5JQIB

Crystal structure of fimh a62s from e. coli uti89 bound to fimg n-terminal extension
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
279
structure length
277
Chain Sequence
FACKTANGTAIPIGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords FimG N-terminal extension
publication title Evolutionary fine-tuning of conformational ensembles in FimH during host-pathogen interactions.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
total genus 58
structure length 277
sequence length 279
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB02
1KIUB 5F3FA 2WMPB 3SQBB 1N0LB 4BUQA 3ZL1A 4XOCA 4CSSA 4XO9A 4CA4A 5JQIB 3BFQG 2XG5B 3ME0B 3ZPDA 4X5RA 3JWNE 4J3OF 5ABZA 5IQNA 5AB1A 4AUYA 5F2FA 5FX3A 5AALA 3BWUF 4J3OH 2UY6B 2J2ZB 4AVIA 4XODA 4AVHA 4XOBA 2W07B 5FS5A 2JMRA 4XOEA 2VCOA 4LOVA 3MCYA 4AV5A 1ZE3H 5AAPA 4AV4A 3BFWA 2UY7B 4AUJA 1N12A 3JWNH 4ATTA 5IQMA 4X5QA 4J3OG 1KLFB 4X50A 5CGBA 5LNGA 4X5PA 1PDKB 1TR7A 4AVJA 4AV0A 5FLUA 5LNEA 3ZL2A 4XOAA 4CSTA 3JWNG 2XG4B 5IQOA 4XO8A 1UWFA 1QUNB 2JTYA 5FWRA 3RFZA 4AUUA 4AVKA
chains in the Genus database with same CATH superfamily
2MRYA 3PGFH 4I5BB 2WBJA 2F53D 3GSOA 4WV1A 3WNIA 2WY3B 1BW8A 3DBSA 4G6ML 1OTUD 2OCJA 3QA3B 2DQDH 2H47C 4ZXBB 1KB9J 5TQ2L 3QCVL 4JFZL 4YXLH 2E59A 4PBXA 2WQ8A 1CICA 5FGRA 1DVXA 1UA6L 3BP7A 4LL9A 3WGVB 4YSDA 2E7LC 1EEZA 1YEDA 4FFYL 4DERA 2FO8A 3UTTE 5TDNB 2P5PA 5CUSH 5EO1B 3ZHLA 5EEXA 1OZTG 4AKOA 5DZNA 1RPQA 3UTPD 3L5WB 1U8LA 5C0BD 1M53A 2Y5TB 1BMGA 1TETL 2IAMA 2QMJA 2WVTA 3FNKA 4NSKB 4X9IA 5FECA 3DVFA 2XVBA 3U83A 3KPQB 5GQBA 2VLKA 1AD9A 5FB8A 2DS4A 4XVUC 4F33B 2NNXA 4JN1H 1CVRA 4ONGH 4R7LA 2PKDA 2ESVE 4FQLH 3RNKA 4UV7H 4LVHB 1JV5B 1OSYA 2IOOA 3QC6X 4HCGA 1I1AC 1N7ML 5EIIG 3FUMA 3SY6A 3MV7A 1H19A 4JKNA 4MMYB 3FT3A 4WQOA 4BSVB 1TNNA 1XSIA 3CFIC 1QUNA 4FTDA 1K5NB 1UWXH 2C7FA 2DWYA 1XTMA 3QUYD 1K9TA 3HNSH 1TYEB 4XR8C 2XWZA 4EUPH 1SDYA 2A1WL 1QSFB 3B2UD 5CKAA 4OZGE 3SPHA 5PAZA 3EJQA 4J2QA 2QEJA 4MQXD 4PLOB 5FF6A 1ZVYA 2FBOJ 2NQDA 4Z7OB 1UENA 5I30L 3LMJH 3F7VB 4HWZA 1MEXL 4PRBA 2DOCA 1IBHA 3HMXA 2D0GA 3VD9A 3LB6D 2HTLC 4Y9CA 2FX7L 1LE9B 3BKJL 2A2QT 4WWKB 3AS3A 4XCCH 4MSWA 3CIQA 3K6OA 4WFHD 1MH5A 3NA9H 2KLSA 1JNNH 3OPZL 4PVBA 1T66C 1B3IA 4ICWA 5D8JH 2CO6A 3FB8B 3OR7A 4XVTH 5LXVA 4OJDH 1JZHA 4HBCH 5T3XE 3VRJB 3BP6A 1JGUL 4G43B 1KPRA 3NIFE 1ORQA 1XIWC 3OKMA 2V8MA 1LMKA 3MRNA 5I26A 2WUCH 2FT8A 4QJ3B 1G7IA 3CFJA 4PRAB 1FL6B 3NSDA 4KPHH 1RLBA 4F37F 3IFPB 3GYRA 1TMQA 1KIUB 1LXMA 2EINB 3UBXG 5B8CA 3UCQA 3T3PE 5L88H 1ETB1 4Y1SA 3SE3C 1OOWA 1U3HC 3B2VH 1MIMH 1CXEA 1T5XA 3MNMA 1QKZH 3IKCB 4BYHA 3CZNA 5C0NC 4FA6A 4UCFA 3O41A 4OCWH 1IGJB 4H8QA 1T7VA 1KXHA 3IU3B 5IROD 1QQDB 5ABDE 2XDHA 3SKMA 3VXSD 3CXFA 1H3GA 2IPKA 3T8VA 2NNAB 3I50H 3H9SA 4OI7A 4LLAA 5ISZD 2EIKB 2I9LB 5F2FA 2OMXB 3LAFA 2PP7A 1IAKB 2DRUA 1AXIB 2OMYB 5T5FL 4B9PA 3EF7A 2ZG2A 3NIDE 2LU4A 4H4NA 4N2MA 4P2RE 5HDBB 3FF8A 2PPDA 2YD3A 1AGFA 2J8UE 1XTLA 1W0VB 4KJQC 4ZPVB 5CEZD 4PY7A 4FQHB 3L5JA 3STLA 4U1NB 4NZ8A 1S9VB 1Q9WA 1ZV5A 2V2WA 4QRUA 1Q0EA 3HIZA 2Z64C 3IMSA 4WGVB 2FR4B 4N20A 3UJJL 1QLRA 4JG1H 4AIOA 1F3JB 3SPJA 5JDJA 1WHPA 4AQAB 2DYPA 2XUWA 4I9WE 3TV3L 1N6QL 3WFCL 1AE6L 2EUWA 5DO8A 3MYJB 1SEQH 2JKTM 3PG2A 1CFQB 2IXQA 2XXCB 3QFJE 4QRSB 4JR9H 3WNLA 1GS7A 1XCXA 3BHBB 3DV6B 2WJ5A 3ESUF 4ZFFB 3HC3H 5BV7C 5L2KE 5EUOE 3O4LA 2J7LA 1TVDA 3FTGB 4FTVD 5I75C 5E00A 2GFBA 5L9DL 4KQ0A 3FJTA 4FX5A 4NQEB 4PD4J 2VDPB 2X05A 1YEKH 4FQ1H 4I13B 4OCYL 4ALAC 2WXHA 1JAEA 4NZUH 4CUCA 4RRPA 3FUJA 1U6AH 5A16A 3AT8A 3RRQA 4X5PA 1T6VN 1CCZA 1JK8A 2CHDA 2CUIA 5D5ME 4WI6A 3ARBC 3QJTB 1EEQA 2WWKO 2VH5L 5DRXA 3N9GL 1BWWA 1T5WA 3EGSB 3MAWA 2WZPA 3GSNA 3RI5F 5D70L 3CC5A 4JFDE 1BX2B 4QRPA 4UILL 3PHQB 4J28A 5HJGA 4ZX5A 5MENB 1JGDB 4QOKA 1RPUA 2OMNA 4FXLA 4Z7WB 3SE8L 4MJ5A 3FN0L 4P5SA 1RH8A 1FZMA 2X7LA 2Y6TE 3F7RA 3NPSC 4HIXL 4PTTA 3GMMA 4WGKA 4JHAH 4L23A 3M8OH 1OP4A 3PHOA 1B2YA 1JRHL 4HHWA 4JQIA 5GRWA 2P8PA 1S7RA 2BW5A 2BW4A 1TCRB 3NH7H 2MMXA 2VWEC 4IDJL 4K3EL 1NLDL 1F97A 3DJZA 4F7MA 1DJSA 4LKXA 3C6LC 3QZWA 4F2ME 1KB9K 1YYML 3RWDA 2QVIA 2YKLL 2VLJB 1G7PB 3S5LA 1FAIL 2Z34A 2AKRA 5JTWA 3V9FA 4DK5A 2E6PA 2E7HA 1BQUA 1KJMB 5KAQG 4HJ0D 5EUKB 2KDGA 4C56A 1RURL 3B8YA 3VXTB 1L9SA 3I9GL 2I07B 4JFYA 4DN4L 2B1OA 1PD0A 1JK9A 1C5BH 4AE0A 1I7ZB 1QATA 3GNML 1ZTXL 4Q7DA 3ULUL 3JV6A 5IJBC 2Z31B 1A7PH 3E6FB 5IM7A 5PCYA 4KRPD 1MHEB 3N85H 2FATH 5E08H 1C9SA 3BQUD 1KTJA 2Q0ZX 4KMQA 1PZCA 5H4YA 3SHSA 3AT0A 4LSTH 1TZ8A 5LBSL 4QNPE 3AG4B 2LHAA 3D3VD 3NEXA 1VZHA 2OA9A 2KS0A 4MNGE 1PX3A 3NSJA 1HKFA 4KAQH 1MNUH 2ZOLA 3ZE2B 2VQTA 2OAAA 4FLOA 2J71A 2BCMA 1NAMB 4XAKE 2GK2A 1LEKB 2EKSA 3OR6B 2XRAL 5A2FA 5I28A 5CWSA 2G5BB 3HHSB 4JM2C 1ES0A 3I2CH 3VGDA 1DJWA 3U7AA 2VDQL 5TTRA 1FL3A 1O6VA 4BCYA 4O51B 2IMMA 5DJ0A 1ZHNB 4MJID 1KZQA 1G6RB 4GFXA 4N2HA 4WO4D 4KC3B 1AIFA 2Y1VA 5DVPA 5T5NG 4XPAH 3N5AA 3V4PH 2XHNA 1Q0XH 3GMPB 1QX1A 3TO2A 5SWZA 5T1JA 4UNUA 3DOIA 3Q0HA 1QO3A 1JJUA 5I18H 3AACA 3P9LA 5EBWA 2VLMD 3B4NA 5D7HA 2VB5A 1JF5A 3VWJB 3OLEA 3EYSL 4APQD 3ZX1A 4YVUA 2NY4D 1DUYA 1OB1A 1TZOA 4KHTL 1R3LB 4N0YL 2BZ7A 3VMPA 1ZV9A 2E76C 3F05A 1BD2E 4XZUB 2WN2A 4RIRB 5DS8A 1PCXA 4LARH 1T7XA 3VX0A 4G59C 3WJJC 3HZKA 3HRZB 3ZLQC 1R5WB 2NW3A 1IMHC 2JCCF 2VXTH 3N1QC 2YOAA 1MJ7L 3H55A 4PRPA 1KIPB 2ID5A 5EA0H 2JKNA 3K2IA 4Z7UB 3QDMB 3HG5A 5HHOB 3HZ3A 3OGOE 4OCMC 3V55A 5DHVB 2X1PA 3DTXB 4PRID 1WT5A 1SOQA 2FSDA 1WCBA 4OFKA 1LO2H 2CRYA 5GRXG 5IBUG 1BVZA 1LO4H 2EIMB 2GIYA 2W80C 1B2WL 1E4XI 1X5AA 4PN6A 4ZUVA 1RZGA 1UCBH 2V9TA 3LH2H 3RTLA 5JHDD 2GBTA 1FVEA 2ZCKH 4BK5A 1MUJA 1MCDA 4ZW7A 3X1NA 2D3VA 3DX6A 2Q8BH 5A7BA 2IDUA 1MG2C 4HMEA 5EFIA 1I75A 5DUJA 1IKFL 2AV7A 4JPIB 3I75A 1E7VA 1BZ9A 1A0QL 2E8YA 5HJDA 3RZCD 3BWUF 3K1DA 3PQYB 1ZHLA 5DMGC 3FQRA 4DN3L 3VFOA 1CF8L 4C4UA 4LSUH 2Y2TA 2QSVA 1T3FB 3GTVA 2AXHA 5FM8A 2FBRA 1FP5A 1T89C 2J12B 3S97C 1RUQH 1WFTA 1PAMA 3NABL 2ZP0T 3OV6A 2UV3A 2AXWA 4N2GA 1T6WA 4XI5D 4LP8A 3R7QA 3E2HB 2Q8AH 2A77L 4GPVA 4MMZA 5ALCL 1S5IH 2WLNA 1HINH 4MA1C 4PJIA 2WXJA 3JBG7 5GS3A 2G9HB 3NDZE 3RGVD 3SDYH 4AIXA 1DJXA 4N86A 5LJYH 5ETUA 2PWFA 2F61A 3LRSA 4LCIL 4ZAKA 3T0EC 4ZMAT 1J0YA 1JPGA 3CFKA 1NFDE 5C2BH 3LN5A 3SD5A 4U4IA 5HGBB 3WIIL 1MXGA 3TN0D 3VGEA 4DAGH 4X4YB 4Z95L 1KSRA 3CBJB 1ED3A 4PD4K 5L4IA 3X2QB 4M5SA 2ZOKB 4E9LA 1K85A 4L0YA 2B59A 3MV11 1TQCB 2V3EA 4U1GB 4IOFD 2Y7LA 4E9WA 1U8KB 3D30A 2WVVA 3GM0A 3OG6B 3SCMA 2KZ1B 4BE5A 3MV9D 1UJ3B 5AZUA 5C07D 4WW2F 5H35A 5KJ7E 1V5JA 1XCTB 4WTXA 3U25A 1UATA 4XCYA 5KG9A 2BHFA 4AEIH 1J1OH 4NJAH 5DQDL 1D9KD 2IANE 3QG7L 5HYQA 4K94L 2PXYD 3QJXA 3FOMA 1KG0B 1AGEB 5IMMA 3O45B 4WU5B 3QC5X 5J1AB 1I85C 3EO0A 4X5XA 2GITA 2VNCA 4GAYA 5HDLA 4FLRA 1CGVA 1WC7B 2GSMB 3CPUA 3X3FL 1QFHA 1F18A 5AVSB 5K9JH 2X4PA 4CVZB 5IB3B 4IHOA 4ZDHA 1QBBA 4KO9A 4QTIL 2QHRH 3FRPG 1MRDL 3FUKA 4LRIC 1I4FA 4JDVB 3QI9D 3TCTA 4N3UA 1P4UA 1GW0A 4YE0A 1A6UL 4F92B 4WHDA 1WUZA 2NTFB 5IBTH 5BXFB 3HHRB 2A6DA 4OLZH 3VWKC 3VW3H 2W9DL 3QEGH 2F19L 3HA0A 1GYVA 2GUYA 4QDGA 3DVIA 3IMUA 4LSSL 2F8VA 4UYPA 4XNZB 3WBDA 2ATKA 3IS1X 4X7TA 4ILDA 1ODAA 3WFBH 3QARA 1IAOA 1QRKA 2A38A 4NLHA 3MLUL 3HPLA 5HDBE 5F7DA 1JXKA 2D4DA 1CD0A 5F88A 5D1ZC 1SXSA 4Z3IA 4G6MH 4X4XA 1DBBH 5DZLA 2W8CA 4FP8H 4HSAC 4A2EA 1QOKA 5TQ2H 3UBXI 1IQDA 2IV8A 4MA8H 4KVNL 5KW9H 2ODIA 1N59B 4PUBL 1SMDA 4BH7B 2FEEL 4HH9A 4PJ7B 1ZE3H 3MJ7B 2QADB 2B7DT 3NJIA 4KROD 3NRQA 2OXGB 1HHKB 1B4JL 3UAAA 1I3GH 4GXUM 2NY2D 5AKVA 3NSYA 5DFTA 1X7QA 4BA8A 5AB9A 5J0BA 5L7XL 2WZ5A 3L3IA 1YY8A 3F7YB 3MUGB 3P40A 4V2BA 3S36X 1R5IA 1UXSA 3DVNB 4IBZA 4JFXA 4GI8A 4NPYA 5A40E 4QHPA 4U6VL 3BZEA 1Z9SA 4W9ZA 3KYKL 5E1AB 3QORB 2PCPA 2VAAB 5C6WH 4NN6C 4WUUB 32C2B 2QGCA 3MLXH 4RSYA 5AW9B 3KLLA 1SY6A 4NCDA 4YHPA 2OYLA 3SYOA 4BFJA 4QHKI 2J88L 2MQCA 3T8XB 1XBRA 2HZHA 5FHAL 2Z92B 3DARA 2BVQB 4JPKH 2BM3A 5JOFB 2G5RA 3MRGA 2OBGA 1C5DB 3TESA 4QRRB 4MAYD 3KDPB 4XBEH 5CJBA 1SRDA 2DIEA 1OSZA 1I9RH 2VR4A 3T4YB 1NFIA 4NZDA 5D7LE 2X2JA 1JZFA 1OGPA 1E65A 1NGYA 3JVGC 4TUOA 1J5CA 5EBMA 4HKZA 3ARFD 1LD9A 3MOAH 3SE4C 3O3DA 4ZYKB 2A1WH 1UXMA 1SDAB 1LK3L 2XYCA 3ZKSD 4DVRL 4L4VB 3MRPA 2FCBA 3ZGIA 3AY4A 2R0ZL 1T20B 4GRLA 2W91A 4MJJA 4X6DE 4M03A 2ADJB 4G70B 2V5RA 3NCMA 3TJHC 4N26A 3WFDL 3R8QA 4WTQA 4XOCA 2XACC 3L3JA 3MRMA 3WNKA 2QZ5A 2RH0A 4OGYL 3E7JA 4J27A 3HJEA 1TLMA 2FH8A 4HGWA 1U8NB 1WFOA 5H94A 4PGDB 3J27A 2Q7AA 4JFEA 1JGUH 3KPRD 3MMEB 3W5NA 1F6LL 4L5FH 4CC0A 2YN5A 1QR1A 5EULV 4YHYC 3R4RA 2VITB 1IGCH 3HAEH 4TN9A 1I7TA 5FYLE 5I2IA 1MLBB 1RIUL 1SYSB 4WEBL 4WW1B 3GZPA 1UEYA 4PS4H 5F9JB 2HX8A 1MN4A 3IJHB 4P99A 5J11C 2VCOA 2ADFL 3VXRB 2X4SB 1AP2B 4XVSH 1XF4B 1E4XH 1PFCA 4XNAA 5G55A 1C12A 2VZUA 2Y06L 3SDXB 3CWGA 3GKWH 3MRKB 3QUXC 43C9B 2A0LC 3NOIA 4FQPA 4GQZA 4R2GC 3VJ6B 3FTZA 3O6FD 5CEXA 3H2QA 3K4DA 1WQVT 4ONOA 3FUFA 3RY5A 1OE3A 1FZJA 2E75C 4PJCA 1SJXA 1N3NB 25C8L 3MGAA 4KGJA 4YSCA 4DTGL 4N9OB 3I9IA 5EPMA 3DWTA 2ISDA 2QQQA 4XN5A 2BIMA 4GP5B 1D5BB 4TNWK 4QGYA 2CO2A 2XU9A 1SN2A 3ILQD 3CDCA 4AM0A 3GMLB 1KB5A 5FWQA 4YXKL 5HJ3A 3EOTL 2QSTA 1YNLL 3AB0B 4S1RL 3VU1A 2XWBB 2Z4QA 5CN2A 3RGVC 4G43A 3VI4B 5KAQF 3UJJH 1AQDA 3O8XD 4MS8C 3ZE1B 2HJFA 2PW2A 2J20A 4M8QA 1GVIA 4N90D 4FG6C 1LO5A 3UYPB 4HIJA 1I9JH 4UZGA 4U3HA 3VMNA 2H0JA 4WTZA 5GGSY 3DPBB 4PRAA 1UVQB 1YO4A 4TUJA 2CMRL 1KTKE 3TT3L 1EA9C 2I25N 3E80A 4ZFZA 2VC2L 2Z6FA 1UWGL 5F9WC 1DJYA 4CKQA 5L9DH 1GR7A 3GXPA 4PJGA 5JXAH 1FH5H 2XNAB 4OUUB 3CSBA 1CGYA 1AO7A 1I9IH 1M56B 1WDAA 1Z9MA 5TH2B 2AQ2A 3D6GA 4Z7UE 1WS7A 4G8EA 1K6QL 1JZ3A 3ULVC 1BF8A 1Q9KA 4YGVB 2WMPB 3NMEA 3QWNA 4GEIA 2R4RL 5CP3A 1IM3D 3STZA 5AD0B 3BLKA 1UKTA 1Z2KA 3ZT7A 5CILL 3IFLL 3D39D 2R29L 1PX8A 1W8NA 1H8LA 3FMGL 3QPQD 4CN6A 1JHTA 5B1BB 3IMRA 4CJ1A 1DJHA 1OAXH 5CXPA 5F1OB 3RFRA 3SPVA 5EU6E 1U42A 1J48A 3FN0H 5T5NF 1WLHA 4X6BB 4EZKA 1ZLSH 4HIXH 1MCWM 4UDUA 2ENYA 4TPRL 1Z3GL 5F7BA 3BKYL 1U3NA 3UBFA 1QR4A 3TPUB 2GJ6A 2VRQA 1JYWA 3UEQA 4WVRA 4K9EL 3M86A 4QRBA 5IFAH 4JPVL 1A1MB 1G6VK 3NJLA 1ZLUH 3P9MB 4DSYA 2XV6B 1MPAH 3SDCB 4WRLA 1OAKL 4UQAA 1LP9F 1F90L 2YKLH 4LU5L 2NOYA 4OF7A 3VXOB 1Q9OA 1FAIH 1PNDA 2P80D 3SGKC 2ZAGA 2OR9L 2MCMA 2BC4B 5BZWB 1GOFA 3P4MA 1UQSA 3QH3B 4X7DC 4APXA 4EKXA 4F8TA 3PGDA 2HA1A 4PLKD 1FNAA 2CD0A 2AK4A 1K3ZA 4WJ5A 4FABH 1GGBL 4DPBX 2FJSA 3GRWL 4Y2DB 1IBGL 2ZG1A 3RWJB 4KNUA 3D2TA 3OKKB 3GNMH 1ZTXH 1IB5A 1G1CA 4N68A 5KSAD 1ZMYA 2DM7A 2JKSA 5CHNA 4F7CA 2VDMH 4ONHB 1AR1B 4KKCC 3BZ4B 3NJNA 2VM4A 5KBMA 3BW9B 2WQAA 1MI5B 1KPUA 2RCSL 1S3KH 4EAEA 5FEBA 3V9CA 2FLRT 3QO1B 2ZZUT 1LWHA 2FJHB 5F7AA 5LBSH 4JJ5A 1BFOA 4X0KA 3B9DA 2SODB 2QTVA 4Z7VF 2XV2A 4M93C 1U3YA 5E0QA 5MERB 4YH6A 2BVTA 2R2EA 3L08A 3TA4D 1F1AA 3NJHA 1N5AB 1DBMH 5C70A 5CZKA 5EF2A 2FYYA 4GUOA 5EU4B 3QUMB 3C60C 1HKLL 1F6AA 1AMYA 2DIBA 1X5GA 1HL9A 2MHAB 3OMIB 4YPJA 1XZ0B 1LO3L 1KWKA 2Z1PA 4PRNB 1CE6B 5EUKA 2ICWA 1NICA 2OJZH 4BZ2L 1GGYA 1KNOA 1JPTL 4OQTA 5G4NA 4GUQA 4ZUTB 1FFOA 1S7QB 4JZJA 4BXVA 2CQVA 4JY6A 1WE5A 1EAJA 2B4CL 4JRYE 1K2DB 2PPFA 4YN3A 2XN9A 2WXFA 3NTCL 2MCAA 3UYOD 4AMKL 4NCC1 5JIHA 2UWEB 5HGHB 1AQMA 3H53A 4RX4A 4BZYA 3IRCA 3POCA 2I85A 1OGAE 2H9GB 5DZOA 3BXNA 3OC5A 3KJ6L 1L9NA 5ESVB 1UT1A 4NRYA 3DK2A 2X4OB 4JKMA 1J1XL 1MJ7H 2XC8A 3IDXL 5JNYB 4GIAA 2H1PL 5F6IB 5GS0H 3SKUD 4YC2C 5IR1A 2ZYHA 2CDGB 4HZAA 4Z7QE 3PWNA 3II1A 5DRZB 3G6AA 4MYWB 3L7EA 1OARH 3EXLA 4HPYL 3OZKA 4CGUB 4HD5A 4L8DA 3BUPA 1F86A 4LCWD 3ATFA 3ZR5A 4ELME 3ECVA 2NNCA 4KY1L 4MVBC 4D9QD 2XPGB 1EX0A 1HE8A 1IARB 4XO4A 4FMFA 4KWUA 4PLJC 2Z7ZA 3V2AR 2HKAA 2E7BA 4XPGL 3WV0A 4L8SC 1T6BX 3PWJA 2C3VA 4LNRB 4YE4L 4UQ3B 5TE7H 4PJHA 1HJCA 1PTZA 1XMWA 4DN3H 1IKNA 4HFUL 4XVOA 3TIDB 1N6UA 4IK7A 2JK5B 3DV4B 4AQEB 2VM3A 3HN8A 5DD1L 1BM7A 3NEOA 2C8NA 3V4VH 5CLWA 2NW2A 2J6EH 4XZUA 1XR9A 3DRQA 3V4LA 4NIKB 2XG5A 3O6FC 5SWSB 2HFGL 4IIQB 5I1GH 2BMKA 4N2EA 2PO6C 4QF1B 2YD1A 2AQQA 4AZ8A 4PY8I 2YA1A 5BRZA 3BOVA 1KIPA 1KPVA 3HUJA 4KKLD 4QTFA 3CFMA 4FQQB 3C8DA 3K0YA 5T1MA 1U8JB 3FQTB 5FYKE 5IMOB 4HZ1A 1DVYA 3WIIH 1PYWA 1NDMA 1AH1A 4O5LL 4FKHA 1VGKB 4Z95H 4M1CD 5LAXA 3GQFA 3KPSA 4JRLA 1WTLA 4KGLA 3QQ3B 4QTHB 2E7MA 4P8QA 4ZJ9A 4U1IA 3O8XC 1M57B 7PAZA 2IF7A 1JTPA 1HQ4B 1DE4B 4O02A 1RL1A 2LLNA 3RUGB 3NCJL 1J11A 4LLQB 2WBJC 2EQDA 2QHLA 4WV1C 2NY1C 3GFUA 3QIWB 4HETA 3W1ZA 5HHVL 1BIIA 3QPKA 1MDTA 4NQDA 5C7XH 1MOEA 2ESVD 5AL8A 4Z8FL 1KULA 3N44F 4R5XA 4RQQA 2CDEB 2M8XA 4CVWA 4AL8C 2OTWB 2PN5A 3IFNL 4N5UA 1CICC 3EHBB 5E8NB 1O7VA 4DCQB 5HVWA 5EEZA 4N2OA 1A4KB 2F8OA 3FUDA 4UF7C 5CU9A 3C2SA 5E0FA 1UB6B 5KN5B 1BPVA 5J13B 3V95A 5AQ0A 2ZKMX 4Y16B 12E8L 1UZ8A 2HN7B 1T1ZB 3ARDA 4LF3A 2G4EA 2PPCA 5SV4A 3X3FH 2WXMA 3FQWB 3ZKMC 3I74A 5IG7A 4AVIA 2V33A 5DQ9A 3ZE0F 1EQWA 3ZUNC 1JCVA 3G5ZA 4YSOA 1QFWL 1QRNB 4KUZH 2IAMC 2VL4A 4M61B 1LYQA 5D7IF 4M62L 1R19A 1KTDB 2GEQA 1KGIA 1XGYL 4OCSL 1WWAX 4JMXA 4NC0B 2F54E 1BG1A 1F56A 2O61B 3EBGA 1R4XA 1XXDC 4ZMVA 1NANI 3FO2A 1CQYA 4G82A 4HJJL 2AXFA 4YHNA 4BFGA 3RX8A 3PWLB 3UH8A 2F19H 2HYMA 5DJAB 4OZIB 5DZPA 1K4DA 4PWKA 5IVXB 4Y1AB 2NY3D 5HVHC 4N8UA 4JL2A 2WINB 4HIEB 1CK0H 4JKPH 1YEIL 2DQUL 4X6CE 4L8BB 3FB6B 4QRTB 5DQJA 2ICES 4U3SB 1XCTA 3QUKA 1O0VA 5BS0E 4WFFE 5E2TL 1ZLUK 4D8OA 3QE5A 4UQ2B 5CJQL 4F27A 3FSVA 3KR3L 5K69A 5K39A 3VI4E 4IJ3B 1JZ8A 1MLCB 1KN4L 1UFUA 5CD3B 3CFBB 4PFEA 1IILE 1YMMB 2HWZL 2HT4D 1AGEA 3ESMA 5DYOA 2VMDA 1KEGH 3V6BR 2ROXA 1FA4A 4UQIM 5DVLA 4L18A 1LE5A 5L7XH 3FF7A 3DHPA 1ACZA 1B0IA 4YDLB 2ZSVA 4AYFA 5F97E 1DDHB 2XY2A 2JQZA 1FYTA 3C75A 1JGEB 2FQEA 4IIZA 5GGTL 3TH2T 1CC3A 3KYKH 3AVEA 4ZS6D 1BM3H 2Y7QB 3JWOH 2FD6L 1L0XA 4JDVA 2RJMA 1HXYB 3BAIA 5JLZA 4RRPM 3GBMH 2F08A 1KGWA 2QLYA 5BXFA 5I8OL 2MCG1 3TVMD 2FJGB 1IAIH 2BWDA 5IVNA 4KZEH 4HS6B 1WICA 3FQ4A 5FHAH 2BNQB 2CR3A 5J6HB 5I16B 1KYDA 2VLKE 4HUMB 3V4PB 5B8CC 2YXWA 3TNMB 4WHYG 3OQ3B 3RWFB 3VXMA 3U30B 1GYUA 2BCKB 4H26A 4MD5B 4JBSA 1U9KA 35C8L 4I9WD 4XO9A 2HCZX 4NDMA 3O3BA 4R8WL 2A6KB 3RFZB 1F8TH 2YQ2A 5D7JA 3MV7E 5BUGA 1FO0B 3QFJD 1FFPA 1JWUA 3TV8A 1P2CB 4C47A 2WOBA 5L2KD 3K6SA 1PG7L 3ILPA 5BJTB 2B14A 5AB1A 3I02B 4FI8A 5DSCA 5GGSB 4N22A 4H1LA 1EZUA 2VZ3A 1I1FB 4DVRH 1JNJA 2BIHA 3QIUD 2CLZB 4JDEB 3DDGA 2R0ZH 3U6RB 3QEQB 2XI9A 2YBRA 4Y19B 4UQ9A 3WTUA 3TCLB 4QWWD 1RUPL 2GK0B 4OFYD 1JZ2A 4QMEA 4RBPH 3QDHA 2E8ZA 3VVWA 1OCOB 2GSGA 3WFDH 1BQSA 3US1A 5JYLA 1W91A 2O5ZL 4XMPL 1Z0NA 4OGYH 1PZSA 4XC1L 3AU1A 4XNUL 4G8GB 5C08B 1AI1L 4L3EA 2ZXGA 1BXUA 5D1ZI 3QWOA 2OYKA 2VSKB 5B3NA 3U1PA 2YPKB 2WLMA 1PEWA 3BKMH 4UOW0 4N5ED 2YJQA 3RKDC 2OR7A 3LQZB 4FYSA 3G08A 5C0FA 3D0AA 1C5DA 3IE4A 5DK0A 5DR5H 4WEBH 4PJFF 2Q5BA 4BWTA 2PR9A 3WLWD 2H1LM 3HBQA 2OI9C 3NCYP 2IADA 4UZUA 2P1YA 5JO5A 2B39A 4WY7L 3DYMA 2I7SA 5AZ2L 1RZ7L 1J1PL 3C5JA 3EFOA 4HWBA 1A7RL 2JSFA 3UERA 4HYTB 4DF9A 4GUPA 5JR1L 5I0WA 3OLIA 4FXKC 4HIQA 3V0DA 1RUKL 1SXAA 4TL4A 5EOCL 2HAZA 3TYFA 4B0MM 4NBYB 5EH1A 1MQ8A 2GBAA 2ZQKA 5CBAA 2HX9A 3RIFF 1I8KA 5E95B 3DXAA 4PJXA 3SGJA 5IQLA 4GG6F 2ADJA 3DYPA 5F7UA 1X4YA 5F7KC 5DMKA 5DT1L 4H5SA 4DTGH 3H9SE 5KVEL 4NFBA 2C9SA 1EO5A 1P7KB 2XT1B 2VQ1B 2X9WA 4W9JC 2L7JA 4H0HB 4ZQKA 2ZUTA 4BJLA 4ZMNA 1NOAA 4ZUWB 4P46B 3MBWB 5C0CA 2OYMA 3S4SB 3QIBD 4D9LH 2X0UA 4Q9QH 2YPVL 3QK0A 5FW7A 4NO2B 2XQBH 3WUWG 3RGHA 2WSKA 4JREB 4HWNA 5I1IL 5F1IB 3I6GA 3REWB 5B4MC 5DHDA 2WXLA 1RFDL 4LPYA 1KTLA 4LLDB 4QAMB 1P7QD 4P07A 2TSBA 4FFZH 1MG3C 1CWVA 5DD6A 1NC4B 3ETSA 1BYNA 1A6AA 4N0RA 1RXLA 2UWEE 4ISVB 4NGHL 5IB4A 1AC0A 5C0JB 3L1OL 4M5ZL 2VQ4A 2VC2H 2B1AL 4G9FA 1JZ7A 2P44B 3IWVA 4QT5A 5IKCB 1M3JA 3O4LE 3NK4A 3VXRA 1QLFB 1SXZA 3B5GA 5ACZB 1SDDA 1U58B 4TSAL 5DJZA 4OLWH 2X4TB 4NQCB 4BRVA 1CU4H 1TZIB 4WIQA 3CLEL 1K6QH 1C16A 4FJYA 3HBGA 4J1UA 2A9NL 5LCVL 2COQA 2MIZA 3GLEA 1G0XA 1S46A 2W07B 1JS4A 2XVGA 4PJ8B 3DTDA 1OTTD 5ACLA 1Q1PA 4TRPL 3U9UA 4XOEA 2NZ9C 5E8PA 4UM9B 2EH7H 5CILH 5A2AA 3IFLH 1RJZB 4PY8J 4D0DB 5LGHL 1QI5A 3HPJA 4PGCA 5HD8D 2ADYA 3N50A 4PV8A 4NO5B 5LWYH 1MHHA 4QRPE 1ECZA 2EXYC 2E6JA 3MROB 2A6IA 1DCLA 2UY7B 4QOKE 3UX9B 3ILEA 5D2NA 4HX1B 3GI8L 2VDRH 1I3RB 3BKYH 4Z6AT 4K7FB 3NRPA 1J10A 1DVZA 3LKOA 2H41A 2CKBL 2CRMA 4LRNH 5C86A 4K9EH 1I3UA 5DZVA 2N01B 1UVQA 3QEHB 4TLTA 1NM4A 1YUKB 4Y4KD 3MX0A 4RGNE 1U0QA 1O6TA 1FYHB 2LAAA 2XWDA 3ZDXF 1F13A 1OSEA 3V5KA 3VXPA 5LGJA 3MODL 5SWSE 1JYVA 2OR9H 1CT8A 3MACL 4PM1A 1NANH 4M1GL 4Y5XB 1C7SA 2HPOA 1P4IL 3CUPA 1RIHH 4CVUA 3ZTNH 3BIBX 2BP0A 2N0MA 4C56E 1IBGH 3S2AA 2APVA 1J87A 5FGCE 4HW6A 5F7WC 1HJBC 1M2VA 5IESH 1BXAA 4K7PH 3GF8A 5KSVB 4NKDB 2D2CC 1Y18B 7FABH 3D69B 3E3QC 4TQPA 4IMLA 3HNVL 3OHMB 5B39G 5ESAB 4XO8A 1UWFA 3TO4D 1ZGLA 1KBGL 2J2ZB 4W9LC 1WVZA 4BFIB 1ICTA 4JUSA 1NCHA 3WU1A 4MA3B 3LZRA 3SE6A 1VFOA 5CEZH 3TA3C 3MBED 1QZ1A 3TPUA 2OX5B 3N0PB 2R15A 4D8PA 2ATPB 4N1CA 3MJ6A 4KI5D 3MA7B 1T1XA 3VGFA 5DC9B 3MI6A 2W95A 1MDAA 5J6SA 1QSEA 5IOPA 3GJFH 4JW3A 3AXLB 4QRQB 2MWCA 4UQEA 5I8EB 4ES9A 4DP5X 1QSFD 2ZAIA 4JKKA 4AXWB 1WAPA 1LO3H 2DQGL 3KPLB 4CNIB 1A3LL 3SJVB 1Y6NR 1QRNE 1VFAB 1RLWA 3GSWA 3BPCA 1SYVA 4PJDB 2EACA 4L8CB 1QHPA 3R18A 5F1NB 5SWZE 4G72B 1FDLL 5KYYB 4WWKD 1YEEL 1SMOA 2BFVH 5I73B 2GBUA 1EFXA 2YPLA 2X9XA 1A1NA 1JMXA 4OLUL 5GIRB 4YBLB 3N3EA 1FQ9C 2NY5L 4ONHA 4MMZC 1G7HA 1OCCB 3RWEB 3UG5A 1IGML 4IBVA 3DO7A 1A22B 4TV3A 1NKRA 4RA0C 1NL0H 2IAND 1VCAA 3RWIA 3IEAA 5D1QB 2W0FA 3SO3B 3KJ6H 5GGQL 5ERWB 4CRPA 2WQRA 3X1BA 2XTSA 1J1XH 4JLRB 3UEZA 1EK3A 4PJBF 2OSLA 2NXYC 2R23A 1ID2A 3HVNA 3IDXH 1OCZB 2XQYK 4OKVA 4ZAKC 1J8HA 1SEBA 4EZLA 1E4WL 5FA4B 4HV8A 2VLRA 2Y36L 4PRPE 3TZVA 3LDBB 3UGEA 1U8OB 4R26H 4P23A 3SDAD 2FJFB 2P5EA 1NJ9B 1ND0B 3FB5B 2DV6A 1U95B 5IEKA 1HCZA 2BY3A 4UUJA 1NUFA 1P9MA 2NXZC 2VGLM 3LZFL 4UIKL 3HFFA 1YEFH 3SCMC 3D12B 3BUTA 2PW1B 1EHXA 5E6ZA 3FQNA 1H5BB 3RJDA 3DX3A 1TPXB 2I27N 5IB5A 2HG5A 4WHTA 4AMWA 4JFUA 1JN6A 1JUFB 1LK2B 4EUPA 2COVD 1FHGA 3OAUH 1PKQB 1IGIL 2OQJB 1JZ5A 1GAFL 1AZZC 3K3QA 1S78D 1E9QB 3NIGB 4TKWA 4L9DA 1NOLA 5IY5B 4M6MH 1CDGA 4QO1A 4XVJH 4HFUH 3T1FB 5I1CH 3O11B 5GPRA 4DGUA 3NUKA 1PJWA 3IRZA 4IRZH 1G4MA 3WYRA 5DD1H 2H8PB 5DJXA 3ULAB 1QABA 3FQXA 1XF2B 4ODUA 3LKPB 3VA2C 3WLBA 3RIKA 1EGJA 3W81A 5IHZA 2JWYA 4NQQA 4AK2A 1NIAA 2HFGH 3DHMA 2FT6A 3U9PL 3HEIB 4YWGL 1KXQE 2ZPKL 4N8VB 2P7TA 4B60A 4U1KA 4PJIE 4M7LT 1YPZF 1KCUL 1U8HA 2EDJA 2CDGA 1BA9A 2FE0A 4U1JA 3ZYOA 3LNIA 4PRHA 5C6PB 1RHHB 4ZTPL 3WOVA 2BSDA 1ONQB 3BH8A 3P73A 4JANB 1HYSC 1S7VB 3B7RL 3QEQE 3MRDB 4NQED 3MA9L 1ULVA 4ZW8A 3FUEA 4N1EA 4Y19E 5I19H 2R2HB 4PJEF 4HALA 3RA7H 4ETQA 4ZNCD 4I77L 2WWOA 1TTUA 1N2RB 3D33A 2BSEA 3PYCA 2DQHH 2FYVA 2JXMB 4P3CL 3RPIB 4NXKA 2HVJB 3CMOL 4IKJA 4N0CC 3RBSA 4F7PB 4JMNA 1BEYL 2JKWA 5KSBA 4PJAB 5HHVH 5JIPA 4Z8FH 2QVTA 3BVWA 3IJ7A 1CG9B 5HDQH 3KS0H 3TIDA 4M7ZC 2R4SH 4HK3J 5MEND 1DBAL 4PJ9A 5D7LD 5DWUH 1TTFA 3FFDA 4EDXB 1QEWA 2XG4A 1EXUB 4KKAD 2F74A 12E8H 5FW6A 3OKNB 3ESNA 1OF2B 1EO8L 3JT0A 3KWXA 4J3OC 2C3HA 4KNSA 4G8AC 1UXWA 3QJHB 2ENJA 4JFFA 5KJRL 1HQRB 2C9PA 5TDOB 2V2XA 3EOYG 1ETA1 1RQ5A 4X8XA 5JW5A 1CVSC 4P3WA 1NFKA 3GTTA 3P4OB 4DFIA 2AQPA 1OWRM 4IU3B 4P2CG 3TOPA 5IMOA 4ZPTA 3WMQA 1NGWB 1YQVL 2VLJD 4DK3A 3D34A 1V3MA 2BNUA 4GW5A 3ULSA 1LEGB 1FG2B 1WZMA 3WI9A 4IEFB 3NRFA 1GGTA 4M9OA 4QHNB 5HYFA 1E9PA 2NY0B 1AVAA 4FHBD 4OJFL 4E5XB 1W80A 3JWNC 2MTAA 1XF1A 3E8UL 4N0FB 1ROCA 5HI3C 1T1YB 3NYKA 2ITFA 1A4BA 2P8LB 2DIJA 1DQTA 1QYGH 2DQUH 4FYTA 3MNVA 2H6UA 2DWTA 3SOBL 3PV6B 3QIWA 5D7EA 5ELIA 3EYUH 1W6LA 4QJ5B 2XBTA 5CBEB 3HE6A 4ZXBC 2Z31D 1JZEA 5FYJE 3ZKXC 4N4YB 2D31B 5E2TH 3GZOA 5CJQH 4ONFL 4XRCB 3AY4C 3PP3K 4NZTH 4WK0B 2BS71 2CO1A 2HWZH 1XH0A 4R96B 4OF5A 2YD7A 1G7QA 3K6FA 4BUQA 3HI1B 1OAZL 5C1MB 5DEZA 1BQLL 1SJEB 3HC4L 1J8RA 5DJYB 2ZXEB 1OGTB 4L1TA 1J0IA 1UUNA 2GUOA 2Q7YA 5KJ4A 2NX5A 1T4WA 1MJJB 5BUAA 2YGPA 3B2MA 2DLFL 1NGXA 2Z1KA 2W0LA 2FD6H 3OKOB 3BKCL 2IH1A 3HVDA 2A73A 1H3VA 3TH4T 2VDQB 3QJQB 5I8OH 3DSFL 1F11A 2JKXA 2H0FA 4JVUA 4U05A 4Z7NF 1UXLA 2JKRM 3A3YB 4GJTB 1BCIA 2DI8A 2BNRA 2JIXA 1F5WA 5FDWA 2Z3FA 4V1DA 4WI4A 2WINA 4R5TA 4KI5C 4XCEA 1DANU 3SQOL 3K2UL 2B77A 2V5MA 3L95A 3UG3A 4GRWF 1C7TA 4U1SA 2YD2A 4FRWA 1T83A 4R8WH 5FDYA 2IH9A 5I1HL 2EYTB 2MNWA 1PG7H 3TASA 2FJUB 4PBWD 3WNOA 3ETBJ 3GJFK 4BH8B 2VXQH 3JTTA 4UOW1 5BW7A 1KENL 1D2PA 4UTBA 5BQ7A 3GIVB 4FE9A 3P77A 3RIAF 1E4JA 1DQLH 1GL4B 2EYRB 4CW1B 1RUPH 4POZC 3RVXD 1YN6B 4R4NC 3DHJA 3B6SB 4CGTA 1MVUB 2UUDH 5F9AC 3FN3A 2VABA 3ELQA 4XZ4A 1DZ0A 2O5ZH 1MFCH 4HC1A 5DEGB 2K0RA 2AW2A 2QMKA 5DVMA 4XC1H 3AXIA 2C5DC 5GRJL 5D4IA 1SHMA 3EYVB 4XNUH 5A2IH 3BT2H 4GLRI 2XZCL 4N0UB 3VXQA 1MY7A 1BJ1H 5K59F 2IEPA 1JI2A 1YQ2A 4LPUA 2FJGA 4KK8D 4OFQA 2D3NA 4OGAC 4ANUA 2UZPA 5EU6D 5IF0A 1YLBB 2GSIA 2R83A 3FHAA 3CVHL 1JV2A 1G1KA 1RJLB 2DJSA 3ML8A 3PABA 4HS8H 2X89A 1CFVH 4B9FA 3HFML 5AOLA 3SGEI 2ATAA 3HG1B 2CLVA 2L7EA 4QXVA 1PJ9A 5T3XL 1TLKA 2AJVL 2O5NA 1I8AA 2Y2WA 1QLEH 5ID0A 4WY7H 5AZ2H 1BOGB 3RFZA 3M17A 4LESA 5I1AA 4WNQB 4AENA 4OJYA 5I8CA 1NC2B 1GJUA 5F3HB 1RUKH 2NPLX 4H25B 4ODXB 5EOCH 4NKIH 1I1FA 2PYFA 2OMVB 2DY2A 3U6RA 2AFNA 1BJ1J 1TENA 1T2QH 2H3KA 2AJSL 4NNPH 4WWNA 3R8BB 1U8QB 3L6FA 4JZNB 3PIQA 1XL6A 4PJCE 4YDZA 4D3CL 3ZDYE 2UZIL 2XKNB 4WDIA 3OAZH 2ADGB 2CXGA 3LV3B 1E5YA 2DH3A 3VG0H 5EOTB 3DGGB 4YL4A 1RZ8A 3S88L 4PJDE 2YPVH 1IBZA 2O5YL 2R69L 4IGBA 2P48B 1TZGL 3HTLX 3BEWB 3QWRD 1OE1A 5CSGA 1PLBA 2WUBH 1HS6A 2XQ0A 5D4QA 3CHQA 1K5WA 1WRFA 4H44C 5I6MA 5EOCJ 3I3BA 1U93B 4XNXL 5EBLB 2VE6B 4HJEA 5E9AA 5AOZA 1AD0B 4RGMB 3TIEB 3OZ9L 3AUVA 4QGTA 4NGHH 1EDHA 1IC5L 1G9NC 2ZCLH 3FU7A 3KVDD 3MLTA 5DJ8B 5E5UB 1IC4L 2IO5A 2X4NA 4L3CA 1XSOA 4OB5H 3H3BC 4M5ZH 4DW2H 4EXPX 4ZI8A 5TDPA 2GJJA 3K72A 3LQAL 4PP1D 2AJ3A 4YHKL 2DJ4A 3PCYA 3BFOA 4O2FA 5C2UB 4PJGE 1T80A 3PWPB 2ADIA 1KXVA 5HSFA 3ROOB 1NPJA 1B3JA 3NFNA 5LCVH 2A9NH 1AO7E 2LLLA 3V0JA 5ADPL 4JE0A 2ZT9C 2IIJA 2ZXWB 3QT2A 1DJIA 5TFSH 1NMAL 2GABA 3PLYA 4A63A 3DVGB 5FR3A 4N1HB 3ZDZB 3I85A 2CJUH 4WHYH 4EI5D 2F6AA 3QDGB 1WP6A 2FIKB 3HI5L 5IW6B 3FAXA 3FHQA 5KYWB 3O2DH 4JRYD 1JXJA 4P5TA 3BQVA 2HXAA 4R4BB 4BE6A 1NDGA 4MHHG 4GKSA 4U6HA 2QV2A 4HIPA 1X5JA 4NOFA 3R19A 3GI8H 3L2LA 2BOLA 3CN0A 1FPTL 1MAJA 4JFQB 1YG9A 2IPUK 2D7OA 3NZ8A 4K5MA 3TBTB 2GAZB 4GIOA 5E5MA 2GJ6E 2MQ3A 1SVZA 4UT6H 2OM5A 1FV1B 1RK1A 4FNLL 5CP7A 3T2OA 5D1XA 2Z93B 4DO4A 4IRJA 5ESQB 1SZNA 4CBPA 5C97A 4PP2B 3CFQA 3US0A 2QGBA 1N0XH 4MQ7B 4P2QB 2CALA 1BECA 2O26U 1X5FA 3TEUA 4TQIA 5IFHH 1OIOA 3EYQC 3CCHA 4IS6A 3NP4A 4JZJC 5E6ID 3A4EA 1YRKA 4UYQA 4LSVL 2AK4E 2AXJA 2Z31C 5IBUB 3ME0B 3GPSA 3IMWA 5I76B 1F4HA 2EO9A 5HY9A 1ZLVK 5I66B 3QORD 1I1RA 1A47A 4Z7VB 3DBXB 1U8IA 1O7DE 4DOHE 3OX8B 3HNVH 3LS5L 4JFPA 4WUUD 2DMKA 1XCQA 5F7NC 1KBGH 1SXCA 2IBZX 3OJ2C 4DK6A 4BQ9A 2FHBA 4MJ2A 3CAFA 4JEGB 4O58L 3TP4A 4L1BA 1FZOB 2E5EA 4GKZB 4UB0H 3MRHB 4XPFL 3JT2A 2UX6A 2WB7A 2ORBL 3X14A 5I5MA 3BSZH 4UOQA 2VXSL 2QSCL 2PTTA 4W4NA 5JHBA 4YPGB 1OAQH 3DUUA 2R56H 2A6JA 4P04A 3WN5B 3PNWB 4DP1X 4GRWH 1Z66A 5E8DL 2ZNXA 4X9GA 1LNUB 4G11A 3S3JA 4A55A 4DGIL 2OCCB 4AQZA 4LDCA 5LG1A 5DC0A 4LDOB 2RB8A 5TQ0L 4L4VD 4U6XB 4UU9B 1A3LH 2APBA 3HZYB 1MZYA 2DQJH 4ZTOL 2DQFA 3VWJC 1KC5H 5SWQB 2WSPA 1IKNC 2V9RA 1XF3B 1CGTA 3HC0A 4GSXA 2Y24A 4PB9H 4E41E 3WIHL 1IE4A 2O6CA 1PZBA 4Z18A 1YEEH 3BT0A 4R9HA 1S7SB 4OUOA 2QPDB 4YDJA 4OLUH 4U7SA 2B5IC 2NY5H 1KYFA 3WIAA 1P69B 2EDBA 1BLIA 1R17A 2R1XB 1JXDA 2MPAH 4BHUA 2DBLH 3R0MA 1IGMH 4NKMB 3VDAA 3HRZC 4J4PD 2XN9E 3QFDA 1FGNH 4XPBH 1OP5H 1I8MB 2ZX6A 5FK9A 5GGQH 4OF0A 3HG3A 4KDWA 4MAUL 3BIKB 3C09B 4HSQA 4NN5C 4HIIB 4TTGA 3QPXH 4XMXA 1GZPB 1VEPA 3WEMA 1MF2H 1RU9H 2V8LA 5LN4A 3C5ZA 1H8SA 2ZXAA 5DJ2B 4YSTA 1SHXA 5I1EL 5I1JH 4LLMB 4FS0A 5GSRB 4N3TA 3S8WA 4E9QA 2VZOA 4HQQH 2UUDK 2J1ZA 5GHWL 2X4UB 4ZK8A 5C9JB 3IVKA 3EGDB 4L4TB 4DQAA 1RZJL 4HUVB 4XNYH 4Y2OB 2R1YA 1SUJA 2VN4A 3LZFH 4UIKH 3L3GB 1P7HL 4QRQA 1BFVL 2F54D 2L8AA 4J3BA 2FECL 4OCNC 1J9CT 3V0WH 3O6MH 3MV8A 4GLRH 4TQEH 2BY2A 3HS0B 4Q4EA 5AZEL 3KPLA 3V79C 2YD8A 4XX1E 1NKOA 2F53B 2YXFA 1A9BA 3VI3F 1MW1A 1N8ZB 5KOVC 1GAFH 2OMUB 3DK0A 4DKFH 3B83A 3RL2B 4DPCX 4RAHA 3SGEH 4H20L 4XTRC 3UZEC 2OJEA 1ZEAH 4TSCL 1X4ZA 4PJHE 3U6XS 1PX4A 2JKLA 2JCCA 3L9RA 5GIRA 1M7DA 3D0VB 3E2HC 2D7MA 5I5RA 4XNMA 2NR6D 5BS0D 4Q6YA 1MAKA 4C55A 3QNXA 4PGEA 4IM8A 4UTAL 4KBPA 1JDCA 5D1QA 2KBGA 1DQVA 2OTUA 4F9PA 3CMGA 4C54A 2WLIB 2VO5A 3O9WB 4O4YL 3U9PH 2ZPKH 1DLHA 2CZNA 2VT0A 4OAWA 1EHLH 1SXNA 2GEEA 2QR0B 3JYCA 1CL7L 3SY0A 5BRZE 3DETD 4GY4A 43CAA 2HT3C 3G5XA 3HUJE 4LAJH 3EBAA 2TRYA 5FO7B 2O30A 3HAEA 4EBQL 3V4UL 1TQCC 1LDPH 2D2OA 3G5VA 1Q0YH 3Q2CA 3MC0A 3NIDF 4DGVL 2VC2B 3KPSE 3VU2A 1ZA3A 4LQ1A 2W65B 4HKXB 4X4KA 4P3CH 2BVPB 2I60L 4K3JL 2XZAL 3K46A 1AXSA 4Y7MA 3OMZA 1BEYH 4G5AA 5T33L 3PHSA 1UA3A 5KYNA 2Q9OA 2VLKD 2NCEA 1IGYB 4I2XB 2ZSWB 3BVNA 4YK4B 1UH3A 5EC1A 2BY1A 4NQDE 4Q9BA 3CFNA 2YEZB 4KJPC 4N0UE 4NHUA 4JDTL 4MASA 3UTZB 1MAML 4CU7A 2B16A 1OLLA 2ITDB 3JVFC 1ZHKA 1HEZA 1I1CA 4JB9H 3V0HA 3DIDA 4KQ3H 4WJKB 4KK9C 5E7FA 5E2VL 2H2SC 4YDVB 3L4ZA 3LSOA 1J0KA 2EDXA 1JPST 4IOIA 4XNQB 1O9ZA 3GK8H 3OC8A 3AITA 4M6NL 1A7OH 4IBYA 1BZOA 1IVTA 3GINA 3SDCD 1KBKA 1ZVSA 2M2DA 2K6YA 1BVKB 3P02A 5DS1A 5DUPL 3ARRA 2C26A 2CHNA 4HJGA 5CNHA 1KT2B 3IRPX 2ZXDA 3VFRB 4HK0A 5BPPA 4WW2A 3U48A 2HJKA 4J8QA 3LVEA 5B1KA 5TF1H 4CMMB 4XNZC 3D25A 1AGCB 3OB8A 3M1OA 4OJFH 4F1SA 1N2RA 3ES6B 1R3KB 3EGXA 3B5HA 1WSST 3C9NA 1P5UB 5CR8A 2HVJA 1X7TA 4LCYB 5IFJA 3KGSA 1DSFL 4W68A 1HAUA 4AUYA 4Q6KA 2A9MH 1AR1D 2X6BA 2AJUL 4FFVD 4GI9A 2GJRA 4R4FL 1MI5D 2J44A 5GZND 1MJUL 1PDKA 3PFQA 5CU5A 1NCWL 2E9BA 3VXSB 1GYWA 3FKUS 2QADC 3RVWC 5DVNA 1E5ZA 2EIZA 4ZMYA 4HF5L 2IGTA 4Q0XH 4L29B 4MGXA 2C9XA 4LBAA 4JN2A 4X98A 3M1BA 5EIIA 3HC4H 4NP9A 1XH2A 1TCMA 3KBFA 4WEUD 1HQRA 1T04A 5F0PB 1KBBA 5JOPE 3T2LA 1P4LA 2V6HA 2WLLA 3NFSH 1NLBL 1MRCH 1PBYA 2QQNH 2DTML 1CGSH 1J0HA 4I3RL 1FYTE 3SKOA 4G42A 1N67A 3H9SD 4YNYA 4YHMH 4J3XA 4C4KT 3IN0A 1MWAH 1ZRUA 3DSFH 1BVNP 1IGFL 2XX1A 1JTTA 3PDOB 4W9GC 1L9OA 4K5LA 3APDA 3WTVA 3QDJA 4LPTA 3IXTA 3GJFB 4P2OB 2HPTA 5A6LA 2K8QA 1CI5A 2Y1ZA 1JE6A 4XO5A 1MXDA 3LD8B 2JLLA 3CVBA 3QXVA 1MHCB 4HT1L 4KTDL 4RWYH 3SQOH 3K2UH 1X3DA 3V52L 1UH4A 4P5MB 1HHHB 3L4UA 3T5WA 3OD3A 3QG6B 1D5MA 1YN7B 3MHZA 5CMAA 3VXME 2N1TE 1QBLH 3RVTD 3SDDB 3TBSB 5A3IC 5I1HH 3LYRA 1MQKL 3T0WA 2DYPD 2QVFB 1J8KA 5EORL 2QZQA 2FBJL 4GKNB 4MX7B 1PLCA 1ZSHA 1KENH 3NFPB 5DJCB 1E5UI 1NBZA 4WJG3 1TVBA 1SJEA 3I6KB 4MA7H 3UBXA 4YZFE 1WZLA 1YEGL 2WHVA 5HJBA 5LBSA 4A7TA 3GXMA 4LP4A 4XBGA 5JPNB 2EE9A 5DD0L 2XZQH 3HS8A 2ZP9A 4MNQA 1P0SE 4NM4H 4ANXA 3VCLA 3MBXH 5HHNB 4AGMA 3K4AA 7TAAA 4J4PC 5FWRA 4DEUA 5ICXB 3L3OA 1A1OB 5GRJH 4B9KC 3QGVA 4TNFA 5ID1A 1S7UB 4A6YL 2YK1L 5EF3A 5DEFB 1A4JA 3MCLL 1PZ5B 2H6PA 3WS6A 4L3EE 4J3UA 2V5SA 5K1NA 3VRLE 4RISL 5DRNA 4MHHI 1HFUA 4PG9B 4QRPD 1N9PA 2BSTB 5FO2A 3MRQA 4QOKD 3OBAA 5CJOH 4NRXA 1L3NA 2FIRT 3HFMH 4PTUB 5GGVL 4EN2A 1E50A 3CVDA 3RPKA 1FG9C 4I9XA 1ZGLM 3FONA 2AJVH 4RMQA 3UAJA 5IW3A 3LRKA 2WD0A 4YBQC 3PL6A 1IM9A 1WFJA 1BBDL 1KJ2H 5KVGH 2ENPA 4PGBA 5DVOA 5CZVL 2EYTA 3A21A 3KWWB 4RGND 2HLAA 3BYYA 1RJYB 4G8IB 1OPGH 5FYLL 4P4KA 5SWSD 2Y72A 4ZO9A 1CLVA 4JGUA 3U0TB 4HCFA 5LUMA 3KPMA 1GZHC 2AJSH 4ODHL 4N28A 4CW1A 1MCWW 2AK1L 5EC2A 3K2KA 4NUJA 3FT1A 2XBZA 3IGAA 5HYJA 4JM4L 2JE8A 3DXAE 4PJXE 4D3CH 3ZZQA 5INDB 4OSUL 3AUWB 2NNFA 2UZIH 3D3VB 2X9ZA 3S3SA 2D7QA 3Q05A 3T2NL 4JO3L 3L45A 4W9EC 5I17A 6FABL 3AB0C 1A6VH 3EF4A 2YWYA 5EZOH 4U31A 1S9XA 3LZLA 3P30L 4QHUB 4G6AD 3U9WA 4ECNA 1TZGH 5C0CE 5J89A 1A65A 1X5XA 3LXBA 1P4BL 3P2TA 3V0FA 4B9JA 4G6KH 3N1MC 2P3YA 3UP1A 4GMTL 3JWDC 4XHJC 5LDUA 3VFUA 7CGTA 3ELAT 2CKNA 1PPIA 2PR4L 1RZIB 2P5WA 4MJIB 4DNLA 4YSUA 1CXIA 1IE5A 2ITCB 5HI5D 3FSZA 3VGHA 3EXJA 1MVFA 4OLVL 3HG1A 3EHBD 1BV8A 1ZK9A 1L5GB 3LQAH 4KI5F 3VFGL 1PQZB 2SEBA 1QSZA 3MXVH 3L54A 2UXVA 5E9DB 5AW1B 4O9HL 4Y4FA 3S36H 4Y5VA 1HNGA 1A14L 4G9FE 4WNQA 4Y16D 3W9DB 5HGGS 2O6FA 5I15L 2VR3A 4X4MA 2HLFC 3KLHC 5DD3L 3KXFE 1UURA 2NY4B 5JW3L 1EVTC 3V4VA 4Z7OF 2LAGB 4K71B 3QQDA 2W38A 1F3DJ 2J6EA 1GYCA 4H0LC 1VAHA 3OKDA 1QRND 15C8H 4FMVA 3INOA 4R3SB 1T03L 1BAFL 2C1OA 3B8SA 4P06A 4FKKA 5IHHA 2RALA 1KCVH 3EDJA 4LXFA 2ZJSL 4XWOD 1PL3A 3HI5H 2UZXB 1GW6A 4JL1A 3ZK0A 2MQGA 3QXTA 4F91B 3HE7A 1NEPA 5TK4A 3FO9B 1JI1A 3HCVB 3QXAA 3WEBA 3IDMA 2P4AB 2OV0A 4J6RL 5AW7B 3EW3B 5EZIL 3L1GA 5F89B 1SVBA 3T6XA 2TAAA 4I4WA 3ZDXB 1E9OA 2NY6C 4LKCA 3OKLB 5D2NE 2EIEA 2Y7SA 3TIEA 2ICEB 5A2BA 3W3BA 3APFA 3FAWA 1VACA 2L7UA 2XV3A 3KLDA 3QR1A 2OJ1A 3EJJX 4CADB 3K71B 1RD6A 3CHOA 4P0DA 4PSPA 1CR9H 1QFUH 1BPLB 2C1PA 4XOBA 5ANMB 1YMMD 4IRSB 4FNRA 3RZCB 5JMOC 4XBPB 4Y2DC 3FRUB 3CFDA 3W82A 1OAYH 4RMVA 3PWPA 3BSGA 4B9ZA 1NEZB 1PIGA 3KCWA 1U4FA 4EIUA 1UC6A 3GDCA 3QEUB 1AR1C 4L37B 1UM4L 2MKLC 5E8OA 2EYSB 3HB3B 5BO0D 4KJYB 2YQ3A 1JPFA 3PJSA 4HWUA 4KJWC 5F6HJ 3VSVA 2WVSA 3C12A 5MHSE 4HLJA 1IEAA 2YSSA 1B0RB 3K4ZA 4X80H 2VKWA 4M43L 5HDBF 2CCWA 1CLOL 2ZYIA 5FYKU 5BOZG 4MJ6A 2CJSA 2WKGA 1CDUA 1PZ3A 1BZ7A 3AS1A 4O58H 3FBKA 4G7YL 4KY2A 1LVEA 3TZVC 4XPFH 5SX5K 5EEVA 2VDNH 1LP9A 3TN0B 3V6FB 1OHZA 3GSRB 5C9KA 4UBDD 3ULVL 2VXSH 2QSCH 4JS7A 2WIIB 2DTSA 2EVIA 3TBTA 4QXUH 4N2BA 1UACH 4M6AA 2DPKA 3S3DB 1ZDSA 5E8DH 1JZJA 3MV9B 1ADQL 3W56A 4F58L 1QSEE 1PLAA 1RVFH 1WHOA 2PF6A 3CFEB 1ILUA 2R0WH 3HRPA 4FFWD 4HJIA 3QEQD 5GGRY 2Q6WA 4ZTOH 1CLCA 4P2QA 4Y19D 2MSPA 1LDSA 3RZWA 1A6WL 2BERA 5JZ7C 2ZKWA 1AS7A 1SM3L 3RLSA 1WIOA 2VDOH 3RVTC 2PXYB 1USQA 4OH2A 1EAQA 4ORGB 1IT9H 3GHBL 4ODWB 3VFSA 5I76A 1QW9A 1S9WB 1IUZA 1JXGA 1NGQH 4DP8X 2F15A 5I66A 4OZ4B 5JXED 2HUHA 1CFSA 4WU7A 4Z7VA 2WO3B 2YPLE 5C08D 2C4XA 2HRGA 1J0ZA 3Q2VA 4Q2ZB 5JPMB 4Z7WF 1H6FA 3BZDA 5IMKB 3HR5A 4YR6B 3D8MA 2ZIDA 4JAMA 3SKJL 3RHWF 1UB5A 1A02N 4KKBD 1I9EA 4E9YA 3UPCA 1HCFX 1T0MA 1ZLWK 1DTUA 3T65B 5D9SA 3EJZD 3FOLB 3P4LA 5I1EH 1MNNA 3V6OA 3IF1A 1J8HE 3RX9A 2WGXA 1SJHA 3FB7A 5CZXC 2VLRE 2ED8A 1RZJH 4U3CA 5DLML 3MRLB 1FHNA 4NWTH 4LL1A 5KS9B 1B6UA 2P5EE 4Q58C 1XF5B 1GCFA 4PLNC 1BFVH 3VD0A 2FEDD 3HKZA 4LHUB 1INEL 5IV2B 1G7JB 3SYCA 1S7TB 1X5MA 3EJCA 4NT6A 2W60B 2YR3A 3KDMA 4HZLA 1Z1WA 4TLUA 4FQXA 4Q6IB 1NEUA 2H1XA 4XGZB 1JFHA 3V5DB 1M7IA 1SBSL 4TSCH 4LSRL 4UT9L 2YEVB 5F0LB 4P46D 3VAEA 1CFTA 3LKRB 1U3ZA 1GC1L 3WXWH 2ZXCA 5FYJD 2ALAA 1QFWM 2RBLA 4AQ1B 4A39A 2NY2B 5INCB 4HOXA 3A6OA 4YQXL 3W39A 2F7OA 4Z77A 5EO9A 4UTAH 5KBKA 2BJMH 5JIKA 2PCFB 2BHYA 2YUWA 3NJXA 4ODVH 3BI9X 4M8UA 3B3IB 3BIKA 3WO4B 2X44D 3ZE2F 4EOWH 5DFWH 1TSRA 3C6LA 2CGRL 1NC4D 4G3YL 1MFBL 3BWSA 3BO8B 3R06A 3FCTA 4QAWA 5E5RB 2X12A 2DWDA 1EDQA 5DJ2A 3IJSB 3N0AA 2K78A 3O4OB 4HEPG 2ZKHL 3TC9A 1T0OA 1QA9A 3DX7A 3EGDA 1VZIA 3BPNB 1YDPA 3FFCB 1M3IA 4G6AC 4PRHE 5EDSA 5L0QB 2H6OA 5DTFB 5D96C 4DGVH 2IQ9H 4HD9A 4MAYB 4NQCD 5J1TC 3UTSA 3H3KA 1J86A 5FYKL 3CSTA 3QIWC 4DHLA 3GUTB 2I60H 3ZKND 3HE6C 3WE6B 5ICYA 3RVUC 5LDSA 1K8IA 5ALBL 3AT9A 5LKNA 3FRPA 2NDFA 4PJ8D 5T33H 4BZ1L 4Z3TA 4NQSB 1KYOJ 1Z7JA 3WUZA 2ARJB 3RL2A 5KSBE 1NCTA 3CHXA 1NGZA 3CH8A 5CINL 4F24A 4LHQB 2LABA 2B0SL 1Q4NX 3D09A 2XFXB 4Z3EA 1ZLDA 4NP4L 3MCKA 4LLWA 4WGWB 1KDIA 5J9PB 2GB2A 4XN4A 3KYMA 3EYFA 3BDYL 4A1RA 4M29A 3U6XA 4YXHL 2A83B 3LTVA 1O5PA 5E2VH 4MD0B 4R90L 1BLNA 4M1DL 5K1JA 4B53A 3NGBB 5C0BA 1I7RB 2OL3L 4AGNA 4Z7UF 4BIKA 1WZKA 2HVKA 4G8FA 3QYNA 3A4DA 2LLGA 3NESA 1AHKA 4OZHB 1TUPA 2CKBB 4GRLD 1AGBB 1EUTA 3DJ9A 4HKJB 4HU2A 5DUPH 4B27A 3O3AA 2AMUA 4FFZA 3EJRA 4YSEA 2DB8A 2DMCA 3BEVB 3ZTCC 5IB2B 1A2YB 1BVLB 3L4WA 1XGQB 2EICA 1HWGB 3Q8AA 3AABA 3KCPB 3DROB 3BESR 1YEJL 4R6UA 1BMZA 3SZ6A 4M00A 3L13A 5FGBA 3CVIL 4GRMA 3IS0X 2PWDA 5LBGA 3BYTA 1IKOP 1UOLA 2DQCH 4JO2H 3QUYA 1D5RA 2FB4H 2WJ7A 3F12A 3VXUB 3C5SB 2R9HC 1TMCB 2HUEA 1OP3K 1AGDA 2ZSWA 2HJLA 3FTVA 4MFHA 5BW7C 3VUAA 4BFOA 1MJUH 1BZDA 1RSYA 3MRRB 1NCWH 4YHIA 5D71L 1AY1L 5LXGH 3WJJA 1SLVA 3OGCB 3CXDH 3D4ZA 4MNHA 2EE2A 2VR5A 3GHPA 3L9YA 5D7IA 4L48A 4YDLC 2EDFA 1YZZA 2RGSA 2RR3A 3G5YB 2OS7A 1M71B 4LCUA 5D55A 5I9QB 1FSKB 1RCYA 2G3MA 1AAJA 3BPLB 4X6FA 4IBSA 1MHPL 4HSCX 4ZSOB 1NLBH 5K9OB 3PE9A 5DI8B 4ZW6A 2G4GA 1MKFA 5DRWB 3VFPA 4KX9A 4AL8L 5J3HD 5FUCC 3QNZA 2YRBA 4LVNB 1VKXA 3G6JE 1IGFH 2CGZA 2FL5B 1QAWA 1ZDQA 1SN5A 5JHMA 2OCFD 1TIUA 5BVJB 3HS9A 3QXWA 5BOJA 3STBA 4BELD 3U30C 3H4FA 1R3KA 3REVA 2EE6A 4EI6B 5CZRA 3L3KB 1TVHA 4QKXB 4MDIA 3RFZC 1W2KT 2BNRE 3L1FA 3B9KB 4C4BA 5C3LD 5L4JA 2D9CA 3H42L 5CEYA 4LSQL 4V1DE 4BFKA 1F58L 5C8JB 1E27B 4HWEH 3NCXA 3MRBA 1HHGB 5K93A 2VAJA 2P24B 3ZO0A 3L9EA 3D85D 4G6FD 3ARXA 5ISZA 3CU1A 4PREA 4XNBA 4QY8A 4KO5A 4Q97A 1IM3B 1HNFA 1J9TA 5CSBA 2FGZA 4L29A 3TJEH 4QHLB 4ZD3L 2FWOB 3D39B 3MO1A 1WEJL 3T77A 4LP5A 5F7EL 2UXFA 4A2GA 3O0RH 3P0YL 3T0EA 1CZ8H 1AO7D 1FNSL 2P8MB 4K0OA 2PTUA 1XGUB 4IGBC 1V27A 4PG2C 4YOKA 3I6SA 2OZ4H 2YO3A 1FUNA 3E6HB 3RWGA 5I74B 2YK1H 1C08B 2QKIB 3K6IA 5KYXA 5SX4I 3VFWA 4PJ6A 4DZBB 3MCLH 5H2BA 3RY6C 3OM3B 3ASWA 3HMXL 4L05A 4RISH 3GJFA 4ZUUB 2HKFH 1SJVA 1OXYA 5GGVH 2B2XL 4FTVA 1A6TA 3U4BL 2C4FU 2V17L 4PJ5B 4RSVA 5MI0B 2XV0A 5J12C 5L4FA 3FPYA 4JZOB 4M7JH 3V5HB 5BJTA 2JVUA 1YN7A 3G04A 3H4HA 4HJ1A 2HKHL 1BBDH 5CZVH 2VL5A 3GLDA 1LEIA 2Y6SC 4N6QA 4KQ4L 2K7QA 5IJDC 4JRXE 5MEOB 4G71B 5JIMA 3N91A 4KHXL 3FUNA 3X3GL 2AQRA 3QJFA 1NA8A 4PJ7F 2PTVA 3QUZB 1R0AL 1INQA 1A66A 1CFMA 1Z5YD 4F3FB 4ODHH 2OP4L 1UGKA 1DQDH 5EU3A 1KGJA 1HAWA 3I6KA 5F0MB 1TQBB 4Y89A 1A3RL 4M7LH 4NM8H 5JPNA 2UZYA 4BKLB 4G1EA 2UYLB 3KPOA 3MREB 2HH0L 4P5TC 3ECBB 2X6CA 1Z5LA 4J3SA 1CDJA 1SVCP 2C3XA 4NYLB 4S1DD 3GI9L 6FABH 2VQUA 2YAOA 3CPLA 1QI4A 5JUEH 3A6BL 4LNVA 4A2DA 3VWKA 2VN7A 4HISA 4JREC 3P30H 4UM8B 5FUOL 6CGTA 2X0WA 1S7UA 1QPXA 2A9AA 3EOAB 4PJFA 3IT8D 1G6RH 1RUAL 2YC1A 4F15B 3MNDA 4H40A 3RTQB 2BP8A 1PZ5A 2B9AA 5CF3A 4ZS7H 1KYOK 2MOQA 3S37L 4Q52A 2PR4H 2AGJL 5IIEB 3R1GL 1BVOA 4ZMXA 5D1XC 3FZUC 5D1ZA 4IRJC 1F42A 1R5VA 3DRTA 1UGNA 4NNYA 2F0CA 5IVZB 4ERSH 2OK0L 3IGUA 4DGYL 3NN8B 5D2LB 2R0KL 4N2AA 3QW9A 4WI3A 2WYTA 3JV5A 1A14H 4GG6A 3FTXA 3EYOA 4G8IA 4IRZA 5JA8B 3SBRA 2QBWA 4NFCA 4NAMA 4QCIA 5DD3H 3ARYA 5JW3H 3P4NB 3U0TA 1JP5A 1G0DA 5ILTL 3WS3A 1HYRC 1X9LA 2WK2A 4CSZA 3LS4L 1JPSL 5E6RB 1DSYA 2FGWL 2JB5L 2Y07H 2AV1A 5E8EB 3RDTB 5C0RL 1I1YA 1YUHB 2HRPL 3BQUA 1FN4B 4E41D 1PD1A 2G2RA 5GGRB 4K7PX 4W1TA 4GQQA 2JMRA 5T1DH 1TU2B 3ARVA 1QW8A 5DHVH 2R7EB 3WMPA 3CZFB 4BQ8A 3OLGA 2RACA 3OVUB 1E2ZA 2WLJA 3SIKA 3C6EA 4AYID 3N42B 4MJ4A 3VD3A 2VDLL 4J6RH 2XN9D 5IVOA 3HZMA 2PYEE 2VIRA 4I18A 2H0EA 2KI6A 4P2AA 3SYQA 1VCBC 3VQ1C 4LCWB 3GSNL 3PAUA 5KVEE 4RNRB 3ARED 3JVGA 4M7KL 4WO4A 1BG9A 4Y5XC 3SE4A 1NCIA 1HIML 3DMMB 3MJ8A 3ULUD 1HL8A 4JDZB 5DYFA 3IETA 4O2EB 2PP9A 3D4GA 3GBDA 5D1XE 2DW5A 3T0BA 3X13B 4JQIL 1BBJB 3GBLA 3SDXF 3DNKA 3H54A 1U91B 1UFGA 1ZE3C 2Z91A 4APQA 4RZCA 4MQSB 3QULB 2EDKA 4HCRH 3LN4A 3DUSB 3H85A 1L7IH 3PU7A 4H13C 2IDTA 2XTJE 4YIQB 1X5KA 1TKWB 4PV8B 4BSWA 3Q6FB 3UZVB 5TF0A 3GMQA 3D0LB 4YSRA 1HXMB 1BHGA 1FIGH 4WK4B 5ITBH 3S48A 1CLOH 2D4FA 2DJUA 5HYEA 5HHXL 4HAFA 1XR8A 2J56A 3OB0K 4G7YH 3RL1A 1QNZL 1E2VA 2K9FB 3UTTB 4LGSB 2E27L 1TEGA 3LJ3A 3VI4F 2DMHA 3ZE1F 1IAMA 4UQDA 3VYPA 4G7SB 4PRIA 5ENWB 4GUCA 5F89A 3UJTH 4AVKA 1E0OB 2V3DA 3BH9A 1VLXA 1JIBA 3KW8A 4KTEH 3O6KL 4Z78B 2WQWA 5K9JL 3NACH 3MYZA 2HFTA 1W0WA 4OGXL 3DJRA 5JHDA 3ZMNA 3NZHL 1GGIL 3I9PA 3CV5A 2QPSA 1MCKA 1FJ1B 2Z7WA 1XH3B 3QUXA 4F58H 5FO9B 4YDMA 1FRGH 1JNLH 2VJ0A 3HZVB 2ESVB 2Y1YA 3TBCA 1VADB 3RZCA 5KSUA 5F9OH 1G9HA 4A7VA 3QO0B 5DJDB 1FFNB 3S9DB 1I7UB 3DX9B 1LWJA 2ZCZA 4OCLC 4FLHA 2DAVA 2I5YL 4AI7A 4LPCA 3AQXA 4TUKH 8FABA 4EN3B 2EYSA 3GHBH 3WAJA 1CLYL 4MDJB 1T5KA 2IGFL 4MMXA 1C8QA 1CD1B 1I3VA 5LGKA 4FXGB 3KPNA 1GSKA 5D1QC 3V0VB 3CDGB 2Y22A 3ECUA 3IDJA 4OZGB 5AYUL 4OFVA 3SO3C 4F9PC 4DKEL 4N8CL 4PWFA 3RGVA 1WBYB 2DEWX 1KZYA 1AZBA 4HCIA 4RMBA 1ACYL 4DWHA 3PP4H 3VYOA 1E6OH 3VXUE 3Q5TA 1OM3H 1A5FL 1NCNA 3B37A 2X2UA 1OD9A 4EVNA 1G7LB 4FQ2H 1YECL 3IAPA 1H6UA 3CK0H 3FSWA 3KPPA 2C3WA 3GSVB 3CVHB 2QDWA 3BAJA 3EFDL 1B9KA 3CDZB 3LKSB 4O2CB 3BWUC 4HUXB 4JO8A 1TJXA 4P4RB 1K3IA 3C2AL 3S4SG 2DF3A 2NY3B 4AGQA 1H5BC 4XN1A 1TPXC 3VH8A 3A4FA 1INEH 4PIBA 3NIFB 1MFAL 1PKOA 3MFFB 3II2A 3O2VL 5C07A 2CR0A 4WSJA 2AQ1A 2APFA 2JKIS 5BUPA 1QSVA 2KPWA 4OD2B 3ZHDA 3Q06A 3MV8E 4Z3GA 1MCOL 4XP4L 4Z23A 3C87A 1HILA 1RK0A 2EDOA 2VXQA 2WIMA 5G4MA 4BFNA 3U36A 4YAQA 1WISA 1GJIA 1ORSB 4LAQL 1D9KA 1RJCA 3T3PB 4KK6D 1S5HB 4OCRL 4LSRH 5AVYB 2OSYA 1E3XA 3MXWL 3HNTL 1GC1H 3ECQA 3JTBA 4PJBA 1I1AB 5EZLB 5K9KB 1AIZA 2ERJC 4NHCL 3CXHK 2MJWA 4QYOA 5G5DA 4NRZB 5EHFA 2H26B 5I0ZA 4RAVA 4GQRA 1GPOH 3TEYA 1CI3M 3CFCH 2CIIB 1TQUA 2AJYL 2QQLL 1ITBB 3WY2A 2VZTA 1U92A 5F1SA 5AEAA 4ZO7A 5F3FA 3D2UD 2X4RB 1ZWIB 2CGRH 2XN0A 3DOSB 3QCTH 1MFBH 3QI9A 5AVQB 3L4VA 3Q8FA 5EF1A 3TYGL 5IHWA 3MGTA 2FX8H 2QELA 4P2RB 2A4EA 5G4OA 3TVMB 1NBVH 1U8CB 3NSFA 2J8UB 1O6SB 3I6LE 4WW2C 2ZKHH 4L5FE 2NQ3A 3ESOA 1P6FA 3H9HA 2CM6A 3ARQA 1N18A 3HHMA 1FYTD 3KGUA 1E28A 3LKNA 3ZW3A 2O5XH 3UGXA 1EAPB 3OXSA 1D5ZA 3UO1L 1FE8H 5IV2A 4GBXD 3KMDA 1G7JA 3THMH 2ZAHA 1HH9A 1JTOA 3PJLA 3LRHA 2MEJB 2VRAA 2CDFB 2L4OA 4B97A 1AFVH 3TFKD 1XO8A 4ZMQA 3P9WB 4BD4A 3DC0A 5HHME 5C0AA 4LLVA 5EUOB 1EH9A 1XIWB 1ZHBB 2IPTL 3ZTEA 5E4OA 1GYAA 4XP5L 3ZRSA 3QIUB 5CINH 4R7NB 1EJOH 3JTSA 2UWEF 4MTMA 5C0DB 4JG0L 2GJPA 5GS1A 1FGVH 4K8RD 1YPZA 3M1CA 4HAGA 1U3HB 3I9AA 1JWMB 3GBNH 1TZHB 3HLAB 3S3CB 5D7JD 1WF5A 2VISB 4DKAA 4YXHH 2CO7A 4KZDL 5L8JB 4R90H 4M1DH 4KXAA 1R6VA 3B3IA 5D5MB 2YPVA 3Q13A 5GJTL 3BWAB 4QLWA 3APCA 1DQJB 4NENB 2KUTA 3RWCB 1EEYB 4WI9A 5CJ8A 1KB3A 5C6TH 1INDL 3A47A 3RE0A 2V2TB 4B95C 4PJEA 2V7HA 3KLAA 4JFDB 4HIHB 4YSQA 5TGBA 3C60A 4NO0B 4OGQC 1GGCL 3GSXA 4OV5A 2O93L 4RFOH 2NY0C 2Y3NA 3TTSA 4BFRA 2CIKB 2EEAA 5CGYC 2VLLA 3MFGB 3PWVB 3VM5A 3WNNA 2P46B 3DX8A 3UIZA 4BDVB 2K6ZA 3F64A 5A43C 2X70A 4UAHA 5EN2B 5B3JF 3AG2B 1QPPA 2R2BA 2WVUA 1YMHB 3K1KC 3TBVA 5IW1A 1M7UA 3MKGA 4F2MB 3ARFA 2WB1A 2C7UB 3N04A 4XAWH 4CC4A 1H15A 4YDIL 1GZQA 5LCVA 4K23L 4B7LA 5FO8B 2ZKXA 2EXWD 4PB0L 4F80A 2IDFA 4WTWA 4JNXA 4Y0GA 3T9WA 1FVCB 3QHFL 1PG7X 4AJVA 3WXVL 1Z3RA 1ETZA 3ZL4H 5I75B 3O2DA 4K5OA 5FYJL 1R47A 2WQXA 1W16A 2PUQT 4LK4A 1MHPH 3MRFA 1AQKL 3MGOA 3P1VA 3WHXB 2BOCB 5IT2L 3L3OC 4PR5A 2DD8L 4DQOL 5JORA 4CA4A 3KPRA 3WS6C 3B2DC 4IKNA 2M1KA 4WTZG 3ARGB 3ARBB 5D7SL 1R24A 1P7QB 2Y4SA 1JERA 2WXKA 4MNGB 1KLFA 3M88A 4KVCH 4UT6A 4TVSa 3ZYZA 1D7DA 4GW1B 3RWHA 3S96A 2OXHA 3WJMB 5A1AA 5JW4R 4FHKA 3RUGF 4Y2NA 3QDJE 1Q9LB 4LSPH 3KLQA 3BP4B 3UAJC 3UROR 2F5AL 3ZYJA 4YLCA 5BO1L 4NQVA 3PL6C 1AHMA 3NPSB 3IDNA 4JG5A 1NOFA 1M9SA 1RK7A 3H42H 4LSQH 4LCVA 1F58H 2OMWB 4XMTA 4WFEE 2WWNA 1SY6L 5E6YA 4MXQD 1G9EA 4LLUB 4HDIB 2BH0A 1LTXA 5E4IA 4P4KC 2XXGA 1AHWB 2R0LL 3LIZH 3FU8A 3O6FA 3Q3GA 3O6LH 1FVDB 3ZZLA 3TBWA 5FKAA 1ZIAA 1FNHA 3P3SA 5DD5H 3CHRA 5CGMA 4G9FD 4DP6X 4TS6A 2NYYC 2YAFA 3KXFD 2A74A 2BSRB 5GS0C 4PYGA 5E94B 1UTDA 5KVDL 5IQMA 1H9DA 2AEPH 3LRLA 1FNSH 4GXUN 5K9OA 2YUVA 3EJYC 1BD2B 4L4TD 2IGLA 2J72A 4WI0B 1E40A 4MNQE 3BSZA 5BVPL 3KJ4B 2BRRL 3MNWA 3O8XA 4TUUA 2FWLB 1NMBL 1KY7A 4AEFA 3K2MC 3S35L 5GZOD 4U4BA 5BVJA 4OZIF 1T0NA 4LEOB 5IVXF 1FC1A 4Y4KB 5DK3A 4N8VG 5HGAB 1JWSA 5JQ6H 2WTRA 5FCUH 3LEVH 3L3HB 4P57B 4F57L 1ZTMA 4AEEA 2B1HL 3CFTA 1OF0A 1K4CA 1P84K 1IGTB 3BAKA 4Y4FC 2R1WB 1GIGL 4Y5VC 4YSPA 1J9QA 3UG4A 2HKHH 1GHFL 3WUWA 4M5YL 1J05A 1KTBA 3WN6A 1FL5B 4E42A 4JM2B 3BH4A 4S11A 4KQ4H 4WAFA 3CN4A 4I87A 3WFZA 2HFEA 3HJ0A 3BP5A 5AUMB 1D5IL 4KHXH 1R0AH 3T4AB 2ZKYA 2OMTA 2P28B 3EO1A 1NIBA 4XXCA 1IM3A 3O9WD 4JO5A 1ERNA 1GH7A 2I9TA 1KIRA 1N0LB 2Y25A 4PS7A 4C58B 1NBQA 4BK8A 2VSDA 2AEQL 3F84A 3TO4B 5HPOA 3FTUA 1EAOA 3L7FA 3NAAH 3PXLA 3HE7C 2HH0H 4KV5F 4C4KO 2BVOB 4A37A 3UZQB 5HYJE 1II4E 1W72L 2E7DA 2YGNA 3GI9H 1XGUA 5T1LB 3JUYA 1M6OA 3V7AG 3MBEB 4KUCD 5TE6L 1C08A 1XFPA 4AITA 5HPMB 1TSHA 4W93A 1NBYB 3QUMH 5BZDB 2E7CA 4RGMC 4QKTA 1T21B 4GO8A 2DLHA 1S8DA 2NMSA 2UY6B 1VFBB 2Y9RT 3MCG1 3EJTA 4MZ3A 2AGJH 1MCFA 5E2UH 4J8RA 1HHIB 4UT7L 1DQMH 2AAVA 4ZUSB 1NFDB 2GTZB 3U4AA 2CE6A 4I0PB 1N19A 2P5WE 2XWEA 3NVQA 2X88A 4FYRA 1XAUA 1DN0B 1TQTA 2XWXA 3QUGA 2EJ1A 5GISH 2CHZA 1KB5L 2F2HA 4XPHL 5KBNC 4JJHA 1H3PL 3D9AL 1TZAA 2DIAA 3UC0L 5IGXL 2HB0A 2CK0L 2WNXA 3GJEB 3MNZA 4W9FC 4PH8A 4E5XG 2DM2A 2FH6A 2YD6A 4I48A 4ESKA 4LEXL 5KSAA 1IEBA 4X4ME 1D5XA 2AABL 4F3FA 4AG4L 5DA4A 1JPSH 1MW0A 3BRGC 5C0RH 4WI7A 2HRPH 4U33A 3WIFA 2QGEA 3VD1A 2IANB 4QXTA 5FUZH 1OSPL 4X99B 4CVXA 1B4TA 1T2XA 3U1QA 1S9YB 5B38B 2QVKA 2NUPA 3KL0A 3BUYA 1CYWA 3DO4A 3IDYB 1FCGA 4Z0BH 1U8PA 3X11B 3U46B 1U2HA 4Q74A 2QVMA 1XGRB 4HUUA 3RNQA 2VDLH 5IQ9B 1E8ZA 3SDAB 4Z0XB 4BQCA 4LOFA 1JVOA 4CILA 1QMUA 4HJTA 3QQ9C 3U1SL 2DQTL 5B39A 4LOEA 5IWLA 4M7KH 1PGRB 4JVWA 4QD2E 5FKPA 1SQ2N 3EADA 3IYLW 2IVFC 3K8LA 4TXVB 3JV4B 2YN3A 1HIMH 3ABGA 3KYOA 4LEEA 2X1WL 3LN9A 4YBHA 3NPZB 4GO9A 3CE1A 4MCZB 1DL7L 2XA8L 1MCHA 3IDIB 3K6NA 5E56A 4P23D 1QD0A 3GXFA 4H88L 4Y2LA 4TNWF 1DQQB 2XWTB 4TYUA 3KH3A 3AZUA 2FX9L 3D4CA 4G7VL 4OLYH 2PPAA 4MS6A 4OD3L 4TSBL 2J8OA 4YGAB 4BBWA 1DCEA 1AS8A 1HHJB 4KVPA 1ZKAA 1ZD6A 1KJVB 1FFTB 4K2UH 1H0DB 4Y7OC 1MFNA 2JJWA 4LPXA 4DP9X 1DO5A 5KYUB 4LLYB 2Q76A 2AXGB 2G2NA 1G9NL 4MQTB 2FK9A 2QPUA 5D72L 3WEOA 5ICZA 2GJZA 3DURA 4ZFGH 1DHKA 2H3NB 3JWOC 2K9UA 1JHLL 2BRQA 1Q1JL 4NNXB 5DFVC 4DP0X 3TWCL 5HHXH 1MFDH 1GMIA 3MLWH 4XP6L 5I1DB 1A6ZB 1XL4A 4P2OD 2AJZB <