DMMC 3NTCL 2IAMC 3O81A 4JHWL 4HJJH 4MXVE 4JO2L 2CKBB 2R0LH 4LHUB 3TZVA 1AR2A 4UDUB 5C2BL 4XX1E 1VFBB 4HZLA 5DZLA 5IB4B 5IESH 1L6XA 4RX4D 1FYHB 4F9LC 1OSPL 4MAUH 3E0GA 4F57L 2Z35A 3BGMA 5DSCB 4JANA 3BXNB 1YEKH 3HRPA 1CN4A 2JJWA 3MBEB 3LS5H 4MJ5A 5KJRH 2VLRB 3GDBA 4XCNB 3BPLB 4DOHE 3CFDA 4WVRA 2ZCKL 3U4AA 4KK6D 4MZ3A 1B0GA 2PTTB 4X99A 3GMMA 3GSRB 4K3EH 5C0AB 1PG7X 5I76B 2NY5H 3GB7A 4U3CA 5IB5B 3U6RA 3T2OA 3V0AC 1G7LA 3A6BL 5TE6L 1P1ZA 1OHQA 2C1OA 3WSQL 4WI9A 4IRJA 5IQ7L 1KTDA 3DGGB 1BZ7B 3AB0B 2OL3L 4XNYH 5FGRA 5L2KD 1DBBL 3M8OL 4JFFE 4XVJH 3GIZH 1G0DA 1WTGT 3O3BA 5EIQA 3FN9A 2VDNH 1MJ7L 1KYOK 2NY7L 4UMGA 3WXWH 4J3VA 2E7CA 3G9AB 5IF0A 2D9CA 2GJZB 3AREA 5ALBH 3S35H 1T5XA 5DEZA 3U4EA 5JXED 2B8OT 4MNGE 1F8TL 3U46B 2DDQH 1GXEA 1CFBA 4GSDH 5GZOC 4XP4L 4Z7OF 2FEEL 3BIKB 1C1EL 1K5NB 4LDLB 3RGVC 5FECA 4WTZG 1BVLA 2MJWA 5MI0C 1LEGA 2Y23A 1HDMA 1A7QH 3Q6GL 1SEQH 3EYVB 5KVDH 1ZGLB 3RWEB 4OM1L 2QQKH 5C0BD 4QGTA 1ZT7B 1J05B 5T5FL 2W9DL 3QP3A 4JZNB 4JHBA 2D2OA 2I9TB 2OR7A 1KLFA 1J0JA 1F3JA 3CU1A 1JHLH 1NC2A 4M6NH 4HUUB 5FEBA 4HKBA 3HCVB 3B9KD 4LSPL 4PJAA 1UB6A 4LVOB 3OG6B 4UV7L 3MJ7B 5KANG 5J3HC 4OAWB 2Y5TA 1LEKB 2J2ZA 3ARGD 1Z3GL 1OP5K 2P8PB 5EOQH 3HE6B 3THMH 4NZTH 3FRUA 4HLZG 5IMKB 4JJ5A 4NKDB 1BQSA 1RI8A 4OZHB 5SX5K 7FABL 4V1DE 2NYYD 4RAVA 1NSNL 1EJOL 4D0DB 1ZHLA 3PXJA 5CD5C 4G42A 3QO0B 4NQUA 1G0YR 1ZE3C 4QRUA 5C0EA 1D9KB 2VKWA 2NY1B 4DVBB 4KUCD 1DEEA 4OLYL 4PJFE 5IVZA 4HXBH 1TJHH 5IHUL 4PB0L 3SOBH 4L8DB 4PJCB 5DI8A 2VLJD 4Y2DC 4UU9B 5FGBC 1AC0A 4LEXL 4QOKE 3WNLA 1P4BL 4Z5RB 2YMXH 3MODL 4JO3L 1TFHA 2W65B 1FVEB 1A7BA 4K7FA 1F4WH 1J0YA 3DECA 1Y6NR 1JPTL 2GK2A 1ZVYA 3AVEA 5HXMA 1U8KA 3VDBA 1FV1A 2NLJA 2MCPL 2X4PB 1U93A 4R3SA 5ID0B 1JYXA 4M6MH 1A7RL 3MA9L 2HJFB 4TSAH 1RV6X 4GQ9H 2WBKA 1S8DB 3PJSB 2QQNH 1JZ5A 4KRLB 4XCYB 4HWNA 3EZJB 2APVA 3GK8H 3RVWC 5DUBB 4AJ0A 1R3LB 4PGZA 4LCYB 4XHJD 5F3BA 4RAUB 2D4FA 3G5XA 4B7LA 2LV4A 5EUOB 4I18A 5I1HH 2AKRB 5B4MC 4Z6AT 1NFDB 1C8PA 1NAKL 4U6YB 3U0TB 3KPRD 4CU6A 4FQJL 2VIRB 2GJ6A 2J6EA 2DM4A 4N0YL 2CIIA 5DLML 5JR1H 1BGXL 1NGXB 1FNGA 2QTEA 3LEXA 1KLGA 1L0XA 4MJIB 1GGBL 1QEWB 3VFUA 1JVKA 2YC1B 1JNNH 3RWJB 5D1XA 1KB5A 1ZA6A 1XIWB 4NQTA 1VPOL 3ARRA 4DK6A 3BKML 1XGPA 1LK2B 2ORBH 4DZBA 2WUBL 1S7TB 4ZTOH 2QQLH 1I8KA 3FB5B 5I9QC 4X4XB 2AXJA 4MVBC 3FO0L 4FQHB 3VI3E 4GXVL 5F7NC 1UWGL 4EUPA 4M1GL 3LKSB 1OSZA 4LDEB 1UG9A 4QXGH 5L9DH 3V9FA 2P43B 4JFPB 1KJVA 4IHOB 4JVUA 1N3NA 4WV1A 2XT1B 5F6IC 3QXDB 4G6FB 3MCKA 3HZYA 4UQ2A 3FOLA 3VGBA 2EH7H 3QZWB 4F7PA 5BZDB 1SM3L 4LPWA 1W2KT 3QCVL 4KRPD 1FSKC 4K9EH 2X9XA 3CFJA 1UADC 5HHOB 3DX6A 3LKRB 4FA8A 1OAZL 3O8XB 1FZKB 2VLKA 3OXSA 3TNMB 1UQSA 2VDLH 1KNOB 3DMMB 1PBYA 3JVGA 1Q9WB 2IAMB 1ODAA 2ESVB 3RIFF 4BQ8A 2HMID 4UQ3A 2DM7A 1GZQB 1BLNB 1PJ9A 1MHPH 3EYFA 4K2UH 3NA9H 3O2DL 3RVUD 2VN4A 1KFAH 4JY5L 5KVEL 3O6FD 3QUMA 4WHTB 1OP9A 2VH5L 1K85A 2BC4A 1BREA 3MLYL 1E28B 3L95A 3HE7A 1KJMA 4TQEH 2CDGA 3FRPG 4XNQB 2BSRB 3QUZC 1T1WA 5FUZH 3VW3L 1G7IA 3WHE1 4KKLD 1VGKA 5HI5D 3QI9D 1NUFA 3V0WL 3VWJC 4XXDB 5HHQA 4P5MA 1OLLA 2CRZA 1UB5B 5J06A 4WW2F 1SQ2N 4MX7B 5EUKB 3ULUD 3QUXD 3WFZA 3EFDH 3INUH 4HS3B 5TDPA 4TRPL 3TCXA 5FM8A 1CG9A 4YX2L 5F9WC 3RKDD 2DQCL 5DYOB 1OGTA 1W0YT 1D6EB 1W8NA 3KPSB 1G7MB 1FN4B 2DRUA 4EDWL 3C5SB 4N0CD 1VB9A 2CK2A 3RUGB 3WYRA 1KENL 4GG8B 4YBQD 2Y1VA 5IV2A 4ETQA 5FOBA 4PRIA 4DVRH 3IJSA 2R1XA 1MHEA 1U8NB 3ZE2F 4HKXA 1J11A 3ZLQC 4K7PL 4HDIA 4JHZA 1J1XL 3S9DB 1IC4H 5MI0B 1OOAA 2CLRB 3V95A 3VXTA 5HGBA 4ZUUA 1V8HA 1QSFE 5A40E 1NCUA 3CC5B 2GSGB 2ED8A 4JCLA 1A5FL 5B39B 5DTFA 4I3SH 3HMWH 3FO2A 3B43A 5I18L 1AJ7H 3PHQA 4R90H 3RWIB 4YHZH 3Q2CA 5JW5A 3F7YA 1H3PL 5F9DC 5IK3B 2X05A 2VXTH 3NCJL 4OZGA 3C8KA 2WZPD 2FJHA 2JIXB 2PCPA 2KZWA 1ZHKB 5ISZD 1T20B 4JPVH 2YK1H 3M07A 2FHCA 5HYEA 5IIEA 4OB5L 3VE0B 4ZODA 1CR9H 3PWVB 4OLVH 4HX1B 4MJ6B 1I8MB 1BOGB 3QUKB 4YDKH 3BAEH 4OLZL 4PRNB 1YN6B 3GSUB 3AS0A 4Y5XB 4ZYKA 5C08B 2FB4L 2XY2A 2YPLB 3OGCA 1YUHB 2AEPL 4KQ3L 5HD8C 4Y2DB 1BIIB 1X5HA 2P8MB 4L3CB 3MCLH 4Y88A 5JHLH 3IJYA 2YHGA 4L5FL 2GEEA 3CU7A 4KJPC 3CFCH 4X5XA 2EDKA 5INDB 3AS2A 4MNQD 43CAB 4NO5A 1K4DA 2JJUA 3MLVL 4GG6F 4NC1E 1MPAH 1A7PL 4Y16D 3KYMA 4FZ8H 2YPKA 2BMKA 5EDXA 1UM6L 2DICA 3F65A 4M43L 1QACA 2EDYA 3MXWH 2PW2B 4LPTA 2DQHL 2R1YA 1QZ1A 5D7JC 2BSSA 4I0CC 5C7XH 3KLAB 2EXYC 3LMJH 4IDJL 3DX7B 1F6AB 3FFCA 2I5YH 5DWUH 2ZOLA 2BJMH 3T04D 3GMNB 3W81A 2ADFH 4CL7A 3REWB 1XF2B 4EVNB 3RKPA 2X4UA 3V52L 1BFVH 5HI3C 3DVFA 2GITB 3WV0A 1ZS8A 1ZEAL 5F7KC 1S7UA 5TFSL 4P3CL 5KSVA 1WT5A 1HIMH 4PJAE 2Q76A 5FHBH 1V05A 3ZT5A 5E99H 3LZFL 4TUOA 4XAKE 1IGIH 3QISA 4RGNE 5DJXA 4BFGA 3IAQA 3QDJB 1G7QB 4L4TD 3U4BH 3CMGA 3IDGB 3TIEA 3ULVC 5EFIB 1YNTA 4PRDB 1UH4A 5IM7A 4J4PC 2R0LL 4ODSL 1QFUH 1Y6KR 2DYPD 1K3IA 4KH2A 3V6ZB 5IESL 3P4OA 3CVHA 4TNWF 1NGWA 1K2DB 3QDMB 4MAUL 3EJZD 1F3RB 3EOBB 2Z8VC 3H9ZA 4HQQH 3L5XH 3SCMC 1YEKL 3QDHA 3BGFC 4R97B 3VRIB 5IGXH 4HFWB 3LS5L 4PJ7F 5KJRL 5DQ9A 4CUCA 4KKCC 1FSKB 5F7UA 1BD2D 4LNRB 3QIBD 4JKMA 5FYJU 1V3LA 1QA9B 2R4RH 1MWAB 4X4YA 5HHMB 1INEH 1MLBA 4K3EL 5DR5H 2XN9B 2D31A 2NY5L 4JRXD 3QQ9C 3MYJA 3T8XB 1H0DB 5DEFB 1HHKB 2K9UA 1HH9A 2K3TA 4YFDB 1UZ6F 1JN6B 3RHWK 3WBDA 1S7XA 2Q7NA 1G9EA 1HSBB 1KGCD 1VFUA 4PJGB 4XNYL 2EDTA 3VFTA 5EBMA 43C9A 4XVJL 3O2VH 3VXQB 1RMFL 3GSQB 2HP4A 4JFED 4U1LA 4FFZL 3G5ZB 4AM0B 3IDNB 4PUBL 1O5DT 2VDNL 4FQIL 1FFPB 3WXWL 1EEYA 1CDGA 3BMWA 3JV0A 2DS4A 3SGJC 1KCLA 1TMCB 3NCYS 5E5MA 2AJZB 3VA6A 3QUZB 5DJ6A 5ALBL 3SDAA 3S35L 3O4LD 1OM3H 2GJ6E 3VXSA 5E2VH 3WLBA 4PLJD 1HKFA 1IKNC 4DZ8A 1UVQA 4TNVK 1DDHB 4M6AA 5EOCJ 4OV5B 4P4RB 1QG3A 5CLTA 1RJZA 1A7QL 4OTXH 5BQ7B 1SEQL 3OKEA 1TJIH 3JBG7 2O5XH 3OAYH 5KVDL 5IOPA 2QQKL 4GO6B 4EQ2A 4RMTA 4CDHA 1E4XH 3PGCB 2CRYA 1J0KA 3PQYB 5F9WB 4HK0B 4PR5A 3CJJA 4X7EC 5SWZB 1JHLL 4M6NL 4EI5C 1FPTH 1ITCA 2XWTB 1JZ4A 2AV7A 2YN5A 3VXUB 3ZT7A 3GSNA 3OB8A 5EZJB 2ZKHH 3TBWA 4AH2A 2VDMH 3ET9F 3PABA 3JTSA 2A83B 1XR9B 5EOQL 4NZTL 3WIHH 3MV9B 2X4TA 4AT6B 4QHLB 3LQAC 3RA7H 5HPMB 2KQMA 3ZZ1A 1N0LA 1TCRA 5E6ZA 2RB8A 1S9VA 3FQTA 5FHAH 3GRWL 4G3YH 4YIQA 3FT3A 5TDOA 5FO9B 3Q3GB 2VLKE 1X5GA 2EYTA 3EYQD 4FQXA 1U2HA 5J7CC 2OK0L 4YXLH 4HXBL 1I7UB 3SOBL 1ZAGA 3WN5A 3KR3H 5JIHA 5ITBH 2AQ1A 4KKNA 1DVFD 5MEQA 4NQVB 3Q5TA 4GBXD 4JFDA 4WW2C 4GW4B 5ABDE 1NUNB 2IPUG 4UT7L 3SGDI 3O9WD 3PP3K 4Z7VB 3T4YA 5FF6B 1A6VH 3GRWA 3KYKH 4MSWB 4ZUTB 5ACMA 3MLRH 3VD5A 4M6ML 2OTWA 4TSAL 4G8FB 4XI5C 4JQVC 1XF1A 4GQ9L 5GGRB 2OSLA 4YDLC 5D5MA 2ADJA 2V2TB 1EO7A 2QQNL 2V9TA 3GJEB 3IXTB 4PY7B 5JLZA 3GKWH 2CR3A 2X1QA 4LLAA 3GK8L 5C07B 4M7KH 5H2BA 4YFLF 4CMMA 5ACZA 3JZ7A 3L1OH 5BS0B 1A4KB 4PJEB 4JR9H 3C5ZB 5JIKA 5I1HL 1KBGH 2AGJL 3PF2A 5CEYB 4DUXA 4Q2ZB 4XXCC 3DVNB 2FJFB 5KVMC 4ZOCA 5FKPA 5DC4B 4TTDC 5FYLH 1SBSL 5HHPB 5CBAB 4Q9RL 5FYKU 3HMXA 3QUYA 1A1OB 1JNNL 4X0KA 2FO1A 2D7NA 4HGWB 4KUCF 1TIUA 1WV7T 1WICA 4PRIE 2ORBL 3SE4A 2GCYA 4ZTOL 3JV4B 3MRDB 3KPNB 2QQLL 4N90E 3DVGB 4OQTA 3GBMH 3MLUL 3OPZH 3GMRA 2QJDA 1U3HD 4PTUB 1GC1L 1CFVL 3EO9H 2HVKA 2BNQB 3GSWB 2PYEB 4QXGL 4JFHD 5L9DL 1Q9LB 1D5XA 4WWKC 2GIYA 7CGTA 3L7FB 5F8QC 1R6VA 3F12B 3O3AB 2XA3A 2NY6D 4AEIH 5A1AA 1R3JB 1A1NB 3CUPA 5F1OB 4M5ZH 3O0RH 1WCQA 4APQD 3AM8C 1UZ8A 2EH7L 3KYNA 4I3GA 1Q1JH 1IC5L 4J23A 1FIGL 3QNYA 4K9EL 1KEGH 1LP9B 4JKLA 4OGAD 3STLA 5EIIA 2R1WA 2HJKB 4XTRC 1G84A 2GAZA 4OZGE 2CKBL 5DHVB 4Z7QF 3MV7A 3SDYH 5BVPH 2JCCB 2XWJB 1BJ8A 4Z7NF 4MA8H 2D0GA 2NZ9C 2ZOKA 3MACH 2UWEF 3IGAB 3NA9L 4PGCA 1R0AH 4X6CF 4LBEA 4LQ1A 1A6ZA 4Q9CA 1R5VA 1WF5A 2WUCH 1VFOA 3I3EA 5T5NF 1ZGLM 1HH6B 1LQSR 2FJGA 2NY0C 3V5DB 4PP1C 3U7AA 3D9AH 5FA3B 3GM0A 5T1KB 5T5NG 4Y4FD 4XPFH 4TQEL 5SV3A 1H5BC 3BO8B 3RZCD 3MUGB 5AAWA 3TVMB 3BGFB 1MWAH 4G7YH 3WEXB 2CKBA 4FTVA 4MQ7A 5FUZL 1T2XA 4UDUA 4AQ1B 1OAKH 1I1YB 4DUVA 2B0SH 3GMOB 2BVOB 1S7QA 4H1LB 4PREA 5DJ2A 2X4QB 5ID1B 5TF0A 5HY9A 4XBGA 3FT4A 1AHWC 3BXNA 4G5ZH 4HV8B 2PW1B 1N0XH 5DA4A 1XGQA 3EFDL 3INUL 5JIIA 3MRPB 4RWHA 5C0DA 2IBGA 5EBLB 3WUWA 3MFFB 1P4IH 4F8QA 2DIBA 2PTTA 1AKJD 4FQ1H 1UM5H 3GSRA 4FFWD 25C8L 3FFCE 4JO4H 3T0ED 5C0AA 5I76A 1JZ3A 1NUGA 4TULH 4GH7B 5AD0A 3IKKA 5GGVY 5IB5A 4F15C 4ZXBD 3LV3A 4Y19D 5MP6H 2AJ3A 1GIGH 4NRXA 4Z7UA 2FBOJ 3DGGA 3ELAT 1MEXH 5IQ9B 3MRGB 1VFMA 4LCWD 1RK1A 1UH2A 3V6OA 1VKXB 1O7VA 4POZD 2FIKA 4U7KA 3MRIB 4P2RB 5AAMA 2GFBA 3GMPB 3ZSSA 1IC4L 3CXHJ 3MROB 2IADA 1KULA 1KPRA 4WJ5B 5J12C 3NIFF 4WU5A 4IMLA 5IBUG 4ZD3H 1L7IH 2DMKA 4LHQB 4G9FD 1RZIA 2DLEA 4JY4A 3ARBB 4XH2A 1EA9C 3OKLA 1MCWM 2RFXB 3BIKA 2AQ3A 4I3SL 3HMWL 3MLPA 1AY1H 1AJ7L 4R90L 4YHZL 4WWID 4K7PX 4CBPA 2X44D 1CLOH 1ULVA 2A38A 1ZLUK 1S5HB 4F7CB 3ARUA 2VXTL 3BYYA 4KMLB 1HCFX 5HGGS 4G9DB 1PY4A 4Z76A 3ULUF 2HWZH 3I85A 4JZNA 2XQYK 2BVTA 2A6IB 1NMCC 2AK4D 1TPXC 4JPVL 2J8HA 3DBXA 4UBDC 2YK1L 1FRGH 2D7TH 3EYSL 1NANI 3VH8B 3C2SA 1CR9L 3MJ7A 4OLVL 2W38A 3BEVB 4KC3B 4OAWA 4BQ9A 2WWKT 5KVFH 1RZ8A 2VL5A 4MDIA 3AAZB 4B0MM 5KS9B 3VWKA 2MHAA 1G6RB 1IAIM 3ARWA 1NGZB 4MCZA 1B6DA 5D4QA 3PGDA 4KXZH 4UAOB 3MCLL 3NIDF 5JHLL 1T1XA 3MCG1 3QO0A 3CFCL 5EZIH 1D9KA 1KCSH 1ZWIB 4ZSOA 2P45B 4E41B 3WHE0 1MPAL 1AD0A 4KTYA 1NCNA 1ZGLP 4FZ8L 4WHYH 4LLQB 4UU9A 4JAMB 4NNXB 1KYOJ 3QFJD 3VGFA 3LN9A 2AJSH 2XZCH 1VFAA 3NFPA 3MXWL 5IBTH 4KK6C 4Z5RA 4PTTB 2OMNA 3VXSE 2W65A 4PJ8D 1FVEA 1ED3B 5DJCB 1OTUD 1V3MA 5C7XL 3W2DH 3LMJL 3MRNB 3B5HA 4PD4K 4C83B 5EU3A 3IFPB 2I5YL 1YEHL 5DWUL 3HNTH 4PPTA 2X4PA 2BJML 2ADFL 5ID0A 4BSVB 3OAZK 4EZMA 2AW2A 1WBXB 1FE8H 1S8DA 3B3IA 1ZT4B 3TJHD 4I0PD 3SKMB 5FA4B 5DUBA 5BZWB 1R3LA 3AROA 1HIML 1DR9A 5FHBL 1FAKT 4OLXH 4RAUA 4XPTH 4GJTB 4YGVA 5DJYB 5E99L 3SJVB 4JZOA 2IQ9H 4BZ2L 1FZMA 1IGIL 1NFDA 2V5YA 4U6YA 3QCUL 2PTVA 2D7PA 3RRQA 2Z9TA 3U4BL 5DK2A 3UTZB 4P46A 1NGXA 1W0VB 1GOHA 4X6DF 1C12A 1QFUL 1XIWA 4QKXB 3BP7B 5D1ZC 1KELL 4WWKB 3C60D 1S7TA 2DQJH 4J3TA 1ZVHA 3UAJD 2J5LB 3FB5A 5GGSY 4HQQL 3L5XL 2ENSA 1XAUA 3B9KC 4CADB 3WL9A 2WBJA 3HI1A 4KV5F 4JFDE 3BH8B 4LPUA 3G5YA 3SPVA 3PHOA 1S7SA 1VADB 5DHVH 4O2FB 1M4KA 3ARGC 3VJ6A 4IMKA 3OKOA 2R4RL 3QEQB 1INEL 5JOFB 5DR5L 4HK3N 3QXDA 2HTKD 5DQJB 4KROD 3I50H 3QZWA 4NZDA 1NCCH 3MXVH 4BYHA 5DRNB 3NIGF 2R15A 5D5ME 4XP6H 1U95B 1WAAF 3PWPD 2EIZB 4JPWH 5HHOA 1PYWA 3QQ4B 1ORSB 3BZ4A 3LOWA 5E2TH 4DKFH 1NMAH 4HWEH 3AU1B 3O2VL 3TA3C 3A6CH 1MRFH 1OAXH 2NY0B 4FQLL 1Q9WA 2IAMA 1INQB 4H1LH 1H5BB 1G7HB 3HNVH 2E9WA 4LASL 3G6DH 1BLNA 1LILA 3LCYA 1T22A 2WK2A 3LIZH 1EFXB 4QRRD 2FZ3B 1EEZB 1OM3L 5E2VL 2DLFH 4WHTA 4TVPE 1UCBH 3QJHA 1SMOA 4F9LA 3MYZA 2B1HL 3LN5B 5E1AA 4P2OD 4OTXL 1A6TB 1IILE 1TJIL 5DZNA 5I1IH 5ICXB 1G0XA 2HT2D 2ZNXA 3VRJB 3VXRD 2M1KA 1H3XA 1MHCB 3ETBF 1KT2B 4XHJC 1N6VA 5JORA 1CLYH 2HKFH 3L9RB 1FPTL 2IPKB 2C3XA 3WD5H 4P48A 2ZKHL 3HPJB 2EICA 2CDFB 2VDML 5E6IB 4KTDH 2XACC 5DJ0B 5AG8A 3QULB 3QJFB 4PV9B 3RA7L 3RPIB 1D6EA 2OXHA 3KPSA 1FN4A 2R29H 3BPNC 3T4AB 3RUGA 2VITA 2N1KA 5FHAL 1CXHA 2H2SD 4G3YL 1OP3K 1A9EA 3SQOH 5J12B 4HJGA 5KAQF 4J12A 3CMOH 2WM0A 3BQUC 3MV7E 1WGOA 3HPLA 5FYKL 3KR3L 5KAQG 5ITBL 3V0VB 4PJ5D 3RGVA 2A73A 4IIQC 5HYSB 4HKJA 1RULH 5BW7C 1PZ5B 4OGXH 4X8XA 5D2NB 1I4FB 4P4KC 3T3PF 4JEGB 1A3RH 4JM2A 4QEGA 1QBBA 3VXOA 3TBSA 1A6VL 3KYKL 2CK0H 3KDMA 3MLRL 1NMCB 4KRPC 1NAMB 5E2WH 3SBWC 5JHDA 4FTVE 1S7RA 1G6RH 4QRTA 3CSYB 3OKDA 4N9GA 1LWRA 3RNQA 3ULSA 3GKWL 5JUEH 4ELMF 1KIRB 4M7KL 3ISWA 4IRSA 3EUUA 3L1OL 3TBYA 1KCRH 2JIXA 4JR9L 1ZHKA 4GAYB 4LLDA 3RTQD 3RVXD 1T20A 1C5DA 5JDSB 4LSTL 5CSZB 5E8EB 1WZ1H 4JB9H 4U6VH 4LVNC 5MEOB 1GAFH 1OGAD 4JY6B 1KBGL 3H8NA 3O6FC 4BZ1H 5J4MA 1T66C 2V5TA 4MJ6A 1I8MA 1I8LC 3SGKC 3CK0H 2F54A 5I1LB 4FQCH 4PRNA 2EDOA 5DDHA 4ORGB 3GSUA 5C0AE 3ZL4L 4XNMA 5FYLL 1B90A 1QHOA 1SBBA 2WINB 5A2FA 2YPLA 1JHKH 3MRQB 2BNRD 2OZ4H 2YWZA 4OCSL 5IWLC 4NN7C 1YUHA 5D7IF 2VSDA 2X9YA 4PJBA 2R9HC 4Y2DA 4Z7UE 1BIIA 3LKOA 5HI5C 3QI9C 4NQSB 2VDPH 1QLFB 3GO1H 4JN2B 1T83A 1J8HD 3P3YA 3V6OE 1FYTD 5FM5O 43CAA 2H45A 1MF2H 1R3KB 3QUXC 3OPZL 1YPZF 3EO9L 1ZHBA 5HHXH 2AERT 4J6RH 3W0WA 3RL2A 5B3NA 3RKDC 3T0BA 5F9JB 2E9IA 2NY4C 4KK8D 4AEIL 3H3PH 4GOSA 4NC2B 5DRWB 4M5ZL 4YPGB 1EJ6A 3O0RL 4N0CC 3W9DB 5T3ZE 3D48R 1C5BH 1FG2B 3DX7A 4PBXA 5I1KH 5KN5B 4YBQC 2P7TB 1Q1JL 4XPAH 4NM4H 2XTJB 1P4LB 1KEGL 5H35B 3SDCD 4AEEA 3A67L 2YSSB 5F7DB 4EVNA 5DMIH 4CN6A 3WFBH 4MB4A 5I6XC 5CGMA 3S8WA 1I1FA 2P5WA 3KHQA 1U9KA 3AXLA 4B5EA 5E4EC 5BXFB 3MFGB 3HR5A 4LLUA 4MA8L 5CEZL 3MACL 2IPTH 3SEPA 1R0AL 5KSBF 5D1ZB 4W4NA 5DO2D 3QDJA 4EKXA 3I75B 5GRVL 1X5JA 4OI7A 3D9AL 3VFRB 3D25A 3PWNA 4XPFL 1HSAB 3G5VB 4E42A 4QYOB 4ZPTB 3WJLC 1MWAL 4G7YL 3FZUD 5C09B 2FIRT 2XTLA 1BAFH 1PEZA 4U7SA 1S78D 4H20L 3ARGB 1OAKL 1X4XA 2LAAA 3O6LH 1FGVH 4GAGH 4ZSOE 4RNRB 4MQXC 1FGNH 4LVEA 4DQOH 4OV6F 1KN4H 1YEDB 3KLHC 3EDJA 4OIBA 3TH2T 5F1IB 1RJLA 5JPNB 1DLFH 1T03H 1DN2A 1N0XL 1T0NA 3LQZA 3RI5K 3T0WA 4NO2B 4U1HB 4XC1H 1JK8B 2PO6A 4N1EA 2W0FB 1RUPL 4P2YA 1P4IL 2UY6A 2PUQT 1DUYA 1NCAH 1LEIB 3QXWA 2KKQA 1QD0A 5F88A 2QV2A 1QA9A 4FQ1L 1UM5L 3K4DA 4JO4L 3TA3B 5TPWL 4HF5H 3T8XA 4TULL 1I1RA 3IDYB 4LIQL 1U41A 3IDUA 5MP6L 1AGDA 1GIGL 5BRZD 1JN6A 1II4E 5JPMB 1MEXL 1HSBA 5F93C 3TIDB 1AD9B 2AJXH 2WANA 3L7EB 1U8PA 3VXQA 3GSQA 1EDQA 2QADD 3FQRA 1B0RA 3IDNA 5JOEA 4KKBD 5IT2H 1OAQH 4PJHA 3WIIH 2DQTL 4ODUB 2ICEA 4ODTL 1NFDE 2EIDA 4WU7B 1J8KA 5DVOA 3QUZA 3LS4L 4ZD3L 1LO4H 3BJLA 4EBQH 4NUJB 3BZDA 3DYOA 3JXAA 3VWJA 5FYJE 4UIKL 1DDHA 2YA2A 3Q6FB 4ONHA 3UJTH 4OV5A 4P4RA 1MRCH 1Q72H 5HDBE 4M03A 1DL7H 2EDJA 1CLOL 2R4SH 4MXQD 4N0UB 4YHPB 3VFVB 5D2LB 4IS6B 5FGCE 3QNZA 2HWZL 3RJDA 4C4KT 4B7IA 4C59B 4RIRB 4HK0A 4P23C 2VL4A 5SWZA 2AXGA 3BPNB 1FRGL 2D7TL 1U8OA 4KK9D 5I8OH 1QRNA 4LPXA 5E7BA 2FEEI 4L8SA 5INCB 5EH1A 5KVFL 2EO1A 4YFEA 5KSAA 1XGYH 1IL1A 1ZMYA 2IQAB 3BQUB 2E6JA 3VFNB 5HPMA 3QNXA 4J3SA 3UTSB 2X4SA 4L29B 5DURB 3ILPB 3UEZA 5ESAB 5HHOE 5KZCD 1IGYB 5FO9A 3Q3GA 1VEMA 1NAMH 3NGBC 5EZIL 1GH7A 1KCSL 3HZVA 1BQLH 2DLGA 3BFOA 1J88A 4P4KB 4Y89A 2Q8AL 3VG9C 1DLHB 5IMMB 1RVFH 4MQTB 4GS7C 5L8JB 2GJJA 1NBVH 3I3DA 2AJSL 2XZCL 5IBTL 3E2HC 5EA0H 3V7AG 4HIIA 4NKQB 5IEHB 4NYLA 1I9IH 4ZNCD 4KI1A 1RJYA 4QRSB 1CYGA 3BH9A 4Z7VA 3W2DL 3UYRH 4LLWA 3WO4B 2P42B 3B5TA 1JHTA 3HNTL 1P6FA 1T4KB 2AAVA 5E8NB 1AGFB 4RA0C 5EZLA 4GRWF 1IM9A 1FL6B 2A6JB 2V2TA 1FE8L 4PY7A 2XZAL 4MLIA 4D9QD 4PJXB 3ROLB 1IQDA 4G43A 1JGEB 2R56H 5TH2B 3N0PB 2NR6D 4WTZA 1JF5A 1EHXA 4OLXL 4XPTL 4H8WC 4QT5A 4Z7WF 2GY5A 1F58H 5D1QB 5CEYA 1I85C 5SX4H 3JV5A 4NT6B 3BEWB 3R06B 4PP2B 4G8GB 5ANMB 3QQ3A 3ARZA 3SDXF 3CDCA 3VFMB 4GRLD 3KPSE 2DQIH 1FNEA 1LE9B 1BEYL 2XFXB 5HHPA 1T1YB 2YZ1A 3RUGE 4NQEB 3QUXB 1DN0A 1A1OA 1OD7A 4MAYB 4NOBA 1C5CH 4PY8I 4HFUH 4A6YA 1MJJB 5DK3A 5T1MB 2DQJL 4YZFF 2F19H 4M7ZC 4UUJB 2NY4B 1A6AB 1F6LL 3DVGA 4F7TB 5J13B 5D7JA 2JE8A 2V7NB 1QPXA 1G1CA 3MZTA 3FB6A 2D7OA 2DJUA 4PTUA 3ZDYF 2PYEA 4WTXA 1FVDA 5IMLA 4BFEA 1P5VA 3MRMB 2XZQH 2X9WA 3L7FA 4Y1AA 4GKSA 3EDDA 3F12A 5LAXB 3B9AA 3ULVL 2Y07L 4U31A 5I6XB 1A1NA 2J88H 2DJ4A 2MPAH 4NC0B 5TF1L 4UB0H 3I50L 3E6HB 1NCDH 5JHDE 2P4AB 1HOCA 3MXVL 3N1GC 1PFCA 2FD6H 5J9PA 4JZJA 4XP6L 5LGJA 5DK0A 4N5UA 5FYKE 4JPWL 3QDGB 4WFHE 5CMAB 2HJKA 1EO8H 2NX5B 5E2TL 2BZDA 1NMAL 3QEHB 4JQIH 5KBNC 4JFQA 2ZPKH 2NXZD 3A6CL 5FV2A 1MRFL 1OAXL 5D7LA 1D6VL 3C6LD 5I17B 2XWJA 4FP8H 2DQFA 3HNVL 2JJSC 3FHQA 3G6DL 1I7RA 4UINH 4J4PA 2GK0B 5I73C 2EE3A 2F54E 3LIZL 2J8UB 3HG1B 5GZND 1WBYA 2DLFL 5JW4Q 1UCBL 2BY0A 2YPLE 5FA3A 2EXWD 5T1KA 4CN4A 5GSRA 1QLEH 4PJBE 1LE5B 3N50A 3SCMA 5IW6A 9CGTA 1HI6B 1LNUB 5I1IL 1NEZG 1HQ4A 2VAJA 3C6SB 1I1YA 1QHPA 5ECJE 1AO7A 1LO5A 3MSPA 2X4QA 2HKFL 3RWGB 5ID1A 4HH9A 1IVLA 2H2PC 2PW1A 3EO0B 3WD5L 1C16B 1SVCP 4MQSB 3W0WE 5TQ0H 32C2B 4XPBH 5FYLE 1NC4D 1RIUH 2E9JA 4KTDL 3ALXA 4R4ND 3TYGH 3MFFA 3QWOB 1RURH 4ALAH 4D0CA 4Z8FL 4KAQH 3MRLB 3OJVC 4JQXC 4X8JB 2ZG3A 1MCHA 4OUOA 2N56A 4DOHB 3TH4T 4V1DD 2FL5A 4EDXA 3SQOL 1X6LA 3SGJA 1HXMB 1HINH 2H6PA 4XBPA 4P49A 4NHUB 2P5WE 3CMOL 1CICA 1VSCA 2YN3A 1U3HC 4BH8B 1IKNA 3B4NA 4MYWB 2BXYA 3MRIA 1AGEB 5ADOH 5EU4B 1V7ML 4ZFZA 3MROA 1EERB 1I9RH 5DJ8A 4J2XA 1RULL 1CDIA 1ADQL 2JJVA 4OGXL 5I8EB 1EXUB 2NY6C 1HYRC 1NQBA 4QHNA 1CLCA 1BIHA 4JFFB 5IJKA 3QDJE 1A3RL 4CGTA 3BIBX 4X83A 3WE6A 4APQC 3QG6A 2YEZB 1IGMH 1MJUL 1JGLH 1RFDH 3WS3B 2X89D 5JA9A 1JFQL 2F53D 5A43C 3I6KA 5T3XH 3FKUS 4P23B 5E2WL 3UYPA 4EI5A 4HUMB 5F6HJ 3S3PA 1G6RL 4DCQB 4YHYC 2EDRA 2NXYD 3ARYA 5L7XH 4MNGB 5JUEL 4C56A 5CEZE 1ZA3A 3ES6B 1UH3A 5E4IA 4G9DA 4E5XB 4HMCA 5CEXA 1KTLB 1EMTH 3IKCB 1KCRL 1B3JA 3OJ2C 1ADQA 1EHAA 4Y5VB 4JB9L 1HQRA 3QG7H 3FRPA 2JF1A 3TBVB 3CK0L 5GRXG 2VB5A 3NGBB 5HVFB 2GT9A 5I16B 3RZCC 1JHKL 2OZ4L 5TJWK 1AXIB 4LKXA 1W72B 2YBRB 4Y4KD 5HDQH 1AIFB 1K8DB 4WY7H 4FFVC 4ZQKB 1ERNA 2LABA 4WW2A 2VDPL 3E2HB 5DVLA 3QPQC 3GO1L 4HGMA 1Y6MR 2EDDA 1MF2L 2X4OB 3F58L 3GUTB 5SWSD 4PJHE 4YHOL 1RPQA 2GSIB 4Z95H 4JAMA 1EIBA 4J6RL 3F7VB 2AV1B 1KPVA 4JQVA 3P11H 4PJFB 1MCCA 4KVNH 4LIQE 5F1NA 2HT4C 1OAUH 4XWGH 4HUWA 3H3PL 3MRJB 4U1JA 1GHFH 4QNPF 5I1KL 2I26N 4ZXBC 2ED7A 4KJWC 1NGQH 3H6JA 4MA1C 4XPAL 4NM4L 4KVCH 3D0LB 3EGSA 5I66A 1AR1C 2E6QA 2CIKA 4HUXA 1WBXA 5AZEH 5DMIL 4DKAA 4NPYB 3SKNA 3WFBL 5I1DA 4K3DH 3MRHA 5IB1B 4XXCA 3ESUF 3CVIL 4POZC 2Q8BH 1KN2H 4WEBH 3SKMA 5C0GB 4X5WB 2WIIB 5SWZE 4I3RH 4HCRH 4P5TA 4WDIB 4M9PA 5K93A 1IEAA 2W0PA 5F7WC 1QRNE 4LF3A 4OFKA 4PGEA 2ENYA 5IVXF 3BUYB 2IPTL 4AL8H 5EU7C 5K9KA 4LPYA 2KPNA 1BJ1J 4DW2H 5EU6A 5FDWB 1HNGA 2X70B 3QR2A 3IFLH 4D9LL 1SYSB 3FN3A 3GJFB 4WI4A 4I5BB 1BAFL 1VERA 3S37H 2H26A 5ICYA 3O6LL 4GAGL 1FGVL 4LPCA 4WWKA 1FGNL 4DQOL 3I6LD 3TPUB 1CT8A 4PB9H 1IARB 1KN4L 4NSKB 3RVVD 4KDWA 1DLFL 4PJ9D 1T03L 3S4SB 3R0NA 3AM8A 4OZFB 4XC1L 2P47B 5MEPB 4RGNC 3QIWD 5IJVB 5F3HA 1ZVSB 1NCAL 3T2NL 4Z7VE 2PXYA 2CLVB 1ZT1B 2CUIA 2Z91B 5TGBB 4AYFA 2PF6A 3TBTA 5DRNA 1OB1B 4GG6A 4DEPB 4NNYB 3QQ4A 2AJXL 1ORSA 2IH1B 5F96H 2XNAA 4XMKH 1L9MA 5DS8B 3MRRB 1Q0XH 2DAVA 2XRAH 5EO0B 5IT2L 4FG6D 1CGVA 1OAQL 4Z7OE 4XNZB 4E9LA 1INQA 5C6WH 1G7HA 2DLTA 4XCEB 3BISA 4WUUA 4PJ8C 2GTZA 2R23B 3TNNB 2Y25A 3HTLX 3ZTJH 1EEZA 1LO4L 4EBQL 2ATKB 3CFBB 1J1OL 3H9SD 4WO4B 4I2XA 5CZKA 4YEFA 3UBXB 1CFQA 4QF1A 3UJTL 4DKDC 3B5GA 1M7DA 1MRCL 2Y7QB 1AHWA 4DFIA 4YO0A 3QDAA 1DL7L 1R5WB 2R4SL 1EFQA 4XVTH 1HZHL 1X4YA 4NP4H 2A2QT 3TJHC 1X6NA 1MAKA 2NPLX 5ESVA 1J7VR 4I9WD 3DRQA 3BKJH 4GW5B 4Q6IC 5T1LD 2BOBB 2IPKA 4LOUD 4WUKH 3QO1B 2PYEE 4OFYA 4OUUB 5I8OL 3VXMD 4KU1A 2C3VB 4Y1AE 2CDFA 4JO1H 1BECA 4XCFH 1HN1A 3T2QA 3DXAD 1XGYL 4IOFD 5DJ0A 5HYJD 3QJFA 2C4FU 4PV9A 3PP3H 1P7QD 2EE6A 3CFEA 2LQRA 3MRFA 3RPIA 3IFOA 1RU9H 4G8IB 4MA3A 3S5LG 5IR1B 5DHXB 2YD6A 2IG2H 2D4DA 4NO0A 3V6BR 4MMXC 4U6TA 3RL1A 1N5AB 4PJ7A 4BH7A 4NRZB 1NAML 5DXWA 1BQLL 1N2RB 4OZ4B 5D7LE 1AQKH 3EFFB 3ZKSD 1RVFL 3ULVE 4BQCA 4MNHB 1D5ZA 3DURA 1NBVL 4WEMB 2OI9C 4YXHH 4HPOL 1P84J 3AY4A 4OF5A 1OCWH 1INDL 5EA0L 5F9OH 5DRXB 4XZUB 4YHYB 4M61B 3VRLF 5ERWA 1I9IL 2O61B 3TN0D 1I4FA 1UXWB 5D93C 3UO1H 2HTKC 3OAUH 2FSEA 3IYLW 4KROC 4CVXB 1HE7A 1M6OB 5KTEH 4PRHA 5CBEB 3W11D 1ZHNA 4PJIF 3RIAK 4MS8C 1QSFB 4ZFFB 4D0BB 3KWWB 1SYVB 2AEQL 5TE7H 5IFAH 1AO7E 2GY7B 3OF6D 2FR4B 3LKNB 5JW3L 3SN6N 4GMSH 3MX0A 4OKDA 5E94B 3RZCB 4ODBD 5JDSA 3E6FA 5H37H 2B4CC 5E8EA 4HZLB 2NMSA 3PL6D 2XI9A 1N8ZA 1F58L 3GI9H 3HE7C 4KJYA 4ZUWB 1YMHB 3BGMB 4RX4A 5CP3A 5LKNA 2IGFL 4RRPG 4OFDA 4ORGA 2DQIL 4O4YH 4MJ5B 4CDGC 4P2OC 3I6GA 3MRQA 3CFDB 3ZE0F 2EZ0C 1RHHB 1YEJH 1B0GB 1C5CL 4X99B 1Q94B 2A0LC 2VZTA 4HFUL 4NQSA 1QLFA 1T6WA 4JN2A 3DLQR 2F19L 2V17L 2VLLA 4KHXH 3U6RB 2YD5A 1AP2A 1G7LB 1P1ZB 2C1OB 3KJ6H 1R3KA 1IQWH 4IRJB 1KTDB 3RHWF 5DEGB 4HBCH 3P0GB 4MA1B 4D9RE 4LL9A 3BKCL 1XEDA 2I60H 2Z31D 2XZQL 1GCFA 1N6UA 3MGTB 5L2KA 1WWAX 3O3BB 5JXAH 4YPGA 1RK0B 1HHIA 4UB0L 4OF0A 2WAHA 1FG2A 5CJBA 4PLKD 1NCDL 4JM4H 2H2SC 3MBXL 1PD6A 2FD6L 2YRPA 3TYFA 4P9HC 2ADIB 1T5XB 5H35A 5F7MC 5EOCH 5F7DA 4C56E 4HEME 1GGTA 4TNVF 4JQIL 3N1FC 3RNKA 2ZPKL 2Q3ZA 2N7AA 2OMBA 5EB9A 1BVLB 5DD1H 3GJFH 1PQZA 1CZ8H 1LEGB 1HDMB 3TT3H 1HCVA 1UT9A 4Q9BA 4TTGA 5BXFA 4FP8L 4J3WA 2Y9RT 3HAEG 3DSFH 1TNMA 4UINL 5J6GA 1A1MB 2YD2A 3LDBC 2C4FT 5C0BA 4FOMA 4PY8J 4OZFH 5J11B 5D1ZA 2DIAA 3MRCA 1NC2B 2Q1EA 3I75A 4HKBB 2P48B 1BOYA 4PJAB 1UB6B 4MXVF 5A2JH 1QLEL 4GKOA