4P5TD

14.c6 tcr complexed with mhc class ii i-ab/3k peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
217
structure length
199
Chain Sequence
FEAQKAKANKAVDHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRA protein
publication title Effect of CDR3 Sequences and Distal V Gene Residues in Regulating TCR-MHC Contacts and Ligand Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 199
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
D PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4p5tD02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4p5tD01
2H8PA 5FHBL 5FYKD 3QI9D 4KZEH 1FIGH 3I3DA 3GGWB 1ZV5A 3ZHKA 4LNRB 1LVEA 3KS0H 5C0FA 3RX7A 1P7QD 1LNUA 1AGDB 3CH8A 5DURB 5ITFB 3K4AA 3WBDA 3ZSTA 5FDWA 3WCYA 5D5MF 3T3PE 4FMFA 4LIQE 5DFWH 3NBNA 5IB1A 4O9HL 5E9DA 4QY8A 1MAMH 3ZTJH 4KK5D 5FF6A 1XGPB 4PJGE 5TH2A 2Q8BH 3G6DH 4U05A 4LSVH 3L3HA 5LCVH 3RBSA 4JJ5A 4HKZA 5EN2A 2ZUXA 3STLB 3SDAA 4OLUH 4OZHF 1M6OB 4X6DE 2R2BA 4JPWL 2WP3T 4PJIA 2W60A 4TRPH 3QO1B 1NLDH 1KIPA 4U7SA 1HHHA 3RVTC 3AM8A 3DROA 3GMQA 3QIUC 5DJ8B 2BVEA 3GSQB 1F6AB 5HGDA 5C07E 2ERJC 1D7FA 4OBSA 3RUGB 5BOZG 5CP7A 2XWJB 2OJEB 1O7VA 1JMZA 4L8SA 3V6FA 2NY5C 5DLMH 3RY5A 3H9HB 2GSGB 4RMQA 1K8DB 5EO1B 3U46B 3ARFD 1C7TA 1KV3A 4BQCA 4Q9QH 1LEKB 3VGHA 1W0VA 1BWMA 4F7PA 5KVDH 1A22B 4U2YA 4MNQD 3QUYC 5JXEC 2HA1A 5T1MA 4ZSOA 1YJDL 1OCWH 1AD0B 3WNMA 5AZEL 3SJVB 4LNRA 4U33A 1H3UA 1AGDA 4PRDB 3JWOL 1FDLL 3DGCR 5ITFA 4G8GD 2E7HA 2W9EH 5JDJA 1I9IL 4ERSL 5D1QB 1KC5L 2P24B 1Q38A 3TBSB 2EC8A 4S1RL 2LU7A 3P30L 4KRPC 4Q0XH 1TJHH 1U3HB 1XGPA 2GY5A 1BD2B 3ARGC 4FZ8H 4K3HA 3MJ8B 1ZAGA 3S96B 2VXTL 3SE8H 1M6OA 1OF2B 1EV2E 5I16B 5JLZB 3QO1A 4XNMB 4X6FB 3V0VB 3SEPA 3TV3L 2HTKD 3C5SB 3VG0L 4K8RC 3UTZB 5DJ8A 3GSQA 3SKUD 1F6AA 4X9HA 4CNIB 2D7TH 1A3QA 5T5NG 2R2EB 2NY3D 4LHUB 1YEJL 2GY7B 3LKNA 5CP3A 1T1WB 4Z7WE 2OJEA 2FSEB 3ARDA 4N5ED 3HMXH 4LU5L 3H9HA 5D8JH 3KR3L 2GSGA 2IAMB 2XOTA 1K8DA 2FJHB 4HT1L 3U46A 1K6QH 4K2UH 3ARED 1M7IB 1CK0H 4P0DA 3W2DL 1LEKA 4W6WB 3X14B 5E5UB 3AGVA 1HOCB 3EBAA 1H3VA 4IEFB 3WN5C 3A6BH 4U3XA 4LLVB 4L4TD 2VDOH 1A1MB 3WFEH 1TZGL 3O4OB 1AD0A 2BFVH 4P4KD 3ULVD 3SJVA 4KV5F 1T7XA 3SGJA 1EXUB 1DJSA 4PRDA 2VDMH 4FP8L 4X6BB 4QHKI 3FOLB 3EGSB 1ZOXA 5JNYB 2IQ9L 5BS0B 5D1QA 2A2QT 2P24A 1EMTH 4AH2B 1TQBC 1C12B 2YPKA 4O5LH 4P3WA 3TBSA 4HWBH 5DQJB 1U3HA 1BD2A 2MMXA 5IJKC 1IC1A 2IPTL 2VWEE 4JRWA 3MJ8A 4J4PA 4XB8A 4CJ0A 2Y72A 1OF2A 3E2HC 4NKDB 5C70A 4ONOA 5I16A 2VN4A 5JLZA 4XNMA 4X6FA 1QFWM 3V0VA 1K85A 4YH6A 3W11D 3C5SA 4MQTB 3BPOB 4KI5D 4CNIA 3ARPA 2R2EA 4G6KL 4LHUA 4LSRL 4N8CL 1T1WA 5IB4A 4AQOA 2FSEA 1HZHL 4WI5A 2YUZA 1SY6H 4ORGA 2V6HA 2IAMA 2FJHA 3GMMB 1T1ZB 1JHTB 2YWZA 1M7IA 3X14A 4XBGB 3I75B 4YDLC 3T4AA 3S3PA 4BH8B 3NAAH 4LLVA 5I1IL 1A1MA 2VZVA 4M1GH 2OR7A 2JCCE 1DFBL 4KJYB 2A9ML 2QKIB 3PL6C 2QQQA 2VIRB 4R2GB 5F70A 7CGTA 4UBDD 1QKZH 3L3JB 1EXUA 1CDUA 2BNRB 2RQ8A 3C8DA 3KJ4C 1OP5K 4JM2D 4X6BA 4WO4C 2XIDA 3B9KB 3FOLA 5GRJH 3ES6B 3EGSA 4FS0A 5JNYA 2AXJA 4H25B 1FGNL 3HR6A 5BS0A 3NTCH 2NY3C 4L8CB 4KHTL 4AH2A 1J7VR 3DX9B 4LIQH 5DQJA 4AM0A 4P23B 2EE9A 3IRPX 35C8H 3BKJL 1B6DA 2F8OA 2XICA 3PG2A 3MRCB 3WFDH 1HK6A 1A7RH 1CFVL 2LU4A 4W6YB 1JNLL 1BFVL 4NKDA 1KLUB 3D85D 2KQNA 2M26A 5IW3A 5F1OB 1NCTA 3SCMB 5CEXB 1ZWIB 5ERWB 3VWJD 4M43H 3E0GA 2BHZA 2EDWA 4G6ML 4JFDB 4NBYB 3PGDB 4NYLB 2H2SC 2NLJB 1FFPB 1UEMA 1YZZA 3GMMA 3L3OB 1T1ZA 2AQ1A 1JHTA 3GRWL 1QSEB 3PQYE 4MHHG 5B38G 1AXSA 4XBGA 3I75A 3I3EA 1IAII 4BH8A 1ZGLM 1ZGLP 4HLJA 3WJJA 3VI3F 1F11B 5CEZD 3WYRA 2IFFH 4PJXB 5ESVB 4BM7A 4KJYA 4Z0BH 3TT1L 1KIRA 4GRLD 3I6KB 4M7LH 3BGFB 2QKIA 3CVHH 4BQ9A 3KLAB 2VIRA 3FN9A 2XT1B 3L3JA 1EZVX 2BNRA 3C6LC 1BBDL 3ZMRA 4UTAH 3JXAA 1LE5A 3CX5K 3MXWH 3B9KA 3DMMD 3ES6A 4B41A 1YQVL 1IRAY 1JPTL 1WT5C 1DBKL 4H25A 4PBVC 1XAUA 4NJAL 2Z35B 2FD6L 3RI5K 1MH5B 2ZUQC 4PLKD 1CGXA 3DX9A 1YMMD 5HI4D 1MLCB 2BSRB 3FQRB 4P23A 4JFFD 4RGND 4UIKL 1DDHB 1FVDB 1KJ3L 4LRNL 3MRCA 5I71C 4OZIE 1K8IA 1UM5L 2MCPH 5IVXB 1KLUA 2VYRE 3SCMA 5CEXA 4Z95H 1ZWIA 5FYJL 1JPST 1Q0XH 5ERWA 4BUGA 4LEXL 1Q9KB 2YD4A 3GSVB 2J6EL 5I1CL 3O81A 4IMLB 6FABH 4UBDC 4JFDA 3PGDA 1I1AD 4NYLA 5I30L 3UMTA 2X42A 4KK6C 2NLJA 2DLEA 4JRYB 1FFPA 4FQHB 3SE9H 3L3OA 2IALB 1DEDA 4NZUH 1QSEA 4EZMA 3TEUA 4JO4H 3FQUB 2AJYL 5CIPB 5CWSB 5JIKA 4OGYH 3C5ZD 1C1EH 1F6FB 1K3IA 4KJPD 4Y8AA 5FYKL 3UBXG 1LP9E 1F11A 1GGCL 4PJXA 1ACYL 4MQ7B 2Q7NA 5ESVA 4OI8A 2OR8A 2AI0H 3VJ6B 3OJ2C 4XH2B 3KLAA 3A6CH 2PTVA 5GJSH 4H0IA 3VFMB 2Y23A 2NY0C 3PWVB 5DRZA 2ZCKH 1QFPA 5GGUB 5HI3C 2P7TA 3RVXD 1FAIH 1I9EA 3DETC 1N6QH 3I85A 2O5ZL 5E4EC 1X5YA 1IAIH 5CZVH 4HC1H 1MH5A 2A38A 1FH5L 4HKXB 3QUXC 4JN1H 1NLBH 3IDNB 5HVHC 1MLCA 2BSRA 3FQRA 1F4WL 5EZOH 4I9WD 4JPIB 4ODVH 2OSLB 5C0AE 5F6IB 3F12B 1OGTB 1HN1A 1K3ZA 2VDQL 5IVXA 4OD2A 1TETL 2B2XH 4ONFL 2P45B 3CFCH 2Z31D 1Q9KA 2DQJH 5EZLA 1J18A 1RZJH 3GSVA 3RHWF 1QRNB 3S36X 5KBNC 5ID0B 4ONGL 4N90D 5C0CD 4IMLA 4ACPA 1UH2A 1IM9D 5T5FH 5D93B 1I8MB 3K1KC 4JRYA 4QLRA 2A74B 1V7NL 4FQHA 2IALA 4GRWH 3FFDB 2MSPA 3FQUA 5CIPA 5CWSA 5HI4C 3VDCA 4Y4KB 1C5CL 2GCYB 1ES0B 2P42B 1CLZL 2IH3A 3NN8B 4RGNC 1AO7B 3Q5YA 4R96B 2R8SH 4CDHA 3BWUC 4MQ7A 2DBJA 3UYRH 1CDIA 2AJUL 3B4NA 3QO0B 3PIQB 5GZNC 3VJ6A 4XH2A 5DK0B 2FCBA 3PWVA 5J13C 1KIQB 1MY7A 5MERB 5GGUA 1SBBA 1I8KB 2BY1A 2WNGA 4JGUA 1LO4L 1PX3A 1TJIL 2M8XA 5GS0D 1EUTA 1RIVH 4Y19B 2NY2B 4M4RA 1G84A 1S5IH 3BRFA 4HKXA 4NUJB 3FT3B 3IDNA 4YHYB 4OCLC 3S35L 4KMTH 3TH4T 5FUCE 4JPIA 5FAAA 2CDGB 2OSLA 3VCLB 3F12A 4IRZL 1OGTA 3ZKNC 4QRTB 4MAYB 2NY4C 4YZFE 3C60D 4V1DE 1X5AA 5E6ID 1MJ7L 4RWYL 3SQBA 4PRHB 4IDJH 5DRNB 4QF1B 5ID0A 3U6RB 2ICES 2YKLH 1NUDA 1FHGA 2CK2A 4K3EL 4NWUL 1PLGH 2VXVH 5EU6B 4FFYH 2XA8H 1OP3K 4WHTB 3RVXC 3MZGB 4TUOB 1KSRA 3IAQA 2A74A 5CJQL 1IGTB 2ORBL 4YK4C 1TCRB 2IJ0C 3QCVH 4Y4FD 2DKMA 3FFDA 5D1ZB 5C07D 4XMPH 2IQAB 3UBXB 3ZL4H 5E99L 2GCYA 1ES0A 5DHVB 4NCDA 1DQJB 3NN8A 3BRDA 1AO7A 4R96A 4ZOBA 4YWGL 3ULVL 4PPTA 2VDPL 3T0EC 4DUVA 3QO0A 3PIQA 4Y5VC 5DDHB 2J8UB 4NWTH 5DK0A 3F6IA 5MERA 3N1GC 2YHGA 4OKVB 1GCFA 1OAYH 2Z31C 2I5YL 4MD5B 4YHML 3TWCL 1I1RA 1IAMA 2OR9H 1INEL 5DS8A 1HXYB 4Y19A 5F72S 3UC0H 2FECI 3IU3B 3MCLL 4ZXBB 4AT6B 1CFSB 4NUJA 3FT3A 1T2QL 4EN3C 5CMAB 4OM0H 3MLUH 3VXME 1BZ9B 2CDGA 4FNLL 4KH2A 3GMNA 1A6PA 5B8CB 2ESVD 4X7SL 4PJDE 3FAXA 1RUKH 5D5ME 2ZUYA 5SWSE 5D7JC 5DEGA 4PJFB 5LVEA 1FPTL 1M7DB 2SEBB 3HCVB 4F9LC 1ZK9A 1E6JL 4LLUB 1OAQL 3M17B 5M94B 2RGSA 4PRHA 4UIMB 5DRNA 4PP1D 2DBLL 4QF1A 3U6RA 3SBWC 3UEZA 1UH3A 4JB9H 2E6QA 5CD5D 4OZHE 4WHTA 2OZ4H 4ZYKB 4TUOA 3QUKB 2UZIL 1IGTA 1C5BH 1TCRA 5D1ZA 2IQAA 3TPUA 3UBXA 2AK1L 4YHZH 3IU4H 25C8L 2XZAH 3DX8A 5DHVA 3IFNL 1DQJA 4MXWH 3VGDA 3ZHLA 1I8IB 5DJ0B 5LQBH 1N5YH 1A5FH 4JPVH 1A1NB 5KSVA 2LQRA 5DDHA 1BM3H 2J8UA 4YC2C 3FJTA 1FIGL 2JK5B 4X80L 3R8QA 4OKVA 4MD5A 4QTIH 1QFOA 4HXBL 1N0LA 5J6GB 4KXZI 1MAJA 3IU3A 4ZXBA 2V9TA 3RWHB 4AT6A 1CFSA 4DOHE 5C6TL 5CMAA 4GBXB 2Q8BL 1BZ9A 2L0DA 5E95B 4E0RB 1DBBH 1UWGL 1XGYH 3G6DL 3OAYH 4LSVL 5DUPH 5LCVL 5B8CA 2C3VB 3QJHB 2YPLE 4OLUL 4CKVX 4WUKH 4PJFA 3VMOA 4TRPL 1M7DA 4YXLL 1WLHA 2FBJH 3N85L 2HRPL 3HCVA 1NLDL 3MUHL 4LLUA 4K9EH 4X99B 3M17A 1IKNA 1RZKC 4FFWC 3TA3D 3JTTB 2X1WL 4UIMA 2EEBA 3X17A 3RVWD 2FO1A 3HUJB 1A47A 3MTRA 2WBJC 1X5IA 4I0PB 3QUKA 5M95B 3JVGA 5CEZL 5BOPA 5HHOE 1UC6A 4D0CB 4Q9QL 5D1XB 1KCLA 4HLZG 5E24E 5DUBB 4N1EA 4WEMB 3IDYC 5KVDL 4Y2DC 1MJ8L 4NJ9L 4QGTA 1I8IA 5DJ0A 1CGTA 1YNTB 3NZ8B 1A1NA 3QRGH 4IIQC 1CDYA 2JK5A 3ZYZA 2WIIB 3VGFA 1NFKA 1RV6X 3BESR 3ESUF 4PJ8B 4Y4HB 4PJIF 1R3KB 4J3SA 5HY9B 4WHYG 4JPKL 1OP9A 2FGWL 2I9TA 2W9EL 1EBPA 4NO0B 3U9UB 5J6GA 2E8YA 3RWHA 3G6JE 5F7LB 3W9DB 4LCCC 1FYTB 1XF1A 1Z3GL 4ZS7H 4Q0XL 1D5ZB 4KV5E 1TJHL 3Q2CA 4XVUD 4J3XA 5FHAH 4GBXA 4QRPE 4E0RA 3WV0A 1A7NH 2V5RA 3BHBB 2C3VA 5B21A 3QJHA 5GJTH 4OCMC 4G6AD 1MWAB 5IG7B 2OXGA 4OGAD 3AS3A 4X99A 4WCYH 5BRZB 1U8LB 4KXZH 3JTTA 5KS9E 5IHUH 1Y6MR 1DBJH 3QUML 5ICXB 2YK1H 1NCDH 4PRPE 1AC0A 4Y5YC 3AROA 3HMXL 4I0PA 1UXSB 4OCRL 2R0WH 2EIDA 3HZYB 4HJ0C 1F02I 1GYAA 1ADQA 4V2BA 1K6QL 4LHQB 4IRJB 1CK0L 3F7VB 5D1XA 4LASH 5DUBA 5C0BB 4ZAKB 3QR2A 4PYHA 43CAB 3S88L 1D5MB 3A6BL 2VLME 5F7DB 5IB2B 2NTSP 3O3BB 2VDOL 3PUCA 4M6NL 1YNTA 3NZ8A 1RUQL 2AEIT 4KC3B 3RGVB 3LPGA 4S2SB 1NAKL 4ZOCA 4TSAH 3PQYD 3SGKA 4HS6B 1NEZG 2X6MA 4MA3B 4NQSB 5EWIH 1FC2D 4PJ8A 4Y4HA 3TGXA 4U0RB 3L9RB 1T04B 3U7AA 5HY9A 2FLBT 1NAMA 2VDML 4YR6B 5EOQH 4IOIB 4H88H 5JDSB 4NO0A 3U7YH 3U9UA 5A2KH 3NCYS 2OTWB 4EIGB 1OWRM 4M4PA 4OIAA 1EMTL 1KJMB 3GM8A 1QLEH 3HPJB 3EYOB 3W9DA 1FYTA 4O5LL 4HWBL 2XPGB 4EXKA 1D5ZA 2QV2A 3V6OA 5KVFH 2XN9B 2K7QA 2EEAA 3BDYH 1MRDL 3GIVB 4OQ1A 1QSZA 1NCBH 3SKOB 3BHBA 4BSJA 2QTEA 4NC2B 1S7VB 3LD8C 4TQEL 1AQDB 2UWEE 4QGYA 1MWAA 1F00I 1G6RH 2WMPA 3I2CL 3RIFF 3KJ6H 5BRZA 1U8LA 4QXGH 5AZ2H 3T0AA 3DV6B 3T8XB 5ICXA 3HMWH 3ARQA 3RAJL 4D9LH 3OPZL 3HLAB 1DBAH 5ETUA 3RJQB 4KKLC 5FO8B 1UXSA 3HB3C 4M6AA 3QG7H 3HZYA 2AP2A 3K74B 1IVLA 3GUTA 4JHAH 2FO4B 4IRJA 3F7VA 1BQUA 5EO0B 5C0BA 4ZAKA 2AJXH 43CAA 3NAAL 1D5MA 1RU9H 2A0LD 5IB2A 3O3BA 4QOKD 1HWGB 1NMBL 3RGVA 3U7WH 5IROA 4S2SA 2R2CA 1IC4L 3TYFB 3Q1SL 1NDGA 4HS6A 5HDQH 4MA3A 4NQSA 5GS0L 5I1EH 1QKZL 3OL2A 1J87A 4G6AC 2VKWA 4ZUSB 1T04A 4AENB 3NFSH 4YR6A 4IOIA 3VI3E 1G7JB 3SDXB 5GRJL 5JDSA 1TXKA 1P7QB 1JYWA 2NZ9D 3MCG1 2OTWA 1ZMYA 3HPJA 1KJMA 3EYOA 4LIQL 1OD9A 2PO6D 2APXA 2Y07H 1I85A 2NCMA 2Y7QB 2X05A 1KTRL 2XN9A 35C8L 1EH9A 5IVOA 1BVZA 4RGMC 3MOQA 4YDVB 5C3TA 1WICA 2AV1B 1BAFH 4KVCH 3WFDL 4UDTB 1S7VA 5C09B 3WIFB 3O6LL 1AQDA 1AE6L 2DQIH 4XPTH 5HGAB 2RB8A 4QRRD 1QBMH 4UV7H 1DEEB 1BJMA 4M43L 3DV6A 2O5YL 3QHZH 3T8XA 2OK0H 5E7FA 5T1KD 1S7SB 3TIEB 3HLAA 3LIZH 1FFQA 3U0WH 5FO8A 4K3DH 1CFQB 2FNBA 4YFLF 2C1PA 4ODBD 3ULUE 1K5NB 2EXWD 15C8L 2FO4A 1YYMH 4K3GA 4XNZC 3IDGA 3BKML 5EO0A 4FQLL 4L29A 4F9PA 4NUGH 5H94B 4LAJH 4LLMB 2FX9L 3TYFA 4IHOB 3SE3C 3CVHL 4OLVH 2QR0B 3QSKB 5D72L 3HG1B 4ZUSA 3OHXB 4AENA 5D9SB 2H1PL 4NCC1 2FL5B 3V4UH 3NACH 3BYYA 1G7JA 3SDXA 1ED3B 4UQ2B 1P7QA 3B9DA 5CZXD 4O58L 3PV6B 4FFVD 4UU9B 4Q2ZB 4JZNA 4EJ1C 1X9QA 2Y7QA 2Z0BA 3MC0A 1IGCH 1DSFH 3RDTC 1ACZA 4MDIB 1UKQA 3F65A 4YDVA 4OZFG 4PJ9C 2LAGB 4UDTA 1FZOB 2DI8A 5C09A 2ATKB 2MCPL 3WIFA 2C3WA 4DFHA 3RIAK 4YPGB 1J5OL 5HGAA 2F8VA 4D8PB 4FXKB 1Q0XL 1DL7H 4YGAB 1DEEA 1UM6H 1NCAH 1EBAA 4PYGA 2MOVA 4S1SL 1S7SA 4V1DD 3TIEA 3DYMA 3QWOB 3EDFA 4XI5C 1CFQA 4YHIB 2N7BA 4M1CC 5JPNB 3BKYL 1K5NA 4HUXB 4G7YH 4NZUL 3WXVH 3BPCB 4DKFL 1YEFL 3UJJH 2PO6C 1C1EL 1DTUA 3LH2H 1JE6A 3KYMB 3AREB 4RMSA 5DYOB 1E4XI 4HKBA 5H94A 4JZJB 4LLMA 4RMWA 1MPAL 3B8YA 2AI0L 4MJ4A 2QR0A 4MJID 4JM4H 5AUMA 2XNAB 2BY2A 3LQAL 5GJSL 3VFOA 3MV7D 1KN2L 1V05A 3HG1A 4ZTOL 4P4KB 2VERN 3OHXA 1INQB 1N4XH 5F1KC 2FL5A 2DKSA 5C6WH 4KGJA 3V5HB 1ED3A 4H1LB 1N6QL 2GW5A 4UQ2A 3UJIH 5T5NF 5GRZA 1IAIL 5CZVL 4K9EC 3DVFA 4UU9A 1T03H 2ID5A 1YECH 1BQHB 5EZOL 3DUSB 3AAZB 3KXFE 4MDIA 5EZJB 4TSCL 5EULV 4R6UA 4K7FB 4K94C 1FZOA 2ATKA 4MB4A 3O0RH 2JJSA 4LKXB 4G9FE 3DX7B 2F8XC 4YPGA 3HI1B 3VXSE 4D8PA 4FXKA 3CFCL 1KACB 3EHBC 3MRFB 1RZJL 2HWZH 4PJXF 3MLXH 2J8HA 3KYNB 5CINL 4Q7DA 1FE8H 1YEIH 5SWSD 1OAXH 3HHRB 5DJDB 1EEUA 2F58L 5A2JH 3KYOB 3QWOA 4WEBH 4HWZB 3QDAA 4ONHB 4YHIA 4JDVB 1U0QA 1ZVHA 4XP1L 4HUXA 4XCEB 1NFDE 3BPCA 1S7TB 3BDXA 3KYMA 5FGBA 5E1HB 5GGRY 5CGMA 5DYOA 4NO3B 3K2MC 2DLGA 3IRZA 4JZJA 1B0GB 3NPZB 3LY6A 3SQOH 3UYRL 1XFPA 5KANG 3I02B 4HUVB 4OT1H 3VXUA 2XNAA 4CU8A 2AW2A 1A6WH 3EFFA 1UCTA 4C4KT 4N0UB 5FUCC 4FTVD 4NQTA 5L9DL 4L5FH 1INQA 4D9RD 3BIBX 2CMRH 1XGTA 3F7PC 3GM0A 4I13B 3GMOB 5EB9A 4RZCB 3V5HA 4H1LA 1RIVL 4LCWE 4B50A 3LS5H 2EYRA 4R3SB 3EYQC 1E4XH 1P69B 1F2QA 1BQHA 1T83C 3DUSA 3AAZA 4XB7A 3RX8A 2MFNA 1RPQA 5EZJA 3CFEB 4J12A 4GUPB 2ZJSH 1PG7W 3INUH 1X6NA 3FOMB 4WFFE 5D96B 3DX7A 5CGYD 1ZEAH 4WW2C 1FO0H 1FYHB 5FK9B 4ETQB 4LMQE 3HI1A 4YDIH 1N64H 1XCTB 1PY9A 5ALBH 3ZKMD 4N0CC 4X6CB 5IEKA 3MRFA 3PNWB 1LO3H 3KYNA 4PJBB 1MY5A 3VWJB 5DJDA 3FQWB 4X83A 4TNVF 3UZEA 1PLGL 3D6GA 3KYOA 1T7YA 4HWZA 5C0DA 2E9BA 1VADB 1NGZA 4ONHA 4JDVA 2CR3A 5JW4Q 4GAYA 4M93C 4XCEA 1S78D 2BRQA 3G9VA 3F7QA 3ULUH 1Y6NR 5JHDE 1EAPA 4HIEB 3C8HA 5L2KE 5ESQB 3UTOA 5IP4A 4NO3A 5HHMB 1H9VA 1N7MH 2DQTH 3F8UB 4KQ3L 3D2UD 5E8PB 1JIBA 4HUVA 5DF0A 4FA8A 4NWTL 4NN6C 1MI5E 4YBQC 2GTZB 4NQCB 4N0UA 3S8WA 4RWHA 3DI3B 5ALCH 2ZNXA 4N9OB 4KDVA 3IDJB 1P6FA 3GMOA 5JOPD 2AJSH 4WUUE 4RZCA 4JFZH 2IBGA 1CF8H 5I6XC 2OR9L 2VDNL 4M6ML 3IKKA 2I07B 4R3SA 4WENB 3DMMB 5AWNH 3EDDA 4PJ7B 5ABDE 4OZFA 1AGFB 3THMH 3F62A 3MLUL 1IGJB 5F7FA 2R0ZH 4O51B 5CSZB 2C3XA 1RJCA 3RVUD 3CFEA 1HCFX 4GUPA 4N5UA 1RUKL 4UV4H 3B83A 2R1WA 3FOMA 2ICWJ 4OFVA 2CXKA 1NGWB 5FK9A 1EEZB 4ETQA 4X6CA 5BZWB 3CMOL 3NFNB 3FB7B 5I66A 3PNWA 5K9QG 3B43A 5F9AC 3HS0A 3IF1A 2DLHA 3AC0A 5F7HA 3VWJA 4JB9L 1ZT1B 3FQWA 3RWIB 1VADA 3DYPA 1F4YL 3SDDC 2IMNA 1T0MB 2PXYD 1I1AB 1AIFB 4GMSH 4QXUL 4PRPD 3QUMB 1HSBB 1FFRA 3UCRA 3IU4L 2XZAL 5JHLH 5C0JA 1EZVY 4ESKA 3LRSA 1T1XB 2OJZH 2AQ2A 3IS1X 4MXWL 2XACC 4N1HB 5LQBL 5INCB 1A5FL 4MWFB 3C5ZB 5DHYB 4IOFD 1V3JA 5E8PA 1BM3L 3ZDZF 3LN9A 2GTZA 4NQCA 3TIDB 2Q8AL 4LVNC 1RJZB 1QR4A 2FATL 2PKDA 2X4RB 3E1F1 5E9DE 2EZ0D 3OGCB 4YHNB 4LMQI 1MCWW 2I07A 3DMMA 4OCSH 1UJTA 3TZVB 4PJ7A 2AAVA 3JBG7 1QHPA 2FHCA 4PP2B 1AGFA 4PJIE 5GGQH 1IGJA 5C08D 4O51A 5CSZA 1L0YA 1MCOL 5FKAB 2ICWI 5C9JB 2DTSA 4WUKL 5IHZB 1DQDH 2VL5A 4H8WL 2FBJL 1NGWA 1EEZA 1CYGA 2HAZA 4K9EL 5BZWA 3NFNA 3FB7A 4NHCL 4NT6B 3RP1A 5LGJA 1PSKL 2FECL 5BMFL 4OD1H 1AHWC 5AEAA 3ZKXC 4E9LA 1ZT1A 2DQUH 2J8UF 3RWIA 2ZUUA 3WIHH 2ZNWA 3VRIB 4UAOB 1T0MA 3NA4A 1I1AA 2PNDA 1AIFA 3QIWC 2XQBL 1R3JB 2D31B 3BH8B 3QUMA 1HSBA 4ZSOE 1T1XA 3N50A 4LHJB 2BHUA 4UNUA 4GAGH 1U2HA 4MWFA 3C5ZA 5DHYA 3QRGL 4P3DB 3EYFB 1UACL 3TIDA 4PJFF 4Q9RH 1V7ML 2V2TB 4LEOB 3ARBD 2X4RA 1CG9B 1ULVA 1WIPA 5J89A 3DUHA 3LEVL 3QDMB 1I3GL 3EJZC 1DVFA 2B4CC 3OGCA 4ZTPH 2J7LA 4YHNA 2EDQA 4LSSH 4PG2A 2Q7YB 1D6EA 1AJ7L 4J3OC 3TZVA 2JF1A 2FH6A 2LFGA 1IFHL 4BJLA 4PP2A 4LQ1A 3DIFB 3PWLB 4GXUM 3M1BB 4ODHH 3L95B 5FKAA 4NOBA 4LSTH 5C9JA 3P3YA 4E41D 1U8PB 2YUWA 5IHZA 5GJTL 2P48B 5AYUH 3VFTB 3RA7H 4UNVA 3RUGE 4WCYL 4JG1L 4NT6A 4IOFC 4HUNB 5IHUL 2VTFA 5E6IB 4N8PA 2YK1L 1NCDL 4IDLA 1CGSH 5FEBA 4UTBH 4FQJH 4R4ND 5I1LB 1JF5A 3KLHC 4NIKB 2R0WL 1HSAB 4NKMB 2RHEA 4TSBL 4FQIL 2DLFL 2DDQL 1T66D 1R3JA 2AGJH 3RTQD 3BH8A 3QCTL 1KXQE 4LASL 3DUUB 1P53A 4Y4FB 3Q6GL 3HZMB 5TE4L 2EE6A 2R4RH 4ZFGH 4OF5A 1PY4A 3SJVE 3I50H 4P3DA 5JIPA 5GGRA 3EYFA 5C0GB 1UADC 3CU7A 1ND0B 4LF3B 4YUEL 4XNUH 3VGBA 1AXIB 2V2TA 4LEOA 1K4CB 3WJLC 1CG9A 4G42B 5EOQL 4E42B 3QDMA 4PJHB 1OAKL 3U7YL 3A6OA 2Q7YA 1BD2E 1ITBB 4HFUL 1QLEL 5MEQB 2NXZD 4JO1H 5KVFL 3LB6D 5JXAH 3DGGB 2V5MA 5E94B 1FLRL 3BDYL 3LEXB 5BVJB 3DIFA 3PWLA 5B4MD 3M1BA 3L95A 1YYLL 4PJEB 2AJVL 2YRPA 2W0KA 2R69H 1U8PA 4YBLB 2YPVH 2P5WD 5DJXB 3VFTA 2ESVB 1G6RL 3RPIA 3KJ6L 1I75A 4U3CA 4M62H 4QXGL 3FT4B 3UXFA 3UZVB 5E6IA 5C86A 5TE6L 4ZFOL 1YQ2A 2UZXB 4D9LL 1TLKA 5I1LA 4XHJC 5FUZH 2J2ZA 1EHNA 1HSAA 3L3GB 4NKMA 2LTQB 2Y06L 1D5XB 3VXRB 4JHAL 5C7XL 5DRXB 5DVNA 1RVFH 3ZDYE 1L0QA 3DUUA 3K46A 4FQXC 2AJXL 1KJ2L 1RU9L 2WQ8A 1AGBB 5HYSB 1LEIB 4MQXC 4L3AA 5C0GA 3OSKA 4ODUB 4M7ZB 1ND0A 4LF3A 3C09B 5BS0E 2W9LA 5FYLE 3S37H 1K4CA 4G42A 4E42A 4PJHA 1GC1H 2Q3ZA 4PRBA 4OFYA 4TOYH 3N06B 4XCNB 1LO0L 1CU4H 4A6YL 3NPSC 4V2CB 5MEQA 3JWDL 2Y07L 1EVTC 2A77H 4LP5A 1IQWL 4XC3H 5DFTA 5E94A 5AAMA 3LEXA 5BVJA 2AV7B 4KVCL 3HZKB 3QEHB 4PJEA 4NO5B 4FZEH 3QHTC 3BSZH 2DQIL 5SV3A 5E6ZA 1FAKT 2R1YA 4X9IA 2ESVA 1INDL 1GAFL 2HFTA 1NANI 4U6YB 1F8TH 1Z0NA 1QBML 4UV7L 3VGAB 3H3KA 2J4WH 3AU1B 3ULUC 1MCBA 1L7IL 3KWWB 3QHZL 1XR8B 1JUFB 1CBVL 3TA3B 1JYNA 3VXSD 3LIZL 3U0WL 4K3DL 1IEHA 2XKNB 3L3GA 3HC4H 1D5XA 2CLVA 2VLJD 3VXRA 1TJGH 2YD2A 3T08A 4BFBD 4LOUD 5T3ZH 1YYML 3FN3A 4DEPB 5JPMB 5IMOB 5DRXA 1FL5B 5IF0B 1CDBA 5IBLD 3IETB 1SYSB 5I8KH 3LZFL 4NUGL 1AGBA 5AG9A 3R0NA 2BNRE 3GHEL 1LEIA 4HZLB 2PR4H 4GRWB 2MJWA 2E9JA 4MLIA 4ODUA 4P2OD 3E8UL 5DMIH 1ZKAA 1Q9WB 3BQUC 4XP4H 2APWA 4RFOH 2FYYB 1NGPL 3B5GA 1QFUH 2VOTA 4GXVH 2DI9A 3EJYD 4XCNA 4WFEE 1MOEA 2WUBH 4FRWA 3D39D 1FFNB 1IGCL 1DSFL 2E8ZA 2MHAB 3O45B 2AV7A 4P2QD 1F58H 3HZKA 3QEHA 4NM4L 2Q20A 3RWFB 4NO5A 3MBXH 4RSVA 5LWYL 5A2IH 3QQ9C 4U6YA 5DD3L 3TFKC 2IGFH 3AU1A 4WI2A 4JFDE 5CP3H 1UM6L 3KWWA 1XR8A 3AUVA 1JUFA 3L5HA 3TBTB 5IEHB 4N9GB 3S5LB 3P0GB 3TA3A 4XP6H 1NFIB 1QSEE 4YFLI 2R9HC 5FM8A 2XKNA 3AB0C 3MBED 4UOW1 2ZOKB 3SDXF 2MQ3A 4G7YL 3RY6A 5JPMA 4PJXE 5F9OH 1FL5A 5IF0A 1DUYB 1MSPA 3LH2L 4F2MB 3H3PH 1YEKL 1JZ7A 3IETA 1SYSA 3NCMA 2D0FA 3HNVH 4NFDA 1NGQH 4EI5A 1PX4A 2EICA 1U8HB 4HZLA 1Y18B 4ZUVB 3LMJL 2X7LB 1EHAA 5CHNB 4WV1B 5L2KD 1Q9WA 2APBA 1N4XL 2FYYA 2GI7A 5KJRH 4WWKC 3RWCB 1J1OH 2E27L 4LPWA 2EXYC 4RX4D 5HSFA 4JFED 4LARL 3UJIL 5I73C 1ZVYA 2D0GA 4JFPB 1DQML 1T03L 1YECL 2VB5A 4H20H 3QAZB 1MFEH 3PHQA 2EO1A 5IVXE 1FFNA 3KPNB 4OAWA 2WW8A 2P5ED 3RZCC 4HS8H 3O45A 2YUXA 3EYVB 3E6HB 3RWFA 5KW9H 5GRWA 3V0WH 3V4VL 3EFDH 3O0RL 1VEPA 4M1DL 4HGKC 3WHXB 5H37H 4OLZH 5J6HB 3MLXL 4X6EB 1UB6B 4XVSH 4TTDD 3H3BC 4JRYE 3TBTA 5IW6B 1OAXL 1WEJH 3JV4B 4N9GA 5IEHA 4R26H 3OXRB 1T5WB 2NY1D 3JSSA 1NFIA 1UA6H 5BW7A 2G75B 1MREL 3SO3C 2E7MA 4CBPA 4GH7B 2ZOKA 1G9ML 1BQLH 5GZOC 3U30B 2VSCA 3QNZB 4Z7QF 1DUYA 5MEPB 2D9QB 1QLRB 1I8LC 3OJMB 5F6HI 4WFGE 3NCCB 4F2MA 3B6SB 5JW3L 4PLJD 5E2WL 3L5WB 2NY6D 3TN0D 4F8QA 1NMCC 1G7PB 4KDWA 1U8HA 3SQOL 1Y18A 4QOKB 4ZUVA 1UENA 4P9ML 3ZE1E 4C56B 2EDOA 4HFWB 4OT1L 3VWKC 3GIZL 5JMOC 4BFEA 5CHNA 4WV1A 3VFPB 4PB9H 3D87B 3GK8L 2CMRL 4NZTL 3RWCA 1QZ1A 5FYLH 5DVOA 1QSFE 3IDIB 1G6VK 4XPAH 3VFGH 1OY3B 2D3VA 3LS5L 3MGTB 1LMKA 4XCCH 3BAEH 3H0TB 1UJ3C 1E4XL 4OV5B 3KPNA 5E9DD 3D1MC 4JKPH 4XX1G 3EYVA 3E6HA 1XIWA 4HMEA 3LAFA 5I1JH 4MJ2A 3KHOA 1C5DB 3WHXA 1QRNE 5D6DA 5DR5H 3SDAD 3FRUB 4YDIL 2ILLA 5I1DB 4YXHL 5ALBL 4U1GB 1HNFA 3DI2B 5I74C 5J6HA 3RWEB 4X6EA 1UB6A 4QRRB 5IW6A 3JV4A 3OXRA 1T5WA 1MUJB 3DVGB 4S1DD 1FNGA 2A1WL 4DN3H 1EFXD 2G75A 4U0QB 4YE4L 2YBRB 5DTFB 1PW3A 1YUHB 4WTXA 1AO7E 3KHQA 2VLRD 1XH3A 3QNZA 5A3IC 5MEPA 4M7JH 4RMUA 3B6SA 1XCQB 2BVPB 2AJ3B 4KTYA 4J3VA 5H8DA 1HH6B 2OM5A 3O3AB 4LRIA 3D0VB 5DJCB 4L4JA 5T3ZD 3B9VA 2DQTL 3E6FB 4QOKA 5A2FA 1A7PH 5A2LH 4C56A 1NUNB 4HFWA 3QCUL 2H41A 1RULH 4J3TA 4P46D 3VFPA 1QLFA 3TJHC 5I8OH 4Y19E 3UTTD 2YD7A 4D94A 5JZ7C 4F58L 1MEXL 2JKXA 3FN0H 2R1XB 1CF8L 3DRTB 2R23B 3IDIA 4U31A 3GBML 4P9HH 3CDYA 3MGTA 5JR1H 4Z7OF 2HJFB 3QXAB 5AWNL 3ZDZE 3H0TA 4DFIA 4XCFH 1SHMA 4OV5A 4PGCB 4KI5F 4DCQB 4MXQD 3CH1B 3VMPA 3THML 1CXLA 4IRSC 2HKHH 5EUOB 3GSUB 1MHCB 4JEGB 2DQDL 5F9WB 5EC2B 3DSNA 1JGDA 4Y1AA 1C5DA 4PRHE 4GAJH 4YQXH 1I9JH 3FRUA 2NY6C 5I1DA 3EIFA 2EDXA 2H9GB 3TJEH 4R97C 5EU6E 1JNHB 1S8DB 3RWEA 1YN6B 4LSUH 4EI6B 4QRRA 3V5DB 3SDCD 4RNRB 4E5XA 3DTXB 1MUJA 3DVGA 4L9DA 1ZANL 1U3JA 3BP7B 4WI4A 1A7QH 2YBRA 5DTFA 3ARDD 5F88B 5E2UL 1YUHA 5DMGD 2GSIB 4P2CG 5EIVA 4WW1B 5JHLL 3QUYB 1XCQA 2BVPA 5FO7B 2J8UE 2OJZL 2JB6B 2AJ3A 4UT7H 5SX5H 5ILTH 1CLOH 2C1OB 1X3DA 3O3AA 3D0VA 5DJCA 1ZLVH 4RA0C 1HKLL 1T7ZA 1O5DT 4U1IB 2CO6B 2Y5TB 3E6FA 3VXTA 1FCGA 1LK3L 4OCYH 4XMLH 1I1CA 2D4DA 4JKLA 1NC2D 4S11A 3P0VL 4I3GA 5L0QC 3SDAC 4Z8FH 1NL0L 4MJIB 2CKNA 4ZNCD 3MV7B 1OT1A 3O8XD 2R1XA 4P4RB 3W9EB 1BEYL 4X6CF 3DRTA 2R23A 1WZMA 5FB8B 4FXGB 2ADJA 4KRPB 2HJFA 3QXAA 4JO2H 3GKWH 5D1QD 4PGCA 1MCFA 1IGIH 4DCQA 2UV3A 4DQOH 3CH1A 3BOVA 4PJFE 5GGQL 1UKSA 5EUOA 3GSUA 4JQVC 1MFBH 1BD2D 5EC2A 1WIUA 4J4PD 1DQDL 3JZ7A 3IFOB 3DARA 3V6ZB 3EYSH 1PDKA 1LGVA 4IOSD 2EDNA 4X4ZA 1S8DA 2DWDB 4HV8A 1YN6A 3B2UC 4OTXH 4OD1L 1FC1A 1P84K 3V5DA 4RNRA 2DQUL 2Z9TA 3DTXA 4Z7VB 4N0YH 3LKOB 3BP7A 3WIHL 1FNFA 3WDJA 4B7LA 3V4PH 5F88A 4FOMA 5CIPH 3G08B 3L6FB 4FQ1H 3RRQA 5DVKA 4TUJA 2DL9A 3TM6A 1AGCB 2IAMD 2GSIA 2A9NL 2CR6A 4WW1A 3OKEB 2ADGB 3QUYA 5JXEA 5FO7A 5L7XH 2X5PA 2JB6A 1J0JA 1CD1B 4PJ7F 2C1OA 4GAGL 2CRIA 1JHKH 2VO5A 2Y5TA 3D0LB 3U4EB 1MF2H 5IBTL 4PLOB 3RI5F 3QDGD 3N1MC 1WWWX 1KFAH 1J0YA 3CGTA 1KELH 3GMPB 1J88A 1KJ2B 1TZIB 4MJIA 1HIML 2V2XB 3FZUC 5DA0B 2ZCHL 2NX5B 3DJ9A 4P4RA 2X4NB 5EOCJ 3W9EA 2K7PA 4FTVB 5FB8A 1L6XA 4FXGA 4PTTB 1MRFH 1VA9A 1B2WH 5BS0D 3FT2B 5BQ7B 5KSBF 4R90L 4KHXL 1NCNA 3E2HB 5TJWK 2XZCL 4PLNC 4LSTL 3RQ3A 3UBXI 2BK8A 3OMZA 4GT7A 3IFOA 4A6YB 5AYUL 3V6ZA 4DZBB 3VDBA 4MVBC 4YFEA 3HZVB 3HUJE 2D0HA 3D25A 4GQPH 2DWDA 3VXOB 3VMNA 1JN6B 3QEUB 4FHBD 5LBSH 4FQCL 4JY4B 2A6IB 2XZQL 3CDFA 1GZPB 4PV9B 1CGSL 5GSVB 5TFSH 4Z7VA 5GSRA 2HT3C 5EBWB 3LKOA 3O6FC 1CE6B 1NBZB 1WZ1H 5BXFA 1Q0YH 1VGEL 12E8H 3G08A 3L6FA 1U58B 4MA7L 2I27N 1AGCA 3JTSB 4YDLB 4PRAB 3WN5A 4L8BB 5IT2H 2YZ1A 2HN7B 5MEND 2ADFH 2ADGA 3HFMH 4PJCA 4RMRA 4C54A 3H6JA 1CD1A 4J1UB 5KG9B 1U3HC 4OFPA 1VESA 3I50L 3D0LA 3U4EA 1LO5B 2I26N 3ZTJG 4H26B 4OCXH 3DURA 5C0RL 3KJ4B 1CD8A 1UZ6F 4HF5H 5J57B 3D2UB 4XNUL 3GMPA 1KJ2A 1TZIA 4R2GD 2V2XA 3K80A 4M61B 3T77B 4LLQB 4U1JB 1FYTE 2BNRD 2NX5A 2X4NA 5FHBH 4I1NB 1L7TH 4FTVA 4IM8A 3V6OE 4NQUA 4PTTA 4ZMAT 3VXNB 3U36B 3FT2A 4DTGL 1YEGH 5IJKA 2FDBP 3MLRL 5JXAL 3MRQB 2MNUA 4FG6D 3FO9B 3ZE0F 2ATPB 5F89B 4O9HH 3PF2A 3AMKA 3W39B 2YPVL 5C0ND 1PFCA 4A6YA 4DZBA 1JYVA 5E2TH 2HT2C 3HZVA 5DGRA 4NSKB 3VXOA 4RCAA 3FB6B 1JN6A 3QEUA 1IEBB 3ZSSA 3OKYA 4JY4A 5D2LB 2A6IA 1OTSC 1GZPA 2GUOB 5D7LA 5GSVA 3TBWB 3GSNL 5EBWA 2EDRA 3GDBA 1CE6A 1NBZA 3HRZB 4A2LA 5C0BE 2P8PB 4JFDD 5DSCB 2ZUVA 5F7UA 1U58A 3JTSA 3T0XA 1H5BB 4P57A 4PRAA 5DHVH 1S7QB 1ZLWK 2PXYB 2HN7A 3MLWL 4KGLA 2D7OA 1MCEA 3REVB 2R0LL 3S3SA 2DOCA 4MNHB 4QRSB 2UVEA 3CFDB 1R24B 1KLFA 4J1UA 5KG9A 3BISA 3MYJB 5F7KC 4NGHH 3BD5A 4OD3H 3EDEA 4H26A 3L7EA 3MRDB 1IQDB 3AS2A 1IE5A 3D2UA 4QHLB 1OSPH 3T0BA 1YJDH 3T77A 4P5MB 4LLQA 4U1JA 3SPVB 1GC1L 3MA9L 3LEYL 4Q6IC 5AZEH 5SX4I 2XN9E 3BPOC 4TOYL 4KKCD 3B5HA 3VXNA 2KZWA 3U36A 2A77L 2EIBA 5L2JB 4KK9C 3MRQA 3KLSA 4NZRL 1VERA 4G6JH 4WU5B 1I9IH 1KC5H 3FO9A 2ZSVB 4UMGA 2ATPA 4W4NA 5EZIL 5GPRA 4HW6A 1GOGA 3W39A 4FZEL 5C08B 3OAUH 5DRWB 2EEDA 1LDPL 3P4OB 3WFCH 1QFHA 1EGJL 4NSKA 1YEDB 2VNCA 5IVZB 2VXTH 4OB5L 3FB6A 4PREB 2WBWB 1IEBA 3EO1A 5FYJE 4EDXB 4YNYB 2XV6B 5D2LA 2CXGA 2GUOA 4Y89A 5HBBA 2QADD 3HRZA 3NA9L 2P8PA 3HC4L 5DSCA 4RRPA 1TVHB 1NEUA 3RKDD 4LCIL 3BE1L 1YEJH 4PJHF 3B9KC 5T3ZL 1H5BA 5D71H 1S7QA 2K9UA 2PXYA 1N6VA 4LU5H 3MFGB 3ARXA 4QT5B 2QJDA 4MNHA 4N8VG 1CXKA 5I8KL 3QFJD 4QNPF 4P23C 3MYJA 3W2DH 3PP3H 1QEWB 2DQGH 1H8OA 2PR4L 4HH8A 3QIBD 3SDXE 3MRDA 4WFGD 5DMIL 1IQDA 1CXIA 3ALWA 5TE7H 4QHLA 4PGDA 5C9KA 4RFOL 4AK1A 1TZGH 4P5MA 1AKJD 3SCMC 1A6TB 1WT5A 4JQIH 5DK2B 4N0FA 5EPMB 1QFUL 4PR5B 3SPVA 4J7RA 1CR9H 1H3WM 3LHPH 3ARBB 3ARRA 4R4FH 4F7TB 4GXVL 4QHNB 4FP8H 2WUBL 4L3CB 5C09E 5L2JA 1JRHI 5E8DL 3O6KL 4WU5A 1CICC 2OLDA 1KYOJ 3PABB 3ISWA 2AVGA 3ME0A 2VZOA 2PUQT 4YO0B 1DN2A 1X5LA 5C08A 3C5JB 3MBXL 5DRWA 2BRRL 4KTEL 2IPTH 4E41B 3P4OA 1F3RB 4ODWB 3WNLA 5SX4H 2IGFL 4OF8A 4ZUTB 3TBVB 4D3CL 1YEDA 5IVZA 43C9B 3CSYB 4PREA 4XAWL 4EDXA 4YNYA 1PG7H 4LBEB 5BV7L 3JUYA 2AEPL 4H0HB 1A6VH 4G8IB 3BGFC 3WUWG 4XP6L 1ADQH 1VB9A 2YRLA 3MRNB 4NQVB 3S6CA 1NDMB 1TVHA 1I1FB 4CN6A 4LSRH 5ANMB 1R3HB 4N8CH 1D3CA 5F9OL 3HKFA 3IXTA 5FCSH 3H3PL 4QT5A 4WTWA 4KUZH 1NGQL 1KEGH 2CSPA 5E8OB 1QEWA 4U7MA 4OUOA 3TT3H 4CUCA 1JNJA 1NAMH 3OV6A 5I1IH 3OAZK 3OKOB 3P4MB 5DQDH 5KJRL 1A6TA 5DK2A 5HI5D 1J1OL 5EPMA 3MRIB 2A9MH 4PR5A 2HLAB 3V6BR 3U0PA 3ARBA 1SBSL 5IKCB 4HIXH 4X4MA 1CI5A 3L5IA 4QHNA 5IFAL 4Y19D 4H20L 3EOBB 2NY2D 4L3CA 1Z5LA 1MJUH 5B39G 3I84A 3IFPB 1QVOA 2NY4B 3PABA 4KHTH 2NXZB 5GGVL 3V0WL 1MWAH 3C5JA 3QBTB 1NBVH 3NCFB 3EYUL 1EJ6A 1RFDL 4ODWA 2P5WB 2BVUA 4ZUTA 1S9WB 1ODAA 3TBVA 43C9A 1JNLH 3CSYA 1BFVH 4XVSL 5DFVC 1WEJL 4OLYL 4R26L 3OKNB 4G8IA 4L1HA 1JRHH 1MFAH 3BP5B 5FOJA 1MFDL 4UUJB 2NW2B 3LS4H 4NQVA 4TPRH 5ADOL 1NDMA 4ODXB 1U36A 1I1FA 1BQLL 1R3HA 4Z7NF 4LFHG 4G6MH 4N8VB 4MA8L 1RZFL 3CFBB 4L4TE 1SYVB 4DUWA 3V52H 4KVNL 2W1NA 1E27B 5K9KA 4Y16C 1A1OB 3IKCB 5E8OA 3QPQC 4HIHB 5F7WC 3N0PB 1G0YR 3PWUB 2GK2A 1BMGA 3WEXB 3C6SB 3OKOA 3P4MA 4HQQH 3TT1H 2X4TB 5DC9B 4K7PH 3MRIA 2HLAA 3HE6D 3DO3A 4QWWC 4XPAL 3VFGL 4DGYL 4OZGF 5IKCA 1YDPB 3ZTNL 3RWGA 1BBDH 4G6FB 3W81A 5HHNB 3BAEL 4KY1H 2LAAA 3TVMD 3SDYH 3EOBA 3T09A 5CSBA 5D7IB 1JPTH 2W9DL 3IFPA 4QKXB 1XMWA 5D7JB 3Q6FB 3HAEG 1I3VA 1CFTA 4WY7L 2XWBB 5DVMA 5DR5L 5F1NB 1KJ3H 4LRNH 4Y4KC 1UWXH 1CXHA 2P5WA 4KI5E 4EOWH 5I1HL 1S9WA 4W4OC 5GS3A 1R6VA 3BN9D 1TVBB 3WUWB 5C92A 2NPLX 5HD8D 3OKNA 5FYJH 3BP5A 2XTLA 4WDIA 4X7TB 1MHPL 4UUJA 3HC3L 2Q6WB 2NW2A 2IADB 5I1CH 4Q58C 1FNSL 5ELIA 4OJFH 3CDGB 1BECA 5DI8B 2VLJB 1F3DJ 4N8VA 4M7JL 5T33H 1CGUA 3CFBA 1SYVA 4X7CC 4KPHL 3JV6B 1E27A 4N0UE 1A1OA 3IKCA 2DF3A 2AJYH 3MRGB 4HIHA 4LGPB 4HIJB 1A7PL 1AR2A 1RULL 4WHYH 4ZS6C 2XFXA 4JHZA 4MAYC 2HLFC 4MJ6B 2VLKB 3G5XA 3PWUA 5IHLB 3WEXA 4BZ1L 3C6SA 1ACYH 1V8HA 3KPMB 2X4TA 4KUCD 4S0TD 3HA0A 5BVPH 4KMLB 4J3UA 3OKKB 3WLBB 3I9GH 4P9HL 1YDPA 5JR1L 1M71B 1CD9B 2G2RB 4CVWA 4AL8H 2NR6C 3FHAA 5D7IA 3QH3B 2C9AA 1SVCP 4S1QH 5D7JA 4GBXD 3D39B 1FH5H 3Q6FA 4X6CE 5FYJU 2OTPA 5D1ZC 1X6LA 2XWBA 4GAJL 4P2QB 4PJBE 3DV4B 4YQXL 5F1NA 1PKQB 5CBAB 1Y0LB 3O41B 4M5ZH 3U82B 3SBWA 4WTZG 1TVBA 3WUWA 4JZOB 4HWNA 1JV5B 3ET9F 4X7TA 5DO2C 5BO1L 1EO5A 4MJ5A 2Q6WA 1HYRC 2IADA 4I0PD 3CDGA 5DI8A 5HHME 3IDYB 3HTLX 4JRXD 1YJDC 1NCCL 2VLJA 3S37X 4ZXBC 5CEZE 4FQ2H 4QTHB 5ITBL 5SWZD 3JV6A 4UT7L 2IF7A 1CLOL 1UB5B 4NQCE 3PP4L 5C0EB 2RCSL 4LKCB 2ICWB 5DD0H 3JWOC 3MRGA 4HIJA 4K71B 5I0ZA 1C5CH 3LKSB 3VFUB 5LAXB 5INDB 4PJGA 4NQDD 5B8CC 4NN5C 4MJ6A 2XXMB 2VLKA 4YHOL 2K1MA 2EYTB 5IIEB 1OTTD 2AJUH 4PJ7E 4F3FB 4ZODA 3OKKA 5BZDA 3WLBA 3MROB 2NXYC 2EYSB 1M71A 3FQNB 4NO0D 4JO2L 3R4DA 2G2RA 2WWKT 4WFHD 4JFEB 1IGIL 1FYTD 2DJ4A 1WBXB 3QH3A 3HAEB 1HE7A 2HYMA 2R15A 1MFBL 2NMSA 3D39A 3JVGC 4FMKA 3LKPB 5CILH 5IUSA 2P5EB 3S35H 4P2QA 1V5JA 3DV4A 1VKXB 5CBAA 1Y0LA 2I60H 3TNNB 4IRZH 5J56B 4HUMB 1G7LB 3K1DA 1H15B 5BRZD 5J3HD 4JZOA 4Y5YB 4XWOD 3S3JA 1JV5A 1QPPA 5I0DA 4K3JH 1MJ7H 4N0YL 4Z6AT 4K23L 2DQHL 3GMRB 4I4WA 3WO4C 5HYQB 3V4PL 3SOBL 2NY1B 2X1PA 1S7WB 4K3EH 4NWUH 2G60L 3W82A 2IG2H 4YHPB 1WWBX 3NABL 4IRJD 3GSNB 4QTHA 5L7XL 4EUPB 4XWGH 1FG9C 2ORBH 1UB5A 4J6RL 1JHKL 4LLDB 5C0EA 4LKCA 4GBXC 1WAAF 5EUOF 2CIIB 4C59B 5JO5B 4LLYB 3TN0B 3VFUA 5CGTA 5LAXA 5INDA 5FGRA 5FDYA 4KKAD 1KFAL 5C0IB 4PJ5D 4MCZB 2EYTA 2VDPH 4H1LH 5IIEA 1S7RB 1I7RB 2X4UB 1F3DH 4OFIA 4F3FA 4X4YB 3DXAB 1XF2B 2KH2B 4XNYH 3MROA 2EYSA 5C0FB 1MRFL 3FQNA 3RIAF 1W0WB 1B2WL 2I5YH 3V2AR 4JFEA 4YHMH 1UZ6E 3TWCH 3X13B 5DD1L 3VRLF 2LE9A 1WBXA 1INEH 3HAEA 1H3GA 4NO2B 3BUTA 3MCLH 3LD8B 2XN9D 3BZDA 4ELMB 5K33A 3LKPA 5JW4R 2J5LB 2P5EA 3MLPA 2EDTA 1WUNT 5D1XC 1OHQA 5HGBB 1VKXA 1BIIB 2XTJD 3VW3L 1G7LA 4X7SH 1H15A 4Y5YA 5LBSL 3CX2A 3ZE0E 3ARUA 3QT2A 3SE4A 1ZT4B 1DR9A 4XPBH 3SGKC 2HFFA 1OAQH 3T3ME 5IJVB 1R5VB 4PJ8C 3GMRA 4Y4HC 5HYQA 2DBLH 1Q0YL 5HGDB 1S7WA 2H32B 1IAOB 1EFXB 1KBGL 2VUYA 5E7BA 5C2BH 7FABH 4YHPA 2ADFL 3GSNA 2GAZA 4EUPA 2VLRB 1ZHLB 2UZIH 3H8NA 4KI1A 2CDFB 4N0RA 3R8BB 4LLDA 5FOBB 3V6OC 3MRPA 4CVZB 5DMKB 3UZQA 4PD4K 3PHOB 2CIIA 1HHKA 5JO5A 4LLYA 4OCXL 1BJ1H 3QDME 2V9RA 3IFNH 5C0IA 4MCZA 3L5XL 1R3IL 1S7RA 5J0BA 1I7RA 2X4UA 4P46B 2E7LA 1L7TL 4X4YA 3DXAA 1C7SA 3UTTB 1OP5H 1MCIA 1XF2A 4X80H 3IYLW 4PG9B 4XAKD 4XT1C 1W0WA 3ARYA 4POZD 5AAWA 1YEGL 2C7UB 3KPLB 4Z7VF 1D5IL 4HXBH 4RGMB 2VKXA 3X13A 1I9RL 5LJYH 2FJGB 2W59A 5HHVH 3WKMH 1JGLH 4NO2A 2F54B 3LDBC 4CU7A 3BMWA 4DW2L 4ELMA 5JW4M 3P11H 4F33B 5I18H 5C6TH 4AY0A 4IRJC 4APQD 1Q72L 4PJAB 1OGAD 1WFTA 4P2YA 5C09D 5HGBA 1GRWA 1BIIA 5E2TL 4ZAKC 1UWGH 4PJCF 4WTZA 5KANI 4KKNA 4GG6B 2VJXA 2PW2B 3RGVC 4YXLH 1P4BH 5IROC 3N85H 3BJLA 4JGJA 4KKAC 2HRPH 1ZT4A 4KJQC 3TCXA 2JCCA 3QRFM 1LK2B 3NIFE 2DM7A 5IJVA 1R5VA 1U8QB 3SDCB 4U0RC 4UT6H 1BGXH 3MRHB 1PYWB 1EGJA 2H32A 1IAOA 1EFXA 3KNBB 2VQ1A 3LKNB 5CJOH 3U2SB 4K55A 5BV7B 5ICYB 3CLFL 4HJJH 1RD6A 3ARDB 4KTDL 5JQ6H 3H9YA 4LPVA 5LGKA 1AP2B 1BVKB 2VLRA 1ZHLA 3P4LA 2CDFA 5CEZH 4JR9H 2R4SH 4G8FA 5FOBA 3ZDXE 2FEDC 1UKTA 4NGHL 5DMKA 3WIIL 2X40A 4CVZA 3TF7C 3QXDB 3PHOA 4OD3L 4I0KA 1MJ8H 4PJHE 4JVPA 4NJ9H 4JLRB 2QHRL 1OSPL 1TENA 1NC2B 5I8EB 3HG1D 3O9WC 4P46A 2APTA 3UTTA 4QNPE 2R0KH 3FO1B 4CADB 4PG9A 3O8XB 3P4NB 1CL7I 2P49B 2XWTB 3J8F7 2C7UA 5I19H 3KPLA 4PJEE 1QTYT 4JFHE 5I1AB 3MLSH 4JPKH 2FGWH 2V5TA 3OKDB 2FJGA 4G6JL 2F54A 2CJUH 2VDLL 2ESVE 1QPXA 4KRMB 2YPKB 4F33A 1Z3GH 3OAUL 3WHE0 4PJAA 5GRVK 2DLIA 2FEEL 1M7XA 1R5WB 3WFCL 2GIYA 4OQTA 4GG6A 1I3UA 3MJ9L 2OX5A 2PW2A 1KCKA 4OLWL 2BCKB 3NIDF 1UCBH 3VXRE 4AMKH 2BSED 2N1KA 1G9EA 1LK2A 2CQVA 3T2NL 1U8QA 3SDCA 4NC0B 3W5MA 1L4IA 2MPAH 3QI9C 4GSDL 3MRHA 3QUMH 1PYWA 5GGSY 4KROB 1W2KT 3KNBA 3U2SA 5D71L 2IH1B 5IB4B 5ICYA 1LEGB 4KK8D 1JJUA 4OCRH 3GBNH 1KB5B 4ORGB 4KFZC 1AP2A 1BVKA 5IQ7L 1J8HD 4LP4A 1A9EA 1J10A 4XXCA 3QXDA 5I9QC 3QXWA 2DQGL 2PTTB 3T4AB 3ZE2E 3S88H 4LVOB 1HHJB 3P9LB 4JLRA 4KK5C 4M6NH 5TF1H 1GVIA 4ZPVB 3VXUD 5K9QI 4IJ3C 1RUQH 5TE7L 3QDGB 5KOMC 4ZNEA 1NAKH 1NC2A 5I8EA 1ZT7B 4JQIL 5F71A 1CR9L 3LHPL 3ZO0A 3WFZA 4R4FL 3FO1A 2NZIA 4CADA 3O8XA 3P4NA 5D2LF 4HPOH 2XWTA 5HHXH 3R1GH 3ZYOA 4LGRB 1FNHA 5I1AA 2QSVA 3OKDA 2NW3A 3FMGL 2X09A 1T89A 2DMCA 3MNVB 4AEHL 4AM0B 1KCUH 4P5KB 1BF8A 1YY8A 3UTSD 1MRDH 1R5WA 3ARFC 5ISZD 5FM4A 1DE4B 4ZO9A 4TQEH 3B3IB 5L88L 5F96H 3MA7B 1CL7H 1PG7L 2BCKA 1A6VL 5K9JH 3T2QA 3I2CH 4RGOL 1ADQL 4GQ9L 2BVYA 1KCVH 3KG5A 4JFYB 3RAJH 2IH1A 3OPZH 3ZHDA 1LEGA 4JCLA 3DSFL 1KB5A 4PB0H 3IDUA 4GRWE 4KUZL 5E5MB 4MNGB 5MENB 1KEGL 4M8VA 3F7YB 1AXSB 2PTTA 3TT3L 4POYA 4BSWB 1HHJA 3P9LA 1NAML 3U4AA 4ZPVA 5C0AA 5E0QA 1NMBH 1QP1A 2JJSC 3B9EA 3QDGA 5DQDL 2HMID 3R06B 4NN7B 1IC4H 1ZT7A 1KIRB 4U1KB 3Q1SH 5D7KE 1B6UA 2IBBA 2V7NB 3VH8G 1LD9B 5GS0H 3MFFB 4HIXL 3VI4F 4DKAA 3QUZB 2HTKC 1LE5B 2F53B 2X4QB 2AXFB 4OFKA 2BXZA 1MJUL 3N1PC 5E00B 4ALAL 3CFKB 3KYAA 1MWAL 4N5EC 3MNVA 1OB1A 2CLRB 1F6LL 1NBVL 4P5KA 4WIQA 3AREC 5FGBC 4X5XA 1DE4A 4I3SL 1K8IB 1L0XA 3B3IA 3NIGF 2OP4H 3O6LH 1AE6H 3MA7A 4JZJC 4NKIL 2VSDA 3UDWA 4JY5H 1JRHL 1MFAL 4GMTH 3BPNB 4M93B 4P4KC 4TPRL 2O5YH 3LS4L 1U6AH 1OP3H 4W81A 1JTOA 5I75B 3ULVC 2Z8WC 4JFYA 5D2NB 5HYJD 4MXVE 5GGTL 1PAMA 5F8RC 1B4RA 3V52L 4XPHH 2BVOB 5E5MA 4MNGA 5MENA 15C8H 4HSQA 2L4OA 3F7YA 4IMKC 5MI0B 5HHMD 3BKMH 1XGUB 4BSWA 4FQLH 3U9PL 1MFCH 1Q8MA 1A3RL 2ZG1A 4HQQL 2FX9H 5I6XB 1B9ZA 3R06A 4NQCD 4U1KA 4K7PL 1DN0B 2MWCA 2V7NA 4LK4A 1LD9A 5F3HB 5D72H 1R3LB 5DRZB 5K59F 3MFFA 4AYFA 5E1AB 2P7TB 3QUZA 2EDEA 4KY1L 2H1PH 3W11C 3SDYL 1RZ7L 5CS7A 2F53A 1P9MC 2X4QA 2AXFA 4KI5C 1I7UB 3KDMB 3EOYG 2GKIA 1NGYB 5E00A 3CFKA 1U92B 4O58H 5HYFA 3NFPB 2VAJA 3MUGB 2BOBA 4JHBA 4UILL 2CLRA 3WS6A 3BZFB 1EPFA 1LWRA 5DUMH 4EOWL 2JJUA 1GHFH 4ENED 4I2XB 2FRGP 4OD2B 4DVBB 2AEQL 4U49A 1J5OH 1BFSA 4HUKB 2H6PB 4HJGB 1A6ZB 4NCC2 5EZLB 5I15H 2QADB 1GOHA 4S1SH 4OJFL 5TPWL 4G8EA 3F58L 4ZOEA 4XP5L 5D2NA 3I6LE 4HMDA 4XPGL 4HG4K 4JM2C 5HJ3B 5T33L 4QOKE 4PBWD 3GI8L 5GGSB 3CZJA 4C56E 3BKYH 2BVOA 3EKCA 3IFLH 5HVGB 4DKFH 1YEFH 1XGUA 3QFJB 4G9DB 2MKWA 2E7BA 1DLHB 2IH3B 4OIIH 1OQOA 3QIBB 3MGOB 3RWJB 1MPAH 4PJDA 4Y88A 2YD6A 1DN0A 2YPLB 2V9QA 5BVPL 5F3HA 1YEHH 4LPCA 1IC7L 3LQAH 1KN2H 1A21A 1AKJB 1R3LA 3I9GL 3D9AH 1DVFD 5E1AA 4ZTOH 3VWJC 3P2TA 4AL8L 1JYXA 2HTLD 1I7UA 3KDMA 1GGIH 3TZVD 1S9VB 1NGYA 3AXLB 1U92A 4S1QL 3NFPA 2EDHA 3MUGA 3GJFK 3T0DA 2BNQB 4PRID 4HUWB 3DVIA 4QRRE 2CUIA 3BZFA 4XXDB 4TSCH 4M5ZL 4I2XA 2Y4SA 4NQED 2VXSH 1CWVA 4NKQB 4DVBA 5J4MA 1E4WH 3X3GL 4LQFL 5IM7B 3EAKA 1YY9D 2H6PA 4HJGA 1A6ZA 4GRLC 1CIDA 4TVPH 5CINH 1MCHA 1JGUH 5EA0H 2F58H 2BX5A 5DJYB 5HJ3A 1C16B 4NFCA 5GGSA 4FQ2L 1A9BB 3DMMC 1V3LA 4XP1H 1QD0A 5B38B 3LRHA 5D7IF 2VZSA 4PLKC 5DD0L 3QFJA 4G9DA 3CPLB 1DLHA 3QIBA 3MGOA 3RWJA 1GGBH 4UNTA 2YPLA 4GG8B 3J7HA 3CLEH 1ZA6A 3QDMD 1AKJA 5EUOE 5DA4A 1VEOA 5L9DH 2E6PA 1CXFA 1MFNA 4YXKL 1S9VA 2FBOJ 5IWLC 4RISH 5DS8B 3AXLA 4O00A 3ESVF 5GRVL 2BNQA 4X7EC 1UGNA 4JKMA 1I1AC 5CILL 3PWJB 3S36H 4HUWA 1OOAA 2Y6SD 1MLBB 5CCKH 5C3LD 3PGFL 4LVHC 1YC7A 4XXDA 1RQ5A 2I60L 1NUGA 1A3LH 3GMNB 3NCJH 4CW1B 1WFUA 3VRLE 5L6YL 3C5ZC 4KJPC 5DEGB 3FTGB 4AIZA 2KKQA 4K3JL 5IM7A 3H7BB 4PJGF 1RZ8A 4DGVH 5IR1B 2QQKH 5F44A 2PYFB 1WGOA 5HVWA 2IG2L 3BKCL 5DJYA 1C16A 5ACZB 3X12B 1A9BA 4XWGL 3TZVC 4KMQA 2C4XA 5B38A 3FFCD 4OGZA 2H2PD 3TPUB 4UINL 4PY8J 2Z8RA 4MJIE 3DX8B 2DQEH 3MV7E 3CPLA 4KZDH 4B53A 5KSVB 1J86A 4KQ3H 2CLZB 4GG8A 1TPXB 1IBGH 5HDBF 2UWEB 4XNYL 3C08L 2H26B 4OFYD 4OUUA 3O11B 3RU8H 3HE6B 4DK6A 3WL9B 5LGHH 1EHLH 2EIEA 2VDNH 3QHFL 3WNNA 4NBZB 4M6MH 3TVMB 4UAOC 3K81A 1AR1D 1FG2A 1RK0B 2EDYA 3PWJA 4JANB 1W72L 1MLBA 4BA8A 4JFHD 4X5LA 5CJ8A 3LPFA 4XTRD 4CW1A 1LO2H 5E2VL 2YA2A 1BPVA 3FTGA 1KCRL 4XPBL 1QYGL 4JO3L 3H7BA 3CMOH 1JL8A 5IR1A 1JNNL 2PYFA 2VDKH 4M7KH 2JELH 4FQXB 1WISA 3VXRD 5C2BL 4ZO6A 4KQ4H 7FABL 5ACZA 3TO4D 3X12A 4QCIA 1F4YH 1ETZB 4X8XA 5GS0C 2YD8A 4PY8I 3LPWA 5I1KL 4QXUH 1T80A 3CFIC 4F37K 4DVRL 4Z7WF 2NX5E 2BY3A 1HINH 2QEJA 3DHJA 4FTVE 4I5BB 4D9RE 1OW0A 2CLZA 4NC1E 2UWEA 4UT9H 3C60C 2H26A 4XMKL 3WNKA 2Q8AH 3O11A 5E6IC 2FATH 5HXMA 3HE6A 3QXVA 3WL9A 1BZQK 2D9CA 4YJZL 2I9TB 4X5WB 2VXQH 5HHVL 3TVMA 1JGLL 2JIXD 4KDTC 3WKML 4WGVB 4P49A 3P11L 5I18L 1PEZA 1CDGA 1RK0A 1EK3A 4JANA 3QEGL 4LL9A 4MLSA 1MCOH 4Y4FC 1OT2A 3G5VB 1X5FA 1P4BL 2LV4A 4H8WH 1CFBA 4JGMA 1LILA 4HPYH 2YD3A 3QWRD 4NHCH 3RVVD 1PSKH 3QQNA 5JA8B 3KYKL 4UT6L 3O2DL 5BMFH 1BGXL 5DD6B 5JTWA 5CJOL 2PCPB 3MJ9A 4FQXA 2F74B 1FL6B 2DLTA 4OBRA 4HJJL 5JQ6L 3NIDE 1SM3L 4HK3J 1U2CA 4TVPD 2YD9A 1ETZA 1EEYA 4K7PX 4OIBA 2YMXL 4JRXB 3KPRD 2UUDK 4JR9L 2R4SL 5HGHB 4KJWD 2XQBH 4QHMB 4JFOB 4H0GA 5SWZB 2OCFD 3TCLB 4LLWB 4EI5D 4JG0L 5CKGA 4ELMF 1E4KA 2OL3A 1G9NL 4I5BA 4YBLC 1X44A 3TPKA 4GS7B 4CU6A 4KKBD 5JOPE 4NQDB 2DIJA 1OLLA 4B5EA 4XGZB 2R0KL 2P44B 1UACH 4L3EB 3EZJB 3MXVH 3QDJD 1V7MH 3FRPG 5HGGS 1NAMB 2YR3A 5I19L 3LEVH 5FM5M 1I3GH 4OI9A 3QPXH 2JCCF 3MLSL 2YN3A 4PP1C 2WLYA 4RDQG 4X5WA 5D7KD 4DKEL 2CJUL 4KAQH 4BZ2L 2LTQC 1AJ7H 5CD5C 3P0YH 1IFHH 2V2WB 2V5YA 3VFRB 1NMAH 3ORJA 5D2LE 1BLNB 3IGAB 3VD4A 3G5VA 3RL2B 1WK0A 3GI9L 2NY5H 1WIOA 1MCRA 5DWUL 1UCBL 3MSPA 4YAQA 5HPMA 1FP5A 3EUUA 4AMKL 1ZHKB 2XZZA 4M7ZC 4JG1H 3C09C 2NYYD 2MPAL 5DD6A 5EORL 3ROOB 4MB3A 2PCPA 1ZSDB 5EFIB 2WWMD 2VL4A 2F74A 1FL6A 5CEYB 5ETUB 4HBCL 4M48L 3GBNL 4HK3N 4XNXH 4TSBH 4NZJA 3LQAC 4FQIH 4JRXA 2DLFH 2D2OA 2DDQH 3PDGA 5HGHA 3GUTB 3K2UL 4QHMA 4JFOA 3QCTH 5SWZA 3TCLA 4LLWA 3CD4A 3Q6GH 4AEFA 5TE4H 5TF1L 4PJAF 1JWUB 3KPSD 4NQDA 5JQHC 3TH3T 3BP4B 2RBLA 1T0PB 1NDGB 4PJ5B 1WWCA 4XGZA 4YUEH 4GG6F 1KXVC 4L3EA 3LKQB 3FB5B 4DJMA 4HPOL 1TQCB 2VWEC 3RVVC 4BUHA 1MCCA 5HHXL 3TA3C 3R1GL 4Z78B 4BK4A 5C08E 1OAKH 1JZ4A 5GISH 3RVWC 5BCAA 4HFUH 4NOFA 1RZJC 1RUAL 4K8RH 1XIWD 1KCUL 2V2WA 3PXJA 4DEPC 1NSNL 3VFRA 1FLRH 1BLNA 1BVLA 1NFDB 3IGAA 4R7DA 3RL2A 2X2YA 1YYLH 1FQ9C 2AJVH 1QBBA 5F96L 2XTJB 1X4ZA 1CL7L 3WDIA 3K7UA 1KGCD 5K9JL 1ZHKA 3B8SA 3SO3B 4CMHB 1OM3H 5EG6C 4H5SB 1D6VH 1KEMH 1KCVL 2DQCL 5TE6H 3ROOA 2W65B 4P2RB 4MS8D 4ZDHB 4HULB 1ZSDA 5EFIA 1U8NB 4ORZC 3NIGE 5CEYA 4D9QD 5EBLB 4WI7A 3KLDA 4PB0L 2DM4A 1HHIB 1NMCB 2Y06H 1FORH 2C1PB 4JFXB 3IDGB 5C7XH 4Y2OA 3WLWD 3MJ6A 1Z2KA 1RIHL 3MLVL 2CGRH 3MLTB 3I6LD 1OD7A 1KJ2H 2IWGA 1WSST 4L29B 2VRAA 2V7HB 4QHUB 5I8CB 4XVUC 4MMXC 4C56D 2X1OA 2CKBB 4WWKA 1I3RB 5GGTA 4X4ME 1JWUA 4W70A 3QXTA 3OQ3B 5E56A 3BP4A 4PJ5A 3S35X 2ICEB 2GITB 4CVUA 4OGAC 3LKQA 3FB5A 2EE3A 4P3CH 3ZLQC 4Z78A 1W8OA 4JFQB 3KS0J 2CRMA 4L4VD 4E41E 4F7EB 1LO0H 4JZNB 2DIAA 4A6YH 2JJWA 3JWDH 1IZJA 1IQWH 3FQXB 5K59E 1GGTA 4Y1AD 1NFDA 4APQB 1OGAB 1YEEH 2OP4L 4RIRB 4D0BB 4PGEB 1Y6KR 1A64A 2LU3A 1INDH 1J0ZA 3HI6L 4F57H 1GAFH 5DJ6B 2H45A 4JY5L 4GMTL 5ANME 5J11B 1JMXA 2HG5B 1Z9OA 1FVCB 5KSAD 4H5SA 2AK4D 3RFZC 2OQJB 2HH0L 1L7IH 1U6AL 2W65A 4P2RA 1IKFL 4ZDHA 1CBVH 3N9GH 1U8NA 1IARB 3CXDL 3MLYH 3MRLB 5EBLA 1IGML 3BT2H 1GGUA 1E28B 1HHIA 2DI7A 3PGCA 1EFQA 3QJFB 1FN4B 4XPHL 2E9IA 4JFXA 4L8DB 3G04B 3MLTA 3HNSL 2XKUA 5K9OB 1DLFL 2V7HA 4QHUA 5I8CA 1MFCL 3LZFH 2CKBA 4HKBB 4XRCB 1I3RA 3GHEH 2FX7L 4RAUB 5D6DC 3GSWB 1NEZB 3OJDA 5AUMB 1R0AH 3E8UH 5FA3B 3BI9X 3VFOB 2ICEA 2BC4B 2GITA 1UJ3A 1ZLSH 1SQ2N 3CFJB 4C57C 1T7WA 3T4YB 2VE6B 1NGPH 4BQBA 3DPBA 1CN4A 1QFWL 4JFQA 4JREB 2GJZB 2ZSWB 3MV11 4F7EA 1IC5H 1P4IL 3V95A 2P5WE 1REIA 3FQXA 1T3FB 4R97B 4K07A 5DUML 1B4JL 4APQA 1FNAA 1GHFL 4NM4H 1OGAA 1ZE3C 3WLWC 3QIUD 4LRIC 3QQ4B 1S5HB 4RIRA 4D0BA 2A0LC 4PGEA 3CXHJ 5LWYH 5DJ6A 1MVFA 5DD3H 2YC1B 2HG5A 3MCKB 3LQZB 4OF6A 1FVCA 4Z76B 5I15L 2RIKA 2OQJA 4QRQB 2NQCA 3FB8B 3E3QE 2GFBA 3MRLA 3LSOB 2GJ6D 2VABB 2OI9C 3DO7B 1E28A 3QJFA 4I8DA 4ZO8A 5J9PA 1FN4A 3QUYD 5JXED 2NZ9C 4HCRA 3W0WB 2X4OB 1F97A 3IFLL 3TESA 4L8DA 3G04A 1J8HB 1AQKH 2MCG1 2IANB 1YEKH 2D7PA 5K9OA 3L3IA 1AI1H 4WW2F 1FGVH 4XRCA 1Q1JL 2J88L 4OIIL 1BREA 4YGVB 1N6UA 2C3GA 4RAUA 1S9XB 2VR4A 1NEZA 2KZ1B 3GSWA 3LMJH 1JP5A 4U1GC 4G7VH 3VXUB 1YEHL 1RUPH 5FA3A 3CSBA 3EFFB 5D7IE 2BC4A 3D9AL 5H37G 3MJGX 4AZ8A 3CFJA 3NZHL 3V9FA 1UZ8B 3T4YA 1XGTB 3BGMB 2VE6A 4IRSA 4LHUG 4X98A 1AXTL 2E27H 3O4LB 4GKZB 4KRPD 4PS4H 4P5TB 1GGIL 4H8WC 2WUCL 5CUSL 5CJXC 4PGJA 4LARH 1JHLL 3ARGD 2GJZA 2ZSWA 4HS3B 2EYRB 1DQMH 1T6WA 5EIQA 1FZMB 4U1LB 3WMSA 1FFOB 4RFEB 1T3FA 2PW1B 4OM1L 5IMMB 1JZ3A 3CNKA 2EXWC 4Z18A 3V4VH 4K8RD 1FBIL 2VXSL 5IB3B 3UTSB 3QQ4A 1S5HA 4M1DH 1E4WL 5ISZB 4I48B 3DLQR 4MSWB 1W72B 3UJTL 2YC1A 3MCKA 3LQZA 4Z76A 5IEKB 2VLJE 4O2EB 4TVPL 5IQ9B 2EDFA 1JGUL 4QRQA 4PJDF 4O2FB 3BJ91 2FZ3B 1OPGL 3FB8A 4G5ZH 2HT4D 5EA0L 2AABL 3IXAB 3LSOA 4EBQH 5C0DB 1MREH 1NGZB 2VABA 3DO7A 4GAYB 1G9MH 2VLKE 3IJHB 5CZXC 2X4OA 3W0WA 4FFVC 5IB5B 1J8HA 4QXWA 1EAPB 2IANA 5JW3H 4FN0A 5E2WH 5F9WC 4XC1L 1FLTX 2OXHA 1VDGA 4YGVA 1GGBL 1S9XA 2YD5A 3CC5B 4P9MH 3CLEL 3GIZH 3RY4A 2NX5D 3IDXH 4PGBB 1YMHA 5J12B 3GK8H 1UZ8A 3BGMA 4RBPK 3D39E 4NZTH 3O4LA 4GKZA 5KZCD 1SMAA 3QFDB 1WFNA 4JQVA 4P5TA 4WWID 4RISL 1KTLB 4P2QE 1S7XA 1PKQE 4HS3A 3IVKB 5HDBE 1UFUA 1FZMA 1EAJA 3S36L 4U1LA 1FFOA 4RFEA 5CCKL 2PW1A 2P47B 1CVSC 4OZFB 5IMMA 1EIBA 5HHQB 1A3LL 3NCJL 5IV2B 1JF1B 5IB3A 3UTSA 4NDMB 2R1WB 1UEYA 2FB4H 4GRMB 4I48A 5ISZA 3GGWA 3IJYB 3O6FB 4I18B 1A0QL 4MSWA 1W72A 4YXHH 1PGRB 3WS3B 4D0DB 4DGVL 2QQKL 5D7LD 3UP1A 5I66B 1QRKA 1PEWA 4O2EA 3HS0B 3IF1B 5IQ9A 5MP6H 4DAGL 3GO1L 4O2FA 2FZ3A 4QHKJ 4BH7B 1OARL 2A1WH 3IXAA 5B22A 4WHCA 4DGIH 1BFOB 2ITDB 1M4KA 2YRZA 1FV1B 4YE4H 3KVQA 5HYJB 2VQTA 1XT5A 2VZTA 1TTFA 1DZBA 3IJHA 2BDNL 2M2DA 2VITB 5IB5A 1NUFA 2A6JB 3STLA 3AS0A 4U1SB 5C0JB 2DQEL 3PL6D 3LRSB 3TLRA 2I24N 4BKLB 1JZ8A 1ZLUK 4KZDL 1FNEB 1OAUL 3CC5A 4WO4D 2D4FA 3BO8B 1IBGL 1GPOH 3QCUH 4JFEE 5ENWB 5F21B 2J1KA 5DGQA 2WAHA 2CO7B 3RUGA 4PGBA 2X1QA 2ZG3A 3RU8L 2EH7H 2XWJA 4F58H 1MEXH 5LGHL 4NPYB 3QFDA 1EHLL 3OB0K 2P5EE 1KTLA 3OBAA 5EO1A 3GBMH 2HT4C 4GKSB 3IVKA 2AEWA 2EKJA 1EERB 5A16B 2QBWA 4U7KA 5HHQA 4X9FA 2AERT 4X8JB 3TNMB 2DQDH 1WC7B 2L7JA 5IV2A 2NY7H 1JF1A 1LO2L 4NDMA 3G6JF 5TQ2H 2VL5B 4GRMA 4HAGA 1N59B 3IJYA 3O6FA 1J0KA 4I18A 1PVHA 3WS3A 4D0DA 5LGJB 2IPUK 2H2SD 4XP9H 3GJEB 4CGTA 1CQKA 5T1DH 2VDKL 4M7KL 2JELL 5KSBB 2XA3A 4BH7A 2Z93B 4KQ4L 1ZANH 4Q74A 2VH5H 1BFOA 2RJMA 2ITDA 2VDRH 2WINB 3IB4A 3QWQB 1FSKB 3WSQH 1FV1A 2QSQA 2Z92B 1VFMA 2GHWB 2DKUA 1N0XH 1ORSB 5HYJA 5E2UH 5KS9F 2ARJB 4NC1C 3O2DA 2IC2A 4YHLL 2VITA 2A6JA 3T1WA 1KCSL 1QBLL 4U1SA 3S96A 5MHSD 2VZ3A 1HINL 3DXAE 4BKLA 2DJSA 1FNEA 3BYTA 1HKLH 3C6LD 1UM4H 3ILPB 1JGVH 4Q6IB 3JWDC 3UTZA 1LK3H 1MIML 1ZTXL 3BO8A 5ENWA 3T0WA 3P0VH 1AH1A 4UT9L 5CGYC 1E6OH 2WWKO 3PJSB 2YXFA 3ZKMC 1NL0H 4ELME 3OZ9H 4NPYA 4JVUA 1BEYH 4NP4L 1DVFB 1XF3B 3DX6B 2VXQL 1D6EB 2N56A 5TF0A 4GKSA 2UYLB 5A16A 1HOCA 3C8KB 4FQPA 3BWAB 4CDGC 4M3JA 4X8JA 4PRIB 3TNMA 4BQ8A 4F8TA 1WC7A 1S78C 3DBXB 3GJFB 3MV8D 3B5TA 4WRLA 5I2IB 4C55A 4LVEA 1N59A 4NQEB 1X5ZA 5C8JB 1U9KA 4HPYL 1HQRB 1SJHB 3GJEA 2P46B 4KK6D 1EO7A 4O4YL 3N1QC 5FGCB 2VLRE 3ALXA 5KSBA 2J12B 2Z93A 2UWEF 5CLWA 3GSXB 5TGBB 1C12A 2WINA 2ICCA 2Z92A 5T3ZE 1ORSA 4PRNB 1CLCA 2ARJA 2APFA 2C26A 2A9NH 4M02A 3D69B 1GIGL 2EDKA 2B0SH 2DQFB 5FCUL 3UTTE 1LHZA 3BRGC 2NY0D 5C2UB 3OTTA 5HI3D 3ILPA 1X5JA 3RVUC 1IAIM 4Q6IA 5IBTH 4POUB 5GGRB 3DETD 1VEMA 3LVEA 3PJSA 1RMFL 1A4JB 3MXVL 2F54E 3BZ4B 1HIMH 2ZCHH 2ZPKH 3QUXD 5HYEA 3L7FB 1CICB 1WWAX 3QPXL 3OKLB 2O26U 1V3KA 1XF3A 3DX6A 4PJAE 1N2RB 3RJDA 4KAQL 2FJFB 3P0YL 2UYLA 1RZKH 4R90H 1H5BC 4GG6E 3C8KA 1NMAL 1ZXQA 2HKFH 4KHXH 3BWAA 2PXYC 3VD7A 4PRIA 5IFJB 3DBXA 3GJFA 2AQ3A 2XZCH 3STBA 5I2IA 4QO1A 2NY5L 3P9WB 2F5BL 4NQEA 5KTEH 5C8JA 3O2VL 3RPIB 3EJJX 3V5KB 1HQRA 1TVDA 1SJHA 3PWNB 5IVNA 3ILQD 5ACLA 1CIUA 4FQCH 2XZQH 2DMBA 4L8CA 3GSXA 4JY6B 5TGBA 4KUCF 4R7NB 2EZ0C 4OGXH 4XNXL 4GXUN 4PRNA 1VGEH 2KQMA 4MA7H 3FKUS 1CGYA 2HRLA 4X7FC 2QSCL 2DD8H 2F5AL 4YX2H 3NH7L 1HQ4B 1QBAA 3D69A 4ZNEE 4JQXA 1IJ9A 5GZND 3M45A 3FFCB 3NCEB 3CXHK 2DQFA 3EDKA 4Y5XB 1X7QB 3QEQD 3ULUF 2BZDA 32C2B 3ECBB 5C0RH 5LXGH 1T4KB 1A4JA 3BZ4A 2E7CA 2DIBA 2DM2A 3HAEH 3L7FA 1CICA 2B1AH 3OKLA 2F19H 3LKRB 4PRBB 5GISL 1N2RA 4I77H 5JUEL 3QULB 4NM8H 1WF5A 4ETYA 2FJFA 3ZKND 2GYSA 1OAZH 1ORQB 4DTGH 1A7BA 2NY4D 1EVUA 4K8RL 3MLRH 2ZUWA 5MEOB 5IFJA 4HAFA 4GLRI 1Q9LB 3V7AE 2JE8A 3I6KA 2Q86B 3VA2C 3ZKQD 1TTUA 1S3KL 2R1YB 1WZKA 4ZUWB 1G9MC 1OVZA 3WNPA 5JOFB 3V5KA 1VPOL