3GK8H

X-ray crystal structure of the fab from mab 14, mouse antibody against canine parvovirus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
220
structure length
220
Chain Sequence
b'AVHLQGTELVKPGASAGVKLSCKASGYTFTNYDMNWVRQRPEQGLEWIGWIFPGDGSTRYNEKFKGKATLTTDKSSSTAYQLNRLTSEDSAVYFCARRGFHGSYSFAYWGQGTLVTVSGAKTTAPSVYPLAPAAGAAGAGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLADLYTLSSSVTVTSSTWPAESITCNVAHPASSTKVDKKIEPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 14 Light Chain
molecule tags Immune system
source organism Mus musculus
publication title Structural comparison of different antibodies interacting with parvovirus capsids.
pubmed doi rcsb
total genus 33
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2009-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gk8H01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gk8H02
1PKQE 1F02I 3PIQB 3L3JA 1HHIA 4OFYD 4X0KB 5D7LD 3HE7A 4R2GD 1AP2A 4NQXA 5TE6H 1ZGLB 4U7SA 4YZFE 4PS4H 1NGZB 4UQ2A 5T1MB 4TVSa 3OF6D 2YPVH 3BMVA 1TETH 4N68A 1I85C 4J23A 3QUXD 1NCDL 3D39D 1KXVC 1P4LA 3DTXB 3LPGA 4XPFL 2F5BH 1YY9C 5DRZB 4JN1L 3WN5C 1X4ZA 1M7DA 5K9KB 3U0PB 3GSRA 2APTA 1XZ0B 1VFMA 4FFYL 3UPRA 1A4JB 2JCCA 1FNLA 43C9B 1BZQK 3WO4C 1MAML 1MJ8L 4OZGB 1D7FA 2WMPA 1KV3A 4PJCF 5DJ2A 3ULUD 2IBZY 3LRSB 3G5ZA 3M17B 2DQTH 4ONHA 2EDOA 3AREB 3DYMA 1SYVA 3HZYB 4YJZL 4LSRH 1YEJL 1T2JA 1RJCA 2OK0L 3G5YA 3KYNB 3IGAA 1G6RH 1BFVH 3WS3B 1MCFA 2DL9A 1CL7H 2FX7L 3KXFE 3LKSB 3RU8L 1CWVA 2DQGH 3QEGH 1ZS8A 5FCUH 4KQ3H 1U8PA 4Y1AE 3TT1L 2R1YA 3V5DB 5FYJH 1T1WB 1T83A 4HS8H 3L7FB 5IP4A 5I1GH 4Z7UF 5BW7A 1I1AC 3KDMA 4P23B 4K9EC 3HAEG 2Q1EA 4L3EB 3IFLH 1MCPH 5MI0C 1A7OL 1VCAA 3C2AL 3FTGB 4PGCB 4I13B 1H15B 5T3ZH 2R15A 1YEGL 1CFVH 5GS0C 4X5WA 3AC0A 4PB9L 4PJXB 2V9RA 1B3JA 4NWTL 1QLEH 2VABA 2AXGB 4NN5B 1S7XB 4OKVB 1N5YH 4BKLB 4N1CA 3WDIA 1QBAA 1Z9SA 4TQEH 4PP2B 1KCSL 3WUWG 3KHOA 2IBBA 1NEUA 5FOBB 2C1PA 3O4OC 4NKMA 2LVCA 1GGBH 3VFVB 5HYIA 5FUOL 5J06A 1B2WH 4UTBH 3SE4A 4CU8A 2GUOA 4UUJB 4I18C 1BJ1H 2Y4SA 3BGMA 3IJHB 3S5LB 3VDBA 5AYUL 1EFXB 3V6BR 5J6GA 2BHUA 2WBJC 3VXUE 1FPTH 1ZVHA 3ARPA 1T21A 5HPOA 1L4IA 1ZOXA 3HMXL 4M02A 5A16B 4DZBB 1MCLA 4ZXBB 2V7HB 1ZAGA 4FQCH 3HC0B 1TCMA 1XF3A 1DBBH 2W60A 3IU3B 1IM9B 3DUSB 3O2WH 1OSZA 4I4WB 1KPVA 4G7VL 1QRNE 4OBRA 3FRUB 4ZS6D 2VLRE 1UXWB 5ANME 5DHVA 4POYA 3P30H 5KTEH 3FO2A 5I73B 2YD5A 4M1DL 3KHQA 1OTTD 2FGWH 2GUOB 1NLDH 1HHIB 4HG4K 3SBWA 5C0DA 2HT2D 1UA6L 2CMRL 4WW1B 4I3RL 3BPNC 4HIEA 3OKMB 3S4SB 3IXTB 4ZS7H 5SV3A 4ELMF 5E2JA 1NCWH 1Z6JT 3HG1E 5B39A 4QEGA 5ICXA 1U8HB 4RMUA 3LV3B 1MREH 4LPWA 3CCHA 1T1XB 3RFZC 4QLRA 4X5LA 1JI1A 1SYSB 1IGYB 3RWFA 2ID5A 3I9GH 4P23D 2DTSA 3F7QA 5HDOA 4NQDE 2O61B 1T66D 3O4OB 4F7TA 2BVPB 3C9NB 5K9OB 2BVQA 4G8EB 4AMKL 5D7IF 3WFBL 4EIZC 3C6LC 1BOYA 4ONHB 2C5DC 3D39A 4JN2B 1IMHC 2CDFA 3NA9L 2J6EH 2YK1L 4QHLA 4DCQA 3KYNA 4KRPD 4QCIB 2EYRB 4U1LB 4ETQA 1V3MA 2XT1B 4LCWD 4LCIH 3LZFH 1H3GA 4OFYA 2EE2A 2R0WL 1UWXH 1CXIA 4XP9H 4NO2A 1CE6B 1OL0A 4PJ5A 1LVEA 1GC1H 2G75A 4PJHA 4YBHA 1JHTB 3PV6A 3MRKB 4NT6B 5GGSB 1PVHA 4H20H 4M7ZC 4JPKL 2FIKA 4PJFF 3SDXB 2G9HA 1HYSD 1HQ4B 4U3XA 4L8BB 1Z9LA 4JZNA 4XB8A 4OZIE 2R8SL 1UM6L 3RKDC 3CMOH 1FPTL 5DRNA 4L5FL 5C08A 1F45A 4X6EB 3QR2A 4HUXB 1XR9A 4IIQC 3U7WL 2EDJA 3W5MA 3C6LA 1B0RA 4N0CC 3AU1B 4XB7A 2CKNA 4X7EC 4FQCL 1M7XA 5E6IA 4IRSD 1NBZA 4WTZG 2C1PB 2BY2A 3BO8B 1AGFB 3LB6C 3MXWL 4H25B 3T1FA 1V7ML 1ACZA 2NNAA 5GZOC 3OXSA 5D7LE 1TNNA 3QJHB 1CLZH 1U8OA 5EC1A 1X5ZA 3IRZA 4RAUA 2QKIA 4J1UA 1LNUA 1JGDA 4HKJB 1GGTA 2QR0B 3TH3T 1R3LB 3CVIL 1J5OH 2JF1A 2EXYD 4I3RH 2W07A 4ODWB 4XPBH 1FL3A 3V0VA 3NAAL 4ZS7L 1D5ZB 5D6CA 3O6FD 1OP3H 4AENB 3EHBD 3MFFA 4QF1B 2BCKA 4U1IB 1ZE3C 1G7QB 3PP4H 2VN4A 2YR3A 5J12B 3LQAL 1BD2E 4GQ9L 2R0ZL 1JV5A 1GZQA 1TZHA 1OLZA 2WANA 3RWJB 2NNAB 4LMQI 3UBXG 3IAPA 1N6UA 1VEPA 4EOWH 2BSSB 4C56D 5JUEH 5JIKA 4XAWH 2X4PB 4OZIA 4HMCA 4X6DA 3ULVF 3QCUL 4P57A 1KYOK 4BFIA 2JE8A 4M6NH 1VKXB 2QEJA 4G6KH 2EXYC 3FFCD 2C4FT 3QPQC 1CBVL 4JRXD 1FL3B 1VACA 4MAUH 4G8GE 3QXUA 5ACZA 5KSBE 2P1YA 1PDKA 3L3IA 2P5ED 4JVPA 2NX5B 5FYJE 3MFFB 4QF1A 4HPOL 5DRWA 3PQYA 3T1WA 1NAML 3B9AA 5EORH 3RIFF 1XGRA 3UBXB 4LDOB 1NBQA 2OR7A 3QFDA 4M93C 3L3GA 2E7CA 5H37H 5KSBF 1FYTE 1NFDB 3TP4A 3CX2A 1IM3B 1HH6B 3JV0A 3PWLA 2AS5M 2VLJA 2OTWA 1RZ8A 5B39G 1IAOB 4N5ED 5F9OL 4Z95L 3H9SB 5JPNA 4R4FH 4ZYKB 5JHLL 1FNSH 3FQWB 4LL9A 4MA7L 4U1HA 5EBWA 4NQDA 1QRKA 4D9LH 3S7GA 2J12B 4I3GA 1P7QB 3QQ3A 5DRWB 1J0HA 1ADQH 3QDJA 2FB4L 3ARQA 1EHNA 4OZHF 4PJ7A 3MUY1 2OS7A 1RHHB 1R3JA 4OQTL 5J12C 2NLJB 3U46A 3SO3B 2BJML 3TJEL 4DN3L 4P2RD 2VMFA 2A73A 3S98A 2GY5A 4DTGL 4JQXA 3WBDA 2BSTB 5C2BL 3UX9B 4HS6B 4LSTL 4YWGL 3UC0L 1MFEL 4MVBD 2OSLA 4TNVK 4OZGF 4P9MH 4XBPA 4MDIA 4K3DL 3VE0B 3HNTH 4LAQH 5EZOH 4ZYKA 4PJIE 4QWWC 4LP5A 3O6KL 2NXZD 3KWWA 5DUML 3MBXL 1OD7A 2VJXA 3ARVA 3WE6A 5DD6B 2F8OA 3VGDA 3CVHB 1YEHH 1OM3H 2Q8AH 4PTTB 3WFCL 1A6ZA 2DJ4A 4ZMAT 2MTPA 4AT6A 2R0LH 3QJHA 4M7LH 4UIKL 4Y19D 5KVMC 4CN4A 3R4DA 5CHNB 3W0WD 5TJWK 1I3GH 5LGKA 3O41A 3BVNB 3ARWA 3VXRD 1WJ3A 4HS6A 4QTHA 5FA4A 2DD8H 2VLKE 5CP3H 3D48R 3HE6B 3DX7B 4MXQD 5GGRY 3U4BH 5JW5B 3LKOB 1E4KC 5FKPA 2J8UF 2BOCB 5ERWB 5CIPB 4Q58C 5T1DL 3ILPA 4LSUH 1CXFA 1E28B 4RGND 1XGTB 1ITCA 3ZHLA 1PEWA 2FO4B 5BOPA 5KVFL 4N0UB 1QRND 3M1BB 3BDYL 3SDDD 5I9QB 1F4WL 5C0CA 5CKAA 4KUZH 4FABL 1I1YA 4DW2L 4ZNEA 4AIXA 5D7KE 3TO4D 3MGTA 2EZ0C 4RZCA 1AY1H 5I6XC 2A77H 3MBED 3TN0A 1CN4A 1XIWD 2AJZA 1T0NA 3NCEB 4M5ZH 4LIQH 3WXVL 4Y4FD 2NYYD 5DTFA 3RA7L 2VXUL 4L8SA 1A6VL 5A3IC 3JWNC 1DTUA 3QB7C 5KW9H 3MREA 1TDQA 5SWZE 1RIVL 3MCKA 2ESVD 2PCPB 2PYFB 3O0RL 1H5BA 1AFVH 3MV9A 1DUZB 5C92A 4TRPH 2UYLA 4YDVB 4LASL 5IR1B 5J1AA 4DUXA 3GUTA 4YGVB 2X4OA 2XI9A 3RVWD 2YPKB 5DMGC 4QRUA 4KKCC 1FL6A 2E9IA 4Q9QL 2HRPL 3TVMD 4K3JL 2FECL 2RBLA 4OFPA 1C12B 4WHTB 1EO7A 4U6TA 3QUYC 2YD8A 1S9YA 3I6GB 4HFUL 4TULL 1KEML 3S6CA 1WQVT 2I25N 3LH2H 4ZFOB 3R06A 5B22A 3SCMA 4L8SB 4MJ5B 2AV1A 1FBIL 4RBPK 3HTLX 1T2QL 4RSVA 1RFDH 2NY6D 4PJGA 1G9ML 3V79C 1MF2L 5D7JD 5H2BB 4KRLB 5SWSE 3LEXB 4HPYL 1TTGA 3QDMD 2B5IB 2VN7A 4Y16D 5J56B 4KV5F 3MBXH 4Z0XB 3SE3A 3B9VA 3IB4A 4G7YH 2EDNA 3QPXH 2Q8AL 1KGCD 4PJ8C 4Q9BA 4R7DA 4MA1C 4NCDA 3ZDZF 4F37K 4IOFC 5FM8A 4UTAL 5HVFB 2CJUH 3BJLA 4L3AA 1T3FA 1AGDB 5CJ8A 3QNXB 2NY5H 1BM3H 3G04B 4BQ9A 4LLQA 1EFXD 5GRYA 4WI8A 1INEL 4Y2DA 5FGSA 2VLME 2O5YL 3BZEA 3LEVL 5GQBA 3ULSA 1CICA 2H26A 4K23L 3ALXA 3DVGA 5EIIA 2H1PH 3SKNB 5ICYA 4PGZA 1LO2L 3AY4C 5C0BA 3TV3H 15C8H 2MQCA 4WU7B 4JLRA 5F96L 4OIIH 1IC7H 4BZYA 1A7NH 2VQ1A 4CDHA 1EO8H 3VGEA 1X5LA 3VG0L 1H5BC 4RDQF 2P5WA 2DB8A 2HFGH 3HUJF 3KPNA 4S1RL 3MA7A 1XCTB 3DMMB 1KGCE 4P9HL 2D03H 1CD1A 3LKOA 2OYPA 1T03H 5TQ2H 4AM0A 1QA9A 5JO5A 4IDJH 5T1LD 3Q1SH 3TN0C 5JOPD 5KW9L 2E27L 3N85H 1A9EA 5SWSD 4AL8H 5I1DA 1RIVH 4E5XB 3QUKB 1NJ9A 2NXZC 3WHXB 4MX7B 4JFZL 4ZO9A 2DQDL 3NOIA 1OGAA 4XRCB 1E27A 2RGSA 3TA3A 1I1AA 3P4OB 1LMKA 1TVDA 4O2FB 4BFEA 2A6JA 4ALAL 5IVXA 1RK1B 1ZT7A 1HWHB 5JIHA 3FZUC 1YUHB 2JB6A 3EFDL 5DJ2B 3RUGA 3RVXD 1NH6A 1J8HB 5EIQA 3HAEB 5JXEA 4PJ9D 5EZLB 5CCKL 2W65B 2PXYD 5EN2A 3ZMRA 4JB9H 4UQ2B 3BYTA 5ITFA 5IVXF 4GT7A 1BX2A 3I2CL 3VFUA 3UTTD 1UH3A 5H37G 1AI1L 2ZOLA 4K2UH 3BIKB 1KCLA 4QHKJ 5T3XE 5DHYA 1ZHLB 3MV01 3FFDB 1DQDL 5HPMA 4WVRA 4X98B 2X4RA 5D70H 2P8PB 4I8DA 4ZPTA 1VFUA 1E27B 2H32B 4HPYH 3T0DA 5GGSY 4RIRB 4XBEH 3I6KA 3WN5A 4O5LL 3BKYL 5HJ3A 5T1LB 3EO0A 2Y23A 4WFED 3CX5K 4PJXA 5E2TL 3UAJC 3RBGA 5L88L 5I0ZA 3ZKXB 3FOMB 4YHNA 2AXFA 1FZOB 2W1NA 5KSAC 4OCSH 1RUKH 3X14B 3F7YA 5F3BA 1BX2B 4PJCA 3G5VB 2WP3T 3PHQA 3CSGA 3VXME 1NDMB 4M1GH 4KKNA 1INEH 2AJXL 4L29B 3RVUC 4WFGE 3V5DA 2H3NA 3IETA 3MRGB 4URTB 2KDGA 1K8DA 4JM2D 2VOTA 1QPPA 4O00A 5HTSA 4UUJA 3LKNB 1EMTH 4HJJH 4PJ8D 4EQ2A 4ELMB 1IC7L 4OAWA 3DVFA 5E0QA 2A83A 2LABA 2VDKH 1K8IA 1AGDA 7FABH 4DZBA 1IGCH 1QLFA 3WEXA 3VH8G 5AAMA 3S4SG 1TZGH 3BYYA 2B2XL 4LPUA 4P4KD 3A6BL 4Q7DA 2JCCF 3QIWC 3G6JA 4M00A 2O5ZH 3ZHKA 2EDLA 1JZ2A 1KJ2H 3W9DA 3Q1SL 1QNZH 4RWYH 3BRFA 4H88H 2XIDA 4XI5D 4HQQH 5I9QC 1U8IB 3KLHD 1RUAL 5I8OH 1UJ3C 4YPGB 5E7FA 5LXGL 3PWPD 2J8UE 4PJDB 4Q9RL 5BRZB 4G8FA 1MNUL 5BS0E 2MPAH 5SX5K 1F11A 1A6WH 3FN3A 1RJLA 4U7MA 4K8RL 4J6RH 3X3FH 4LFHD 5CCKH 2OP4H 2CGRH 4GW4B 5HHQB 2ZCLH 4KHTL 3CFKB 3ZE1F 1JWMA 3K80A 5BVPL 5HYEA 2ZKHL 4OLVL 3IXAA 1VENA 3TVMB 1M7DB 1JGEB 1MCQA 3W9DB 4PJFB 4K07A 4IRJA 3PWJA 3VFOB 3K8LA 1MFDL 4LDEB 1ZT7B 5GRZA 2ENSA 3P9WB 5JW4M 1IEAA 1DBMH 1KJ3H 1N6VA 1QHPA 2OI9C 3EFFA 3W81A 43CAA 2ESVB 4HCRA 4JFEE 1EEQA 3G9VA 4F3FB 2NXYD 2HMIC 1MAJA 5BXFB 2R2EA 1QD0A 3FKUS 1AIFA 1GHFL 1CDBA 5DMYA 5MEND 2Q86A 2ZUVA 2J4WL 5L7XL 3E6HB 3GO1L 3H3BC 1CI5A 1YY9D 1RVFH 2APWA 5CSGA 2AJXH 1X3DA 4PJHB 2HFEB 4K3HA 2H9GB 5DJ0A 1NKRA 1YYLL 1OLLA 3QEQD 2YKLL 2Q3AA 3CDGB 3ULUF 4MZ2A 3CUPB 3MRCB 2D9QB 2EKSB 1I9IL 5HJ3B 1OQOA 4G43A 4XP4L 3V4UL 4S1QL 2OL3L 1XR9B 4XVUD 1OGTB 4L1DA 4QHLB 5GJTH 1T20A 4OIBA 1BBDL 3QCVL 2CLRB 1IGCL 1QTYT 4U1LA 4PP2A 5SX5H 3QULB 5F9WB 4HIIA 1HHKB 1T1ZB 4BH7B 1PBYA 4BSWA 4YHIB 5IOPB 3U7AA 4JFFB 3TPKA 3TBSB 4WNQB 2B39A 4AY0A 4HXBL 3T4YA 3LS5L 2PW1B 4QRSA 5ENWB 1K5NB 3UJTL 1UADC 4H88L 2LTQB 5DT1L 2Z35B 1ZA3B 1DQQB 2QSVA 3SDDC 4ELMA 4IHOA 4XC1L 4U1JA 1MCPL 4GRMB 5KANI 5H8DA 2XZCH 5C0EA 5EU6B 1NMBH 3JWDC 2HT4D 1T7XA 2NY6B 3BQUD 2BFVL 4HV8A 2HLFD 1ZVYA 4M5YL 1M71B 4EDXB 2AJVH 1JBJA 3C6SB 3MRRA 5IHUH 1MQ8A 2OXGA 2I5YH 3MRFA 3V4VL 1WBZB 5IF0A 4NQSA 5C6WH 4OCWH 2FEEI 3QULA 3VJ6B 4XNUL 3RL2B 5I74B 2J88H 1DDHA 2DN7A 4PRPD 1W72B 4XT1C 3OAYH 4DKFL 2PW1A 2Z93A 3KPMB 4F9LA 4NJAL 1Q94B 4X6DB 3L6FB 1RQ5A 2HP4A 5DC9B 2DIAA 4P57B 2BC4B 4JFXB 4KI1A 4Q6YA 3U4EA 1UT9A 5MENB 3GNML 1VKXA 1G7PA 2WIIB 4LLVA 4V1DA 4WENB 4QXGL 2CLVA 1LO0L 5B39B 3W2DH 2J5LB 1XGPA 5E8NA 4JPVL 3CFKA 4XVTL 3QIUA 4I0PD 2I07B 4ODHL 3VJ6A 2B7DT 4OCNC 5EWIL 3D0VA 3VXNB 2IJ0C 1AO7D 1T4KA 4M1DH 5I1EH 2XA8H 4UT6L 3UZVB 4F7TB 2FGWL 4J2XA 3SKUD 4X4XB 3CGTA 1W72L 2VLLB 2HT2C 3JWOC 5F1KC 1AXIB 4N8VG 1MVUA 4JO2H 3RY4A 4M8QA 1DLHA 4TSCL 5EO0A 3STZA 4OM1H 3CDFA 4DCQB 4DN4L 2A6KA 3MLSL 4AEFA 4WV1B 4EN3D 4XP4H 2A74B 2EYSA 4I48B 2P49B 2QQNL 3BKCH 4WU5B 1QFUL 3GJEA 4EUPG 5AZEH 5EBMB 3CK0H 1FDLH 5F72S 4Y0GA 5ESVB 3VXRB 4AIZB 4KJPC 5DK3A 1LWRA 1FAKT 1A6AB 3LQZB 2DQFB 1B9ZA 1YN7A 2XV6B 3I3DA 5EO9A 3CFCH 3MRDA 4P49A 1BQSA 3T2PA 1MJUL 5DD0H 4LPXA 4N1HB 3REVA 3SKJL 5DJ8B 4JFHD 2X42A 2DMKA 4NO0A 1PZUB 1W0VA 2KUTA 2VTFA 4Y5XC 3RBSA 2OSLB 1KJMB 3DI2B 5B4MD 2WQRA 3T65B 5BVJA 3PL6A 3GMOB 5C7XH 4LLUA 5FXCH 4NHCL 5E2VH 1T6VN 2H41A 4PJEA 5DEGA 3WD5L 1AGEA 1HHKA 3QAZC 1GAFH 3GBLA 3MXVH 3RY6A 3BE1H 4EI5D 1YC8A 4JFEA 1VHPA 2DWEB 4HWBA 3LAFA 1EGJA 1R5VA 3QEHB 3IDJB 4MXVE 4W70A 5GGUB 2FHBA 5I15L 4DKEH 2D7TH 3IJSB 4LEOB 4MA8L 3V8OA 4QXUL 2Y25A 5J6HA 1CG9A 3ILQD 5DA4A 1ED3B 5IWLC 4C54A 1QSFA 4ZSOE 5DO2C 3U30C 5J8OA 4OCRL 4P9HC 2HWZH 2WV3A 4IIQB 4TSAH 2JIXD 4HV8B 1WCQA 2P8MA 5HYSA 1M71A 3VD9A 2JLLA 5D5MB 4F7PB 1NCCL 1SJHB 1DEEB 6CGTA 1A7RH 4P3DA 2UVFA 4OD3H 1UCTA 5D1ZA 1GGUA 5I18H 1FZJA 4G5ZL 2HKFH 4LPYA 3RI5F 2AK1H 3QP3A 1OP5H 3K4ZA 1M05B 3G9AB 4RISH 3VXUD 2Z93B 3WFHA 3ARGD 1Q94A 1KLUB 2BSRB 4YK4B 3GKZA 3V7MA 4Z7VF 3P0YH 1RURH 1W72H 2AJZB 35C8L 4RMRA 1NPUA 2FJFA 3BD3A 4JY5L 5DQ9B 1EAPA 3MA9H 2WIIA 3PGDA 3BIBX 4N0YL 2NX5D 3X12A 5SWQB 4HBQA 2P8MB 3BZFA 5HYSB 2IFGA 3RPIB 2RAMA 4JY4A 3HFMH 1KB5A 5ACZB 1RZFH 3MLSH 3O2VL 4LSPH 1WZKA 3UO1L 3HA0A 5GS2H 4F7EB 4OCYH 5D1ZB 3VXQB 3ALWA 4ZO8A 4OLEA 3TYGH 4HC1H 4XMLH 3DGCR 4IM8A 3NIFF 4JFDE 2X44D 4NRXB 4XAWL 2OLDA 2HA1A 1SM3H 2G60H 2HYMA 4X6CA 3CSYA 3V9FA 5DD0L 3MX0A 1SEBA 5DK2A 4WHYH 5HYSG 3MSPA 4JFOB 5JW4Q 3GSNA 2X4NB 1A2YB 1DLHB 4NBYB 1A4KA 4MA3B 1S78C 1FJ1B 1E6OL 4U1NA 4MJ5A 4KK6C 2R56L 2I9LB 5ISZB 4YHYB 3ARYA 1MLBB 2Q8BH 3TIDA 4KTDL 3VFGL 1HOCA 3KXFA 2Z4QA 1X5YA 5I6XB 4I0PC 1UM5H 2DQFA 4ZAKA 1LE9B 2NTFA 2D31A 2NY0B 5H35A 4QHNB 2CKBL 1QKZL 3FMGL 2VITA 4WUUB 1NUDA 3BFOA 5DUBA 1F13A 4ODBD 3HPJA 2B0SH 1U3HC 3RRQA 4U6XA 1F6AA 4LLQB 3HC4H 1V3KA 5E4IA 3DVNA 2DIJA 5KAQG 4OIAA 3JUYA 4M03A 3VRIA 2YPVL 3VXMD 2ILLA 4U1GB 2CDEA 2X1WL 5E9DE 2OBGA 3H3PL 1OWRM 1PY4A 5F3HB 4G9DA 4OD3L 3Q3GA 5GIRB 5DR5H 1OF2A 2R69H 4P2OD 4YQXH 1RJZA 3GRWL 2W0KA 1R3HA 1R5WB 5JW4N 1RK0B 4JJHA 3L3JB 2ATPB 4I2XA 4LSSH 5HVWA 1VGEH 4L4VD 5L2KE 4NO5B 4K8RD 2ERJB 1RURL 2C7UA 2DYPD 1BHGA 3IKCA 4KPHL 1CD1B 2VXSH 2BNUB 4W6WB 1Z3GL 1I7UA 4AYFA 1KULA 4PGBB 2BP3A 3FB8B 3HNTL 5EZOL 1A64A 3KPQB 4NM4H 2DM2A 3MGOA 5BV7L 4Y5XB 3QI9D 5I1DB 4P2RB 5C0NC 1S9WB 1S7TA 1C5DB 2VXQL 5GHWL 4LLAA 4NZDA 3FHQA 4N0UA 4F8TA 1JN6A 3LKRB 4YXHL 2EDKA 5K59F 5CD5D 2YEZB 2HRLA 3SGKA 3SJVA 3TYGL 1A14L 4XNZC 5KVEL 3A0OA 2AABH 4HGWA 2AJSH 3HAEA 4P3CH 3MGAA 3I50L 4JDTH 3WFDL 3AREA 3GIZH 3MRJB 2DRUA 2MHAB 1KJ2B 1BFOA 3BN9D 4I77L 3O6LL 4APQC 3N1QC 3ZKMD 1YEGH 1P69B 3P2TA 1XIWB 4QRQB 4XCYB 5T1DH 4C58B 2ZG1A 5D1XB 1N5YL 3FHAA 3FFDA 3RVUD 1A9EB 1QSEA 1MCCA 3KNBB 1RZJH 3ARZA 1NBYA 1UWEH 4OD1H 3T77A 2H6PB 3U9UA 3B9KD 4LGPB 4R0LC 5E9DD 3SDAD 4YX2L 4J3VA 1B2WL 3T0VA 1BQLL 3KPRE 5IGXH 1EX0A 1UG9A 4PJAB 5CGTA 3QZWA 1IM9D 3TNNB 3VFPB 5IW1B 3F5WB 1DSFL 1JRHH 4V1DE 4Z18A 1CF8L 2XQBL 1N7MH 1TJHH 3PHQB 4JO1L 3MMEA 4Z7UB 5F70A 5ALCL 1Q72H 4PG2A 5H2BA 4X9IA 1S5HB 1UZ6F 2HFFA 3SDCC 1SVCP 1ZHKB 4ZAKB 2FHCA 4HZAA 2RJMA 1RZKH 4GMTH 2ATKA 4UU9A 1ZLSL 2F19L 3KLHC 2ORBL 4KY1L 2MCPL 1WT5A 3GSVB 3GRWH 1MJJA 3TJHD 4KGLA 3PXHA 4MJ6A 5IQ9A 2A1WH 3BP6A 3K0WA 1U3HD 4MS8D 1KENL 2YOCA 3DWTA 5CSBA 2KKQA 1QFWM 4U1MA 4OFIA 1UA6H 3VFSA 1R24B 4PRAA 4UT7L 2EH7L 2OX5A 2GAZB 4GSDL 1LD9A 4Z7VB 5HI4C 2YD4A 4J12A 2DYPB 3VRIB 1NMCC 1KPVB 2C3VA 4Y7MA 1L0QA 4PJCB 1IQDA 4F7MA 3QHZH 1TVHB 4Z7WA 4DK3A 3QQ9D 4FTVB 1AXSB 1FH5H 3FRUA 5FF6B 3IETB 2VXQH 3QDHA 2AJ3B 4XXCC 3P9LB 1AHWA 2UWEE 5EZIH 1T5WA 1JGLL 4G6JL 3T0EE 4KGJA 3QXDA 1A14H 3BEWA 3LDBC 1I8MA 3RWDB 4JQIL 2YN3A 4JRYE 2MQ3A 3IJYA 4WW1A 1YDPA 2ZPKH 5HHME 2I60L 1YPZE 3QCTH 2ARWA 5EIVA 3EDDA 1GGIH 2WZPD 1HWGB 1QA9B 2J6EL 3ARRA 3NA9H 4YO0A 5JO5B 1IKNC 3LEVH 2G5BB 2OJZL 2NY4C 3GKWH 1RUQL 1ZT1B 3DX9B 3SDAB 3R0MA 1MCWW 4MNQB 1RIUL 4UINH 3MPCA 4LCIL 2QLVB 3PWJB 3VFOA 1AXSA 3B9KB 1ZLUK 4F57L 3I6LD 3O45A 3M45A 2A6JB 1RK1A 4KQ4L 4XVSH 2P48B 2Z91B 3VWJC 2NR6D 3BT2H 2HFGL 4M43L 3RVTD 4JN2A 5D7KD 3NPZB 2EIZB 3L95A 5I19L 1G7LB 3ME0A 1V05A 5T1MA 3IAGC 4MQXC 1IZKA 2EDFA 4NWUH 3VFNA 1PG7X 5HHQA 1W0WA 3IFNH 2RFXB 5D71H 1CF8H 3MLWL 4FQLL 5E5MA 1JGUH 2VXVH 3U0WL 1WAAE 1C08A 2QHRL 1F97A 3IXAB 3T04D 1Q72L 1DUYB 4LARH 1KIRB 4D9QE 3RDTA 1J12A 4FXGB 4FQHB 5C0AE 4IRJB 4POUB 1GOHA 5F1NA 3MRKA 4ALAH 2APFA 3O8XB 5ITBH 1OB1B 1RU9H 4BELD 2F19H 4PJ9C 4DVBB 1LK2B 3BPOB 3HMXA 4M6ML 2WK2A 2FWOB 3QJFA 2QQLH 1C5CL 1D6VH 1SY6H 5A40E 5BV7B 3FN0L 1T20B 3GGWB 4PJHF 2R2EB 2ZSWB 2B1AH 2F5AH 3AU1A 2BVUA 1BJMA 2FZ3B 4OZHE 4HULB 4HUXA 3ZYZA 1F90L 1NBZB 2N7AA 3MV7D 3UYOD 3QRGH 3LQMA 5FUZL 5D70L 1DBJH 4PBWD 3QHTC 3HNSL 4Q6IA 1QQDA 4QRSB 1S5IH 5DURD 5GS2D 1SMAA 1FE8L 4W4OA 2H9GA 4GQ9H 1A7BA 3RHWF 4XP6H 2WUBL 4NNXB 3BKYH 3UTZA 5EU6A 4N90E 5IMKB 4PGCA 4CADA 5C9JB 1H15A 5FFLA 1SVZA 2YSSA 5HI3D 2GYSA 4E41D 1QSVA 25C8H 4JKPL 3OR7A 4MAYC 1S7XA 4K7FB 1OT1A 4M3KB 5T1KD 1MWAH 3AGVA 3OPZH 2ADIB 2E7HA 4IDLA 1B4JH 5EBLA 1DQLL 1YJDL 3HUJE 3EOBB 5J13C 1CXKA 1S7VB 2BNQB 1TZHB 3KJ6L 32C2B 4J3OC 4HPOH 4YE4H 5LVEA 1ZSDA 4H1LH 1AHWB 5EORL 1S9VB 2DQEL 2YRZA 1UVQA 3DUHA 3T2QA 4L4TB 3WNOA 4PREB 1DLFH 4FNLL 5GZND 4QOKB 4LCWB 1DBKL 2X4PA 1BVZA 5C0EB 3RGVD 1DQJA 1LO5A 3FFCB 4LLWA 1A1NB 1YQVL 1N64H 3ZL4H 2JJUA 3IFOA 3A6BH 3ARFC 3UDWA 3QIWD 1P7KA 5F9OH 4WY7L 5CGMA 2BNRE 4GH7B 4PJAF 3NZ8B 4RFEB 2VR4A 4MNGB 3IFNL 3L3IB 3QWRD 4GRLA 1OTSC 4HZLA 3K1KC 4FZEL 4GG8B 1A5FH 4HQQL 4LQFH 2V2TA 3QQ9C 3H8NA 1RZ7H 2DLTA 1ZSDB 4HDIB 1WISA 3UTQB 4FQJL 3MYZA 3VFTB 1JZ4A 5E8PA 1KC5L 5SX4H 3CFJA 2XNAA 3IDXL 2OTWB 1TQCB 3QI9B 3ECBB 1HQRA 3T3PE 2Y6SD 4M6MH 1GCFA 4BSJA 1OOAA 4ONFL 4HS3A 1LO5B 2VLJB 3QUYA 1U8HA 4PJBF 5IEHB 1RZ8B 2QQLL 4L4VE 1KTDA 4YWGH 5T5FH 1DJSA 4OSUH 3GSWA 1GVIA 3VH8A 1HKLH 3H9SA 4P2YA 3QIUB 3VXSD 5TH2B 1FNFA 2I07A 4K3DH 4F7CA 5I16B 1FYTD 3DO7B 1EJOH 1OTSD 3LSOA 4X8XA 3MODH 2YMXH 3O9WD 4FQHA 4NN7C 3W11D 2ZUWA 1CU4L 2EECA 4JG0L 5FKAA 4TN9A 1CGTA 5C6TH 1YPZF 3UTQA 3VFTA 3DRTB 1G9NL 1FSKC 3WL9B 4QRRB 1N5AA 4YHOL 1V8HA 4R4NC 5AEAA 2AQ2A 3KPSA 1KB5L 2OR9H 4MYWB 4OZFH 1MVUB 3KPRD 2BNRA 4YHML 4RA3A 4Y88A 5KG9B 3QBTB 1PKQB 5JA9A 3OR6B 5HXMA 2EYSB 5L7XH 2J4WH 1TETL 3VH8B 2OZ4A 3BPCB 3GO1H 5SWZD 4XPFH 3ZE0E 1D5XA 5LKNA 2E5EA 5K9JL 3B5TA 3HI6H 4NKOA 1DQLH 1RMFH 1EEYB 5EDXA 2XTJC 1O0VA 4P2OC 3SOBL 1SBSH 4JHAH 2DQCH 1HHGB 2QHLA 4K94C 4KJWC 3NFPA 2JTDA 3MRDB 4PRIA 4PV9A 1QSFB 2G9HB 3UTZB 2PYED 1MJ8H 1WWCA 1UJTA 3BP4A 5L8JB 1X9QA 3V4UH 1AY1L 1YECL 4OZHA 2ZOKA 4NKDB 3OR7B 1DBKH 1MCNA 4ZFFB 1QACA 2FEEL 4OZGE 2XICA 4EKXA 2V17L 4UZGA 3UYRH 1PKQA 1QO3A 1G6RL 1U8MA 1XF2A 4XCFL 5DEGB 1BD2D 2GKIA 5I1LA 3D18A 2FO4A 3QEGL 5FCUL 4I18A 4H25A 2HJFA 1EEYA 3O0RH 4HS8L 5EOTB 1OAZH 1KLUA 2BSRA 2AXHA 3S88L 3NFPB 3UZEA 2F58H 5JXAH 2XACC 1RUML 1ZGLP 3FN9A 5D9SA 2X4UA 5K9QG 4Q9QH 3MOAL 4IIQA 3OBAA 5GRJH 4P4RA 2FIRT 3T2NH 5IJKA 5D5MA 4F7PA 1BZ9A 2UY6A 2YPLB 1A21A 3V4VH 3RTQD 4ZUUB 5CBEB 1WIUA 5ELIA 1SJXA 2VKXA 3MLUL 4E9LA 3PWPE 3LEYH 1T2QH 3EHBC 2F54D 4AEEA 1MF2H 2VDNH 2EC9T 1J1PL 4GUPB 2WAHA 4LU5H 3GUTB 2VH5H 2UZIL 2NY2B 4M6OH 2IADB 5BO1H 4UTBL 5EUKA 2YD3A 3HZMB 5C6TL 3THMH 1FRGL 4WHTA 4HFWB 1HDMB 3DURA 3QXVA 5GZNC 1SY6A 2VC2L 4V2BA 4MCYB 4Z7WF 3ARDA 1ZVSA 3MYJA 4DFHA 2PNDA 1A0QH 4MD4B 4UTAH 2GSIB 5DEFB 5JHDB 2CJUL 3HMXH 1KFAL 4M4PA 4JR9H 3V52L 2IAND 4Z7QF 5FYJU 4R2GB 3HCVB 4NGHL 2P42B 1FFRA 4D0DA 4M9OA 1CTOA 1LHZA 3M07A 3GB7A 3CPLA 4IS6B 1J86A 3N9GL 5LBSH 3BX7C 5CJ5A 5DQJA 3MQIA 5DS8A 4FZ8H 1HHJA 4EQ3A 1JP5A 1JTTA 1QRNB 4HWZA 2VLRB 3MLZL 1IM3A 3G6JF 3CSPA 1A7NL 1R5IB 1ODAA 4R4ND 1EO8L 2ZNWA 4LVOB 1OHQA 4GG6E 4L8CA 4EI6A 1CD9B 3DURB 5IFJA 2NY1B 3CH1A 2FJHB 4OM1L 4RQQB 3C60C 1R3IL 4NZRH 3EOTL 3MZTA 2X1OA 3NIGE 3RIFK 1J88A 2I9TA 2ITDA 1J1OH 1XCQA 4KZEH 3DX6B 3O3BB 3WSQL 4GXVH 3ULSB 4J8RB 4M61A 5B38B 5E8OB 1S8DB 4KVNH 4CNIB 3SGKC 3MLXL 3HG1B 5EIIB 4Y4KB 1KPRA 2EEAA 1R5WA 4K7PL 1EGJL 4IS6A 2NLJA 4MJ4A 5C0RH 3KGRA 1T7VA 3GHEH 4A6YH 3HC3H 5DS8B 3K8MA 2BERA 3SDCB 5HVHB 5HHXH 2P5WB 5CP3A 1IGFL 3HPLB 2XPGB 2W59A 4J4PA 1J9CT 1NCTA 3PIQA 4NQVB 1YEKH 5FB8A 1LDSA 4Y5VC 1C5BH 1OPGH 2R1XA 1U6AH 3X13B 5CD3A 2OL3B 1CFSA 3A6OA 4NUGH 3E2HC 4DOHB 1DEEA 4XP5L 1N2RB 1Z9MA 4XBGA 4RGNE 4X7SH 3O3BA 4RMSA 3PP3H 4PJBB 3D2UB 1Z9OA 4LHUD 1I1AB 3VWJA 1TQBC 1JNNH 3NCBB 3W39B 3HG1A 3WHXA 2D7TL 4MX7A 2LAAA 1NFKA 4X6FA 4GG6F 2VDNL 1C1EL 1HH9A 1T66C 3RDTC 5H94A 4GRLC 2R2CA 1K6QL 5D1XC 1RZKC 3KPLB 1FC1A 3T2OA 2AERT 4D9RE 2IANB 2X89A 3U1SL 4HLJA 5E1AB 1Q0XL 5DMKB 4UOJA 4ZUUA 4N8VB 2AK4D 3SDXE 5D1XA 1DVFB 5JQ6H 3NGBB 2HKFL 1T7WA 2EO1A 2XG5A 4FFWD 4OLUL 4NZTL 1MCKA 3CVHH 1C16A 4AH2A 3O3UN 1N3NB 3QISA 3TBVA 2YEZA 2X40A 4LOUC 2W92A 2MWCA 3VFMB 2ZP0T 5LBSL 2F54B 1P1ZB 2Z9TA 4JHWL 4HIJB 3TN0B 3O6ML 4PJAA 4NIKB 1D9KB 4RGMC 1ZVSB 3STLB 3L3OA 3BKJL 2BRRL 4Q0XL 1FJ1A 2GJZB 1BFOB 3VD5A 4KDTC 4J4PC 3O4LE 3RTQC 1C8PA 3P4MB 2HFTA 1TZGL 2PYFA 2VABB 4JO4L 2E6QA 5EUOF 4ZS6C 1H5BB 1CT8B 2PTTA 5A2LH 4Q2ZA 2XA3A 1A8JH 3LRGA 4R9HA 2DF3A 1NL0H 1MJJB 1FGVH 1AHWC 2EIDA 3MNVA 3QUML 1EO5A 5FECA 1DN0B 2V5YA 5KSUB 3LKNA 2UUDK 1AO7E 1BD2B 4DUVA 3SY0A 3L5XL 3VFSB 1N26A 4TTGA 4N5EC 1KB9K 3FB7A 4KK6D 3WIFA 5C9KA 2HLFC 1U6AL 1S78D 2AK4E 2CK2A 1UB5A 4X4YB 3BWUC 3C5SB 1MRCH 1XCQB 5JNYB 3RAJH 2JJTC 3ABZA 1TZIB 2D2OA 4ZXBA 1YZZA 2NY4D 2V2WA 5C0JA 5FYKE 1A9BA 1P4BH 3V7AG 1S7SA 3O2DA 1BAFH 4WW2F 4G8GB 2K3TA 1F4HA 1JTPA 1JNNL 3QO1A 2VLKD 3QXDB 1CD0A 5LQBH 4P5KA 3V4PH 2ATPA 1G6VK 2BNQD 5EBGA 5BZWA 1EDQA 5FO7A 5EH1A 4M7KH 2B0SL 4NO5A 5IW6B 4G8FB 3DIFA 3NCJL 2OL3A 5FYKH 3WLBB 4S1DC 1IFHL 2FX7H 3PWVB 4B5EA 3WMSA 4PGBA 1T0MB 5JHDD 1JCKA 4KQ3L 1NFDE 1YA5A 2XXMB 4Y5XA 4E41B 6FABL 4ONGL 3K2UH 1FNSL 4NQEA 4UDTA 3CDYA 3WDJA 5BCAA 2APBA 1VPOH 4YQXL 4PRPE 1FO0A 3W0WE 1KN2L 4MB3A 4F37F 3OAZH 4QTIL 1FZMA 2E7LC 4G8GA 1RVFL 2MQ0A 1QVOA 2O61A 3QQ4A 3E3QC 3QO1B 1E4JA 1G9EA 2YD2A 3LD8C 3EO1B 3LPFA 2GJ6E 1BFTA 4KMTH 4O2CB 3FCTB 1QLEL 1VB9A 1AP2B 2AGJL 4LSQH 5I1AB 4G8IB 5LWYL 1CLCA 1I85A 4HCRL 4WWKC 1ERNA 2Q7NA 3AS3A 4GMSH 1EHAA 1W8OA 4YLQT 3QCVH 2P45B 3ZSTA 3QUKA 3RP1A 2AI0H 3JTTB 4ORGB 4OT1L 5CZVH 5ILTH 4JO4H 2QSCL 5E8DH 3GSRB 4AQ1B 2YHGA 1KTRL 4PRBA 2DQUH 4I5BB 5ANMA 2GSGB 1YEHL 4MJ2A 3ESVF 4PJ5B 5AYUH 1L0YA 2C4XA 2X5PA 5DJ0B 4KROB 4HH8A 1NL0L 4JHBA 3ISWA 2J8UA 3GMNA 2F53A 3I50H 3GIZL 2IG2H 4Z7NF 2FIKB 1CIUA 3FO1B 3VFPA 1JPGB 4XCNB 1WK0A 3SE9H 2ZSWA 1QEWA 1D6EA 4DGYL 1GOFA 3MR9A 1QFWH 1BIIB 3T0EC 5C08B 4HIIB 3G6JE 5E5UB 1BQUA 1X5AA 4WFEE 4YHZH 5JORA 1U8PB 3WS3A 1MI5A 4JFFA 2D7MA 3LKQB 2GK2A 2AEIT 3TBSA 5HHNA 5D7SH 1C08B 2VLKB 1IGJA 2JJSC 1G0YR 3VXPB 3GSOA 1AJ7H 3HS0A 4DFIA 3LB6D 4RIRA 4JM2B 5F1NB 3GSVA 4IHOB 3FT4A 3TZVD 5J9PA 3CZFB 3OXSB 2VIRA 2H8PB 4QRPD 3DX8A 5EZJB 4ZFGL 2WIMA 3IAQA 3ULVE 4JFDA 4YAQA 4HKJA 2KL6A 4LKXB 4NDMA 5HHOA 1ZLVK 5FUCC 3WNPA 4U2YA 5C07D 1IFHH 2D0GA 3RA7H 2VXUH 3LKPB 1G6RA 2CPCA 2HG5A 3LD8B 3I9GL 1A9BB 1FNAA 4ONGH 2D0HA 1BFSA 1HSBB 5KS9A 2IWGA 3QG7L 3S36H 4Y4KD 2CUMA 4NN7B 2PO6D 4YUEL 1U91B 2E7BA 2GTZB 2VDRH 1JHKH 4LASH 5ACLA 2BXZA 4UB0L 1Y18B 2FRGP 1E4XI 2WM0A 4JO3L 3FL7A 5IW6A 4Y4HA 3MBEC 2V9QA 2XZAH 4TTDC 3NCFB 3C5JB 1N4XL 5D6DA 3BZ4B 3HI5L 3LH2L 3WIHL 1D9KD 3P4NB 1YEJH 2HG5B 5DJXA 1ND0A 1NFDF 3GMMA 1ZT1A 3V0WL 2X4TA 1V7NH 1BFVL 4KC3B 3QWQB 5TQ0L 5ILTL 4H20L 3JWDH 3VXOB 1NAKL 5BS0D 3QFDB 5GJSH 5SWSB 3UZQA 1F11B 4Z8FH 4X6BB 1IC5L 3INUL 3SEPA 4H1LA 3C5ZD 1G7LA 4HLZG 1IGTA 4PJXE 1KLGB 3N1FC 1C7SA 4RFNC 3JSSA 3LV3A 3UPCA 1AGBB 3EOAA 3MBEB 3OKDB 1N0XH 4CMHB 1QLRA 1H3UA 3DV6A 3SKMA 2ZCKH 5DJXB 2VDPH 3MXWH 4LVNC 4PJEE 4YHZL 3CCHB 4K23H 1GAFL 2HTLD 2IH1B 2GFBA 3RDTB 1EFQA 5HGBB 1E6JL 1UXSA 5HY9B 4PJ7B 4NN6C 5JOFA 1GGBL 4NZJA 3ULVC 1NC2A 3C9NA 4RAVB 4YFDB 3MUGA 1HILB 1X4XA 3RTQB 5C1MB 4GKSA 1GGCH 1AKJA 3NABL 1GXEA 1CS6A 5F7DA 1D6EB 5ETUB 1Q9KB 4UBDD 3F8UB 3P3YA 1KG0A 1U41A 3CLEL 5D72H 5IQ7L 3S3PA 1NCCH 5JORB 2VXVL 5KSVA 3BRDA 1MI5B 3UROR 3N1MC 1ZGLM 1T6WA 2AJUL 5TPWH 1CE6A 5I18L 2NW2A 5GRVL 4D0BA 3MLVL 5IM7B 1QSEE 1XH3A 4PRHA 3MJ9A 5HGBA 4XPGH 5DWUL 1XR8B 3NBNA 1YJDC 4KMQA 3MRCA 4WEUD 4YUEH 1CDGA 3DX8B 4CADB 5IBLC 1CTNA 4PJIF 1FO0H 3BAEH 1IZJA 5D2NE 3OL2A 5HGAA 3T08A 2A0LD 1KF9B 1Q9WA 2LU4A 3P0YL 3KPSB 3O41B 2IPUK 1AC6A 1WAAA 4TNWK 5E95B 4N0YH 4L8BA 1PSKL 2XFXA 1LP9B 3Q5YA 3Q6FA 4XZUA 1OCWL 1J8HE 1NAMH 3MNWA 1MUJB 5E00A 3VDCA 1DFBL 3K2MC 3BPOC 4U49A 1RD6A 2OXHA 5TFSH 3D85D 4MA1B 1UJ3A 2K1MA 1V7NL 3DI3B 3OHXA 4YR6B 2CR6A 1E28A 1YC7A 2JB5L 3WJJC 1FE8H 4LRIA 3QUZB 2YBRB 1CFBA 2BOBB 4J1UB 5MEPB 4WFGD 4UT9H 2ARJA 4XBEL 2X4UB 1U8OB 5EC1B 1ZEAH 2BRQA 5GJSL 1SJEA 1FGNH 2VZSA 5CJOL 1A1OA 2IPTL 3OZ9L 1EAPB 4JZJB 4BSVB 1A7PH 3BQUC 4BQBA 1WBZA 4EXPX 4Y4FB 4WEMB 1LEGA 5KJRH 4F7EA 3V0VB 1RUKL 2Q8BL 3QXWA 1N0XL 1J0YA 3BSZL 1LGVA 4XCEB 3C09C 4G6ML 1UM5L 4KXZI 1O7SA 3RX7A 1HHHA 1T22A 3D6GA 4M62H 3TJEH 4DN3H 5IIEB 4F9LC 1NAMB 3VXOA 1N6QL 1EMTL 3KPPB 2IGFH 3SDAC 2G2RA 1GC1L 5DK2B 5F8QC 3DXAE 2X4SB 3UC0H 1OTUD 4OZIB 1CFQA 1JNHB 5FO9B 4LSVH 1KTDB 3I6GA 1E4WL 2YPLA 4NQCB 1T89A 3SCMB 4ZFOA 3R06B 1UM6H 4OCMC 1B90A 4HH9A 4PV8B 2AJYH 3SDXF 3VXNA 1OM3L 1CR9L 3U7WH 2DLIA 1U93A 4IOSD 5IK3A 4HAFA 5C8JB 1NLBL 5I8CA 3KG5A 3QXAB 4XNMB 1EV2E 3TBYB 3D3VA 2YUZA 3PHOA 3QUZD 2VLLA 3SE8H 4JKKA 1ZTXH 3C08L 5C0AD 1V7MH 3HZMA 3CH1B 3CFBB 2MPAL 1PKOA 2JELH 2A6KB 3K74B 2R29L 4NQEE 2Z31D 1S7RA 4YGAB 3QIBD 3LQAC 1DN2A 4OLXL 3GJEB 3HLAA 5E7BA 2Q6WA 1IJ9A 5IJVA 5D7IE 3Q5OA 4S2SA 4PRNA 2D9CA 3EYSH 1NC4B 2NY3C 4X8JB 4YDIL 4G3YL 4PB0H 5TDPA 3P73B 5GGRA 4GBXC 5TFSL 4DW2H 3Q3GB 3DARA 5JR1L 2AW2A 3G5XB 5I8CB 1KB9J 5DD5L 1I7ZA 3SDCA 5KANG 1A3RL 1EBPA 1HHGA 4H26B 5C09E 4WU7A 2QQQA 3AB0B 3QDAA 4FQXA 4YHKH 1WZLA 5IT2L 2R0ZH 5FEBA 2R2BA 3LVEA 3QEUB 1MY5A 5I8EA 2YUVA 5GRXG 2AABL 5HGAB 4R8WL 1KB5H 1AQDB 1Q9WB 3DV4A 3GMRB 1VERA 1KT2A 1CGWA 3D1MC 4ODTL 4YXKL 2DQIH 1BF2A 1XCTA 3DMMA 5IB5B 5DVNA 2NX5E 5IB1B 4RGMB 5MI0B 4XBPB 5JIPA 4JFEB 2DWEA 3FQNB 2X10A 4P46A 3VI3F 3WJLA 3J8F7 1RMFL 4WUUD 3FB6B 5DURB 3ES6B 5DF0A 1Q9LB 1UKQA 1V3LA 4JHAL 4K71B 5E70A 2WWKT 3E1F1 3FZUD 4NZUL 5KVGH 4JM4L 3UJJH 4M62L 4TNWF 1YYLH 2J1KA 1A6ZB 5E1HB 1FYTB 3KPLA 4U6YA 1CICC 4TUJB 2YKLH 3CFDA 4GBXA 4C55A 4ERSH 5BMFH 3RUGB 4HF5H 1EHLH 1DE4B 1AQDA 4PJHE 3VGBA 5DO2D 3NH7H 4FQIL 3KJ4C 2R1XB 4JZJA 2KQNA 3H9SE 2EC9U 4LLMB 1JWUB 2V17H 2V5SA 1EEUA 4LSVL 4WCYL 5KN5B 4HUUA 2VXTH 2Y9RT 1DSFH 2ED9A 1JPSL 3T0ED 1FZJB 3ILPB 4Z78B 3S9DB 1L6XA 3BIAX 3FQNA 1T1YA 4ONOA 5MHSE 3FAWA 5ALCH 4EI5C 4WFHD 1UB6B 2AJYL 3HR5A 5CIPA 1XGYH 4KK5D 4RWHA 3VDAA 5DRXB 3DHJA 1NLBH 2XTJB 4N9OB 4X98A 5SV4A 3QWOA 4UI2A 2FB4H 3UTPE 4P46C 4OLWL 1ZLSH 3U6RB 1QPXA 2UZYB 2HKHH 5H94B 2FJFB 4OQTH 3EGSA 5JZ7C 3X12B 3LS4H 3O11B 5EFIB 3EIFA 1CE1H 4OB5L 5DEFA 4YBQC 4R7NB 2JELL 4ZUSB 4HKZA 3MMEB 4PJIB 2ERJC 3H0TA 5D93B 3LPWA 4L9DA 1IBGH 1PLGL 5EU6E 5A3ID 4X9FA 2MMXA 3CSBA 4LAQL 4RFOL 2UYLB 4X99B 1TCRA 2Y7QB 4G3YH 4PB0L 2UZIH 5KAQF 5CBAA 4Y4KC 5CWSA 5FDWB 5FO8B 1F4AA 4GXUN 4LGSB 1JYWA 2DOCA 4NJAH 3CFBA 2R0LL 1KACB 4OZ4B 1E4KA 1OAXL 3BP6B 1C12A 2A83B 2C4FU 4JAMA 5JW3L 2GJZA 3KLDA 1FNHA 4X6DE 5JNYA 3OKLA 4PJDF 1HNFA 2DD8L 4JPVH 4XVTH 4AJ0A 3V6OA 3MJGX 3QNZA 2AV1B 4QT5B 1ZXQA 2HTKC 1I75A 4N5UA 3SBWC 3K1DA 3RL1B 3P73A 4ODHH 4N0UE 5GGRB 5FGCE 2AV7A 3CH8A 2Y7QA 3L5JA 3FQXB 1AE6L 3BKMH 4KI5C 5DJDA 3BZDA 4O9HL 5CZXC 4FFYH 4F57H 3V5KA 4YPGA 4CU6A 5BZDB 4EI5B 3IJHA 2XPGA 3GHBH 4KQ4H 1NGPH 4TNVF 4FABH 1JI2A 3H42L 4U6XB 3B8SA 1FG9C 1YNKL 3EOTH 2VE6B 4HUWB 4PJ7F 3ULUH 5KSAA 1AI1H 3BOVA 4K2UL 4DN4H 1YDPB 1HCFX 3BESR 3LMJH 3RZWA 2CDEB 5I76B 3MRHB 1I9RL 1PG7L 4ZDHB 3ARDC 4OZIF 3OG6B 4F9PC 4MNQA 3WYRA 3SKNA 2VXTL 1CLOH 1KBGL 3RU8H 3MLRH 1CICB 4XXDA 5KVDH 3VI3E 5AZ2L 2P8LA 1JHLL 5B8CB 3DGGB 4Q6IC 3IF1A 4N9GA 1EZVX 2ITCA 1H8SA 5CJXA 3ZSSA 4JANB 2VQ1B 4X5XA 5CMAB 3X3GH 1IEAB 2XYCA 1RU9L 4Z77A 2EIZA 3L95B 4QRPE 5DHVH 2NXYC 4ESKA 1NEZG 4XH2B 5TF1L 5D1QC 1G0XA 4K3JH 5DMKA 2BK8A 4HUWA 2PYEE 5C09A 1B6DA 3JV4B 5T3ZD 1G7JB 5IESL 2XRAL 4CL7A 2B1AL 2F5AL 5IWLA 2DWDA 4Q9CA 1FBIH 1SYSA 4Z7OF 3L7FA 1G84A 4OF3A 4KK8D 3AB0C 3FO9A 3AROA 2X09A 5EPMB 4PLJC 4FXGA 1ZLUH 5B8CC 1R3KA 1MH5B 1P1ZA 4K7PX 2BVPA 4U6VL 3IDIB 5CUSH 2QADD 3TPUA 2WUBH 3PGCA 4UOW0 3CDGA 1H3TA 1H8NA 2HT4C 3QHFH 1J8HA 4QGYA 1J0ZA 5C70A 2B2XH 3K4AA 1CZ8L 2HWZL 2VSCA 4LBEA 3G5ZB 3IVKA 2PXYC 5I1AA 4KWUA 3RZCD 5FHAL 4LCYB 3KR3H 2AXGA 5JW3H 5D96B 5GS0H 4Y19B 2Y06H 4HK3J 4RWYL 3TLRA 3MRIA 4G6AD 5CP7B 5EU5B 3OPZL 4F58H 3L3HB 3OMZA 4I3SH 5HPMB 4OI7A 4R0LA 4PRBB 5I73C 5J9PB 4F15B 4YHPA 2GSGA 3U9UB 2H1PL 4PTUB 2BVOB 4Y5YC 3MNVB 1ACYL 2DQEH 1JHTA 1F3JB 4K8RH 1HIML 4LHUB 3ILQC 1FL5B 3ZO0A 3MRNA 3VXTA 3TNNA 4GRMA 1NGPL 4KHTH 4WWKB 2Z8VC 4IOIB 1PW3A 1RI8A 2X2YA 3EO0B 2EC8A 4N1EA 1P6AB 2E7MA 5KOVC 5AD0B 2XOTA 3DHMA 2ZKHH 3O4LD 2WQ8A 3F7YB 1I8KA 3FOMA 1XF4B 4WWID 3O6FC 1AR2A 3C60A 4K7FA 1S5HA 5IG7A 1CFNA 3X14A 3O2VH 4LSPL 5F3BB 9CGTA 3LKQA 1MREL 3BPLB 4ODUB 2J8OA 5LGJA 3SDCD 4Q74A 4D8PB 3GSOB 4KZDL 32C2A 2FBOJ 2BVOA 2VR5A 2IAMA 4L4TA 4XNYH 5HI5C 2G60L 3I75A 1PG7W 2BZDA 4OAWB 4AMKH 4NUJB 1U8JA 3QIBA 4JFDB 5KSAB 4YDLB 3DXAA 4ONFH 1MHPH 1FNGB 1XF5A 2OZ4L 4F8QA 1Z0NA 4N8PA 1XFPA 1ROWA 5IESH 4QNPE 1UACL 2HN7B 1GIGH 1MRDH 3TFKC 1UC6A 2Q7YB 3LZFL 1U8NB 2NY0D 4RX4D 3D3VD 1FZMB 3L9RB 1LEKA 1I1CA 1G1CA 3IF1B 3IFPB 4N9GB 2DM3A 4R26L 1A47A 3EJZD 5E6IC 1CU4H 4KI5D 3FMGH 1K4DB 1G9NH 4GAYB 2OL3H 5BRZA 1IGTB 1YEDB 3RWEA 4MCZA 1DVFC 2FJGA 4YHOH 2FR4A 3N06B 4GW4A 3WXWL 4LLYB 4S1DD 4WUUE 4OLYH 2FL5A 5CEZE 3RZCB 3CMOL 3DV6B 3SKMB 3WFEH 4A6YB 1MIEL 4XMPL 3KR3L 1FLTX 3SGJC 3UTOA 4FQ1L 2Z92B 2Y06L 5E4EB 1KN2H 2AP2A 3ZDZE 4QTIH 4I3SL 4XC3H 3MV7E 1J0IA 3F7VB 4OF8A 4ELME 1KN4H 1MLCB 4RAVA 3SKOB 4EZMA 5IBLD 4KTEH 5L6YH 3VRLF 4U0QB 4LSSL 4HJJL 2AJVL 4QRRA 1BF8A 1IGIL 5MP6H 2ICWI 1W0VB 5DRNB 1Q0YH 2N1KA 4GMSL 1V3JA 4AG4L 5E5MB 2ZUTA 2DBLL 5L2KB 3FQWA 4XAKD 1NMAH 5BV7H 4GRWB 4NFCA 2JCCE 2W9LA 3C8KA 2NW2B 4D0BB 4QWWD 3KYOA 3VFWB 2DI7A 4DKFH 1BLNA 1XH3B 4PRHB 2GFBB 5J0BA 4ZTPH 2X1PA 1U8QB 4O02H 4PV9B 4X9BA 3MACH 5GS3A 1MLCA 3GNMH 4KXZH 5GPRA 2DLHA 2YC1B 3SKOA 4ZUTA 5BJTA 5A2IH 2QSQA 5LXGH 3NTCL 3KS0J 4X4MA 1CVSC 4AQOA 2EKJA 4ZNEE 1JK8A 3RZCC 1QFWL 2IBZX 4NQTA 1T80A 1FG2A 4QRTB 4LHQB 4M6NL 1Q9KA 1X5XA 5FV1L 4PD4J 1JPST 5GGVY 1KCVH 2JJVA 4JN1H 5E6ZA 2CGRL 3REWA 4OM0H 4UQ3A 2BCKB 5A2KH 4LVOC 1B0RB 4JQVA 1F58L 1FFQA 1ULVA 4X7TA 1OSPH 1AD0A 4PY8J 2P5EE 3ARTA 3MLUH 4YHIA 5F9JA 5L2JA 3OJDA 3FQUA 5EC2A 5E8EB 1FNEA 2NZ9D 1XGQB 1YEFH 5TDNB 2GTZA 1OARL 4KKBC 3HMWL 3Q0HA 5F7NC 1FFNB 2XWBA 3FJTA 3OX8B 3SGJA 2ESVE 1DQQA 4YC2B 3RY5A 4LRNH 2KZ1B 2H2SC 4EBQH 4QRTA 3UEZA 1JRHL 1N59B 2WBJA 3KPRB 5E2UH 4MB5A 1KFAH 3WNMA 1MEXL 2OM5A 3LN5B 1A1MA 1MIEH 3L5IA 4G6FD 4XMPH 4B41A 4QNPF 5DK0A 1DDHB 3OJVC 5E94A 1WWAX 2F15A 4K55A 5FM5O 5L8KB 4IJ3C 4JRYD 5GZOD 3IFLL 4OGXH 4KJQC 2Y36H 4NRXA 3MGTB 3KPMA 2V2XB 5T3ZL 1KN4L 1OP3K 1YEDA 3ARDB 3PWLB 1CFVL 2WWKO 3MLZH 1KTKE 3S3JA 1JWSA 2Q87A 4HT1H 1HDMA 1ZKAA 3OB0H 4KV5E 1A1OB 5HYJD 3FT2B 3O3EB 4Z5RA 4ZFZB 4LLVB 3BE1L 1AGBA 5F7LB 2EH7H 4O58H 1KLFA 1NGXB 2VAAB 3HB3D 3MREB 3AFLA 2XZQH 1TXKA 2DBLH 3JV6B 4KUCD 3MCKB 1M4KA 1BBDH 4MDJB 2A6DB 3CMGA 1ZT4A 4Z7VE 3GI8H 4OI9A 1FORL 1KPUB 4U7KA 1TJGH 2FCBA 3VI4F 1JGLH 4G6JH 3HC3L 4L8CB 3S37H 2HT3D 1FL6B 2IMMA 1DVFD 2LVEA 5GS1B 4DKDC 4E42B 4K94H 2UWEB 3NTCH 4QXWA 3T0EB 2FJHA 3GSWB 4KRPC 1F6AB 4MDIB 5CZKA 4G5ZH 1T7YA 3DX6A 4NUGL 3KLAA 3MOBH 1P2CB 5ID1B 1ZANL 3HE7C 2VAAA 2I5YL 4KK9C 4MZ3A 2IAMD 2OJZH 3U30B 1JYXA 4RISL 1EK3A 2AQ1A 4DZ8A 1TFHA 3T8XA 5HHPA 4OCWL 1NCAH 2FBJH 2PO6A 4Y4KA 1KPRB 5L9DH 1NLDL 1A02N 3D39E 3QNYB 2XWTA 3EZJB 3UTSE 2CRMA 4MNQE 3RNQA 1K9TA 3L3DB 3ZT5A 3BVNA 4P3WA 3QAZB 4M43H 2JK5B 5C07A 4BQCA 2WBWB 1TJIH 3HE6D 4BFBD 3X13A 2M1KA 4LLUB 4M5ZL 1FIEA 4WTWA 1CFSB 3T65A 2W9DL 2Q6WB 4U6HB 3FOLA 1QBLH 5DMIH 3VE0A 1KJVB 4QRPA 2F8VA 4XMLL 4KK9D 5JQ6L 1NGWA 3TZVA 4DEPC 3DJ9A 3OJDB 3PXJA 2NY7H 4NN6B 4HW6A 5C0CB 1NCBH 5JPMA 3QDGA 1K3IA 1SM3L 1ES0A 3MJ6A 5DDHA 3U0TB 5JLZA 1D5MA 1FZKB 3V95A 3RNQB 5I1EL 3RWCB 2YK1H 3RKDD 4CJ0A 4M6AA 2HRPH 3G6DH 3MA7B 1MCJA 1PSKH 5HVGB 4KTDH 5D4QA 3VFGH 2AVGA 2DMCA 5D1QD 4Q0XH 3KJ4B 4U1KB 4TVPL 5IB1A 4GW5A 3AS0A 1P4LB 4QRQA 3HR5B 3OGCB 2FATH 1DUZA 1RFDL 1QFUH 4M93B 5FUZH 4KFZC 1CDYA 5AZEL 5EG6C 1N0LA 1CGVA 3RGHA 1XZ0A 2RCSH 5KS9E 2X9YA 3M1BA 4DGIL 4ODXB 1FORH 1GZPA 3CFCL 4KJYA 4F80A 3E8UL 4RZCB 4L5FH 4WHCA 5C09D 3PGDB 3BP5A 3V2AR 5KBNC 4JKPH 3BZFB 4GAGL 4PYGA 4ZQKB 1BM3L 1B6UA 4MJID 1TVBA 4MXQC 3MUHL 4HHAB 3EYFA 4HKXB 2A6DA 3D0LB 2KPNA 2I27N 5HGDA 1MFAH 2VDML 1P4BL 2GQHA 4B0MM 1VADA 5CWSB 3OAYK 3QA3A 4JRYA 4YE4L 1YNTB 2IADA 1VGEL 3SE4C 4UU9B 3G08A 3IS1X 5F96H 3TO2A 4HFWA 5T3XL 4OIIL 3IDUA 1S9XB 2F74B 3AVEA 4MNQD 5F1SA 5LQBL 2VXSL 3OKKB 5GS1A 1QFWI 3QIUC 1A4KB 4MA3A 1EBAA 1Z3GH 2OJEA 2UWEA 3HI1A 4QXUH 4M7KL 1A3QA 5D93C 1U9KA 3LIZH 3SY0B 4JCLA 2WBJD 4B7LA 3S35X 3NAAH 4JRXB 4P5TB 4ZG1A 1N64L 1TTFA 2V2WB 5IJVB 4PJIA 2VZ1A 4Y2DB 2D03L 5GHWH 3H0TB 3ALPA 1MJ7L 1NC4A 1J05A 4U05A 3BJ91 4X8JA 1KCUL 2H26B 2P43B 3LQAH 3VGFA 4P99A 1LE9A 5FOBA 1A5FL 2FH8A 4FTVA 4WFFE 2YXFA 3SE8L 2GT9B 4P3CL 3RJDA 2NY7L 3C08H 3DPBA 4X83A 3QCUH 2A2QT 5DD1H 5IFAL 3U2SB 1YMMD 4RQQA 3WHE0 1YEIH 5ESQA 5J6GB 3KAAA 4RBPH 1I8MB 1NBVL 1T21B 4XHJC 4YDLC 3Q5TA 1NEZB 4JAMB 4LSQL 5HHVL 2QL1A 3MJ9L 2V7HA 5T5FL 1MRFL 3BD5A 3NACL 5IBTH 4NP4H 4ODVL 3GJFH 4WHYG 4YXLL 2MNUA 1WBYA 2NY2C 1OGAB 2EIEA 5FA3B 4OT1H 5CZVL 4LVHB 1XGUA 5GGVL 4D3CH 1PFCA 4MNHA 4OF5A 3ARBA 4Y16C 5EOCL 4BZ1L 4KRNA 2DDQH 4NYLB 1GYAA 5F7WC 4JG0H 5C07E 5HDQL 1EHXA 3EJZC 4HC1L 5AUMB 2QADC 5EUOB 3FCTA 3JZ7A 4X7CC 1RJLB 3SGEI 4OJFL 3S4SA 4JG1H 5JHLH 3MCG1 5E2TH 2AEQH 3LKSA 3NIFE 3R8BB 2XQYK 3FB8A 3H9YA 4QRRD 1ZLWH 2R1YB 3VWJB 2OI9B 3N0PB 4XXDB 3E0GA 4IRZL 1KEGH 1IQWL 2W0FA 3BHBA 2BJMH 4G9FD 2VDMH 4FFVD 4WJ5A 5IUSA 2DQCL 4DTGH 1YY8A 3SJVB 3HZKA 3UTTB 4KJYB 5GRWA 4F9PA 3EFFB 4Z76A 4DVBA 4DVRH 5D96C 1ZHNA 5D1XD 5T3XH 4OCXL 5IHZA 1A3LL 2XKNA 4WUKH 3QJFB 1CIDA 1JPGA 4XCNA 2XKSA 3UYRL 1L9MA 5AG9A 1PZ5A 4S0TD 5GSRA 5BRZD 2FZ3A 4H0GA 4QHUB 3GI9L 2H3NB 5KSBA 4NKMB 2OQJB 1YNTA 4RAHA 4WGVB 3BHBB 4M7LL 5B38G 4HKBB 4ZODA 3QG7H 3S36L 3HS0B 2BXYA 4JQIH 4PGDB 4LHUA 1MH5A 1BOGA 3VXTB 4P46D 3IDIA 4GLRI 5IMMB 3QCTL 5INCA 2Y07H 3QIWB 3LRSA 1IAII 5JZ7D 3D25A 1SYVB 2JJTA 4ZXBC 5ALBH 2YRPA 5GRJL 3GKWL 4RMVA 4X6EA 2NY1D 5CEZD 1BECA 4LVEA 1IBGL 2OP4L 1RIUH 3JXAA 5TE7H 5HD8C 4DJMA 1CGSH 1MHCB 3PWUA 3O3DB 4L4TD 3ZZ1A 1BGXH 2WLYA 4OLVH 3BO8A 5IFHL 3VGHA 5BW7C 3TH2T 1HE7A 3GSXA 2HFFB 5CS7A 3FQXA 5I1HH 5JTWA 4XMKH 2ICEB 4LU5L 4M7JL 1Y18A 2CUIA 2DDQL 1HYRC 3I6LE 4U1JB 3A6CH 4HMDA 1IC5H 3INUH 2VE6A 3D25B 3O4LA 4FQLH 4U1MB 5ICXB 4Y8DC 4PR5A 4AEIL 2VISA 3MRHA 3GMMB 5A1AA 4UOW1 4OGYL 4C57C 1JPFB 1GHFH 3V52H 1IAKA 12E8H 1S7SB 5HD8D 3T0AA 2MOVA 4YC2C 1I9JH 1MCRA 3I84A 3L9RA 2HTKD 5JHDE 4CVUA 2CR3A 3NN8B 3IFPA 5B21A 2LQRA 4Y89A 4D8PA 4P5KB 4IRZH 1T5XB 3SE3C 1IQWH 1RZJL 4XCCL 1RZGA 3TBTA 5C71A 2CLZB 2FR4B 1YNKH 3T0BA 5HHMD 1BQLH 5DUPH 4V1DB 3QIBB 1KCRH 1AIFB 3VD7A 3RZCA 4JM2F 4NZRL 2YD6A 5A16A 3ARDD 2YD9A 3DTXA 1J8HD 3WUWA 1L9NA 1CLOL 4UV4L 1J8KA 3DUSA 3MLRL 3O2DH 1EXUB 1IL1A 2MKWA 1BQHB 3MUJA 1UCBL 4G7YL 3LSOB 5FYLE 1WZ1L 1MCIA 1DL7H 4G9FA 2DI8A 4HBCH 3GSQA 3GHEL 4BUGA 1WWWX 2VO5A 3TPUB 5ICZA 4D9QD 5F93C 4XC1H 2NR6C 2EE9A 2ED8A 1X5GA 1P9MA 4F3FA 5MERA 1QBBA 3FRPA 3VFNB 1F3RB 1JNLL 5ALBL 3OKYA 4XP5H 2AAVA 4BM7A 4FTVE 3AAZA 3TCLB 4YIQA 3SDDB 3UMTA 1IGYA 3RWFB 3QDJB 3MC0A 1BVKB 1DLFL 4WHDA 4YHPB 2EEBA 3ARBD 4RGNB 1Z0MA 3I02B 4HK0B 5ESAB 3HNVL 2CQVA 2YC1A 4CW1A 3BWAA 4PJBE 4Z7QE 1H0DB 1PJ9A 4FXLA 2YN5A 5EZIL 2VKWA 5ICZB 2FWOA 1AXTL 1LK2A 5A2FA 1Q1JH 2IH3A 1YPZB 3KLSA 4CMMA 1CLYH 1NDGA 1T03L 3AUVA 5GS0L 3VCLA 3IU4L 4BA8A 3F58L 1MCOH 2JIXB 4BFGA 5F6IB 3JUZA 3TESA 2YD7A 2IANE 1Y6KR 1YMMA 4X7TB 1IGJB 3DO3A 5DC0A 4KROC 4NZTH 2VWEE 4YEEA 5F9JB 3KYOB 3VFWA 2AKRB 1R5VB 3QEHA 4PRHD 3QG6B 2FX8H 2V7NA 4FTVD 5JDSB 5EU7C 4LEOA 4NT6A 5F7FA 2XA8L 4UT6H 1ZA3A 4TVPD 5SWZA 4WI3A 3U4EB 4JEGB 3VXSB 3U82B 1W0YT 4LK4A 2IGFL 4YAQB 1NC4D 4A2LA 4OSUL 1L0XA 4XVJL 5D9SB 1K85A 3GMLA 4JZNB 1XF1A 4JVUA 2NYYC 4FQQA 1SJHA 1AKJD 4HAGA 4HIHA 1FVEB 4WI5A 3MODL 4E0RA 1BJ1J 4NRYA 4R3SA 1YMMB 4HIXH 3ZE2E 4DGVL 1TNMA 1UEMA 3NN8A 1WAAF 3CK0L 1FDLL 1XGTA 5D71L 3MLWH 5C0AB 3RL2A 1AGFA 4XCEA 3EOBA 3U0WH 2BDNH 3FQUB 5E8EA 4LVHC 5D2LA 3O9WA 5I75B 3QDGE 4X4XA 1W72A 5CJBA 1WZ1H 4J3WA 3OB8A 4JPWH 1JWSB 4YHMH 3VXSA 4HWEL 1DQJB 5L88H 4PJGF 4TTDD 4KKAC 1KELH 3MJ7B 3QH3B 4MJIA 4L4JA 3BZ4A 4FP8H 3G6AA 4Y4FC 3QUYD 3LN4A 2OZ4H 3NZ8A 1D6VL 1WGOA 2KQMA 2DLEA 3WNNA 2D7QA 2X4TB 3DRQA 4EUPH 1P7KB 1UACH 4JQXC 1OQXA 1DCLA 4R3SB 2N4IA 3VRJB 5BS0A 4U1IA 1A1MB 1SBSL 1UWGL 5C86A 1G7QA 3MXVL 1F90H 1I1FB 4LRIC 3D0VB 3D69B 4HSQA 4W81A 2NY0C 4G9FB 5DSCA 4DQOL 5D2LB 3OJMB 2YUXA 3RKPA 2R1WB 5LCVH 5I15H 1CGUA 3S96A 3R0NA 2FLBT 1FIGH 4JRWA 4OV5B 5DMGD 4YHKL 2X70B 2XNAB 5IHLB 4EDWL 4LHUG 4ZOCA 4L8SC 3NFNB 4OCRH 1A2YA 3EO9L 4P5TC 3CLFL 1DP0A 1S7UB 5TE6L 2AEPL 2DMBA 5D1QA 3WFEL 3QFJB 4WV1A 2NPLX 1QYGL 1AGEB 3MV8E 4Y4HD 3SQOH 2QJDA 4FQ1H 2I9TB 2DM4A 4P2QE 3AAZB 4GBXD 1OAZL 5IB3B 2F5BL 3IDJA 5ADOL 5F9DC 4OTXH 2ENYA 2D3VA 4H26A 4JFPA 2NTFB 3TA3C 4E41E 3QDGD 2R4SL 4Q9RH 1FLRL 4PUBL 4PY7A 4LCWE 1VFAB 1U36A 4NZUH 2QV2A 5JOPE 4GKSB 4J6RL 2FX9H 1HQ4A 3HPLA 3FFCE 4RNRA 5DJ8A 5MP6L 4HJ0D 4UILH 3PGFH 4U1SB 2AGJH 2Z31B 5FDYA 4DK6A 4XVJH 5BVPH 2BNRB 3HE6A 5JW5A 3WCYA 4XAKE 5T3XD 3SGDI 2RR3A 2A9NH 4KMLB 3TNMA 2GJ6B 3NPSC 2IALA 5EU6D 5EBWB 5CJXC 3FB6A 1JPSH 2FEDD 4P46B 2DS4A 1MY7A 3OKNB 1UZ8B 3D5OF 3Q6GL 2PR4H 2PO6B 1XR8A 2FHFA 4MQTB 3TWCL 1Q9LA 1UENA 1PYWA 4K9EL 3MOQA 4OUUA 3DSFH 2R2HA 1AGCA 2VC2H 1YN6A 3RQ3A 4JFFD 1MI5D 4NNYA 2HKHL 1KC5H 1NCUA 3NCCB 2ADJB 4FS0A 5J57B 4PJ5E 3EJJX 4U1SA 4NGHH 3UJIH 4LGRB 2FH6A 1CE1L 5E00B 1E6OH 4AM0B 1F58H 3CDCA 1CL7I 2YUWA 2F53D 1DVFA 1CK0L 1HKLL 5C0AA 3U7YL 1OAYL 4QGTA 3QEQB 3ZYIA 5C08E 1UZ8A 4KK8C 5DFTA 2PKDA 5IR1A 4ODXA 5LAXB 1ITBB 5EOTA 5T5NG 5IVXB 5J89A 1INQA 2R2HB 5DJZA 1MAKA 3S34L 2XXCB 4R97C 4MQ7A 5C0GA 4S1QH 5IVZB 5E99L 5INDB 3QH3A 4MJIB 4ZFGH 3AMKA 3BMWA 1JF1B 2MHAA 1U8KA 3LN4B 4KZEL 2M2DA 3QO0B 3L3OB 5CBEA 5T33L 1OAUL 2OTUB 2OTPA 5E2UL 5HYJA 1FV1B 1BZ9B 4U1KA 3HC4L 3L5WA 4GOSA 3ZKND 1HCVA 1QBML 3C5ZB 2EDDA 3D87B 1H3XA 2PW2A 3FRPG 1TCRB 5F9AC 4JFHE 2DLFH 1I1FA 2EDBA 3ET9F 3UJTH 3R8QA 3IS0X 2EH8H 2CIKB 2P8PA 4Z0XA 3UBXA 4OGXL 5K9JH 3HI6L 1QSFE 5FYKU 4UDUA 2Y36L 4CAGA 5C0BE 4I1NB 1I1YB 4ZAKC 1OPGL 2XZCL 2Z8RA 4GXUM 3OKKA 4RCAA 4LVNB 3HKFA 2GCYA 4NQED 1HH6A 3W82A 3C5ZC 4CMHC 4MQ7B 5C0GB 3BI9X 4X6CB 5JHDA 4P59H 4X80L 1U0QA 4I9WD 4X7SL 3RWHA 4NKIH 5DGRA 4MAYB 2HJKA 4KPHH 5C3LD 2OTUA 1N4XH 1U3HB 2ICES 5HYJB 5F1OB 1LO3H 2LAGB 4FHBD 5C8JA 3IDMB 2A9NL 2EDWA 4KAQL 4HWNA 1KSRA 3TBYA 4XX1E 4Y5YB 1CYGA 5TQ0H 1OAKL 3V5KB 1MIMH 1JHLH 3TF7C 2HT3C 4I2XB 1HHJB 5FCSH 4YGVA 5I30L 3D85A 4HWZB 5BZDA 5I1CL 3HPJB 3UP1A 2YPLE 4D94A 5TF1H 4GJTB 4PRNB 3O6LH 4OQ1A 4P4KC 2L0DA 3BW9A 1KIQB 3WKML 4QYOA 2XRAH 2ICCA 4MNHB 5L9DL 3T0XA 4OFDA 4Y5YA 3U7YH 1WITA 3O6MH 3MRLB 3GIVA 1OTTC 1CFTA 2MCG1 1FQ9C 4WW2B 4TSCH 4JPKH 4PJ7E 2DQHL 2DJUA 5E99H 1G7JA 1HI6A 4XBGB 2UZXB 1NQBA 1I8IA 1OAUH 3MROA 2NXYB 2G5RA 2FEDC 5IHBA 4JR9L 5K9KA 3HUJA 2X4RB 1JGEA 4GAFB 1S9WA 3P77B 1WLHA 5M95B 1VDGA 3TIEA 4JLRB 2H6PA 1I3UA 4GMTL 1JF5A 4Z76B 2W0PA 4PBXA 3HE7B 4WW2A 1HIMH 3BH9A 3P9MB 4YDKL 4N8VA 3IGAB 5BV7C 5E2VL 4TVPH 5E1AA 1FV1A 3MRIB 4HJGB 5CP7A 5EU5A 1LILA 1LK3L 1R3IH 3TBWB 3A67H 3V6OE 3GEWB 1UB6A 1RIHL 2VDOL 5HGDB 3DNKA 2OQJA 4DKEL 4WEBH 5K59E 3CFIC 2J3SA 4P2OB 2HFEA 1I3RA 1A4JA 1ORQB 2P5WE 3P0VH 3MLXH 4RX4A 3TBVB 2DTML 4XX1G 4LF3B 4J3XA 4K7PH 5EOQH 4TSAL 4A6YL 4I0PB 1DBAL 1VEMA 3FO0L 3KYAA 3STLA 4HIJA 2H8PA 5JUEL 4DWHA 1T89C 5JW4R 2VRAA 3ROLB 2W65A 1D9KA 3F65A 2FSEA 5TF0A 4DOHE 5I1CH 4HKZB 1UEYA 5DC4B 4JDVB 2GAZA 3DXAD 4LKXA 5HHOB 1MCWM 1OGTA 2EYTA 4HXAL 2DBJA 2I60H 2XN9B 4MD5A 5TGBB 4J4PD 1IT9H 1G6RB 1MFCH 4L4VA 5DJAB 4WI2A 2XTLA 5D7JC 4XWOD 4FFWC 1ZS8B 4XNXH 2DM7A 3GSXB 5IROC 3IDNA 3L7EA 2IQAB 1GIGL 2PTTB 1P5UA 5C3TA 5CEZL 5E24E 5FO8A 1ZHKA 5LGJB 2CIIB 5KSUA 4P2OA 4NQUA 4G80A 3WJJA 5FECB 4HGMA 4ACPA 2IF7A 1FVDB 1LEIB 3C8DA 2FGZA 1AQKL 1WWBX 3BEWB 2YA1A 3MFGB 4HUVB 2NY4B 4MLSA 2KZWA 4XVSL 5IMKA 3BUTA 3N1PC 1PAMA 4HCRH 3C60D 4RFNB 4BH8B 2RIKA 2DQHH 3ZKXC 3DXAB 5HHOD 4JFDD 2QSCH 4OKVA 1Q0XH 5E8DL 2ADIA 5FYJD 4RDQG 1XF5B 4GO6B 1UXWA 3TFKD 3QUMB 3FQTA 3PWNB 3KYKL 4FQPA 1IQDB 4MA7H 5ICYB 3OKOB 5E03A 1T5XA 1ADQL 2F54E 2UVEA 1J18A 1X6LA 3PJSB 2FJGB 3U36A 5CEYA 1NBVH 4HUMB 4PB9H 1IAIL 1KTLA 1OTUC 4HX1A 1G7PB 4LSDA 4NWTH 5IEKA 5BXFA 5IV2B 2R29H 3SHSA 3VU2A 3O4LB 1QLFB 3WEXB 4YDKH 1XAUA 3ZHDA 1Q0YL 2GIYA 1HXMA 4KUCF 4ODVH 4OLXH 4CVXB 2PTVA 1IL1B 3HB3C 3MO1B 1CXLA 1AJ7L 3V7AE 5BQ7A 4NQEB 3S35H 4GRLB 4HZLB 3HHRB 3O6KH 1RIHH 2VDOH 3VMPA 1FO0B 4JKLA 1U8IA 1A3RH 1AO7B 4ZO6A 3F7VA 3O45B 4OZGA 1MWAB 1BZ7B 3GDBA 5HDBF 7CGTA 5DLML 2VNCA 2Z91A 3MACL 4HEPG 5EZLA 1H3PL 2Z8SA 3U36B 1VA9A 4QXTA 5EN2B 4ENED 5C09B 1Y6MR 3RTQA 2AK4B 4U31A 2AEQL 3IXTA 1RZIA 2BVTA 5BOZG 2A6IA 4G7VH 1HXMB 4WU5A 2YZ1A 4BH7A 3PDGA 4BSWB 1Z5LB 1JYNA 4XGZA 3RAJL 4X6CF 2HH0L 1A6AA 2G75B 4XNXL 1HEZB 1MCBA 2K7QA 4G8GD 1BEYL 4I5BA 2N7BA 5FKAB 4CW1B 1BAFL 4X4ZA 1YEFL 3LRHA 1OB1A 4NSKA 4NC2B 5MEQA 5C0IB 2IH3B 2YSSB 3FTGA 2F53B 3FO1A 3V6OC 1A3LH 4WUKL 4AIOA 5J3HD 3C87A 2A0LC 1FG2B 3K8KA 1JGVL 4NM4L 3MRBB 5KSAD 4PP1C 4J3UA 5FYLL 1RZIB 2X7LA 2IFFH 5IF0B 4G6AC 4FG6C 3Q6FB 4NQSB 3RUGE 1I3VA 5I66A 3EYOA 5KZCB 1F4YL 5GISL 1MFBL 3DOSA 1MEXH 3W0WB 1S7VA 2BNQA 2GI7A 5HHNB 5ECJE 3MRQA 4FFZH 4K71C 3MRMB 4Z8FL 3U83A 4PREA 4TRPL 3TT3L 3QDMB 4ZOAA 4PBVC 3NPSB 1HINH 3ZT6A 4NSKB 5MEQB 2D7OA 2Y07L 4IOIA 1F3DJ 4CGTA 4ELKA 1U92B 3JVGA 3SDYL 5I1IH 2BNRD 1IAIH 3KPRA 5HI4D 4KMTL 4HFUH 5IG7B 4POZC 3K46A 4LCCA 4RFEA 3C6LB 1CVRA 2R0WH 1CGSL 2ZZUT 2CO7B 4O2EA 1I1RA 1GGYA 4YEFA 1UYWL 3OKOA 4LLDA 5I1HL 4J7RA 4WNQA 1UWEL 4OD1L 5CIPH 2B4CH 3RWJA 3FO2B 5CILL 1E0OB 3C8HA 2AXJA 4ZNCD 4PJDA 4AEHH 5I1JH 1U91A 4GRWF 4K3GA 5JA8B 1JZ8A 2R8SH 4N8CL 5DLMH 4Y4HB 2APVA 5IEKB 5IQ7H 5IV2A 1OAXH 2DKSA 2X9WA 2E9JA 1A22B 3RPIA 3EJYD 4LLWB 3FT2A 3O3EA 4JZJC 5DVKA 1FAIH 3GMPB 2CDGA 1T1XA 4HD9A 4LCCB 3VGGA 1I9JL 5ESVA 2RB8A 5CAYB 5DVOA 5F97E 3TC9A 4GAJH 4MNGA 3JV6A 5DSCB 1E4XL 4GUPA 2HH0H 1NCAL 2FBJL 2EDQA 1MWAA 3D3VB 3SOBH 2BVQB 4G8EA 3F62A 1KPUA 1OD9A 1JMXA 1I7TB 5LG1A 5FGCB 3CVIH 1IKFH 4HJ0C 3QIUD 2IBGA 1DANT 4PPTA 3T0EA 5DJYB 1OCWH 4GSDH 2AK4A 3HE6C 3MYJB 5DFWH 1UH4A 1DFBH 4WI6A 1U95B 3ULUL 2PXYB 2UV3A 3QUYB 3B8YA 1XGPB 3RGVA 4P9HH 1JF6A 2Z92A 3O2DL 4GKOA 4ZPVB 5TQ2L 4S2SB 1P4IH 2IH1A 3VW3L 5TH2A 5F7KC 4XCFH 3PQYB 1UCBH 1KBGH 1IC1A 4JFPB 5IMLB 4W68A 2WWMC 3MV9E 2VZVA 4BYHA 4IRJC 5H35B 4R90H 5IROA 3E6FB 2LE9A 1ZEAL 1CDUA 3HG1D 5F44A 4H5SA 3L3DA 3QZWG 3GBMH 4WUUA 2IPTH 2XWTB 3ZYOA 4YH6A 1VFBB 1R5IA 4ENEC 2VDRL 5JXAL 2ZOKB 4I9WE 3P4LA 1Z2KA 4WRLA 4LKCB 5DJCB 5GSVB 3DMMD 1S7UA 3DVIA 3OSKA 1HZHL 3EKCA 3G6DL 3DETD 2H2PD 2XZAL 5KG9A 1KJVA 4QRPB 3H7BA 4JY6B 2ITDB 4HK3N 4DKAA 1CXHA 4H8WC 2P24A 3B3IB 4LMQE 2AKRA 2PYEB