3GK8H

X-ray crystal structure of the fab from mab 14, mouse antibody against canine parvovirus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
220
structure length
220
Chain Sequence
AVHLQGTELVKPGASAGVKLSCKASGYTFTNYDMNWVRQRPEQGLEWIGWIFPGDGSTRYNEKFKGKATLTTDKSSSTAYQLNRLTSEDSAVYFCARRGFHGSYSFAYWGQGTLVTVSGAKTTAPSVYPLAPAAGAAGAGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLADLYTLSSSVTVTSSTWPAESITCNVAHPASSTKVDKKIEPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 14 Light Chain
publication title Structural comparison of different antibodies interacting with parvovirus capsids.
pubmed doi rcsb
source organism Mus musculus
total genus 33
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gk8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gk8H02
3EOAB 3I75A 3MUGB 3FT4B 2L4OA 4JKWA 4MD4A 3DTXA 1QFWH 4WW2C 5I30L 5F88A 4IJ3C 4N90D 1OGAD 1D9KB 4B7IA 3IAQA 4L8BA 1TZHA 1ZEAL 3RWGA 3LN5B 2BNQE 1MAKA 4YHZH 3AMKA 1KEMH 1AIFA 1CDJA 4NN5B 4EOWH 3BJLA 3RWCA 1FSKC 4HWEH 4JZNA 1RULL 4YZFF 1RV6X 4Y19A 3ALWA 1RUML 3MJGX 1FL5B 5A16B 5IP4A 3IS1X 2HVKA 3GMNA 3RDTC 2HH0H 2ADJA 2RQ8A 5MERA 4J3SA 7FABH 1J5OL 4KDVA 1B3JA 1QUNA 2F58H 4HIIB 5FM8A 3MMEA 3QG7L 1JGLH 1PZ5A 3IFPB 3U9UB 1MFAH 3UDWC 1MHCA 1F6LL 3HZKB 2BOCA 4I1NB 4QRPA 3BIAX 2CGRH 3MGTA 4IBLT 2FR4A 3HI5L 3MRLA 1A4JB 3W9EA 1A7NH 2ADFL 1WWCA 4KUCF 3ZO0A 1GCFA 1WIPA 2V7HA 5DC4B 3BISA 1S7RA 2O5XL 5D6CB 4DGYH 5TE7L 1KB9J 4L3AA 4M5YL 4WRLA 3BYTA 1OTTD 1S78C 2RAMA 3GKWH 1KPVA 1VACB 2ICEB 4Y7MA 5GPRA 2VDKL 3PGDB 3QXUA 4Q9QH 4DTGL 3TT1H 3U0TA 4P4KA 4R96A 2CIKA 1A6ZB 4ONFH 4IIQC 2MHAB 3QDHA 1E28B 4WU5B 1ZT1A 3FQWB 4G3YL 5GS1A 2ICES 4D0DB 1GIGH 5HDLA 3I02B 2QKIB 2XXMB 2PTTB 3FFCD 3NFNB 1AR1D 4JO2H 5D8JL 4KI5E 5IB3B 2R0LL 2EYSB 4HUNB 1OQXA 3LIZH 1MCWW 3VWJD 5C6PB 4F58L 4BSVB 3K2UH 4N0CC 5I66B 4FQCH 2H1PH 1I1FA 2P43B 4MDIB 4C58B 2OSLA 1X7QB 3ZE1F 1JNLH 4HHAA 3SDAD 5KSVB 3HZYB 4FQQB 5TFSH 3D2UA 4RFOL 1VFOA 2C5DC 1KC5L 5D7IA 4C57C 4OZGF 4J23A 1MI5B 3AREC 4JZJB 4Q2ZB 4N8VA 3GSVA 5FKAA 1C5DA 1GZPB 2J6EA 4WFFE 3PNWB 1GGYA 4WW1A 1CLOH 3GMRB 3OX8A 4UDTB 1VGEL 4AH2A 2DQDL 4OF0A 4HFWA 5FYJH 4V1DB 3EO0A 1AKJD 1JF1B 4GBXA 2GY5A 5C09B 3TYFA 1CXLA 4QXUH 1C5BH 3VD4A 3IVKB 4HT1H 3NACH 4RISH 4PTUB 5E8NA 1SJHB 2XQBH 4K3EH 4PRNA 5HD8C 4CUCA 4ZS6D 1I8MA 3SDCC 5IIEB 2YWZA 3GI9L 2DD8L 4NQDE 3IXAB 4P9MH 3DUHA 1IAKB 2WUBH 2D0FA 2HYMA 1SEBB 1K8DB 1RMFL 2VR9A 1HKLL 4LRIC 3HNSL 4ETQA 2OQJB 5CJQH 1W2KT 3GK8L 2XG4A 4XNUL 4ZUWB 5I1KL 1KEGL 3FB7B 2FEEI 3Q6GL 1FGVH 2PYFA 1F11A 4NRXB 1NEUA 2Y36L 1T66D 4B0MM 4PGEA 4NWUL 5L6YL 3P0VL 3GRWL 2XZAL 2DMCA 5SX5K 3JV6A 4ZTOL 3U2SB 4GW4B 5ILTH 4K3JL 4OTXL 4AYFA 4TQEL 4L8DB 3GSOB 1P5UA 1A1NB 5EC2A 1T80A 4WGVB 4JQVA 4ZAKA 4XP5L 5D7JC 3G04A 2NX5E 1QO3B 2R1WA 4WHYH 1IGTB 5GISL 1BQHB 3QFJA 5KSUB 2OTWB 2NR6D 3MNVA 2CLRA 5EH1A 4Q6YA 2N56A 5KVMC 3ELAT 3MCKB 2R2BA 3MLYH 3DGGB 4KROB 1UH4A 4YAQB 3ULSB 1D6VH 4EZMA 3CFBA 2Q6WA 1JGEB 3KPOA 2FEDD 2HJLB 4DVBB 3LN9A 5DRNA 4DN3H 1MCBA 2WW8A 2YA2A 4PLJC 3O3EB 3LKNB 4L9LC 4NZTL 5MENB 3GSXA 3IDNB 3VFTB 2VQTA 2AV7B 4Y4HC 3I6LE 2BSTB 2ZOLA 3N9GL 1SM3L 2NXZB 1EEUA 2YA0A 3ULVH 3EDJA 3QIBD 5EZOL 3RWJA 2XN9A 5D2NB 4YHYB 5JDSB 1BOGB 5GS2H 3V5KB 3MV9D 4C83A 2IBGA 4CKVX 4HBCH 2X4QB 2IH1A 2DQGH 1BVKA 3V7AG 1O5DT 2K3TA 2E9WA 5FYKD 3HE7D 1B0WA 4XC3L 4X0KA 2HT2D 1RUPH 5IMMB 3SQOL 3S37H 1GZQB 5GGQL 2YD3A 4GKNB 3QI9A 2JLLA 5HYEA 5D71H 3C6LB 5J8OA 4CW1B 4GRLC 5BJTB 4UAOC 1ZTXH 2CDGA 5I76A 1CGSL 5FYLH 3GNMH 1MWAH 3C08H 1OAXL 3ROOB 1KCUH 2YC1B 1OHQA 3UTTA 4KFZC 2MCG1 5DRWB 3KJ4C 3ZSTA 3ARGA 2EC9U 5CBEA 5FEBA 4QXTB 5FYJU 3U30B 4N9OB 4ZS7H 4K3DL 4LLDA 1WCBB 2X5PA 4XNZC 1WZLA 3L6FA 3V5HB 2X4OB 1CXIA 1T5XB 4KK5C 2GT9B 5HHOE 9CGTA 3WN5A 4NM4H 1OF2A 2EDEA 5DHVA 4AIZB 1I8KB 3DETC 1KG0A 2ICCA 4OJFL 1QSED 3NN8A 4K8RL 1IFHH 5F1NA 4G6JL 4GG8B 4OQTL 3G6JA 4ISVA 1YA5A 4F7TA 2ITCA 3B43A 1ZT7B 1RHFA 5JQHC 4Y16B 1FRGH 4JLRB 4HKZA 4J6RH 1YEIH 1AO7B 4Z7WA 3O4OC 3KLHC 2R39A 4P59L 5EU3A 3C09C 4M62H 1PLGH 4ELMF 3BEVB 2E7LA 3FOMB 4M1CC 1IGFH 5F7EH 3B3IB 4X6EA 3RY6C 3SDDB 3VGDA 2DQJH 3EOTL 4ONHA 4XVTH 3QPQC 3VI4F 2UVEA 3GBNL 5C0JB 1YY8B 5EBMA 1U58A 2IMMA 3RZCC 3PWVA 4HD9A 3UJTH 3I50H 1JIBA 3RGVB 1J9CT 4HWZA 1CGWA 5EZIL 3P0YH 2P8MB 2EDTA 5DQJA 3V6OA 3QO0B 2B7DT 3JV5A 4KHXH 3IGAA 4S2SB 4PGJA 3SGDI 2JJWA 5I2IA 2LVCA 3T2NL 5AAMA 2Q76A 3C60D 3DVIA 4MQSB 4Z78A 3C2AH 4HGKC 3PDDA 1YYLH 3TBTA 2QJDA 1TJIL 3QIUB 3ARFA 3H3PL 3HAEH 3I6KA 5T1DH 4TPRL 5J13C 4K8RC 3I2CL 1LO0L 4L4JA 5E6IB 4WO4B 1OAZH 1CU4H 4OIBA 2X4PA 3P9MA 3BP6B 1E4XL 1RZKL 2RCSH 3KPNA 4J4PC 2BSED 1DQLH 5LAXA 4K94H 2JIXB 4YDLC 2W9EH 3TBYA 1EBPA 1J0HA 1N6UA 3MRGB 4KUZH 1MI5D 3QJFB 3MLWL 3B5HA 1N7MH 4U7MA 4OFDA 4S1SH 4FXKB 3P2TA 1INQA 4JM4L 2VDML 4L8CB 3OKOA 3RPKA 4FFVC 4MNQB 2FWOB 3RL1A 1WZKA 1MJJA 2KKQA 2XI9A 3VGFA 4HIXH 4QT5B 2X70A 5DR5L 1TVDA 2H2PD 1U8JB 4ZNEA 1KIRA 3PP4L 4IMLB 3ZDXE 3NH7L 4G8FB 3BZ4B 4D3CH 5CEXA 5HHNA 2DF3A 1R5WB 1TLKA 4UT7L 1I4FA 3R1GL 4ELME 3BRGC 4PJ9B 3X14A 4OT1H 2MPAL 3CUPB 1WZ1H 1X4YA 4M7LL 3L3OB 4B7LA 4IOIA 1FZOA 1JPFA 5JW5B 1LP9A 3O9WB 2O61A 1CE6A 1DBKL 4YNYB 2HLFD 1OLZA 1N8ZA 1KLGA 5ACLA 4Q0XL 1RZ8B 3QZWG 1MFEL 3N06B 3MV11 4Q6IB 1HIMH 2N7BA 5A2LH 3J7HA 4LSSH 5F7UA 4R97B 1JYXA 4GKZA 5IVNA 1MAJA 2C9AA 4EDXB 1SY6L 5D9SA 1FFQA 4X4YB 3KLAA 5BS0E 5IFAL 1RZKC 2LAGB 2VITB 5J3HD 3BH9A 1IQDB 1JZ2A 1FV1B 3HHRB 1I7UB 4K7PX 3T3PF 3KPLB 4YDJB 1MJ8L 4BZ1L 5TQ0L 2A1WL 3W0WE 8FABA 3UAJC 2GI7A 2MWCA 4PY7B 1L4IA 4YXKH 5KN5B 4PRPE 5EWIL 5EORH 2YD7A 4HKJB 4EXPX 1D5IH 5MEPA 1H5BC 1XGRA 3KDMB 4UV4H 4XCYA 1A4KA 2YN3A 4KROD 1S9YA 5DJ0B 2YMXH 4TRPL 5EBLB 5ACMA 3HPJB 4AENA 3TIDB 5D7IF 1AXTL 1IC7H 4JO3H 4ZDHA 3HNTL 4YK4B 2Z8SA 5E8PA 4U6XA 4WUKH 5E9DA 5F7WC 1DBAL 3PXHA 3NTCH 5CWSB 4JPWL 4LHUB 2Y06H 3ESUF 1GOGA 3QIWA 3WFZA 2NXZD 3C8KB 1NMBH 4NQDB 1MNUL 3MRNA 1TETH 1B0GA 5L8KB 2XPGB 5J1SC 1H8OA 1K3ZA 5EU5B 4OZFB 5EA0H 1UZ8A 4OLZH 3VFNB 4NCC2 4LFHD 2R4RH 4XMKH 2VUYA 4YFLF 1HK6A 3UPAA 3CXDL 4HC1L 3VFPB 3VFSA 1AD9B 4OV5B 4GMTH 4DAGH 3ZHLA 1R3JB 4RZCA 3P30H 4WFED 4LSQH 5ACZA 1XIWA 4DKAA 3C6LD 5AD0B 3X13B 5J6HB 1ZVSB 1MCHA 2WK2A 5HDOA 2Z93A 3ULUE 4LLWB 5DVKA 5HVHB 3KXFE 4ODUA 4YLQT 2W65A 3RVUC 3RNQB 5AZ2L 3FO0H 5DJDB 2VQ1A 3IDUA 5DYOA 4BH8A 3ORJA 5JXED 5DD3H 2NX5B 4PJCE 5HI4D 1WAAF 5HJ3A 4OLXH 2R2EB 2V2TA 4DGIL 4Y2DC 3EO1B 4ODSL 3WFBH 1F4XH 1A7OH 4YQXL 5LXGH 1CYGA 3F58L 5GGSB 3QB7C 2CUHA 3UTSA 2B20A 3A6CH 3IFOA 1NC2A 4Y1AB 1K9TA 3MXVL 3SE3C 5E08L 2FD6L 4D0BB 3H6JA 3VA2C 1K5NB 1RIHL 2DJ4A 4JY6B 5CEZL 1UENA 4QYOB 5I1AB 1UA6L 4GAYB 1UGNA 3PV7A 4Y16D 4U1LA 4I5BB 4Y5VC 1X5HA 5BOPA 3U4EA 5B3NA 4RX4D 3VXUE 1MRCH 4R7DB 5CEYA 4AMKH 1RURH 2VXTL 4QF1B 4NHUA 5IHUH 1QTYT 3PL6A 4HH8A 1IC4L 5CMAA 3U9PL 5IG7A 4UU9A 1WBXA 4UTAL 1E6OL 4G8EA 4PJBA 4XXCA 3JSSA 3WFCH 2IBZY 3FO9A 2V5MA 5DMKA 3RGVD 3SKOA 5F3BA 3FMGL 2BNUB 3E3QC 3RWDA 2Z8WC 4TUJB 1QA9B 4LEXH 1UJ3A 1KCKA 4X8JB 3DWTA 4KJPC 3MCLH 2IMNA 2AK1H 1C5CL 2WBJC 3HC4L 5HYIA 2NZ9C 4Z8FH 1E4JA 5TF1L 1INEL 3TCXA 3S36X 4ZPTB 4EN3C 4KDTC 2R0KH 4BK5A 4X7DC 3OKLA 3L5XH 5JZ7D 1KCVL 1GC1L 4MS8C 1A02N 2VIRB 4GSDL 5C0EB 4KQ4H 3WXWL 2ZUYA 1YDPA 1XGPB 4K7FB 2GJZB 3MJ9H 2GFBA 3QIUD 1FZMA 1LO5B 2R29L 1KLUA 1R3HB 2BNRA 2E6PA 4DGVL 3IDYC 4M6OH 5HHOB 1BBJA 4TUOB 4LL9A 4B53A 3RFZC 1G7QA 1QBML 3FZUD 4GQ9H 4H1LH 3ES6A 5F9JB 1H15A 1EUTA 35C8H 3BO8B 3LKOA 4P2QD 3HNVH 3BAEL 1T1YA 1NMAL 5IW1A 3VFMA 3GBML 2I27N 3HCVA 3QUMA 1IC1A 5J12B 3FRUB 4P5MA 5K9OB 1J0JA 1N0XL 2VLRA 1PEWA 2EDRA 2GJ6A 5DS8A 3ILQD 4JFZH 4FZEH 4U6YB 2PCPA 1WICA 2R69H 4N0FB 4X8XA 2NYYD 3SCMA 1OM3H 4HZLB 1F3DJ 3HMXH 4MNQD 1GVIA 4NSKB 1DDHB 4QNPF 4Q9CA 5I15L 4XB7A 4KHTL 5ADOH 1FIGH 3MR9A 5F96L 5EPMA 3WKNA 2NY5L 4MNGE 4K2UH 5HPMA 1QFUH 1PVHA 2GITB 3RDTA 3LD8C 5K9QG 4NBZB 1QVOB 2XIDA 4A6YA 1KT2A 2L0DA 4PJ9D 1QBBA 1JFQL 5L9DL 1A6UH 2YR3A 1CLZH 3P9LB 3UDWA 3O9WD 1FP5A 1EFQA 2MTPA 1GC1C 4I48A 1EMTH 1HINH 3KYMB 5SWQB 5C0DB 4CAGA 5IBTL 1MRFL 5GSVB 5ERWA 2VLLA 1S7SB 3G5YA 4HUWA 5DFVC 5FAAA 1ZGLB 4KK8D 4OFVA 5F1IB 2VSDA 1IGJA 2NW2B 4NO5B 3O3AA 1BD2E 3QWQB 4OCSL 3NABL 4JFEA 4WEBL 1D5XA 4QHKI 1CL7I 4NC0B 4ODTH 4OKDA 1A1OB 1U3HD 2AJSL 5ISZE 4Z0BL 5JLZB 5IB2B 3B4NA 1WIUA 4HCRH 3WXVL 5ICZA 2FNBA 3C2SA 3MLRH 4PR5A 3NIDE 1Z9OA 3E6FA 4URTB 1U2HA 3AU1A 1MFCH 1DEEB 5DJAB 1MCNA 1FNAA 4ZO9A 1UADC 3KPTA 2E3VA 1RJLB 4IIQA 1I7TB 3S88H 1N4XL 3AB0C 2QR0B 1DLFH 5FUOL 1DFBH 4N0RA 4WFFD 1T1WA 4P23B 5DRXA 2NY5C 3MLXH 1M05B 3MA9L 3BGMA 2GY7B 2YK1L 4QTIH 3AS1A 4BZ2L 2O5YH 5IB1B 3UBXB 1PD6A 1PG7L 4YC2C 5IKCB 2IFGA 4NZRL 4LARH 3SE4C 3LEYL 4H88L 2HTKC 3D9AL 4OM1H 1KB5H 3RBGA 5LBSH 4HPOH 1LO4H 3KLDA 5AG9A 1R24B 1C1EH 4AG4H 1Q9KA 4DZ8B 4ELMB 3X17A 4O5LH 3IF1A 3QEGL 4LHUD 3MRCA 5DD0L 2YPLA 4KUCD 3DRQB 4NQDD 4FXGB 1KN4H 1HDMB 1DVFD 3IDJB 5CP7A 1OTTC 1NGPH 3AREA 4APQB 1WTGT 4TNVK 1YMMA 5JIHA 5MEOB 1JTTA 3QISA 3TT3L 4FFZL 1EDQA 1EPFA 1F4WH 5CZVH 3I9GH 3D69A 5E70A 4L4TA 1J88A 4LIQH 1IILE 2FJGA 4LPTA 4MXWL 3EIFA 1LP9F 1GSMA 5EU7C 3DVNA 2P7TA 3CJJA 1M7IB 1T0NB 1UKQA 3NFPB 1AR2A 3RAJL 4TVPH 1MUJB 1AR1C 3U4BH 1KTLB 3MRDA 1IAOA 3SDCA 5C0FB 1L7TH 4LVOC 4OUUA 3BKCL 2IGFL 4NQCE 4OAWA 2Q87A 3VWJC 3FQRA 4QOKE 3W0WB 1FVCA 1NUNB 2PUQT 3EBAA 4BH7A 4Z7QE 5ANMA 3VFUA 3SDAC 2AJVH 1A9BB 5LGJA 1LD9A 1U95B 3QXAB 1ETZB 5E2VL 4OSUL 4PJEA 1FL3B 5GS0D 4LASH 1FC2D 2VABA 1MIEH 3B2VL 4GXUN 2NTFB 4R0LC 1NLBL 4GAGH 4Y1AD 3V4UL 4Y5XB 1IKNC 4P2RA 1FO0B 3S96B 1CG9B 5T5FH 2UV3A 2Z4QA 3QDJA 1FNHA 4X6CE 1I8IB 1G6RH 2GUOB 4GW1B 3C5SB 4GLRH 4QXGH 5F9OH 4G43B 1P4BL 1CBVL 5CCKH 1MFDL 3A6OA 4K9EH 1T5WB 5EG6C 4GMSH 4OD2B 5EIVA 1BFOB 3BKJL 1UWEH 3LQMA 2CLVA 1UYWL 5D7JA 2L7JA 1V3MA 4RAUB 3TN0A 4PIRF 2XZZA 4JANA 1EAPB 1UJTA 1BFVL 4K07A 4ZS6C 3AXLB 5C08E 2EYRA 3KG5A 4YXHL 4XPTH 3DO7A 1U8QB 4LRNL 2RBLA 4YHNB 3G5VB 3JTSB 4R4BB 3WL9A 1HKFA 4XP6L 5BVPH 4ODWA 4MJIA 4P5TB 5JA9A 3BMVA 3BN9D 4FQLH 4LMQE 2I5YL 4I18B 4S0SD 1UH2A 4TOYL 5IF0B 3TYGL 1WJ3A 2ZCLH 3B5TA 2NPLX 4Y4HA 1J11A 5I75C 3BZEB 5DI8A 3FKUS 3KXFB 1T66C 3VG0L 5A40E 2DQCH 4U1IA 3OKYA 5DT1L 1BQUA 4KDWA 5FYKL 3TFKD 3EGSA 4EVNA 1RJCA 5FYJE 2A6JB 5FGBA 4NBXB 3FB5B 3ULVF 1BZQK 3QRFM 2APWA 4OUOA 4M7JL 3T2PA 3MJ8A 4KJYB 1GGUA 1T20A 3MFGB 2NW3B 4ZFFA 3QDGD 4LEOB 3QAZB 4OI9A 1AGCA 4MAYD 4HK0A 4DOHE 1CDBA 1AHWB 3MRQB 2NR6C 4PJIA 1TENA 2F5BH 1FFPB 4GRLA 3KPSA 3O45A 3WHE1 5FKPB 1B0RB 1YPZA 3O8XA 4OCRH 5FUZL 2WWMD 4LCCC 4XP1H 2E7HA 4U2ZA 2FEDC 4OLYH 4JRYB 3VXUB 4IRSB 3ZT5A 3KPQB 4XPBH 5TDNB 4OLWH 1CFSA 1YJDH 1JMXA 1JL8A 3BIKA 5FA3B 4CDGC 5FECA 3RRQA 3BKYH 3MUHL 5INDA 4L9DA 4PGCA 1KPUA 3RX7A 1FZKB 3LSOA 1DQDL 3QIBC 4M1GL 3KJ6H 1A3RH 3HLAA 4BUGA 1XGUB 1CD1B 3C9NA 4NNYB 2HJKB 3NAAH 2J2ZA 4XWOD 3IETB 5BRZE 5LQBL 3EFFA 1VKXB 5D7LA 3MRIB 3O2DH 3VXRA 3HE7C 4PV8B 4HIHA 2HT2C 2EECA 4PJAA 3MBXH 4JN1L 4EUPA 2GK0A 3RWFA 4PJBF 4HH9A 1XF5A 4QHLB 3N50A 5JXAL 3EYFA 3GI8H 4PRAB 3RY6A 2X4TB 3GJFB 2VQUA 1FFOB 5SWZE 4GAJH 3UPCA 3BUYA 3REVA 4QKXB 1HI6B 4EQ3A 3G5XB 3VXSD 3RZCA 1ZLUK 1B2WL 3CFCH 1ZANH 1U8KA 5EIIA 3EFDH 4ODBD 2AXFA 5HGAA 1J86A 4OCXL 5L8JB 4NN5C 3IJSA 2JJSC 4OF8A 1RJYB 1X5LA 3BP4B 3B6SA 3MJ7B 5E2WL 3GFUA 2F54A 1A5FL 2IEPA 5F89B 1DUYB 1IMHC 2R4SL 4FOMA 1OP3H 4JPVH 1A3QA 5B8CA 2HG5B 4GRMA 1CFVL 2DAVA 3ARBB 4D9QD 3L3IA 1A0QL 3U6RB 4P23D 3PGFL 4M5ZH 3P4NA 2ITDA 1BHGA 3LKPA 3MRRA 1M71B 2FRGP 1FZJA 4NO2A 4G6KH 1SJVA 1U8PB 1LEIA 5CKGA 1HILB 3QH3A 4P9HL 1Q9LA 4OQTA 4LGPB 4MNGB 2CDEB 4LKCA 5FYLE 1W0YT 5J06A 1DQJA 3PG2A 1FNGA 1B6UA 4XCCL 2ZCHH 4GH7B 4J4PA 3GB7B 5EBWA 3KNBA 4EEEA 4JJ5B 4LKXB 4U7SA 5EZJB 4FQHA 1A14H 2OR9H 3LH2L 2P45B 5D6DC 4E41E 2AEQH 4RMVA 5CJXC 1T22B 4APQD 2WQ8A 3MGOA 2DMBA 4IEFB 4Q74A 5CKAA 3S4SB 5KVDH 2Q7YB 1URLA 1ZWIA 1TZGL 2YXFA 3FO1B 1JZ3A 1WIOA 3V52L 3AC0A 2X4RB 1VSCA 1CQKA 3QHZH 2FLBT 2P5EE 4JN2A 4KRNA 5GGVH 3QXDA 5L2KD 4TUKL 1VESA 1V3KA 3D1MC 3RIFK 5BV7B 5FM4A 4BSJA 2BERA 2R0WH 4Z7OF 4X9BA 4M7ZB 3VU2A 2JJUA 2OJEA 2ZSWA 4HFUL 2C4XA 4LSVL 3KWWB 1GOFA 3U7YH 2YRPA 5TPWL 1L7IH 3MRBA 3OKDB 2YKLL 1BAFH 4KMLB 3TO4A 1Q1JL 4U1SA 1DANT 1H9VA 4DVRL 3WCYA 3BH8A 4KMTH 2Y6SD 4YFEA 3P11H 3F65A 1FFNB 2OCFD 2WP3T 1N59B 4FRWA 4P9HC 5FA4B 4UOW1 3QQ4B 2UZIL 2XRAH 1YEEH 1OP3K 4QRRE 1IBGH 1WV7T 3W9DB 3FHAA 1A7PL 5IMOA 4GG6A 4Y19D 3ECBA 1X3DA 3QWOB 5TE4H 2V5YA 3L3GB 5E03A 1CICB 4HMCA 1T1ZB 4F3FB 1P4LB 5FOBA 4P46B 1IGCL 1A9EA 1S9VB 3P3YA 4YH6A 1FNLA 1A6VH 1IT9H 5IHZA 1SYVB 4JDVA 2H2PC 3STZA 3EO9L 1P7KA 2Y23A 3H9HA 1RPQA 4UQ2A 4HJJH 2BK8A 5FGRA 1JHKL 1NAML 4FXLA 4QRPD 4MCYA 4MX7A 1H5BA 5BXFA 4NCDA 4N5ED 2A6IA 5GGRY 1GGBH 1WITA 4JRXA 4KQ3L 1YNLL 1P2CA 4LLYB 3DARA 4OLEA 2HN7B 3SGEH 2HLFC 4XXDB 3PJSB 4P5TD 3BVNA 3AY4C 2AJYL 1JI1A 2YPKA 4PPTA 3ARPA 1FAKT 1JI2A 2R1YB 5DRZA 3DBXB 2OX5A 4LVHB 5HHMD 4FZ8H 4PRHA 2B0SL 2PW2A 5DK2B 2EXWD 3KXFD 5ETUB 2R2HA 4HWBL 1A6TB 2WUCH 4RGMC 4QOKB 1NKRA 4G7VL 5J3HC 3MNWB 4LCUB 3QG6A 4NRZB 5D2LA 3K4DA 1MF2H 3WKMH 1KJ3L 1SY6A 4HXAL 1X6LA 3SJVE 1JWUA 2HFEA 2Y5TA 1F6FB 2V6HA 4WHTA 2AK4A 3RQ3A 2W59A 4JFFA 2DBLH 1EA9C 1FJ1A 2F53A 4XNQA 4L3EA 3OGCB 1I1YA 4XVSL 1VFBB 3WNKA 4XH2B 1E4XI 4XBGB 1CDHA 3T0EA 3VGEA 5C07A 4XPAH 1CFNB 3NCEB 4KY1L 1CK0L 1CF8L 1D5BA 3CCHB 1RQ5A 4X6CB 1Q9WB 2R2CA 5HYQA 4UDUB 4Y4FB 5DD6B 4KROC 3O6ML 1AI1H 3S34H 2KL6A 3E8UH 3H9SA 4PJEF 5JIKA 1JZ7A 2YBRB 3IJYA 4JRYD 2BSRB 4IRSD 3KPRE 1BGXL 1JV5B 3SDYH 1K85A 5GJTH 1W0VB 4AM0A 4E42A 4JFYB 2UY7A 3DV4A 1BREA 1CE1L 2CKNA 4HW6A 4U1HA 3CVHH 4CBPA 2NXZC 4UINL 3K8KA 1NLDL 4QHMB 3RX8A 3QPXH 4BZYA 4ZFZA 3HMWH 5D2NC 4YHYC 3HE6B 4U05A 3OAUL 4WEMB 3SKNA 4GBXD 3SE3A 3U36A 1MLCB 2BSSA 2AP2A 1KJMB 12E8L 5HVFB 4XCFH 4S1RL 1QBLL 2R1XB 3KPMA 4Y5VA 5I8OL 1KFAH 3G6DL 3JWOC 1NPUA 2DTSA 4RQQA 4HIEA 2CK0L 3HI6L 3C6LC 1F45A 3Q0HA 1F6AB 1X5XA 5ADPH 4I4WB 2PF6A 4M3JA 4DKDC 5J11B 1GGIH 3GSRB 3TIEB 1OCWH 4WU7A 4QHKJ 4ZQKB 3M17A 1I9RL 1IE5A 1JPTL 3PGCA 2XZQL 3MZGB 4WI6A 1CFQA 5JXEC 3L3JA 4J8RB 5HI4C 1AGEB 4DOHB 4JFXA 4PJFF 4L3CB 4ESKA 4PJ7E 5EO1B 4ZFOB 5DEFB 1KTKE 4P2YA 3BXNB 4ZSOA 4O2EB 1CLYH 1HXMA 1XCTA 3HUJE 4CNIB 4L29B 43CAB 4KTYA 3FCTB 2E27H 3BZFA 4EN3A 4KDTA 3MLVL 5ALBL 2H26A 2DQHH 5F70A 3VE0B 3ARBD 1CN4A 4AEHH 4NNPH 2LU3A 4OI7A 4UZGA 4Y16C 2HKHH 2VAAB 4JGMA 1IGML 5DZOA 4Q9RL 4ZO8A 1JWMA 3Q6FB 2EIZA 2ATKB 3D3VA 15C8L 3MCG1 4HUKB 4YHOH 5K59F 4JDZB 4YXLH 1MLBB 3HI1A 5IR1A 5D4QA 3SDDC 4UB0L 3QNZA 4GKSA 1ZA6A 1U8IA 4YGAB 5HDBF 3CFEB 2XWBB 1IEBB 3VI3F 1EIBA 2IWGA 5BZDB 1F02I 2R23A 4EI6B 2X9YA 2EH7H 1LQSR 1INDH 1IM3B 3RUGE 2X05A 3IDMB 3RGVC 5IJVA 2KUTA 4ERSL 1J1OL 1IGIL 4HWUA 2XN9D 1MQ8A 1C12A 2VKWA 3WUWB 1K4CB 1CXHA 4DK3A 2JK5A 5SWZB 1KXVC 3QQNA 3VG9C 3SY0B 2LV4A 3C87A 2X1XR 4WV1B 2H41A 2F8OA 3L7EA 3K80A 5JZ7C 1RZIA 1QG3A 3QWRA 1J8HE 2BC4A 2KZ1B 4M8QB 4JFDE 2BCKA 3QIUC 4U0RC 1G7HB 5DFTA 1CI5A 4XZUB 4UNVA 5DEGB 2J8UF 2CR3A 3MQIA 1JK8B 5F44A 1F3JB 4WO4C 2XY2A 4TNVF 5C3LD 5FK9A 3ZL4H 3FZUC 4NO3A 1ZS8A 4MA3B 4FQJL 5I1LB 3L3HA 2FB4H 3UROR 3UTTD 1BIIA 3RA7H 3ARGD 2AABL 3OMZA 3UZEA 5CD5C 1C7TA 4JO4H 1WBZA 4P57A 2JJTA 1I9JH 5C0BE 3V0VA 4CVZA 1S7QA 5H35A 3ILQC 1VFMA 1VEOA 1WQVT 4ZUSB 3FO2A 5E8OB 2F5AL 5IVOA 1UXSB 4KVNH 1W72H 1OGAA 3CSYB 2NYYC 1WEJH 3SKMB 1MWAB 1AGBB 2KQNA 1B88A 5F8RC 3L5JA 1MCPL 4HAGA 3K4ZA 3AAZA 1RJZB 5E2UH 3SOBL 2ZJSL 4M6NH 4IHOA 1NEZG 2PXYB 5E5MB 4E41B 3BPNC 3ZE0F 1X5FA 2DWEA 4U6HA 4PJ9C 1KYOK 3D25A 3F8UB 3CDGB 4ZG1A 3PWUA 5DA0B 5I30H 3VA6A 1L9NA 2B5IB 1JN6B 1V7NL 3L5WA 3O9WC 3WMSA 1ZEAH 2P5EB 3IU4L 5I1CL 3V2AR 5L88H 2APVA 2ZUQB 1RULH 2WIIB 4Q6IC 2EKSB 4Z7VF 3MACH 5E4EB 4KK8C 4YDKL 5JR1H 2C1PB 2P47B 4R97C 4F9PC 5B21A 2RJMA 1J5OH 3LHPL 5EOQH 4MB5A 4XVJL 4XCNA 1PBYA 2C26A 3QG7H 1HHHB 2CKBH 1C08A 4QHUB 4HZAA 1LEKB 4JFQA 4QRQA 2OXGA 1UQSA 4HKXA 3AFLA 1U3HC 2GSGB 1R3KB 5GGUB 5KOVC 3ZKQD 1MCFA 4IOFD 3OAZK 4OIAA 1UEMA 3HI5H 3O6LL 2XQYK 5JNYB 1QSFA 4MXVE 1R5VA 5KG9B 3B9VA 4XPGL 4QRRB 1V7ML 2FJHB 2OI9B 1TJGL 3RPIB 1MHHA 1OSPL 2O5XH 2R8SL 5ENWA 5DJ2B 1DBBL 5FO9B 4M5YH 1OAQL 4Y4FD 5GGRA 1U93A 1D7FA 1J1XL 4NZUL 3PUCA 4M9PA 5IM7B 4WI5A 2B4CL 2LAAA 4R90H 3UO1L 2JB6A 3TA3B 4ZODA 3QUZB 2YD4A 2XNAB 2VDKH 1RZGB 2WNGA 5GS0L 1UACL 1RZJH 4FTVE 2H6PB 4DTGH 1NCDH 1T3FA 3CX5K 4JGJA 3CFDA 1MSPA 4FABL 3U7AA 3HAEB 3DUUB 1ADQA 3KPPB 3P4LA 3QDMA 3GJEB 3IJHA 2Z31B 2EE2A 4HX1A 1DVFC 4ZTPL 2DQTL 5D8JH 3F7VB 6CGTA 3LN4B 2KPNA 3ILPA 1U2CA 5C0CA 2R0LH 1IKNA 3IXTB 3CFIC 1XF1A 3OXSB 3TH4T 4X99B 4NDMA 3ZE0E 2ZOKB 2WANA 4F58H 3N1MC 3DX6A 1JF5A 4Y4KA 5ITFA 3DUSA 1BVLA 3H0TA 2EDKA 3AVEA 3ARDB 5CIPH 2PO6B 4LCYA 2IH3B 5I19H 2Z0BA 1PAMA 1W8NA 2A73B 1AKJA 4PTTB 1G7JA 4FFWD 1WFOA 3O4LE 4RFOH 3WNMA 4KWUA 4EUPG 2PYEB 2A77L 3LRSA 3TJHD 5ID0B 4LCWA 3DURB 3SBWC 2YEZA 5HVHC 5MHSE 2VH5L 2J88L 4OZHF 1F90L 2C1OB 4IM8A 5D5ME 3MOBL 4KTEL 4U1NB 1VGEH 1X5GA 4LHJB 2DQDH 1JGVH 3DNKA 3O81A 3MRMA 2BY1A 3UYPA 3IAGC 3PV6A 5AZEL 3O2VL 5D2LF 4PJ5E 2B4CC 5KVEL 3GMQB 5EU6E 2JB5L 5E94A 4O02L 5D7KE 3GSQB 5GS0C 4W70A 3MO1B 5BMFL 1U91A 1YEDA 5JOFA 2H9GA 2AEWA 4QTHB 2DD8H 4LIQE 3SEPA 3WIHA 2E7MA 3WHE0 5TH2A 3KPRB 3QNXB 2WIMA 1BEYH 1RMFH 1HKLH 1EHLL 3HNSH 4I13B 1TQBB 5JHDA 1XMWA 4TVPE 4DCQB 5IMLA 4XNUH 2GTWB 4PRIA 5I1KH 1KEGH 3MXWL 2ENSA 3Q6GH 2OYPA 4AQ1B 2EDWA 1DE4A 3L3KA 4YBHA 2Y36H 4PJXF 3VD3A 4BELD 3ARQA 4NWUH 4OGXL 5L6YH 3P0VH 4YHKH 3GRWH 2XZAH 2ED7A 5TDPA 5E9DD 4PP1D 5F7MC 4ZTOH 5SWSD 1NFDA 4K3JH 1NGYB 32C2A 4OTXH 4TQEH 3B9KB 4HJ0C 5DMYA 2BZDA 3BN9C 4M61A 5KS9A 3D0LB 2EDYA 2X1OA 4AY0A 2Q8AL 3NCJL 4XP5H 5DJCB 1KJ2L 1ZVHA 5GISH 2HWZL 5SWZD 5HGGS 3FT3A 5DQDL 1EVTC 3QIBA 3VXNB 4IMKA 3TFKC 1T21B 3MV9A 3GEWB 1L0XA 4PJDA 2XZCL 5IB4A 2W9LA 4HKBA 1VEPA 3SDXA 2SEBB 1XIWD 4PJ7B 4LVNB 4GW5B 3ULVD 4D8PA 3HZVA 4X5XB 5F7YC 4O00A 3HE7A 5GIRB 4NZTH 3D39E 4P5KB 4H8WC 5I1HL 5I1IL 4X6FB 1MQKL 1Z9MA 3HPLA 2BXYA 4MAYC 3N9GH 3MOQA 5CSZB 2R15A 1SM3H 3FHQA 4MXQD 1Z5LA 4U1KB 4ZFGL 4X6DF 5CZKA 3UTPD 5EZOH 1D6EA 1WLHA 3QFJE 2A6KA 2ZUSA 3OG6B 4YHLH 5J12C 1S7TB 3EOAA 2WWMC 4BQCA 3MUGA 3FT4A 4PFEA 2X10A 3IYLW 3RIFF 1HQRB 3EJYD 2XKUA 5TDOB 1JZ5A 2WINB 1D9KA 4QRTB 4XC3H 5FF6B 1HE7A 4WENB 5C0ND 3UTSD 1LE5B 3LN5A 5JO5B 3VXQB 3SQOH 5JA8B 5GRVL 2X2YA 5GRWA 3VXOB 5GGQH 4OLUL 4MZ3A 2JJSA 4YDVB 2I25N 4JR9L 1U8MB 2NXYB 3IFNL 4NC1E 1FL5A 5A16A 3MGAA 4L5FL 4E41D 2MQ0A 1CGSH 2IANB 4OGYL 1EV2E 2G60L 5CHNB 5EO0B 3FRPG 1OAXH 4Z6AT 4LLQB 3TNNB 1S7XB 1G9NL 4HIIA 3RUGB 3UTQB 1FH5H 1RD6A 1G9ML 3HA0A 4WTZA 1OP5H 4XWOC 3IFPA 3U9UA 1MELA 3WSQL 4OCLC 1ZHLB 3HZKA 3PL6D 4JREC 4Z7NE 4K3DH 1NCTA 1RZ7L 3GGWB 1A4JA 3P0GB 3S35X 3ZHKA 4OJFH 4WFHE 1J8HB 2QV2A 4HEME 3CFKB 4K8RH 5D6CA 1Y6NR 5BCAA 5IEHB 1FHGA 4OQTH 1KIPB 5JW4N 5D6DA 1CQYA 2HKFH 4LPXA 5CJXA 5I8CB 4YDIL 2FX8H 5IQ7L 1T04B 2IFFH 5ICYB 1VACA 2D31B 4EI5B 2W0LA 4HIJB 2ICEA 2YPVL 1UZ6F 3JWNC 3HFML 1U3JA 3PGDA 3ZDZE 1XGQB 1N3NB 2PNDA 2CXKA 4PJFB 1ZHBB 4NQTA 1A6ZA 4QRRD 2MHAA 1E28A 2GYSA 1FLRL 1MCDA 4WU5A 3FQWA 5C0BB 3QRGH 4JKKA 4D0DA 2EDNA 3EOTH 5IW3A 2C4FT 3I02A 2QKIA 3GBNH 2NY6B 3NFNA 4P23C 4KKBD 3MOAL 4LAJH 4X6DE 5IB3A 2EYSA 3AS2A 3G6JE 1NJ9B 3RVWC 5EZIH 4BSVA 3TA3D 3MRPB 1FNSL 1G9NC 5I66A 2W9DL 1VADB 2YZ8A 1I1AB 4MDIA 1G9MC 1X7QA 2AV1B 3BPOB 4KK6D 3VGBA 2RFXB 4RIRB 4P3CL 4S1QL 3NFSL 2VERN 2GJ6D 3NCYP 3HZYA 4FQQA 4Z7WE 2E8ZA 2ESVE 3T2NH 4U3XA 4JZOB 3SCMD 4UUJB 2AS5M 1NC4B 3UEZA 1QR1B 4Z7UF 2NY1B 1QPPA 1MI5A 1FBIH 4APQC 4H1LB 4JZJA 4Q2ZA 2WMPA 1GZPA 3H3PH 3PNWA 4TPRH 3GMRA 4LNVA 1LO0H 1DBJH 4UDTA 3TBSB 3O0RL 2GW5A 3ARDD 2PO6D 3DSNA 4V1DA 2G5RA 1JF1A 1JYWA 3I84A 1E4XH 1RZKH 1CZ8L 5C09A 1NSNL 3TLRA 2PYED 2VISB 1N5YL 5I1EL 3IVKA 3RTQB 2E5EA 3IFLL 4JDTL 4PTUA 1SJHA 4ZD3L 1NFIB 5KTEL 1A7RL 3MROB 5IIEA 4HMEA 1OAUL 3MLWH 3IXAA 3RX5A 3BUTA 4QRUB 1IAKA 4S0TD 3NCCB 4JM4H 3CFJA 1SEBA 2FHFA 4UV7H 1K8DA 3SQBA 1F58H 1RVFL 3AY4A 2OQJA 2J8UB 3O3DB 4JFED 1EO8H 5DR5H 2NTSP 1ZA3B 2Y6SC 4OIIL 1IRAY 4RWHA 4NQSB 4ZUWA 4LLAA 4Y8AA 3FB7A 2F15A 5C0AE 3NH7H 2YXMA 5T3XD 2FX9L 4NRXA 3R1GH 1JP5A 4UT7H 5LGKA 5GHWH 2X42A 4LSPL 4M7LH 3TVMB 4Y5XC 1DL7L 2NY4B 3K1DA 2FEEL 3EKCA 3BPLB 3U2SA 5DUML 4FTVB 4GW4A 2F8VA 4Z9KB 2NY2D 2WBKA 4L8DA 5F97E 3GSOA 2DKMA 1A1NA 1J0IA 5HPOA 5AUMB 5T5NF 4KKCD 5DVNA 3TM6A 1QO3A 1IGTA 1BQHA 5KSUA 3MRFB 2OTWA 3FQUB 4QO1A 1N64L 1SMOA 5M94B 3K7UA 5ALCH 4ZNEE 1FN4B 4N5EC 2E9JA 5IFAH 3MCKA 4U3CA 5TF0A 2A9ML 1V05A 2BVUA 1UCBL 3DGGA 1CGYA 2ERJC 4YAQA 1RHHB 1Y6KR 3ULSA 4E0RB 1JGEA 3GSWB 3B9KD 4BZ1H 1MJ8H 4P5TC 2HJLA 4DVBA 4KGLA 3O4LB 1MJUL 5DMGD 5TQ0H 4I18C 2EH8L 4NO0B 3O3EA 3LKNA 2Y07L 5MENA 3UYRH 3P4MA 3IDNA 5CP3H 3VFTA 4Z7VB 3DJ9A 2AV7A 3WNOA 2BSTA 4WI9A 3BGAA 2XA8L 2QBWA 2APFA 5KANI 1A22B 2EXWC 4L4TD 2DLTA 4WGWB 1KB5B 5JDSA 5D2NA 5D5MB 4RWYL 2H3NA 2BY2A 2LQRA 3V5KA 1J87A 4TRPH 4QXWA 4HF5H 5C7XL 2X4QA 1R3LB 3KGRA 4MJ2A 4H0HB 3TF7C 3W2DH 4PJ5B 4HWBA 1MFBL 3HNTH 4O51B 3RGHA 2Z91B 4RGNE 1CGTA 2WM0A 3QAZC 5EU6B 2OBGA 5IMMA 2CRMA 3SDCD 3VRLE 4HS6B 3S97C 1GZQA 1DBAH 4GKNA 4JPWH 1AHWC 5BO1H 3C6LA 3ZKXB 2WZPD 4CW1A 5KJRL 2JCCE 1MNUH 5BJTA 5HSFA 5ESAB 3MRKB 1N5AB 2G9HB 3V7MA 2JKXA 3MBEB 1UH3A 4JCLA 3ROOA 5IFJB 2J4WL 4NYLB 4QRSB 2HTLD 2YC1A 2XV6B 1T7XA 4JHAL 4ZOCA 1Y6MR 5DRWA 5JXEA 3OX8B 4IRSC 1S7VB 4QXTA 1VEMA 4PRBB 1CWVA 4HC1H 1WCBA 2HRPL 2NLJB 3NBNA 3V5HA 2X4OA 1EJOL 1T5XA 3QDJD 1P1ZA 1R5IB 2GT9A 2NXYD 1A21A 3ARYA 3V6ZB 4AIZA 2VL5B 1I8KA 2IAND 4UT9L 3TGXA 1T89C 1I3RB 1G9EA 4GG8A 2ADGB 1RI8A 5D7JD 1HCFX 1ZT7A 4YBQD 2D7QA 4Y16A 3TN0D 2HAZA 4JLRA 2BY0A 1TQCB 4K3HA 1AO7A 4DGIH 4HSQA 3M1BB 5CJBA 1G6RB 2F74B 3BEVA 4HUVB 1UM6L 4Y5YB 4YQXH 3FOMA 3F58H 3SKJL 1A47A 2QQLL 3SDDA 3JZ7A 2DM2A 5KS9F 2P24B 1EO5A 1MFNA 3MXVH 4FQ2L 4P0DA 4HUUB 2IF7A 2K9UA 4Y8DC 5E08H 5C0JA 1VGKB 2XTJE 1YY8A 1RIHH 1UA6H 2BVOB 5IQ9B 2VDNH 4OZHB 3D39B 5MP6L 3RGVA 5FXCH 2YOCA 1ITCA 5HYSG 1IZJA 3NIGF 4EI5D 3UPRB 5BV7L 2P8MA 2ARJB 2IADB 2YZ1A 2VXTH 1AQKL 3QO0A 1ZV5A 2PN5A 4S2SA 1IAIH 3ZTNL 1IC4H 3HS0B 4M43L 1F4HA 3PHSA 4LP5A 5IB5B 4JG1L 3U9PH 1KJVB 1UXWB 4O58L 4I77L 4Q58C 4M02A 3ARBC 5IT2L 2R2BB 2UVFA 2YRLA 2Q8BH 4UTAH 3HG1B 2OS7A 4LNRB 2YD2A 4DFIA 3CFBB 3QIUA 2V9RA 5FO8B 5T5NG 3DXAE 3PWPE 3FMGH 3VJ6B 2V5SA 2N7AA 3IDXL 4WVRA 4JY4B 3O8XD 5E6IA 3RZWA 4WO4A 4XAWH 2ARJQ 1IM9B 1OT1A 1H3XA 5HVGB 3RP1A 3BP6A 1BM3H 1E4KC 5TF1H 1INEH 3L1OL 4HLJA 2JIXA 2LABA 4D9LL 1GC1H 4PJXB 1ZT4B 1NC4D 3WXWH 3MRGA 2NY1D 1G7IB 2FDBP 4NCC1 3QJFA 1QFWL 2MNUA 2X1QA 5SX4H 2R29H 3MV7E 1T4KB 4DGVH 4FXKA 3MYJB 4L8CA 1CVSC 4ALAL 4MNQA 1YEHL 2FWOA 2CO6B 1QBMH 1BX2B 1FL6B 3T2OA 3MLTB 4QT5A 3ZTJH 4J2XA 2Y1VA 2EKJA 3BAEH 1U8JA 5LKNA 2NY0B 1NMAH 4IMLA 4F15C 5BV7C 3GBMH 5D7LD 3RTQD 3BZ4A 3VXRD 4F9LC 3T3ME 2ATPB 1R5WA 4PJ9A 1N0XH 4JFHE 3CUPA 2F58L 3L3OA 4D94A 2XG5A 1VPOL 2W1NA 4KZDL 5JW5A 5AYUL 2VLKB 3O9WA 4GRWH 4KKAD 2DB8A 5CINL 4YNYA 4XNYL 5I15H 1RZ8A 5C0RH 4KHTH 2OTPA 4WI8A 5F96H 4Q6IA 4Y88A 3WFEL 4I0PB 1A7NL 3T4AB 3VGAB 3LEXB 3NIGE 3ARGC 3C5JB 1U6AH 4F9PA 1TIUA 4EDXA 3EJJX 3NN8B 4MQXD 4X6DB 3DVGB 4X4YA 5SV4A 1JFQH 5L9DH 4OZIF 3G6JB 1NBZA 3TVMD 1UM5L 2NY4D 1QLRB 2VITA 3VD7A 1IQDA 4YBLC 1FV1A 4W6WB 3G9VA 5C0GB 2VLRE 1I7UA 2C3GA 2FJFB 3KPLA 4YDJA 1MRFH 5IBTH 2OTUB 3K46A 2VLMD 2I9LB 4OFYD 2ESVB 4PY7A 4Q9QL 1HHGA 2VZSA 5KN5A 1F4YL 3TT1L 5T1MB 2Q86B 4ONFL 1XF2B 4KV5F 3ZSSA 1ORSB 4MQ7B 2CMRH 4HKJA 3WD5L 1GIGL 1FCCA 3NABH 3OPZL 3KDMA 4WEBH 2WV3A 4S11A 3JXAA 5DJ0A 2AJSH 1SJXA 5EU4B 5EBLA 4BA8A 4Z0BH 3BEWB 2LVEA 4H26B 3RHWF 3HPJA 3TIDA 1Z3GL 3WXVH 3K2UL 1HH6B 3QYCA 3DMMB 3O11B 3O4LD 2H1PL 1I8LA 2FZ3A 2DRUA 1JNLL 3VDAA 2GKIA 5KSBE 1OWWA 2F19L 4LVHC 5CWSA 4LHUA 5E2TL 5FUOH 3V8OA 3BW9B 5I18H 3C8KA 5I73B 4NQDA 3QQ3B 2GCYB 4XX1G 2XPGA 4MAUL 4FQPA 4KXZI 3RWIB 3MA9H 4NHCL 1H8NA 1K3IA 2YK1H 5EU5A 4OZFA 4BZ2H 1SYSB 2CH8A 3VFNA 3TPKA 1E0OB 1CLOL 1MH5B 4WDIB 1PG7H 4IOFC 1MREL 4PJ5D 4NZRH 2C3VB 3BJ91 2VDPL 1FPTH 5C0AB 1L0QA 3VFPA 1AD9A 3ZT7A 4OV5A 3P9MB 3UZVB 2ZWLT 1R3JA 2LTQB 4LPYA 5CZXD 1E6JL 5DD0H 5AD0A 3X13A 2JTDA 2ZKHL 5J6HA 4HT1L 4RISL 3CC5B 1ZVSA 3QJHB 3MV01 4R3SB 2XQBL 3SBWA 3TO4D 2A6DB 4PGZA 4Y4FC 3K81A 4LLWA 1UWGH 1YN7B 1P6FA 3MBED 3TT3H 1WGOA 2BP3A 3IDGB 4FFZH 2K1MA 4CMHB 1QFWM 4QCIB 3RNQA 4AEIL 5L0QB 5DJDA 4OZIE 4MXWH 2NX5A 3BWUC 3FQTB 4M9OA 5J0BA 3O3UN 2R2EA 1QNZL 2LFGA 5F9WB 4JGUA 3EO1A 4RGOL 5ESVB 2XQYG 5F7DB 1YEKL 5EN2B 1FGVL 3RAJH 4I9WE 3GMMB 5FIEA 5GGSA 4Y1AA 1SEQH 2YPLE 1YC8A 1FYTB 2DM4A 3BKCH 2IGFH 4Z7UB 4D0BA 1EBAA 4OZ4B 4JY6A 4WTZG 4QYOA 1ZAGA 4GAYA 1BWMA 1YMME 1NL0H 4I5BA 4JVWA 2CR6A 1FVEB 4FNLL 5J6GB 5HYFA 4FFWC 5BW7A 3QNYB 3BGFB 4R7DA 1T2XA 2ENYA 5E2VH 3U7WH 1N6VA 4OSUH 3TJHC 3JV0A 1J8KA 3THMH 2AI0L 2CDFB 2DL2A 2XTLA 3A67L 5CUSH 1RIVL 5K9JH 1OD7A 1DJSA 5IVXF 1BZ7B 1CBVH 4RGNB 1EZVX 5DDHB 3QEHB 1MFDH 1LK3H 3SE8H 5JW4Q 2BNUA 2P5WE 5GZOD 4NC2B 4TUJA 1QA9A 2JCCB 4X8JA 3VXTB 3ARTA 1BFTA 3FB6B 5FO7B 4K23H 1R0AH 2I07B 3SGKC 4ZPTA 3S3JA 1BFVH 4O4YL 3ULVL 1FE8L 3U46B 4YXHH 2VIRA 5C0EA 4JFFD 3GHBL 4LRNH 4RAVB 4I3GA 3STBA 1S5IL 3HG1D 1XGPA 4K7FA 2GJZA 4L3ED 4XP6H 2DQGL 4P2RE 4TSBH 1JHTB 2DWDB 1HSAB 1LO5A 3T0ED 1R3HA 3D87B 5T3ZD 5JTWA 2J5LB 4ZDHB 2I5YH 1P53A 4RFNB 5HHOA 4TUOA 4TOYH 3TYGH 3G08B 3O3BB 1IM9D 4DZBB 3S37L 3TV3L 3H9SD 5F9JA 4NQVB 3BO8A 4XI5D 3VG0H 1YQVH 2OLDA 2UWEF 5DT1H 5FYKH 5IV2B 4YHPB 3GNML 3FRUA 4R2GB 1ED3B 4NPYB 3CU7A 5DJYB 1N6QL 3TPUA 4PP1C 5DK3A 4U6YA 4H0GA 4M7JH 3AROA 3DIFB 4N0FA 2A9NL 3OKKB 4HZLA 3U0WH 5CBAB 4QEGA 4ZS7L 4NSKA 1DDHA 1OLLA 1HWHB 2AXGB 3NGBC 5EOCL 1F13A 5DHYB 4WV1C 4HGWB 4EJ1C 2GITA 3LQZB 2V2WB 4HLZG 5FUZH 1U8LB 4UOJA 1QVOA 4IDLA 1OSZB 2ZCKL 4NBYB 2VDLL 3P9LA 3CVHB 5F7LB 1XIWC 2D0GA 2VLKD 1EX0A 4LSRH 3ULVC 3KYMA 3NCBB 2BVQB 5SWQA 5C0DA 3NZ8B 5IVXE 4G5ZH 5GSVA 3RVTD 2WP3O 2OMBA 5FCUH 1S7SA 2W0PA 1PLGL 4MXQC 4QGYA 5C70A 4I0PD 3BHBB 3GM0A 1ZGLA 5I9QB 3HRZB 5F1IA 1DQDH 4NN6B 4NO5A 2NW2A 5CD3B 4M1GH 5TJWK 4PJIE 2DQJL 3CSGA 3V4PL 1AD0B 3DXAB 3PWPB 1K2DB 2HFTA 4NKOB 1YPZE 2EDLA 5GSRB 3FAXA 4X80L 3TBVB 5LQBH 5TGBB 1A1OA 3EJYC 4U49A 2QHRL 2JJVA 4JPKL 3CXHK 2CSPA 5IB2A 5JLZA 5C0NC 5DO2C 3E6HB 4RDQF 4U1GB 1V3JA 4JN1H 3P0YL 4TSCH 1SMAA 1I1CA 1G7LB 1CL7L 1DEEA 5DJAA 3QO1B 2W60B 1DN0B 1RJLA 5JXAH 1I7TA 2QR0A 1NDMB 2UY6A 2KBGA 4U7KA 1BQHG 3BD3A 3PHQB 1RSFA 3MV7B 4P23A 3QUML 4NQEE 1Z9LA 1S9XB 1ZLVK 2I9TB 1M05A 1GH7A 5JQ6L 3PL6C 1ZLWH 3Q3GB 5IB1A 3UBXA 1KUMA 5HYJE 5IKCA 4OCXH 5K33A 3GMOB 2ZUQC 3I6GA 5IFHL 5E4EC 3OJMB 4XBPB 5E2WH 1R24A 1A5FH 3D18B 4PJAE 4DZ8A 3QCTH 4ELMA 2E6JA 2PR4H 2R4SH 2Z92B 4BQBA 3WDHA 3WS3B 3DRQA 2ADIB 4U4BA 1CFVH 2GHWB 4FXGA 5DGRA 1TXKA 1A0QH 1HDMA 3IDJA 1QQDB 2XACC 3F5WB 4A6YL 1MHPH 2OM5A 4KUZL 4APQA 1BQSA 5MEOA 4MJ5A 4P9HH 4S1SL 5D1ZB 4X7SH 3T65B 2H2SD 3H7BB 4FA8A 1IC5L 4HS8L 5D93B 1T7ZA 1FDLL 1FG2B 2FYYB 1CT8B 5C0AD 3PF2A 4XCCH 2OI9C 2IJ0C 1M7IA 1T0NA 3WNLA 2HJFB 4L8SB 3NFPA 3LH2H 3M8OL 4PUBH 1EFXB 1MUJA 5FYKU 4D3CL 1QP1A 5D1XB 4KKBC 2AJ3B 5H37H 1PY4A 5C0FA 4WW2B 1ND0B 4OD3L 4IJ3B 2YUWA 1TZGH 3W0WA 3P40A 4KI5F 4XC1H 5TE6L 3TA3C 4MWFB 3FQXB 3V52H 5T3XL 4NQXB 4U6VH 4RNRB 4KK6C 2IQAA 4GJTB 3S36L 3PQYB 1JNHB 2HLAB 3T04D 1G7PB 1A9BA 2EDDA 1FSKB 4N1HB 4PGDB 2AQ1A 4WY7H 4G8IB 4TUKH 1YEGH 3RWEB 1U95A 3EYUL 1ETZA 3IAPA 3QXAA 1A6AB 4JJHA 4ZYKB 1FL3A 3SCMC 4LHQB 4MD5A 1I1RA 5FB8B 5EBGA 4HFUH 2BHUA 2NTFA 3FT2B 4Y5XA 4WHDA 3UBXI 1FO0A 1NCAL 1FYTD 2MQCA 1CG9A 3S96A 4K94C 2W92A 1I8IA 2GUOA 4GW1A 3C5SA 3E1F1 1ZLWK 4G43A 4X9GA 2M2DA 4RMTA 1ACYH 1T5WA 3RVXD 5KSBB 3ARDC 2PO6C 3GO1L 4DVRH 4OD2A 2VLLB 1BFOA 4NJ9H 1Z6JT 3EJZD 1W72B 4OD1H 1PQZB 4RAUA 1QZ1A 2UZIH 3CAFA 1G6VK 2XWTB 3OHXB 1EAPA 2NZIA 3AXLA 1DQQB 2HTKD 1A7PH 4H25B 4PREB 1U8QA 1GAFL 4RMSA 2EC8A 5I1JL 1QOKA 2QQNL 4YHNA 2YMXL 3G5VA 1MJ7L 2H32B 4RGND 4YX2L 4R8WL 3JTSA 4R4BA 5L2JB 4WTXA 4P5TA 1LO3H 1IC7L 1MCWM 1P7QB 4JO3L 1HHIB 1IGCH 1J10A 4OKVB 4I18A 1TDQA 4MHHI 2X1WL 5IF0A 3EO9H 3RU8L 1X6NA 1Q72H 3BZEA 1NAMH 1W8OA 4N8PA 1UWXK 5DMIL 2DKUA 3KXFA 4I3SH 4NKMB 5E00B 2I24N 3LKRB 3X3GH 1QSFD 3EYQD 4OZIB 1WBYB 1YNLH 4RDQG 2A6JA 3H3KA 5DWUL 2BJMH 3FB5A 1JCKA 2YD5A 4OLZL 2G2RB 4W6XB 2NY2C 4KJYA 2AJYH 4WFGD 4OF3A 4GFTB 2NW3A 3HN3A 2CKBB 1TQBC 4BK4A 4KKCC 4LEOA 3ME0A 1S8DB 3NA9L 4XBEL 1AHWA 3MRQA 2B0SH 3ZYIA 3HC0B 3MRCB 4LSQL 5GXBB 3MA7B 2YPLB 4QLRA 1FFPA 4L1HA 4J3WA 5FKPA 1B0RA 1CGVA 4G7VH 4PG9B 1QSVA 5H2BB 4U1MB 1KJ3H 3CZFB 4HXAH 3BMWA 3B9KC 4OGZA 3QDMD 4N0YL 5DMGC 4JRYA 4IRSA 2X40A 5DD3L 3KPQA 1K8IB 5TDNA 1WFUA 4D2NA 1NFKA 4G7YL 3V5DB 5C0CD 5I0ZA 4XVSH 5FA3A 3MV8B 4ORZC 5INCB 1TMCB 1HZHL 1F4XL 5F1OB 4Y4KD 5JOPE 3QUYB 4RRPG 1FZKA 4KY1H 1CK0H 1CF8H 1Q9OB 1TCMA 4PRHE 1T89A 3O6MH 5MI0B 1P4IH 1XGUA 1CD1A 4NNYA 4OUUB 2HJKA 2P5WB 3IETA 5I74B 1IKFL 4D9RE 3IT8D 4LVNC 1VKXA 4R26H 1VENA 3MRIA 4PV8A 5DSCB 4LCWD 4QGTA 1VB9A 4NN7C 4OCMC 1B90A 5L7XL 3WHXB 1CE1H 1MRCL 4UINH 4QHLA 4XNMB 3X12B 3GMPB 5IHUL 4AIXA 2F53E 4PRAA 2X4TA 1H0DB 3GJFA 1FVDB 5CIPB 4M93B 3CSBA 1FFOA 3T0AA 5C07E 1CDUA 4GXVL 4C56E 3DXAD 2HTLC 2OK0L 3PWPD 1HI6A 3G5XA 1QLFB 12E8H 3S98A 2A38A 3A6BL 4S1RH 1KIUA 1QBLH 1ZGLP 3H7LA 5I8OH 4CU6A 3OKEB 4X7TB 3QHFL 4LEXL 1WAAA 5DA4A 1RJYA 2CK0H 3BP4A 3HI6H 2EEBA 1F2QA 2NXYC 3MJ7A 3U83A 3DOSA 5F89A 4Z8FL 1DUYA 1WFTA 4X9HA 1I9RH 2HG5A 2ZG2A 3L5XL 3ARBA 3FB8B 2EYRB 5JHDD 1JPTH 3U6RA 1CDCA 2XZQH 4PRID 4CVXB 4J3UA 1M71A 5F3HB 4YBQC 2WQRA 3MJ9L 1U8PA 3TN0C 1HILA 3ALPA 1CS6A 2FATL 2ICWJ 1KB9K 25C8L 4MNGA 2CDEA 4L9LB 3V4VH 5KBNC 3WEXB 5C6TH 4LVEA 1E4KA 3VRJB 3GB7A 2O5ZL 4LHUG 3QA3B 4JJ5A 1IVLA 4LKXA 5EZJA 5K9QI 4FS0A 1U8NB 1A2YA 1KCSH 1T22A 2V17L 5D72L 4MMZC 2ZPKL 3IKCB 3S4SA 1CIDA 2Q7YA 4MGXA 4FZEL 3K2MC 1PSKL 5IVXB 4YFLI 4OZFG 2R69L 3N85L 1IGMH 4EI5C 3FO1A 4Q9RH 1R6VA 4KTDH 1UB6B 3AM8A 5F6HI 3E0GA 2X4RA 15C8H 3E3QE 4HK0B 1FIGL 1AP2B 2J12B 5FGBC 1L9MA 4UAOB 1CXKA 4JM2B 4F9LA 1EFXD 3AMLA 5D1XD 1TPXB 3KWWA 5MEQB 2XYCA 4TYUA 1Q94B 4MB3A 3KJ4B 4R6UA 5J57B 5EFIB 3OKDA 4ERSH 4WWKB 1J1OH 1IGIH 1EMTL 3O8XC 3NPSC 3MRJB 2D7OA 4ZUTB 2OZ4L 3BPOC 3R8BB 3RJQB 3PQYD 5IOPB 3U79A 1DBML 1FFNA 1KPUB 1N59A 4G8GE 2CJUH 4CRPA 5FA4A 1DP0A 3QQ4A 3ZZ1A 4NQEB 1D9KD 1WZMA 1O7VA 2D7MA 1NBVL 3W9DA 2NY1C 2UWEB 1CDYA 1AGFB 3EDKA 5D1QB 3JV4B 1KELL 4PS4L 3SPVB 3CMGA 4I8DA 5HYJB 4H0IA 5HHQB 3LZFL 1Z0NA 3QWOA 3PIQB 1AC6A 3L3GA 3LKQB 4XHJD 3DX8B 1CICA 3LY6A 4I2XE 1M1SA 3EYVB 1T1ZA 4F3FA 3DECA 1NCWL 3O4OB 4PJAB 1KOAA 2X1PA 4P46A 4FQJH 3C09B 1S9VA 2FGWH 2VLJE 1SYVA 3V79C 3VW3H 4DUVA 4DFHA 2DM3A 3RTQC 2ZSVB 1IJ9A 3ZDXF 1EVUA 5DJ6B 5EUKB 1WF5A 1I3VA 4W68A 1SJEB 2F5AH 2IPTL 5B38G 4PRDB 4L4VB 4KKAC 3I85A 2UUDH 4ZMAT 4LLYA 3KHOA 4QTIL 5FDWB 2HN7A 2O5YL 1CIUA 4XXDA 3PJSA 1JYVA 1MCPH 2GSIB 2R1YA 3MUJA 3DBXA 1KB5L 5LBSL 5L8LB 2ZJSH 4PJHE 1LO4L 1KTDB 3BYYA 3MFFB 3PWNB 4WUUB 4MA1C 4BKLB 1NBYB 5DK2A 4MQXC 5AYQA 2UZXB 1TVHB 5DVMA 4DEPB 5ETUA 3LMJL 3DYOA 3TVMC 1A6TA 4QOKA 1H3PL 2NY4C 2CIIB 2YA1A 5FUCE 1V7NH 3MNWA 4LCUA 2AJUL 3DPBA 3NPZB 3KS0J 1E4WL 4ZXBB 5F1KC 3IU4H 4WNQA 3ZDYE 1WWBX 5I1CH 2AXJA 5CZVL 5DLML 3I9GL 5B8CC 4N90E 1OGAE 1EXUB 3FL7A 3ZYOA 4I9WD 4YDKH 3LS5L 3BIBX 3OGCA 1VFBA 1QLEL 2BNQB 1NCUA 4XBGA 1QHPA 4LAQL 1IL1B 3MLSH 2YWYA 1CFNA 4GRWE 3L3DB 3CCHA 4X6CA 1Q9WA 4UDUA 4Y4FA 4OCWL 5DD6A 3X3FL 1UEYA 1QFWI 5EO9B 2YBRA 4MVBD 4HPYL 1Q38A 2ZZUT 2BSRA 3O6LH 1JV5A 4XPGH 4DUXA 1W0VA 2M26A 5E4IA 3QEQE 2NCMA 3IB4A 4MJ6B 4JFYA 3MV8D 3MODL 3TJEH 1TJGH 1OSPH 2R8SH 5EZLB 3QUYD 1DBBH 4QHMA 2BOBB 3P9WB 3HE6A 1OTSD 3KR3L 1J1XH 4NZUH 4V1DD 4GAGL 2B4CH 1MLCA 1V3LA 5C92A 5C09D 3QHTC 1KJMA 2P5WD 3HKFA 4JFPB 1B6DA 1LGVA 2OMNA 2RR3A 5F9OL 3BRDA 2R1XA 3ARVA 4K9EL 1ZHKB 1NGXB 1QKZH 3PDGA 4FABH 3LKSB 2VKXA 3B5GA 2OJZH 3EZ8A 1MIML 5CZXC 3ZKXC 3A0OA 1F6AA 3HR5B 4I4WA 4W6YB 5EU7E 1YMHB 3GSRA 3TIEA 3TO4C 4PV9B 1SBSL 4ZQKA 2GAZB 3HC3L 2QSCL 3MBEC 2EYTB 2CPCA 4UT6L 3C6SB 3DX7B 3FFCE 3ULUF 3KYOB 4PY8J 1Q8MA 2M1KA 1RZFL 1T0MA 4J8RA 2LE9A 5ITBH 1AGEA 3S37X 4FQLL 4L3CA 5IROC 5EO1A 4CJ0A 3JUYA 4PJCF 4ZFOA 5DEFA 2EIBA 4LCIL 3BXNA 4O2EA 1R3IH 1NCBL 4CNIA 4L29A 43CAA 3SGKA 3FCTA 4MCYB 5LG1A 1QFOA 1G84A 4OCYH 5T3ZL 4MNHB 3VE0A 2VH5H 1IAMA 4I3RL 3WFDL 2D4DA 4FG6D 4O9HL 1NGQH 3MOBH 4KTEH 2AEPL 2VAAA 2X7LB 5E56A 5JPNB 4JG0H 1TQCC 5AZEH 3O2VH 3UBXG 3Q6FA 4NKIH 3QCUL 3QUXB 2ATKA 2P8LB 3ZLQC 3AS3A 2JB5H 4Y5YC 4JDZA 4K9EC 1MLBA 1U8HB 5BMFH 2R2HB 4LMQI 5FDYA 3C5ZB 2W0KA 3CFEA 2XWBA 5ESQB 3QG6B 5MEND 5BZDA 3VXME 5SWSA 4EI6A 4Z76B 4JHWL 1EHLH 2BVPB 1EGJL 2YD9A 4XP1L 1IM3A 3IDMA 4OLYL 5GZOC 3CZJA 5CGMA 5M7QA 3GHEL 3WUWA 3MXWH 5I1GL 1K4CA 4JPIB 2ZUTA 2YUZA 2W0FB 5SWZA 5FHAH 3SY0A 2Y5EA 5C07B 4C56B 4WV1A 3EOYG 4OGXH 4JM2D 4IS6B 4J3OC 4MHHG 1A3RL 1NDGA 4M8QA 4MA7H 1XGYL 5BQ7B 1G7HA 3DV6B 4M4RA 3T0EC 2NQCA 4XZUA 1XFPA 3WFHB 5DEGA 3S5LB 5CLWA 4WWKD 1JK8A 1F3JA 3NCJH 4NC1C 1KJ2H 4G6MH 1P84J 4Y2DB 1KIQB 2HWZH 4MA3A 4YIQB 3WE6B 5I1LA 4P2OB 3DI3B 4GOSA 4XI5C 1U36A 5DQDH 4NQED 5HBBA 1PDKA 2XZCH 3CLEL 2FIKB 5D1QD 4ZUSA 3NCFB 5E8OA 2IQ9L 5HYJD 3DRTB 4UQ3B 1UXSA 2AW2A 3CSYA 4F8QA 1AFVL 2BHYA 4KZEH 4HS3B 5TQ2L 5C0IB 3SKMA 1AGBA 1SQ2N 3EFDL 1QR4A 5I1HH 5I1IH 1MQKH 1WWWX 1RJZA 3J8F7 4ZFGH 5EC1B 4YO0B 1M6OB 2PXYA 5E5MA 4E41A 4XNXL 3UZQA 1YJDC 1AO7D 3CDGA 4EKXA 3FOLB 5C86A 1JN6A 4YHML 3F7QA 3K0WA 1CFQB 3MV9E 4L4VD 1MPAL 4LLMB 4G6KL 3VWKB 5HGHB 4PJDE 4RMQA 3SDDD 2B1AL 1PX3A 2D2OA 2V2XB 2P5EA 3VGGA 3RVTC 1XZ0B 1TTFA 4ODXB 5B38B 2XY1A 2WIIA 2EKSA 2BRRL 5FYKE 4PLOB 3IFNH 4I0PC 1M4KA 3WO4C 3EHBD 3VGAC 2WBJB 4OM0H 1XCTB 2C1PA 4W81A 4XHQA 4WUUD 2ZCHL 3V9FA 2DIBA 3ZE2E 3DROB 4ZPVB 1XR8B 3MNZB 1G9NH 1A14L 3O6KL 5KAQF 1HHHA 1G9MH 4QHUA 1LEKA 3VCLB 2B2XH 2K7PA 4EDWH 2GSGA 1R3KA 1HSBB 5GGUA 5KVDL 1FIEA 4ZXBD 4KC3B 2B1HL 4X83A 1OWRM 1S9WB 3OZ9L 1NMCB 4PJ8B 1NGZB 1Q0XL 4G6FB 4G8GB 1U3YA 5JNYA 5KG9A 3NIDF 1PYWB 1U3ZA 4QRRA 4HV8B 1PW3A 2FJHA 3BKML 2BNQD 3F12B 3RPIA 1OPGH 1MCOH 3BPCB 2DIJA 5DJ2A 5FO9A 1ULVA 5E6ID 1F8TL 4WO4D 4HXBL 1JTOA 4PGBB 1KPRB 5HHXL 1QSEE 4KPHL 2VWEC 5M95B 5J1AB 5KZCB 4I2XB 3GSNH 3VFGL 5IM7A 4YDIH 1A7BA 4PLKD 4M7KH 1OB1B 3PABB 1OW0A 2JIXD 2H8PB 3TA3A 3QUZA 2YPVH 2XNAA 2VLJB 1RZGA 3HFMH 1P9MC 5CD5D 3HTLX 1CR9L 4OFIA 5EOTB 3T08A 1MEXH 1MHEB 3GIVB 1FLRH 5LWYL 3HAEA 4KMTL 3DUUA 3KPPA 4ELKA 2AGJL 3WIFB 3GJEA 4KKNA 2YHGA 3LD8B 4UIKH 4ODHL 1IBGL 1PKOA 3TCLB 3MOAH 1JPGB 2KQMA 3F7VA 3UCRA 3LN4A 4G9DB 3T4YB 5DJ8B 3IXTA 5LJYH 4X5WB 3OXSA 4X99A 2ZOKA 4XMPH 2H2SC 2VXVL 1FNSH 5TE4L 4LLUB 5A1AA 3C8HA 4LGSB 3ARDA 3T0WA 4PJHB 2PO6A 1JHLH 2IH3A 4P3CH 4S1QH 1WISA 2A73A 5E5UB 4PTTA 3MREB 1A6VL 2PYEA 2LTQC 2VL4A 2NNAB 4JVPA 3WNNA 4POYA 3OG4B 5ID0A 3DURA 2VAJA 2QHLA 3BESR 4L1DA 1CGXA 2C1OA 3CMOL 4CMHC 4U1NA 1YN6B 5E8DH 3O0RH 3PXJA 1I7ZB 4KI5D 5ID1B 3PHOB 1IGYB 4G9FE 4W4NA 2JJTC 4NT6B 3QP3A 4NUJB 5F9WC 1NSNH 4Z7QF 4GRWB 3GMQA 1N5YH 5I1EH 4WCYH 2BMKB 4FZ8L 1NH6A 4JDTH 4DKEH 1MCRA 4ETYA 4ZD3H 1EEZB 1F3DH 3MO1A 5KTEH 1A7RH 1F42A 3UTZB 2NY3B 3OKNB 4QTHA 1HOCB 4LPUA 3F6LA 3KPRA 3QNXA 3RIAK 1MI5E 3QXVA 1MRDL 1RVFH 3REWB 4X6CF 3RVXC 1EEYB 3QEQB 4Y2OA 1S5HB 2FSEB 5E6ZA 4OIIH 3H42L 1FNEB 4DCQA 3BGFC 2GTWA 2QADB 3EJZC 4WI4A 3ZKMD 1QRNE 1DSFL 3QUKA 2FX9H 4OB5L 4NGHH 1ADQL 5IUSA 1XGTA 4LSPH 1OTUD 4XPAL 1TZIB 2AKRB 1WFNA 1DL7H 4F2MB 1MCCA 4JB9L 3WS6C 2VZ1A 5DUMH 1J0KA 4QY8B 4RGNC 1NGYA 3E8UL 2WBWB 3B9KA 3S4SG 1DQTA 2DOCA 2A83B 3D0LA 5AWNL 5DJCA 5GJTL 3T1WA 1RFDL 5KAQG 3CVHL 4JY5H 1BMGA 5GRYA 4C56D 3FFCB 2A9MH 2DLFL 4HUXB 3VXNA 1T21A 3DHJA 3EYQC 1DUZB 5ELIA 3MLZL 3G5ZB 2J6EH 3VWJB 3F7YB 5BS0B 4PJ7A 1MJUH 1KNOB 4GW5A 2J5LC 3NCYS 4X5XA 1S3KL 2EH8H 4XRCB 5GIRA 2D4FA 3INUH 2Y07H 3SDAB 4YJZL 1KFAL 4P5KA 3HR6A 5KW9L 1RUKL 3DYMA 4MD0B 4PD4J 4AT6B 4DQOH 5JDJA 5CSZA 4P2OD 5I16B 4UTBL 4U1KA 1NUDA 5GS3A 3OB0H 2FBJL 5CLTA 4RWYH 4Z0XB 4PRPB 3GZKA 4PJGF 2NX5D 4R0LB 1S7TA 2XFXB 5JW4M 2ZP0T 2KH2B 4NNXB 2RB8A 1HQRA 1RK0B 3WIHL 4HMDA 2IBZX 3LPFA 2IPUK 1MFBH 5TDOA 2DDQH 1JPST 2WINA 4YHIB 4QRTA 5FF6A 3ROLB 3GJFH 4JKPH 5DJZB 5JO5A 2J3SA 3VXQA 4N9GB 1HHJB 4HDIB 3VXOA 1QBAA 4WJ5B 4YDVA 1U8MA 5KJRH 4Y4KC 2EDFA 1BJMA 1CLYL 2IANA 3G6AB 2D03L 4MSWB 3VXMB 2E27L 5CHNA 5DVLA 5EO0A 4Y0GA 3UC0L 2DQHL 4LLQA 3I6LD 5LCVL 1S7XA 2J4WH 4FP8L 3TNNA 2YSSB 3RUGA 3UTQA 1ACZA 4JHAH 1UKTA 1NEZA 5D2NE 3VFVB 1BWWA 2Y9RT 4X7CC 3GUTB 1ZHLA 3VWKD 1QEWB 2ZG1A 4BFIB 1EJOH 3GGWA 2HFGL 5IMKB 1HXYB 3SO5A 1EHAA 2VR5A 3QFDB 4M8VA 4F7CB 1J8HA 4HJ0D 4WFEE 1UB5B 2J1KA 3CFKA 5IEHA 1KIPA 3VGHA 5J1TC 5JPMB 3NMEA 3EW3B 1Y18B 1WSST 5EUOE 2H45A 4XB8A 5I8CA 1MAML 2EH7L 4YPGB 1CDGA 1T04A 5ICYA 2D31A 3JUZA 3QCVH 4U1GC 4EI5A 4HIJA 4PJ8D 2WWKO 1Q0YL 1XGQA 1N3NA 1UM6H 3I3EA 4PJFA 4TTGA 1ZHBA 3FQNB 2HMID 3SKJH 4PJCB 3O41B 2EE6A 2QQLH 5C0BA 4FQ2H 5IGXL 5HHOD 3IRPX 3IRZA 4LCCB 4B41A 5KZCD 5MP6H 1NJ9A 3OXRB 4PJGE 1YNTB 4XPFL 2EE9A 4NRYB 1QFHA 3MRPA 2VLJD 1VADA 1I1AA 2AV1A 1HN1A 2RFXA 4RIRA 2ED9A 3ZTNH 3MJ9A 4JAMB 2MKLC 4M43H 4HQQL 4JG1H 2VN4A 4O58H 4I77H 4JZOA 1YYML 5CS7A 1C16B 1BBDH 5IT2H 2GQHA 1NC4A 1QR1A 3BD5A 1KGCE 1I9JL 1AY1L 3CK0H 3SGDH 4H1LA 2CLZB 1EK3A 4MA8L 1IQWL 3RBSA 3H9ZA 5D1ZC 2EZ0C 4KVNL 2VJXA 1C7SA 1W72L 4D8PB 3IDXH 3TBSA 1WEJL 2DICA 5D93C 4IMKC 3P77B 4NOBA 3STLB 1UC6A 1J18A 1Y0LB 3ARZA 2VISA 1XH3B 5DHVH 2C3WA 3OKMB 4D9LH 3HMXA 2OL3B 3RTQA 3KHQA 3L5HA 1JYNA 5D1XC 1NFIA 3MROA 1HNGA 2F8XC 1OOAA 2AQ3A 4QRUA 4AEFA 1ORQB 3RWHB 1H3TA 4ALAH 4FN0A 1YEHH 3BRFA 5JORB 1BZ9B 4UBDD 3S9DB 2J8UA 3O3DA 2EC9T 1GHFL 5L88L 1ZA3A 4I0KA 1FQ9C 3OF6A 3MACL 4NQSA 2E7CA 1PKQE 4KVCL 5JR1L 3HZMB 3BT2L 1D9KC 2OZ4A 1QSEB 5B3JE 2Z8VC 4P2QE 3SKUD 5EOQL 2NY3D 5KSAB 3D85B 2AJXL 3TVMA 3T1FB 1VPOH 2CKBL 3U0PB 4KZDH 1G0DA 5AYUH 4F7PB 4KH2A 1PEZA 2HA1A 3KYKL 5CINH 4FTVA 2VE6B 4XHJC 4XNYH 1NGWB 4LBEB 4ZUVB 3QEQD 4XCEB 4OFYA 5AUMA 3V0WH 2I26N 3DI2B 1AGDB 3WFEH 4MNQE 4E5XB 3PWJB 1K6QL 2QADD 5HY9B 5A2FA 2RIKA 3MRFA 1U8OB 2I60H 4HCRA 3FQUA 5H94B 3RVWD 4XP4L 3NZHL 3VFOB 1TCRB 1FN4A 4IRJB 1UM5H 4ODVL 1A1MB 4PYGA 2XKNB 2IALB 1RHHA 5GGVY 4X4MA 5E1HB 4WHYG 4R90L 4E0RA 5IEKB 3TZVB 3GSWA 3O4LA 1NAKH 4JO1L 4POZD 5FGSA 1RZJL 2IG2H 1T1XB 1EUUA 4NO0A 1NCDL 1F4YH 1ONQB 1CVRA 3WUWG 4JE4B 2XICA 1YECL 4Z7VA 3WD5H 3OPZH 4AQOA 4MLSA 3C60B 3P4OB 5C8JB 4J1UB 3UJIL 1KB5A 5D5MA 3LQAL 4A2LA 3O6FB 3PWLA 1B9ZA 1LK2B 1BD2B 5SX5H 1R3LA 5K93A 4G9FB 2J7LA 1Z3GH 3CU1A 5BS0D 3S35L 4PJ5A 1U92A 4O51A 3R06B 2Z91A 2QTEA 4N8CL 3ARXA 1KLFA 5EU6A 5ISZB 5I19L 4HS6A 4NKDB 2F19H 3DYPA 2V7NB 5E2TH 3B9AA 2GIYA 3W0WD 5ESAA 3MRKA 4TSAL 4YUEH 1N5AA 2G9HA 4MAUH 4PRPD 4YZFE 3MBEA 4NHCH 5IFJA 3D0VB 4NYLA 4QRSA 5DHXB 4FQIH 1MREH 4KAQL 4MVBC 3DSFL 3VDCA 1S7VA 1JGVL 2VDPH 4PRBA 4R7NB 1QRNB 4PB0H 5IROA 1EO7A 4JZJC 3OR6B 4S10A 4IRZL 2FLRT 1WCQA 2NLJA 4MCZA 1E6JH 3K1KC 1R5IA 2APBA 3BP7B 1VDGA 3QUYC 2ZKHH 5GGTL 3V6ZA 2VL5A 1BLNB 1RZJC 5B39B 1OTSC 1YEJH 3VXMD 1I3RA 5MI0C 1JVKA 2ADGA 1JBJA 5KOMC 3JVGC 5I74C 4AEIH 3CFJB 2CUMA 1BEYL 1CXEA 3VH8G 3FRPA 3LQAC 2X4SB 4JHZA 3LPGA 1QNZH 3M1BA 4RGOH 3LEVH 1YEKH 4X6BB 1G6RA 2F74A 4Z5RB 5J9PB 4HUVA 4Y5YA 3LS4H 3PDOB 2A74B 3V7AE 1D5ZB 1EH9A 2VZTA 2XOTA 4ONGL 1KN2L 1OP9A 4M93C 3H8NA 3P73B 2P24A 5DTFB 4HUUA 4RGMB 4WHCA 4YHKL 1EAJA 1VGKA 1FORL 1KF9B 2BVOA 5IQ9A 4G42B 1UG9A 4OZHA 3D39A 3ULUD 4FNLH 1W0WA 4NQCB 3UPRA 1LEGB 5I8KH 2ARJA 2IADA 3W5MA 5D96B 3JWOL 4PJ7F 2AI0H 3HS0A 3ZE1E 2C3HA 4QHNB 5IB5A 3A67H 1KJVA 1UXWA 3EDEA 4X4XB 3HUJF 1RIVH 2YD8A 4FG6C 4UNUA 3HG1A 4LNRA 1MVUB 4Y1AE 4Z77B 1OGTB 1NAMB 5FO8A 2WLZA 4OZGE 3VJ6A 3MLPA 2P8PB 4JY4A 4R4FL 5DD1H 4RFEB 5E7BA 3TWCH 1IM9A 5IBLD 3BDYL 5EOCJ 1T7WA 4TN9A 3P4MB 5T33L 5I8EB 3QQ9D 3HAEG 4O4YH 3VXUD 3R8QA 1FE8H 4K7PY 4PJXA 1ZT4A 2H3NB 3GHBH 1QYGL 4YHLL 1S5IH 1G7IA 5GRUH 3VXPB 4OBRA 1O7SA 1YUHB 1T4KA 5C08B 3MYJA 4M1DL 1AQDB 4GLRI 2GTZB 4MMXC 2VOTA 1CFTB 3RUGF 2FL5B 1BX2A 2XT1B 1ODAA 1FL6A 4NJAH 4YPJA 1AC0A 1EJ6A 1X5KA 1XR9B 3TV3H 3MLTA 1BOYA 1EGJA 4LU5L 4R4ND 3TNMB 1HQ4B 1WT5C 4JM2C 3V6FB 4F7EB 2VXUH 5ABDE 5EUOB 3FJTA 3CGTA 2ATPA 3LRGA 4K7PH 1TPXC 1N6QH 1S7UB 4JFOB 1XCQB 5HGDB 1FH5L 2R9HD 3CD4A 1KBGH 4FQXB 4K71B 2VLKA 2A9NH 5DUPH 4NM8L 2NY7H 4DN4H 3GIZL 4WWKC 2G75B 4WIQA 3CLFL 2ZUVA 4JCMA 3KYNB 4BFBD 3QDGE 5EOCH 1P1ZB 4I0PA 4JQIH 3T4AA 2V5RA 2FH8A 3LEXA 3C5JA 5IVZB 2Q7NA 3O2DA 1KULA 2DTMH 4X6DA 3U30C 3DVGA 5DK0B 2ZCKH 3OQ3B 4RMRA 3D85D 5KSAD 4PJGB 2VDLH 5D1QC 1QLRA 2HKFL 2HVJB 3BX7C 5C9JB 2APXA 3TO2B 4YE4L 5C0GA 3F7RA 2YD1A 2FX8L 2IFFL 2FJFA 2OTUA 5F9AC 5BOZG 1AXSB 2I9LA 2ESVA 3BE1H 5F9DC 5T1MA 3RJDA 4O2CB 2Q86A 1XF2A 3VFWB 1VFAB 1ORSA 5E8EB 2BDNL 2M8XA 4MQ7A 2JE8A 3QRGL 3FONB 5JUEL 3V4PH 3BWAB 1JUFB 1NCNA 1QFPA 4IRJD 4P49A 4X80H 2Y72A 3BZDA 4F7MB 5HDQL 5EU4A 1KXQE 2QHRH 4JPKH 3BEWA 4H26A 3TZVD 1EEQA 2X9WA 4ZNCD 1HH6A 3DMMA 3JTTB 3O11A 2VDQL 2EDBA 4FMFA 4Y89A 1P9MA 1CL7H 3UP1A 5BRZB 3RIAF 1DLHB 4MQTB 5IW6A 4YGVB 3EHBC 3VG9B 2VXSL 5CJOL 1LE9B 3BW9A 1DQML 4NP4L 3QQ3A 4DEPC 1RUAL 2GCYA 2Q3AA 3QUMH 4PBWD 1LMKA 5ICXB 3RWIA 1LHZA 1JZ6A 3O6FD 1FBIL 5JQ6H 4U0RB 1BD2D 4ZXBC 3L9RB 1X44A 4G9FD 1SYSA 2JELL 3IU3B 4BQ8A 1MH5A 4WDIA 3VXSE 1GL4B 2DQEL 3WJLA 1DBJL 1F2XK 2C3VA 4A2MA 1PKQB 5IFHH 1KCRH 5C0AA 1JWSB 43C9B 5ISZD 3OWEA 4NUGL 1OD9A 1K4DB 4P2QB 1J1PL 4MXVF 1DANU 1GOHA 3CDFA 3BP5B 4LQFL 3CC5A 3QJHA 5E6IC 1D5MB 4R3SA 5GRJL 2A6DA 4A6YH 3DLQR 5BVJB 1YN7A 2YUVA 3QBTB 5KVGL 1FAIH 3IDGA 4D9QE 3KVQA 1X5YA 4PLKC 4CGTA 4XMLL 3SO3B 4QCIA 4DJMA 1IC5H 1H8SA 4HS8H 1EHNA 2HP4A 4UV7L 1FDLH 2ZNXA 5I1DB 1F58L 4LSUH 5DUBB 5LGHL 3FQTA 4N0UE 4XPHH 3VD9A 1J05B 1QRND 2PW1B 1EO8L 1ZSDA 5ESVA 5T1LB 5F7DA 5BZWB 2A0LD