5JQIB

Crystal structure of fimh a62s from e. coli uti89 bound to fimg n-terminal extension
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
279
structure length
277
Chain Sequence
FACKTANGTAIPIGSANVYVNLAPAVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSSFSGTVKYNGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPTGGCDVSARDVTVTLPDYPGSVPIPLTVYCAKSQNLGYYLSGTTADAGNSIFTNTASFSPAQGVGVQLTRNGTIIPANNTVSLGAVGTSAVSLGLTANYARTGGQVTAGNVQSIIGVTFVYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimG N-terminal extension
publication title Evolutionary fine-tuning of conformational ensembles in FimH during host-pathogen interactions.
pubmed doi rcsb
source organism Escherichia coli (strain uti89 / upec)
molecule tags Sugar binding protein
total genus 58
structure length 277
sequence length 279
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2016-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00419 Fimbrial Fimbrial protein
B PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB01
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5jqiB02
4XOCA 3BFQG 5ABZA 1ZE3H 3ZL1A 4XOEA 4J3OG 5LNEA 1TR7A 4X5QA 2W07B 4X5PA 3ZL2A 5AB1A 5LNGA 5IQMA 4LOVA 4J3OF 2J2ZB 4CA4A 5IQOA 3ZPDA 5IQNA 2XG4B 1KLFB 1N12A 4AUUA 5FWRA 3RFZA 3JWNH 3BWUF 4XO9A 3JWNE 5CGBA 5AALA 5F2FA 1QUNB 5FLUA 4AUYA 3BFWA 5FX3A 4AV4A 4AUJA 2UY6B 3JWNG 4XODA 4ATTA 4CSTA 4CSSA 2VCOA 1UWFA 5AAPA 2WMPB 4AV5A 4AVKA 4XOAA 4XO8A 4AV0A 3SQBB 4X5RA 4AVIA 4XOBA 4AVJA 3MCYA 1KIUB 1N0LB 5F3FA 4BUQA 2UY7B 2XG5B 5JQIB 2JTYA 4X50A 2JMRA 4AVHA 1PDKB 3ME0B 4J3OH 5FS5A
chains in the Genus database with same CATH superfamily
2VXSL 4FADA 3IDXL 2FATH 5T1DH 4DW2H 2VDQL 4KQ4L 2BOBB 2M26A 3BXNA 4TUKL 4S11A 1F6AA 4X7SL 4IBVA 1BQKA 1PD0A 5I5IA 3KBPA 3QIWA 4GSXA 5PAZA 2JKXA 3KR3L 8CGTA 4PW4A 2BX5A 4U6XA 4K7PH 3KVQA 4W9FC 5K9JL 2ETWA 2ALAA 5CHNA 2P24B 5D7LB 4NQVB 4ZI8A 4OBSA 4ZSOE 4PJDE 4A6YH 2GBTA 1KFAL 3ABMB 5F7DA 2VXQA 1KJ2A 4TULH 4XHQA 3RWIB 2LU4A 4B7LA 1CGXA 5KJRL 5LBSL 5F7NC 1HH9B 3CIQA 3PL6D 1HXMA 1QFWI 1VEOA 4JM4L 2EEFA 4P2QD 4OV5A 3WNNA 1ZXQA 4XZ4A 5E0FA 1D9KD 5D1XA 2QLYA 2BVEA 5DO8A 3FTZA 2IQAA 4JY4A 2ARJQ 1G0YR 3MBXH 1EEYA 5IWLC 1FFOB 3CTTA 3ETBJ 4FFZH 3U0WL 43C9B 4XPAL 1N59B 2HFGH 2BSTB 2QQKH 3SPCA 3LV3A 4F2EA 3PQYE 3UBXA 3L5JA 1KLUA 3VB8A 5CSGA 4OIBA 2OR8A 3GBDA 4F8LA 2DYRB 2X28A 3H8NA 3IU4L 5FYJD 4UTBL 1U93A 4DESA 3EO0B 4FULA 4K8RH 3UYRL 4X98A 1YUHA 1KEGH 2ATAA 1INDL 4QKTA 4QTHA 2XA3A 3HN8A 4L4TD 4XWOD 4JZNA 1DBKL 1DLHA 1QHOA 2VDOB 1MJ7L 2RBLA 1T7VA 2WXFA 3B37A 4Y1SA 4CGUB 1CFVH 1RLWA 2F74B 3ATEA 3KPRD 3LN4B 4OD1L 4YBLC 5HGDB 3NFPA 4OJFL 3PHQA 3UJIH 2WBJB 2IGLA 4OCYH 4RQQB 4JFVA 1V3MA 3S6CA 3GBNH 2B1HL 1IE4A 3KJ6H 4CSZA 4AJWA 5HYJB 4L18A 1ZLUH 3ZIYA 1DVFA 1FNSH 4H8WH 4ZW7A 4QJ4B 2VLJE 3TO2B 3D39B 1AGCA 3S3JA 3V0JA 4UT9A 2E8ZA 3WEXA 5DJ2A 4MASA 3T65A 2XBTA 1Y0LB 3VFOA 4IKKA 1IGCL 3LN5B 4C58B 3TYFB 4LP4A 1CTOA 4H20H 3T5WA 1HSAA 4YX2L 3I9GL 3U46A 2NY7H 4U7MA 1IBZA 1HILA 2B20A 3RWDB 1ZOXA 4LBEB 3NZHL 6CGTA 3EXJA 1SF5A 2EXSA 4OZ4A 1FYTB 4S1RL 3QAZB 5DMKA 5ISZB 1D3CA 1LEKA 3T2NL 1N67A 3F85A 1J1OH 3IDJA 5FYJU 2W9EH 4GAJH 5LUMA 2ZXDA 3WNMA 3Q2LA 1PLGH 3KPMA 2NMSA 3IJSA 1NUGA 1OGPA 2R0KH 1OGTB 3S88L 1U8MA 1HHIA 1QVOA 4A7GF 3WKML 3TT1H 3SDXB 2P5PA 3K6IA 2Z91A 4PJCB 3GXMA 3MR9A 5AOKA 3WMSA 1NMAL 3EF7A 5T1KB 5TJWK 1U3HA 3VXOB 3ZPDA 4PJ8D 1CTNA 1VB9A 4O2CA 4OZFH 4EXKA 2ZNXA 4B9KC 3HPLA 3QO0A 4FYQA 1FAKT 2B9AA 2PR9A 2FJFA 5MERA 4UQCA 3TA4D 3HB3C 4LSUL 1ES0A 2E3VA 4RRPG 5EU6D 3P4OB 4PPTA 5I0DA 2EICA 2VL5B 2MWCA 3AQZA 4I3RL 5FWRA 2DB8A 4MNQA 5EMYA 4Z77B 5EBLB 4O4YL 3WTWA 4H0LC 5CGBA 5DRXB 3BMWA 3MYZA 1O6TA 2X1PA 3T0DA 3ZE1F 1RLBA 2JF1A 3U7WH 3VI4F 3GM8A 2BCMA 5CILL 1B0GB 4IDJH 5DA4A 3DO7A 2Y22A 2DQUH 4HK0A 1LO2L 1P7KA 2EEBA 5D7KE 3VACA 3S7GA 1FFQA 3SKJH 3N04A 4JFOA 4F93B 4PJ9A 1NGPL 3V5DA 3LIZH 4LSTL 3QE5A 4WI6A 4AV5A 3WO4B 3AUWB 3FQWB 2B0SL 4FS0A 1HXKA 4GW4A 3HC0A 2WWMD 4OCNC 4Z0BH 1PTZA 2J73A 4XNBA 3F01A 1A4AA 3RVTD 3X13A 2Y7NA 4FQCL 3MLXH 3QUGA 5GS0D 4G6ML 2LU3A 4YZFE 3V6ZB 1MVUA 2L0DA 2ZAHA 3IAPA 2DQTL 3GEFA 4MA1B 5JHBA 4IRSA 3WXWH 5JIDA 4P5TA 1EMTL 1IFHL 3OAYH 4PJIE 4PTUA 4Z95L 5E6ZA 3TBYA 5CO1A 1EO8H 1KENH 4JPKH 1A3LL 4CC0A 1XGQA 3D1MC 1WT5C 1DBAL 1KYAA 3JWDH 2NXZD 1I8KA 2W38A 4JM2F 3L3OB 1C08B 3RTQA 1E3FA 3AACA 5I66A 2N0MA 2VLKE 4ONFL 2E27H 2WQVA 2WUCL 3GXDA 3X14A 1PYWA 4YUEH 2Q1EA 3BW9B 1E67A 3EO9L 4EE2A 2Y07H 2Z93B 4P2OC 1HWGB 4ODHH 3UAAA 4PJEB 3U9PH 1DQMH 5ANME 5CJXA 2AGJL 3MRPB 4KK8C 4N0RA 5A2JH 4L3EA 5BV7B 3HLAA 1A7NL 2QHRH 1GS8A 1MFNA 2IDQA 1GZQB 3CZLA 4PJHB 4X4YA 1JV5B 1MWAB 1UA3A 1IKNA 3N41F 5C0DB 5C0GB 2F8OA 4O51A 2YD9A 1NIFA 2DWEA 2GQHA 4E9QA 3UEQA 1U21A 4AM0Q 3G08B 3C60D 5SX4H 4JB9H 5FYKH 2PF6A 1A0QL 1MPAH 3MREA 5C0BA 4FNTA 1NCAH 4G8GD 4PHZA 4DGIL 1CN4A 1IBBA 4GXFA 4PJHF 4P2RE 4TVPD 4WJKB 5GS1A 1TNNA 1G7JA 3NIFB 4YE4H 2BPBA 2LABA 4PJXE 1A5FH 4OIAA 2XG5A 3CH1A 1F58H 2ADIA 3JWNH 3O6LH 4HHAB 3ZT7A 2PXYC 3FT3A 2CK0L 3BP7B 3NCJL 3L1OH 4WU5A 3UPRA 3FU5A 3VI3F 3DKHA 4QTIH 4PW9A 3LD8B 3SYQA 4QXVA 2QGDA 3LQAC 4LDCA 3VXTB 1XO8A 4P8QA 4Z5RB 5DJZA 1CDGA 5HDLA 4LVHC 4LLWA 2XVBA 1R9FA 3SGEH 5JMOC 4YAQA 5KSUB 3CX5K 3RY6C 1CLOH 5HGBA 3VJ6A 4XBMA 4U05A 4JG5A 4M4RB 2IIJA 2QJDA 2OSYA 4Q9QH 2EE9A 2BOBA 2AK4E 3THMH 2DMHA 3DIFB 3T0EC 2IH8A 2GIXA 2VRAA 4B97A 1K6QL 4I9WE 3QQDB 1MVFA 5HVHB 3QNYB 1NAKL 4MDIA 4ZK8A 2P24A 4NQVA 3W2DL 2NNAB 1P7QD 3JV0A 4FLRA 1A7RH 4ABVA 3C6SB 3RWIA 3CLEL 3CFKA 1HH9A 1WAAF 2YPLB 4ODUB 3DX3A 2PYEB 3CSFA 4JANB 4KK5C 1OD9A 4WGWB 4KKLD 1LQBC 1SXNA 3ZUCA 3WUZA 1OTTC 2I07B 1ZVYA 1DJHA 2ZXAA 1TKWB 4I0CC 1CXEA 3EDEA 4FLSA 2FBOJ 4LVEA 1FFOA 1H8SA 1WA1X 2XPGB 2D2CC 4NPJA 4YHKL 3MXVL 2W91A 5DD6B 2EE2A 1AR1D 1WLHA 2H5UA 1VSCA 1DQLH 2LHAA 2NY5H 1L0YA 1NCWH 3V5HB 4ZFGL 4N0YH 3N55A 4MXVF 2IANB 4WI7A 3NSYA 1WA0X 3GKWH 1R17A 2HRPL 1K8IA 2N7BA 3HCVA 1AG0A 4URKA 2K8MA 3EO0A 3PV6B 3B43A 4NZRH 3NJXA 3PU7A 2B7DT 3MOAL 3EZ8A 2UUDK 5EU3A 3GI9H 4MQTB 2C1PB 1LYQA 3FO0H 3LHPH 4DGVL 3VA2C 1AE6L 4XPTH 2IBZX 1G43A 2H32A 1UM5L 3ARWA 2XBZA 5HGDA 3RJOA 2XIIA 3O2VH 3V0AC 5AAWA 4RQQA 3DMMB 3WLWC 3GSVA 3WHE1 1JMXA 1MFAL 5HYJA 2E9JA 1WWWX 3KW7A 2YN5A 3V8OA 2D0HA 4DEPC 1Q90A 3TO2A 3KNBB 3D39A 2EEAA 1A47A 1W6WA 2ZKHH 5ESVB 3HFML 2I26N 3BP5A 2E56A 1ZK5A 4PRPD 4LQFL 3JV5A 1AZCA 1Y0LA 3MV9B 3PWUB 4HGWA 3LN5A 2CDEB 4XC1H 4XCCL 1DUYB 1UYWL 5CLXA 4EKXA 4Q2ZB 3EO1A 3TH3T 3C8KB 1T5XA 1E2VA 4FP8H 3RZWA 2VH5H 3H9ZA 4LAQH 4NJAH 4A7GA 4LBEA 1F3RB 2MQGA 1JHKH 1L3NA 2JKLA 3CPUA 4L3CA 5HJ3B 4V2CB 2DYPB 4O02L 5ISZA 3T4AB 3U30B 4RFOH 2Q7NA 4AEEA 3LKQA 5FDYA 4DKEL 1R5WB 3BIAX 1MJJB 1OAXH 2QPEB 3VCLB 3F8UB 4H8UA 5IMKA 1OGTA 4U0RC 2LT9A 5EWIH 4KFZC 3SDXA 3QC6X 1WO2A 5I5RA 3D85B 4WO0A 5D5ME 2NDGA 4PJCA 2M8XA 2XA8L 4GQ9L 3VXOA 1EJFA 3SCMD 3D25A 4APXB 3H42H 1KT2A 3BFOA 4TTDC 5HI4D 2O4EA 1K2DB 1USQA 5KJ4A 1UHVA 4KO5A 1FFNB 4FYTA 4L8BB 3P4OA 1X5JA 1HNGA 1EAPB 3BKCL 4N5EC 2FIKB 4JFXA 2ZCKH 1ZHKB 1FVCA 1NEUA 5EBLA 1CI5A 3BZ4A 3V6OC 1P84J 4NZDA 4DKAA 5BMFL 4A7QA 2HLAB 2A77L 3D9AL 3FYEB 4GXVL 4L29A 5ILTH 2LTQB 3QUXD 1U8PB 4LARL 3ZE0B 3LB6C 1GPOH 2HKFL 4N0CC 2CMRH 3ZMRA 4XOEA 4I0KA 1B0GA 5GGTH 3TJHC 4HV8B 3R4DA 5LNEA 2ZWZA 3N1FC 4W68A 1G7PB 2B5IB 4R7LA 2GSGA 4JG0H 3RVUC 1W80A 5HHQB 2ODHA 3MUY1 1OSEA 3MNVB 4DGYL 5J6HB 3GD1C 4ZXBC 1DTUA 4NAJA 3I84A 1Z3GH 3D4ZA 5I73B 3B8YA 2FCBA 4OLVL 1LE9A 4MQXC 1OPOA 2XTJB 2XETA 5H37G 3T3MF 1BV8A 3V6ZA 3S36L 3O0RL 2CJTA 3BPNB 5ELIA 3KXFA 5D7IF 1YEHL 5FUCE 1CBVH 1IC5L 1F41A 3V9CA 1GCYA 4LLQB 2H8PA 4F8NA 1KGIA 2WXIA 3B7SA 4U0QB 4G72B 4Y4FB 3TTSA 3MJ7B 3LNFA 3N1GC 4NIYE 3Q5OA 4YDKH 3GWJA 1SXAA 3L3OA 4LCIH 4M56A 1H3XA 4NS0A 3UO1L 2NDFA 3APMA 5LB1A 1FO0A 4Q97A 1HHHB 5HGHB 5E00A 1QFPA 2FE0A 3BGFB 3RL1B 2QVTA 2FIRT 3BW9A 2F18A 4UINH 1T6BX 4OLXH 2Z93A 2GY7B 5FK9A 1NC4A 2OK0H 1K3IA 4UNIA 2K3HA 1PZAA 3QEGH 4PJEA 5I24A 3KVPA 1A65A 1ILUA 2ZUQC 3L4WA 4AL8L 5DMGC 1AJ7H 2ZCLL 3CD4A 4PJHA 5C07E 5KBPA 2O30A 5IKCB 1JV5A 1MWAA 2JI2A 4TUJA 4EUPA 3GXFA 5C0DA 4KKCC 5C0GA 4C56E 1HQRB 2OMYB 1CL7H 3MNDA 2JNZA 3L3GB 2PO6C 4ZUVB 4HIQA 3WFZA 5T3ZD 4MXQD 2CO7B 3G08A 2C9RA 3ATDA 3EJRA 2ITCB 4P9HC 2FGWH 3SKMB 2W92A 4FFYL 1E3XA 5GZND 4GUQA 2DQGH 5EB9A 3KLLA 4UUJB 1TQCB 3RKDC 2YAMA 4JR9L 4MCMA 5D2LF 5IROC 1BVOA 4U1JB 4K8RC 3UTSE 1KGUA 4H44C 2X4QA 5KSVB 3LS5H 4C59B 4IRJD 4NBYB 3BP7A 1AY1L 2J71A 3TU6A 1KV7A 2XWZA 5BVPH 1OVZA 3IJEB 4K23H 3APDA 3U9UA 2MCG1 5K9QG 1KBPA 1LK3H 3U4EB 2DIEA 1CI3M 2X2JA 3VXTA 4AJVA 2Q3XA 3UC2A 2DKMA 3QNFA 3GO1H 3VYNA 5CFAA 2HZHA 2L7JA 1CGVA 1ERNA 1CLCA 1DZBA 1X5XA 3OV6A 4NQCB 2H1PH 1O7DE 4M4RA 4Q74A 3D2UB 4QXTA 3ZL2A 3OGCA 1ZE3C 4Y2DD 3FSOA 2ENJA 3WJLA 2QQQA 1WAAA 3UJTH 1UATA 3DIFA 1JFQH 2VDNL 3QQDA 2VXSH 1NH6A 3DJ9A 3IDXH 1PLCA 5MI0B 2X2UA 4KXDA 2DI9A 2VDQH 4KRPD 1UH3A 4KQ4H 4Y5VA 2P4AB 4TUKH 4DETA 1B9ZA 3GLEA 5FGCB 1CB4A 4AQ1C 4X7SH 1SVBA 5SX4I 4D9QD 5DZNA 4X5XB 1UGNA 3C6SA 4W9JC 1FP5A 1I82A 1GYVA 2ZG3A 3HG1B 3MV8B 3KR3H 2Q6WA 3TWYA 2BZDA 4Y4HB 2BLFA 1N68A 4YIQB 3W81A 2V8MA 3GMNA 4YGVA 1WHOA 2PYEA 3LXCA 3P3RA 4JANA 5EOCL 3TP4A 5K9JH 3X1GA 3GMOB 3WMQA 1Z32X 1KFAH 2I07A 1YYLL 4NQEE 4EN3A 1TKWA 1WK0A 1QFWM 5D1QC 4HKXB 3QJUB 1A1MA 5GRVK 2OV0A 5KJRH 2BS71 5LBSH 2QV2A 4CVXB 2UWEB 4J3OD 2XPGA 3A24A 3LPFA 4B3VA 2HG0A 1FLTX 4JM4H 1TCMA 1UG9A 3W0WB 2P5WE 4KO6A 3A4AA 3V5HA 3SGEI 3SJVD 2IANA 3NCYP 4YEEA 1KIUA 4UTAA 3CFJB 4HUNB 3U0WH 2ZSWB 5IESL 2K4WA 4UBDD 4JKPL 4XPAH 2VMEA 4MAYD 2FYVA 3PV6A 2D0GA 4AYEC 4C83B 4YMPA 4P49A 3OX8A 1JTOA 3WU1A 1RZPA 2UWEF 1MW2A 3BZFB 2C1PA 5L4MA 1QX1A 3VWKC 4UTBH 4JO2L 3NG5A 4F33B 1PSKL 5I76A 3PNWA 2OYLA 3UYRH 4PLNC 4PBVC 1L6ZA 4WO4C 1RIUL 1INDH 1UM6L 3LEVL 4KI5D 1JZ4A 1JZ8A 1XGPB 1DBKH 3DMMA 1TQBC 4CKQA 3ARPA 3UTZB 1OV8A 2NQ3A 1ZPLA 3KGTA 5JQIB 2EDMA 4P9ML 3O9WB 4OD1H 2IGFL 3O3DB 3O8XD 1U95B 4AVHA 1GTFA 5JOFA 4OJFH 5IK3B 1KB5L 4KMLB 2LVCA 3QIUA 4HLZH 2LU5A 4XPBL 2B1HH 2YA1A 3IJYB 1TEFA 4JFTA 1OP4A 2DLEA 3BVNB 3PWUA 3OXSB 4OBRA 4AW7A 1DUYA 4NFDA 4RGMC 5GRUL 4Q2ZA 3VXSB 3LPPA 2BVQB 3C8KA 2CHDA 3LSOA 1CDIA 1UXMA 2Y1VA 3FQ4A 4BBWA 4HQQL 3FL7A 1CFBA 2E9WA 2H45A 2O5ZH 4PLKC 4LLAA 3BT0A 3KPRE 3EIFA 5IUCA 1I1AB 3E9TA 1IGCH 3LRLA 3PUUA 4JFFB 5HJ3A 3T4AA 5EUKA 3TBVB 1JAEA 4YX2H 1F86A 3I9GH 2OL3B 4QWWD 5LNGA 3NQIA 1R5WA 3NZHH 2VR7A 2XQYK 1XF3B 3VCLA 3DX9A 3I75B 4AGMA 4S1RH 3ARGB 3AU0A 3BRFA 1NUDA 2JLPA 3RY5A 4WHTB 5D6DA 3T2NH 3RUGB 4FI6A 4JDVA 3D85A 1MWOA 1MQ8A 3ULVD 3MRBA 1D7DA 1PGRB 2GIMA 3KGRA 4K0OA 5AEAA 4G80B 5BUAA 2DEXX 3C5ZC 3Q2NA 3ZHKA 3S88H 1TQVA 1Z9NA 5FM5M 3WKMH 3B9KC 3TN0A 4U1IB 1K2DA 3WHXB 4HEPG 3U83A 1YEWA 3B9DA 4XZUB 1NMAH 2FLRT 1QFHA 4L8BA 3VXMD 1EAPA 3MVSA 2FIKA 3L54A 4ZX6A 1V7ML 1NCCL 4E9VA 5EHFA 2OX5B 1GS7A 2D8KA 3GXNA 4GOSA 4KU1A 5F70A 2GW5A 2FO8A 4LSUH 3G6JB 2IADA 4KKPA 3HE7C 2WSPA 4J8RA 4I3RH 2H0PA 2WOBA 3UERA 5DC2A 4HV8A 3IDNB 1G7PA 4QRFA 4IQHA 5L88L 4CJ0A 1ZJBA 1OK8A 2IOIA 3QUYC 1E4KA 5HHQA 1L6XA 2HYMA 4POUB 4AYFA 2A6JA 3QFGA 5CILH 2XWTA 3MNVA 2Z31B 5D7IA 4AW4A 1ASQA 1MHPL 1LO2H 2EDOA 1CVRA 1AXTL 3MNWB 1PIFA 5HBBA 3JWNC 5KS9B 3T9WA 2IFFL 4TQPA 1NGPH 2WNXA 3RWCA 2ADJB 3QDGD 3K46A 1FL3B 1BM7A 3KL3A 4LSTH 5AAMA 4YSRA 1OQXA 4X9GA 4HWNA 1DJWA 2CBOA 2B0SH 4A63A 2PW1A 4LVOC 3ORJA 4G6KL 5EUOE 5IVZB 3INOA 4QXGL 5A40E 3FW6A 2EIEA 2YOAA 1U30A 4RAHA 1XCQA 3D5OF 3WTVA 5MENB 4FQCH 4RZCB 1P9MC 4LLQA 4G6MH 1HJCA 5KS9F 3NCCB 3R0MA 3QDMD 1P4LB 4OF8A 2ZAGA 1YC7A 3MJ7A 5CLTA 3S3PA 4B60A 1SM3L 2J72A 2DQTH 1JF5A 3AY4A 2E74C 5I8CA 1SXBA 4X0NA 2GTZB 2OI9B 1EMTH 4JPIB 5HGHA 1IFHH 4Z95H 3MO1B 4JKLA 1HCYA 2A83A 3RL1A 5MEQB 5J1AA 1A3LH 4YXLL 3CFEB 1DBAH 1G1KA 2QSVA 3M07A 4JDZA 3MFFB 2K7QA 4NO2A 3HE6B 5GRZA 5IFJB 4CA4A 1KIRB 4PJDB 4ZSOB 5F1OB 2JFCA 4ONFH 2WUCH 2N1TE 1TTCA 5IKCA 3EO9H 3L3JA 5D2LA 1GSMA 2G5BB 2JXMB 4PMFA 4M48L 1HQRA 2NRDA 2OMYA 3L5HA 4KJWC 5H35B 1VCAA 2AGJH 2DWSA 3L3GA 4HU2A 4ZUVA 2YGPA 3D12B 2BXYA 2DMKA 5DD1L 1A7NH 2CQVA 1J8HB 4XVTL 3NRFA 2IVFC 2VYRE 3J7HA 3SKMA 2WV3A 1EAOA 3BAJA 5DFVD 3BEVB 1KJMB 3QJXA 5FKPB 2W9LA 3ZTJG 3PQYB 5C2BL 2V5YA 4GBXC 1VEMA 3U82B 4JEGB 4U1JA 1T7ZA 2R2BB 3OBAA 2CGYA 2WWOA 3DOSB 1HQ4B 1SNRA 1SUJA 2FEDD 2HG5B 3A21A 3P9LB 3OSVA 4J3TA 5EZIL 4DP2X 5I1GL 5KSVA 4XNMB 3EUDA 4J27A 4L9DA 5MP6H 1LTXA 1EX0A 4F7EB 2NT0A 3U4EA 5EOCJ 1T0MA 4G7YL 3PDOB 1G9ML 2HX7A 1NC2D 4PCKA 3NCJH 2CK0H 5FWQA 2AQTA 1R33A 4BHUI 1PX8A 1VFUA 4XP9L 3D2UA 1SXCA 2DTSA 5AW2B 1MF2L 4QEGA 4ICXA 1UJ3B 1HOCB 4YQXL 3X12A 1WQVT 1HHJA 4ADIA 3PWJB 2VLJB 3QISA 3ZDXE 4TVPE 5L2KB 1JDAA 1CL7I 1QLFB 4S0SD 5HHOE 4PWIA 4U1LA 4PEEA 2BVOB 5BRZD 2H4EA 5JYMA 5BNXD 3KWVA 4JVPA 1Z9MA 2Y69B 3N43B 4ELMF 4X5XA 3FN9A 4LVNB 4Y1AE 1K6QH 2ZUSA 3MV8A 2BFGA 2YSSA 4LO9A 2QFRA 4MKTA 3V52L 1XWVA 4UZUA 4YIQA 2K1MA 3HAEH 1NAKH 3L8QA 5A2KH 2B8OT 4PBWD 3W2DH 5I6NA 3BFQG 1RV6X 1M9SA 4N2HA 4J3XA 3CVHB 4HKXA 4NC1C 2ZTBA 1T6WA 3CLEH 1KJVB 4XB7A 5J1SC 2DQIH 2UWEA 2UYLA 4CVXA 4ORZC 1UZ6F 3FUKA 4FQ2L 5D93B 5FO9B 3QDJB 2W0PA 1U8OA 3W0WA 3U1PA 1F4XL 4K7FB 2QVMA 1J8RA 2BJML 2A9CA 2Y7QA 2ZSWA 4YHKH 3MXVH 1J9CT 4ISVB 3JBG7 2WYIA 1QEWA 3BKML 4BFEA 3I74A 2EXWD 5K39B 3CQQA 3L1EA 1CDUA 4WWKD 4ZFGH 3O3EA 3BZFA 2F58H 4WKXA 5DMIL 2RFXB 1E9PB 1WICA 3J27A 5AW4B 2HRPH 1FL6B 2K6WA 1CWVA 4FQXD 4CU8A 2Y1AA 2Q8AL 4XPGL 3ECUA 1PAZA 1H19A 2IBZY 2NYYD 1ZSHA 3MOAH 5IW3A 1N12A 3WIAA 3VD2A 3SDDB 3ISYA 4DGVH 3UAJD 2EDTA 2XN0A 1AE6H 3O9WA 5D1ZA 5BUGA 3LKSB 1U95A 1FNLA 1UM5H 1V3KA 3VXQB 1NEZG 1MZYA 3T2LA 4HH8A 5GSVA 5FGBA 4LDOB 4DVRL 3A5VA 2UZPA 3HZKB 1JPEA 1MFAH 3BVNA 4FLHA 4N0UB 4ZOAA 3OXSA 5DD0L 3VXSA 1FF5A 3AMLA 4LOFA 2PW2B 1MJ8H 5SWZA 3DARA 1A9BA 1UVQB 5IMOA 5GJTL 2ATPA 1R3KB 3Q2CA 4LQFH 3VTTA 3FFOA 5I15L 4G8EB 1I1AA 3ATFA 2EKJA 4KI1A 1UD6A 2CM6A 4XCCH 3S35L 1UYWH 1KPRB 3D05A 4L9LC 5JW4Q 4JFFA 1AGBB 4JFDB 4UDTB 1Q0XL 1WFNA 2D3NA 3TBVA 2F1BA 1BQRA 1ZHLB 2OW6A 3CHXA 1QRNE 1OE2A 1ZSDA 4CVWA 3B2PA 5JZ7C 4KK6C 1A6VL 1I1FB 5FC9A 3MBED 4P5MB 4MWFB 1OTSD 1QI4A 3CX5J 5J06A 3ARGA 2JLLA 4O02H 4BZ2A 3G6DL 3QPQC 4KQ3H 4QRPB 4WHTA 1CFMA 2PYFB 3DETD 5D1XC 3ZVVA 5AVYB 4DKEH 2AZUA 4X6CE 2A7BA 1NTDA 3KWUA 5KSAB 3CUPB 5EEZA 3I6LE 2ZKMX 4PJIB 4OKDA 1H8LA 2P42B 1DDHB 5EIIA 1CD1B 2IWEA 2AVGA 1A8JH 2C7FA 1HESA 3V5KB 2EXYC 1BBJB 1DJYA 4GAGL 4U1IA 3WHXA 2XUWA 4QRTA 1XAKA 2XA8H 2UVEA 4XZUA 4FXGB 2P28B 3O6MH 3SE4A 1MLCB 4GQ9H 5E6IA 3RDTD 2VLKB 4J4PD 3IM1A 2YAHA 3C8DA 3WFCL 4ODBD 1YEEL 2HTKD 2DKSA 3WDHA 3BD3A 1FNGB 3TA3D 2OX5A 4PM1A 4NP4H 2HVBA 3G7TA 1GSKA 5ANMB 1JGIA 1S7UB 1ZDSA 5EF1A 3HPJB 1JPSL 3BKCH 2CDGB 4X4XB 2GCYB 1XL6A 2O6DA 3UG4A 4OI7A 2WWKT 4DP0X 3HBQA 3IDNA 4PGBB 5BMFH 4L37B 2A77H 1E6JL 3D9AH 4GXVH 1QUNA 2IPUG 1F90L 4YPGB 2BFVL 1BXVA 5A3IC 4Q89A 3NFSH 4DGWC 5HHME 4JL1A 1RMFH 2F7IA 4LARH 4LNRA 1IM9B 1M7IB 2HKFH 4N25A 4QHNB 4XP5L 2AQQA 4ILDA 1OWWA 2Z31A 1IRAY 3TBWA 5IB2B 4JO1L 4F57H 1YCSA 2CALA 2YGVA 4JQVA 2MTAA 5D71L 6PCYA 2MNWA 4ZJ9A 3MNWA 5BO1L 3NPSC 2ZX9A 3PREA 5EOQL 5KS9A 1NOAA 1IQDA 1E5ZA 4P2RB 2ADJA 4PGDA 4JHVA 1DHKA 2XN9A 4PJXB 4LLMB 2CO6B 2FQFA 4Q6IB 1NCDL 1O7VA 3QEHA 1MCEA 3ARFB 2YEVB 4XCYA 3RBGA 3WGUB 4P23B 5IB1A 5IVZA 4KXAA 3RWHB 2VERA 3FSWA 1MUJB 2NY3C 3OLDA 4HS8L 4OLVH 4WQOA 1UD3A 3H2WA 3PE9A 3JTBA 4HW6A 1AHWB 2CIIB 5GRVL 1XQ4A 5K1VA 5MENA 3KPPA 3O2DA 4RZCA 4XAWL 4MD5B 4L5FL 1HT6A 4XVJL 3RZCD 2FSDA 4KC3B 3S36H 1P4LA 4PJXF 5AOZA 4E0RB 1UB6B 1YEHH 2DS4A 3PGDA 5JA9A 1LDSA 3MRMB 3MCLL 4RX4A 1IC5H 2IH9A 3ZZ1A 1P7HL 2AK4B 1LO0L 3A67L 4JPIA 3QNXA 5B39G 2WTPA 4YBQD 4EI6B 1OSZB 5MEQA 2WJ7A 3MJ6A 4NB7A 5DA0B 3CFEA 2IV9A 3IFPB 3PABB 2NCMA 4C8XA 3HG0A 3BI9X 1HOEA 4MNGA 1DP0A 3NJJA 3OKLA 3UO1H 4N2AA 3D4GA 1A3ZA 5IFJA 1U3HC 4YFDB 3V4VL 3DXAA 2VRQA 2X89D 1KIRA 4PJDA 4ZSOA 4XXDB 1I1YA 4CMHB 2OR7A 4ENZA 5JA8B 4JG1L 4ADGA 7FABL 5FYKD 5T1JA 2EILB 1HAUA 1WZAA 4L1HA 1UZGA 2IPKB 3V7AE 2O6CA 5H35A 2UZIL 1OPGL 2YPVL 5LCVL 4AL8H 4RWYL 3IMSA 2HFEB 4FZEH 2J8UE 4H4NA 2ZCLH 5C0ND 4HUMB 3WS3B 3BEVA 5I2IB 4JPVL 1KJMA 4X6DF 4JHWH 3QUMA 4YDLB 2GY5A 5ICZB 3L7EB 5FKPA 4OM1L 1EQWA 2JJTA 1L0XA 1B2YA 1PVHA 4I18C 3SGJA 5JNYB 2R2BA 1W72B 2KQNA 3DOSA 3P9LA 1HQ4A 1A9EA 1NPUA 2E86A 2HG5A 4H1LB 2G5UA 2DZEA 4XNMA 3BISA 4A1RA 1GOGA 3OLIA 4PJ9C 4E42B 2Y6SC 3L81A 1XR9B 4KTGA 1BD2E 2BNRE 4JR9H 4ES9A 1RUML 2HFTA 1H3TA 4P2AA 3LDBC 4ZOBA 5IEKA 2NLJB 1AY1H 3GXTA 4Y5XA 1EEQA 1BXUA 2WO2B 3C6LB 2Z0BA 4IBWA 2BOLA 4AENA 1HOCA 1WG3A 3QFJD 4TL4A 2VLJA 2CJSA 3NSJA 4HWEL 4M6OL 4OIIL 1EZUA 4LDEB 2V2XB 1AFVH 1QLFA 2Q76B 4P5TC 5J8OA 4PHXA 1EO5A 3C8HA 1XMEB 3E6FA 3BVDB 2VDRL 3FT1A 2VDNH 3D3VD 4UV4H 3RTQC 4KGLA 2WBXA 3QXWA 5DI8B 3L2NA 3BIKB 1UWFA 1BQSA 4Z3HA 3Q43A 4Y8AA 5ICXA 3QQ9D 3CVHA 5INCA 2K6ZA 2DDQL 4P46C 4QKXB 1H0DB 3ZT5A 1DQIA 1T4WA 3KG5A 5EOCH 5FO9A 1NUNB 4NZUL 3UL4A 3PAZA 3OM3B 5I5JA 4YHYB 2V6HA 1J1XL 1TFHA 1YYLH 2CRYA 4GAYB 2EDNA 3OMNB 4K7FA 5JXEA 4NM4L 1IKNC 5TD4A 2BINA 1Z7JA 1WFOA 4NAMA 2HWZL 1CXIA 5D5MB 4UYPA 2VWEC 3QQNA 2KLSA 5K39A 4XVUC 4D9QE 4QNPF 1BLIA 3KYKL 1E9OB 3I2CL 3FB7B 5JW3L 2RFXA 1E9PA 3SBQA 4F9LA 2BNQD 1FL6A 2OCFD 5IESH 2WB1A 2VZUA 3BP6B 3L4ZA 4JKPH 4R7DA 2EDJA 3AU1B 5GS1C 4D0CA 1ZGLA 2EUXA 1A4BA 4MZRA 2J56A 1D6VL 3ULSA 3IDYB 2E7HA 2Z6FA 4XCEB 1BXXA 3SDDA 3KYMA 4HX1B 3GBEA 3SOTA 3CMOL 3QWRD 4P57A 2CJ3A 3H9HA 4JO2H 1EEUA 1PSKH 1EXHA 4JCWA 5KBLA 3VXQA 3L95B 4K7PX 4OCWL 5F1IB 1EZVY 4G6JL 1M3JA 2XACC 1RIUH 2FZ3B 1JWUB 1UM6H 1VJSA 4IRZA 4JZJB 3SJVE 4KDWA 3TEWA 3V6BR 1SEQL 4N22A 5AB2A 2YRLA 4KROC 1YN6B 5GGUA 3UP6A 4P9MH 2VAAA 2IGFH 2PW2A 1OP3K 2IH1B 1TDQA 4XP1H 4ZMNA 1BA9A 2GBVA 2VDMB 3BD5A 3HS8A 4JFWA 1KB5H 3IKCB 4QLRA 1R3KA 2NY1B 4W6WB 4XPBH 2AEPL 5BPPA 2X1OA 4AZUA 1DBJL 1KPRA 5GRUH 4Q56A 1L4IA 1AGBA 3Q3GB 4LHUD 3T0EE 4KI5E 5C70A 1ZHLA 3PHOB 4GJTB 4XXCA 3UMTA 3VQ2C 4ZUWB 2K70A 3IE9A 4JQIA 2G0LA 3OHXB 1WSST 4MDJA 4P5MA 3MLPA 3NIDE 4PV9B 3K0YA 2COVD 5C6WH 1FPTL 1BYOA 5DVMA 1KZQA 2R4SL 2PTUA 4V33A 4GS7B 3UP1A 3JV4B 2EADA 5CN2A 2NX5D 1TG8A 3CUPA 1S4IA 1QD0A 2X2HA 1MFBL 1CD1A 1KXVA 1XTLA 4LZKA 4I77L 3V5KA 4AGPA 4GRWH 4OW6A 1NIEA 1BBJA 5FIEA 3ZDYF 5I1CL 5HYQA 4RDQF 4NGHL 1CGYA 2XU9A 2XWXA 3JUZA 1SOSA 1PZ3A 4HSQA 1EEZB 1MLCA 5E2UL 3BESR 2VLKA 3EFFB 2EIDA 3TPUB 4HIEA 2BP8B 1SJXA 2PCXA 5BZWA 4ZTEA 3V7MA 5IMLB 4A2HA 1FNGA 1ZCRA 1IBHA 3SYCA 1JVOA 3S2AA 1Q9LB 5G4NA 2EVHA 2H2PD 2A1WL 1WV7T 4IJ3C 4HHWA 1QR1A 1S7UA 2LW3A 4ZFZB 4HSAC 2N3JA 2A74A 1BFVL 2NZ9C 2CDGA 3L4CA 1JZ5A 1LE5B 1ACZA 1V7MH 1NCCH 1OD7A 2GCYA 3CSTA 1JPFB 5C07B 1XF4A 3OKDB 1I7UB 3HHSA 3QIBA 2BXZA 3IPBA 5AAWC 1LNUB 4C56B 3WG7B 2ICWB 5JHLL 4YPGA 1MI5B 4FG2A 1J0YA 1IM9A 4IGBD 4QHNA 4F3FA 3UJJL 3WFHB 1E28A 3DI2B 2HRGA 5EO1B 2JJVA 1ZGLP 5L88H 2D7PA 1EPFA 3D8MA 2EIJB 4EI5D 4ZPVB 3FH8A 4P2RA 4PJXA 3AJ7A 3KYNB 3EYQC 3UTSB 1BPLB 1VPOL 2CO6A 4GRMB 1QR4A 2BW5A 4L05A 1P5UB 1IAKA 1MHPH 4Q6IA 1BXAA 1AXTH 4JFHD 3K72B 3D2TA 1HDMA 3RWHA 2JB6B 1MUJA 2IFFH 3ZKMD 2ZONA 4RGOL 1AHWA 2CIIA 1NFIB 4F7CB 1F11A 4MD5A 4YR6B 2BCKA 1E40A 5HI5D 2IALB 3BWZA 5E5LA 1YRKA 3A6OA 2C9SA 3IDGB 3QSKB 4XNYL 5D2NA 4WF7A 3RB5A 4QXGH 4E0RA 3F2LA 2P7TB 1UB6A 4GQZA 3HKFA 4EZKA 4FAAB 1WRFA 2AK4A 5C3TA 3CZKA 1S9WB 2XY2A 5I6XB 5DYOB 3WD5H 4EI6A 2A73A 4DCQB 1F3DJ 2WLLB 3U9WA 3WJMB 4WUUB 1KWKA 1QRKA 3IJHA 4K9EH 2R8SH 3EDKA 5C08D 1SJEB 1SLWA 4FKHA 1BQ5A 4GSDL 4HWBL 5DJYB 4XXDA 4X6DA 1X5KA 3IETB 1PX3A 2EUZA 3SO5A 4X4KA 1KN4L 3LXUX 4YXLH 3BE1L 3BWAB 1BF8A 2UUDH 3BFWA 3IU3B 4A38A 1U8HB 3K2UL 1XH2A 3QH3B 1JPGB 3GSWA 1S7VA 1SOQA 1CIUA 3L7FB 5IB4A 4NQEB 2FR4A 4LCWD 1SQ2N 3WS3A 2VSCA 3V6OE 1IUZA 1G7LB 3ECQA 1FFTB 3L7EA 3TGXA 4PRIE 4BH7B 1PF3A 2AK1L 2P5WB 5DD1H 4HU8A 2FBJL 4CVUA 5JNYA 1W72A 2VJXA 4XVTH 4H1LA 2Q9OA 4M03A 3EGXB 4E42A 2WK2A 4AYID 4POZC 3SZKC 1XR9A 4HKBB 3BQUB 5C2BH 3POCA 1P4BL 4FMVA 3JQOB 3LNIA 1BOGB 5B7MA 1LM8V 1S7RB 2AKRB 4J5VA 3PL6B 5EZIH 1DYZA 1N8ZB 3X1EA 3MYJB 1E65A 1OOAA 1D9KB 4Y4KB 3VMOA 3WIFB 4S1DC 4WI5A 4X6FA 3PJSA 1CZ8L 5I6LA 4OLZL 2HLFC 4JM2C 2Y06L 3OB0K 3NUKA 4G7YH 2JELL 1G9MH 3F7QA 3TZVD 1G7IA 4HCRA 1MHHB 1EFXA 1YAIA 2Q76A 1VAHA 2V2XA 5F0JB 4XP9H 2RHEA 1MCNA 1MF2H 1RHFA 5F93C 4DKFL 4DFHA 3L5XL 3WN5C 4YQXH 2CKBB 4ZTOL 3ECWA 1NCGA 3ARZA 5E8OA 2J12B 2X10A 4PGZA 4E9RA 5D70L 5CKGA 1II4E 2FX9L 3ESOA 5C7ZA 4WWNA 3TASA 3JZYA 3EYVB 2DQCL 3BUYA 4X5QA 3FUIA 2ZKYA 1CGUA 2FHCA 3KPRB 3V4PA 3LQZB 1DVTA 2APFA 4AQ8A 1ZLVH 4AYMC 4G83A 2BP5M 1RK0A 1H0DA 3MXWL 3V52H 1IZJA 1PCXA 3TCXA 1N4XL 2J2ZB 4YFLI 1YYML 12E8L 3TBCA 1CYXA 3PWPD 3HRZB 3QEQE 3V7AG 3WYRA 4AC2A 2EYSA 4GAYA 2AV1B 3MGOB 5KVDL 2OJEB 3EFOB 5LVEA 3L3IB 3VXUD 1J5OL 4K4KA 5CD5C 3SQRA 4LAJH 5D5MA 4FQ2H 5B39B 4BK5A 1B4LA 2CSPA 1QI3A 1J86A 4YXHL 3CQFA 3TURA 3WS6C 1E9OA 1F4XH 1QSFD 3SDAA 3R06B 1B4TA 5B4MD 2BJMH 3M88A 3SKNA 2X0WA 2ZIDA 1E7UA 2PMZA 3AU1A 2ZWSA 3BKMH 2FT7A 4M6ML 1WYJA 1X6LA 3QCUL 4HX1A 5GGRY 5DMIH 4YSPA 3FCBA 5AB9A 4PQXA 2D2OA 4FF9A 2Q8AH 5F1IA 4XPGH 3T8XB 3WIIL 2G9HB 2FZ3A 4E36A 1XB6A 4JZJA 4YDNA 5IR1B 1QBAA 3GKZA 4TQEH 2GBUA 4TSCL 3SDCA 3CU1A 1JD7A 4E9WA 2OSLB 1JWMB 5EU7E 2IH1A 5IBLD 4Z18A 1AZZC 4QF1B 1N26A 2QADD 1OTUD 2X2YA 5HHNB 4G82A 4DVRH 3WJLC 2Z7ZA 3IKCA 2BW4A 1TYJA 1HXYB 5DD0H 4YGAB 3AG1B 3HLKA 2HUHA 4NI6A 4OZGE 2J4WL 1OLZA 4HIXL 1FFPB 4JFPB 2ED9A 4HSCX 5B7FA 4Y5VC 1XGUB 5HD8C 5GJTH 2NY4B 4ZUWA 3OKNB 2R59A 3S3CB 5I15H 4TLSA 4NQXB 1U4EA 2KT6A 3S35H 2DI8A 5AVSB 1QACA 1R3JA 4EIBA 4K5NA 3E2HC 1PY4A 4PV9A 3WE1A 3Q6FA 3GIZL 4XTRD 3REVA 4I2XE 5JW4N 1Q0XH 3GJFA 2D4FA 5EUOB 1X4XA 2FX8L 4M8QA 4HPOL 5IHZB 3JV4A 2N0KA 4EN3C 3CE1A 1RFDH 2GEQA 3EH3B 3FAWA 3IMBA 1A6VH 2AMUA 3O11A 5EV7A 4MLSA 5D1QE 1FG2B 5AWNL 5BV7L 3BZEB 1JFHA 4S1QL 3STLA 2ZOTA 4BSJA 4F58H 4LE8A 4ZUTB 3VSUA 3F7YB 4TOYL 5IM7B 5EUOF 3EFFA 2NY0D 4PAZA 3MRNA 1EV2E 1JGDA 5IMLA 2GITA 1FVDB 5CMAB 2EZ0C 3AVEA 1ZIAA 2GABA 4GAGH 5CIPB 2WY3B 5FFOA 3KLHC 3EOYG 1F3JB 3MUZ1 2KHAA 2YS4A 4GKNB 1CICD 4ZFZA 1T83C 2XKNB 2XV3A 3FONA 3ILPB 4NLAA 1RL1A 3WFCH 1LE5A 2UV3A 1YEEH 2VZ1A 3OKDA 1I7UA 2WXGA 1W8OA 3PXLA 3SY0B 4MGXA 4C56A 1LNUA 5AD0A 3FFCD 5C0CD 1L7TL 2PR4L 2VUKA 4MQ7A 1GMEA 3B7UX 3NTCL 5IW1B 2NY6C 4AWJC 3DIVA 1DFBL 1JPSH 1UT9A 3TFBA 5F2FA 4CKVX 3WFHA 4UZGA 3OJ2C 1R3IL 3QUZB 2DLTA 4WW1B 3FC8A 1OF0A 1E6JH 2BVUA 5GIRB 3TO4B 3QIUC 4B5ZA 5JORB 2HJFB 2BFVH 2Q87A 3VD5A 4ZPVA 2J5LC 1ADQA 5E23A 2GJ6A 3HI6H 3VG9B 3TBTB 3KYNA 4XP5H 4NFCA 3UTSA 4N8CL 2EYTB 4GRMA 2FH8A 4KXCA 1P5UA 4UOQA 4S0HA 5D71H 3P4LA 4PJGF 4Z7OF 5BO1H 2F54D 5GZOC 5EOQH 4BRJA 3ALXA 25C8L 4FL4B 1GW6A 1MCWW 3ARED 1MKFA 1JNJA 5E8EB 1NFIA 4YSEA 1JZDC 4AQZA 2VLRD 2IALA 1NCDH 5JDSA 3ASWA 4GXUM 1GYWA 4HS8H 2P7TA 3K5SA 4PG2C 2VZVA 2V2TB 3B2UC 4OD3L 4OM0L 1HEHC 3VFNB 2AJZB 4XAWH 1RVFL 4L5FH 1TLKA 4XVJH 5DYOA 5L4IA 2UY7B 5I0XA 5D6DC 4DCQA 2WLLA 1HKFA 3ZDXB 2ZKXA 4YSOA 1EHKB 5DZVA 2R2HA 2FQDA 4RMVA 5FW8A 5HHOB 1WIOA 1SJEA 4BCYA 3MCLH 1U2HA 3WY4A 2MQ0A 1LO0H 3A67H 5B1KA 1CVSC 2LU7A 4OF6A 3TN0C 3IFLL 2OP4L 4Y1AB 3IYLW 4IU3A 3BZ5A 4RMTA 3BWAA 2DTML 2LGNA 4OI9A 3ZTDC 1D7FA 1U8HA 2JJSA 1CFNB 4G43B 3ZYZA 3V4VH 2VM4A 2ZUXA 1JPGA 3WEAA 4BK8A 1KDIA 3L7FA 4NQEA 2J7LA 4B95C 1A4JB 4K94C 4JG1H 7FABH 1MDAA 3CHRA 4LCCB 3S5ZA 1F18A 1ROWA 2R2EB 1G7LA 3V6FA 2UZIH 5IG7A 1G84A 2N59A 1KCLA 4BH7A 1WTLA 4LSVH 5LCVH 1G5AA 2P5WA 4RWYH 1RZIB 4FA8A 3F6JA 2N4IA 3S3DB 4HIPA 4R2GD 2B3RA 1CQKA 2VSDA 1S9XB 3S96A 3QB7C 3QZWA 4Y1TA 3D06A 4JPVH 1BJ8A 2WP3T 4XPHL 1E4KC 3WKYA 2XJKA 1LWJA 3AZUA 2EO7A 3NYKA 4HKBA 1F56A 2PPCA 4LKXB 3O45B 4WHYH 1BOGA 5FYKE 1F3DH 1O5DT 2AKRA 1NOLA 3PL6A 1VF5C 2H6PB 4P2QA 1KCSL 1N8ZA 2X0UA 4FA6A 2EDLA 2R23B 1HS6A 1D9KA 3NA4A 1JGLL 3ZKND 4Y4KA 5IZ7A 5KVEL 1BX2B 2ZUTA 3F7PC 3WIFA 4XO9A 3WOVA 3JWNE 3QJRB 5AAMC 4Z7UF 4Y16B 3OF6D 1L9RA 1RUMH 4UT9H 4YDVB 2OULB 2SEBA 4MAZA 4NKDB 1AR1B 4Y19B 1J9QA 2YAOA 3FB5B 2R9HC 2HPOA 4KDVA 5C92A 3DECA 1VHPA 1U91B 4QYAA 4XN7A 3U6RB 2CKBA 1WUNT 3T8MA 5KYXA 3AY4C 3RLSA 5E5RB 4M6OH 3M8OL 5F89B 4OIIH 3D51A 3MRDB 4HWEH 3TFKC 4X6BA 3ESPA 5E4OA 1L9TA 3BGFC 3KPRA 1YLBB 2VDRH 3LQZA 1Y07A 2OQJB 3FTGB 4I3GA 4PP2B 4R4ND 4X83A 3T4YA 5CKAA 1NOFA 3TV8A 2ITEA 1QRNB 2VSMB 5ITBL 4YHNB 3OZKA 3J07A 4KHTL 4WV1A 4IOIB 5DZAA 5KWYC 3MGOA 4FZ8H 2I7OA 3RIFF 2OJEA 3EFOA 2DDQH 4JZOA 3P0YL 3TVMD 1JZEA 3EOTL 4GH7B 3LZLA 5B39A 4X6CB 4NZUH 2ZXCA 1J1XH 3R06A 4NM4H 3DBSA 4W4OC 1LO5B 4R96B 4YDIL 3DSNB 1HZKA 2HWZH 5FOJA 5TGBB 4ALAC 5LWYL 2R51A 2MKWA 3S5LB 1PFCA 1E30A 2J6EL 4HWZB 3KYKH 3I2CH 2CO1A 3ISRA 5JW3H 4GB9A 3BGMA 4IBLT 2OMZB 1O9VA 5CEXB 1J05B 2G3NA 2IBBA 4I85A 3T8XA 3T0XA 4BFIB 2G9HA 1JYVA 2O5YH 1D6VH 1XCXA 4K7PY 5IR1A 3RVWC 1RXLA 4I0PD 4YJZL 3V95A 5A43C 3CMOH 1XCTB 3ARBC 1VFBB 5KBMA 4PJBE 1BW8A 4ZAKD 4KBPA 2ID5A 3EJCA 4OCWH 3FYIB 4QF1A 3STBA 2B2XH 4G6JH 4YBLB 2B1AL 5HHNA 1VFMA 4PJ8A 5HHMB 3OKOB 1SEQH 2LOEA 3VFTA 3MA7B 3ULUL 4L4VD 2BNQE 4IKLA 2DWTA 2MQ3A 4HHGA 3L4XA 1FFPA 4JFPA 4UM9B 2LFGA 1QPPA 4N1HB 1KCVL 1KBGH 3UADA 4PG9B 3OKNA 3HI1B 1ZMYA 2AEPH 4F9PC 4NQXA 4JRLA 1L9MA 5F6IB 1THCA 3KW8A 1DBJH 2UZXA 3FUDA 3M86A 5EUOA 3O3UN 2WN3A 1WFIA 3TF7C 2F7QA 4F92B 1YYCA 5HP5A 3BSZL 4LIQL 5IFHL 1NDTA 3BH9B 4APQD 2PPDA 4NC1E 3LMJL 2X4UB 2NSQA 2VQ4A 4H0IA 3APCA 2R4SH 2RQ8A 1ORQB 3AG4B 4C4KO 4BRVA 1JK9B 1P1VA 2OMXA 3VFPA 3F7YA 2WLKA 5C0FB 4KK9D 3TJPA 1MFBH 3HMXL 1S5IL 4I77H 3SB3A 3NZSA 4UQ2B 3ZQXA 1CTMA 5I1CH 3G5XB 3S98A 3QRLA 4PY8J 4DP8X 4GKNA 1UUSA 5E2UH 3ILPA 4MJHA 2XQBL 5J3HC 3W9DA 4UT6L 3QJZA 2EC9U 3GDBA 3Q06A 2NX5E 5AYQA 3SY0A 3TNNA 5TTRA 1RUAL 2HA1A 2OTUA 3CVBA 4HKJB 5IW1A 3I6SA 3HB3B 5EDSA 1JNLL 4PJGA 3ILEA 5D1ZC 1FUNA 4K5MA 2MCMA 2EQDA 3P02A 2J8UB 4PJ5D 3GZQA 5INDB 4NWTL 3H7LA 1AYRA 3ERXA 3BVUA 4WDIA 1J5DA 4WW1A 5JORA 5JHLH 2I7SA 4JUSA 3LKOB 2QKSA 3P4MA 4NRZA 3DC0A 3UJJH 4TLUA 2EYTA 4N6QA 2F68X 3X1BA 4HETA 4AEIL 2VXUL 2J8UF 1NSNL 3FO1A 4M93C 3PPEA 2C3WA 3VTAA 3ARDD 4AIZA 1BD2B 2BNRB 1MCFA 3UTTE 5E8EA 1XB8A 1DE4B 2R39A 3DTXB 5EFIA 5F1SA 1VPOH 3RNQA 1PKQB 3LHAA 1A7BA 3S34L 5HPMB 1BVKB 1QAWA 2Q10A 1VFAB 4G9FD 2HT2D 2BY3A 4Z78B 1WVZA 2IAMD 3NMEA 4YDMA 5IQNA 4KY2A 5DJ0B 1JRHL 4KKQA 4UV7L 4RGOH 3MDJA 2XVGA 3DJRA 3VFNA 4NKIH 4DVBA 3MLWH 5D4JA 3ZUNC 1KACB 1E4XL 2CPUA 3EJQA 4FG4A 3VH8G 3O6FC 2Z4TA 4XNYH 1V5JA 2WNKA 1AH1A 5KANI 3L4YA 5G55A 3T08A 3GZPA 5D1XE 1RY7B 3VNYA 1AZRA 4OFKA 4AGLA 5E6RB 1AMXA 4XN5A 3VRLE 5CLWA 3U25A 4JFHE 3NN8A 3SE3C 1X5AA 1S8DB 5C8JA 3Q9PA 2NW3B 3D0AA 4Y1AA 3MROB 4HAKA 4OJCA 4HFUL 1BAWA 3VFUB 3SE4C 1CFNA 4HFWA 5E6IC 4GSDH 4HWBH 4N9GB 4N3TA 2P45B 4M6AA 1A4JA 1ZHBB 4JQXA 3FS9A 1KN4H 5EZPA 3BE1H 3U2SB 2EDBA 4HD9A 1CGSL 4OFPA 5B8CA 2W1NA 3OHMB 4JN2B 4P2OB 4PLJC 3K2UH 4QRUA 4UAOC 1EO7A 2XKSA 1JS4A 5C08E 4M1DL 4F80A 2UX7A 3SYPA 2B16A 5GGVY 1YQVL 3DBXA 2FJUB 1XCWA 2AK1H 3O4OC 4LKXA 2FBJH 4HS3B 4FLOA 3I9PA 3RRQA 3DDFA 1NGXB 2EE0A 2H6PA 4XWGL 2R23A 2IDCA 4OLEA 2ICCA 5CP3A 4TNVF 1BX2A 1LGVA 2AQ3A 1QSED 2ZG1A 3BN9D 1P4BH 2M83A 3ETSA 4CW1B 1IBYA 5AKSA 4Y16A 4YL4A 2F5BL 2GC7C 4DJMA 4YDVA 3H53A 3P4NB 1JYXA 2YUVA 2BWIA 1ET8A 4NKDA 5J13C 1U6AL 2PXYB 3FB5A 3W11C 3ZE2E 5GISL 4WTXA 4RGND 1CZ8H 4OLZH 2Y06H 5K9KB 1YJDC 5IFAL 2JELH 4H5SA 4K3DL 3K2MC 1BAFL 2AEWA 2OL3L 1O75A 2CG9X 4KTEL 3KMDA 2ZP0T 4P5KB 5F89A 5FEBA 5H94B 3MRDA 2BSBA 4NN7C 4J3OF 1F1GA 3K4AA 1J0HA 2VN3A 2DQDL 4DKFH 3L5XH 4PGCB 3AY2A 1Z9PA 1FZJB 4ZTOH 5HJGA 1JXGA 3T0EB 4LL1A 5AOIA 1GS6X 5D70H 5HSFA 2WCPA 2FX9H 3N44B 1QRNA 1AGEB 2DQCH 2VB5A 2LE9A 2H2SC 3UZEC 3K7UA 3OG4B 4F15C 1IAIL 4KOCA 5LN4A 1AMYA 3MXWH 1GW0A 1N4XH 1VGEL 1WISA 1AD9B 1I9JL 1OAKH 2O5XL 1V27A 1YYMH 2ZUUA 3IDMB 3V0FA 2C26A 4X6CA 12E8H 1T0PB 4EKJA 1RZKC 4KI5F 5AW0B 5F0PB 1ID5I 5KVDH 1LO5A 2X1QA 1WC7A 2TAAA 4WHCA 3N6YA 3DSNA 5IWLA 1J5OH 2JJTC 3NIDF 4FQQA 1NAMA 3MMEB 5EU4B 4LLDB 3S5LA 4YXHH 1CMOA 2R9HD 4HWZA 3R1GL 2X3AA 3CJJA 1QBBA 4U1GC 1GRWA 3UIYA 5CEXA 2X3BA 1BGXL 1J05A 4K3HA 1YECL 2MPVA 2MTPA 3O4LD 4E41E 4BFIA 1DVSA 4M6MH 5DJAA 3EJYC 4O2FB 3VX0A 3QJHB 3QNZA 5DT1L 3IXAB 1XCTA 4Y5XC 2R69A 1N6QL 4YSAA 4ZNEE 2WINB 3GMLB 3WIIH 5ACLA 3AT9A 4BQ6A 4GW5B 3SCMA 3OKOA 2DL9A 3X17A 3MA7A 1HAWA 3IB4A 4TSCH 3LRKA 3NA9L 3C75A 4JFEB 3LKPB 1XVSA 4MS8C 1TYRA 3WAKA 4LPXA 4PY7B 5ERWB 2G2RA 3WENA 4DWHA 2X2IA 4ICWA 4DAGL 4GRLD 1FNAA 5EOTB 4PG9A 5KTEH 3ULVF 3GS4A 3VMNA 8PAZA 1Q72L 5KYNA 3IFOB 1QASA 2B4CC 5TFSL 2J4WH 2AQRA 4HIXH 3VAEA 3VDCA 4OZHE 4A7VA 3KS0H 3KWWB 4NN5C 4PJ7E 5DTFA 1A1OB 1AZBA 4FTVD 5FFLA 4J39A 1J8SA 5EBWB 2EE3A 4MJ6B 2EDXA 1KZYA 4P2YA 2WZ0A 3GIZH 2PP9A 2X4UA 1FGNL 4AT6B 2FX8H 1ORQA 4DH2A 4HPOH 1AKJB 2D3JA 2X4PB 1PX4A 2FWSA 3QJSB 4L3EE 4DHLA 1WCBB 4OD2B 5C0FA 4X9BA 3U4AA 3RVXC 1OSYA 4B9FA 5IHBA 2F5AL 1D5XB 4UQ2A 5AWNH 5BV7H 3W57A 2BVPB 4S1QH 2QPFA 4UANA 2CLVB 2DEWX 3Q2WA 2OAAA 1MWAH 1OGAD 4TOYH 1VENA 4N86A 3QORD 4F9LC 4JO3L 5KYUB 4YHPB 1EVUA 2ZXQA 2Y25A 4NUMA 4WI9A 1ZT7B 1N7ML 1KCUL 3CN3A 3AWFA 3DO3A 4BH8B 3OD3A 3L13A 4CDGC 3SDDC 4OSUL 1URLA 3GHEH 3GS7A 5L6YL 2J8UA 3REWB 3G04B 5INDA 3RGVD 2NR6C 2BP0A 1Y1DA 1B6DA 3TJEL 4ZO8A 4HXBH 2W9DL 1L7TH 2PR4H 5JIIA 3NTCH 4PRIB 1PS3A 3LKOA 5KBKA 1DFBH 5I75C 1KB9K 1SXSA 4Y9CA 4L0YA 5KSBF 4CBPA 4MFHA 2RJMA 1R3IH 3EGSB 4XNDA 5BOZG 1RJZB 5JQ6L 1AOZA 1BD2A 1A7QH 1CPUA 2BNRA 1DE4A 4N8CH 1YG9A 1YN7B 5TDNB 1HC1A 3VO0A 3VU2A 5HPMA 1BVKA 5C0CE 3NEEA 4XXCC 1VFAA 4ZXBB 4Z78A 5HTSA 3JTSB 3EHBC 4ZODA 25C8H 1IVTA 5DMJB 2NZIA 1TPXC 5GZNA 3CZSA 2CIKB 1PDKB 3MV7E 3UROR 3ME0B 3KPOB 4YO0B 3F83A 5DRZB 3N40F 3NRPA 2CJUL 2L7QA 1IM3B 1MH5A 2CUMA 2KLTA 4QHPA 5F88B 3CVHL 4OD3H 4OM0H 1NBZB 5T1LB 2DI7A 1BIHA 4WFHD 5E2WH 4IRJA 1A22B 4FNUA 1T04A 1RVFH 3CQPA 1XMWA 1S7XB 5I1EL 4N2DA 4PW3A 2NW3A 1TJHL 2XX1A 2E6QA 1ZTMA 3MROA 3QO1B 1K4DB 1WT5A 3LKRB 4LMQI 3QXVA 1YMMD 2VLRE 4UQEA 4AYSA 1AQDA 5I1KL 1NDGB 4YHOL 3RHWF 2WXOA 1WH0A 4L1BA 2K45A 2GT9B 2JKWA 2VNCA 1WZ1L 3EJPA 2OP4H 3IFLH 3NT0A 1HL4A 4FG0A 1K9TA 1UFGA 5DD5L 2DTMH 4XMPL 2VMDA 3VRJB 1CXKA 4YXKL 4MCYB 1YDPB 1L9PA 3GIVB 4JN2A 4P2OA 4C4BA 4UTAH 2A74C 1AO7D 3IPFA 2IWKA 3QEQB 5KW9L 4OZIF 4PGEB 5F8QC 2CUAA 2IMMA 1I7ZB 5E94B 4GY4A 2ZUQB 3ZSTA 3AT0A 1IV8A 4YE0A 3DX6A 3QIBC 4FX5A 1KSRA 3QJVB 2PCPB 2Y5TA 2ICEA 1MNNA 2DLGA 3A6BL 2K78A 2ZICA 4NRYB 4HS3A 2AVFA 2DH2A 3ARXA 3S36X 3N3EA 1NGXA 3AT8A 2ESVD 2HX9A 4WJG3 4G6FD 2NY2D 5T5NG 2NXYD 3DX7A 1G9NC 4XPHH 3LAFA 2VDLL 1Z0MA 4W81A 4CW1A 4HJ1A 2YIHA 4Q6IC 3N50A 5LDUA 3P4NA 1MIML 1KCSH 3KZ8A 3L1FA 3GEWB 4GKSA 1QBLH 1TTGA 5J11C 1ET7A 1JGLH 3BUQA 4MMZA 3OLGA 1XZWA 4BDVB 5D7JD 3SJVA 1X5GA 5K9KA 4QOKD 4G8FA 4WI2A 3GSNA 4H40A 3L2LA 1M2VB 4MAYA 5D2NC 5DJXB 1I3GL 4P5KA 1XTMA 3RY6A 3WE6A 4WWKB 2GTQA 2RD0A 1JZ2A 4Z7WB 3L9RB 4MDRA 4KV5F 1KTDB 1XF1A 2F53D 4PGCA 3MLYL 4OZGB 8FABB 4L2LA 2DJUA 4JRXD 3T0EA 3M8OH 1KJ3L 5IUSA 1RULL 1T5KA 5LBGA 5ADPL 1AGEA 5IQ9A 2J5WA 3CK0L 4XN2A 2V2WA 3UBXG 3ZE1E 2VUOA 3MJ9L 4AQ1B 5I1AB 3DHPA 2XWJA 4I2XB 1BZ7B 3VI4E 4KY1L 1MCOL 1VEPA 4Z7AA 1FH2A 4ACTA 1AD9A 2AQ1A 1I4FA 5ITBH 3VXPB 5DO2C 4KHTH 1Z9OA 4GI8A 4HKZB 1UCBL 1FORL 5DEFA 5IB3A 1EWHA 5DHYB 4OQTA 5D1QB 1NJ9A 3P0YH 4M62L 1Z66A 3EOTH 2HMID 1GJUA 4HUUB 3MBWB 3MMEA 1BZ8A 5AB1A 5KBNC 3BAEL 3D0VB 4FKEA 5DHVB 3CFQA 3CV5A 4RISL 2QSTA 5GPRA 3DNKA 4YDIH 2VABB 5IJVB 3LEXB 1XR8B 4OGAC 7PCYA 5F44A 4NQQA 3WTSA 1NA8A 3GHBL 2J6EH 1PBYA 2MFNA 4MVBC 4OZFB 3QJHA 2DM7A 3HC4L 4NBXB 5FM8A 4JPWL 1QO3A 3VWKB 1E5CA 3P69A 3GMLA 4ZG1A 1SJHA 2KYIA 2A9AA 4ZS7H 4A04A 1M7DA 1ZLSL 4GW5A 3NDZE 1HZHH 1OSPL 4KJPD 2F7OA 3QRFM 3Q1EA 3VE0B 1KGCE 1UWEL 4GW1B 5HJBA 4EJ1C 1ECYA 1KTRL 5A1AA 1DO6A 4PY7A 2H2SD 4XRCB 1QFUL 3KXFE 3OKKA 5ERWA 4Z1PA 1G5GA 3QUKB 2B1AH 2C3VB 2FATL 3CXHK 2P8LA 3OR6B 5EOTA 3ULUH 4XB8A 4A66A 5IOPB 5EEXA 2DICA 2VLMD 2QSQA 3BO8B 3HW7A 4KVCL 5JXAH 2ZYIA 2G2PA 3F00A 4ELDA 4WWID 2WIIB 3BN3B 4RGMB 4WJ5A 5E1IA 5TK4A 1RZGA 2C3XA 3KWWA 5F7EL 5AYTA 1DBML 5I74C 4K7PL 1SN2A 1KCVH 3GRBA 1A1OA 4U1HB 1ZLEA 3SYAA 1XF2A 2CE6A 1GJIA 4D9LL 4MJ6A 2A3TA 5F7HA 3WSQL 2BY1A 5J57B 4HMEA 1S9YA 4B53A 1HHGB 2QR0A 1NGYA 2B15A 1AKJA 2X4PA 1BJMA 3K6NA 2KKQA 3EH1A 3RFZB 5I0WA 3RVVD 5I71B 4MX7A 3BSZH 4LIQH 3COOA 3BD4A 2ITFA 3LZFL 4FFZL 5AOLA 3QI9C 3LMJH 1V05A 1JJUA 4BUGA 2CLVA 3CZGA 4YOKA 3PCYA 1QG3A 3LOWA 3AW5A 1JGVL 2X7LB 3WO3B 3F7KA 3SDAC 5E1HB 1JGEB 3VI3E 5J89A 1WEJL 2V5SA 5KYUA 3KWTA 4YHPA 1S5IH 4R0LA 4MBRA 4WEEA 3C5ZB 3FHAA 4BH8A 5IMMB 1W72L 3B9KB 4OF0A 2MJWA 5KSBA 1KEGL 5EIVA 4YN3A 5I1HL 3K1KC 1SF3A 1YY8B 2XQBH 1CFVL 1CGWA 4PRHB 4UT6H 2FWOB 3D33A 2NPLX 3REWA 4R3SB 3FK3A 1IIIA 2Q5BA 4NC2B 5EZLA 3JVGA 2ZXEB 5EA0L 4XBEH 2CDFB 4DK6A 1RUAH 3GF8A 3VYPA 2BC4B 4C55A 4CMMB 3SDCC 5K93A 1JNLH 1Z9LA 3F7LA 4Q9RL 1XF5A 3HE7B 4NWTH 1B9KA 5FKAB 2XOTA 3ZZLA 3FQTA 3EGSA 4DN4H 3QHFL 2O5NA 5SWSD 5IT2H 1ASOA 3ALWA 5AB0A 4ZBJA 3QIWD 3O3AA 2WTRB 1N18A 3ES6B 1WAAE 2EVIA 1M9WA 1BM3L 2ZYSA 4JHZA 3G5VB 1E5AA 2WUBL 1TNMA 1N0XL 4AEIH 3OC5A 1WS7A 2XWDA 2VXUH 3DUHA 1NSNH 4FFWD 5BS0D 5E9DB 4PJ5E 4GG8B 3IK2A 3ZX1A 1IGYA 1IGML 2WKGA 3S34H 1GYAA 4R9HA 4EIGB 1FZMB 5DRZA 2V3FA 1JHTA 5FV1L 3QS3A 4OCMC 1PJWA 2BWDA 1BVLB 5IP4A 1JRHH 5F88A 2DAVA 3LH2L 4UV7H 4C54A 1J5CA 5T1LA 3GMRB 1E27B 4BFOA 5ID0A 3S8GB 3SD2A 3MLRH 1E4XH 1S7XA 4I13B 5DS2A 2I9TB 2JCCB 4PR5B 4KQ0A 2ISDA 3CDZA 3ZGIA 15C8L 2CK2A 4M8VA 2ICES 3WFEL 3SBWC 4XMZA 3D52A 4YC2C 1E90A 1LJMA 3IPEA 3P0GB 1NC2A 1CXLA 2X6UA 3QZPA 4IEFB 1T89C 5EN2B 1ODUA 3DUSB 2XXMB 2AJXL 3MRGB 4HFUH 4UDUA 3VRJA 3SGDH 2CNYA 4MCYA 4A6YA 3LRHA 3E8UL 3QEQA 3V4UL 3ZDZE 4YVNA 4PGEA 4YBHA 3CLWA 4MNHB 2YWYA 1G4RA 4PY8I 1KYOK 1SY6L 2VE6B 4FMFA 1CGSH 2NOYA 3FU3A 1W0VB 1CLVA 2OW7A 4PD4J 1GKEA 1P2CA 4R7XA 4ENEC 3EXLA 3AAZB 3VFVA 1RCYA 3IWVA 4NRYA 4XHJD 3EHBD 5IHUL 1UENA 1B0RB 4WENB 4M1DH 3KPLB 5HVGB 2L3BA 3VWJC 3NEXA 1YQVH 2W8CA 1MIEL 1Q94A 4HAGA 4WI3A 5LXVA 1QSZA 4UOW1 2E7DA 4JDEB 4MJIB 1ML0A 5DWUL 2X9XA 4XWGH 5E8PB 5BVJA 3PYCA 3FPXA 5E4EC 3K8KA 3VFMB 5J4MA 4BDVA 1AC6A 4F27A 1J0IA 2V9QA 1N5YL 1T1WB 3VXRB 2F5BH 1F4YL 4G6AD 1HH6B 3NIGF 3QPKA 1WP6A 3S9DB 3GXPA 1ZGLM 4PJBB 4U6YB 5DJXA 1B4RA 2XIBA 5GISH 5GGVL 4ZMAT 3CX2A 4WWKA 4X5WB 1P4IL 3WXWL 3N40P 3L9RA 4N8UA 1H3WM 3B6SB 2BNQB 1KTDA 1NANH 5IFAH 4K3DH 4FQXA 4DP4X 3MPCA 1BAFH 3ELQA 2OL3H 3DV4B 4JPKL 1MJUL 4OZGA 4JX0A 4LL4A 4KTEH 4UM8B 4HZAA 4HMDA 3JWDL 4P05A 1HHKB 5DR5L 5FGSA 5F7LB 3U48A 3EJUA 1UEYA 3UAJA 1I9IL 2DQDH 1WS8A 4FI7A 1XFPA 3V0VB 4ZPTA 5I1AA 4AQ1A 1BZEA 2AQ2A 1J7VR 1DJGA 2ZNWA 4ODXB 1G1OA 1THAA 2HVJB 4FNPA 3PG2A 4I2XA 2J8HA 1JF6A 4TNEA 2JJSC 1PG7L 2WXRA 4M3JA 5MEPB 4BQ9A 2P9RA 3VXPA 1HIML 4BQBA 4HKZA 1MFEL 1AP2B 5AW6B 1HX0A 4IMLB 4BFGA 3JTTA 1J18A 4P3DB 3TT3L 5DHYA 1IAIH 3ETBF 1PCSA 3AWGA 4OCXH 3MRKB 5D1QA 3SE9L 3BUTA 4BFRA 1VGEH 2O5XH 1I9JH 2O1AA 1T03L 4HUUA 3OQRA 5I18L 2VTFA 4PRAB 1HE7A 4OUUB 3D0VA 5DHVA 1KV3A 4LHUB 2ZOUA 2OJ1A 4Y7OC 3TWCL 2VABA 3P2TA 3EFDL 2R1YA 4MZ2A 1MCWM 2FHFA 1KY7A 1XR8A 4KZ0A 5JO5B 3T3ME 1K85A 3HRPA 4I1PA 1MXDA 3MBEA 2XXFA 3RGHA 3RWEA 3PL6C 4OZFA 2BO0A 6PAZA 3R1GH 5D7IE 2C3GA 4Q52A 1D9KC 3VWKA 5BJTA 1BGXH 2GB2A 1YC8A 3QQ3A 3OGOE 3FQRB 5TF0A 4WKZA 1MRDL 4ZNCD 5FR3A 5LLIC 4I87A 5DT1H 3ILQD 1YAZA 1NFDE 3F6IA 2YQGA 3VE0A 3L5WA 3SD5A 1N6QH 4IRSD 1CLOL 4XRCA 5CJBA 3ZYOA 4CL7A 4ORGB 2C3VA 2WYTA 3RDTA 4J4PA 1Z6JT 3OR6A 5IOPA 1YPZE 3BO8A 3NA9H 1G7QB 3CC5B 3BHBB 3IMTA 5MEOB 4XWOC 2WIIA 4M5ZL 3WLBA 1QTPA 1EZLA 1ZWIB 2MHAB 5BQ7A 1BFOB 1JSYA 3LIZA 5D6CB 5FUZL 3BXNB 3HBGA 3N0AA 4U1HA 4EDWL 5HY9A 4Z3FA 3UTTB 1F6AB 1EDYA 2FGZA 2Z64C 1Q72H 2DRUA 1OM3L 3DJTA 4M7JL 5GHWL 4UQ9A 2X4OA 4L9LB 3STZB 4U6XB 2GK0B 1HHGA 4CSPA 5C0JB 1IEAB 2RTTA 3F64A 4WV1C 4AUUA 2G60L 3BVVA 3RFZA 4V1DE 1JZHA 3QZLA 1I7TA 4EI5B 1HK6A 5D2LE 1HXMB 3F3HA 1U2YA 1FGNH 4FQHB 4G1MB 4RMSA 2ENSA 1YNTF 5DJCA 5D1XB 2OMTB 1UC6A 2X7LA 2BRQA 1BWWA 5ALBH 5CNHA 1JGEA 1MCPL 4GRWE 4JY4B 5DHDA 3ZK0A 5C0BD 3DI3B 1EEYB 3UZVA 2F5AH 3WNOA 5JOEA 3C5ZA 2DMGA 4Z3IA 3A4FA 4FTVE 3S37L 5IMMA 3H9SE 2XNAB 3LV3B 3N85L 3QAQA 3W39B 1UXSA 4H2AA 3UBXB 1OCWL 1KLUB 1I8UA 4W70A 3RZCA 1QW9A 3GI9L 3DX2A 4QYOB 1YY8A 5F97E 1H3GA 1XIWD 4JO3H 2BIOA 2FWOA 3U79A 1A6UL 1U93B 3ARVA 4R3SA 4XN4A 5JIKA 1N7MH 1KCUH 4X98B 3TTYA 4EO5A 2IFGA 3GB7A 4QHUB 2BC4A 4OSUH 4OU3A 4WZ9A 4CMMA 2PLTA 3HI5L 3S35X 3WDJA 3H6AA 4Q4EA 1RK1B 4RMRA 4G42A 1HNFA 5L6YH 5L0QC 2YFOA 4H8QA 1KLGA 5EF0A 3U1SL 5IF0B 2OCCB 1WZKA 5FKAA 3TJEH 2ZKHL 3NFPB 4PJ8C 2W9DH 4N2GA 4OGXL 1CQYA 2WTRA 1T4KA 3ES6A 1Q9KA 1BBDL 1ZHNB 4XC1L 1AGDA 2Z3FA 1KFGA 5C09E 5FUOL 2FSEA 3G5VA 3QZMA 1AGCB 5D7LD 3MQIA 4Y5YA 5IV2B 5JQ6H 3WEXB 3NCXA 3NPSB 3T65B 1A7PL 1L9NA 4GG8A 4R7VA 3I6KA 3W5MA 3ET9F 5C97A 1OIOA 5JDJA 2GFBB 1IU1A 2EDDA 4QLWA 4F2ME 3TCLA 4TTGA 1HSAB 2WNWA 1FZMA 2FWUA 3ZE2B 5JW5B 2AQSA 3U46B 3KBHE 4ZMOA 4KKBD 3ZHLA 1F1AA 1HILB 3EOAB 2NY3B 4KUZH 1PZCA 3CFBB 4N8PA 3GMRA 4LSSL 4OZ4B 3KH3A 3KBFA 3VA6A 4B27A 1P9MA 5H37H 4PR5A 5DMKB 3JUYA 2TSBA 4I1NB 5E1AA 2CJUH 1O0VA 4NDMB 1SBSL 2D31A 2ZCZA 3TXAA 4EUPG 4ZRGA 3CVHH 2EH7L 3HA0A 2FRGP 4HLJA 4OFQA 3T77B 3KPMB 3PUCA 2WWMC 4IEFA 2D7TL 3SN6N 3WXVL 5EBMA 5EN2A 5I1EH 2QHLA 3RVTC 3HTLX 1QVOB 1TJHH 3DUSA 4PP1D 4RVBA 2B14A 1C16B 3MRGA 1R0AH 2Z91B 5GS0C 1FE8L 1Y7VA 3HHMA 5KVFH 5C86A 2A4ZA 5I1KH 2KBGA 2OR9H 1U3HB 1SFDA 2C1OB 4YHOH 4O2CB 1W8EA 4PS4L 2OTPA 1WZ1H 2WBJD 2XFXB 3MA9H 1HCZA 4NNXB 5L4JA 2BHUA 2E76C 2VE6A 3FU6A 5DD5H 4U1NA 4XMPH 2WZ6A 1W0VA 5E0QA 4YXKH 4HISA 2B39A 1MRCL 5HYJD 4JMXA 2Z65C 2H41A 5KW9H 1B90A 3D39D 2NXZC 4IK6A 4MNQB 1B0RA 3RX8A 3U7YL 1YMME 4QHMB 3QR2A 4IIZA 1HN1A 1JRHI 3F7RA 1LO4L 3AB0C 3A6BH 4XT1C 4Y2LA 2WYHA 1ONQB 1E4XI 1BEYL 3BKYL 4JDEA 4I18B 4ABUA 4HVBA 1DR9A 1R3LB 1WZLA 1FDLL 1P7KB 4PUBL 4AEHL 5D8JL 2DF3A 4O5LL 3TC9A 4BV1A 2HSIA 1DL7L 4E41B 1EH9A 1NDMB 4PJ9B 1DVQA 1FYTD 2FD6L 2VDLH 5GGSB 1T1WA 5TDPA 2K7PA 1HH6A 5KG9B 2F9BT 1MIMH 1D5ZB 2GI7A 4PJBA 3PGFL 4PWKA 4U6YA 4GW4B 4G7VL 3LDBB 3SGDI 1RP9A 2VXVL 3K1DA 1F02I 3C60C 4ABWA 2YXFA 4MMXA 4X5WA 4I3SL 3T0VA 3L3HB 1SRDA 4TF4A 3IRZA 1KB9J 2BNQA 4M9PA 1H15B 2JJWA 1W16A 4U2YA 2J1ZA 1I3GH 4UM8A 4Y2NA 5T1KD 2FTAA 2ICWJ 1GC1H 2J1WA 3G6AB 3B1UA 2WHVA 3QWRA 4P5TB 4DSYA 3V0VA 1XH0A 4RBPK 3MLYH 1V55B 5CS7A 1KJ3H 4OZHB 4OLXL 2EDKA 1RULH 1N3NB 1I8KB 3K81A 2XHNA 3LJ3A 3VG0L 4PJ7B 3RTQB 3L1GA 5ADPH 3WNLA 2YXVA 4HCFA 3CK0H 2RCSL 4JQXC 4IMLA 3VWJD 3MJ9H 4GP5B 1DQTA 5B8CC 4OFYD 4KY1H 1MCOH 4P46B 1RI8A 2EVFA 3N42B 3FTXA 1LEIA 1MCIA 2F53E 1FBIL 1J1PL 1Z9SB 2QELA 4ODTL 4OTXL 1EXUB 3VSVA 4L3EB 5F9WC 3CIAA 1UCBH 2WWKO 1CDYA 4LHUA 4Q8BA 2A9NL 4N1EA 4X4YB 4M62H 1TSHA 2DMBA 5JO5A 4NQUA 3ABKB 1TZ8A 1WPCA 2R2CA 4C57C 2XBDA 1O9ZA 2AAVA 3B7TA 2QMKA 1NANI 2Y9RT 3A4EA 3BAEH 3NOIA 5TE4L 1E8XA 4F1ZA 3KPSD 4RISH 3N42F 2D7MA 3IFNH 4KKLC 2ZXBA 5J56B 3MREB 3POHA 1CLYL 2NX5A 3R8QA 1T0OA 3NK4A 4K23L 4DN3L 3FQRA 3GTVA 5LDSA 3GHBH 1LK3L 1G7JB 4PTTA 3EKCA 1C7TA 3HC4H 1GGIH 2D03L 4BSWA 3N9GL 3SO3C 4Z0XA 3MJGX 1RZJL 2FBRA 4D9RD 5IQ7L 3HS0A 1U8QA 2IH3B 4AYDC 5K1NA 2IV8A 1OSPH 5GGTA 5GSRA 4TSBH 1IAII 5IW6A 1G7QA 1HE8A 1UWEH 1H3UA 1LXMA 3VJ6B 4NKQB 1OCRB 1QFUH 4TMPA 3UPAA 3Q9QA 1ZWIA 5KYYB 2MHAA 1GZPB 1BFOA 1AC0A 5D6CA 1XV8A 1XGZA 3UTTA 4W6XB 2XZCL 4KVCH 1GY1A 4P5RA 5C0CB 2QTEA 4L9LA 3STZA 5F7EH 2GK0A 4MNGE 1DBMH 1BECA 4IGBA 4MDIB 5C0JA 1IEAA 5SWQB 3DXAE 4MS6A 4NP9A 3BAWA 4XCNA 5JHAA 1EUUA 4OR1A 1N9PA 1ZV2A 3DTUB 4X8XA 3FZUD 4D9LH 4Z7QF 3MRLA 3MV7B 5J7CC 3CFKB 4EI5A 2WJ5A 3WSQH 4FQHA 1N19A 4G1MA 2OMTA 1QSVA 4GINA 1OP5K 4M5TA 2EYRB 3ZKQD 4A2DA 3LZFH 4OF7A 4LGRB 5D72H 2XNAA 3W39A 3ZBMA 2VLRB 1FIGL 1JGVH 2IC2A 5HHPB 2BY0A 4A2GA 4YEFA 2G3ZA 3ARTA 4L8SC 4QYOA 1PZ2A 1WEJH 2XJLA 3LH9A 4S0TD 5CCKL 3HCVB 5CGYD 1K8IB 3GPEA 3MTRA 4BHUA 3WN6A 2VDKL 1SQMA 4NNPL 5IVNA 3BKJL 1W72H 4QHUA 5TK2A 3DK2A 2OJZL 3KEHA 3NJMA 5I1HH 1VA9A 5EU3B 4IJ3B 3QCVL 4IKNA 2ZWKA 3AFLA 1RK1A 1OCCB 4P04A 2H32B 5C08A 1FJ1A 5IF0A 2R15A 4KAQL 5EA0H 4ELME 2OMWB 3SCMC 1W0WB 1JHLL 3I3EA 3WFBL 1U8JA 5JYLA 2XWEA 3GSVB 5HI4C 4PI2A 1ZHNA 4Q9RH 1WITA 1WHPA 4KZCA 4PS8A 4KX7A 3HNVL 5F7KC 1X5HA 3V2AR 3VFRB 3BP5B 3QHFH 5IV2A 1AKPA 1C5DA 2X4RB 2O5ZL 5F6IC 3ATBA 4LCWA 4AH2B 2UX6A 4R4FL 4HGWB 1BM3H 3ASOB 3ZL4L 4TUUA 1UZ6E 2YPLD 4YL9A 3EO1B 2PYED 3GHPA 2GFBA 2WUBH 1QPKA 3PHSA 3QUXC 4TNFA 1N0XH 1QHQA 4O2EB 1KPVA 2LLGA 5FECB 5ES4B 1T5XB 2J1KA 5JW5A 3GZOA 4IBZA 5DMYA 2W95A 2YAQA 1D2PA 2AAAA 4JCMA 5LGYA 2V17L 1SN5A 2Y72A 3EOAA 4ETYA 4AQEB 3CFBA 1B6UA 1IGMH 5DVNA 5F7UA 4L3CB 5EO9A 1RZQA 1G6VK 2OYKA 5FW7A 2I60L 3HZ3A 4NDMA 3WY2A 3FF8A 3LKQB 5DHXB 2IAND 2XQ0A 3LH2H 4L5FE 3T77A 1G6RB 2YWZA 5B3JE 5IMKB 2DN7A 1IEHA 2HT3D 3DHMA 3SPHA 1PG7W 2WLMA 4BQ8A 5BS0E 15C8H 1C16A 3L08A 3GLDA 3UAFA 5AVZB 3LNEA 3WFEH 1X5FA 3B2VL 3IJ9A 4UQBA 4K2UL 5BOPA 4PBDA 2C1OA 3TZVA 2DJ4A 3D25B 3ZE1B 2UZYB 3T8VA 2XFXA 3EDDA 4NNXA 4YVUA 1KT2B 5I17A 2AJXH 3VI4B 3DMMD 1JMZA 2XFGB 4KVNL 4LPWA 2G2NA 2PCFB 1Z5HA 1MFVA 3B5HA 3E8UH 1AQMA 3V4UH 4D7BA 1B0IA 4JFXB 4JG9A 5LBSA 2YHGA 2O26U 1FVCB 1IGJB 3DYOA 5AKTA 3BZ4B 2SODB 3WELA 4N1CA 1SY6H 4MCZA 3P11L 4QHMA 4L29B 1AGFB 3MV9D 2QZ5A 5FF6B 2BS9A 4XMKL 5MHSE 4JDTH 1F5WA 2APSA 2GVYA 5JR1H 3LXAA 1G7MB 1ONQA 1BJ1J 5IHUH 4I18A 1C5BH 2XICA 3II1A 1R3LA 3PAYA 1TJMA 2XTLA 4NNYB 1GXEA 1BFSA 4GQRA 4FD0A 5F7BA 4AJYV 1OCOB 3PWPA 3HG3A 4E41A 2GSGB 4WHDA 1NDMA 4CJ1A 1MIEH 5GGSA 1B0WA 2DYPD 4UTBA 4LOEA 3ZTJH 5H4ZA 5EH1A 3AG3B 3VXUA 4GIAA 4JRYE 5DWUH 5KG9A 3TVMB 5DQ9B 4GG6E 4JHAL 1D5ZA 3SKUD 1NBCA 3E80A 2VW6A 2BDNH 4MXQC 3QDAA 4NKOA 4ZNEA 4HUCA 4FABL 4AUYA 4DT2A 1LE9B 5E2TH 4HUXA 3RILA 4Q58C 1GR7A 1N5YH 3T71A 3L3HA 3GMMB 3ESUF 4K3EL 5GZNC 1F4YH 4WSGA 4M61B 4JM2B 1H15A 4B9CA 2OFQA 3FJTA 5KVFL 3KXFB 3UIZA 3G6AA 5GGVH 1F8TL 4ZW5A 1P4IH 3DHJA 4IRJC 2YJLA 2H8PB 5E2VH 3JWOC 1M7UA 4PFEA 4EXPX 1MJUH 3MLVL 3WN5B 1OO2A 3MODL 1IKFH 4OZHA 2AV7A 2RALA 1N3NA 4LRIA 1IC4L 5DR5H 4PJ7A 1FO0B 2EIKB 1I9IH