4P5TD

14.c6 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
199
Chain Sequence
FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords TRA protein
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 199
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5tD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5tD01
3ARFD 4KROD 4NDMA 5LQBL 2RQ8A 5E8PA 1T1WA 3WO4B 1HE7A 1UB6B 2H2SC 4NQVA 5DTFB 1WTGT 4X6EA 2FHBA 2YBRB 4KAQH 3H9YA 3L3OB 4JM4L 3R06A 2XN9B 5J6GA 1UZ8A 1RPQA 4C56D 3DGGA 4U1KA 2Q7NA 5I15H 1U8OB 1J05A 4JY6B 5E8DH 5FOJA 4X6CA 1FAIL 3VGBA 4AL8L 3D87B 5D96C 4ELMF 2APXA 4LDOB 4G6KL 1BQLL 2JKXA 4FNLH 3F58L 3T0EC 3P4NB 4GW5B 4ZYKA 5FO9B 3WE6B 5E4IA 1INEL 5EFIB 1VERA 2CUHA 3RNKA 5H94B 4QRPE 3EOYG 4JFEE 2DL2A 4LRNH 3BVNB 3Q0HA 3E2HB 3IU3A 1TZIA 4QXTA 5F7DB 4KMLB 5D7LD 4LF3B 3FQUB 1KPVA 5K9JL 3UJTH 4KQ3L 1ITBB 4RA3A 4BSWB 1OP5K 1KJ3L 2W0KA 5EWIL 4R26L 3ZE2E 4KKAD 5I74C 3MJ7B 1CFSA 3ZSTA 1A6UH 4TPRL 2IADA 1A7PL 1D5BB 2B7DT 4YR6B 5TQ0L 1Y18B 4WU5B 3TT3H 4NIKB 1JL8A 4PJHB 1T0MB 1T04B 2FL5B 4QF1A 4JZOB 1PY4A 2HFEA 3FT3A 5KVDL 5HDBF 4OZIE 1EO7A 5FYKD 5T5NF 4YIQB 5BOPA 2VWEC 3JTTA 4FP8H 1SEQL 4JAMA 5IMKB 2FX8H 1U95A 2BRRH 3G5ZA 3VA2C 2JJUA 2JK5A 4GG6F 4QHUB 2HKHH 4OZFB 4EDWH 2V5RA 1XGPB 4Y4KC 2C3GA 4O51A 4P9MH 2CKNA 5F1NB 2J6EA 4Y89A 2AK4B 1NCBL 4N5ED 4X6DB 4Z7NE 1C5BH 4UOJA 1DR9A 1YEKL 4FQ2H 1DEEA 2I26N 3KXFD 5IMMB 3B9KD 3X3GL 1T4KB 2QR0B 3RWFB 3LPWA 3KDMA 1CICA 1ZS8B 1KENL 4QTHA 3WNPA 1NLDL 2IEPA 4K2UL 3S5LB 3QJHB 2HT3D 1ZT7A 3BPCA 3D39D 1ZKAA 3DV6B 5C0JB 2L7JA 1AO7D 1F90L 2DM3A 2ZCLL 5DRZA 2ITDB 5FDWA 2E7LC 3MRPB 1CLYL 3QQ3B 1U0QA 4XVUD 3GMMA 1NEZB 3B2UC 3MV8B 1KV3A 3WLBA 5C0ND 2CO7B 5MEND 1XGTA 4LOUD 3GSXA 2EECA 2LFGA 4MX7B 5D1XA 1OD7A 5D5MB 5JW3L 3ARDA 4JPIA 2VZ3A 3DYOA 3AB0B 1CBVH 2VAJA 4JREB 3RZCC 2OR9L 2IPKA 1OAYH 2XIDA 3QZWB 1DBBL 1HINH 1FLTX 3QDGB 4HMEA 5FA3B 1R3IL 4PRPE 2A6IA 3S88H 3MUGA 1TVHA 1YY8A 3IETA 4OFIA 2EC9T 4EI5A 5ESQB 3S36L 4XMKL 1FNEB 5D2NE 3T2OA 2ZUWA 1T66C 3MLUH 5HHQA 4NQEA 3SDXB 3U2SA 4WHYH 1F58L 1ZA3A 1HCVA 1IM3A 1LWRA 7FABH 4H1LH 4MLIA 5J13C 4UAOB 1RFDH 5L2KE 2ADGB 1A6ZA 2R1XA 5C9KA 5D72H 4I48B 3MCKA 2DICA 5FF6A 3TBYB 5K59E 4GKNA 3JZ7A 4LEXH 3DTXB 1QLFA 3MRCA 2EE9A 1YEHL 4R2GD 1WAAE 2ZNXA 2IAMD 1RURL 1XGUB 4WRLA 4P5MB 5SV3A 1U3HB 3O41A 3W5NA 3NPZB 1FORH 1UWGH 3IFNL 3DBXB 4QYOB 4YGAB 3C60B 3QEQB 2W92A 4KVNH 4NC1E 3RI5F 5IIEB 5K9KB 4NO5B 5JDJA 3AUVA 4YO0B 5CEXB 4P4KB 4ZG1A 5B39A 4KQ4H 4LPUA 1WC7A 3UYRL 5HYSB 1Z9OA 2SEBB 3DXAB 4QHMB 5I1DB 3OF6D 4LHUD 4P49A 3ZKNC 4NJAL 4E41B 2ARWA 3SE9L 3UPRB 4X99B 5DMGC 4CL7A 3DWTA 1P53A 4PGBA 5I16A 3MBEA 2ARJB 3C8DA 5GRUL 1KNOB 2VDPH 4J8RB 1JZ7A 1S7XB 4QKXB 3T3PE 3OKYA 3H9SE 2QSQA 2H32A 3QR2A 1YMHA 2VMFA 1RZFH 1NANH 4OUUB 3G6JF 1UJ3B 5EZJA 1GHFL 5ADPH 3H3PH 4OF5A 2XQBH 1YEEL 3SDAC 3QG7L 4Y5YC 4UTBL 3N9GL 5D7IF 4L5FH 1MCIA 5B8CB 5DMKA 4PJ8D 4TVPD 5KAQG 4JFQB 5EUOE 4LLVA 4JDTH 3LKSA 3QQ9C 2GSGA 4HUUB 1HQ4B 4UIMA 3OKMB 3DETC 4IRZL 1DQJB 4DAGH 4NOBA 3HHRB 5MERB 2VR9A 3QNZB 5KJRL 3KYKL 3ULUE 1J0JA 5T3ZL 1U41A 2KUTA 5J8OA 3KYMA 3QI9C 5KZCD 1QHPA 1XGRB 5IHUH 5TE7H 1Z3GL 3BIBX 5SWZE 5C9JA 1HHJA 3RX5A 2HLFC 1YMME 4RWYH 3AS0A 3LQZB 4BQ9A 5GGSY 3KAAA 1R24B 2IF7A 4MQTB 1A3LH 3G5YA 1CVSC 3RAJL 2AJVL 2C1OB 3BZEB 4LCCA 4PJ7F 2VZ1A 3EFDL 1JHLL 5CSBA 4JANA 1A7QH 4NRYB 5IVXF 2ZZUT 1WCQA 3SJVD 4YC2B 1TIUA 3WJJC 4BFIB 2A74A 1MEXL 1FZMB 4HPYH 3QEUA 2BXYA 5BJTA 4N68A 3ZDYE 4KDTC 4RRPG 3X3FL 2X5PA 1FYTE 2R29L 3WFDH 3HR5B 4XHJC 1KGCD 5DK3A 5GPRA 1WK0A 1GZPB 4YXHL 3PL6D 3S34H 5GGRY 2VXVH 4HGWB 5IBUB 3U48A 2AV1B 2VRAA 2QEJA 4OJFL 3PIQA 5I0DA 2F53A 1KB9J 4LNRA 3TBVB 2OL3H 1NGQH 3BKJH 4NQDD 2XRAH 5IB5B 1YEGH 2DQCH 1SJEB 1MVUA 1ZV5A 4JRXA 5C0EB 5FO8B 1G84A 3DRTB 4QNPF 3WFEH 1EERB 2A77H 4X6EB 1UKTA 2HH0H 4IRSA 5FM4A 3RIFK 3MACH 4ONGL 3HG1E 5FYLH 4U1KB 5EU6D 3BEWB 4K71B 1NEUA 1NPUA 1R3JB 3O45A 3WBDA 4X6CB 2IBZY 3P11H 3P30L 2UZXB 3EOTL 4OV5A 1L7TH 1TVBA 1WICA 1MJ8L 1G7PA 3D2UD 4OKDA 4KHTL 4YBLB 3O2WL 3ZKQD 4RQQA 3SE3A 3RVUD 5IFAH 4HWBH 2IH3A 4UTAL 5JTWA 1QTYT 3ROOA 3L3DB 3NCMA 1EMTH 4ZYKB 2BNQB 4J3WA 4K3DH 1MCPL 43C9B 5I73C 3BW9A 4EOWH 3IU3B 1RI8A 3BPLC 4QXTB 4JFFD 3O4LB 2ADIB 2FGWL 5E0QA 4Q0XH 4X6BA 1WIUA 3NZ8B 1G7QA 4H88L 2KDGA 5TDPB 3NIGF 5DD6A 3NFPB 4YDVB 5CKGA 1AKJD 4FQXC 4LPTA 4KHXH 3ZLQC 5KBNC 5DK0B 3QCUL 4MQXC 3BRDA 1U8MA 2WBWB 1FO0A 1IL1B 3FT3B 1J1OL 1BREA 4UDTA 3I6LE 1TJHH 1AR1C 1N6UA 3ZHDA 3FO0L 4MDIA 3CH8A 1ZSDA 3HNVH 5I9QB 4WGWB 4KK6D 3OAUH 3LKNA 3G5ZB 4MXWL 2K7PA 2E6JA 1MRCH 4G7VH 1IAIH 4XP6H 3IKCB 2ED7A 4R3SA 3O11A 3QAZC 3HPLA 1ZLVK 2BSRB 4M4RA 3B9AA 2Z92A 1IZKA 4APQA 4W70A 4ODVL 4F8TA 4PRBA 4U1LA 4JDZB 4PJHF 1UWXK 3FHAA 2VDNH 4K3JL 2GEEA 2LABA 3IFPB 1HXYA 4I8DA 1DN0A 1CICB 1SEBA 2P1YA 2VQ1B 5KW9L 3RWIB 1KJMA 1ZT7B 6FABL 3QHZL 4XNQA 4Y5VA 4IS6A 4H0GA 4Q6IA 2DMCA 3D69A 4GBXC 4ONFH 2BSED 1U91B 3U79A 4LVNC 1ZEAL 1KN2H 1TQCB 2PYFA 4IRJC 4ZMAT 2VAAA 3T09A 5DRZB 5FDWB 5IOPB 3UTTD 4GG8B 1CF8H 3CSGA 3R0NA 1KSRA 4TUKL 4TNVK 3EYVB 3WLBB 3V79C 1D6EA 4X6DF 4X5WA 2D31A 5FEBA 3GSXB 4NQCD 2DL9A 4ZD3H 4GAJH 4HWEH 1YNKH 5HGBB 3ARDB 4JPIB 1JI1A 5HHXL 1P7HL 3VRLE 5JHDA 4KTEL 4HMDA 2CUMA 3EJZD 5TJWK 2IPKB 4HIXL 1XGQA 1A6VH 3EO1A 2X4TA 1NGZB 1CN4A 4ZNCD 2A6IB 1VESA 1EGJL 3EYOA 3MUGB 1GOGA 1TVHB 2W0LA 5IW1A 4EI5B 2GW5A 1FAKT 5CJXC 4WI4A 5HHQB 3OKLB 4H0HB 4RZCA 4ZO8A 5SWSD 1Q9OA 4L8BA 4RGMC 2Q87A 5GS2D 3TO4A 5F88A 3MGTA 2CLRA 1YQVH 3HI5L 5MEOB 1AE6H 1CXLA 1CK0H 2LVEA 1GC1L 4MAYD 5C2UB 3NABL 2P4AB 3ARSA 1CI5A 3GMPB 1QR4A 4AG4L 5EIIB 5I8OL 2VZVA 3T0EE 4Q9RL 1HN1A 2YR3A 1QLFB 3MRCB 1TNNA 2EIZB 1B0RA 4MA1B 4N1EA 5CD3A 1L6ZA 1N8ZB 3FJTA 4BM7A 1QQDA 2XWTA 3REVB 3OR7B 3W2DH 2QSCH 3QCVL 4KKBC 4G8FA 4JQXC 4P59L 1BJMA 2VXTL 5M7QA 1KC5H 1MCOL 4BUGA 1QEWA 4Z7UE 1ZLSL 1YQ2A 3BH9A 3M07A 4ODWA 1T7VA 2BY2A 1X5HA 4PLKD 4FQIL 3TA3A 5BRZD 5LAXB 3SDXF 2CK0H 4GRWH 4OI8A 3QH3A 4DTGH 3U6RA 5B39B 2R56L 1NCWL 1DBAH 5ITBL 4EUPH 3WJLA 4MWFA 4YNYB 4LCWD 1S9WA 3RY4A 5IT2L 4Q97A 1AGFA 1ODAA 2WIIB 1QSED 1ZLUK 2NNAA 5JZ7D 3HE7B 3L5XH 2VC2L 3H3BC 1MCQA 1MWAA 1F8TH 1YYLH 1BFVH 3U7AA 3GSWA 2H41A 2BCKB 5J6HA 2VWEE 1M4KA 2Y36L 1UZ6F 2AJZA 3T2QA 1I1RA 4G43A 3DO7A 5CP3A 2BNRB 1SJVA 3VXOA 3VGAC 4MJ6B 5EZJB 4N0UB 3IFOA 2DQFA 2OLDA 3QRGL 4ZUVA 4ERSL 2IANE 2QSTA 1MIEL 4OLYL 4HQQL 1FG9C 4XBEL 1I1YA 2CLZA 5C3TA 3VXUD 1M6OA 1W2KT 1MREH 4JZNB 1CXHA 4OB5L 5GRWA 4PP1C 4WHCA 2G2RA 3EYQD 3GGWB 3MJ6A 4GXUM 5ELIA 1AI1L 5C1MB 5I1EH 4UIMB 1JNHA 2VXUL 1FNGA 3DPBA 3QWQB 4JFDA 4UI2A 1UADC 4FTVA 2QV2A 5A2IH 3RUGE 2AK1H 3EOAA 4H5SA 2Q3AA 1D9KB 1PEWA 2QQLL 5HYJE 1T2QH 2XXCB 1JWUB 2VLMD 2Y5TB 3P4LA 4HBQA 4IM8A 2VLRD 3LSOB 5KG9A 3TWCL 2NY2D 1VGEL 4DEPC 4QHLA 5B4MC 1XEDA 2X7LA 2AV7A 4AH2A 1FVCA 4M43L 3UAJC 4N0FB 3G5YB 2Q8BH 2BHUA 1Z0NA 4LCCB 5KOVC 5F89A 1MLBB 1XIWC 1FQ9C 3BP7A 4NZUL 4HG4J 4Q6YA 3ZHLA 5FAAA 1CR9H 3SO3C 1QLEL 2YZ8A 3FMGH 1V3KA 2KL6A 5KVEL 3DHMA 2C7UB 1KLUA 3QEUB 4I77L 1A47A 5I1JH 5FUOH 5BJTB 5DJ6B 5AWNL 2W0PA 1DDHB 3THML 3P3YA 4I3RL 3KLAB 5ANME 1Q9WA 1RIUH 4MD5A 5IP4A 3HAEB 4F9LC 3DI2B 1L0XA 4KMQA 1BP3B 3T0DA 1MJJA 3QT2A 1GZQA 5TDOA 2R9HD 5D7SL 2HT4C 2F53B 1ZTXL 3GIZL 5EO9A 1I1FA 4JRXB 1MVUB 3UYPA 5TF1L 1ETZA 1H5BB 2QQNL 4U33A 1E4XH 2CKBL 1DCLA 4IRSB 1LD9B 2JJTC 3PXJA 1VB9A 1AD9A 4M5YL 4OLVL 4HWZA 1AGEA 5K93A 3MXWH 1P1ZA 3O2DH 2FJGB 4PJGB 3I3BA 1E6JL 4XNXL 4HUXA 4NM4L 4PR5A 4OFYD 4U0QB 1P7QD 1X4ZA 4GLRI 1WV7T 3K8MA 3VH8B 1YJDL 1G7PB 4YPGA 4DGVL 2IH3B 3D9AH 4ZOEA 1UG9A 2ICEA 4NP4H 43CAA 3BXNB 2YPLD 1MHPL 3WXVL 1KTDB 1JYXA 3U83A 4KK8C 4NKDB 2XN9D 1C7TA 3HI6L 4ZPTA 1D5MA 4S1RH 1MRDH 5A3IC 4I0PC 3UBXA 3VI3E 3CUPB 3FHQA 2VITA 1WFOA 5KVFH 1OLLA 3LVEA 1GIGH 4J3VA 3WHE0 4TOYH 4X6BB 1RJLB 1G7QB 3K1KC 1TQBB 4LSTH 3MODL 3BPNC 3LKRB 2AJXH 4GAGL 3SE8L 1JWSA 1CVRA 3MRHA 3AROA 3WKMH 3O3UN 3IDGA 3QIUC 4R7NB 5JW4M 1TZGH 4HCRA 2YN3A 1ZSDB 2Z8WC 4U3XA 5C08D 4P2YA 3ZE0F 1A1OB 3VXRB 2R1WA 3CMGA 3LKNB 5FYLE 5B3JF 4XCCH 4DVRL 5SX5H 3DVIA 4LSVH 3UC0H 1MI5E 4FQCH 4OBRA 2I9TA 3ZKMC 3O11B 4NNXA 4PRHA 4ZAKA 2Q86A 4YHNB 4AQOA 2DLHA 4WHYG 4APQB 1FFNA 1I3RB 2Z4QA 4L1HA 1IGCH 4OGXH 3V4UL 4PY8I 5EZOL 3K0WA 5GRXG 5T1DH 5HXMA 4X7SH 1BMGA 1HXYB 4KK9D 3GRWL 2NY0D 3JBG7 4HS3A 3RX7A 3VXSE 1SEBB 4G9FE 1TTGA 1SY6H 3MUJA 1U6AH 5GIRB 5HI3D 1MCSA 2CQVA 3MZGB 4RRPA 3MZTA 5C7XL 5C92A 1VEPA 5IFHH 4IS6B 4KY1H 4R4NC 1BAFL 3O8XC 5E4EC 1EJOL 3MSPA 5HGHA 3WS6A 4EDXA 5E00A 5HHPB 2V9TA 1UACH 2P8PB 2KPNA 3MCLH 2DYPB 1U8QA 4OM1L 3MA9L 1LO3L 5LCVL 4P2OA 2AS5M 3HMWL 1X44A 3KPRE 3MOQA 1PZ5A 1YNLL 4Z78B 3ARGC 5JHDB 2AEPH 3U0TB 1J8HE 5AZEL 3LEYH 1CU4L 3CXHK 4RAVA 3ARXA 3AS2A 4NZRL 4WUUE 4LQFH 3EYOB 5J1SC 2AXGB 3BSZH 4ZSOA 1DBJH 5LXGH 4RAUA 2YPVH 1BF8A 2W0FB 5DLML 4URTB 4PJ9A 3DMMB 4KJPD 1AXTL 2CLRB 3E0GA 1NGWA 3WNOA 1SBBA 3MJ8B 4PB0L 4DGIL 4X7EC 3CFBA 1C1EH 5DJ2A 5GZND 1T22A 3UX9B 2JB6B 1JGVH 4HJ0D 5L2KA 4JG1L 2PO6D 2WAHA 4AEIH 5CD3B 3B6SA 5AAMA 1QQDB 2XWTB 5HVFB 1DBKL 1T80A 4D8PB 3L3GA 3BMVA 3QYCA 4XPFH 1QEWB 4F2MA 4JJ5A 2H2PC 3VMOA 4GQ9L 1P7KA 2XNAB 5T3XH 2FJFA 3RY6C 5JA9A 4ODWB 4PJIA 4CW1A 1N6QL 3T2NL 2P7TA 3LKPA 4OIIL 4Z5RA 3TA3B 5IB3A 2Z31A 1WISA 5I66A 3EAKA 1TVDA 2ZJSL 1EUTA 3Q2CA 3O6LH 1W0VA 3MMEA 3U6RB 4RX4A 3DUUA 1LDPH 2HA1A 5HHVL 4FFYH 4NO0D 3GNMH 1JV5A 5KSAA 1S9WB 2R0KL 4WW1B 2IGFL 4WO4C 1YZZA 2YHGA 35C8H 3BE1H 2V7NB 4CMMB 3LS5L 5EZIH 5GS0C 4O00A 2H9GB 1IBGH 2XZQH 3Q6GL 4F15B 4X5XA 5I1IH 2AJZB 4LCUB 4RNRB 4G43B 4L4TB 1J1PL 4XRCA 3A6BH 5AG8A 1IM9D 5TE4H 3HC3L 4FFZH 3G6AA 5LVEA 4QT5A 3IFOB 2DQFB 4ZUVB 4E41D 2IFGA 4N8PA 1F5WA 4B50A 1I1YB 4JO4L 1HHIA 4LARL 3QUYD 3PHSA 1RQ5A 4U1GC 4KI5F 5HHOD 2MQ3A 4NM8L 5GGSA 1I85C 4PRNA 1JNHB 4YUEH 3RTQB 4JFDB 1FNGB 3QO0B 5I1KL 3JTSA 1GCFA 5BS0D 4XNUH 4XPBL 3W82A 3EOAB 4H5SB 3QWOA 5F7EH 8CGTA 1PG7W 2DQDL 3IJHB 5IVNA 3W0WE 2WBJC 3MBXH 4GRWE 5KG9B 4QHNA 3WN5C 3NFNB 3BWAA 3V0WH 3EO9L 4KPHL 5E94A 2W9LA 3C6LA 3LDBC 2HYMA 5IB1A 2I07A 2OTWB 4AH2B 4PJXB 1FVCB 4P3DA 4EBQH 4P5TA 3C5ZA 3OXSA 1AXSA 1VACA 2DF3A 2ESVB 4JJHA 1RUKH 3ECBA 5GGRA 1MAMH 1KB5B 2XA8L 5CCKL 3I50H 3MRJB 4NNPL 3PGCB 1N59A 4NSKA 4OZGB 1TLKA 3D3VE 5I17B 2PXYA 5H35B 3MLRH 1S78C 1RJCA 5SWZD 4HFWA 1WBYB 3MLSH 4J3TA 1YMMD 3TBSB 4DCQB 1DANU 3CZFA 2Y1VA 1WSST 1UQSB 4JPKL 3RNQA 3H7BA 4YHML 5GS0H 2A9NL 4MVBD 3FB6B 2QQKH 4G9DB 1GZQB 1U8IA 5TDOB 3VFRA 3QHFL 3VGHA 2AABL 2X4RB 4GRLB 3O9WC 2YD9A 2DWEB 4OM0H 1I1FB 5JMRA 4G8GA 3SGDH 2FR4A 2W60A 3RI5K 3CX5J 5L0QB 1ETZB 5HJ3B 2VISA 2O93L 1PEZA 1TZHA 2XKNA 3TCLA 1ES0B 1AD9B 5FV1L 3CVHA 1X5XA 3MNVA 3BWUC 6CGTA 3J7HA 4X8JA 3OJDB 1P1ZB 2RCSH 2R23A 3ZL4L 2C4FU 1QSFA 1BQHG 4PRAB 5JW5A 4HUXB 4O4YL 4PR5B 4P57A 5ACZA 1YPZE 5DQDH 4YPGB 5GRZA 2Z0BA 5EOQH 2NY3D 3O6KL 1DVFA 4QGTA 4DVBB 2VLKE 4YE4H 1MAKA 4XPHH 1BD2E 3ISWA 4XCNB 4L3EE 5IG7A 4Y8AA 1UYWH 1NSNL 1TPXC 2BMKA 1SJXA 1OP5H 4A2LA 4LSDA 3KJ6L 4QRPB 1OY3B 1OD9A 3EJYC 2GCYA 4ZPTB 5HPMB 1D5MB 3MGOB 2HJKA 4Z76A 5MI0B 3EHBC 2F5BL 2FB4H 1NMCB 5I71C 1J0ZA 5IBLD 3L3JA 3SQOH 3MLWL 4PJGF 3WLWD 4QXUL 1IC1A 1NBYB 4Q58C 4FQPA 3P0YL 4ELKB 2G5BA 3Q3GA 2FH8A 3WXWH 4K3HA 4XH2A 3QRFM 4HH9B 1MCJA 3DARA 4QXGH 4S1SH 4IMLA 1EHAA 4OFDA 1JWSB 3MRHB 1QNZL 1PBYA 4WV1C 4G6FD 3SCMB 4XNMB 4OZIB 5F93C 2IBZX 5C0BA 5GGVL 3CC5A 1FE8L 3RDTA 3U4EB 4K7PL 2OXGA 3M8OL 4IBLT 4Q74A 2EIDA 4ZDHA 3T04D 2I9TB 1KCVH 1IAKB 4OCXH 3QIWC 2FATH 5E56A 3DX9B 3RVWC 2HWZH 5FKAB 4HDIA 4ZAKB 3VDAA 4C59B 1T03H 4HPOH 2UVFA 3M17B 1D6VH 4JFOA 4R96B 4QOKE 2AJYL 3DOSA 1IGTB 3GBLA 5CSZA 3H3KA 4JO2H 5I2IA 1E4JA 1NAMH 2GTWA 4G80A 4BQCA 1A14L 1J10A 5DMIH 1ITCA 3VXMA 1FVEA 1CDCA 3C2AH 1BZ7A 1FBIL 2DI8A 1N2RB 1ND0B 1JZ3A 5TF0A 5DD0L 4KV5E 3B8YA 3QXAA 4L8SB 1YEJH 1FSKB 4X9GA 2CLVA 3REWA 1T7YA 2DJ4A 1ED3A 4K3GA 1JPFB 1KCUL 4W4OC 5DSCA 3VRJA 4OZHA 4EDXB 3P9LB 3FOLB 1LQSR 4K8RD 4NZJA 3UZQA 1KG0A 3ARBC 1FRGH 1GGBH 1K2DA 1FNSL 5SX4I 4XPGH 3BP6B 1F4WH 4XP1L 4P2OB 1MNUL 4F7TA 3VFVB 3S96A 2VZTA 4YXKL 1UA6L 5DO2D 1MCWW 4WTXA 4RAVB 2NXYD 2VXQL 1OVZA 4Y2DA 4PGDA 5I1GH 2D7OA 1I1AC 3QIBC 4PV8A 1B0WA 4ZSOB 1WT5A 2UZIH 2WV3A 3HNSH 4PRPB 5BVPH 1FIEA 4JPVH 2VQTA 1SM3L 5EB9A 5BOZG 5D2NB 3IAPA 4P99A 4JO1L 5KVGH 2WUCH 4HIEA 5D1XD 3C6SA 1RVFH 2NY5L 3HZYB 5DJ2B 4X7TA 3LZFL 5TFSH 1TITA 1UJTA 5KSVB 5L2KB 4XAKE 3G04B 3OJ2C 5D70L 1RJYA 3G6DL 3T0EA 2PUQT 3WFCH 4PG2C 5F7KC 2H2SD 3ESVF 4TYUA 3ZKXC 5BMFL 3L3GB 3TVMC 4ZXBC 4EKXA 4F2MB 3D48R 4NQED 2BNUA 2AJUL 1ADQH 1P7KB 2C3VA 3B2VH 4QRTA 4QO1A 4YK4B 1R3KB 3UO1L 4CW1B 4ZFGH 2H8PA 3FB8A 5JR1L 3LKPB 5DD1L 4YAQA 4GKSA 5IB3B 3HNTH 5I19H 3MV9E 4G6AC 4L8DB 2XKUA 3ROLB 4RA0C 4YXLL 1G9ML 4LP4A 1RZJC 5TPWL 5C0FA 5KSAB 1IGIL 3RL2B 4QGYA 2R4SH 1AHWB 2Q3ZA 1OAQL 1F4YL 4NKIL 4Q9BA 5GRJH 4OD3H 3P4MB 1KEGL 1EJ6A 1ZWIA 5AYUH 4GMTL 1I7RA 3NIDF 1RZ8A 1RK0A 4PJCE 2YD4A 2EDWA 2B4CL 2ZSWA 3VFTA 4U49A 1EFXA 1OAZH 3VFWB 4M62L 5TQ2L 2Q6WA 5E7BA 3H9SB 2O61A 2X70A 4OT1H 2V7HB 2YUVA 1KIUA 4YBQC 4QT5B 4WWID 1MHHA 3GHBH 4KJYA 1YN6A 1U2CA 3BDYH 4OAWB 3K80A 3TN0C 3W9DA 5LQBH 1HHIB 4D9RE 2FIKA 3I75B 5DUML 1DBML 3E6HA 3MBED 4P2QA 4JM4H 5GGSB 4NN7C 3L9RB 4DOHE 4IEFB 2DLEA 3X12B 1JGEA 2YMXL 1W72A 1XF3A 5T3XE 1DLFL 1WZMA 3IDYC 4AL8H 2XACC 3RIAF 2CRIA 3WIIH 3BUYB 3GSQA 4G6KH 4X0KA 1BQLH 2KQMA 3SKNA 3SKJH 3MJ9L 4OGYH 4Z0XB 4PJFA 5CEZD 3C6LB 5FUZL 5IB1B 5DVMA 1INEH 2I07B 3QUMA 3HZMA 4P3DB 5J1TC 3OXSB 3C5ZB 1AXSB 4Q2ZA 1C08A 3LRSB 2NY1D 25C8L 5GGRB 1EH9A 3L5WA 4HC1A 4M1DH 5EIQA 1PY9A 2LU4A 1AP2A 4PJ5E 3RVXC 4PP2B 5K9JH 4KQ3H 4WNQA 1I7TA 5E6IA 5HYJD 3NA9L 5CKAA 1RZJH 2X1QA 1KJ3H 5EWIH 4R26H 5E70A 5ICXA 4N0CC 5AAWA 1FYTB 1A7PH 3T65A 5DMJB 1K5NA 3H7BB 4UQ3A 2J6EL 5F3HA 1RAMA 2YEZB 3DIFB 4UBDD 2F54E 2DM7A 1X9QA 1X5KA 4Q7DA 5DHYA 2DM2A 1K85A 2QADD 4ZUSB 4K8RL 1HHHB 4HFUL 4PJXF 2WINA 3V6ZB 4G8GB 2FR4B 4OQ1A 1SEQH 1W0WA 4QRRE 3QNYB 1LE9B 3QUKB 15C8L 1TZHB 2JB5H 3OPZL 3LH2L 2R39A 5JXAL 4PJEE 2O5YL 4OZGF 4AEEA 3OAZH 4X8JB 3GSUA 1HWHB 2FD6H 4MNQA 1MCDA 1EX0A 4Y4FC 4P23B 4NT6A 4TQEH 1BVKA 1NCBH 1MQKL 2VDLH 5ACZB 3VJ6B 1R5VA 4M7LL 5TGBA 1F3RB 1R5IA 2F53D 3SBWA 3NN8B 3AM8C 1DVFB 3ARFC 4KROC 2OR7A 4XWGL 1DUZA 3LQAL 4Y5XC 3SOBL 4JQIL 4M6OL 1HILA 5DYOA 4LBEA 1JZ4A 1ONQA 1NBQA 2UVEA 1P5VA 1KENH 1KCRL 2NXZB 2KKQA 4IRSD 4K2UH 1MFNA 2GCYB 5HGGS 1UM6L 2VERN 4Z76B 3DRQA 4MQSB 1BFOA 3R1GL 3Q1SH 1F90H 2ZCLH 3L3JB 1QO3A 1MY7A 1ZHLB 1CLYH 3GSNA 3SEPA 2G5BB 1A9EB 3KHQA 5DA4A 2AXFB 4XH2B 5BV7C 3DJ9A 5INDA 3UMTA 5CZVL 4P46A 2MMXA 2G9HB 2ZPKH 4XGZB 3N1GC 2H1PH 5JW3H 3CFJB 2Z9TA 3MRLB 4DKDC 3VW3L 4N8VG 2CIKB 5BW7C 2OR9H 3M45A 5C0BB 3W39A 1DBBH 3MNZA 4L1DA 1WBXA 4NKQB 1R3IH 2VH5H 3RDTB 4M7JL 3TV3H 1LO2L 3TESA 1UWXH 1QRNA 5BVJA 4XMKH 4HHAB 5GGTL 3OTTA 4CBPA 1V7NL 4BFEA 4ODSL 5D8JH 4U1MB 4N8CH 3GMLA 1LK2B 2Q20A 4ZS6D 4RMRA 4JE4B 3PDOA 3ZE2F 3RGVA 1KYOJ 5I2IB 3SDAD 5T5NG 2XTJD 5KAQF 2GTWB 3UTPD 5I8EA 4GAYA 5JOPE 3VWKA 1BZ7B 4XCFL 5I1AA 1RURH 4OZIF 3MRQA 4BSVA 5E9DE 5ICZA 3IFNH 3LKOA 1KTKE 4PY7B 3BZFB 1ED3B 1RUML 3BQUB 5FYKU 1A7BA 4APQD 5DSCB 3UJJL 1H3VA 5CWSB 5DD5H 3MLVH 3B9KC 3D5OF 1WF5A 3PWPA 1K2DB 4A6YH 5A16A 3UYRH 2GT9B 3FL7A 4M00A 4F7TB 2HT3C 4Z7NF 2KQNA 1ACYL 1NGPL 3QJFB 5CEZL 4E0RB 3ARTA 5BV7H 3NVQA 1H15B 3AREA 5GRUH 2F19H 1DSFH 1NJ9A 5E2VH 4NKMA 4Y2DB 5J89A 1MVFA 1OGAE 4Y4HB 3WNNA 1BQHA 4FZ8L 2IH1B 3IXAA 5FECA 3L7EB 4PV8B 1NCNA 4H20L 4V2BA 1A21A 4R90H 3V5HB 5DJYA 4WUUA 5C0NC 1MCFA 4LOUC 1F45A 1MFAL 1YEEH 3QG7H 1AJ7L 4UDUB 4XHJD 4J3OC 1XF2A 3N9GH 2NX5E 3DECA 3C8KA 3GMOA 3C6SB 4GKZB 4HK3J 1BWMA 3MPCA 5D96B 5JHDD 2IPUG 3HI1B 5F1IA 3VE0A 5D93C 1RJYB 4DJMA 1RJZA 4IRZH 5FYKH 3T0EB 4YQXL 3R8QA 5GS1A 1T6VN 1G7JB 1K8DA 5KJRH 3C08L 3KYKH 3MLXL 1IKFH 3IB4A 5T3ZH 2YD7A 2XFXB 3I6KB 4Z7UB 3TO4D 5HYIA 1ZLUH 1CD0A 2H8PB 1UM4L 2WWMD 3FB8B 2H26A 3W81A 1S7UA 3OL2A 4KTDL 1RMFL 1PKQA 2E6PA 4AY0A 4YHZL 3RAJH 2AJVH 2P5WE 1J5OH 3OZ9H 2IAMC 3EFDH 5C0FB 4RFEA 1RD6A 3TPKA 3V8CA 2KH2B 3HCVA 2JE8A 4YFLI 4NN6C 5DHVH 1MEXH 5JXEC 4X4YB 1NMAH 2JCCA 3MRDA 2R0ZL 3MLTA 5K59F 4PRIA 1CDYA 5CBAB 3QDMD 3L6FB 4LKCB 3C2SA 2VO5A 2ZSWB 2R29H 3VFTB 1OLZA 1EFXB 1NANI 1RV6X 1JPSH 2VLJA 5KN5A 2OQJB 5CJOL 2ZUYA 1U8LA 2X70B 4Z77B 4OCRL 3WIHA 4HIIB 1S7SB 1TJGL 4OJFH 2VDKL 3FN9A 1MHHB 1RK1A 3PP4L 4PREB 4ZFZA 1YN6B 1Z5LB 4Y4KB 4F7MA 4IOFD 3HMXL 1U58A 5I76A 2IANB 1A6WL 3SDYL 3HPJA 2VE6A 4LVOC 2FIKB 3O3BB 2B1AL 3OGCB 5IQ7L 1G1CA 2PW1A 4NRZA 4WJ5A 4XPAL 1JF6A 4E42B 1P4BL 4PIRF 2G60H 3PQYE 4ONGH 1XF3B 5B38G 4WEBH 3OQ3B 1XCTA 3TZVA 3EOTH 3EZJB 4K07A 3HE6A 3GSQB 5HDQL 1MJ8H 4X0KB 3P0GB 3GKZA 4JG0L 1DLHA 3SKNB 3T3PF 4PJ8C 4UTAH 3QXDA 5EBLA 1I1CA 5GXBB 4F57H 3WUWG 4Z9KB 2X9YA 3HLAA 1MCPH 2WQ8A 3KJ4C 3VFUA 2Y72A 4Q2ZB 5L7XL 4AENB 4KK5D 2V2WB 2HT2D 1LK3L 4LIQL 1T1ZA 3L5WB 3IAGC 4JFDD 3CFKB 4FQHA 4WGVB 2FO4A 4FG6D 3E8UL 4CAGA 1GGYA 4FTVD 4CVXA 2NY6C 2H3NB 4NO3B 4PJDE 3VXQA 1I7TB 4O2CA 3I9GL 4G5ZL 3QQ4B 2R15A 2B39A 2GJ6A 4LASH 4JFYB 1X5ZA 5ICXB 3RZCB 5ANMB 5ALCL 3T65B 3ULUF 1K5NB 4UQ3B 4KWUA 3QCUH 3QEGH 1BQSA 1J1OH 1FNFA 3GMRA 2D03L 2A6DB 3LB6D 4ZNEE 3FO0H 2WINB 3D18B 3ZTNH 2EEBA 3OJVC 3UZEA 3RL1A 5IMOA 2D0FA 4MXWH 1FDLL 2OXHA 4KI1A 4M1GL 1GC1C 5J13B 1S7QA 1DJSA 5LGJB 5IF0A 2VLLA 4MNHA 3GJEB 3CD4A 1UKSA 4NUGL 3QFJA 3JUZA 4OCWH 4MNQB 3KGRA 3TT1L 4NT6B 1CDGA 1BVKB 2FEDD 3KYNB 3ZDYF 4PTTA 3OXRB 3KPMB 5JPNB 5DF0A 4ODVH 4OCSL 1EVTC 1MCEA 1XGYL 4PJBA 5EZLB 2FYYB 1DUZB 1L6XA 5DEFA 4XVTH 1UCBL 4K3JH 5DYOB 1ZT1A 5D1ZA 3RBSA 4MJIA 5FM5M 2X4QB 3KPOA 1A6TA 2AP2A 5HSFA 1J1XL 4M6ML 4Y16A 5KW9H 3TYGL 1BZ9A 5BXFB 5CMAA 2YSSB 1MH5A 3QHZH 5KSBE 3DRQB 1B6UA 5FOBB 2VL4A 1GXEA 1ZEAH 3O3DA 1QO3B 1HHKA 5J11C 4FXLA 4P2RE 4JRYE 4L4VE 2F9BT 3GSNB 2VLKD 2XQYG 4X9BA 5INDB 1QYGL 4P46B 4HULB 5T1MB 5C0GA 2FLRT 2OL3B 4TTGA 3X14A 4RMSA 4X98B 1KIRA 5F9JA 4EN3A 5CP7B 1QHOA 1LP9A 4Z7VA 3FQNA 4HIXH 3B3IB 3CLEL 3MNZB 4IDJH 4Y5YB 5GSVB 1KELL 1EGJH 1IAII 4DZ8A 4NHUB 4BA8A 4HJGA 4HUVA 4BSJA 5DD3L 1MI5B 4I18C 1IEAA 3MNWB 2G75A 2WMPA 2X4SB 1ZVSA 4TULL 1GC1H 3GMLB 5D1QA 1KFAL 3PDOB 4M7ZC 5IROA 3NABH 3RGVB 3BMWA 1S7RB 5I8OH 3QI9B 3V0AC 1AXIB 4Q9RH 4GAYB 1AGDA 4L9LA 4CVZA 4JM2A 1FLRH 3S35H 1A8JH 1JGUL 2Y06H 3MROA 3QCVH 1JGLH 4YDJB 4BSVB 2VXTH 4MXVE 4HJJL 1MCOH 3VXSB 4MJ5A 1ZLSH 2AKRB 4G9FB 1MWAL 3U0WL 1I9JL 1NL0L 1T7ZA 4PRHD 4U1HA 1ULVA 4RSVA 3AC0A 3H2WA 3FCTA 4FQIH 3FB5A 5ETUA 1CDIA 4GUPA 2R8SL 4M1CD 2R56H 2EEDA 5ACMA 2AEQL 4IMKC 5F7YC 5IT2H 2FIRT 4GXVH 2LU3A 4OLUL 1HYSD 2NPLX 2VC2H 4I2XE 3RWCA 2ZCHL 1XIWD 2A73A 3V7MA 3KPRB 5E1HB 2HRPL 4UNVA 1VA9A 4NKMB 1J8HB 1X3DA 1BQHB 4FRWA 3WD5L 1H0DA 4WUUB 3MV7A 4U1SA 3S4SG 2MQCA 4B5EA 5F7HA 1UB5A 2M8XA 5DK2B 1W8NA 4ERSH 1FFOA 2HAZA 3GIVB 1XF2B 4OLYH 4EZMA 3C8KB 3GMOB 3KWWA 3EJZC 3C5JB 4JHAH 3PWNA 3QSKB 4GOSA 5CJ8A 1Q0XL 4XXDA 4OB5H 5F1IB 2BX5A 4M61A 3VE0B 4U6XA 5AG9A 4WFEE 1WEJL 1YJDC 1VFUA 4KH2A 2P48B 1KB5L 2WLYA 1CG9A 1HKLL 2VXUH 2I9LA 1OGTB 3FRPG 5GS1B 3BZDA 3VRLF 1KCLA 4ELMA 4C56E 4KMTL 5I73B 4PJ9D 2J1KA 1EHLL 3IS1X 4MAYC 3BPLB 4WUKL 4KDWA 3IDMA 2H26B 1VGEH 1C8PA 3ET9F 1S7UB 3K7UA 1FFRA 1PKQB 1VFMA 3MUY1 2HP4A 3I84A 1RU9L 2J88L 2R0WL 4JN2B 4F8QA 2DJUA 3DVGA 1YC7A 4NZUH 1S9VB 4AMKL 3AY4C 1NFIB 1YYML 2BERA 3S6CA 2Y07L 2VABA 4WEUD 4X83A 3LIZL 5C6WH 4FQXB 2JCCB 3MRDB 4KK8D 1N64L 5D7LE 4I77H 5AWNH 4Z7WE 2BVPB 3THMH 4I3RH 1L9MA 3V52L 2VDRL 4PLKC 5JQ6L 4V1DD 2Y25A 1PW3A 4OFKA 5KN5B 2Z31D 4LP5A 4Z7UF 3LEXA 1FIGH 1U8LB 3CNKA 5C0AD 4BZ1H 2A6JA 2FLBT 1MAJA 4RX4D 5DS8B 4LFHD 4KUCF 1HI6A 5D7SH 4Z7QE 3J8F7 4X80L 3STZB 4C4KT 1JPGB 4TRPL 2FGZA 1TJIH 4ZFZB 5JZ7C 3P2TA 3MRKA 3FO1B 3QAZB 3HPJB 2QQNH 3AVEA 3RA7H 5FYKE 2CKBH 3AMKA 1OM3L 3JWDL 2E27L 5D9SA 5AZ2L 4OLVH 5T3ZE 3BGMB 2N4IA 2C4FT 3PDDA 3OKOA 5DGRA 4XNXH 4NM4H 3GUTA 4IHOA 4Z0BL 5EBMB 4FS0A 3HE6B 4XZUA 1UVQA 1YJDH 2HJFA 3NZHL 3SO5A 1DLHB 4U6YB 5DJDB 4XC3L 3W0WB 4DGVH 4LMQE 3QXDB 5DT1L 5FDYA 2C4XA 5CZKA 4YHOL 1GGCH 3FTGA 1MHPH 3WXVH 3HLAB 4GBXB 3EYQC 5GS2H 1H3TA 3KXFE 4IRJB 1T1ZB 1NFDE 2XOTA 5I75C 2BSTA 5C07A 5F7UA 4FQHB 1A0QL 2CMRL 1LGVA 4ZOBA 3D39E 3EFFB 4MA7L 3DV4A 4B41A 3CCHB 4WTZA 5GSRA 4X9IA 5BCAA 3D3VB 2NY2C 3VWJC 3GO1L 1JNLL 1U8PA 5JIKA 1K8IA 1AO7E 1S7WA 3BGFB 2VZUA 3C6LD 4JQVA 5FGCE 5DUBB 3RUGF 5F9AC 3MODH 4OD1H 3WV0A 4PPTA 1WCBB 2UUDK 1G0YR 1J0IA 4P5TD 4WFFE 1XF4A 3SE8H 3C9NA 1L0QA 5ILTL 5MENE 3LPFA 1DL7L 5M94B 5JLZA 1MJUL 5IHLB 3R0MA 3IDXL 3RL1B 5FGSA 1E4XI 5CFHA 3LMJL 2DBLL 2PXYD 2HVJB 4YX2L 4DVRH 4QCIA 5JNYA 4MYWB 4YFLF 4YZFE 5MEPA 3WKNA 3CSYA 1S7QB 2CJUL 4W6XB 1I9IL 1NDMB 3QCTL 4MNHB 2V6HA 3QDJA 3JV0A 5EH1A 4YHLL 1DQML 1U92B 3D0LA 5EULV 3VXNB 4XVSL 4M93C 4HK0B 4R0LC 3AAZA 1CZ8L 4TSAL 4WIQA 1WZ1L 2C1PA 4XAWH 5ESVB 3G5XA 3B43A 3L3KB 3U1SL 2ITCA 3LY6A 1ZT1B 4QRRD 5EPMB 3RY6A 2X1XR 1NAKH 3GRWH 1U93A 3O3EA 1BD2B 3RPIA 1A6TB 5BZWA 3NH7L 4K94C 4XP5H 4OSUH 3RY5A 3W9EA 1WJ3A 1BZ9B 5I6XC 3IVKA 3D85B 1CT8A 4EI6A 5FYJD 4YPJA 2DIJA 4HUWB 1QSFD 2GJJA 2Q76A 3OHXA 5ENWA 2EYSA 4EXKA 5IUSA 4XCEA 4HX1B 2AQ2A 4WWKA 1U8JA 3O3DB 1EJOH 1FP5A 2BJML 1HHKB 1N3NA 4W6YB 1IC5L 5T1LA 2H2PD 3FONB 4XWOD 1IQDB 2JJWA 1ZHBB 3WO4C 1UXWA 2J8UE 3UZVB 1E28A 4OM1H 3RBGA 3MA9H 1LO3H 3HS0A 1BGXL 5E2JA 3HMWH 5L8JB 1XF5A 3RIAK 3TH3T 4CN1A 3UTSA 4B7LA 4MXQD 1HQRA 1GGTA 2GIYA 1YNLH 1GL4B 3VGAB 4ZOCA 3KPSA 1KIRB 5AZEH 5F9JB 4EN3B 5IV2B 1E4KC 5E1AA 4F37K 2KZWA 4POZD 4WO4D 4NZRH 2GITA 1RUAL 4DZ8B 2IJ0C 1V7ML 4OGAD 3UTOA 3G6JA 4CVUA 4XXCA 3K81A 3K4DA 3VI3F 5DLMH 1IVLA 1IEAB 2ID5A 4Y19A 2ADJA 5ID0A 4HZLA 4H0IA 3E2HC 5D7IA 3BAEH 2P8MA 3MRIB 2DB8A 3WUWA 1ZVSB 5D1QB 4PB0H 5IMLA 5JORB 3NCJL 3JWOL 5DDHB 2Q8AL 3LCYA 1OP3K 4QOKB 5C0BD 5CHNA 4X6FB 4JG1H 1KTRL 4XP9L 4I4WB 2P42B 2EDKA 4DKAA 3GBNL 1TETH 4FZEH 3VFGL 2APWA 5DFWH 5FKPA 5IR1A 4WFHD 4DEPB 4Y7MA 2PTVA 4MDJA 4DQOL 2V2XB 3DX8A 5IK3B 5ISZA 5E9DA 2EH7L 1PQZA 3S98A 2PTUA 4U1HB 1JFQL 4N0YL 3EO0B 3FO9A 4LLUB 1T20B 1D3CA 3SGKC 1AH1A 4MD0A 4K94H 3SO3B 1N6QH 4OF3A 1GYAA 1BVLB 3FCTB 1FVDA 4P3CL 3QWRA 5ADOL 2ZJSH 2GK0B 3O4OC 5KTEL 3QG6A 4PJ7A 4KK9C 2NY0C 3D1MC 9CGTA 5JOPD 3VXMD 2X4OB 2R0KH 2WK2A 4U6VH 2IGFH 1KPRA 5HI3C 3F62A 2H6PB 4JGUA 5HGDB 1J12A 4JVPA 4NQSA 3ULVD 3O6FA 3MR9A 1OAXL 2FH6A 3NGBB 4ENED 3Q6GH 4NQXA 3PV6A 1G9NC 3QDAA 1URLA 2DRUA 4ZTOL 1SYSB 2YPKA 3HUJE 1NC2A 1J1PH 1H0DB 3MV7B 3P73B 2VSCA 4J23A 2PW2A 1FNLA 1KGCE 3ULUL 1A7OL 2C3WA 4WI2A 4JZJC 4S1QL 5LWYL 2CDEB 3T77B 1O0VA 4YWGL 4JKMA 2QL1A 3VCLB 4X9FA 3FQXB 5I1LA 2MCPL 4LARH 3KYAA 3IJYB 3LS4L 4QY8B 4FHBD 1U3YA 3S97C 2AJ3A 4NQDE 4UT9H 5D7JA 4F7CA 4NM8H 4QRUA 2BVOB 1DQTA 1OGAD 4U05A 5I1KH 1M71B 1AFVL 4J6RH 2VXSL 1NCTA 1MFCL 4XPBH 3L95A 5TH2A 1EHXA 2PYEA 2DQDH 4KJPC 1KIQB 2EYTB 5EU6E 4J1UA 4GG6A 1VENA 4LLMA 4OIAA 1R0AL 2NX5D 2L4OA 3IU4L 1CXKA 2YKLH 3T2PA 4I0PB 4JREC 4HJ0C 1MCCA 1HIMH 2O5XL 2IPTH 3ZYJA 4ZOAA 2B8OT 2PO6C 3MV9B 5DFVD 5D2LE 4N8VB 4F7EA 1MSPA 2DQUL 2YD3A 5DTFA 5ICYB 2XA8H 3PWJB 4Y2OA 2VABB 5CCKH 1A6AB 2YBRA 4NNPH 5C0IB 3LEVH 3BPNB 2A6KA 4JFFE 3L1OH 1U8OA 1JPTL 4WENB 4RFOL 4JY6A 1ZLWH 2C3HA 3K2UL 2E9WA 4PJCB 5FYJL 4JPKH 1JBJA 1JNJA 5B21A 4YHMH 2A9NH 3BT2L 2A6JB 4GW5A 4M9PA 5A2KH 5FO9A 3SKOB 1NC4B 1F3JB 1G9NH 2AABH 1N0XL 2X40A 1T7WA 5H94A 2BXZA 3WYRA 1U3HC 4JPWL 4OF8A 4LLWA 2MPAL 3MRKB 1MRFL 2B1HL 1S9XB 5F7DA 2EXYD 1GSMA 3FQUA 1U8NA 3HN3A 1T89C 2KZ1B 5D9SB 5KS9E 2EDQA 5FCUL 1W0YT 4LHUG 1EFXD 5JO5B 4DOHB 3ZL4H 3OKOB 1F6LL 5JPMB 4S0SD 4IJ3B 4O4YH 3S3SA 4M3JA 5C0DB 3BN3B 3F7PC 4ZS7H 2X89A 3T0BA 3BD5A 2HJFB 2D7NA 4TSBL 4YR6A 1J11A 3D6GA 4PJHA 1T04A 2FL5A 3QIWD 4JZOA 3RVWD 1MQ8A 3H0TA 2EDJA 2VSDA 3FTGB 5AD0A 1UKQA 1NSNH 2BY3A 1HZHL 4YIQA 3O8XB 4P2QD 5E4EB 3WCYA 4JFZL 5IMKA 2O5ZL 3AGVA 3I85A 4WY7L 3PQYD 5C07B 4QHUA 2F5BH 4OZFA 1UGNA 1G7HB 4KAQL 4PJ5B 3MV01 5F1NA 4AJ0A 1HEZA 5B8CC 5I15L 3P0YH 1K8IB 3U7YL 5C6PB 3ARGB 4NRXA 3UTTE 4GMSL 4ETQB 3FAXA 4HKJA 3RRQA 4HLZH 5IMMA 3C9NB 1QNZH 2F54B 2QR0A 3SGDI 3RWFA 4NQCE 1ZS8A 4JR9L 1T6WA 1XZ0B 3S5LA 3QJHA 5GGVH 3WSQL 1EEQA 4OQTA 1YECH 1EPFA 5E6ID 4KC3B 4NZTL 2C26A 3QUXA 3DV6A 2WWKO 4K7PH 3M8OH 5EC2B 5C0JA 5HYEA 5MEPB 2NY5C 2YRLA 3OBAA 3UJTL 1FZKB 4MVBC 2ITDA 4XMLL 1FYHB 3QQ3A 4RGOL 1NEZA 1EEYB 3MV8A 3FFCA 4YHPB 2EE2A 1A1MA 5SWSE 2NTSP 5GJTL 3CGTA 3NPSC 2NLJB 4DKEL 5BZDA 1P6AB 2AJYH 5JA8B 2YWYA 3RWEB 2RFXA 4MX7A 3G5XB 1INDL 1A4KB 2FEEI 3CK0L 1U93B 3O3EB 3RKDC 3W9EB 2MKLC 4GQPH 1XAUA 4FP8L 2D7QA 1BBDL 1XCQB 1AQDB 5DD0H 2BRQA 4WU7A 1AIFB 2Q76B 3OHXB 5ESQA 4MNQD 4HEPG 1G9MC 4WWKB 2NY3C 1KCUH 1Q94B 4O2FB 4TUOB 4R7DA 4OKVB 5T1LB 2AXJA 4JRYA 7CGTA 2APVA 3MUHL 5H2BB 1OPGL 1FNSH 1E28B 5FUCC 1A6PA 2RR3A 2MCG1 1C5BL 4I48A 4XP1H 4PV9B 3TBYA 1H3XA 1JF1B 5HD8C 3DTXA 4K71C 5ALBH 1LO5B 4JKWA 4IIQA 4ZTPH 4LCWE 3I6GB 1JMXA 4YXKH 1UA6H 3Q5TA 3KPSB 1XGUA 4GH7B 4P5MA 2N56A 1QSEE 2VXQH 3WLWC 4YBLC 5B38B 3DBXA 1E6OL 4G6MH 3C60A 1LILA 4RGNB 5M95B 5K9KA 1SM3H 4NO5A 5DEGB 4L8CB 4U1GB 4G3YL 4P46D 1Z9MA 2ADJB 4XNYL 4JO1H 5CEXA 2ZSVA 4P4KA 3WUWB 4NNYB 5HYSA 4U1JA 1E4WL 2SEBA 1QFUL 1QKZL 3DXAA 2NY5H 4HWUA 4QHMA 5I1DA 5IMLB 4FMFA 5HVGB 3LZFH 4M4PA 4LU5L 4X99A 2WBJB 3CH1A 3QUZA 3VXUE 3BOVA 3G6DH 2ZUQB 3V0VB 3EUUA 5E8OA 5MP6L 2ARJA 2GFBB 5IKCB 5F44A 4J8RA 1QRND 5BMFH 1S7XA 1OAYL 2EO9A 4MDJB 4AK1A 1HINL 2AJUH 3DX8B 5ISZB 5E9DB 4CDHA 1M7IA 4XBPB 5DJ8A 1K6QL 1PZUB 1PQZB 4PYHA 4OUUA 2ORBL 5DVNA 3UO1H 1LEKB 4MD0B 5FCSH 5DD1H 2VLME 5J0BA 5HBBA 5IJVA 1LE5A 2IQAB 2VLRE 3QPXL 4M7LT 3RGVD 2X09A 2EEAA 1QFWH 4PJ7B 1VHPA 4LAQL 4JFQA 3BX7C 4YXLH 1G9MH 3VWKD 5IVXE 1VEMA 1T83A 4G42B 4ISVA 1IGIH 4NC2B 1HQ4A 4HXAH 3RVVC 2X41A 1F4YH 4NKIH 1JTTA 4HXBL 3MR9B 3OKMA 1KEGH 4LEXL 4GMTH 3QNZA 4JY4A 5GHWL 2EDHA 5L9DL 4K8RC 4M62H 3TNMA 1XGRA 2DQTL 4KUZL 1FCGA 1FORL 3DLQR 4POUB 4KV5F 1M05B 3PWPD 1WIOA 3LQZA 2PW2B 4HLJA 1CICC 4OCNC 4S1DD 2COQA 2ED9A 5C09A 2C1OA 3BZEA 2VZSA 4QTIH 5DO2C 1NAMB 2B5IB 4KQ4L 1LDSA 1MELA 3QUML 3VXTA 4QHKJ 3ARED 3TPUA 1H3UA 4KFZC 2NXYC 4HT1L 3IS0X 4F7CB 1WUNT 4XPTL 4QRUB 4BFIA 1I3VA 2XZCH 1FZMA 1CCZA 4HC1L 4YLQT 1MHCB 1KJ2A 2BDNH 3LQAC 5TH2B 2VDPL 2XY1A 3N0PB 3HR5A 4YEEA 2WUBL 4ORGA 4LLMB 4NCC1 1Z9SA 5D1XC 2GAZB 3EIFA 3TCXA 4XTRD 3MOBH 3ARDC 1DEDA 1KB9K 1G7IB 5LJYH 2AV1A 4BZ2L 1T3FB 3K46A 4M48L 5FUZH 5EU4B 4PUBL 5ADPL 5I71B 3TBVA 5L88L 4OD2A 5HHMB 1DP0A 2EDTA 1OW0A 2FX7L 4NGHH 1NCUA 3DRTA 4WFED 4U7MA 25C8H 2WLZA 3PDGA 2YPLE 1I9EA 4F7EB 4EI5C 2P5WB 4I0KA 3ARVA 2YK1H 5DC9B 2A83B 4JDTL 2XN9E 2NTFA 2A6KB 4HF5L 1CFTB 3NA9H 4G7YL 3BEWA 3RGHA 1A1NA 1R3JA 5ESAB 2YN5A 1CQKA 3TGXA 4WV1B 4GSDL 2WP3O 5IEHA 2P5ED 5F9OL 4NHCL 1N4XL 3EGSB 1INQA 2J6EH 3L3DA 3S36X 2OK0H 5FHBH 1GJIA 2BNQA 3T0VA 1ZHKB 2NY4B 4RWYL 3F6IA 4K8RH 3X13A 4HFUH 43C9A 3VD3A 1GGUA 4MMZC 4YGVA 4LLWB 2X4NA 2EDDA 3RPKA 2D9QB 2R1YA 2Q7YA 3RU8H 4PJAA 4MHHI 5GQBA 1WFNA 3O4LA 1U8NB 4PRID 3TBWA 3OPZH 5HDLA 5C08E 4FXGB 5JXAH 3PP3H 2ADIA 2VLJD 3GSRA 3HB3D 3NZ8A 1DQDH 2PTTA 5IB2B 3MJ9A 5T33L 5TDPA 4G8EB 3NFPA 4YDVA 2PR4L 1MQKH 3F12B 4PJCF 1X4XA 4M7LH 1IARB 3GSNL 1YC8A 5DK0A 3OKEA 4XWGH 1B0GA 3LQAH 1IL1A 1WBZB 3GBML 3H0TB 5F7FA 4JQIH 3SOBH 2LAAA 5JOEA 4M6OH 3MBEC 4LNVA 5AD0B 1KCRH 4XHQA 4OF7A 5ITFB 2OL3L 1NCCH 3BKJL 1UM6H 1YEGL 2DQCL 3KXFA 4JVUA 5T3ZD 2DTSA 1K4CA 3ARBB 1CS6A 2EH8L 4EVNB 3R1GH 5DJZB 3IKCA 3TZVD 2HH0L 2FSEA 1BLNB 5FFLA 3HE6D 3S4SB 3MOAL 1HEZB 2AK4E 3VD9A 2BSRA 1O7VA 2ZG2A 4FABH 4X4XA 4GRMB 4JKLA 4X6DE 4NRXB 1AO7A 1VDGA 4X8XA 2NY1C 4HKJB 3OKDB 4JDZA 2W38A 1I1AB 1F11A 4IOIA 3QIBB 1JMZA 1JUFB 3IFPA 5EU7C 5CLWA 5IJKA 1T21B 1QVOB 4JCMA 3VW3H 2VQ1A 4OIBA 4HIHA 3RWIA 2DD8L 4JGJA 3MXVH 3FN3A 3BI9X 4EOWL 3QUXB 4M7JH 4JY5L 1LO2H 5DI8B 1ZK9A 1FN4B 2GJ6D 1U91A 5DMYA 1WZLA 3MLZL 1CFVL 2E9JA 5IOPA 3W11D 4GG8A 4UBDC 2PNDA 1L9NA 3PWLB 3SDDA 4ODSH 4LCCC 3UYOD 4WFFD 1LO4L 2QADC 3EYVA 1LO0H 3FFCB 1A1MB 1I7ZB 2YRZA 3KPPA 5BZDB 3ZKXB 3TVMB 2RFXB 4ZXBB 3EDKA 4PB9L 5D5ME 5HGBA 4M8QB 2FHCA 1R3HA 4RMWA 2OZ4A 2JJSA 2BOCB 5DURD 4LAJH 1TJHL 1G6VK 5CZXC 4XCFH 4DN4H 3SE4A 4K23H 4ZO6A 3QDGE 2X4UA 1NGZA 3WFHB 4JDVA 2OR8A 4LHJB 4CU8A 3GKWL 4WU7B 2BC4A 3QFJD 5MEQB 5KSBB 3Q6FB 2ZCKL 5J9PB 3TH4T 3OKLA 5AUMB 1RUMH 1IAIL 1NLBH 3D25A 2YC1B 2H32H 4KDVA 4R7DB 3L3HB 2R4RH 1JNNH 3OB0K 5MEOA 4P2RB 4JRYB 4L4VB 4KTYA 5EIVA 3STLB 5D1ZD 5E2TL 3L5HA 1CDHA 4MJID 1T5WA 4IRSC 3GMPA 2NZ9D 1EV2E 5EIIA 1ACYH 5T1KD 5CEZH 4Y16D 5CIPA 3VFMB 4CMHC 2EIZA 4Z8FH 4IIQB 2VDNL 1N8ZA 2BFVH 3REVA 3OR7A 5GGTA 4U6TA 3SE3C 4FZ8H 1KACB 4D0CB 1J88A 3EYUL 5JXED 2YD5A 5IESL 1IQWL 4H20H 4RFNC 5INCA 1RIHL 2ATKB 4X4ME 3TN0B 3ZO0A 2R0LL 3QEQE 3MRFB 3TIEB 3CFDB 5LAXA 1MFAH 3P9WB 4LL9A 1AJ7H 2EDRA 3PE9A 4NN7B 2ZSVB 1K4DB 3C8HA 4WI7A 4UUJB 3FT4B 4U1JB 1B2WH 4YNYA 3IDYB 4K7PY 4E41E 3CSPA 2ARJQ 2E9BA 4EN3D 1H8OA 2WIIA 3CH1B 3QUZB 1Z2KA 3HE7A 4ZD3L 5J12C 4WW2C 4GAJL 1YNKL 4MJ4A 4YQXH 1DFBL 5E8OB 5HHOE 3LN5B 3NAAH 3CU7A 2BCKA 1I8IB 3MRRB 1WWCA 5L6YL 2XZAL 1M7IB 4NFCA 4LHQB 5DJ8B 3CU1A 3ZYOA 5BS0E 2BNRA 3NMEA 3B9EA 4ZS6C 4MJ6A 1UM4H 2EC9U 4KTDH 2XTJC 4N0UA 2AI0L 5IJVB 1LE5B 4YHZH 2ICWJ 5SV4A 4BKLA 3WIHL 4AYFA 1F2QA 5IVZB 4PGJA 4JZNA 3WL9B 4JM2D 3V4PL 5J1AB 4ISVB 1OB1A 1MFBH 1OTSC 3GGWA 2VN4A 3TBTB 2R0ZH 2MFNA 1YEIL 2JIXD 4KJQC 4MCYA 4I2XB 4JY4B 4NWTL 4LSPH 1C16B 3SJVA 4APQC 3ZHKA 2QSCL 1D9KA 3ALXA 4D9QD 2NY6D 3TNMB 1JWUA 2Y5TA 2QSVA 1Y6KR 3LSOA 3GJFA 3MCG1 4G8IB 1P9MA 1PSKH 3DX7A 4OCRH 4CKVX 1YDPA 1TJGH 5J7CC 4I9WD 3DVFA 3DNKA 3ILPA 3PP4H 4N0FA 2CK0L 2V17L 5C09B 3PL6A 2YA2A 3MRNB 1MLBA 3N1QC 3SDYH 4Y5VC 4Q6IC 3VXTB 4Y4FB 1Q9KA 3TPUB 3PV7A 2B1AH 5IQ7H 4XPAH 2C7UA 4ZFOA 3E3QC 2C3XA 3ARFB 4OCMC 5B22A 4KROB 3VDCA 5DJ6A 1FV1B 1BPVA 1DDHA 1JGDA 1KJ2B 5I1CH 3KLAA 1F8TL 2ENSA 1BFVL 2XKSA 4ORGB 4NJ9L 3HAEA 1I9RL 4UU9A 5HDQH 4C56B 3LV3B 2EZ0C 4JG0H 5HHNB 1RZGA 2L0DA 1LEGA 4LMQI 4QWWC 4F3FB 4A6YB 4OD2B 2BVQB 3F5WB 2ZNWA 3ORJA 5L7XH 4LDEB 1FO0H 4WHTB 1H5BA 4LIQH 2FCBA 4NKOA 1AC6A 2EIBA 1EXUB 1P4LB 5I30L 2PN5A 3E8UH 5BV7B 4HS6A 2X44D 1LD9A 2NTFB 1ZT4B 3TO4C 4L4JA 4CDGC 1B4JL 1JF5A 2FJGA 4PJGA 3WNMA 1A1NB 1IGFL 1B9ZA 2WWMC 1DQLL 4X6CE 5D7LB 2PETA 4AEHL 4JFXA 5IEHB 1AD0B 3VH8A 5ALCH 1INQB 5E95B 3V6FA 3HMXA 3BXNA 4KVCL 2D03H 3EKCA 1AKJA 1KTDA 3X13B 4HLZG 2JELL 4YGVB 4U1IA 1OHQA 5DC0A 2FDBP 2X4NB 4NKDA 4I18A 4NC0B 2Q8BL 2R1YB 2Q7YB 4PJAB 5F6HI 1FDLH 2ZUUA 3G5VB 3TBWB 3CUPA 3EOBA 2XG4A 3FMGL 3TA3C 5JUEH 3TLRA 4AIXA 5KS9A 3GZKA 3S35X 3GSRB 4NUGH 5HYFA 2A0LD 2PTTB 1RJLA 5I1JL 3TT1H 3O81A 4IOFC 4FXKA 4HKZB 3T4AA 4Y1AA 2BY0A 3LKRA 3OKEB 1G0XA 1XGYH 3C5SB 1B0GB 1S3KH 1UCBH 4R7NA 5E2WL 5JDSB 2Y5EA 4O02H 3ES6B 3EYSL 4M6MH 4AQ1B 1A1OA 3VXRA 4BELD 3KXFB 5DHVB 2OSLB 2UUDH 3B9KB 1D5IH 1KCSL 1K4CB 1KN4L 1Y6NR 4XP4L 5J57B 1PG7L 1E4XL 2HTLD 2OM5A 2FSEB 4ALAL 4Z7OE 3D39B 4NCC2 1FG2B 4KRPD 5JW4Q 4X4XB 4YHNA 1AO7B 1CGSL 3ZKSD 1QYGH 4KK5C 2HT2C 2AJSL 5FGCB 2AW2A 3G9VA 4M8VA 1I3RA 4IOIB 1F11B 1PLGL 2OP4L 4FG6C 5EU3B 3VA6A 3OX8A 4HMCA 5MENB 4HIHB 3SQBA 4O58L 3QB7C 4NQCA 2NW2B 5GIRA 2NQCA 1OF2B 2DMBA 1EBPA 1BQUA 4S1RL 1YNTA 3PGDA 1MRDL 2ERJC 3BP4A 5HY9B 2GHWB 3V7AE 5DD3H 1OWRM 5KVFL 5D93B 4PJDF 3SDDB 3ZZ1A 4DK6A 4TUJB 5HHPA 4HUNB 4TULH 5C0CD 4LLQB 3LB6C 4PTUB 2P8PA 1CXFA 1KFAH 2DYPA 4U4BA 3KPPB 2DI9A 4U3HA 2IG2H 3CFEB 3QEHB 5TDNB 1R3HB 2CSPA 4Z78A 2H45A 3GMNB 3U0TA 4MB5A 2MJWA 1JGUH 3OB8A 4LKXA 4I13B 3IRPX 2X4UB 3P9MB 1S5IH 4LLYB 4Q9QL 4HUKB 3DUSA 2FECL 4JDVB 5FO7A 1MWAH 2AXGA 3U0WH 1I9JH 3QDJD 4R2GB 2FEDC 1G6RA 2BC4B 4BH8A 4GW1B 2FNBA 2IAMB 4NQEE 2W0FA 3DMMA 3D25B 3JSSA 4KGJA 4NN6B 5CP3H 2J2ZA 4LVHC 5F21B 3VRIA 3HC4L 3HKFA 3HRPA 3MJ8A 2GTZA 3SN6N 2F8OA 5LGHH 3ARUA 4ZFFB 1KIPB 1T5WB 5BRZA 2JB6A 4NWUL 5IBUG 4NFDA 2DM4A 5DJ0B 8FABB 1V3LA 1UH2A 5CIPB 3H8NA 4OLUH 3DROB 4YDKL 1JN6B 4X7DC 4LHUB 2HRPH 4R97B 1N7ML 4D8PA 2EIEA 4WWKD 1EAJA 4LSUH 3VGDA 4LPYA 5INCB 1OP9A 2XNAA 4MA3B 4MMXC 2IFFH 3WD5H 2P45B 5T1LD 5C70A 3IFLL 3UP1A 4LVOB 5KSBF 3QO1B 4KY1L 2AERT 2FO1A 4DGYL 1LMKA 3BKYL 3UTSD 1CYGA 1IT9L 1UACL 3TIDB 4WW1A 3MCLL 1QFHA 4E9LA 2BY1A 4CADB 2OS7A 2V7NA 4CMMA 3LN9A 4RIRB 4LSRH 4PJ8B 2H9GA 2IMMA 1RIVL 5E99L 3GEWB 3LN4B 4HSQA 2BHYA 4CNIB 4KMTH 1NMBL 4LCUA 4I5BB 4RNRA 1IMHC 4L4TA 4Y19D 4HS8L 4LQFL 4R8WH 1DBJL 5LXGL 4WUKH 2DQEL 1IAIM 2YPVL 4QRQB 4PGZA 3RQ3A 5KZCB 1RU9H 1FGNL 2J88H 4BKLB 2R0WH 4B53A 5CEZE 2DKUA 4J2XA 2ILLA 1N5AA 4AMKH 1YYMH 1C1EL 2Y07H 1OB1B 1TCRB 3TP4A 5LKNA 3LIZH 1JGVL 1YN7B 4LLDB 3WHXA 1N64H 3RTQA 3QO0A 4MCYB 5ISZD 4ZAKC 5EU7E 3U9UA 2APFA 4AEIL 5H37H 3O0RL 1U8KA 3Q5OA 3SY0B 3VG0L 4LPCA 3SJVB 3V52H 2RB8A 2VDRH 1FL6B 4LK4A 5JQ6H 3IJHA 4MXVF 4UNUA 2MOVA 4M1CC 3OGOE 4FQ1L 3GJFB 3NFNA 1REIA 5T3XL 2WSKA 3VWJD 1DN2A 3DX7B 1YDPB 4YHIB 2OTWA 4X80H 4PJXA 2UYLA 3ILPB 4XVJL 4D94A 1HYSC 2LV4A 1K3ZA 1CFNA 4NO2B 4IOSD 3PL6B 3BRFA 1JRHL 2ESVA 1KB5A 3O6FD 1Q9KB 4FFYL 4OFVA 3MRJA 1OM3H 3PGCA 2E27H 1DE4B 5AZ2H 4OZGA 3NCFB 4NQDB 2D7TH 4ZFOB 3WS6C 35C8L 1NBVL 5I17A 1Z9LA 5H35A 1FFPA 1RUPL 1P69B 5EZIL 1JGDB 1NC2D 1WBYA 1JTPA 2FBJH 2DTML 2XZQL 3TBSA 3GI8L 3WEXA 4Z0BH 3WDHA 4DCQA 1UQSA 3PF2A 4UU9B 4P2OC 5I1IL 1KPUA 3N1PC 5EU6B 4XC3H 3FB6A 4U3CA 4G9DA 5DT1H 3V7AG 1RZGB 3A6BL 1GPOL 5TE4L 4GRLA 2X4RA 1LEGB 3UPCA 3CX5K 2F53E 2DWEA 3D2UB 3HC0B 3TFKD 5D7JD 5J11B 4NKOB 5HJ3A 4LEOA 1V3JA 1I8MB 4HCRH 1FL5A 3BD4A 5D2LB 4CN6A 3UDWA 5FB8B 2E5EA 4OF6A 4HS6B 1A0QH 1ES0A 2PYED 4PJ9C 3OJDA 1OARL 3V5DB 4PRAA 3ZE1E 1JNLH 2A38A 4J4PA 4JFPA 4FQJH 4JFXB 4OGZA 5FGBA 5F97E 1TNMA 2V5YA 4DVBA 3V6FB 3VFPB 5HHMD 4XCNA 2J4WL 2V2TB 5ILTH 1AKJB 1DL7H 2ADFL 5F8QC 3CLFH 4U1IB 3VFSA 1A3QA 4QRPA 4I18B 3IDXH 4JFEA 5HPMA 2CH8A 3MGOA 4I3GA 1E27A 4GW4B 4YX2H 3O2VL 2IWGA 1SVCP 1J0YA 3EOBB 3KR3H 1QG3A 4KXZH 4M7ZB 3RWHB 2Z31C 2CJUH 5KS9B 1I9IH 3TNNB 3QCTH 1NBYA 2MTPA 1PD6A 4YHLH 1DQMH 4DN3L 3VI4E 4ELKA 2OTPA 4XVSH 2GY5A 4Z7WF 4HH9A 1S7VA 4DUVA 5KSAC 2NY4D 3CDYA 1CZ8H 4TSAH 1WZ1H 2FX9L 4FXKB 3T4AB 1UFUA 5JHLL 4Y1AB 5AYQA 5KANG 4UT7L 1KTLB 2HN7B 2DKMA 4LIQE 3U1SH 3SGEH 2DMKA 3BUTA 4Z18A 3EDFA 1I8LA 1G7LB 1VEOA 3AS3A 2A1WL 2XTJE 1BIIB 4XNMA 4Z7QF 3SCMA 4OZIA 3UTPE 3E6FA 3VG9C 3U4EA 4PJAF 4BFBD 3NACH 2YD2A 2GUOA 1HSAB 3A6OA 3KLHD 1IAKA 2BJMH 1F13A 3DX9A 1IC5H 32C2B 2DQIL 5EUKA 5FKAA 1QR1B 5CGTA 1E0OB 4RBPK 3M17A 4MAUL 5FHAL 1WVZA 3DURA 4M6NL 4R96A 1IGTA 3WFZA 3I02B 1FPTH 3UTTB 4XC1L 4H1LG 2YD6A 5JIPA 3KPLA 3JUYA 3G08A 3WS3B 3T8XB 1WWAX 4XPHL 2YS4A 3U9PL 3OX8B 2W59A 1Q72L 2Y6SD 3IXTA 2HFFA 1N2RA 2CKBB 3JVGA 1F6AA 4NQCB 1ND0A 2FEEL 1CFQB 1NCAH 4L8SA 1RUAH 4L29B 1NFDF 1YNTB 3PGDB 5EO1B 2AK4D 3C6LC 3C87A 2FB4L 3BP4B 4K7FB 2HFGH 1JPFA 4P5TC 1M7DB 3C5ZC 3E3QE 3FOLA 3P9LA 3T1FA 2CXKA 3EDDA 5E03A 3IF1B 5CD5D 1OTTD 3NCJH 3BP6A 3OAYH 5SWSB 5IVOA 3HA0A 4QXGL 2QLVB 2PXYC 3VFVA 4PY8J 1X5JA 4XP9H 4MAYB 5JHDE 4K9EL 1V3MA 3GBNH 3VFGH 5IW6B 2J7LA 4LKXB 5D7KD 4AIOA 1OSZB 3F8UB 1MHEB 4DQOH 3DUSB 3GM0A 5FO7B 2R2HB 2EH7H 1G6RB 4PRPA 4BH8B 1CL7L 1JFQH 4N0YH 3MV8D 3FFCD 4YZFF 5D2NA 3CVIL 5GJSL 3U36B 4P3CH 5ADOH 3L3IA 2F58H 4OCXL 3VRIB 5KTEH 2HWZL 1XMWA 5TE6L 2GTZB 2DOCA 3HZYA 1T03L 1ORSB 4HPOL 5CGMA 1D6VL 3WDJA 2DQGH 5BRZB 5KSVA 3ZDXE 3G04A 3QDGD 4LCIL 3DX6B 4ETYA 1OAXH 3T0XA 4NO0A 2ATPB 4LCWB 1WAAA 4H26B 2OJEB 4U7KA 5GRVL 1QSEB 4ZTOH 1DVFC 4XWOC 3QDME 1FGVL 4OZ4A 1MFDL 4FN0A 1U36A 1R3KA 5IHZA 1B88A 2JJVA 1P84J 3IRZA 1XR9B 2NXZC 4S1QH 5JOFB 5LWYH 4L8DA 4MXQC 3GFUA 3AS1A 3ROLA 3ZYZA 1IM9A 1P4IL 5FYJU 2ZP0T 2MCPH 3RL2A 2IALA 4POZC 1AHWA 1IZJA 1U3HD 1YUHA 1KXQE 4PFEA 2HMID 4OGAC 3P4MA 1RHHB 4WCYL 2MHAB 2EE3A 1AFVH 3QUYA 3ALWA 5HYQA 4QRSB 3NCEB 3C60D 3QEQD 3GSVB 3K1DA 3QISA 2F5AL 3CIQA 5EA0L 3VFWA 3P4OB 2Z8VC 5I1GL 2FBOJ 3H9SA 4P4KD 3I2CL 1R0AH 3HNSL 2DIBA 2VNCA 2ZOLA 3H7LA 2V7HA 1GOHA 3IU4H 1LNUA 5BVPL 3DXAD 3BKML 3QULB 4EXPX 2O5XH 1CE6A 2DQHL 4OAWA 1F00I 1S7TB 2VLRB 4HKXA 5KVGL 3K4ZA 1ZA6A 2WUCL 4PLOB 2NY2B 1N5AB 3I75A 2V9QA 2BVYA 2DQUH 1HCFX 5EUOA 4QHKI 5TFSL 3X17A 3CFIC 2HTKC 1MUJB 3LHPH 3L9RA 5F6IC 3U30C 4KKNA 3WHXB 3X12A 4JFDE 4FFWD 1CGTA 1JPTH 1QA9B 4RFOH 3U9UB 1U2HA 3RJDA 4FTVE 1MF2L 1FFQA 1U8KB 1BWWA 3VXPA 3K2UH 4K3EL 3CVHH 5K9QG 1CIDA 3BUYA 5FYJH 2IPUK 4PGEA 2VQUA 4YDLC 4K7PX 5A2JH 4Z0XA 3KLDA 1P2CA 3BT2H 5SWZA 1UCTA 3B2VL 5DRXB 3WO3B 4PLJC 4CJ1A 1YMMA 1N0XH 1T2XA 2UYLB 3MYJB 3ULVC 4JPWH 1CFNB 3LRSA 3ZDZE 1MRFH 3FB7B 3U7WH 4ZPVB 4ENEC 1JYWA 4F58L 3RWGA 3H9HB 2DN7A 1XT5A 4FMKA 4R0LB 4PP2A 4LPVA 4C58B 2R4SL 1VADB 1FFPB 1CDUA 1R3LA 2VN7A 1JHTA 4OD3L 4PS4L 3STBA 1ZE3C 4WHDA 4UNTA 3WEXB 2JLLA 4OLZL 4X9HA 1FYTA 1BFTA 1QBAA 1KPUB 4I1NB 5I6XB 2YEZA 3DIFA 5IGXL 2CGRH 1UEMA 4M3KB 5EORL 3IKKA 4OT1L 1P7QB 4ZUSA 4CN4A 3JV5A 1HHHA 2HRLA 3V6ZA 3GHBL 4MS8D 2O5ZH 4WFGE 2B20A 1WT5C 3QNYA 4WY7H 1LE9A 4LEOB 1BEYL 5FM5O 3QUKA 1FL5B 4U1NB 2YPLB 4ODHL 2E7CA 12E8L 4HW6A 3ME0A 3RKDD 2QKIA 4OQTL 5DQ9B 3S37L 1HNGA 2Y7QB 2VB5A 2X9XA 4F9PC 3HG1A 4P23A 1A02N 3VDBA 3Q48A 4JKPL 3U7YH 4JFPB 3SGJA 1QBLH 3CFCL 3VJ6A 2C9AA 4LLAA 3WIIL 2W9DH 4GMSH 2X1OA 3MV11 3NN8A 4JLRA 3IDNA 5DFVC 3B5GA 3BRGC 3SKJL 4OGYL 1TTFA 4U2YA 4JR9H 3VFSB 1ZVHA 2ENYA 4JFEB 4HKBB 3WSQH 3BPOB 1CWVA 1E27B 1MCWM 5HD8D 4NZTH 4HGKC 5D2LF 4M1DL 1QOKA 3KPTA 1C5DB 3SDCA 3ULVH 1QRKA 3BHBA 5C08B 1BBJB 5FGRA 1F2XK 1ZHLA 3QXTA 3BD3A 4XMLH 2Z8SA 4YFDB 1NKOA 5F1OB 2GJZB 4RGOH 1RY7B 4L3CA 1SYVB 1RZJL 1A9EA 2MSPA 2AXFA 2BNQD 1S7VB 5GJTH 1RZKL 2PCPB 4DKEH 1FZOB 5IHBA 2G9HA 3PJSB 4XGZA 5KSUA 2I60L 5F71A 2EXYC 5D6DA 3CFJA 5GGQL 1INDH 3MRLA 3CK0H 2RHEA 4OLWH 1BJ8A 2CIKA 3BEVA 3O4LD 3WFBL 3E6FB 1QLRB 1H3PH 3OWEA 1KLGA 1BBDH 2FWOB 3O4OB 4UINH 1SHMA 1YEFL 2NY0B 5A2FA 2JB5L 3QPQD 4X7FC 4HHAA 2ICCA 4ODXB 1HH6B 2GUOB 5KS9F 4PRHE 2AGJL 1GAFL 5EUKB 4U1MA 3PHQA 1KYOK 2FD6L 4I3SL 2E8ZA 1LK2A 4TQEL 1J8KA 3DURB 4FOMA 1OPGH 1U42A 2VDLL 4AEFA 3KPLB 4GS7C 3G08B 5I1HL 1JHKL 4OTXL 5EU5B 2VDOH 3KPQB 2YWZA 4XB7A 3IXTB 4V2CB 2HFFB 1VFBB 2J8HA 1F6AB 2ZUSA 4JZJB 3RVVD 5DRWA 5E08L 3FFDB 1IKNA 1NGXA 4P5KB 1E6OH 2LAGB 3FZUD 5DJXB 4TSCL 4PY7A 4QEGA 3BZFA 3BQUA 3Q1SL 4BQ6A 3FQRB 2X4PA 4G3YH 4MD4B 4RISL 4XNYH 3T1FB 1JK8B 2Y9RT 5CWSA 1OCWL 1XR8B 4JN1H 2BSSB 2HKFL 1E4WH 1QFUH 1QKZH 2GT9A 5IWLA 5GRVK 4YHYC 3BP5B 1CICD 1OSPL 4LU5H 2R69H 1D5ZA 4EUPG 2MQ0A 3QJFA 5E6IC 4E0RA 2ZPKL 1H15A 2H1PL 4OCLC 5MP6H 2XQYK 3OB0H 4XNZB 4Y4HA 5CEYB 5F9WC 2IH1A 4FQLL 3L7EA 4ZSOE 2PO6B 3V5HA 1K6QH 3SDDD 2VH5L 3TV3L 2J12B 1JE6A 2ORBH 5CILH 3QNXA 1TXKA 4UV7L 1UXSB 5C0RL 5IQ9B 3QPXH 4UDUA 3L3IB 1SBSL 3QXWA 4KKCD 2YUXA 3IGAA 2LTQC 5DR5H 5DWUL 3MQIA 4J3XA 5D8JL 3ARDD 4LAQH 4GKZA 4N8CL 3IJSA 1ROWA 3HI1A 3KPNB 3ARWA 3B83A 3A6CL 2J8OA 1IGMH 3OG4B 4HXBH 1OTUD 4K55A 1G7JA 4NO0B 4EI5D 5DVOA 5GHWH 5DJAB 5C2BH 5L9DH 3SBWC 4P9HL 2XFXA 1W72H 4S11A 3I6KA 2DQTH 4OZ4B 4Z7UA 1KJ2L 5H37G 4KUZH 3PHOA 1EAPA 4PJIE 1NBZB 4V1DE 3UCRA 5IHZB 2HG5A 1VFOA 5GISL 4KZDL 5C0AE 3ARPA 1X5LA 2JF1A 2ICWI 5DD5L 3MLVL 1IM9B 1J0KA 4A6YL 3QUMH 1CIUA 1MLCA 4M5ZL 4HT1H 2IALB 4PRDB 4XPTH 1ZHNA 1YUHB 3JV4A 4X4YA 4HC1H 3RWJA 2J5LC 1GH7A 3TJHD 5CBAA 3L6FA 5BV7L 4LKCA 3QUYB 5HYQB 2BK8A 2F19L 1DSFL 5E2VL 4P46C 4HZAA 1C12B 5HHOB 2WUBH 2ZKHL 3UBXG 2OQJA 4BZYA 4R90L 4DFIA 4OCYL 4Z77A 5BS0B 2ZOLB 4UIKL 4HIIA 1S7SA 1CXEA 1LNUB 4BZ2H 4M48H 4H1LA 2Z93B 3MLYH 1QFWI 4PUBH 4WTWA 4Z95L 4KI5D 4PREA 1CE6B 5L88H 1Z5LA 4Y4KA 2CR3A 1PKOA 5E8NB 5SWQB 4HKXB 2FX7H 2IANA 2WZPD 1DUYB 1ZA6B 5E6YA 3HE7D 1CTOA 3O3BA 3ULSA 3CDCA 3OGCA 5EUOB 4OLEA 1JZ6A 4E42A 4BUHA 4HF5H 4LSSL 5F7LB 4HWNA 4G7YH 1FC2D 2BNRD 3IDIA 1FAIH 5FYKL 3VXPB 2HVKB 4MB4A 2XPGB 4GSDH 3GSOB 3RUGA 3DVNB 1IKFL 3RGVC 4PGEB 5F9OH 1IFHL 4MGXA 4NHCH 3F58H 5F7MC 1N4XH 5HYJA 4JRWA 1P2CB 5E5RB 5SWZB 3VWKC 3JV6A 1A5FL 1MCKA 3U46A 1YMMB 5E8EA 2ICWB 4AENA 2V2WA 1NDGB 4PG9B 5CUSL 3EYFB 2DQJL 2E7LA 2XA3A 2XV6B 1BM3L 3RWGB 1J5OL 1Y0LA 1KCKA 3CFKA 3OZ9L 2RAMA 2V5TA 2H3NA 3NPSB 4NO3A 1D9KD 2DLTA 1NMAL 1R3LB 2F74B 1MPAL 1JHTB 3QQ4A 5T33H 4BQ8A 4KKLD 4JFYA 2PR4H 4S1DC 3RZCA 4TPRH 5ANMA 1HOCB 3V2AR 5TQ0H 1JPSL 3GSNH 4NQTA 3TJEL 2R2BA 3GBMH 3AREC 4JFHD 1EEZA 4NZDA 3C09C 2A6DA 5KVDH 5LBSL 3D18A 4G8GE 4ODBD 2NY3B 2VL5B 2OJZL 4NDMB 5E8PB 1T1WB 4NQVB 2EH8H 5CZXD 2QKIB 5LGJA 3R06B 2G60L 4HAGA 5FYJE 5I18L 5J6GB 4XTRC 3GJEA 3MOAH 1UZ8B 1QSFE 3DGGB 3HG1B 5E24E 5DUPL 1L0YA 1J05B 4YH6A 3KYNA 2YOCA 4WEBL 3OXRA 3KPMA 5JPNA 4JLRB 3IDNB 3FRUA 1JZ8A 1YEKH 5EZLA 2FYYA 4JRXD 4I0CC 3X3GH 5GS1C 3Q5YA 4BK5A 2X4QA 4F57L 3RNKB 1NLDH 3OAZK 2DWDA 3VGGA 3IDUA 5BXFA 3GB7A 2OZ4L 2DD8H 2YSSA 4JY5H 1TZIB 5L2JA 4G6FB 4KRLB 4MQ7A 5FOBA 1KPVB 3SDCB 1TCMA 3BHBB 2XY2A 3MLZH 4XCYA 1CFVH 3T4YA 3B8SA 4WW2A 4AIZA 4L3CB 3UPAA 1LO4H 4J3SA 3T3ME 4LASL 3WNLA 1CFSB 5KSUB 2IADB 5T1MA 3B5TA 1CD1A 2EXWC 4BQBA 4PB9H 3MREA 2OL3A 4QF1B 5ACLA 3QEGL 4RWHA 3B4NA 2HFEB 4X98A 3M1BA 3BEVB 1ZLVH 1L4IA 5CP7A 5C0BE 4LFHG 3B3IA 1KLGB 3SDAA 1VPOL 3HB3C 3ZTNL 4Y5YA 3JTTB 4JAMB 5GSVA 1Q38A 2Y23A 5D71L 2GI7A 1U95B 3GKWH 4WFHE 4NHUA 2JK5B 3S36H 2ZCKH 2QHRL 4UMGA 1MI5A 5I0ZA 3U0PA 3MNWA 2AVGA 3ZMRA 1F58H 4O51B 4Y1AD 2X4SA 3ARYA 3PHQB 3V4VL 2M26A