5JQIB

Crystal structure of fimh a62s from e. coli uti89 bound to fimg n-terminal extension
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
279
structure length
277
Chain Sequence
b'FACKTANGTAIPIGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimG N-terminal extension
publication title Evolutionary fine-tuning of conformational ensembles in FimH during host-pathogen interactions.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
molecule tags Sugar binding protein
total genus 58
structure length 277
sequence length 279
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB02
5FWRA 5AB1A 3ZL1A 1ZE3H 4AV5A 2UY7B 5FX3A 5F3FA 1UWFA 4AVJA 3ME0B 1TR7A 4XOCA 5ABZA 3SQBB 3MCYA 3JWNH 4XOAA 1PDKB 3ZPDA 4J3OG 2UY6B 2XG5B 5IQOA 2XG4B 4CSTA 4AUYA 5AALA 4XODA 3ZL2A 5LNEA 5JQIB 5LNGA 1N12A 5IQNA 4AVIA 5F2FA 3JWNE 5IQMA 4AV0A 3RFZA 2J2ZB 4CA4A 4X5RA 4ATTA 4J3OH 1KLFB 2WMPB 1N0LB 4X50A 4AVHA 1KIUB 4LOVA 4X5QA 5FLUA 4AUJA 4XO8A 2JMRA 1QUNB 5FS5A 3BFQG 4CSSA 4BUQA 3BWUF 4AVKA 3JWNG 4XO9A 4X5PA 2W07B 4XOBA 4AUUA 2VCOA 5CGBA 2JTYA 4XOEA 4AV4A 4J3OF 3BFWA 5AAPA
chains in the Genus database with same CATH superfamily
1YUKB 4JFQB 2JH2A 1S2EA 3FQ2A 3NJNA 1OB0A 3I3BA 2GYSA 3C6LD 5FCUH 2XXGA 2BSRB 2VDLB 3GI9H 4GUPB 5AZEL 1ZHNA 1UASA 1UD3A 1D9KB 5ACZA 3FTVA 4P3DB 3FJTA 2B4CL 2C9QA 3LPFA 4MD4B 2ZOLB 2VAAB 3RY6A 4XNQB 5DD1H 3O3DB 1RZJL 1LGVA 2CCLA 1JGIA 1IARB 4H7VA 3TO4C 4GP5B 4J4PC 3CC1A 4GW4B 4JKLA 4PRIE 4BKLA 3FB6A 4PV1C 1F8TL 4UV4H 1U8PB 2XY2A 3FUFA 1KXQE 5DFTA 4PJHE 3RFZB 4GMSH 2IGFH 4CU6A 4OLZL 2VN6A 3UL4A 4NKMA 1PDKB 5AFAA 1I3VA 4GH7B 2NY2D 3MBED 1LO5A 4OFVA 2BVPA 2J8OA 3A22A 3I85A 3QG7L 4Q0XH 3ENEA 2VABA 4AIEA 1UACH 3QORA 1J0JA 1HQ4B 5K9OA 1QQDA 4HLZG 4UOJA 3FU8A 4NXSA 3EF7A 3VI3A 1SN2A 1ZV5A 3CFJA 2V5TA 4QRRD 1XF3A 2WXJA 1MVYA 4UZUA 3AROA 3O8XC 4IYKA 1M6OB 4CN6A 4XVTL 1TUPA 3RZCA 4R4ND 3G5WA 4MBRA 3GSXB 2CZNA 1K8DA 5TDOB 1FPTH 2J1ZA 2EIMB 1V10A 1OCWL 2OKMA 2W91A 2BS8A 4GAJL 4GS7C 4LNRB 2XLLA 5F93C 3MNZA 4R84A 2QZQA 5F21B 3WNKA 5HJGA 5JR1L 4GSUA 4U1LA 3DETC 5E6ID 3NAAH 5C0CE 4CW1A 1FCGA 1A0QH 3V6BR 1IX2A 4H26A 1D5ZB 4TQEH 2MCAA 1AKJD 1JDAA 2CJSA 4HJSA 4POYA 3ULVF 4Z7AA 2YD2A 3IDYB 2WXLA 4ANKA 1DE4B 2NY5L 3INUH 3N3EA 3K2KA 3TEZA 2UWEB 2X42A 4O51B 1YUHB 2BCMA 4YXLL 4NHUA 3CH1B 3ULAB 1QLRB 1OGAD 4TLUA 3UJIH 3WD5L 1R17A 1Q0XL 1MHEA 4UQ2B 3P0YH 1DBAH 2NY3D 5DRWB 1E4KC 1T5WB 3GS7A 1HESA 3GSVB 4RGMC 5BRPA 3D2UA 1KLUB 3PAVA 4QRSB 4A2GA 4HJTA 3MQIA 4MJ2A 4A7VA 2QQKH 5BVJB 3QIBA 2VXQL 2A6DA 2AQRA 1I1FB 2IAND 3IS0X 4J1UB 4KXZH 4Z7QB 4K0OA 4U1SA 3RY5A 3O4OC 4TNWF 4BFIA 1A7NH 1VHPA 3QXTA 5CKGA 1S7QA 3T65A 4DQOL 1FRGL 1UH2A 1E5AA 1YEFH 5AVUB 3UOAB 5IB1B 4N0YL 4FQ2H 1OCOB 4RFOH 5IMLA 5L7XH 1M1XB 4WK0B 3F85A 5D96B 3S5YA 3QXWA 3WFDL 1TFHA 5J5EA 4AYID 2CA4A 4OZHE 3ZK0A 3E80A 4V33A 3GUTB 4IRJA 4RFEA 4F58H 1OPOA 4I0CC 4LCWB 4W9FC 4P0DA 5HHMB 4AYBA 4FFVC 4F24A 4F7CA 1NCAH 4S0TD 1NGPL 5MHSE 1KYFA 3FFDA 3DX3A 2X89D 1P5VA 2F19H 3B7SA 2BY0A 3BLKA 5ALCL 3MOBH 1R34A 2X4PB 4CMMA 2WLNA 5E56A 2AQ1A 2BVQB 3KPRE 1IKNC 1UWXK 1VPOL 5IVZB 2MQGA 4M61A 4OIBA 5E5MB 4NWUL 2Q8BH 4MJ6A 5E8PA 1GOHA 1R75A 3X3GL 1AKJB 4G72B 1BD2E 2CK0H 3HNVH 2GJRA 1ZIBA 4TVPL 5DMIL 3TU6A 3V5HB 1EAOA 5DHXB 4NAMA 1AQDA 3EBHA 2W88A 1NCGA 2H3XC 4LKXA 4JJHA 2JELH 1G1CA 3IJ9A 1OM3H 3P11H 1H5BA 2LVCA 4P2OD 4XVUD 4Y5VC 2AEOA 4MASA 4BE6A 1CE1H 1NC4A 2NY3B 3HE7C 5CJOL 5AD0B 4RWYH 3II1A 1OAQL 3HG1E 4JJ5B 1G6RH 4XX1G 4XZ4A 2UZIH 1A02N 4ENZA 5EU5A 1B0IA 4LU5H 3PAZA 4POUB 1ADQA 4HXAH 3FAXA 5I1DA 1BAGA 2CQVA 2PTTA 3DO4A 4YFEA 4TTDC 5GSVA 4GSRA 5JLZB 2J8UE 4WRLA 4Y8AA 1P5UC 1U3YA 1MCWW 5AVYB 1ZWIA 5T5FL 1E3XA 1T7XA 4ETQB 4GY4A 2DB8A 4TNEA 2BSDA 5CHNA 2QELA 2W5PA 2RQ8A 3MUGA 3ARXA 3BXNB 4GEJA 3R8QA 1FWXA 1ROCA 3L5JA 4DP2X 4MNHA 4WUUD 1CK0H 3HFML 3SE3A 2G0KA 4Q74A 4KUZL 4HK3J 3V0GA 4NBYB 2A9DA 4ODXA 5GRWA 5EO9B 2Q8AL 1EBAA 1OW0C 3F65A 1C12A 1UWGH 1I7RA 3ZQWA 4L3CB 1NAKL 3R8BB 4CGTA 2AABL 1ZSHA 3GSNH 3G5ZB 3NCXA 4JQIH 2NY6C 2XWBA 5EFIA 5AW2B 2VDNH 4ZMOA 3BP4B 1UCBL 1C7SA 2BDNL 4LSTH 1YY9C 2E7LC 1MEXH 4DPAX 3RWFB 2CDGA 4AGNA 3LV3B 2I32A 3PNRB 4L4TA 5C07B 4ELDA 2EAEA 3VM7A 3C75A 4ZYKB 4RESB 3GNML 5KYUA 4EAEA 1NUFA 4PJ9C 5DQDH 5MERA 5A6LA 5IHUL 3IFOA 3Q3GB 2ENSA 3V5KA 1L7TL 1QNZL 2GBUA 1KPUA 4HKXB 3WG7B 4NQDA 2CRZA 3E7JA 3MREA 1AO7D 2DQEL 4HGMA 4JM2C 4MBOA 4NYLA 4DZ8A 2R59A 2CU9A 1SLWA 2IPUK 3KCPB 2ZZUT 2IOOA 3S35X 4XNUL 1S78D 4B96A 3RE0A 2QPDB 2Q76A 3CZLA 3LN5A 4MA8L 3TH2T 3NFNA 3IDIA 1YECH 4UM9A 3WO4B 4QHNB 2Y7SA 4JZOB 4TNVF 3N44F 1CQKA 2AVFA 4XXDB 1XSKA 2VNCA 2Y06H 4FKKA 5DJ6B 1KCWA 4PW3A 5CMAA 2L4OA 1Q9WA 2XRAH 2EC8A 2QVKA 3QXAA 2VR5A 4PJ5A 2C26A 4RRPM 4J2XA 3FF8A 5IOKA 3H4HA 4YL9A 1HQRA 1IT9H 3WIHH 4FP8H 1F97A 3OAZK 5FA4B 4ZSOE 1QWUA 1QBML 4GLRI 1AHWA 1SDYA 5TK4A 4PGBB 3F7QA 5CEZE 4RMVA 1YYLL 2HT2D 3CUPB 3WUZA 3X14A 1K3ZA 4I7ZC 1D7CA 2QQLL 1TU2A 1BXVA 2CUIA 2WXHA 3QO0B 2JVUA 2R4RH 3C5ZD 1IZJA 2BIQA 3SYPA 3QCTL 4U2ZA 4MXQD 4ONHB 5C0AB 4XB8A 4HOMA 2OX5B 2R69H 3NIDB 1BQKA 2ADFH 2WGNB 3VXMB 5CLWA 2ZUXA 4AEIH 2FT8A 2YPLB 4I89A 1BZ9A 2F5AL 3P73B 3T09A 4AGMA 2KZWA 4QF1B 4ALAL 1CMOA 1HWWA 1T04B 1O6VA 4ZS7H 2N01B 3G7TA 1IKOP 4QRAA 3GINA 1ZKAA 3BGMB 3QB7C 3QUXD 1SHXA 1UWXH 2ZWZA 5GJSL 3TA3D 4NQEA 4MNGB 4FNQA 3ULUE 1E6JL 4I0PC 3FO2B 2A9AA 4AYGA 2B1HL 2NTFA 4LCUB 4AQAA 2KYIA 4LZKA 5FOJA 5IVXE 5TQ0L 3P9MB 3PHOB 2Q9OA 1QBLH 2Z34A 3FT3B 3C2SA 4ZW3A 2BSTB 5D6DC 4DN3L 3MX0B 4FC3E 4JW3A 4ZX6A 5I1JH 3RBSA 2BW4A 2E3VA 3B1UA 3JTSA 4G7YH 5E6ZA 3ABKB 4J4PA 4I2XA 2H4EA 1D9KC 1JZJA 1BMZA 4JHWL 2YKKA 4QKXB 3GHPA 3QAZC 4JM2F 2R0WH 5HHXL 4NZUH 1Z5LA 1XWVA 4HETA 5ESVA 2WQSA 5FO8B 1TVBA 4NO0D 4U1NA 1FHGA 3ZL1A 1DBML 2X2YA 4QXGH 4ZPTB 4BFEA 1ZVNA 1NBZB 1H6EA 2FJGB 4OCXH 2YBRA 2QVMA 3QJVB 3HG5A 2J1KA 2NNCA 3MA7B 2WLYA 5DJ2A 2JXMB 1INDL 4WV1A 3MCKA 3SYQA 2ATKB 3EFDH 3FB5B 3D18B 2WWMC 1KYUA 4O02A 3CFMA 1NPNA 1QZ1A 4JX0A 4KZ0A 3W9DA 2DQHL 4YK4C 5FO2A 1YNTF 1TCRB 4JO1H 5LWYH 4XMPH 2R7EA 5GISL 4XP6H 3DVGA 3P54A 1KBVA 4KUCF 1Q94B 5D1ZA 2V2TA 1IGJB 2PLTA 4K3HA 2F53E 2FX9H 2HJKA 5TE6L 3APCA 5IZ7A 1RZFH 3RWEA 2A4EA 3EJTA 1N19A 6FABH 3SE4C 3IGAB 1I1RA 4EIZC 1MJ7L 1DLFH 1G9ML 2F6AA 2I7OA 4QRPA 3RYMA 2EIKB 2ESVA 4QT5B 4ZW7A 2WPGA 4LPCA 3RX5A 3B56A 4XP9H 1RIHL 3ZE1F 4Y16A 3DJRA 5LG1A 1O9ZA 1B6UA 4JM4L 2Q10A 2X1XR 1QR1B 5ANMB 3LIZH 3MV9A 3NABH 4JRYD 2ATAA 2WZAA 1EEZB 1TTGA 3TA3B 1WIPA 3V0WL 3DX7B 1RUKH 2A9ML 2C4FU 1ZLUK 3VSTA 4GRWE 2OMVB 2WVVA 3X1EA 3HPLB 2BNUB 1N0XH 2BOLA 3T4AB 4HFUL 3SKMA 5F1KC 5JUEL 1AI1L 4CA4A 4KITB 3C5SA 4LRIC 5HVGB 5ISZA 1P1ZA 1JNHB 2EABA 1A6WH 2BWIA 3FT4B 1NFDB 4ODTL 3VRJA 3C6LC 2A7BA 2BP8B 1Q9KB 5JQ6H 1XF5A 1S7VB 3X12A 5FGCB 4YEFA 3O41B 2NSQA 4N0RA 1DZ0A 4PJDB 4IJ3C 2XQYK 5DI8A 2NPLX 1JGVL 3LXUX 3WHE1 3FSVA 1CFVL 2P28B 1MXGA 2IF7A 3BZDA 2H5UA 5E03A 4IU2A 1N5AA 3MV11 1KDIA 3WE6A 3ABGA 3DVNA 5C3IA 4LCCA 5I16A 3NP4A 5D96C 1J8HE 2WQAA 3S98A 5DJ8B 2OTWB 3C12A 1RPUA 4PYGA 3OAZH 2NY2C 3MBEC 4S1SH 4CJ0A 3Q8FA 1II4E 2Z93A 4QRQB 2W9DH 1S3KH 4ZMAT 3QHZL 4UQDA 3NJMA 4Z78A 1BVKB 2VLJA 4PJGA 3BPOB 5C08D 4TQPA 1IC7L 3HZKB 2HTKD 5IT2L 1FAKT 3EOTL 3UTZA 1WFOA 1GGCL 2APWA 2R1XA 4HUWA 4I48A 1JN6A 3L7FB 3L3IA 4OLYH 4FNLH 4R4NC 1XGYL 4NX0A 2NNAA 3QR2A 4GKSA 1KGJA 3DWTA 4JFFA 1QVOA 3UYOD 4HAKA 4PRHD 1BG9A 5BMFL 2BLFA 4R0LB 2VDPL 2WLLB 3O6KH 5D7JB 5E6IC 4WGWB 2N59A 2CUHA 1XF4A 4HC1H 5E9DB 2G3NA 3UZVA 4U6YA 4A67A 5KYYB 4GKZB 3M1BB 3ILQD 4AIXA 2R8SL 2EC9T 3OR6B 3FBKA 1JBJA 2YUXA 4JRYB 4BDVA 1CF1A 3HE7A 5F88A 5J7CC 1L9OA 5CKAA 2H47C 3WSQL 5AW8B 5EBGA 3NFSL 5GS0L 2FX7H 4KJYA 3G08A 3UGXA 4OZGE 2NY3C 3UTPE 2XVLA 1WF5A 2OQJA 3CFEB 4ATWA 3QQNA 3B5HA 4JFZH 3GMRA 3Q13A 1CYGA 3B2MA 1P4IH 3UBXA 1IBHA 5F71A 4WWOA 2YUZA 2G3XA 3EJYD 2AF2A 1IRAY 3V4UH 1BBDL 1YN7B 3DGDA 4PRPA 4WSGA 4O5LL 1T66D 4YHLH 3THML 1SEBB 5M95B 3CVDA 3IJEA 4W9EC 3IGLA 3WDJA 5E1QA 4PJFA 3CFDA 3S96B 4WU5A 1LDPL 2OMTB 1JV2A 3WENA 2XWJB 1KZYA 4DNLA 2VLKD 2Y1YA 3W82A 3WO3B 4DETA 4I3RL 4P4KD 4K4KA 1TTUA 1VB9A 4MDIA 5C0FA 1E9QB 4AY0A 3TT3L 5E1IA 3FQRA 3WUWG 2ZX9A 4FQHA 3ROOA 5C08B 2H1XA 4DO5A 3SOTA 5AG8A 3NEXA 1Z3GL 2E7LA 5LB1A 3MRFB 2ALAA 1SJEA 1HL5A 5I6PA 3IFNH 2VXUH 3MLXH 3AY2A 1JGUH 2YD1A 3DUUA 5BRZB 1XT5A 4OCYH 2CBPA 3GMLA 1NPJA 4G8IA 4QHUB 3R7QA 4X80L 3K4DA 2EUWA 3MODL 1WT5C 1BWWA 3DARA 3HUJE 1AE6H 3OKNB 4QY8A 3L45A 3MLPA 5EOCH 3ARPA 3QI9B 3AJ7A 2AQTA 5JHDA 1N64L 3MOQA 2WO3B 3HZMB 1AMXA 3UC0L 2QGEA 4O00A 1RMFH 2YAFA 2DL2A 4JREB 5K39A 1QUPA 3NCJH 3Q44A 4LSQL 4NBZB 5CR1A 3T3MF 1J0YA 2ZCKH 2DIEA 2BSSA 4P2OC 4XVUC 4AIOA 4OZIB 1R3JA 2YA0A 1DBBL 3ARUA 1ZLUH 5B8CC 2FZ3B 1FFNA 5I0WA 1QHQA 1K5NA 3PL6A 4L8DA 4O2EA 3S3JA 1IVLA 1YPZA 1PD1A 3GIZH 5JORB 3DX8B 4IOSA 1A3LL 4X4YA 2XXCB 1I7UB 1TQSA 4PG9B 2CJTA 3D7PA 3RVXD 1CXHA 4XC1H 2QKIC 4PS3A 2P1YA 1XO8A 1SOKA 1T1YB 4LCIH 1ZJBA 5CD5D 2L3BA 2IH1A 1K5WA 4JCWA 4FULA 1HEZA 1KTBA 5HDQH 1QSEA 1UA3A 4PWKA 3LH9A 3S9DB 2FBRA 1G6RB 5E2WH 3WY1A 3V0EA 3WDIA 3I02B 1O9WA 3KPOB 4HS8H 4WHCA 1T21B 4I9XA 1QBAA 4ODHH 2GAZB 1YJDL 4HCRA 5BV7C 4G80A 5GRXG 2WV3A 5BO0D 35C8L 1JWSB 1KXVA 3QPQD 3MRJA 4TSCL 3WJMB 4NWTH 4Z7WB 2HPTA 2PW2A 3U7WH 5KTEL 5CILH 4WO0A 2ZKHL 5F0MB 3U46A 5I5JA 5JHBA 4KDWA 5IBLD 3MGTB 2WYIA 1FVDA 1QR4A 1YRKA 4HT1L 4I0PA 3VFVB 1MFMA 1GTNA 5D2LE 3DMMB 2ILLA 2K70A 4H40A 5BS0A 3H0TB 4OJEH 4GP8B 1S5HB 4Q7DA 3IDJB 2XTSA 4LO9A 5D93B 3S34H 4JKKA 1EO8H 3AM8A 3WL9B 3MLVH 3LZNA 4WEBL 1FAIH 4AJVA 1DQQB 3M1CA 2BSRA 1LO2H 4GUPA 1AH1A 4L3EB 1D9KA 3GSNB 2XPGA 3W1ZA 1M7UA 1S78C 2VDNB 4MD4A 2X6VA 1SUHA 5DURD 2VAAA 1EV2E 3Q6FB 4XNQA 3O3DA 1HI6B 1NCWH 3NA9H 3S4SB 1ZANH 1QUNB 2AI0L 2GJPA 4GW4A 3MV7E 2VDOH 5GJTH 1L9SA 1U8PA 4JB9L 1JYVA 3K6IA 1H3GA 4UNIA 5FGRA 3N04A 2X1WL 4BQBA 4AOFA 1KXTB 3F6IA 3JWNG 4J3VA 4NPKA 2F74B 4XP1L 4AGLA 1AC6A 1RP8A 2TSAA 2APVA 1NLDL 5A2AA 5DXWA 5D7LD 1LILA 2HG0A 1CCZA 1BFSA 1LXMA 1XB3A 5AL8A 1HQ4A 4PIRF 4R7NB 4TVPD 4GQRA 4JPWH 1JWUB 2BP3A 3RU8H 3U48A 2LABA 4F37F 5FWRA 4AQEB 3QIWD 4PAZA 2ZXDA 5ID0B 1OEZW 2WAQA 2BXYA 3GSXA 4HGWB 2HT2C 5TDOA 3MACL 2H0EA 4LNRA 3PV6B 1MRDH 1HWGB 3TOPA 4UQCA 3TO2B 3EW3B 3U7YL 5CP3H 4GKLA 3C5ZC 4JFEE 1LQSR 3NRQA 4MXQC 1D5ZA 3F05A 5T3XH 5SWSE 1W72H 5LXGH 5JW4R 1DE4A 2JKJA 2VLRE 4FLOA 2UWEA 3T0VA 2Y07L 1YUHA 3DXAD 1ZTMA 2J6EA 3CH1A 2ZWNA 1QLRA 4RRPA 1JTPA 5GZNA 4AEFA 2OJZH 1FFPB 4FTVE 3ZDXE 1F00I 1HHGB 5DLMH 3QUXC 1IZKA 1WSST 4UQ2A 4DUVA 5DRWA 3TA3C 1T5WA 3F2LA 2QSTA 4M03A 3GSVA 3NEEA 3QVAA 1BYNA 4LRIA 1KLUA 1U33A 4G9FE 1KC5L 3EH1A 4M6OL 4QRSA 3ZL2A 5I1LB 1CO1A 5BVJA 4XPHL 4Q14A 3LD8C 1GJIA 1AZRA 2J20A 3M8OH 5D4JA 4OCNC 1I1FA 2XWZA 1HTYA 3ETSA 4J1UA 3T4AC 4Z9KB 3MLZL 2VR7A 3QDJE 2RR3A 3GIVB 3P0VL 4HXBL 5IB1A 3V2AR 3REWB 3A4FA 1X44A 3DX9B 3NZHH 3QO1B 3P4LA 1M1XA 1OLLA 3QAQA 2O5YL 4CVWA 1Q4NX 4YXHH 4R9HA 2RTTA 1PIGA 2WSDA 2VO5A 2DH2A 2EDEA 3TIDB 3GUTA 2AVGA 4LCWA 1GYUA 1KB5H 4L5FE 1WTLA 2ADJB 4Z7OB 2YKLH 4PHZA 4XNAA 4JKNA 5KVGE 2BX5A 4F7EB 1EQWA 4G8EB 4LPTA 1MFBH 3V4PL 1IE4A 4NKQB 4LIQL 4X9GA 4N28A 1IBGH 3OG6B 3MA9L 1CJYA 1U8IB 4EO5A 3FCSB 1S46A 4Z7VF 3T1WA 2X4PA 2HB0A 1T80A 4Y5YC 2OMNA 2BVQA 4FI7A 3FCGA 3K2UL 4IRZL 1E5ZA 5IVZA 3TNMB 2CO6B 3VRIB 5E08H 1F4YL 5E5MA 3O4LE 1YMME 3IPFA 4DUXA 3NIGE 1AKJA 4G1MB 2Q2LA 5AEAA 4W70A 3WIAA 5I1CL 4JL2A 3V0AC 3MLRH 5AW0B 1MQKL 2P4AB 3CCHB 5H94B 3V5HA 2HJFB 5L4FA 5F70A 1CZ8H 1MIMH 1UZ6F 5L88H 4BGDA 2X3BA 5D2NC 4M7LL 4NZJA 5D71H 3FUHA 3MO1B 3X1BA 4DOHE 5AD0A 3CZGA 2JJTC 3F7PC 1SYSB 3FRPG 4JJOA 3Q01A 4PWIA 3HI1B 3RHWF 3RIKA 4FRWA 4U1GB 4UNVA 5J57B 4PH8A 2LW3A 3VI4B 1CUOA 4BCZA 3LQZB 3DROA 4FKHA 2Z0UA 1MFNA 4WK2B 4CN4A 3HS0C 2XZAL 4M48H 4PGZA 4CC0A 4DFHA 5JLZA 5G55A 1USQA 2I07B 1QSFE 1HWHB 2KI6A 3QIUD 4PV9B 4ETQA 1QYGH 4F8NA 1JK9B 4KVNH 4MNQE 3HI6L 4PJXF 2CR6A 4DKDC 3KWUA 2Z8VC 4K3JL 3DPDA 2O6DA 2V9RA 1K2DB 4IBTA 3T2QA 3W2DL 3BXNA 5KVDE 2XT1B 2MNJB 3QDME 2B5IC 3KJ4C 5F7LB 4E2OA 2A0LC 3L5XH 3QUZD 3WTXA 5EO9A 1FYTE 1ZK5A 3T6VA 4L3CA 5LQBL 1MFAH 3ZL4L 2F8IA 1BJMA 2CJ3A 1JF1A 3IN2A 4KY1L 2YPVL 3G5ZA 5EEWA 1OF2B 5F1IB 3BP4A 1CI5A 1D7FA 2DLFL 2MQ3A 2HTKC 4L29B 2ZE0A 5D4QA 3RWFA 3RTQD 1E67A 1UT1A 3LV3A 4UDTB 4BQCA 4HPOH 1KTRL 1ZVSB 3CHXA 2XSKA 5C07A 2WXFA 2O30A 4H8PA 4ZYKA 4WVRA 3BT0A 4W93A 4OFPA 1CDCA 5HGHB 4IRSD 4ESKA 3Q3GA 4G5ZL 4L4VB 4Q9CA 4HKXA 3KS0H 4AK2A 4OCSH 3D25B 4X7SH 1B88A 3W57A 2GSGB 2MMXA 3KCPA 4F9LC 4JO3L 3SYOA 4EMZA 2APFA 2YN5A 3ILQC 4DSYA 3QFJB 4BKSC 3T3PE 2P5EE 5JDJA 3ZMNA 2P43B 4QHNA 4JZOA 3VM5A 1EAQA 4Z3EA 1LNUB 2IH9A 4XXDA 5DJ6A 5EU3B 1TETL 4ZNEE 4KVCL 3SCMD 1TSRA 3RL2B 2NY1D 5EOQH 5GGRB 3KM1A 2XJLA 4XOEA 4P05A 4OCLC 4K8RC 4ZW8A 2JK5B 5FA4A 3U0WH 1DQML 3QIUB 1XDTT 3FQNB 2EH8L 2X4RB 3A6CL 2QSVA 1MHPL 1U9KA 1U8MB 2YWYA 1N26A 2C8NA 4PGBA 3D2TA 4RA0C 5IFJB 4OCRH 3EJYC 5GS3A 3BE1H 2P8MB 4YC2C 4Y5XB 1PSKH 1FO0L 1T66C 3CUPA 3HC0B 4MLSA 2WXQA 1DQIA 5GGVH 3ZT7A 2MWCA 1MI5B 2IGLA 4RFNB 2BK8A 1X5MA 4P2QB 3QO0A 1WJ3A 2G60L 5B1JC 5C0BE 3OAUL 3W37A 4ONHA 2UZXB 5C0AA 4FHKA 3ZE0E 5DHYB 4XPAL 1HDMA 3O2WL 1REIA 3G04B 3VXMA 3HAEH 3SDXE 3SPCA 1I8AA 4DVBB 3IRCA 2YPLA 2APSA 5A7EA 3CAFA 3P73A 4RGNE 3T0EE 4QF1A 1T04A 1UWEL 3H2PA 3T0DA 2V3FA 4WY7H 3D0AA 1UM4L 3D3VD 4FLRA 4LEXL 4AUYA 1RIUL 2B4CC 3N43B 1T0OA 2EQDA 1RZJC 4Q6YA 4MNGA 4M4RB 3QJFB 1CDBA 5D55A 3HHSB 4HWBH 4HD5A 4KK5D 1SZNA 3FO2A 5I0VA 4LCUA 4FHBD 2ZXQA 5GRUL 1EUUA 2PR9A 1WEJL 4QGYA 4WI3A 1FNEB 1YEJH 3VYOA 4LSVL 3P9MA 3ZRSA 3PHOA 3MLTB 3FT3A 2LTQB 3B5GA 2BSTA 1LO3L 1R3IL 3MX0A 5HSFA 2ITFA 4MQSB 2BZDA 5I6KA 1AKPA 2YD7A 1Y6NR 2Y2WA 1PAZA 3RHWK 4U6VL 3RDJA 4BFKA 2J57A 3Q48A 2ZX6A 2CIIB 2E0PA 2FWSA 4XCCH 1J5IA 4O58H 1AYRA 2JCCF 4OD3L 5ITBL 2CHZA 3IMTA 3ESMA 3ZKXB 4F8OA 1GS7A 2NY1B 3HHRB 5FO8A 1RJYB 3PP4H 4UILH 2EDYA 1AOHA 2IIJA 4LQFH 2EP6A 4E41D 3BVWA 5DSCB 2FX8L 4DF9A 4LAQH 3FULA 2Q3ZA 2I7SA 1J1OH 1NBZA 1RK7A 2FJGA 1L7IL 4PREA 4MAUH 3TTYA 2H8PB 4MVBD 3C2AH 4XNMB 2JXMA 4YZFE 1NMCB 2ATKA 3OG4B 3FB5A 3D18A 3RVXC 3MNWB 4BGLA 2NY5C 2YSTA 2A83B 1NFAA 3VFNB 5IFAL 1TCRA 4OD1L 5CD5C 1FFTB 4HUKB 4I8DA 1YEKH 4YIQB 1Q94A 4KJPD 3BJLA 3CDFA 1IGJA 5D5MB 2P80D 5TGBB 5CBEB 3LKQB 3EYFB 5FFLA 2PCYA 4XMZA 5GS0D 3CZNA 5JOPD 1RQ5A 3ZT5A 2EVIA 3IGAA 2WLJA 4UT6A 1NDTA 2X1PA 3UGEA 3AGVA 3ARBD 4QT5A 3SPGA 4ANXA 3QQ9D 4N2IA 5ID1A 1NANH 4BINA 3QPQC 1YEEH 3NSYA 3LZPA 4NQSB 4TMPA 3D3VB 4Z7IA 1QR1A 1KPRB 4PB9L 4WFEE 5ANMA 1W16A 3D34A 1NH6A 5KAQF 1EEZA 2NOYA 4N0FA 4U1JB 3TA3A 3I6KB 2OLDA 5IBLC 3PRZA 3DX7A 4C58B 5DRZB 2OMVA 3RURA 2CO3A 3HPLA 2BNUA 3B7UX 3U4BH 5FEBA 3EH5B 4YO0B 3T4AA 2K6WA 3QRFM 4IOFD 3Q2CA 4JANB 4Z7WF 1MH5B 1JNHA 3FT4A 3DV6B 4JCMA 3MLUH 3OC8A 2GC4C 2G4GA 1Q9KA 4BHUA 4ZTPL 3BAWA 1S7VA 5IQOA 2VN3A 3O41A 2I9LB 5HHOD 4PJDA 1UM6H 3S5LG 2FAUA 4N2GA 3H9SD 4R4FH 2Z7UA 5SWZB 2PO6D 5K1NA 1GA2A 2AHIA 2YAHA 1MFDL 1FLTX 4G6AD 4JFDD 4U0RB 3S7GA 3DTUB 2HA1A 3ZKMD 3ZTNL 1PX3A 3VI3E 1NFKA 5DJ8A 1E90A 3EAKA 1EHLL 2OTWA 1TQTA 2OMYB 2VDPB 1S3RA 1MCHA 1UCTA 2H2SD 4NC1C 2ZJSH 4HSCX 5KSVB 1ZPUA 4LDLB 2AEIT 1A9EB 5FA3B 4ZOEA 1BVKA 2KLTA 5F7EL 3HZKA 1WS7A 5SX4H 3CPLB 2PWEA 3QIWC 4L0ZA 3L7FA 4ZRGA 1L6PA 1V05A 2W81C 3LPGA 3DHJA 3HVDA 3VTAA 2VMDA 2KLSA 1TYJA 3EDKA 1OZTG 2JLLA 2D9QB 2B2XH 2ITCB 2WLLA 1NC2B 3HNTH 4R0LA 5D7JA 4ACTA 4G8GB 1T83C 1LEKB 3FQYA 1F5WA 1UH3A 5E9DA 1AD9B 2ENJA 4PJIB 2OZ4L 4ODSH 1ILUA 5KYYA 3Q5YA 3EH3B 1CDYA 4GKZA 3M1BA 1RK1B 4KKQA 3OR6A 4LP5A 5DUML 3L5WB 3EO9H 4JRYA 4BV1A 5GGQH 4ONFH 4F15C 3II2A 2VDML 3H3BC 3UABA 4PJ7F 3BVNB 1VA9A 5MI0B 4H1LB 1EHKB 3L81A 1G7MB 3QYMA 4GSDH 2R2BB 1BG1A 2FUTA 2YR3A 3CFEA 4P99A 2R2EB 5DUPH 3SJVB 3EDDA 5D8JH 4U1GC 3F83A 4YSAA 5CGTA 4XBEH 4UT7H 4LSSH 1M05B 1ZTXL 3SBRA 3FYEB 1YN7A 1JD9A 1VFBB 3N40P 1KF9B 2LQRA 4F8TA 1SEBA 3U2SB 4WAFA 1C1EL 3FN3A 4G3YH 2AERT 3CLEL 3SZKC 1IGFL 2HZHA 4H25B 4YDKH 5ACMA 3S96A 5DGRA 2OMTA 4BZ1L 2XWJA 3ZE2E 4OQTH 3ZQ9A 2CR3A 3ARED 5TFSL 4B7IA 2WINB 4LARH 1E9QA 1A66A 1FZMB 3O2DH 2BZ7A 3Q2NA 4GG6E 3LHPL 5D7IB 5C08A 3IKKA 1S7RB 4OJFH 4XCFL 3MRFA 1DQDL 1I85A 3ZIYA 4ZOBA 1A1OB 5BRZA 3VB8A 2IAMD 4HIXH 5KW9H 4QHUA 5FLVA 2WIIB 4D9LH 1AXTH 1NIFA 3DJTA 2NT0A 3PDOB 1Z9NA 4ZI8A 4HBCL 3JUYA 3ILEA 1BQHG 4BD4A 3DJSA 3ECUA 3OKNA 1TZGH 3BP7B 3RDTD 1XR8B 2KKQA 2IWFA 2X4QB 3QI9A 5CCHE 3PWJB 5BNXD 3Q6GH 1PX8A 3MN8A 5AWNL 1X7QB 4JG1H 4WNJA 3CFKB 3HZMA 3M88A 1PTZA 3MV01 1XD0A 2E76C 4JFHD 2X44D 4F2FA 1WFNA 2GFBB 4IBLT 4LESA 5F3BB 4OZIA 1OAXH 2FZ3A 3NRFA 2VMCA 2OR9L 2Y4SA 5I30L 5DZ9A 1SVCP 2BCKB 4YXKH 5JORA 3RNQB 4F57L 2VUOA 4N0UE 3DX8A 1QATA 4AKPA 1I7UA 1X4YA 4OJAA 4PG9A 1T2QH 2NX5B 4NP4L 3BGFC 5DJYB 2AAAA 3BH8B 4TSBH 4F7TA 1YA5A 3SGKA 2FYYB 1NOFA 1H0DB 2V0AA 3QIUC 4HUMB 5EBLB 3WFEL 5D1QB 3F7KA 3CMGA 1OGTB 2ZWYA 3OLGA 1YC7A 2X9XA 4ALAC 4F93B 3VI4F 4ZMWA 4JM0A 3A4DA 3HBPA 4WCYL 2JSFA 1G6RA 4OF3A 1NOLA 4E9WA 2GKIA 3OKOB 1RUAL 4BQ9A 3QUZC 1NFIB 3I02A 3KPOA 4K2UL 4LFHD 2PWFA 4M6NH 1T21A 4AMXA 2GAZA 3FQWA 4Y9FA 1SRDA 4I5BB 2AZUA 4B3VA 4L4TE 4X6DF 3EXJA 4UAOB 5A6MA 1JWSA 4OLUH 2B39A 1QFOA 4Z7WA 4LE8A 4XNYH 3UBGA 3WJMA 1T4WA 3D87B 3Q9QA 4K07A 3KEDA 4KTDH 2IDSA 3IM1A 5AKSA 1QZNA 4HX1B 3MGTA 4M4PA 4BKTC 3RTQC 2IWKA 5K9QI 3VFVA 3CFNA 4EZLA 4NKIL 1MHHB 3DMMA 1FORL 4W9IC 2XX0A 1RZ7L 3H0TA 1S5HA 2A6JB 3CVIH 3IDJA 3B7TA 3MHZA 3WL9A 1RUPL 3OHXB 1N2RA 1BHGA 4WTZA 2QR0B 4IRSC 1EXHA 5BQ7B 4JRXD 1DQQA 4QCIB 1C5BH 1CLZL 3FTWA 4L3EA 3GSNA 4V1DD 1BF5A 3WAJA 4OGZA 2MOGA 1DQVA 4PJ5E 2C9RA 3Q6FA 4WJG3 1EHNA 1JWMB 1HI6A 1XCQB 4L23A 3S4SA 1QUNA 2PCPB 3O3UN 4XN7A 5BO1H 5EZOL 5C0RH 3FSWA 5TPWL 2YGPA 3UAJD 2Y9RT 3IGUA 2H9GB 4WFFD 5F97E 5I8OH 1KXTA 4MYWB 3SCMC 2F74A 1R19A 3DSNB 1BM7A 2NY1C 4JO4H 5D7KE 4F33B 5HBBA 3ULVE 2NQ3A 1W8NA 1E5CA 2WBXA 2A6KB 1PNDA 4R7NA 3RI5F 3VTTA 4LHJB 4WI9A 1G9MC 1SJXA 4GXVL 1JWUA 1O0VA 5IP4A 1T5XB 3GI8H 2EDRA 1NMCC 4AQEA 2GK0B 3DV4B 3FTZA 3RVUD 5ID0A 1FLRL 3P1VA 2Q1EA 2VZ3A 2Y0SA 1Q72H 4X50A 4E36A 4HGWA 2ARJB 1IGIH 4HLZH 1ZDSA 3LKSB 3EUDA 3TH4T 5F7FA 3TO2A 3NCWA 4ONGL 3PP3K 5TDNB 4EVNB 4WEEA 5GS1C 1SN5A 1FUNA 4XO8A 4KMTL 1EFXD 4HLJA 1WP6A 4ZUVB 1DVYA 3WGUB 1I8KB 1OE3A 4AYFB 3DX6B 3FHAA 4PD4K 2W07B 2OR7A 2XFXA 3PGFH 1MKFA 1UKSA 4HUUA 5I1GH 2J5LB 1FFPA 1MCOL 2CM5A 4Z0XB 5I1HL 2E74C 1J86A 1HHGA 1A5FH 1HZHH 3G9VA 2X70B 5E1HB 2J2ZA 3UC2A 4KZEL 4OGQC 4AYSA 4WSKA 2H26B 5I1LA 4KK5C 1E27B 4QHKI 3UTSD 4L1LA 1DANT 2C9AA 5GZOD 5ECGA 2VW6A 1CGWA 3P3SA 5INCB 3OZKA 2R69A 3BIKB 3D9AL 4HVBA 5EOCJ 1IC5L 1RZIA 3KPSB 1T6VN 3KVPA 3QZOA 4JKMA 4RWHA 3N43F 4KRNA 2XICA 4NPJA 4OFKA 1L5GB 4XWGL 4UTBL 1CXLA 5AZEH 3REWA 4ZUWB 4X0NA 3DX9A 3QO1A 1QG3A 1TR7A 1E6OL 1T7VA 1V7NL 2B4CH 4FFTA 1UOWA 4JAMB 4QOKD 3W39B 4N5ED 3M6DA 5ABZA 1RZJH 5IWLC 2JKWA 1G9NH 3BPLB 2PYEE 4E0RB 5HD8D 3TIDA 4U0RC 3FNKA 3T77B 3E8VA 2ADJA 3KYMB 4EQ2A 3LRSB 3QG6B 3CSYB 4CSTA 4MVBC 4OIAA 1YNKH 3QG7H 4G8EA 1NAMB 2DM4A 4PW4A 6PCYA 1FL3B 3SB3A 2VW4A 3BRDA 4ZO9A 1M7XA 1U8IA 3JWOL 5ENWB 3FCSA 1ERNA 4WI0B 3WTTA 4GEIA 3H9HA 2OK0H 5KJRL 2IDUA 3VRIA 3MU3A 4QRPE 2ESVE 2CO6A 3NJFA 5E2TH 1SJHB 1GSMA 3NJVA 4KJPC 1GPOL 4NZTL 1T83A 3H85A 1HT6A 3ZZSA 1OCWH 4M6MH 4G1MA 5GS0C 3PQYE 4CC4C 3HC3L 3IWUA 4HG4K 2KC0A 3CCHA 5H94A 1F4XL 2CD0A 2HJFA 3QQ9C 5T5FA 5D1XB 1NWPA 5FV2A 5D5MF 2NY5H 3CSFA 4KK8D 3ZY7A 4KOBA 4Y4FB 3BQVA 5DK3A 3MO1A 2DWEB 1U95B 1SYSA 4UT9L 3WIIH 1CLVA 5E70A 3I3EA 3HI1A 1QMUA 2PWHA 4JFVA 3U4EB 2H2PD 3HMWH 3PAYA 3VI4A 2WB7A 3LQZA 4IOFC 3CQQA 3UBHA 4GAGH 1UXSB 4TULL 2I07A 2VXQH 3NQIA 4MA7L 2M2DA 4PV9A 2RACA 2Z4TA 4UINL 3H4FA 4PY8J 3SQOL 1JK9A 2MCPL 3UPAA 3S35H 5EORL 3NDYE 5EO0B 4W4NA 1FRGH 3LIZA 5J6SA 4NKDB 3BH4A 3QJTB 5CIPH 4N0YH 4OLVH 5JOFB 1WRFA 2PO6C 5ESQA 5C0GB 4RDBA 4U31A 4G6AC 2KL6A 3BWSA 3ZKMC 4MA3B 5I15L 4MZ2A 4M7ZB 1F4AA 3BRFA 3TASA 1XGTB 5EEYA 1ILSA 3LS5H 1KCSL 3VFTB 1TEFA 2H2SC 2VLLB 3O11B 4NJAL 2N7SA 4GXUM 1FVCB 4FQJH 4DO6A 1OF2A 1O6SB 4RX4D 5EUKB 5F1IA 4JFFE 3MFGB 2CJUH 5DJ0B 3L16A 4L29A 3SGDI 1Z9PA 1DQKA 1KJ3L 2MPAH 3BWAB 5EU7C 3SDAD 4UDTA 5JXAL 5IESL 1ZVSA 2E86A 5HDBF 3VUAA 2K7PA 2AJSH 2UX6A 4NQCE 1S9YB 4KDTC 5DJDB 1CL7H 3WOVA 3PP3H 2UY6B 1RIVL 5JPNB 5HGHA 1UJTA 2WIMA 5E6YA 7CGTA 5DHDA 3A23A 1V3KA 5KS9F 3ARFD 4L4VA 1YG9A 1CD1B 3B83A 1IV8A 3D25A 2ZKMX 3I2CH 1B9ZA 2GSGA 5MENB 1DJSA 3WEOA 3OTTA 4FXTA 5EOTB 4NUPA 1HL4A 3ILDA 2YAOA 4X0KB 3MFFB 2WN3A 5GHWL 4WENB 4TKWA 5C0EB 4NNPL 1N68A 3GT6A 1LNUA 4G6JH 4WU7B 2EUZA 1CFNB 1OWWA 4YFLI 5EU3A 4BXVA 3CLFH 3D39D 3FUEA 4LP4A 4HPYH 3RL2A 5GGRA 3WY3A 3K71B 1GJWA 1NQBA 1OAQH 3KLAB 4PRPE 4YBQD 5I1AB 3L6FB 4HSAC 4KH9A 4JRFA 3KYOB 1RUML 2JK5A 2WLHA 4BFFA 2AJYL 4D2NA 3QIUA 3GXFA 3FQNA 2X4RA 5DO8A 4Z8FH 3C8HA 3VXUD 1CICB 5CJQL 5IFJA 3TJPA 1YJDC 1JPSL 2P8MA 2V37A 5A2BA 3U1SH 4Y5XA 4LT7A 4WUKL 3EJPA 2YMXL 3HC0A 1UYWL 4B3EA 1UT9A 2XJKA 3FQTB 2W80C 2VJ0A 1MI5A 5HYIA 2Z1KA 4FAAB 1B3JA 4P2QA 5FAAA 4KK6D 4G6FD 3FUIA 2V2WB 4U4BA 5DHYA 3AREC 5DDHB 1DTUA 4EQ3A 1YEGL 3G04A 1MG2C 5EPMB 1H3UA 5HDRA 4J3TA 4DVBA 2F7IA 4XPFL 3DOIA 1NAKH 2NDGA 1MRCH 5E4AA 2Y1AA 3SDAB 1NMBL 4H88H 1XZ0B 5DGQA 3N85H 2IAMC 3CVHB 1A7PL 2P52A 1PS3A 3QPXH 6PAZA 2QVTA 4M4RA 3M7FB 3QJFA 2FUQA 1QTSA 1LE9B 2AQNA 3HHSA 5DC2A 5HGAB 3ARFB 1L0QA 2Y7NA 3VSQA 1HEHC 3H8NA 1ZEAL 3BPNC 1FNEA 3GSOA 5DU7A 2OMWB 3RDTC 1ETB1 2WXRA 3MLTA 4DGIL 2VJXA 1B2WL 2YJQA 4GI6A 4OFQA 4GG8B 4KK9D 5A2LH 2R0ZH 3IGFA 5LBGA 4JGJA 1I9IL 1G0YR 1OTSD 1S6NA 3D69B 4TS6A 3O9WB 4X42A 4ZFOL 1LO4L 2CIIA 1AFVH 3FZUD 2DRUA 4UCFA 1WZ1L 3WMSA 3L95B 2WN2A 2O6PA 2AK4D 3DOHA 1RJYA 5DSCA 2N56A 1CYWA 3HCVB 4OLWL 2JFCA 4MLIA 2FJHB 3LNIA 5L2KD 1LDSA 2H8PA 1DFBL 4XMXA 1OAYL 4XNMA 3SPJA 4KO9A 4ZX3A 4TQIA 5IOPB 3ZE1E 1MCKA 4RZCB 1QSEE 5I8KL 3FT9A 1SDAB 2P7TA 2V33A 3DHUA 4OIIL 3MNWA 4R3SB 1XIWB 1N5YL 1PYWB 5JHLL 2A83A 5DZOA 3VFNA 5C97A 4RETB 1DBJL 1YQVH 3VGFA 4YIQA 1GOGA 2CKNA 4K7FB 5D5MA 5TGBA 5CBEA 3GMPB 1NKRA 3EYFA 4FXGC 2QQLH 4X4ME 3IU4H 2CDFA 5D1ZI 1AG0A 1QRND 1ZAGA 3MSPA 2UXFA 3MRKB 2YAEA 5IEHB 4P4RB 2QVFB 4RSYA 2FGWL 2E4TA 5BS0E 1HL9A 2W0FA 2ED8A 4NQSA 3D3VA 3WELA 1KPRA 4OJDH 4HA1A 2F5AH 2P42B 5I2IB 4U1JA 4ALAH 1UOVA 1IKFH 3I6KA 3OQ3B 3HPJA 3A47A 2L7UA 5DRZA 3QQXA 5GJSH 3TBSB 4PJBF 3WXVH 4CBZA 4YGVB 3U0TB 4YO0A 1J5OH 3FK3A 3IDXH 3JVFC 4HFWB 4DN4H 4HU8A 4JANA 5G2NA 1MH5A 1PFOA 5FM4A 5D9SB 3VDCA 3DV6A 3WJLA 2HVKB 3KS0J 3BPCB 3AWEA 5DJAB 1HNGA 2I9LA 2GHWB 1KLGB 4ZMTA 1U2YA 4BFBD 3NYKA 4M43L 4Q6IC 2ZUSA 3BZFB 4NZFA 3NCYP 3T0AA 3QWRD 5SWZA 2H1PL 3NJXA 3KBPA 1DN0B 2XN9E 4XCNA 1LTXA 3VQMA 4PJEB 3UAJC 5HHXH 1ZHKB 2V7NB 2F68X 1JP5A 3HC4L 5C6PB 4Y9EA 4UDUA 2DYPD 2OMYA 5FX3A 1CGYA 1UADC 3BAEL 4Z3GA 1DBMH 3MUZ1 3GBNH 5IG7B 2C9XA 3RPKA 5KSVA 5FA3A 1A9EA 2XQ0A 4XE0A 1SY6L 1NCCL 3FFCB 3KZ8A 2VMJA 1CF8H 4JFPB 1FE8H 3ZVVA 5T3ZL 2VDMB 3RVUC 4QAWA 2OZNA 1TTFA 4L37B 4X9IA 5EG6C 3OGOE 4NRYB 5T1DL 2RCSL 2QADD 5HHPB 4X6CB 3RGVB 4CC4A 1CLOL 2ITCA 4Q97A 2V8MA 1BEYL 1DJYA 1NC2A 2OXGA 1YEDA 4G8GA 4DK5A 4DTGH 1OAZH 1LEKA 2BFGA 1WFIA 1AD9A 4W9HC 3AXIA 3LTVA 4PJIA 1WGVA 2Y7OA 1JFQL 1UFGA 1MJ7H 4G6ML 3CU1A 3FOLB 1VFUA 1RK1A 2NNFA 4HHGA 3H42L 5JXED 5E9NA 4NUJB 1ACYH 2QQNH 2VH5L 4F5CE 1VACB 3SHSA 2BW5A 1JTTA 3WJJA 3BVNA 3IGKA 1LMIA 1KYDA 4H1LA 3NCFB 4NO5B 1IM9D 5EU6D 1XF1A 1G7MA 1XAUA 3DGCR 1PZBA 2WSKA 1HINL 3KL0A 1O9VA 2R2BA 4HW6A 4KI5D 4N2EA 3UPRB 2A9MH 2R2EA 3SJVA 3JT0A 3OWEA 1ZCRA 4AITA 1MZZA 3GLDA 3I9GL 1LYQA 1UKTA 3LAFA 4IW4C 5GZOC 4FL4C 5GS2H 1AG6A 2WNWA 1AI1H 1M05A 1NGYA 4TRPH 3ZMEA 2VDKL 4C55A 4Z77B 3PCYA 4DKAA 5J1AA 3T6ZA 1ROWA 3CLWA 5EEXA 3AITA 2QSCH 1BIHA 3HBQA 1BV8A 1OSYA 2MOQA 4BZ2H 3U2SA 2ITDB 3UBXI 4CN1A 4YOKA 4HCFA 3LEYH 1VZGA 1IQWL 5HHME 3T8VA 4H25A 1LP9F 3KJ6L 4AIZB 2V5SA 1JDDA 4N5EC 1CFVH 3RQ3A 4FNSA 4QRRE 2YRBA 4YUEH 4PGEB 1KBBA 1QSZA 5HD8C 2AXGB 2WINA 4TNFA 4H13C 1R9FA 2VSKB 3RKPA 3A67L 1FZMA 2NQCA 2YQ2A 1TEGA 1SVZA 1WIUA 5CINH 2D4FA 3TVMD 3ZZ1A 1S7RA 3L1OH 5CO1A 3FTUA 4PLKD 3N0PB 1ID2A 3PAUA 1R33A 4LGPB 3QHZH 3QJRB 1A1OA 3T3ME 1LO0H 4NAJA 3HG4A 4OJCA 4NZDA 4KDTA 3FPXA 3SD2A 1CBJA 1G43A 1M6UA 4FLHA 2WIIA 3REVB 2QADB 2VRAA 3S37X 3PDOA 3PDGA 5KYWB 3ZDZF 4RISH 1ZGLP 2RA1A 1OGAE 4FZEL 2D0FA 1XR8A 2ODHA 3DO7B 2X4QA 3EDFA 3PWJA 3IXTB 3EGSB 5BMFH 3WTUA 3ESPA 4MMYB 4F8LA 1X7QA 3CFKA 2G9HB 3ATAA 4X9BA 3HI5L 3L1FA 2GFBA 2X6CA 1BX2B 3S36X 3O6MH 4YHIB 4KK8C 5JPMB 2IANE 5F3BA 2X9YA 3OZLA 3PWPD 5K9QG 1UOKA 5FB8B 3GSUB 4JKPL 1A3RH 2YD8A 1A64A 4BIKA 2WNGA 3KWWB 3BUQA 4WW2B 1G7PB 2BCKA 4N2AA 15C8L 4DP1X 2H2PC 4HUNB 3RNQA 3UZEA 1TLKA 3DUSB 5MP6H 2Y5EA 2NX5A 2EDDA 3BUTA 4BK5C 1S7WA 5DJYA 3BH8A 4Z95L 2FYYA 4FN0A 1H0DA 5EBLA 4PRBA 8FABB 2GI0A 3B9KB 1OGTA 2H32B 1GVIA 3FC8A 4K94L 5JHAA 4FA8A 3V52L 1V3MA 5C2UB 2H0JA 2WLIB 4E9SA 2NNXA 4KXBA 2H45A 5AQ0A 3ZTEA 1HSBB 4NHCL 3OKOA 4G7QB 2QMJA 1NFIA 2X87A 5C0DB 1KJ2H 4Y2DB 3TVMB 4N3TA 4YWGL 4I5BA 4I3RH 4NB7A 4HIPA 1GCFA 4KFZC 5C07E 5HYQB 2ZYHA 3WEBA 3ARSA 4XVJL 3AFLA 3QHFH 3D33A 3KGUA 4UBDD 5CAYB 1LWHA 1JV5B 5E2VH 1SFHA 4N8VB 1JZEA 1IC4L 4P2AA 5KVEE 4HX1A 3BQUB 1I1YB 2FE0A 3SDAC 2RIKA 4P2YA 1MHHA 2ZCZA 3H7BB 3VVWA 3I6SA 4AG4L 4KNTA 5HPMB 2A6JA 3OPZL 3RDTA 4N24A 5FR3A 2M1KA 3ET9F 2QR0A 1FIEA 3ARFC 3EZJB 5FUOH 4EZMA 3FSAA 1NUNB 4QCIA 2ZX7A 3WFCH 1H3PL 2VN4A 1MCPH 3B7YA 4NJ9L 1W0WB 2DEXX 3SQRA 1E65A 3LH8A 3Q8AA 2DLTA 2DY2A 1JWMA 4YSOA 1XCQA 4O2FB 5GSRB 2PCPA 3OKMB 2CGRL 4NCDA 2WUBL 4K23H 2J5WA 2AANA 1WZLA 2H9GA 4JZJB 4R5XA 1WUZA 3RGBA 3DSNA 3ZKND 4F33A 1S5IH 1UGNA 4LMQI 4OSUH 4OCWL 4YBQC 5HXMA 3BT2L 2G2PA 3NACL 5FWQA 2A6KA 4WUUE 3FO9A 1IE5A 3S3SA 3VX0A 3JWNH 1E2VA 2O5ZH 1T5XA 2GK0A 3DV4A 1ADQL 1UXWB 3HS8A 4X2UA 1JYNA 4GAFB 3VFGH 2ARJA 4EDWH 4XX5A 4O4YL 4ODWB 3LKSA 3A6BL 2HFGH 4PN6A 4APQD 3U0PB 1U30A 5TDNA 4EVNA 2Y25A 4KK6C 4BWWA 3KLHD 4K3DH 2C5DC 4NP9A 4M1GL 1BOGA 2ZONA 3IPEA 1NLBL 1GAFL 2CO7B 4ZUVA 4NN7C 3VFMB 2HKFL 2ISDA 1I8KA 4PBVC 4B27A 4AYFA 4YSEA 1KCRH 1UFUA 3DX6A 3WTYA 2XDHA 2W07A 1TO5A 3APFA 5DYOB 4LLDB 1I8MB 3WU1A 1UATA 2D3NA 4Z0XA 1M9SA 4TSAL 1PZUB 1AO7E 3RIAF 3GRGA 5KTEH 2NZ1A 2X70A 1D5BB 1QTYT 2AFNA 2FIKB 5I1EL 1AYOA 4IQHA 4UOQA 2H26A 2VJ8A 4H20H 2A99A 1E27A 4BEIA 1UZGA 5INCA 3BIKA 3EOYG 1WISA 3UBFA 1F3DH 3PGCB 3KPSA 2BY2A 1NCOA 5I17B 2OS7A 1L5GA 2EZ0D 2EYRB 3FO0L 4YFDB 5DZNA 3ECBB 4KK9C 4J3WA 4Z7VE 4ZUWA 5FKAB 4Q9RH 1OTSC 1ORSB 2ZG3A 1JHLH 3KM2A 1WAAA 2AJXH 3MLYL 3W39A 1HL8A 1RU9H 2ZOKB 1IGMH 1KDJA 2CBQA 4I77L 4P5RA 4XPTH 1K8IB 4XVSH 3JVGC 2AI0H 5FYLH 4E0RA 4L1TA 4GKNB 4HWBA 4JB9H 5SX5H 2EIZB 3NSJA 3WHXB 2CRIA 4FS0A 4R97C 1L9RA 3OD3A 5HGGS 2X7LB 3T77A 3KYMA 4NT6A 4XP1H 3LRSA 3ZDWA 3QG6A 4TUKH 3CSYA 3CMOL 3K6SB 3DJ9A 1WTGT 4YHKL 4LRNL 1NAMA 1J1XL 1UZ6E 3L17A 1NKGA 1FL3A 1A6VL 5DWUL 5F6IC 1E50A 3BEWB 5ENWA 3MXVL 5AYUH 4FYRA 4WI0A 5E8OB 2K3HA 3SE9L 3PABB 3E6FB 4RMBA 4M5SA 1IGTB 3GK8L 1RL1A 4HHAB 4XCYB 4APQB 1ACXA 3BYYA 5KVFE 5FGBC 1PCXA 3CJJA 3L4CA 5E8DL 1G1YA 1Y1UA 2WW8A 4Y1TA 2OI9C 4OF7A 1FN4B 1W0YT 2AQ3A 5D1XA 1CXFA 4PJXE 4XWOD 4M93C 5CZKA 1JERA 1SQ2N 4NZRH 2CRMA 3QRGH 3GBML 4WDIB 2O61B 1F18A 4MDJB 4Y4FA 5FYJH 2DWEA 4QRFA 2X6MA 3C87A 1U95A 1H3VA 3GTTA 2BOBB 3QDGD 3AW5A 2FT6A 1J12A 4LLQB 3U4EA 1FZJB 1A1MB 2IJ0C 3TL5A 4OCMC 1F13A 1IAMA 3Q1SH 3V4VH 4BFOA 4YE4L 1XR9B 5LBVA 3T1FB 1XX9C 5FW6A 4M5YH 1BZEA 5EIIA 4B9CA 1UXSA 2NRDA 3VWKB 1ZE3C 2F54D 2YPVA 1HYRC 3AQXA 2EICA 3IJHB 4ODVL 3FN0H 1AANA 1TNMA 1QSFD 3KXFB 4MCYB 5B1BB 3OBAA 4QOKA 5EO0A 4G9DB 4NKDA 3BW9B 4JMNA 3UTTB 4BQ6A 2B1OA 3QFDB 3MBWB 3LPWA 1WD8A 2WUCL 4CVZB 5DR5H 5C0GA 3S88L 3W0WB 1VJSA 4MA3A 3L2NA 4M1CD 3IMVA 1SUJA 1XGTA 3VFTA 1HNYA 2VLLA 1TYRA 3O11A 4CJ1A 1IO4C 3N06B 4GBXD 1N3NB 2I5YH 1K9TA 1FVCA 2C3GA 4G11A 1CGSL 1O6SA 2B0SL 3K46A 5EUKA 3BAIA 1EGJL 4HOWA 4F92B 5DJ0A 1AR2A 1JZHA 4ZAKD 2R1YB 3V4PH 2KS0A 3BWAA 4LIQH 1ZV2A 2QGBA 3E9TA 3N91A 5DRNB 1D6EB 1S9YA 4UF7C 5DJDA 1E7UA 2UY6A 5D2NE 3K2UH 3ZQXA 2QADC 2JTYA 1GIGL 2YEZB 4O02L 3NMEA 4IMLB 4XE5B 4XMKH 1KCLA 1RLBA 4JRYE 1CD1A 1EDYA 1XGQB 1TJIL 1Y0LB 1FFRA 3ZZLA 1MFEL 4TXVB 1KGXA 5MENA 1GZPB 4F8QA 4MMXC 1WBZB 2MEJB 5EOTA 2QT6A 3P3UA 2XTJD 3EF4A 5ILTL 1QASA 4X0KA 3MFFA 2BIIA 5JXEC 5C0EA 4DZBB 3TF7C 4UWQB 3RA7L 3A0OA 4YSQA 1FO0A 4WU7A 3UTOA 2P5ED 1CFNA 4N2KA 2IXQB 5IGXH 4ES8A 2YXMA 3SGJC 5BUAA 1HE7A 5C09D 2QL1A 1PBYA 3MJ7B 3K71A 2CIKB 1NIAA 3KLAA 4NCC2 5HHVL 4KI5C 2Z0BA 3V7MA 5I1AA 1DQLH 2D7QA 3L6FA 4HH9B 4LPXA 5EIVA 2VKWA 3KYOA 1MY7A 1AY1H 3R06B 4OB5L 2RJMA 2DLGA 2JB6B 3MRIB 3TFBA 2MTAA 1G84A 4FJ6A 2GEQA 4ZMZA 1X5XA 1U4FA 2QTEA 2ZXAA 3QEGH 4V11A 2JB5H 5I82A 4JFXB 2YK1L 4YDVB 3HI6H 3FQTA 4M8UA 1CR9H 2VZOA 3FHEA 2G5UA 4JLRA 5E8NB 1LWJA 4B9JA 5C08E 3WV0A 2EKSB 2V2WA 3H3PL 4A6YH 3F7YB 3I6LD 4YLBA 1JJUA 12E8L 5DDHA 5AUMB 3QJOA 4YEEA 5EPMA 5BRZE 4LSPL 4C59B 4NLHA 4MD0B 4RX4A 4CU8A 4ZTOH 3TVMC 3ZL4H 1J0KA 4PRHE 1FA4A 4PLKC 1V5JA 1HH9B 2FH8A 4MJID 2FO4B 4RA3A 4XR8C 4ZO6A 4ZFOB 3SDAA 2JCCE 4HQQL 1WV7T 1CDJA 5E5RB 1F45A 3CVHA 3J7HA 3TZVD 4YAQB 2GIYA 4G1EB 3DLQR 1LE9A 4FYTA 4J3XA 4LP8A 5IQ9B 5HGAA 3ARFA 4E42B 2KQNA 2XOTA 2GEEA 1YEWA 2H3NB 4AQ1C 1FFOB 4X7TB 4GG8A 2XTJB 2X41A 3T04D 1QLEH 4NKOB 5HI4D 4EE2A 3O9WA 1MLBB 3PPSA 4UYQA 3WXWH 5LN4A 4DP9X 3GZQA 3WUWB 3GKWL 1I82A 3L95A 1YZZA 2BNRB 3G9AB 3GJEB 2IV9A 2WLMA 3HCVA 3WNIA 2FJHA 4JY5L 5CUSL 4B9ZA 2D03L 4KV5F 3V7AE 3WBDA 2ZF9A 1IM3B 1DL7L 3GDBA 2BSCA 2W9LA 2WXIA 1BZDA 5EZLA 1IEBB 3CNKA 5IOPA 5HYFA 4RZCA 4RSVA 1DQMH 3OKYA 2VLKE 3ORJA 4R3SA 4KI5F 1XIWA 3A6CH 1PYWA 2OYLA 4AQOA 2B3IA 3RAJL 2WWOA 3I9AA 5AZUA 2ZCLH 4BM7A 1A9VA 4K7FA 1BAFL 1H15B 4LPUA 4RLDA 1SXSA 3GMPA 3TBCA 5JMRA 2NSMA 4BZYA 1B0WA 2VT0A 2N7BA 2X9ZA 3TLRA 4Z7WE 1CWVA 1C7TA 2G60H 4KTYA 3OAUH 4TOYH 1B4TA 2D3LA 1MCWM 1SFDA 4WK4B 4XPAH 1KN4H 3KYNB 3ZPDA 5HVWA 1JZ2A 3MRKA 1R5WB 3QZNA 2HCZX 5IEHA 3GB7B 4P4RA 4MJIB 2IDFA 1HOEA 1KG0B 2KT6A 4PBDA 4X8JB 4UBDC 4OW6A 5I2IA 3OJDB 2P5WD 4WJKB 5EF2A 1HK6A 4DKTA 1LK3H 1YYCA 2IQ9L 3GO1L 3QCUH 1GS6X 1FL6B 2W59A 2ZUVA 4LEXH 4KOCA 3TBSA 4YGVA 3U0TA 1KY7A 4HFWA 3STZB 3SDCD 3OV6A 1KJ2B 5D9SA 2A1WL 4ENED 1DJIA 4MXWL 2HVKA 1KNOA 3BPCA 2WJ7A 3JYCA 1YNLH 5DJAA 1IFHL 2XWEA 3UJTL 3ZYJA 1KLGA 1LO3H 4PD4J 1TLMA 2X3CA 3BZFA 3BCFA 4BHUI 3JVGA 1JTOA 2EVGA 3JWOC 4M3HA 2YLHA 1DN0A 4EN3B 1XEUA 4N87A 3TBYB 2K8MA 5ITBH 3GXIA 4PJEA 3T8MA 2EJ1A 1ZHKA 2V7NA 2E6QA 2HX7A 3QORD 3U2JA 3BUPA 1JHKL 4XBPB 3ZKNC 3RPIB 2HRPH 1T89C 1UA6H 2QLYA 2GG1A 5CN1A 5IG7A 2OZ4A 3RZCD 2VXVL 4UZGA 5L4JA 3S2CA 2A2QT 4LVNC 4KMQA 3FFCA 1D5MB 4NC2B 2WCSA 2Y7LA 1YEHL 4JFPA 2XYCA 2FB4H 3UBXG 4PJ7E 3F62A 3BO8B 4DVRL 1QBBA 3D0VB 4L37A 4A68A 2XX1A 4K7PY 2DPKA 1CIUA 1HXYB 1SXCA 2YD0A 4CKQA 3IAQA 3RGVA 4X6CA 5HHPA 1VZHA 4YHZH 4NUGH 4APQC 5LGKA 3MV8B 5AB9A 3ETTA 2Q86B 4FQXB 4Q9QH 3KLHC 2XV0A 1CD8A 4TPRH 3DECA 4MZ3A 4NC0B 1J0HA 1SXBA 3HOGA 4YDLB 1MIEL 1BQLL 3FOLA 4UTAL 4ZJ9A 1OE2A 2D7NA 3LIUA 4NUJA 3SDYH 2DZEA 1JVLA 3Q5OA 1VACA 2SODB 5CEZH 3BESR 3RIFK 4NO5A 4PB9H 3IMSA 3PU7A 3QIBD 3MRPB 3UPRA 2CKBL 4QUOA 1ODUA 4FHJA 3CWGA 3ECWA 4E5XB 1P6WA 3SDCB 4XP4H 1KCVH 3FF7A 3QXUA 5IW3A 5I1KH 4HKJB 4GSQA 3FU3A 4YHML 4GRLD 4HG4J 2NYYD 2X09A 3FUDA 5DA4A 5I19H 4LVHC 4Z77A 3F01A 1HS6A 5BZWA 3MRLB 5IMKB 2IV8A 2EZ0C 5EO1B 3BKJH 4NC1E 3QWRA 4AE0A 2ITDA 3AG2B 5D7LE 3LH2H 3SODB 4IRJD 1A7OL 4XXCC 4AIZA 1E3ZA 2VDLL 4S1QL 4TVPE 1HIML 1UEYA 4PWJA 3CX2A 4PGEA 3AAZB 2M8XA 4P46D 2AXGA 1G1OA 5CF3A 1P6AB 4FQLL 1R46A 1EHLH 3BVDB 4Q58C 1IGCL 1O6TA 1H3WM 2G9KA 2APBA 1N7ML 2J72A 4W81A 4KXZI 3VD5A 1K6QL 4R96A 2Z4QB 4FG2A 1UURA 4MHHI 5IKCB 3B34A 4TUOB 2IG2L 2YD9A 2VDQH 4AVHA 3REVA 4X7CC 5H2BB 3DXAE 1JZ5A 1BPVA 1CGXA 5L2JA 5KYWA 1A7QL 1JXFA 2FBOJ 1MPAH 3ZRFC 5I6NA 3DO7A 3E2HC 3IXTA 3FUMA 3NZUA 3EGSA 3P4MA 4OBSA 4MMYA 2J73A 4AMKL 2DYRB 3WNNA 2G9HA 1DN2A 3IS1X 4A2LA 3WS6C 1XB6A 4LVOB 5JXEA 2HRHA 5DQ9B 1NC4D 2R0LL 4X4KA 3WY4A 3RWHA 4NERA 4G82A 4XWOC 1BX2A 1KEGL 4YHIA 4F1SA 3IRZA 3SGJA 2CLRB 1FDLL 2Z92A 3ZYIA 5JPMA 5EU6A 4AW7A 4KXAA 4GQQA 5JYMA 5FB8A 1NIDA 3GSUA 4OF8A 4LNVA 2EDMA 3L08A 3QUYB 3QZWB 4JBSA 3KWWA 1DLHB 3O6LL 4WW2A 1G7PA 2J6EL 1X5YA 5IV2B 3DUSA 3ARQA 4X6DE 4CDGC 4YBHA 3P4OB 3VACA 8FABA 1MZYA 2DEYX 2EIJB 2Q7YB 2D9CA 2LU3A 2QEJA 2Y22A 3B9KA 4W6YB 3DBXB 2H32A 2E9IA 1VZIA 1DJXA 2JKTM 1N9PA 5KZCB 2WLIA 4CKVX 4KI1A 4DFIA 2CLZB 2GK2A 1V3LA 3U6XS 2XWTB 3V79C 1C1EH 3LQAL 5FF6B 1HSBA 5I8EB 4H8WH 4GRWH 4JN2B 3GJFB 3K6DA 4M1CC 5C0DA 1SQMA 1P69B 4BZ1H 1HJCA 3V4VB 4Y2DA 2BS71 3CD4A 3KD4A 3TVMA 3N1FC 2EE6A 4P59L 5TFSH 3Q8EA 5DC0A 5HYQA 5I28A 2ZG2A 3FRPB 4GBXC 1GC1L 3ZOAA 4HCGA 2BHZA 4TUJA 3LHPH 3OC5A 4M5ZL 1JV5A 4XCFH 2ZOWA 2J71A 4N8VA 4JGUA 1Z9LA 1PG7L 3BQUA 4PLNC 4ZOAA 1ET7A 2BZCA 3IEAA 3H7BA 4NQDD 1JHTB 2QSQA 1YY8B 2GJ6D 3QP3A 3AMLA 3INOA 2B59B 4FX5A 1OOWA 4JVWA 5C70A 5ETUB 5DRXB 1IAOB 4QAMB 1BFTA 3SKNA 2EIDA 2R29H 3DI2B 4B9IA 1W0WA 4P2RB 2VQTA 4KX9A 5EEUA 3KEHA 2XTJC 3CU7A 5GSRA 4UOW1 3NEOA 4O2FA 5GRJH 3OKMA 3HRZB 4K7PL 3TYGL 4Y7MA 3FT2A 5L4IA 1CDUA 3R1GL 2OPCA 2YO3A 3PYCA 2DEWX 3TJHD 3V0FA 4JZJA 3RUGF 4PRIB 1GHFL 3P02A 4NEHB 3GZPA 3H2QA 2Z65C 2OR9H 2XQBL 5I1IL 4S1RH 5D7KD 2A5UA 1ZRUA 2DV6A 1FBIH 1TFPA 4HIEB 3W5NA 4HIHB 4HJJL 5ADPH 2IPKB 1KACB 1CPUA 5EBWB 3D5OF 3KMDA 4FFYH 3IF1B 5JIHA 1L6ZA 3ECVA 2EDFA 1U6AL 4G42B 1UXWA 5G4MA 1RURL 1OCRB 2QHRH 2NSXA 4W9KC 2YZ8A 4F7MB 4NRZB 3VH8B 4ODWA 4RZKA 2D0GA 1I3RB 2V5RA 3U0PA 1T5KA 4GJTB 2HT3D 5CJ5A 4EIGB 3MTRA 2NY7L 4HWUA 3UFIA 43CAB 3HMXH 1PY4A 2WLZA 2CO7A 1XH0A 5C0CB 3VFMA 4M8QB 2XKUA 1XB8A 4BH7B 1W9XA 5F6HI 3KLKA 5JW3L 5DYOA 5F9JB 4ZNCD 4NQED 4LLDA 1I8MA 5I8CB 1OVZA 2CHNA 2FHFA 1BPLB 3VFRB 3NQKA 2YQBA 1NINA 2OYPA 3RNKB 1D5BA 1R6VA 1PMYA 4JHUA 4LSUL 4NFDA 4EUPB 1QEWB 2HG5B 2XVGA 3TZVC 2FIKA 4X5XB 2NW2B 1AMYA 2GJ6B 5E4EB 1MW2A 1TVDA 2KH2B 4X6EB 1MCLA 4NKIH 4YSPA 2ZXWB 4M1DL 2OYKA 3ZYOA 4M3JA 3MGAA 2COQA 4QO1B 4LLYB 3N42B 4GPVA 3RB7A 3PGCA 4I18B 4HULB 2JKNA 2WTOA 3F6JA 5I17A 2EYRA 5DHEA 3ECBA 3RRQA 3WNOA 1IEAB 5FKAA 4UUJB 2V17L 5HI4C 1ORSA 3FMGL 4LSRH 3ULSB 3GHEH 3K0WA 4OT1L 3LNGA 2YJLA 1K8IA 2ICEB 4GT7A 1O5PA 5AZ2L 1T89A 4GKNA 2EIZA 1SHMA 4QIRA 1Z0MA 1PZDA 3WHXA 7FABH 4IBUA 3B2DC 3OKEB 2X7LA 5E99H 4OZHB 5D72L 5DQJA 3HBZA 4BRVA 4EEEA 4Y1SA 5J1SC 3K6SA 3PREA 4N2NA 5D5ME 2Q5BA 3BEWA 1PGRB 1QLEB 3AQZA 3I74A 5D1ZD 3RX7A 1J11A 1HC1A 2QPSA 1NDMA 5E8OA 5DD3H 1O75A 4MB5A 3PABA 3E6FA 4XB3A 2B14A 2HX8A 1IGTA 4EI0A 4HHAA 4XCYA 1DDHB 4APQA 1GY1A 4UT9A 4P9HL 1UXLA 3JT2A 3M86A 3MTXA 2DKMA 3OL2A 4F20A 3KWXA 4Z7UF 3D3VE 2X1OA 4Y16D 5PAZA 4ONGH 3ZHNA 2ZSVB 3DRTA 4R7LA 1G7QB 4UQ9A 3TTSA 4A39A 3SIKA 4KMTH 3MV9D 1BD2B 4M8RA 2Z64C 1FN4A 1OB1B 4WDIA 2O61A 2WWNA 3VQLA 4MDJA 2OA9A 3BUIA 1MRFL 4KROD 3TT1H 4EOWH 3H53A 2G5BB 4BWTA 4EZKA 3ZGHA 4M9PA 4HS6B 1MCOH 3CGTA 5FYKL 2AGJL 5IEKB 3QJZA 5ISZD 4LLQA 3QNZB 1FZJA 1A1MA 2HSIA 3ES6B 3KH3A 5BQDA 1HHIB 2X2JA 1U3ZA 3VMNA 1AZBA 1XR9A 2FWUA 3SDCC 2A73B 3T1FA 3MLWL 3VWKA 4ENEC 3RY6C 3UAFA 3C09B 1TJHL 3IJHA 4WZ9A 5F1NB 5DJCB 4XN4A 4E41E 2J8UB 3KXFA 4K9EL 5C9JB 1EZVY 4YDZA 4G9DA 4UTBH 1WCBB 1TNNA 3A6OA 3BW9A 3UTTA 3TP4A 5HDBE 3QFDA 3MBWA 3UJJL 3ZN6A 2JJWA 4R2GD 4CVZA 4KQ3H 2OJEB 4IKKA 1V7NH 4PS4L 4YHOH 3W0WA 3VXSD 4BUHA 3G5XB 3JZYA 5KS9E 1NCBH 3QORC 1FGNL 1THAA 1YHPA 2VLJD 3U6XA 1JXGA 3G6DL 5J06A 4FMKA 1SBSH 2D2OA 4QGTA 1N3NA 1FV1B 2OL3H 3A24A 2YMTA 5F96L 3RZCC 4KHTH 1E42A 2AMUA 5JOPE 2D7OA 2R1YA 3JV5A 1E5UI 1GMIA 4R7XA 4EF3A 1Z2KA 1TITA 2C4XA 5EF1A 3OX8B 4W6WB 5DRNA 2VW7A 1D6EA 5C1MB 3K6OA 3OZ9H 4PWEA 3TONA 1QFWH 2D0HA 1IIIA 2EE0A 2YEZA 2MCMA 1P7HL 4IMLA 3S5LB 1XGQA 4BUGA 2BJMH 3DKHA 1Y0LA 4MCZB 1JGDB 3KBEA 5T1JA 4RAVB 5EF3A 4FQCH 1GZPA 1MREH 2GHZA 1DVTA 2DYSB 2FK9A 4NGHL 2Z8RA 3CSBA 1ETJA 1UJ3B 4GIOA 2DWTA 4F91B 1Y07A 4JDTL 2ZNWA 2RHEA 4DZBA 3FH8A 1DBKL 1W8OA 3EYUH 2R4SL 2IXQA 2EIEA 1MCIA 4R26H 1F1GA 5IB2B 5MEOB 2IALB 3QK0A 4K94C 3QR1A 4ZT1A 2IOMA 4S2SB 1PQZB 3QIBC 1DSFL 3MJ7A 2CIKA 5HHOE 1NEUA 4HH9A 4A66A 3L54A 1E4HA 1YEIH 3H9SE 3R06A 4PRPD 3JWDL 5K9KB 5CEYB 1PD6A 2CO1A 2JB6A 4GRLC 3MRIA 4JFDE 3ZYZA 2NYYC 1F3DJ 5BJTB 4ZSOB 1I53A 3SDDB 4WI5A 1TVHB 3SYAA 1A4JB 3F58L 4UINH 1YQ2A 3SQOH 2FD6L 4X7EC 3HE6B 2MCPH 4J3OF 4JFXA 4YDVA 3L3HB 4PLJC 1NCHA 5E8NA 3MXWL 3VXSB 4ZD3H 4IRJC 5DMYA 5D6CB 4P04A 4GIPD 5AKRA 1AXIB 2EKSA 1GGBH 5IFHH 3F7YA 1BBJB 4YVNA 3B8SA 5EU7E 2HH0L 5AUMA 5PCYA 5TF1H 4P46C 4XP5L 4RDQG 4FOMA 1CDIA 4BSWB 5L9DH 1UUNA 4MD0A 3BD3A 1Y6MR 2ZG1A 3QZMA 3FKUS 1AQMA 3X1GA 1G4RA 1HH9A 2FO4A 4ZFOA 5BZDB 3N41B 4P5TB 4JRWA 4BZ2A 1CBVH 2FEDD 2ZUQB 4Y2OB 3L48A 4AL8C 2QV2A 4YAQA 1G7IA 1RZKH 1PLGH 3DK0A 5FCUL 4G1EA 4JHAH 3D0LA 3GI9L 1CU4L 1WBYA 3ARYA 5IQ9A 5A43C 3KPQB 4MZRA 5JHDD 4E42A 3SBPA 2H3NA 1RIVH 1AJ7H 1KV7A 1WDAA 4TLSA 1FFOA 4HF5H 4L5FH 1AGDB 1NEPA 2X10A 2D7TH 3ELQA 4UV4L 4X7TA 5IVXB 1H5BC 3GBLA 1DSYA 2Z1PA 3CVCA 4GMSL 2IGFL 4NKOA 2VGLM 4Q4EA 4ZXBB 5KVGH 2W9EH 1E3FA 2A77L 3P40A 3VMOA 4IBWA 2HTLD 2DD8L 3PL6D 5F9WC 1F11B 3WUWA 4PRAB 4U7SA 4ABUA 5IUCA 4Q0XL 2RAMA 2R39A 1UACL 2NX5E 4IOSD 6CGTA 5J89A 3GJEA 4Z23A 2WCGA 1TXKA 2FEJA 2WZ6A 1NCUA 3NRPA 1BVLA 2IQAB 1IM3A 3CXHK 3KPNB 3KGRA 3AADB 1LL1A 1FL5B 1IEBA 2R51A 3CFCH 3LDBB 1JZGA 2AJYH 3J07A 1A2YB 4Z7UA 1EO5A 3MLSH 1LQBC 1X5HA 4ERSL 3AT0A 2BVOB 4LHUD 4OH2A 3SE3C 1A0QL 2WQVA 3MCG1 4H2CA 4TQEL 3UZQB 3PIQB 4JGNA 5AW7B 1Z9SB 1H15A 2YMXH 4HMDA 4PJBE 2JKIS 4NNXB 3TWCH 3C60B 4DP6X 5HVHC 1QOKA 2F53B 3BVUA 4ODUA 4G70B 1HCYA 1CI3M 4KO7A 1A3QA 5CD3B 2FJSA 4P23B 1R5WA 1EAJA 3L8QA 4GB9A 1XF2B 1KIRB 3N1MC 1CXIA 3GB7A 2J88H 4MJIA 5LGHH 1DBAL 3VA6A 2J1YA 1KG0A 4I0PD 4UU9B 3GBDA 4X8JA 3IDUA 4Z6AT 1T7ZA 4UM8B 3BJ91 5DEZA 3OJDA 5GQBA 2QQKL 2PUQT 3DGGA 4XRCB 3IWVA 4KTEL 1FL6A 4R7DB 1A7NL 5B7MA 5KVDH 1A7PH 4JFHE 5CGMA 1YEFL 5FECB 3MRDB 4HUXB 4JQXC 4FD0A 4GRWB 3ROLB 3STZA 4FQ2L 5FGSA 5B38A 5DHVH 1KJ2A 3MUY1 4P3WA 3FO1A 4RFOL 3NP3A 2J3SA 4MQ7B 5HYJB 2P9RA 1B2WH 1KCUH 3M46A 4X4ZA 1N18A 4F58L 1OV8A 1EWHA 2E27H 1M9WA 4EN3A 3TBYA 2ENQA 1NCAL 3IDGB 3MJ8B 3TJHC 1P84J 1WZ1H 3BD4A 4I1NB 3MUJA 2F19L 3QT2A 4XBPA 1AD0B 3VGGA 4L8SB 4CDHA 1J05B 3E3QC 1J8HB 1EJ8A 3MOBL 5EEVA 3WKNA 2OSXA 1PX4A 1JZ8A 1BP3B 2JJVA 4IGBB 2PR4H 1AIFB 4QHPA 3MUHL 4JPKL 1D5MA 4DGUA 1FP5A 5GRVL 1GGIL 1Z5YD 1ZA6B 4LHUB 4PY8I 4K3EH 3BO8A 3FB7B 4OIIH 3D0VA 5F2FA 2CK0L 5CP7B 2AXHA 3HNVL 1HXYA 5DMGD 2CKBB 1EZLA 3VSUA 1KB9K 2UXGA 4HK0B 2MJWA 3MV8A 2HT3C 2Q86A 4FQXA 2JELL 1ZLSH 1OM3L 4PCTA 4X6FB 4BK4A 2XPZA 1ONQB 2O26U 5GZND 1CE1L 3L9RA 1OSPL 3FTSA 2Y7QB 3K2MC 4RWYL 4TQHA 3LPPA 1G6RL 1SNRA 4OGXH 3VFUB 1WZMA 4LU5L 3RGHA 2DI8A 2DDQH 4HXAL 3AU0A 4JRXE 2ICCA 2GSMB 4K73A 5HYSG 1LP9E 3N9GH 4Y9BA 3EUUA 1HSAB 2OMZB 1I7TB 4V1DE 4J6RH 3V5DB 3MRPA 2BO0A 4GMTH 3VGAB 2VXTH 5I75B 3W5MA 2APXA 4E5XA 4ZMNA 2WTPA 3S37H 4ONOA 3SDCA 3SGEI 3P69A 4HJUA 4LIQE 1BZ7B 4P5MB 1A47A 3T08A 4YHPB 5CZRA 2G75B 1I8LA 4KNUA 4HWEL 4MB4A 5INDB 1NJ9B 4EBQH 1OP9A 2UXTA 5FYKU 5CGBA 3LN9A 5D4IA 4WFFE 4E9TA 4FKEA 4TVSa 2OFQA 2EIBA 1CK0L 5IMKA 5EO1A 2RQEA 2XTLA 3C09C 2NW3B 1ET5A 1MF2H 1EERB 4YFLF 3FSOA 5DZLA 4MS6A 3S36H 4LCWD 5HHMD 3GSNL 3ZDZE 1NCIA 2WXMA 4IJTA 2WK2A 1UVQB 3AAZA 2Y1ZA 5DUBB 4XHQA 2VDNL 5LBSH 2XVKA 4WV1C 4LSTL 2RFXB 1V55B 2F1AA 1PKQB 1KIQB 4LDCA 1WITA 3E8UH 4ES9A 1C8QA 4XOCA 4PCYA 1EZVX 3JYBA 4JPSA 1SY6H 3MCYA 2PXYB 2XIDA 1NCCH 4JFUA 4MWFB 2E8YA 4XOAA 5D1ZC 2Z4QA 5DQDL 5JTWA 5IKCA 4LDOB 4TUOA 4HIJA 5H2BA 3V7AG 2X6UA 2F9BT 1CE6B 4ELKA 3ZRCC 1I3GH 4DGVH 1TJGH 2YA2A 3UGUA 3EYSH 2RCSH 3AC0A 3DHPA 1YECL 3L4YA 5I74C 4YHNB 4CILA 2YUVA 4Y16C 3HUJB 2VDRH 1NBVH 1FNSH 4UMSA 5HVFB 5KAQG 3T0BA 3GSWB 3IKCB 2Y06L 3AB0C 4TV3A 5DQ9A 2XRAL 3NGBB 3HNSH 3RG1C 3GRWA 3UTSE 1OK8A 2HFFB 2FBJL 2CLRA 3OQRA 4UIMA 3H42H 4KROC 5GGRY 4AZ8B 3EOAB 2AJVL 2QLVB 3UG5A 4YHYC 3ZTJG 2B08A 1C8PA 1ES0A 3B2VH 1PL3A 5E7BA 4E9VA 2NUTB 4HUVB 2X05A 5GIRA 1BWMA 3QUYA 3QZWA 2WBJB 1DLHA 2YGVA 2YD3A 1RSFA 5EF0A 1FH5H 5IV2A 3MYJA 4GRLA 4QOKE 3GYRA 1WC7B 4K71B 4PBXA 4XZUB 3V0DA 3P4OA 1YDPA 4ORGB 5HHNB 5I73B 3W9EB 2LLLA 5KEZA 1KIUB 4WTZG 5DHMC 4FA6A 2FQDA 2Q7YA 3DRQB 4MAYB 1E9PB 3UTQB 3DBXA 2HJLB 5FM5O 2R4RL 2WVSA 2X38A 2D3JA 5FO9A 3SDDC 4LCCC 3BI9X 3R7RA 2R69L 2CLZA 3AU1B 4U2YA 2ADFL 2XWTA 2ZXEB 1MW1A 2XHNA 5FF6A 2DQGL 4R2GC 4P46A 5I8EA 3S4SG 4AEIL 1O7DC 1UHVA 2FATH 2F7PA 4NN5B 2VERA 5D70H 4JN2A 3GJFA 3B9VA 2YQGA 4PMEA 4XMWA 3BOVA 4ZS7L 4PJCB 4PJAF 4PP2B 3O45B 1L6XA 3FRPA 3A67H 4GXFA 5EBMB 1P4BH 1F41A 5C07D 2YHGA 4GIAA 5DZAA 4YR6B 5TE7H 3MDJA 5B39B 1H6UA 3W56A 5CCJA 1QBLL 1EK3A 2C9SA 1JHTA 2WYTA 4JG5A 5I1JL 4G7YL 5D2LB 1AIZA 5FPIA 3MNDA 2B59A 4HJIA 5ETUA 5DRXA 1IAOA 4OV5B 3KL3A 1XGUA 2QDVA 2R0WL 4F3FB 5EV7A 2OL3B 4LEOB 4MJJA 4GAAA 4NZUL 4P2RA 1WO2A 5FV1L 2BHUA 5FUCC 4QXGL 4O9HH 3X1FA 4QWWD 2BHYA 3ZBMA 2BRQA 3HRZA 2EC9U 1W15A 4B50A 2FH6A 2BIOA 2P45B 4PRDB 3GXNA 4DESA 1M1SA 1A8ZA 1ZLEA 1GW6A 3MV7B 4FQ1H 4YMPA 3D30A 3EFDL 1C5CH 1KXQA 3ESOA 2DQCH 2CUMA 3FTGB 4YSCA 1BVNT 3FAWA 2NMSA 3MBXH 2QGDA 4HIEA 4CMHC 1EJOH 2D31B 2HVJB 4JO1L 4B60A 4HIHA 4XMPL 4YJZL 2IPKA 1GW0A 4U4IA 5LWYL 3LKPB 2GBVA 4XP6L 5FUZL 4FI8A 5EBWA 2H7WA 3IF1A 1HH6B 1EAPB 2FX9L 1UC6A 4H5SB 2LAGB 1JPTH 1PAMA 1DEEB 1A7RH 4G42A 1RZFL 4QYOB 4CVUA 3ZO9A 4YS4A 4N0CD 4QXUL 2C9UA 3NUKA 1ZHBB 2F5BH 4UIKH 5C0AD 2AQPA 4F7MA 1M42A 4NRZA 2CRYA 3SE8H 3VH8A 3V52H 4A2HA 3MRNB 3QE5A 4OKVB 1I3RA 1ITCA 3VXMD