5JQIB

Crystal structure of fimh a62s from e. coli uti89 bound to fimg n-terminal extension
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
279
structure length
277
Chain Sequence
FACKTANGTAIPIGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolutionary fine-tuning of conformational ensembles in FimH during host-pathogen interactions.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
molecule tags Sugar binding protein
molecule keywords FimG N-terminal extension
total genus 58
structure length 277
sequence length 279
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB02
3ZL1A 4CSTA 5CGBA 4AUJA 4AVIA 5AAPA 4BUQA 2WMPB 4XOBA 4AUUA 5JQIB 5F2FA 2JTYA 3BWUF 2VCOA 4XOCA 5FLUA 4X5QA 4AV4A 5LNGA 5FX3A 3ZPDA 5F3FA 2UY6B 1QUNB 3MCYA 4CA4A 2XG4B 4J3OH 5AALA 5IQMA 5IQOA 2JMRA 5AB1A 1TR7A 1KLFB 3BFWA 4XOEA 3SQBB 4X5RA 2UY7B 2XG5B 4LOVA 4X50A 4AV5A 1UWFA 5FS5A 1N12A 3BFQG 4ATTA 5ABZA 4AUYA 1PDKB 4AVHA 3JWNG 5FWRA 1ZE3H 3JWNE 3ZL2A 2J2ZB 4XO8A 4J3OG 5IQNA 3JWNH 4AVJA 3ME0B 2W07B 4J3OF 3RFZA 4X5PA 1N0LB 4XOAA 4XODA 4AVKA 4AV0A 4CSSA 4XO9A 5LNEA 1KIUB
chains in the Genus database with same CATH superfamily
4BFKA 1ACYL 2P5ED 3DA0A 3O0RH 5BOPA 4XBEL 3EO9H 3G5WA 1MLBA 5D9SA 3BRFA 3F7YA 4C58B 4NENA 4UQCA 5IQ7L 1FNSL 2Y6SD 3N55A 2P5EA 3ASOB 1YUHA 3KYAA 3NIFE 3C6LD 1F3JA 5EU6A 5LDSA 4LOFA 3BUTA 4OZHF 1KXHA 4EJ1C 2KLSA 2FTAA 2P7TA 1UUSA 4Y1AA 3PFQA 2YLHA 1PAZA 1NUNB 2DQJL 3RAJH 3C6EA 3GMOA 1LO0L 2I27N 4J3BA 2H7WA 2R59A 2AV7B 1JV2B 3E2HB 2X88A 3JZYA 1E43A 5E8NB 3VJ6A 2EC9T 2X4OA 3ILPA 1T21B 2PYEA 1RIVH 1H8LA 2VAAB 4H44C 5ETUA 3Q06A 1EHKB 4HS3B 1CGWA 1TQWA 3QEGH 3IJSA 5I73B 2HFTA 5ERWA 5A2IH 3MOAH 3PAUA 4RMSA 1U8PB 4RBPK 4JR9H 2ARJA 1YEIL 3AABA 5D1ZC 3TFKD 1RSYA 4GKNB 1ORSA 4G1EB 2OTWB 3L9RA 1F6LL 1NEZA 3L1FA 3WEXB 2F74A 2P24B 2C26A 1LO4H 3FU6A 3IEAA 4GPVA 4CSSA 4JY6B 1ZVSA 3FUKA 4XN5A 4HCRL 1QSEE 1E5UI 2WINA 5TGBA 2BS9A 3L2MA 1WZKA 4HGMA 1O9WA 4ELKB 3EYVA 1JZ2A 4J39A 1JGLH 3WG7B 4QTHB 4GRLD 1LO2L 2QELA 3OKMB 4PYHA 5FA4B 3SCMB 1LLAA 1J1OH 5D5MF 4YLBA 2VZUA 2OKMA 1HDMB 3CVIL 5C0CD 2XN2A 3ZR5A 2ZOTA 4HEPA 5ABZA 3SPCA 3N42B 5IB3A 5LGYA 1E40A 4EN3D 1FZJB 3DXAB 4P2RB 4K3JL 2VZ1A 4LVNC 5L2JA 3VFMB 4NAJA 4ZTPL 1YEDB 2AJ3B 2RFXB 3FQYA 1IEBA 1ORQB 2N59A 1IJNA 4DGIL 1XSIA 3W3BA 4OQTL 2JK5A 5JMOC 2ITCB 1LGVA 3SBQA 4DZ8B 2NXYC 4KQ4L 5KSAA 1YNTA 1KJ2H 3MXWH 3QAZC 3NCJL 1PY4A 3WTTA 4PVNA 2LT9A 4LHUD 2Y23A 1J10A 3MBEC 4CVXA 4R9HA 5KEZA 5IB3B 3HS0C 2IAMB 3I02B 1JVKA 2K7QA 5C7ZA 2NXZB 3QE5A 1SDYA 1BJ1H 4L4TE 4AGMA 4NQQA 5HDBE 2X2JA 1VPOH 4GRWF 5E2UH 2Q5BA 4UQ2A 4BA8A 1YN6A 4X7CC 3S98A 1AZUA 3MLYH 4XP5L 3S5ZA 4DESA 2Z6FA 2PWFA 4ZXBD 5I16B 3OKNB 5J1SC 5D6DC 2NTSP 4Z3TA 4OI7A 3GMRB 1RPQA 3O8XC 3MLSL 4BK5C 5KVFH 1DQML 4PP1C 4E41D 5ITFA 2VIRA 3VXRD 4LESA 5K59E 5C2UB 2EIEA 1N0LB 1YYMH 2Z91B 3EYSL 3ROOA 4F15C 2I24N 3FB5B 1BGXH 2BSCA 2DS4A 2ZX8A 1XSOA 1UM5H 4PJGE 4LPVA 5HPMA 4L37A 2WY3B 5AW8B 3WAJA 4WHYG 1P4LB 2WBWB 1M71A 1K72A 2EUXA 2PO6A 5D7IF 3AM8C 1M4KA 1MQKH 4G80B 4S1QH 3V6OE 5AYQA 2X6CA 1W72A 1CT8B 4F58H 4I4WB 4I3GA 4AJVA 4F24A 1HCVA 3PE9A 1DUYA 1DVTA 1ZV5A 2NYYD 3QULB 1ZGLB 4OLWL 2NX5D 5D2NB 1JYNA 1P9MA 2J8OA 4I9WE 3BAEH 3I85A 4PCKA 2AQSA 4YE4L 1V5JA 1FL6B 1GS6X 2H8PA 1KBGL 1I8LA 2R1YA 4OCXH 3T0EB 3ZTCC 3BZEA 3QDMA 4R5TA 3ZSTA 4XBGA 4PWJA 1NCBH 1XR9A 3BW9B 2XG4A 4PJCE 1XGUA 4L8CA 2FX7L 3OZKA 1RH8A 4JPIB 1U36A 1ZGLM 4WKZB 1Y0LA 2N3JA 2YD2A 1WH0A 3TO4B 4YL9A 3EO9L 4AEIH 2V5SA 4PS3A 1KJMB 4APQA 2WLKA 3BZ4B 4N25A 2WIIA 1DANU 4C83A 4KROC 5JIMA 3WN5C 5I1DB 4F15B 2YJQA 1RK0B 4U4BA 3WDIA 5IEHA 1LD9B 4MMXB 3GZPA 3R0NA 1GZQB 1S3KH 3FRPG 4PRPD 4TM9A 1MWOA 4R5VA 5DT1H 3RUGB 4MFHA 4KK9C 3T1FB 1FO0A 5GRJL 2DD8H 2I5YL 2NY1B 5CLTA 1SY6L 3FYIB 4J3TA 3OQRA 1OTSC 2Y22A 3OJDA 4Q14A 5CIPA 2H1PH 1K4CB 1JZEA 3TIEA 1F1DA 4KX7A 4ANXA 3K4AA 5DEZA 3DXAE 4P2RE 1UA7A 4DGIH 3X1EA 2ITFA 2H2SC 4OAWA 1P4BH 3VG0L 1U8LA 5TPWL 1QLRB 3MOAL 3UAJD 2F08A 4HX1A 3HRPA 2LR4A 1KJ2L 3FB6B 2ICWA 1JF1A 1UKTA 1K8IB 2GSGA 4N2KA 2J1XA 4P3DB 2O93L 1HILB 2GJ6A 4PJGA 2BJMH 1LNUB 3A22A 4P3CH 1OAJA 1OGTA 4KTYA 3C6LC 5DD5L 1NFKA 1SUHA 1JGEA 4OCSL 1IQWH 4IBLT 4JM2C 5CWSA 1SDDA 4M3KB 4P2OC 4WUKL 3JSSA 1KDJA 2CH8A 3RFZC 4FA6A 2EINB 2X40A 3BSZH 1BQ5A 4DPRA 1JZJA 1U3NA 2R0ZL 2ZP8A 3WIHA 5EU5A 4LU5L 3GJFK 4I2XE 1YSOA 2BWDA 2J73A 2E8ZA 4NP9A 2FBOJ 4PRDB 1MFBL 4I18C 5I1JH 4FXGC 1ITCA 3LNEA 3P9WB 4HGWA 4OD2B 4KWUA 2Q8AL 2B0SL 1A1NA 1CLYH 3BP4A 5HI3C 3ARDA 5C09D 4K3JH 5KSBA 3PF2A 4UT9A 4QRPE 1S8DB 3HUJA 1YEFL 3VXQB 3GMRA 2WLNA 2XSKA 4W6YB 3UZEA 1R5VA 4JO1L 3S88L 3OR7A 4ONHB 2CBMA 3NJJA 1ES0A 5EIQA 3EYQC 2X4TA 1SLVA 3VRIB 5DK3A 3DJ9A 1RU9H 5HHOB 2ZYHA 3Q6GH 5L4FA 1AD0A 1IGCH 2BLFA 4KO9A 3ZHFA 4JDVB 3D25A 2C1OA 2VJ0A 1HI6B 1QWNA 1FAIH 2NQCA 4O2CB 25C8H 3PRZA 1QW8A 2P46B 4HETA 4N8VB 5AOIA 3UAEA 2ZE0A 1D6VH 2PR4L 3DWTA 4JPWH 1ZANH 1EEZA 4MASA 5T5FA 2WWMD 3GYRA 1CYWA 2DL9A 2EIZB 1NOLA 1P5UC 1KB5A 3QNFA 2IDTA 3AACA 1BDYA 4GG6F 2R4RH 4XBPB 3LOWA 5IQNA 5HHOE 5DS1A 4WDIA 5C0RH 5C08E 3MNWB 5JOPD 4A2DA 4NFCA 2CSPA 1P0SE 1QVOA 3JUYA 3W0WB 5DZNA 4FFYH 2YPKB 3T4YB 5I1HL 4G71B 1K5NA 2W9EL 1G9ML 2WXNA 5AG8A 5KYWB 1O6SB 2XETA 4ZX5A 3UAAA 4AEHH 4XI5D 5IHUL 3ULVL 4WFEE 3FQ2A 4QO1B 4GG8B 4M4RA 5EZOL 1N0XL 5D7LD 1MG2C 3RUGF 4WI7A 4XMTA 3UCQA 1NFAA 1RP8A 2WO3B 1QFPA 2OX5A 5EU6B 1DBJH 2JQAA 5FYJU 3LX9A 4W68A 1ODUA 2EICA 2WBKA 3WO3B 3QUYD 4JZJB 1FVEB 1Z1WA 3US1A 1EDQA 2C4XA 4R0LA 1BAGA 1TEGA 4JCMA 3D87B 4NN5C 3WY1A 4AKQA 3PJLA 5E8NA 3VJ6B 1AS6A 1G7QB 1E27A 2NX5A 3NVQA 1YNKH 1RUMH 3NIGB 2I60H 5ITBH 4I0PD 4PBXA 4KJPD 3FN0H 2ZUUA 1MFCL 1ADQA 4L48A 2EYRA 4PS8A 1L3WA 4BBWA 3MJ9L 3WUWA 4HK3N 4UQEA 2J4WH 1TSHA 4KZEL 2EE6A 1B4JL 2VDKB 5DUML 4O5LH 4DK3A 1SMOA 2LTQB 4U4IA 3IRPX 2VLLB 2CIIB 1HHGA 3NRQA 1OD9A 3OL2A 3KM1A 3NABH 4NKMB 5IHLB 4KJWC 4J12A 4JJHA 1D2PA 4G8EA 4PRHD 2XIBA 2YAQA 3NPSC 1RZJH 3VI4B 3HAEH 3SKOA 4ONOA 1YMMA 1AKJB 3BFOA 5HVHB 1UCBL 3D39E 4YHNA 2C3WA 2CK0H 1SXSA 2YBGA 3LXAA 3LS4H 2CK2A 5DJXA 4TTDD 3HNSL 5FAAA 3E9TA 1ET5A 4X80L 2DQEH 4L3EA 3TBSA 2CGYA 3K1KC 4ELMA 1T1ZB 3LEVL 5FEBA 2YFNA 5KZCD 4NQCE 4ZG1A 3JV6A 1BG9A 1BFSA 2XXCB 5AZUA 4AI7A 2RA1A 1H9VA 2X0VA 3FH5A 1Q0XH 3AT9A 3JTSA 3DIVA 2Y69B 5BUGA 4LPTA 5EC2A 3ZDWA 3ULUE 4GBXB 2EILB 1IQWL 2AJ3A 1C7TA 5L2KB 5AENA 3CHOA 3W2DH 3FO9B 3PDGA 4R96B 3A67H 2QZQA 4C56A 4ODBD 2IV8A 4I0PC 1XF4A 1UURA 2CM5A 2Z93B 3HLKA 2P48B 1BFOA 2GCYA 4Z7VB 3F7LA 5DJXB 4MAZA 25C8L 5CEXB 1JPSL 1FI8C 2DIBA 3MRCA 3G04A 3QORD 3FKUS 3GNMH 2BVEA 4U2ZA 3MLTA 1RXLA 4FXGB 1I8MB 1UKQA 2JJWA 3D0LB 1Z9SB 5I1AB 1A7NH 3O6FD 4HJJL 5IHZB 4E9VA 1HTYA 4KNTA 4F80A 4FHBD 1ZVSB 2CO2A 1I1YB 3MN8A 4M6OL 2VKXA 1JDDA 4WHDA 3R19A 5EBWA 1KWKA 4XP1L 1OTTD 1J0YA 4JX0A 4FFZL 3ZUNC 2L7QA 4E68A 4FFYL 1BF5A 3ZYIA 3O6LL 1BLIA 4PJXE 1KIQA 1TSRA 1HH9B 1GGBL 1S9XB 5IHUH 2WQAA 2DM7A 4U6TA 4GAYB 4NHCL 2NY6C 3IFNL 4JZJC 5AAMC 3MFGB 3GZKA 4AZ8B 2PR4H 4OVVA 2Q3AA 3FF8A 1W16A 3IGFA 3ULUL 2WO4A 2VWEC 2MQGA 2QQKH 1WUZA 5JORA 4UMGA 1TTRA 3NPZB 2GITB 1QUPA 3A4DA 1XD1A 1KIPA 3NESA 4I9XA 4J1UA 5IESL 4NZTH 5KVMC 1F86A 4JRYE 1LK3H 4BH7A 4LSRH 4QUOA 2OR8A 1OAYL 2CPUA 3HJ0A 4WFFD 4XWGL 4EI5D 3IDIA 4MJ6A 3FT3B 4IRJD 1BXVA 2AQ3A 2AXFB 1MRDH 4OB5H 3I02A 2G2NA 1A6UL 1DQLH 3ETTA 1PL3A 4XN4A 3U0PB 3ZE1B 4DN3L 3VWJD 4XHQA 1HOCA 2X4PA 1EEYA 1UWEH 1MXDA 4BQ8A 5HJDA 1IM9D 3SPHA 4LHUA 3RGVB 4F92B 2OXHA 4HH9B 4XNQB 4WCYL 2DQFA 3V4PB 4JFVA 1D7BA 1EHAA 1YZZA 4N68A 1VFOA 3LPOA 4F5CA 2MHAB 3NCCB 1I1AA 4MLIA 4PJDE 4R26H 3BSZL 3WU1A 5ADOH 3Q1EA 4F3FB 4KRPB 5HGHB 4L18A 4YC2C 3NH7H 4HOMA 1UZ6F 2I9LA 2AV7A 1MJ8H 1RZ8B 1DSWA 4H2AA 1I1RA 3TO2A 5IVZB 1J05B 4M5YH 1W0WA 1U8HB 1Z5LA 1GSMA 5GRUL 1OZTG 3IJ7A 2Z4QA 4RAUA 1WWCA 2DWDB 5JW5B 3HE6B 5BRZE 4DKFL 2CIKA 3WSQH 2QVTA 2XWRA 4Q0XH 3WY2A 4JM2D 1IAOA 3T4AC 3K6OA 2EC8A 5IJCC 5DQJB 4YXLH 1DQDH 3JTBA 3WE1A 1OF2A 1QZNA 3FN0L 4ZODA 5I8EA 1Q38A 4TRPH 2VITB 4OZIF 3DV6A 1H6TA 2JLPA 2DMCA 4I77L 4YK4C 3IDMB 5EC1B 4OJDH 2AXGA 4MNGA 2MTAA 1JG9A 4WTWA 1U8HA 3MA9H 4XO3A 1A1OB 4OLUH 3CDYA 4XCEA 3RB5A 4Y4KA 4A38A 5JXEA 4UDTB 3H7LA 3LKQA 4FQHB 1ETB1 4M3JA 5AWNH 3TT3L 1RZJL 5E1AA 3DRQA 5GJTL 1NCCL 5HDQH 2NY5L 5C07E 3CZSA 1GYUA 1Z9NA 4ZFGH 3BSHA 4BE6A 4IU3B 4GRWH 3IN0A 1OZUA 3DX9B 4P9ML 1T6VN 4OIIH 3UTTD 4DCQB 1IVTA 4H1LB 5I66B 2NXZC 4DP7X 4CVUA 5I8KH 4MVBD 4UBDC 3ETSA 2A6KB 1CR9L 2GEEA 3HZYB 4X9FA 2HH0L 2G2RB 3BH8B 3KYOB 3BT2L 1EXUA 5DO8A 3CDGB 1DQKA 1SMAA 2APVA 4EN3B 1LO3H 4U05A 5AVSB 5KW9L 2P8MB 3WS6C 1YDPA 4TL5A 1TNMA 3M17A 4HJEA 4KXDA 4JG1H 3CZKA 5E9NA 3O6KL 4QTIH 1M1XB 1YPZF 4MA8H 2DM3A 3MV7E 1XF2A 1OM9A 2Z7UA 4H2CA 1KCUH 2FLBT 4MNQE 3CQFA 3G5XB 1XCWA 1RUPL 4C4KO 3ZT5A 3WFEL 1WAPA 2RQEA 4KAQH 1NC4B 2IIJA 5EF2A 3PIQA 4WWOA 3OTTA 2IAMD 1KXQA 4G2AA 5FKAA 4DAGL 2FD6H 4ELMF 3AXLB 2QKIC 3Q2VA 1CLCA 4J6IA 1P7BA 5C0IB 3ZZLA 4AGPA 5C1MB 1G4RA 3M17B 4AQAB 4BSJA 4BUGA 4AOFA 4KGLA 1I1FB 3KLHC 3U2JA 4L5FE 3U4BH 5E08L 2F1BA 3MRCB 4B9JA 3C5ZB 3AREB 1IM3A 2VW7A 4TQEL 5D1ZB 3PJNA 2CGZA 4POZD 5AB9A 2F19L 1GS8A 3F01A 5K9JL 1T1WB 4WEBH 3HPJB 3IKKA 1U92B 5FUCC 1JF6A 1A3RL 1BPLB 4NN6C 1G84A 2PYFA 4G6FB 3FOMA 3MRNB 1ZLDA 4Y9BA 3B5TA 3HPLA 4NUJA 4GFTB 4E41A 1XL4A 3FCTB 1KTBA 3RTQA 4AQ8C 1JNLH 1QBAA 2W0FA 4R7NB 2DQDH 3UG3A 1WF5A 2ZP0T 1QFUH 1TCRA 4IBTA 4NO5B 1E27B 2NX5B 1Q4NX 3ZT7A 2ZCHL 5ICXA 2FSEA 5DMGC 3LB6D 3KYKH 4FFTA 2A9MH 2D4DA 1ZLVH 1UVQA 3FHEA 3TZVB 1JJUA 2OMTA 1OF2B 4WCYH 2DYRB 2ZXQA 3WHE1 3KPMB 3MA9L 3L5IA 1BVOA 2EDWA 4MDIA 1NDMB 3GZQA 5DJYB 1ID5I 2FB4L 3MV11 3PWJA 1T2XA 2IALB 3OX8B 4J4PD 1BVLA 3UBXI 2VLRB 1EA9C 2B15A 3PQYD 4EDXA 1NBZA 1TTBA 3WOVA 2WOYA 3CH1A 1XMWA 4MXQD 4HS6B 3ZX1A 3S37X 1DVSA 5JTWA 1O6SA 1B2YA 4ICWA 1R47A 3BHBB 4IS6A 3UTPD 4HXAL 1S7WB 4TRPL 3GLAA 4M7KH 2EDHA 3US0A 4Z3HA 4D9RD 2VLJE 2XV0A 5KVDH 3FUDA 4WHYH 2H3NA 4KXBA 3PPEA 3QIWA 5TPWH 4F2FA 2O6PA 3NK3A 4AE0A 2MPAH 4GIOA 4PS4H 3OBAA 2WTRA 4MD0B 4IGBA 1YMME 3HE7A 3NCWA 3QFJE 3DX0A 1RZQA 4I87A 3ZDZB 2KS0A 4TSBL 4CW1B 3RA7H 4XZ4A 1G9HA 2L04A 3BN9C 4FKHA 1KTDA 1V3KA 3M46A 4JFYA 5EMYA 1EX0A 2VJXA 5B1JA 3ROLB 4HUVB 1IIKA 3U7YL 4GI6A 5BZDA 3FCSA 2Z65C 4EKJA 1XEDA 2BP8B 4AX3A 1U8IA 3I3DA 1F90H 1ZHKB 4PJ8C 4PLJC 3BKMH 3UIYA 3DMMB 2BY1A 1JV5B 2CG9X 5C0FA 5FUZH 3A4FA 5KJ7E 2NUPA 3K6FA 3LJ3A 4L0ZA 2CDGB 4PSPA 4ZUSA 5JHLL 5B1CA 2FGZA 4D9QE 4XC1H 1HSAB 1A1MB 2V2WB 2AFNA 4YFLI 1L5GA 4HG4J 1MIMH 3QQ4A 3WS3A 4UM8B 4BHUA 4EI0A 2CNZA 5BXFA 1NUGA 5CJQL 1CQYA 4F20A 1QI5A 4R90H 3DIDA 3FTUA 5T1MB 4BFIB 2JXMB 4N2BA 3BAEL 4Q7DA 3MCLH 2O5XH 4JHWL 2Q87A 4HOZA 2NY5C 2FYYA 3EJPA 4FQXD 3CLEL 3PHSA 4XRCA 5F3HA 4GBXA 3MACL 3EH4B 2YMOA 3X3FH 3GSRB 3JTSB 4JFSA 3HHRB 3VH8B 2A6KA 3HZYA 3CN2A 5CS7A 2XV3A 4F7MB 2ADJA 1MCOH 2AV1A 3RDTD 2HUEA 1VEMA 4U1KA 5JW3H 3O4OC 3O9WC 1EHNA 3FBKA 3QQ4B 3HZKA 4XP4L 5ESVA 3U0TB 3WS3B 1QO3B 4ZXBB 5E2WH 1CQKA 1GKEA 1IX2A 1FNEB 2FK9A 3GK8H 3GM0A 4A2FA 5A1AA 1YEDA 1GR7A 1HIML 1SXAA 4HWUA 1IBGH 4YDZA 4B50A 4M6ML 3P0YH 4ZUTB 3TESA 3L54A 4IRJC 5CEYA 4BQ9A 1YMHA 3L3DA 1MY7A 1W8NA 1KXTB 3VXRB 4ENEC 3SKJH 2V8LA 4JZNB 1H15A 4N0YH 2FYVA 2WWKT 2P5EE 3QZNA 3QZWB 3HCVA 5DGQA 1AJ7H 5CZVL 3FTYA 3L1OL 1CFMA 3QJOA 5MP6H 3OXRB 4N0UE 1UWXH 3T9WA 2BNRE 4KHTL 3M88A 4LCCC 4WEBL 1S7QA 3OR7B 2VB5A 1UXMA 1P4BL 2NY6D 1GAFL 5GGSY 1ANUA 3P9MB 1FUNA 5I9QC 3TJEL 1RAMA 5DMKA 3O45A 3P77B 3MJ7A 1Z3GH 1BD2B 3G6JE 4PB0H 2GTZA 3NJIA 4GKNA 2N01B 1UYWH 3T4AB 4FG6D 4K5OA 2GIYA 1XH0A 1J8KA 3MROA 3QUYB 5FGCE 2EEDA 3T0ED 2BY2A 2NW2A 4GFXA 3UPAA 3Q44A 3FTZA 4WFGD 4NQEA 3LIZA 5E5RB 3Q01A 3D7PA 2IBBA 3H9SE 3ABGA 4NAMA 3TH2T 5SWSA 1E5BA 3LN4A 3N1QC 2C3GA 2QGEA 2VE6B 1AC6A 1KXVA 4YGVB 5DJDA 2F1AA 2BCKB 2ETWA 2XWJA 1OPGL 2J1ZA 4Q2ZB 2DQIL 4ANKA 4F7KA 1CZ8L 1R24B 2XIIA 3NFNB 5KYWA 1RIUL 1J9SA 1TJGH 1H0DA 1X4XA 3QEHA 2OK0H 3VFWA 2GSIB 3QUXC 3UGEA 3V6OC 5C71A 1BPVA 2W38A 4KH2A 4BSWB 2JNZA 2J20A 1H9DA 4U1GB 2D2CC 5K9KB 4GLRI 4YDJB 2VERA 1U8JB 3C6SB 4N9GB 3B9KB 3RY6C 1MIEL 2JB5L 1VERA 1W8OA 4YWGH 2DQHH 3ZN6A 1SJVA 5HHPB 3WN6A 1D5XB 1IGCL 5GQBA 5FYLD 3BH8A 3KYOA 1AANA 3GB7B 4GQRA 4CVXB 4RNRB 4HXBH 3DBSA 1L7IL 4QTHA 5IOPA 2OXGB 2VDQL 3E6FB 3BRGC 3PGDA 2J44A 4W1TA 2HKHL 1WFNA 3ULUF 5T1LA 1N6QH 2X4RA 4Y4HB 1XDTT 3QBTB 1URZA 5ISZD 3M07A 1RJLB 2ZX5A 3PP4H 3Q48A 4IJTA 4L1HA 4TUJB 1OGAE 5B8CC 5FF6A 2RMNA 5CIPH 3RL1B 4KK6D 2J5LC 1C5DA 5IEKA 1IO4C 3IDNA 4PJFB 2M8XA 3R8QA 4AV0A 3KYNA 3VXTB 4MS8D 2Z31A 1WA2X 4OLVH 4AEHL 5DWUL 1PG7X 2P80A 2X3CA 4HS3A 1UFUA 3OKDA 1JUFB 4WHCA 4NUGL 3E8VA 4NZJA 2F7QA 4OBRA 4NWTL 2EACA 3GMNB 5DI8A 5C3IA 2FZ3B 1MRCH 1FNEA 4Y0GA 1OTUD 1PF3A 3L3KA 3MGAA 3TXAA 2UY7B 3WO4B 3HG5A 1T89A 3STZA 2WQSA 4S1DC 2G60H 3WEXA 2QQNH 1KUMA 3PWNB 1LNUA 3RIKA 1ZHKA 5C86A 1UZ8B 5EBLB 1F02I 1VPOL 4NP4H 2GSGB 1IM9A 1NCDH 3I84A 2Y4SA 4W6WB 1MCOL 4KI5D 5H37G 2DMKA 1ACZA 2FEEL 3EJYD 4YDNA 5D1XC 3GSNA 1SLUA 3ZRFC 4IKKA 2WK2A 1RVFH 2NLJA 4DJMA 4YDLB 3MQIA 1EUTA 5E2WL 3C6LB 3HAEG 1N59A 5IK3A 3V8OA 3Q8FA 1E6JL 3POHA 4QNPE 5KUKA 1TU2B 5I15L 4XNXL 4NNXB 5CGYC 2VOTA 1QLFA 4ATTA 1FHNA 4DQOH 3IFPB 4FERA 4UDUB 4QWWD 1XVSA 2B3RA 3EYSH 4PGBA 2V6HA 3MU3A 4G43B 4DN3H 4S1SH 3JT0A 4QXUH 2NSXA 4EI5B 3AY4C 5HHVH 1JS4A 2A1WL 5L2JB 2FNBA 1X5ZA 2OW7A 3RI5K 3QZMA 3MNZB 1BVKA 4YZFE 1BM3L 1EJFA 2OL3H 5DJ8A 5J13B 3KPSD 3RWGB 3WJLA 2XQBH 2FJSA 2N1KA 3LEYH 3QXUA 1QA9A 3P3UA 2ZX7A 4ISVA 2L4OA 3H7BB 5ECJE 5BRPA 1RULL 4F8PA 4GMSL 5F3BB 1ZVHA 2Y9RT 3RGVD 1UT1A 5D7LB 3OJDB 5ALBL 1L7TH 2YMXH 3JBG7 4OZIE 3TBYB 3QDMB 1YEHH 3VG0H 2VL5A 1H3PH 5F1IB 5TD4A 1A0QH 5KOMC 4M48L 2ZICA 4DKFH 3P69A 2H1PL 4KV5F 4D9QD 35C8H 2HLAA 5A16A 3MV9D 2G5BA 2XWZA 3BHBA 3TA3C 3K72A 4LSSL 3WJJA 2OJEA 4U3XA 4PLOB 1DDHA 5I2IA 1E9OB 2WPGA 4GP5B 4NN7B 5F9OH 4FQXC 3SDDC 1R3JA 2W91A 1N19A 1ZY9A 2Z7YA 3AJ7A 5CSGA 2BC4A 4H26B 4N2FA 4R97C 2C9VA 1B90A 2E27H 3WDHA 4NUJB 2Y5QA 4IU2B 2IJ0C 3AADB 4DP8X 2YOAA 3K2IA 4PREB 4QRQB 5T3XD 4DO6A 5HPMB 4LU5H 2J5LB 4L3CA 1CGSL 2GJ6E 3V0GA 1PKQE 1AHWC 3ROOB 3QIWD 5LWYH 4ZAKA 1MVUA 1A6TB 3ATDA 5IMMA 1ZS8B 1JGIA 4PGDB 3WKMH 5IQOA 2ZOKA 1M9WA 4PHXA 2HYMA 1ORSB 3OXSB 3MV8B 5FUCE 2DEWX 1MUJA 3BP7B 1U30A 5D1ZI 4PJ8D 4N26A 2X1OA 4ZMPA 3EOBA 3MUUA 4Z7QE 3U1SL 2JJTA 2IDQA 3QNZB 5A2BA 4NGHL 2YO3A 4AGNA 4V1DA 1F11B 1YY9D 1H0DB 2FDBP 3D48R 4GAAA 2HJLB 2DTSA 3F04A 3LSOB 2NY2B 4PVMA 5BZXA 1NOAA 2J7LA 3KH4A 2CXKA 4Z7UF 3VD2A 2KYIA 5SWZB 1YYCA 1C16B 4JDVA 5D4JA 6FABH 1Y0LB 4YBQC 3IFLH 4BIKA 2NMSA 3KDPB 2ALWA 3HAEB 3P2DA 2YD7A 1VENA 2DQGH 5BXFB 3BVTA 1JK8A 1FFRA 1Z66A 2H1XA 2XG5A 3QO0A 4X6DE 2APTA 3KGTA 5EH1A 2DYPA 4FP8L 5H4ZA 2JLLA 3C8KB 1KIUA 2OMWB 3GHEL 4JFXA 3WEMA 1MW3A 4B9GA 1MWAB 4HIPA 4Y5VA 4AKOA 5M94B 1DJSA 2GJPA 3TN0B 2JTDA 5KSBB 4GKLA 3OB8A 1RPKA 3NZSA 3ZKQD 4M1CC 1XF3B 4UQIM 4BZ1H 3K4DA 1E8WA 2F54E 1E6OH 4YBLC 5GRZA 1YEEH 4Y19D 5IIEA 3ESNA 4GW1B 4M7ZC 4K3HA 4G80A 5ADPL 3CFDA 1I1FA 4UB0L 4YDVB 4GT0A 2AK1H 12E8H 3QIBC 4J4PC 4R26L 3VFSB 1MHPL 4LCWA 5IQ9A 2BVTA 4YSSA 5GS1C 4H4NA 4HUVA 2DH3A 4AL8H 3AG4B 3PABB 3VGEA 1BBJA 4LHQB 4CBPA 3U36B 5EC2B 1JGUH 4HK0A 4TQEH 5C07B 2WVSA 4Z7UE 2OTWA 5ELIA 5C3TA 2YUXA 3QI9B 4HIXH 1ACXA 5DD6B 5FXCH 2YMXL 1TJHL 1OSPH 3B83A 4NJAH 3RBSA 3DVNB 2A74B 1UB6A 5GGVL 2VSMB 5IKCB 2WJ5A 3IPBA 1IT9L 1XH3B 2N7AA 4N86A 2DF3A 4YO0A 3O8XB 1OGAA 4Q9RL 1F56A 1TZ8A 3VW3H 1EWHA 2VSKB 1UQSB 2FT6A 5CBAA 1JN6B 2BVPB 2B59A 4NQCA 1YY8B 3QXDB 1EFXB 3HN5A 3L3JB 3HMXA 3QUZB 5E8DH 3ARPA 2NY1D 3B4NA 3FJTA 4JGUA 4LPXA 1PG7H 5J12B 4GO9A 2CDFB 3LMJL 1MVYA 4P05A 3SJVD 4ZXBC 2J43A 3T1FA 5JOEA 1OK0A 2FGWL 3DGCR 1FG2A 1C1EH 1KOAA 3VWJB 5EF0A 5KYYA 4G8GA 4X9GA 3MRBA 4YAQA 5IOKA 1CGSH 3KWVA 4ODXB 4DUWA 1RY7B 2QKIB 5H4YA 1A25A 4I7ZC 3VMPA 3IRCA 3LZFL 4Z18A 2BCKA 2Y5TA 3CV5A 3NJGA 1NDGA 1UXSB 4NNXA 4RVBA 2JKRM 3C5JB 2GJZA 3QPXL 4NCC1 1QEWB 4Y5YC 4N8VA 3FH8A 3O41A 4KY2A 2Y07L 3T0AA 3D18A 1RUQH 4OLVL 1LO4L 1KCVH 2WXOA 2XKUA 4TTGA 2DQEL 3APMA 3B3BA 3FT4A 2FX9L 3P4MA 4OFYD 3OB0H 3FT3A 4LSUH 4HJ0C 5HDBF 3VWJA 1S5HA 1NBVL 1SRDA 4ONFH 3LD8C 5DHYB 2JCWA 4XNYL 5F3BA 4BWWA 3FOMB 1HCFX 1HJCA 1YEFH 1U8QA 2F5AL 3FU5A 4JM2B 3WY3A 4JVWA 3DSFH 2EDDA 1MCLA 4MA8L 4K15A 1RP9A 4PWFA 1S7QB 5GXBB 3F65A 4WV1C 3ARBC 1L0PA 3SPVA 3TV3H 4MCYB 4OU3A 2OQJB 4BH8B 4ZOAA 4E0RA 1MNUL 5GS0L 2C3VB 2GG1A 5EDXA 4G6AC 4YR6B 3T2QA 2R15A 2MH4A 1C5CH 5CSZB 4FABL 1Q1JL 3V6BR 1NFIA 4UBDD 5FPIA 2GC7C 3VFNA 2OSYA 2ZKHH 4OZGB 2NXZD 5DQ9A 3ARWA 4KXZH 1EPFA 3K72B 1M2OA 4J3OF 4FQ2H 4FXKB 3V2AR 3WKML 3MJ9A 1V3MA 3UDWC 4K3DL 3PHQA 3L9YA 4OFYA 3A0OA 4KXAA 4HV8B 2V17H 1UB5A 3WXWL 1GZPB 4DQOL 1R5IA 3MO1A 3TM6A 2CUIA 4K5PA 5BVJA 4N1CA 3MXVH 5K33A 1NBZB 3OZ9L 2WGXA 4OI9A 4M6NL 4NQSA 1EJOL 2FUTA 1KCLA 2CIKB 2WTPA 4ZUUA 2M1KA 3O2VL 1VZHA 1WTGT 3DHJA 5DTFB 4NENB 5JQHC 6TAAA 3WJJC 3JV0A 1OW0C 3UTQB 3V52H 5MEQB 2ZF8A 3VXUB 1G7MA 4R90L 2QHLA 2J12B 4DVBA 3GRBA 5HYJA 1FGVL 1A7RH 3OPZH 2KH2B 4IIQC 3ARDB 2DWSA 4NQXA 5DRWB 3LZOA 4APXA 4DO5A 3D52A 4O4YL 1KIRB 2NLJB 2CR3A 4ETYA 1QSFD 3W81A 4RIRA 3DI2B 5FM5M 4QRPA 2PPCA 3DOSB 1XXDC 3L95B 3P4NA 4NZFA 1K9TA 3H42L 1EGJH 4NN7C 4NQEE 2DLTA 4WI0B 5HJ3A 4ERSH 4PJ5E 5HXMA 1E6OL 3CZGA 2GI7A 4OLXL 3OB0K 3RZCC 3GT6A 1GGUA 1WAAE 4NAQA 3QUGA 4NO3B 2H0PA 4NQCB 2WB1A 5J7CC 2X1PA 1B6DA 1CN4A 4IRSC 5FCUH 2Q9OA 3GZOA 4NZUH 4NLHA 4P07A 4ZMAT 4M43H 5JA9A 4PSRA 2OMWA 3GBMH 3QJZA 3SKJL 4PY7B 2EVIA 1U6AL 4JCLA 4PJEF 4X6CF 1MFUA 3NABL 1TZGL 4Y9FA 1USZA 1HYRC 2N1TE 4XXWA 5ISZA 1TZIB 1NCHA 3TN0C 3UJIL 3SY0A 3BGFB 4PRNA 2OMZB 4UOQA 4Y2DC 3P4LA 3KAAA 5EIVA 1OM3H 3RVUD 2VM9A 3TEUA 1VHPA 3GMNA 4JANA 5DI8B 4MNGE 2ZYSA 5DJAA 2EYRB 1MWAH 4UIMB 2Y07H 2IWEA 1AY1L 1RUQL 1ZPLA 1H6FA 1CI3M 4GNKB 3ELQA 4OB5L 3RZCA 1U2YA 2IH3B 2UXTA 4FYTA 2EVGA 4EI5C 4GY4A 5DK2A 2Y3AA 3GLEA 1PKQB 1THCA 1PQZA 3W37A 3AROA 3R06B 3VACA 5T3ZH 4KQ3H 5I6MA 2DI7A 2QBWA 4BQ6A 4MAYD 3B7SA 3RL2A 4D94A 4H40A 3PGFL 1UHVA 4JQVC 5KZCB 4XP9L 1LE5B 1NCIA 4B96A 2EE9A 4POYA 3VXPB 1BD2D 2NY0D 5BV7B 2VERN 1NGXA 4XP5H 4HCFA 3OVUB 2R2EB 4FABH 4LDEB 1X5HA 1YNLH 5FA3A 2HTLC 1XSJA 4YHOL 4AWJC 5LCVH 5DF0A 1NH6A 1Y1DA 3MODL 2X4SB 5D1XD 5JNYA 5GJTH 1NFDE 5FIEA 4A6YA 4H1LA 3QPXH 4P5TA 3VRJA 4JN2B 2R69H 3IMBA 2C9RA 3S35X 3B9KA 4JO8A 4KI5E 5D70L 5DQDH 5E9AA 3OMZA 3GLDA 4J8QA 1I7UB 1KCVL 2AXFA 4R4ND 3V0AC 4XPFH 5EZPA 2OSWA 2L3BA 5IMLB 2PYEE 3A4EA 4R7NA 4YEFA 3BEVB 3OKOB 1PX3A 4U6YA 3COOA 3ATBA 1U58A 2ZD0A 2ATKA 3GKWH 1T5XA 3H9SB 3WFDL 1X6LA 3N44B 1CFQB 4LBEB 4XGZB 3ZZQA 1E8ZA 3FQWB 3NCMA 3BIAX 4K3GA 3T04D 2HG0A 3ARSA 2W88A 5I8OL 4L1TA 2ICCA 1KCRH 4MS8C 3SGEI 4MD4B 5MEOA 3TCLA 4D0BB 4ZSOB 1FZMB 2E7LA 1R3HB 5CILH 4P9HL 4GG8A 5KVEL 4JRYD 4QRRE 3U7AA 5DMJB 5I71C 3ZQXA 2DWTA 4DIXA 3V0JA 2Z0UA 5IG7A 2VDOL 3ARZA 5BW7C 1JHKH 1MCCA 4G8GE 4PREA 4ZO9A 4RSYA 4NXSA 1XV8A 5CJBA 5DHXB 3GXPA 4HD9A 1U93B 5A2FA 3UABA 3GSXB 2ZSWB 2ARWA 1W0WB 1OCCB 4R3SB 3GUTA 2Z35B 2TAAA 1I9RH 4WKXA 5IROC 4QHNA 2TRHA 1F4HA 1KSRA 1TTFA 3K3QA 1NFDB 4TXVB 4M29A 3HS9A 3S9DB 4A7QA 4NZUL 2PYED 4U6HA 1KLUB 1ZLUH 4UM9B 5C0BA 5DT1L 3O2VH 3Q9QA 3TGXA 4TUUA 3OWRA 3MREA 2H9GB 1BIIB 4NP4L 3ILPB 3K4ZA 4FI6A 2WJ7A 4R97B 4YSEA 1PFOA 4KJPC 4ZPVA 4CVZB 4LOVA 1SHWA 4KAQL 4ZFFA 4RQQA 3IGLA 4Z77B 4NJ9L 4GKZA 4OCXL 4RSVA 4K7PY 1FCCA 4TSAL 5CGTA 1KPVA 3TIEB 4WO0A 4DK5A 1SOSA 5KJRL 1KYOJ 2ICWI 4FLRA 1E3FA 4Q0XL 1H5BB 4Z76A 4EXKA 4XBEH 3KJ4B 1SGKA 4LNRB 1L0YA 1QLRA 3FQ4A 4L8SC 3KPMA 3ZKMD 1J5OH 2XLLA 5T3ZD 4D8PB 2K6WA 4ZPTA 1FORH 2EZ0C 3KPPB 1Q94A 3FRUB 4H0LC 4OD1L 2OR9H 2P5WA 4ZPVB 3FO9A 4JRXB 3WO4C 1SUJA 4GEIA 5IR1A 2F7RA 3FU8A 3OKDB 3GF8A 2BW5A 4OCYH 4OGYH 1ZDQA 3BJLA 3HI1B 4KDTA 5K9OA 4K8RH 3X12A 2DLGA 1EVUA 4MNHB 1UWGL 4TLTA 1RZKH 1HINH 5EU5B 2J8UB 5SWQA 4LCWB 3WI9A 5IQ9B 3TTSA 4PB9L 4CMHB 2O1AA 1XGQA 4W4OA 1JZ7A 1UZ8A 3QIBA 2ROXA 2QVMA 4XC3L 3PWNA 1AKJD 3QDHA 4OD3H 1INEH 1X9RA 2AJSH 4KHXH 1FWXA 1TVHA 3S5YA 4IBQA 2CKBA 1FFPA 4JM4L 4JY5L 4Y1AB 4HXAH 5FCSH 1OP4A 4LL9A 4L4JA 1BFTA 1A6AB 1EZLA 2EXYC 4PJEB 4X6CB 1CF8L 3KZ8A 3H1ZA 3BPLC 1FN4B 4P4RA 1ZT7B 3ESUF 2JKLA 5K1NA 4XB8A 1CBVL 3M1BB 3PXHA 2UXFA 3BGFC 2YSTA 1E5AA 1KLGA 2ERJB 2NY3B 4HJGA 4Q56A 4XMXA 3KYMA 2HTKD 2XWDA 1Z7JA 3W5NA 4FOMA 2XWBA 2QPEB 3H9SA 5E99H 1TNNA 3CMOL 4FNSA 4XXDA 3ARGD 4MBOA 5GGSB 5I8CB 1E4XH 4IBSA 3U7WL 4D0DA 2AS5M 4YXKL 3HC3H 4YDIH 4MZ3A 3L5XL 2XWTA 2JELH 1XBDA 2HCZX 4OUUA 5IW6B 1KTRL 2QSVA 4HSCX 3SDXE 3NSYA 2J71A 3KGSA 2FUQA 5KYYB 2Q20A 4XCYB 4K5NA 2CO3A 2GQHA 2EDXA 4AUUA 4WDIB 3O6FB 4XOCA 1SJXA 2R0LH 1JGDA 1NDTA 4I0CC 4I85A 2FD6L 5D8JH 5I75C 3ULVH 3BISA 4CKVX 4EIGB 1A14L 4OZFB 1V8HA 2C3HA 4IGBC 1CL7I 3LIZH 2C34A 4TPRH 5AZEH 2K8QA 3HC0B 5HDRA 2F9BT 4ABUA 2ZG2A 5JHBA 2FSEB 3P11H 4XNBA 3OKKA 1NIEA 3WEOA 3W9EB 3FXIC 2PCYA 3K8LA 4LLYA 1FIGH 1NOFA 2QHRL 2LLLA 2BMKA 3P4OA 1S78D 1BCIA 3GIVA 3CXHK 4XCYA 4KUZL 4UNIA 3NIFF 3SD5A 5DSCB 5KS9B 4IRZH 2HUHA 3OKOA 2E4TA 2ODIA 4YFLF 3I9GH 2HLEB 2FJHB 3TASA 3ARVA 1MHCA 1NEZG 1XCQA 4GQZA 3F58H 1Q9LB 5BVPH 1SOQA 3N0PB 3EJSA 3UTSE 1LEGB 1QBML 2BRRH 5HI4C 1A4JB 1NPUA 5EBMA 2D03H 4I48B 1DJHA 1KN2L 3NJFA 2WW8A 5AW4B 2HVKA 5MHSD 1W6WA 4FQLH 3RAJL 1CD0A 3AUWB 3DECA 3ZTNH 1FAKT 1ZJAA 3KYKL 3N06B 4CU6A 1E5YA 5ITFB 1OAYH 4YGAB 4PJCA 2F8IA 2OMYA 1K85A 5GRYA 2B39A 4Y4KD 3FOLA 5AB1A 5JXED 2X7LA 1IQDA 3GUFA 4XN7A 4ZPTB 2DJSA 1MCDA 2C5DC 3PWLB 4XNMB 2ZSWA 2OZNA 1J0KA 5BO1H 2WLIA 4MJIA 5D6CA 3DYOA 1K5NB 5FYJH 1XGRB 4MXVF 4W9KC 4OCNC 3SE9L 1C08B 2QMKA 1QSEB 1AP2A 4NPYB 4KVCH 1EVTC 4HIEB 5KS9E 4ZFOL 4U1NA 1U8PA 1HS6A 4U1IB 1VDGA 4MNHA 2VYRE 4JFYB 4CDGC 3O3EB 4R7LA 3BIKA 4BKSC 2ZXCA 4EXPX 2R1WB 4PJHE 4PJ9C 4L3AA 3CFCH 1QKZH 3L9RB 3CG8A 5ANHA 5GZND 3T2NL 3MV9E 3B5GA 1FNAA 5HYJB 1S5IH 4FZ8L 1OCWH 4E9WA 3MRKB 3QPQC 1OL0A 3Q5TA 3MLUH 2FH6A 3PWUB 4ZOCA 3QFGA 2X53A 3ZZSA 3GFUA 4G11A 2GABA 4X0KA 1ZT7A 4JO2L 4Y9EA 1AP2B 3HIZA 4NPYA 4AK1A 3TPUA 1JI1A 2J6EA 3EYVB 3GRWL 3EXJA 3ZYZA 4IS6B 2C9QA 3B2XA 5LQBH 5J6HA 4ZTPH 5DHVH 5KVEH 5D93B 1CTOA 1XD0A 4RGNB 2A4CA 2K45A 3CVCA 3G6AA 1S7UB 2DD8L 2PF6A 4FAAB 5IP4A 4E9YA 3MA7B 4XRCB 4Y16D 1T89C 3T6WA 4ZUWA 3TJEH 4KMTH 5GGUB 4HLEA 2VQTA 2AJYH 2YGOA 3FHQA 4HDIA 4UIKH 5E2TL 3W5MA 1LWRA 1E2VA 1PD6A 5CCJA 4ZJ9A 3ZKXB 1DTUA 1MW1A 1VZIA 1X5MA 5E6RB 3DO3A 3QDMD 3CQQA 3NCYS 5JZ7C 3MLXL 5E6YA 2VZVA 4PY8J 2H0FA 3FQTA 1RZ7H 1WFTA 2Z31C 4PJAF 3VI3E 1DJXA 1CF1A 2VDMB 3GSWB 3VMNA 4ETQA 5E2UL 3MVSA 4ATWA 3QQ3A 4Z7UA 2ADFL 3IAGC 3QC5X 3TYFA 3DUUB 2OL3A 1EMTH 2Y36L 4P2YA 1E8YA 4D2NA 3FTGB 1AXSB 1OAZH 4J3OD 2YUVA 3LKNB 2ORBL 1CZ8H 4ZUVB 1CFQA 2A6IA 2FRGP 3LNIA 4MTMA 1PQZB 1JD7A 2K4AA 3FUEA 3SKUD 2J56A 3BUBA 3QHZH 4HUUB 5GS0H 2ICWB 3DKHA 2NNAA 1VACA 2XYBA 1NCWH 2ZG3A 4UZUA 5DD3L 3LZNA 4MA1B 2DLFH 1J5HA 1QBMH 4WU7B 3QRGH 4I1PA 1T1WA 1HZHL 1UB5B 1M9SA 3ZKSD 1TMQA 4EN3C 2YPVA 2WQXA 4KH9A 3O6LH 1OAKL 5H2BB 1F45A 4FNLH 3NFSH 2BP0A 4U3SA 2J8UF 1MH5A 3FNKA 2V0AA 5FA3B 3QG7L 4XCFH 3W39A 3VYOA 3X13B 4AQEB 4B97A 1NAMA 1S46A 4HHAA 3OLDA 3D18B 3WTVA 3RYMA 1JZ8A 5E5UB 1KLUA 3EF7A 5KJ4A 4I3RL 3QDJD 1ZCRA 3SPGA 1ADWA 2GYSA 4X6BA 1WZ1H 2IPTH 3C2AH 4KKNA 2MCPL 1WD8A 1KBGH 2WQVA 1FZKB 4FZEL 3ARED 3LZQA 4APQD 3HBGA 4JFOA 4J3VA 5DJDB 1SY6A 4YHKH 1LP9B 1KIQB 4N8VG 5EOQL 2F6AA 2ZWLT 3SQBA 1AO7B 4KKAD 1O75A 2PWDA 3IFOA 4NKIL 3V4UL 2G9HA 3BW9A 4UQDA 4E9XA 1IKNC 5IB1A 4AXWB 1WBZA 4PWIA 4FYSA 1ZLUK 2R1YB 4YLCA 1DBBH 5T3XH 2WC7A 3DX8B 1HAUA 3MV7B 2ZSVB 4IDJH 3HG3A 3RVXD 1JNHB 2ZCZA 4X9BA 1QASA 3WMPA 1ERNA 1I1AC 2XJLA 3ARDD 1UEMA 1OCOB 2I69A 1Y07A 2OMBA 4FTVB 4AQZA 5BZWA 1PEWA 1X3DA 3UACA 1HHGB 2X89D 4OZIB 4GOSA 4QF1A 3U1PA 1OSZB 3C12A 2IANB 2VLMD 3CFMA 2XZQH 3C5SB 2BM3A 3C8HA 3MBEB 1QR4A 3FU7A 3QIUC 4NOBA 4X5WB 5LB1A 5IV2A 1A4JA 3UTPE 5AYUL 4WNQA 1DFBH 3ABZA 1KY7A 3GD1C 5JA8B 4Y16A 4UT6H 5D7JC 2PWHA 3GSOB 2DL2A 3KHQA 3NFPB 2AF2A 5ILTH 5F89A 3HG1A 5C08B 1H3UA 2NNXA 2X1WL 4X2UA 3FB7B 3SE9H 3SPIA 3QI9D 3UEQA 1PLAA 2O6FA 4QRFA 4WUUA 2WSDA 4FXTA 1TETL 2IPUK 4NRYA 5MERB 2WGNB 1CG9A 3DMMA 4Q4IA 3LAFA 2ZTBA 5DEFA 4PJXF 5KANG 2BSRA 1DL7L 4JUSA 2Y72A 4APXB 2DPKA 3FQXB 5K1JA 1DJZA 3CFUA 4UV7H 4Y2OB 1NL0H 1AD9A 4K7FB 1JDAA 4OH2A 4EZJA 1MCKA 1QA9B 1EXUB 3VDAA 5C08A 4XZUB 1PKOA 4IHOA 2EYSB 4P4KC 2WB7A 2AJXL 1MJUH 3UTOA 3V5KB 5HI5C 1W0YT 4KX9A 3O2DH 3GSVB 1NAKH 1YPZB 4Z7VF 4JHUA 5AWNL 3T0DA 4P4KD 2B4CC 1NLDH 3KWWB 3SE8H 4EMZA 3D9AL 1T7WA 1FNGB 4N2NA 4ZUVA 2O5ZH 2CJTA 2ENSA 1ZA3A 1FLTX 5IW6A 3NAAL 4PCYA 4GW5B 3BP7A 2VL4A 5ENWB 1R4XA 5I73C 1VGEH 3JV5A 1OCRB 2DWEA 3SE4A 1P4IL 2VMFA 4NQDE 4JDEB 2OMXA 1HC1A 2NZ9C 4AM0Q 1HQ4B 1HEZB 4UDTA 4BSVB 1QR1B 3R1GH 3ZRSA 3SDAD 4I0PA 3U1SH 5DRZA 2DJ4A 3ZTNL 5D1QA 5PCYA 2XKNA 3A23A 3IE4A 3WFCH 3KE0A 1GGIH 4U7MA 3TVMB 2OP4L 1ES0B 1S4IA 2V3DA 3JWNC 3TIDA 2YAFA 2HRPH 1W0VB 2XN9D 3DX9A 1OTTC 4QJ3B 5CP7B 4HMEA 5JMRA 5GS1B 3QUZA 4ZS6D 5AVVB 4FQJH 3RWGA 3KHOA 5TF0A 1K5WA 4XP6H 1GGTA 3BKYH 3NIGE 5AL0A 2FJFA 4W9FC 2VMJA 2AQRA 1U2CA 1JZHA 1E2ZA 3EDDA 5EZLB 1LILA 1SVCP 1HYSD 2E59A 2QV2A 3KVDD 2ENQA 5HYFA 1G9MH 3HE7C 1E28B 2P42B 4NNYA 2WXGA 3FTGA 2VDOH 4NNPL 5DO2D 3TBYA 5HJGA 1KG0A 3RTQB 4IDJL 3CDZA 3O41B 1B9KA 3DUUA 4FX5A 5T1LD 5DLML 1SOKA 1A3LH 3UYPA 4RETB 4MMZA 5EUKB 2JQMA 4P23B 2ILLA 1DN0B 3CXHJ 5AKTA 4ZYKB 1S5IL 5L0QB 4JJOA 1F2QA 3IDGA 4AT6A 9PCYA 3L2NA 3NMEA 3CSBA 3V4VB 5ICYB 3ZTJH 1XIWD 2DQFB 1N6VA 2VZSA 2NNAB 1E0OB 1TR7A 1SEQL 8FABB 5AYUH 3L48A 2CDEA 4RAVB 3U6XA 5EA0L 4DF9A 1NDMA 4RFNC 1NMCB 1A4KA 4FP8H 1IC1A 2H6PA 1RZ8A 4CRPA 5C0AA 3QFJB 3DUSB 2FX7H 5EUKA 3P3TA 3D3VB 3WFBH 3PLYA 1G5AA 3GBNH 2R7EA 1F3RB 4OZGA 2VRAA 5MEPA 2BOLA 2D3LA 1ZK5A 2VLJA 4NO0D 4PBDA 4BSWA 2VSCA 5IMKB 2YXFA 5I24A 2X6MA 4DFHA 4QYOA 1EAQA 2GSIA 4UAOC 2PTUA 2RGSA 1LEKA 5JORB 4FJYA 2ZXWB 35C8L 3VFSA 3DTDA 4AQ8A 3KPRD 2B1OA 4C83B 1EO8L 4U1SA 2YJLA 4BQCA 1G7HA 3QPKA 4QTFA 3CHRA 1W72H 3U36A 5GRJH 4BK4A 3OAYK 4HFWB 3GSNB 2F7OA 1R9FA 1RIHL 3C60C 3RU8L 4AUJA 2XX1A 3ETBJ 4OD1H 1U8OB 3P0VH 2G3NA 1UKSA 3B2VL 4S2SB 2E5EA 3B1UA 1CD8A 2Y7QA 3BD3A 4GI9A 2ZIDA 1Q9OB 2B8OT 1KTKE 4WWKD 4QPEA 4X0KB 4PI2A 5LAPA 3NAAH 1CD1B 1MCNA 1XH3A 4ES9A 1R1CA 2G4EA 1G94A 1RZKL 4OI8A 3QUYC 3PCYA 3QUKB 3G6JA 3D39B 1TZHB 4J3XA 1OAKH 4YSCA 1NCGA 1TPXC 1EGJA 1F3DJ 4Y2LA 1BEYL 2KMWA 1BIIA 5D1QD 1J8HE 2JJUA 4JHZA 5T1DH 1JTTA 1JF5A 2YZ1A 4DP9X 4JAMA 1MKFA 1GJWA 1ID2A 1OGTB 1NPNA 1YEGL 4AG4H 2YQGA 3SGJA 3NCJH 4LASH 4F2ME 1GGCH 1N7ML 3CJJA 3G3LA 3QS3A 3NA9H 3DX7B 4CUCA 1XGRA 1PG7W 4LSPL 1S3KL 4MAYB 5IIEB 1I8KA 1BLNA 4LVHB 4QEGA 1FV1B 3FMGL 3STZB 4FNRA 1QFWM 3ME0B 4AMKL 5E99L 3AS0A 5IHZA 2FZ3A 2WVTA 2YLKA 4MDRA 3MRGA 5E4IA 3V7AG 4AENA 3EADA 2YAHA 4K9JA 3F7KA 2X6UA 2FE0A 1B88A 2WBJA 4FXGA 2JIXA 3DRTA 4B9KC 1UD5A 1HHKA 4WJKB 3WS6A 4XHJD 3MLRL 5CP3H 3SOBH 1CFNA 1X5GA 1QUNA 3DGGB 3R1GL 4F57L 4WFHD 4CSPA 1DEDA 1A7PH 3WGVB 1CWVA 4FS0A 2PCPB 3AAZB 3ML9A 3BZFA 5DD6A 2YAPA 2ZKYA 3HG0A 2OP4H 4JZOA 1HE8A 5C0CE 3B34A 4FI8A 1H19A 4GG6E 2VN6A 4ANUA 4JO3L 1ZTXE 1F6FB 3ET9F 1AHKA 1LO3L 4QJ5B 1TJIH 5LNEA 4KNUA 5F3FA 4K8RC 1LK3L 4DTGL 3TV3L 3BSZA 4EI5A 4AEFA 5DMIL 3F7VA 4O58H 2ERJC 2HFGH 1OGAD 4S1QL 3O2WH 3X1BA 2UZIL 4LLUA 1GMIA 5L8JB 1IGJA 1H15B 4H5SB 4V11A 2Y2TA 3BVWA 4ZK8A 1CGVA 4Y4KC 5JXEC 3PWPA 5LDUA 1AH1A 4B7LA 3FB8B 1T1XB 4KO6A 4LKXB 1EZSA 2GVYA 3EFDH 3EDJA 3EJJX 1ROWA 4A04A 1YJDH 3MR9B 4FLQA 1ZTXH 2YUWA 4PJ9A 3LH8A 4FEIA 1SPDA 1HHJB 3BMVA 5J6GB 3D2TA 3TIDB 4PM1A 4Y4FD 4I0KA 3BEWA 3T4AA 3IJEB 4N6RA 5J9PB 4YSPA 4UV7L 3B7TA 3U6RB 4YBHA 2FSDA 3UP1A 32C2B 3ULSB 3US9A 2GHWB 4RGNE 3UAFA 1A9EA 2NY4D 3NIFB 1AGBB 3FPYA 1AGDB 2O5YL 4K07A 5L7XL 2HT2C 2H2SD 4X9IA 2NY4C 1D6VL 4JPWL 4XODA 1HE7A 1RJZA 1MDTA 4Y9CA 4ZDHB 3V0WH 5KAQG 3OZLA 3WYRA 3QEQD 3WNPA 4JRYA 4G6JH 4YX2L 3DHMA 4EN2A 4LLVA 1BFVH 5DFVD 1VGEL 3TJPA 4ZMZA 5CLZA 1MH5B 4J3SA 1CL7H 3RY5A 4IGBD 1P9MC 1NINA 1KELL 1UD8A 3EZJB 4YFEA 4MD5B 3SY6A 4GAJH 4HJ1A 5GS2H 5E8PB 1KZQA 5FB8A 1MFDH 3I75A 5EU7C 2ROYA 5TE7H 4JFHE 2YD3A 1A9BA 1DJIA 3IF1A 5DVKA 1KFGA 3FUHA 1OV8A 1T0NB 5DVLA 4GG6B 4C55A 1NBYB 3AXHA 4NC2B 2X0UA 1O7DC 1VGKA 2CGRL 1ZVNA 3PQYE 1DBKH 4YDIL 5KBMA 3HKZA 4UTCA 3SO3C 1AZZC 1A6ZB 4OF0A 2WVVB 2ZWKA 3B9DA 3N1PC 4O02B 3U2SB 3N1MC 3OD3A 4XP9H 5CMAA 1QPKA 5EOCJ 1EHXA 5AFAA 4UM9A 1JWUA 3BQVA 4P59L 4NRZA 5ACLA 2KDYA 1K4CA 4NUMA 4W9HC 3P0VL 5D6DA 2PNDA 3VXSB 3WFHB 3BKJL 4QYOB 3T2LA 4DOHB 5AAMA 4QXTA 3PWVB 3DBXA 3VCLB 3GPEA 1IIIA 3S88H 3RWHA 3QG6B 2A4EA 4LLDA 2GJ6B 1BG1A 4ZUSB 3DARA 2GUOA 3UTSB 4PRIE 1FP5A 2IANA 3Q6GL 4FYRA 3FUJA 2IBGA 5DJ6A 1YCSA 4JRWA 2XX0A 1KPVB 4IW4C 2DEXX 5EUOE 5G5DB 5T3XE 5IT2H 2X89A 3RFZB 2QQQA 2BK8A 3FT1A 3WTYA 1TEYA 3S8FB 4Y1AD 1G7PA 1XH1A 2FHFA 3PYCA 4MWFB 1AS7A 4WNSA 4NWUL 3NA9L 4AW7A 5DC9B 2VSDA 1EEQA 4YDJA 3L3HA 1PPIA 1CC3A 5EA0H 5EO0B 1P1ZB 2ZUXA 1I7ZB 2CK0L 2ORBH 1WDAA 4BDVA 3JVGC 2NY3D 4N9OB 5I5IA 1GZQA 3AS3A 2H3NB 4GKSA 3NDZE 2HRLA 4HCIA 1H6UA 1A7PL 1ZSDA 1UM6L 4PLKD 5GISL 3STLB 4MXWH 1IBYA 5IB4B 1VAHA 3IXTB 3R4RA 4MSWA 2HXAA 1JV2A 3M45A 4JFZL 4N22A 3EO0A 2NUTB 4P49A 3CVHB 1E28A 4MS6A 3I9PA 1BVZA 5AAWC 3CMGA 1MXGA 1JMZA 3WBDA 5I26A 5J8OA 3IETB 4BH8A 3UOAB 5DK2B 2ARJQ 3GSVA 4KC3B 1NAMB 4HHAB 4G9DA 4QRRB 3BAWA 3RZCB 4JLRA 4LOUC 5ICYA 5I74B 5GSVA 4N3TA 4PR5B 5KBKA 1G1OA 2YXMA 2JIXB 3DRTB 5C09E 4HKZB 5IB4A 2BOBB 2YRBA 5IFAH 1R3HA 3EFDL 1A6AA 1TYRA 1R5WB 3HVDA 4URTB 3OM3B 3CDGA 1JHLH 2CHNA 4QOKE 4E9SA 1P69B 4MQSB 1I75A 1DUZB 1D6EB 4RMRA 1KLGB 1HL8A 2BNQE 1IC4H 4ORGA 1U95B 4PJEE 4X6CE 1SHMA 2R1XB 5HYQA 4ILDA 5DZAA 4K73A 1B4LA 1J9QA 1KELH 1QNIA 2H26A 2Y06L 1F97A 4NBXB 1RURH 2D9CA 1ZHBB 1WS8A 2VDRB 2Y5TB 3GSRA 4U7SA 4DP0X 5FR3A 2VXSL 2AK4D 2XJKA 3ALWA 3E6HA 4L29A 4OF5A 3K81A 4ZMTA 2G5BB 4BGDA 3NBNA 4PTUA 3JXAA 3ZL2A 2VDNB 3CU7A 3MRPA 1G6RL 3L3GA 1CD9B 1LEKB 5KSUA 1EAPB 2A9AA 5B38G 5IUSA 5HHQB 1OY3B 2IALA 3OX8A 4HD5A 4G6KH 3QUZD 4CBZA 5K9OB 4Z7QB 4PFEA 5TJWK 3BZEB 1IT9H 1AD0B 1AJ7L 1NQBA 2J88H 3MKGA 3FQUA 2VR8A 4P59H 4KVNH 1I3UA 4TVPD 1FNFA 1FL6A 1QYGH 4M02A 2YA0A 4JHVA 4NYLB 1EAJA 3LVTA 1J9CT 4ZUTA 3SJVB 3F12A 3ZDXE 3KPRA 4DGVL 4HKJA 2UV3A 5IVXB 5E95B 2XC8A 5E6ZA 3TBWA 1FNLA 1KPUA 4OJFH 5T33L 2IQAB 1G1CA 1UWGH 2IAND 3MLZH 4HAGA 1CL7L 3ILDA 4WUUB 1IEAA 4KX8A 5IVOA 3TJHC 5KG9A 2ZCKL 2VKWA 2IF7A 4DPCX 3T3PB 5CN3A 2AJZB 1NGWB 2B2XH 5C0DB 4H8QA 5C08D 2KDGA 1R5IB 3K1DA 4XH2A 2KKQA 4Z78A 1BZDA 3LZFH 4V2CB 4XPBH 4ZNEA 1DVUA 1CF8H 3D3VA 4KTDH 2A6JA 1FYTB 1ZD6A 3S3DB 1P5UA 1AZBA 3MJ8A 1PX8A 3RFRA 5TFSL 1VFAB 4G7RB 5F7FA 3RNKA 3MRRB 5EU4A 4ZMYA 1NGZB 3LKOA 2NW2B 5DTFA 5GJSL 3TONA 2NY0C 4OIIL 2A4ZA 5KG9B 2GBVA 2CBOA 2GK2A 1K8IA 4GG6A 3VFTB 1ZWIA 3EFFB 1VJSA 4IMLB 4MJIB 1YPZE 3QC6X 2F5AH 1J8SA 2BNQA 1DFXA 3Q6FA 4HFWA 4XPGL 3TFBA 1WHPA 1X5FA 4MQXD 1M7DB 1YYLL 5D71L 5JPNB 3UZEC 2LQRA 3K6NA 4YJZL 1FYHB 2Y1ZA 2Q2EB 1ZXKA 4Y16B 4CNIA 1F58L 5IHBA 4L0YA 4P48A 2A99A 1U3HA 3S2AA 2YXVA 2IQ9L 2IGLA 3S97C 1MQKL 5DRZB 1XB8A 2G2PA 1A65A 5INCB 3ZKXC 1HZKA 3MACH 1FLRH 1NBCA 2P80D 1L5GB 2H32A 2AJVH 5BMFH 3PAYA 2E6JA 3IGAA 1ICTA 4JREB 4ZBJA 3RVTD 4K9EC 2QV4A 2VDNL 1GXEA 1OF0A 1JNNL 3DDFA 3FRUA 1ZHNB 2ZF9A 3BP6B 4DHLA 2JI2A 4G6JL 2LU4A 4EE2A 2P8PA 4P2OA 3ULVD 5DHEA 1BQLH 1U93A 3GHEH 4QRSB 1PY0A 1UM5L 4OM1H 2OXGA 2VAJA 2PYEB 2Y1VA 2PTTB 3LZRA 4RMVA 4YZFF 1R3LA 5FC9A 2YBRB 1DDTA 4BFFA 3HHMA 2XN9B 4QMEA 3VGHA 3MA7A 2YPLA 3WJLC 2BFGA 3REVA 3CLWA 4XMUA 2X4QB 3MR9A 4JKPH 1G43A 2FGWH 1I3VA 1DN0A 1A3LL 1ZKAA 3HOGA 3FK3A 3NZ8A 2QZ5A 3GMLB 4RFEB 1XQ4A 3HN8A 4KJQD 4MD4A 4DW2L 1C5BH 3VQ2C 3B1TA 1X5YA 4AV5A 3EGXA 3CFTA 4ABWA 1BZ8A 2AEWA 3ZZ1A 2NPLX 4FQLL 1JTOA 1QD0A 4PD4J 5IBTL 3SN6N 1EXGA 4G83A 1HXYA 5E1QA 3TJHD 4PJFF 4XN8A 2WXQA 1S7RA 3IXAB 1RJZB 4QGTA 1OXYA 4BCXA 2C9AA 1MFEH 5GRXG 4OLYL 1LK2A 2H45A 3VA2C 1ND0A 3D0VB 3ZGHA 5J1TC 1TETH 1GYCA 2OI9B 2Z91A 3KL3A 3LRGA 3ML8A 3UYRL 2HWZH 3APDA 3QJUB 1EHLL 2YD4A 5C0BD 1MCFA 3B6SA 5JDSB 1C8QA 2UVEA 3PJSA 4X5LA 3X1GA 4XO8A 1JP5A 2BVOB 4FLOA 5E08H 4JDTH 4QCIA 3HI5L 4XMVA 5ESAB 1EZVX 4U1JB 5KBDA 5D72H 3L7EA 1AQ8A 2VC2H 2EVHA 2AMGA 3MV7D 2HRGA 2HT3D 4GEJA 3P02A 4DP1X 4KVPA 4XCNA 4WY7L 4IOIB 3RPIA 1E90A 1F42A 1T1XA 1CYGA 1FVDB 3IJHB 4YO0B 5F1OB 1OWRM 4NO0B 3LN9A 3KLAA 3V4VH 4PGBB 5H37H 3C5ZA 3VB9A 4ZTEA 5T33H 3NDYE 3QIBB 3E3QC 5LKNA 2YQ3A 4WO4D 4JO2H 5CJOL 3O4LE 1VFAA 1T5XB 5A7BA 3KLSA 4PN6A 2NY0B 2XN1A 5F70A 1UOVA 1J87A 3HCVB 2G3ZA 3HLAA 5FFOA 1A3ZA 3FZUC 3X3GL 4NZ8A 3CSPA 3VWKC 1BX2A 4WV1B 1IVLA 1TZAA 3RKDC 3FCGA 4M48H 3VXSA 4PGCA 3HE6C 1AHWB 4LARL 4TN9A 2QVFB 1QKZL 2P8LB 1NM4A 1F11A 2K9UA 5DSCA 4PV8A 4IHBA 2X09A 4Y89A 2B4CL 2WBJD 4GB9A 4LCYB 1FE8L 2X4UA 3HG4A 5FO9B 2PW2A 4BK5A 4BD4A 2VGLM 1HHIB 4K4KA 2N7BA 1QFWI 2LE9A 4HCRH 2FX8H 4GAFB 4E5XA 4O2EB 1HSBB 1KCUL 2CHDA 2FL5A 2VDKH 4PIBA 4E9QA 2FBRA 1DSFH 1IGMH 1LJMA 3KL5A 1DP0A 3HA0A 2G0KA 3RWJA 1UGNA 5HHXL 5TFSH 4QO1A 3NZUA 3R0MA 5BNXD 2VCOA 5EPMA 3TBVB 4WV1A 4HWBH 4FNTA 3LS5H 4R4BA 3UGUA 4AMKH 3MKKA 3HS0A 1MJJA 4LF3B 1RMFH 4R2GD 2I9TA 3UX9B 4NUGH 5E6IB 1A66A 3MBEA 1AFVH 3RL1A 4DK6A 5I18L 3I6GB 2IFFL 3QHFL 5KANI 1TUPA 2WLIB 2AXWA 3U4KA 1UC6A 4L5FH 1KPRA 2DI8A 2VXVH 5F89B 2G60L 1HZHH 3QDGD 3TF4A 4E0RB 2HVJB 1OWWA 1HESA 1G9MC 2XVLA 2BIPA 1F58H 1VRSA 4LSTH 3UZQA 5GGSA 4DW2H 4DEPB 5JW4Q 3ZGIA 5A2CA 4Y5YA 2VO8A 1DVFC 4N2LA 1SDAB 1SVZA 4P57B 3WLWD 1B0IA 3G04B 2B5IB 1IZJA 2GEQA 4LEOB 1NGQH 1RFDH 1CICC 4TLSA 3MRDB 1QBBA 2YARA 3BAIA 3KH3A 5CZRA 3S8GB 1GYVA 5IVNA 2IEPA 5EOQH 1WLHA 4LT7A 1VB9A 4CNIB 3SQRA 3JWNH 1T1YA 2EEFA 2YA2A 1DBAH 1YNKL 3GC3A 3O11A 4KKLC 4Z5RA 4YHMH 2B1HH 2ICEC 4FZEH 1VKXA 1C16A 3HUJE 3DHUA 1MFCH 5EIIG 4ODUB 1LK2B 2WN3A 1A7QL 3F7QA 4S1SL 4UZSA 4Y19E 3CZNA 4G1EA 5JDJA 4KVCL 4NQVB 1FA4A 5F6HI 1N6UA 3BD4A 4NERA 2IDSA 2PXYB 3H9YA 1DBJL 4PYGA 1WCBA 1Z9PA 3F64A 3PGFH 5CLXA 5DYFA 4L0PB 4J3OG 4ALAH 2FEDD 4L4VA 4MCMA 2DWXA 3EBIA 1U8NB 1TVBB 2VH5H 3O3BA 5HD8C 4EQ3A 5JDSA 1C9SA 2E76C 3CDCA 4UOJA 1FFOB 4GRWE 1JGEB 1JHTA 1JGVL 1CCZA 5EU3B 5I1EL 2VDLH 1A0QL 1T66C 3Q8AA 4RH4A 3MC0A 1NGYB 2W0LA 4JZOB 5DZOA 3S4SG 5BOJA 3BAJA 4XN1A 1UXWA 1Q9KA 3B2UC 4NFBA 2Q8BL 1QABA 2YPVL 3NZ8B 1BQHB 4HF5H 2XPGB 3QWOB 1M1SA 3FTXA 4J4PA 5F6IC 3RWDA 1HH6A 1KPUB 2J57A 3V5HB 3VGDA 3TBTB 2L7EA 1SN5A 4AVKA 3GHBH 4XXCC 4QKXB 2IVFC 1VZGA 5CN1A 4FNPA 4HUUA 3W0WD 3P0YL 3K0WA 1X5XA 1R33A 2G5UA 1XGPB 3T6QC 2MHAA 4FXLA 2KHAA 4OFKA 1FVEA 3M1OA 2AJZA 4AC4A 1GCFA 5IW1B 5FO9A 3A24A 4JFEE 1Z5YD 4YFDB 1FSKC 2A5UA 1P5UB 2XN0A 3KLKA 1WE5A 1UOLA 1YPZA 4G1MB 3K6SA 1Q72L 3KJ6H 1MSPA 1JFQH 4DUXA 3B2UD 3ULVE 5IQLA 1HI6A 1JWMB 4EO5A 2QLVB 3LS4L 3O3EA 2B1AH 1FNHA 2CCLA 2ICWJ 3HPJA 5E8EA 1EFQA 1ZT4B 1CFTA 3QUMA 3RWJB 3VSVA 2CO6A 3NP3A 1IAOB 3S3BB 2CHWA 2BDNL 3ARGB 2DB8A 4HMDA 1ZT1A 1FE8H 2F68X 2BMKB 4I1NB 4A7UA 1NFDF 3HG1E 2IBZX 1RK1B 4UNVA 2R0WH 3ZTEA 2EIKB 3LYRA 1F6AA 4FJ6A 1DVXA 3RBGA 1OP5K 4ZNEE 2EC9U 1D5XA 3BVUA 1K4DA 3BO8A 5E9DA 4EUPB 1SJHB 2XZZA 15C8L 1NIBA 2JI1A 4HIIB 4OCLC 4KKRA 1QEWA 1DSFL 5JHLH 3D39D 1L0XA 4NDMB 3VXSD 1CDYA 4U6VH 2NCMA 3P30L 3VO0A 3O2WL 3T6VA 2SODB 3DK0A 2JKXA 5EV7A 4WUKH 5DC0A 1P2CB 4K94C 2GJJA 4GMTH 1RCYA 1UACH 4WU5A 2BP5M 1PW3A 3MX0A 4HH9A 4XNQA 4XWGH 3UTSD 2NOYA 1IARB 2OAAA 3TU6A 1F4XH 1ECYA 2Y0SA 3SE8L 3I3BA 3W1ZA 2E3VA 3IF1B 2K9FB 3KBFA 2I32A 2ZXDA 4OZIA 4Q2ZA 4UTAA 5IVXF 1CICD 1S7XB 3D12B 2VXVL 4FQXA 5FKPA 1KCSL 3SZKC 2R0KH 3HI6L 3L5WA 4IOFC 4PU2A 2P8MA 4HKXA 5GPRA 5BS0D 1PLCA 1C08A 5J13C 2OSLB 4HP5A 4YHIA 3TL5A 1UGKA 4P46D 3W56A 3MV8E 1MLBB 1LO0H 4WHTB 4ZRGA 3GPSA 1BQKA 3MV8A 4U1GC 5KYUB 5IEHB 3MLPA 2DKMA 2BOCB 1P1VA 4LSTL 4HSQA 5F7LB 5MENB 1LP9A 1SXZA 1ZHLA 4G59C 4PR5A 1DBAL 1NMAL 4HCGA 3V4VL 1T0MB 4C4UA 1EUUA 4KXZI 1R0AH 2AK4A 2F5BL 2B08A 1GZPA 3VG9B 3W9DA 4ZOEA 4F2MA 5CR1A 3LSOA 2QEJA 1MEXH 5LBSA 3S3CB 3VFRA 3MYZA 4K55A 2FO4A 4NQDA 3QT2A 3JUZA 4M7JH 4Y4KB 4NNYB 3X12B 2IH3A 1MFDL 1PG7L 5BZWB 4KJYB 4NNPH 4I18B 4J8RB 1TZOA 3DJSA 1UZ6E 5MENA 3TCTA 3ZDYB 4PGJA 4GKSB 2EE2A 1NPJA 3QRFM 1CE6A 5F9WC 4F37K 4ECNA 2R8SL 3QWRA 4GJTB 3QNXB 1XZ0B 4BUQA 5B7MA 3IVKA 1F13A 5AOZA 3VWKD 1DLFL 1IGIH 3C9NA 4ANVA 2A7BA 3T2PA 4D7BA 1R3LB 4IIZA 5ANME 4ELKA 5D1XE 5JIHA 1NCDL 5FW8A 4OFVA 1TQCB 5IJVA 1HWGB 1MFNA 3D50A 5AB2A 5HYSB 3CVHA 1R75A 3L5XH 4Y1SA 2Q76B 3BAXA 2P5PA 3H2QA 2NCEA 4JCWA 2Q6WB 4NPKA 1OE2A 1RMFL 2Y7MA 3TYFB 3CFCL 4OIAA 4C56D 4WJG3 1BEXA 5F88A 1YC8A 2MQ0A 4DGVH 3BVDB 4LSVL 4XPAH 4AGQA 5JHDA 2FAUA 4D8PA 4DZ8A 1L4IA 2CO7A 2F54B 2OMNA 3ARYA 3LQZB 5FW6A 5J11C 2YEVB 4GUOA 2K4WA 2COQA 4U1KB 1SLXA 4RDBA 3D3VE 4PRID 5DS8A 4F9LA 2WNGA 3F85A 5DJAB 5IREA 2PW1A 2BJML 3MUGA 4ONHA 5LXGH 5G55A 4PRIA 5LAXB 1UT9A 1IC5L 3BO8B 4K9EH 4N0CC 5E9DB 4EUPA 1KMGA 1NGQL 4G8AC 1QO3A 5D4IA 4O2EA 2LTQC 3IS0X 1FIGL 3EJQA 4Y1AE 5DA4A 3V5HA 3WN5B 3LQAH 3AU0A 2EDLA 3U6RA 3FW6A 4HBCL 1MCPL 43C9A 4P0DA 3AU1B 2IWGA 3VFUB 2DMHA 1KBWA 3L81A 4KMTL 2UZPA 3V0VB 4YSUA 4UQ2B 2P5EB 2OFQA 3CPUA 2IWKA 4LO9A 4WI5A 4ZFGL 1FFPB 2WN2A 2J8UE 3LQZA 3VGGA 1YEHL 4NRYB 5C0CB 5LLIC 4WGWB 3LRHA 4AIZB 3BKYL 1FYTD 3BFQG 2PW1B 2BVYA 2DQ6A 3HE7B 4FXKA 4TUKH 1EJOH 1QLEB 1CTNA 1G7IB 5B1KA 3T0EC 2RAMA 3DGDA 1RPUA 2OM5A 4F7PA 5I1GL 4Q9QL 4YS4A 4GINA 4KDVA 5BUPA 5GSRA 3RY6A 3RUGA 2FVNA 5DD1H 1UWYA 5ESQB 4R7DA 4P2QE 3ZL1A 1DE4B 2D8KA 2QQNL 4N2MA 3HRZB 3MGTB 5AZ2H 4DP6X 2YK1H 4A39A 1QMUA 4OGAD 1M2VA 1DANT 2MSPA 5C0NC 2X4NB 3OAUH 4PRPE 3QUXA 3UJTH 4MJID 5F7WC 1NFDA 5JPMA 3ROLA 3VXUA 3NEOA 2E4FA 5CZXD 4BEIA 5IBLC 2HSIA 4Y19A 2Z7WA 1W91A 3RTQD 4JN2A 4UOW1 4AH2B 2J21A 1MEXL 3UXFA 5LBVA 5E6IC 4FLSA 2X70A 1UA6L 3AG1B 4NIYE 1AIZA 5DZVA 1BWMA 2R29L 3K80A 2LFEA 3QZOA 1FC2D 1Z5LB 4IBUA 4QGYA 4ZNCD 4FC3E 4R7DB 4PJBE 2EE0A 4GP8B 1TJMA 3MRRA 5DC4B 5EU4B 4GKZB 4NQDB 3ZE0F 3CIQA 1GC1C 1GYAA 5HGAB 3QEHB 4F1ZA 7CGTA 3AMKA 5MI0C 3WIIH 2FR4B 4O9HH 3I6LD 1GMEA 4UV4H 4U0RC 2XI9A 3EJZC 1CIDA 2Y7LA 4G7YL 5IBUG 3ECVA 5E24E 2EIBA 2P7TB 2PXYA 5CEZE 5L8LB 3PV6B 4FMKA 1G9NL 5EC1A 3D3VD 3IPFA 1MI5E 3DV6B 1RK0A 2MKLC 4CN1A 4Z6AT 1PJ9A 4N2DA 1L0QA 1F3DH 2FIRT 5DFTA 2WQ8A 4UT7L 4Y4FA 2C4FU 5CZXC 4A67A 1TQCC 4TQIA 3RZCD 3OKEB 1X5LA 4LSRL 2UUDK 2X2HA 1WICA 3B2VH 2WZ0A 4L4VD 1P7QB 4PJDF 5KYUA 4A6YL 1L9MA 1FGNH 1MCIA 4C8XA 2VN3A 1OCZB 3KLQA 4OV5B 2P45B 4LVNB 4BZ1A 3NG5A 1MHHB 3QH3A 1I8KB 2HWZL 1NCUA 1TVDA 2EIDA 4YHZH 1DCLA 1WEJH 4RRPG 3ZL4H 2K6YA 1NICA 2NW3B 3PXLA 3FFCD 1ZHNA 4M7ZB 3BLBA 3U1QA 1C5DB 3HMWL 4YUEL 5LNGA 1DJGA 3O81A 3UBGA 3QYCA 4Q97A 5JW4M 1TT6A 3L4CA 5GGVY 2DQTH 5F0LB 2NUTA 2XICA 1CFSB 4Z0XA 2DOCA 2GT9B 3TO4D 5F7AA 3IT8D 3C87A 5A2AA 4Z5RB 3DX6B 2GIXA 4M9OA 4E41B 3CC1A 1F4XL 2BSEA 5FHAL 4LSQL 1T83A 5D93C 4HOWA 3BKJH 5L88H 3HVNA 5D5ME 2QPFA 1QSFA 1HXKA 1X4YA 2RFXA 2E75C 1FH5H 3THMH 4ODTH 3DXAA 4P2RA 4AITA 2ATPB 3FT2B 4IKNA 1CFTB 1GZHA 4N2EA 4LKXA 3M86A 1KB9K 3KLLA 3GS4A 1DEEB 2V9RA 4P9HC 5FKAB 5SX4I 4OSUH 4H8VA 3W2DL 1PDKA 2WIMA 4YPGA 4KROB 1NLDL 1BMGA 1CTMA 1DE4A 2OMVA 5F96L 5AVYB 2V7HB 1FJ1A 3IDGB 4MMYA 3QNYB 5EZIH 1QHQA 4D0CB 2DLIA 1NSNH 1U8KB 3SKMA 1YMHB 5C9KA 3BDYH 5J3HC 5K39B 3NSFA 4JEGB 1BAFL 2DQGL 1A7NL 2KBGA 1TZHA 3ARBB 3VM5A 1PZCA 4DKEL 3MX0B 1FQ9C 2PCPA 3AAZA 1MJJB 2MKWA 5DUPH 5I6OA 1HT6A 2WWNA 6CGTA 4QT5A 1T20B 4K71C 1U8MA 3CFKA 5D7IB 2OZ4A 3ZIYA 4LOUD 1CK0H 1FFNB 3QW9A 4DPAX 1V3JA 1WG3A 5D7KE 5EN2A 5F8RC 5A43C 1A7BA 4W9EC 43C9B 3SDYL 1SFDA 4PJHF 2BWIA 3HZMB 2VXTH 3HB3B 5GZOA 5T8IA 1LEIA 1RUAH 4J3OC 3U48A 2A9NH 5IGXL 1BZOA 1Y6MR 4IKLA 4NS0A 3MRQA 5FYKU 3C75A 4HPHA 1NUFA 1S7VA 1NZRA 4NHCH 4OGXL 4XOEA 1TQSA 4DN4H 4HW6A 1ZLSL 3V8CA 5A7EA 3ARGA 3QQ9D 1M71B 5JW4R 2DMBA 3KPTA 3ULUH 4H26A 2FJGB 5D7SL 2P8LA 1E4WL 1OHQA 3ECBB 4P23D 2BHFA 1GYWA 2ZNXA 5DA0B 5CD5D 4QF1B 3R4DA 4OQTA 2Z31B 3D30A 1KLFA 2NY3C 2PO6D 1M05B 1S7SA 1U42A 4HUXB 3IDNB 3B2DC 5EOCH 4QXWA 3HR5A 1G87A 1TO5A 3RVVD 4NDMA 2ZWZA 3UJJH 4MXWL 1KC5L 1AZCA 1XF5A 2GI0A 2IFGA 4HIIA 4ENZA 4J7RA 4UINL 5LUMA 4O02A 3AUVA 5LO7A 3HBZA 3NJNA 1A6WL 3EOAA 4MHHG 1OAQH 2WCPA 3ULSA 3KDMA 1MUJB 1WFMA 2XWEA 3RP1A 3T65B 5HGBA 4OV5A 2DDQL 3WELA 2IGFL 3P4OB 1X7QA 3QEQB 4ZFZA 1TLMA 4MX7A 3P3SA 2H32H 4N0YL 1ASQA 1YNTF 4ES8A 4Q4EA 1QNZH 3Q13A 1AD9B 4K7FA 5HHPA 1TJGL 1IBDA 2IANE 3QDJE 3RWIA 3T3MF 5K9JH 4WK4B 3IM1A 1OT1A 2FHBA 3AZUA 4TNFA 3RIFK 1MLCA 2EH8L 2ADGA 5C7XH 1Q0XL 1KPRB 3S4SB 2IH1A 3KEDA 4JKMA 4G6KL 3QXWA 4F9LC 1P7KA 4XE0A 1F4WH 3SBRA 1QX1A 1WBYB 4P57A 4PJIA 4NT6B 5AYTA 4PRPA 4XWOD 4QHMB 4TNWK 4X6DB 3RWFB 3MUY1 1PX4A 1AOHA 4I2XB 1FL5A 2Q2LA 4FMFA 3WLBA 2UYLA 4E9LA 5JOFA 4IBWA 4AV4A 2A9DA 3IWUA 5FOBA 3BH9B 2MNUA 4KY1H 3DSFL 2DQCL 5C0DA 1LO5A 1DQTA 3F00A 3BCFA 1O5PA 1EBAA 1Z3RA 2DEYX 1JK9A 3VD3A 2WLMA 3WMSA 3UTZA 3WFZA 5E7FA 3SCMA 1QI4A 3AQZA 5F7EL 4HWNA 5D6CB 3TPKA 2DWDA 4YVUA 5D1QB 3IKCB 5EIIB 4KDWA 5EZIL 1KNOB 2UY7A 4EZMA 2FT8A 1X5JA 3T09A 1CO1A 1M6OB 2B0SH 1BV8A 4DETA 3GSUB 4DOHE 5J5EA 5K59F 2NR6C 3U0WH 1OOAA 2UYLB 4YWGL 5D2LE 3CVDA 4P2QB 4W81A 2V17L 1A1NB 1YY9C 2B5IC 2CBQA 3MOBH 2C9UA 4I18A 3TNNA 2BSRB 4FADA 2WOBA 3SJVE 1J9TA 3QHFH 5KWYC 2P52A 5T3ZE 3NZHL 2XBTA 4ZMNA 2WP3T 1G6VK 2NY6B 2A74A 5DUBB 1KEGL 4CL7A 2XNAA 2ZT9C 3K6IA 1I82A 5JYMA 4Z3FA 5I8KL 4TMPA 5C0EB 3EFOB 4P8QA 3SGEH 1UATA 1BYPA 3C6LA 3MDJA 2ZUWA 3ZKNC 1AZRA 1A6ZA 4JS7A 1M42A 2Y24A 2PPDA 5CEYB 1ZANL 2H26B 3FO0H 1K8DB 1ET7A 1JN6A 3PPSA 4KTDL 5GIRA 2G75A 5FO8A